data_3A01
# 
_entry.id   3A01 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3A01         
NDB   PD1250       
RCSB  RCSB028640   
WWPDB D_1000028640 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3A02 'Aristaless homeodomain' unspecified 
PDB 3A03 'Hox11L1 homeodomain'    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3A01 
_pdbx_database_status.recvd_initial_deposition_date   2009-02-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Miyazono, K.' 1 
'Nagata, K.'   2 
'Saigo, K.'    3 
'Kojima, T.'   4 
'Tanokura, M.' 5 
# 
_citation.id                        primary 
_citation.title                     'Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            29 
_citation.page_first                1613 
_citation.page_last                 1623 
_citation.year                      2010 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20389279 
_citation.pdbx_database_id_DOI      10.1038/emboj.2010.53 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Miyazono, K.' 1 
primary 'Zhi, Y.'      2 
primary 'Takamura, Y.' 3 
primary 'Nagata, K.'   4 
primary 'Saigo, K.'    5 
primary 'Kojima, T.'   6 
primary 'Tanokura, M.' 7 
# 
_cell.entry_id           3A01 
_cell.length_a           70.930 
_cell.length_b           85.400 
_cell.length_c           110.680 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3A01 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Homeodomain-containing protein'                              11191.974 2 ? ? 'Clawless Homeobox, residues 170-261' 
? 
2 polymer man 'Homeobox protein aristaless'                                 8335.609  2 ? ? 'Homeobox, residues 80-146'           
? 
3 polymer syn "5'-D(*GP*GP*CP*TP*TP*AP*AP*TP*TP*AP*AP*TP*TP*GP*CP*GP*G)-3'" 5257.419  2 ? ? ?                                     
? 
4 polymer syn "5'-D(*CP*CP*GP*CP*AP*AP*TP*TP*AP*AP*TP*TP*AP*AP*GP*CP*C)-3'" 5155.375  2 ? ? ?                                     
? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEER
EAERQAANRLMLS
;
;MARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEER
EAERQAANRLMLS
;
A,E ? 
2 'polypeptide(L)'        no no APKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKV                              
APKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKV                              B,F ? 
3 polydeoxyribonucleotide no no '(DG)(DG)(DC)(DT)(DT)(DA)(DA)(DT)(DT)(DA)(DA)(DT)(DT)(DG)(DC)(DG)(DG)'                           
GGCTTAATTAATTGCGG                                                                                C,G ? 
4 polydeoxyribonucleotide no no '(DC)(DC)(DG)(DC)(DA)(DA)(DT)(DT)(DA)(DA)(DT)(DT)(DA)(DA)(DG)(DC)(DC)'                           
CCGCAATTAATTAAGCC                                                                                D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  ARG n 
1 4  ARG n 
1 5  ILE n 
1 6  GLY n 
1 7  HIS n 
1 8  PRO n 
1 9  TYR n 
1 10 GLN n 
1 11 ASN n 
1 12 ARG n 
1 13 THR n 
1 14 PRO n 
1 15 PRO n 
1 16 LYS n 
1 17 ARG n 
1 18 LYS n 
1 19 LYS n 
1 20 PRO n 
1 21 ARG n 
1 22 THR n 
1 23 SER n 
1 24 PHE n 
1 25 THR n 
1 26 ARG n 
1 27 ILE n 
1 28 GLN n 
1 29 VAL n 
1 30 ALA n 
1 31 GLU n 
1 32 LEU n 
1 33 GLU n 
1 34 LYS n 
1 35 ARG n 
1 36 PHE n 
1 37 HIS n 
1 38 LYS n 
1 39 GLN n 
1 40 LYS n 
1 41 TYR n 
1 42 LEU n 
1 43 ALA n 
1 44 SER n 
1 45 ALA n 
1 46 GLU n 
1 47 ARG n 
1 48 ALA n 
1 49 ALA n 
1 50 LEU n 
1 51 ALA n 
1 52 ARG n 
1 53 GLY n 
1 54 LEU n 
1 55 LYS n 
1 56 MET n 
1 57 THR n 
1 58 ASP n 
1 59 ALA n 
1 60 GLN n 
1 61 VAL n 
1 62 LYS n 
1 63 THR n 
1 64 TRP n 
1 65 PHE n 
1 66 GLN n 
1 67 ASN n 
1 68 ARG n 
1 69 ARG n 
1 70 THR n 
1 71 LYS n 
1 72 TRP n 
1 73 ARG n 
1 74 ARG n 
1 75 GLN n 
1 76 THR n 
1 77 ALA n 
1 78 GLU n 
1 79 GLU n 
1 80 ARG n 
1 81 GLU n 
1 82 ALA n 
1 83 GLU n 
1 84 ARG n 
1 85 GLN n 
1 86 ALA n 
1 87 ALA n 
1 88 ASN n 
1 89 ARG n 
1 90 LEU n 
1 91 MET n 
1 92 LEU n 
1 93 SER n 
2 1  ALA n 
2 2  PRO n 
2 3  LYS n 
2 4  ARG n 
2 5  LYS n 
2 6  GLN n 
2 7  ARG n 
2 8  ARG n 
2 9  TYR n 
2 10 ARG n 
2 11 THR n 
2 12 THR n 
2 13 PHE n 
2 14 THR n 
2 15 SER n 
2 16 PHE n 
2 17 GLN n 
2 18 LEU n 
2 19 GLU n 
2 20 GLU n 
2 21 LEU n 
2 22 GLU n 
2 23 LYS n 
2 24 ALA n 
2 25 PHE n 
2 26 SER n 
2 27 ARG n 
2 28 THR n 
2 29 HIS n 
2 30 TYR n 
2 31 PRO n 
2 32 ASP n 
2 33 VAL n 
2 34 PHE n 
2 35 THR n 
2 36 ARG n 
2 37 GLU n 
2 38 GLU n 
2 39 LEU n 
2 40 ALA n 
2 41 MET n 
2 42 LYS n 
2 43 ILE n 
2 44 GLY n 
2 45 LEU n 
2 46 THR n 
2 47 GLU n 
2 48 ALA n 
2 49 ARG n 
2 50 ILE n 
2 51 GLN n 
2 52 VAL n 
2 53 TRP n 
2 54 PHE n 
2 55 GLN n 
2 56 ASN n 
2 57 ARG n 
2 58 ARG n 
2 59 ALA n 
2 60 LYS n 
2 61 TRP n 
2 62 ARG n 
2 63 LYS n 
2 64 GLN n 
2 65 GLU n 
2 66 LYS n 
2 67 VAL n 
3 1  DG  n 
3 2  DG  n 
3 3  DC  n 
3 4  DT  n 
3 5  DT  n 
3 6  DA  n 
3 7  DA  n 
3 8  DT  n 
3 9  DT  n 
3 10 DA  n 
3 11 DA  n 
3 12 DT  n 
3 13 DT  n 
3 14 DG  n 
3 15 DC  n 
3 16 DG  n 
3 17 DG  n 
4 1  DC  n 
4 2  DC  n 
4 3  DG  n 
4 4  DC  n 
4 5  DA  n 
4 6  DA  n 
4 7  DT  n 
4 8  DT  n 
4 9  DA  n 
4 10 DA  n 
4 11 DT  n 
4 12 DT  n 
4 13 DA  n 
4 14 DA  n 
4 15 DG  n 
4 16 DC  n 
4 17 DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'Fruit fly' ? 'C15, CG7937' ? ? ? ? ? ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'Fruit fly' ? 'al, CG3935'  ? ? ? ? ? ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q9VD99_DROME Q9VD99 1 
;ARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEERE
AERQAANRLMLS
;
170 ? 
2 UNP AL_DROME     Q06453 2 APKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKV                             80  ? 
3 PDB 3A01         3A01   3 ?                                                                                               ?   ? 
4 PDB 3A01         3A01   4 ?                                                                                               ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3A01 A 2 ? 93 ? Q9VD99 170 ? 261 ? 170 261 
2 2 3A01 B 1 ? 67 ? Q06453 80  ? 146 ? 80  146 
3 1 3A01 E 2 ? 93 ? Q9VD99 170 ? 261 ? 170 261 
4 2 3A01 F 1 ? 67 ? Q06453 80  ? 146 ? 80  146 
5 3 3A01 C 1 ? 17 ? 3A01   1   ? 17  ? 1   17  
6 3 3A01 G 1 ? 17 ? 3A01   1   ? 17  ? 1   17  
7 4 3A01 D 1 ? 17 ? 3A01   1   ? 17  ? 1   17  
8 4 3A01 H 1 ? 17 ? 3A01   1   ? 17  ? 1   17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3A01 MET A 1 ? UNP Q9VD99 ? ? 'INITIATING METHIONINE' 169 1 
3 3A01 MET E 1 ? UNP Q9VD99 ? ? 'INITIATING METHIONINE' 169 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3A01 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.80 
_exptl_crystal.density_percent_sol   56.06 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     3A01 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.70 
_reflns.d_resolution_low             20.0 
_reflns.number_all                   ? 
_reflns.number_obs                   18995 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3A01 
_refine.ls_number_reflns_obs                     17051 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.65 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_R_factor_obs                          0.23363 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22824 
_refine.ls_R_factor_R_free                       0.28275 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.2 
_refine.ls_number_reflns_R_free                  1943 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.904 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRIES 3A02, 3A03, and 1PUF' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.793 
_refine.pdbx_overall_ESU_R_Free                  0.367 
_refine.overall_SU_ML                            0.279 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2286 
_refine_hist.pdbx_number_atoms_nucleic_acid   1382 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3668 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        19.65 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.021  ? 3884 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.769  2.389  ? 5508 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.990  5.000  ? 259  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.494 20.840 ? 131  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       21.424 15.000 ? 452  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.837 15.000 ? 41   'X-RAY DIFFRACTION' ? 
r_chiral_restr               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 2491 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.220  0.200  ? 1540 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.309  0.200  ? 2488 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.181  0.200  ? 133  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.151  0.200  ? 38   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.172  0.200  ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.700 
_refine_ls_shell.d_res_low                        2.769 
_refine_ls_shell.number_reflns_R_work             1242 
_refine_ls_shell.R_factor_R_work                  0.354 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.408 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             121 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3A01 
_struct.title                     'Crystal structure of Aristaless and Clawless homeodomains bound to DNA' 
_struct.pdbx_descriptor           'Homeodomain-containing protein, Homeobox protein aristaless/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3A01 
_struct_keywords.pdbx_keywords   'Gene Regulation/DNA' 
_struct_keywords.text            
'HOMEODOMAIN, PROTEIN-DNA COMPLEX, DNA-binding, Homeobox, Nucleus, Developmental protein, Gene Regulation-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 25 ? GLN A 39 ? THR A 193 GLN A 207 1 ? 15 
HELX_P HELX_P2  2  ALA A 43 ? GLY A 53 ? ALA A 211 GLY A 221 1 ? 11 
HELX_P HELX_P3  3  THR A 57 ? ALA A 77 ? THR A 225 ALA A 245 1 ? 21 
HELX_P HELX_P4  4  THR B 14 ? THR B 28 ? THR B 93  THR B 107 1 ? 15 
HELX_P HELX_P5  5  ASP B 32 ? GLY B 44 ? ASP B 111 GLY B 123 1 ? 13 
HELX_P HELX_P6  6  THR B 46 ? LYS B 63 ? THR B 125 LYS B 142 1 ? 18 
HELX_P HELX_P7  7  PRO E 8  ? ARG E 12 ? PRO E 176 ARG E 180 5 ? 5  
HELX_P HELX_P8  8  THR E 25 ? GLN E 39 ? THR E 193 GLN E 207 1 ? 15 
HELX_P HELX_P9  9  ALA E 43 ? LEU E 54 ? ALA E 211 LEU E 222 1 ? 12 
HELX_P HELX_P10 10 THR E 57 ? ALA E 77 ? THR E 225 ALA E 245 1 ? 21 
HELX_P HELX_P11 11 THR F 14 ? THR F 28 ? THR F 93  THR F 107 1 ? 15 
HELX_P HELX_P12 12 ASP F 32 ? GLY F 44 ? ASP F 111 GLY F 123 1 ? 13 
HELX_P HELX_P13 13 THR F 46 ? GLU F 65 ? THR F 125 GLU F 144 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C DG 1  N1 ? ? ? 1_555 D DC 17 N3 ? ? C DG 1  D DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? C DG 1  N2 ? ? ? 1_555 D DC 17 O2 ? ? C DG 1  D DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? C DG 1  O6 ? ? ? 1_555 D DC 17 N4 ? ? C DG 1  D DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? C DG 2  N1 ? ? ? 1_555 D DC 16 N3 ? ? C DG 2  D DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? C DG 2  N2 ? ? ? 1_555 D DC 16 O2 ? ? C DG 2  D DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? C DG 2  O6 ? ? ? 1_555 D DC 16 N4 ? ? C DG 2  D DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? C DC 3  N3 ? ? ? 1_555 D DG 15 N1 ? ? C DC 3  D DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? C DC 3  N4 ? ? ? 1_555 D DG 15 O6 ? ? C DC 3  D DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? C DC 3  O2 ? ? ? 1_555 D DG 15 N2 ? ? C DC 3  D DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? C DT 4  N3 ? ? ? 1_555 D DA 14 N1 ? ? C DT 4  D DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? C DT 4  O4 ? ? ? 1_555 D DA 14 N6 ? ? C DT 4  D DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? C DT 5  N3 ? ? ? 1_555 D DA 13 N1 ? ? C DT 5  D DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? C DT 5  O4 ? ? ? 1_555 D DA 13 N6 ? ? C DT 5  D DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? C DA 6  N1 ? ? ? 1_555 D DT 12 N3 ? ? C DA 6  D DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? C DA 6  N6 ? ? ? 1_555 D DT 12 O4 ? ? C DA 6  D DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 11 N3 ? ? C DA 7  D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 11 O4 ? ? C DA 7  D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? C DT 8  N3 ? ? ? 1_555 D DA 10 N1 ? ? C DT 8  D DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? C DT 8  O4 ? ? ? 1_555 D DA 10 N6 ? ? C DT 8  D DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? C DT 9  N3 ? ? ? 1_555 D DA 9  N1 ? ? C DT 9  D DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? C DT 9  O4 ? ? ? 1_555 D DA 9  N6 ? ? C DT 9  D DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? C DA 10 N1 ? ? ? 1_555 D DT 8  N3 ? ? C DA 10 D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? C DA 10 N6 ? ? ? 1_555 D DT 8  O4 ? ? C DA 10 D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? C DA 11 N1 ? ? ? 1_555 D DT 7  N3 ? ? C DA 11 D DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? C DA 11 N6 ? ? ? 1_555 D DT 7  O4 ? ? C DA 11 D DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA 6  N1 ? ? C DT 12 D DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA 6  N6 ? ? C DT 12 D DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? C DT 13 N3 ? ? ? 1_555 D DA 5  N1 ? ? C DT 13 D DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? C DT 13 O4 ? ? ? 1_555 D DA 5  N6 ? ? C DT 13 D DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? C DG 14 N1 ? ? ? 1_555 D DC 4  N3 ? ? C DG 14 D DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? C DG 14 N2 ? ? ? 1_555 D DC 4  O2 ? ? C DG 14 D DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? C DG 14 O6 ? ? ? 1_555 D DC 4  N4 ? ? C DG 14 D DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? C DC 15 N3 ? ? ? 1_555 D DG 3  N1 ? ? C DC 15 D DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? C DC 15 N4 ? ? ? 1_555 D DG 3  O6 ? ? C DC 15 D DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? C DC 15 O2 ? ? ? 1_555 D DG 3  N2 ? ? C DC 15 D DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? C DG 16 N1 ? ? ? 1_555 D DC 2  N3 ? ? C DG 16 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? C DG 16 N2 ? ? ? 1_555 D DC 2  O2 ? ? C DG 16 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? C DG 16 O6 ? ? ? 1_555 D DC 2  N4 ? ? C DG 16 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? C DG 17 N1 ? ? ? 1_555 D DC 1  N3 ? ? C DG 17 D DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? C DG 17 N2 ? ? ? 1_555 D DC 1  O2 ? ? C DG 17 D DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? C DG 17 O6 ? ? ? 1_555 D DC 1  N4 ? ? C DG 17 D DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? G DG 1  N1 ? ? ? 1_555 H DC 17 N3 ? ? G DG 1  H DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? G DG 1  N2 ? ? ? 1_555 H DC 17 O2 ? ? G DG 1  H DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? G DG 1  O6 ? ? ? 1_555 H DC 17 N4 ? ? G DG 1  H DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? G DG 2  N1 ? ? ? 1_555 H DC 16 N3 ? ? G DG 2  H DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? G DG 2  N2 ? ? ? 1_555 H DC 16 O2 ? ? G DG 2  H DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? G DG 2  O6 ? ? ? 1_555 H DC 16 N4 ? ? G DG 2  H DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? G DC 3  N3 ? ? ? 1_555 H DG 15 N1 ? ? G DC 3  H DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? G DC 3  N4 ? ? ? 1_555 H DG 15 O6 ? ? G DC 3  H DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? G DC 3  O2 ? ? ? 1_555 H DG 15 N2 ? ? G DC 3  H DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? G DT 4  N3 ? ? ? 1_555 H DA 14 N1 ? ? G DT 4  H DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? G DT 4  O4 ? ? ? 1_555 H DA 14 N6 ? ? G DT 4  H DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? G DT 5  N3 ? ? ? 1_555 H DA 13 N1 ? ? G DT 5  H DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? G DT 5  O4 ? ? ? 1_555 H DA 13 N6 ? ? G DT 5  H DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? G DA 6  N1 ? ? ? 1_555 H DT 12 N3 ? ? G DA 6  H DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? G DA 6  N6 ? ? ? 1_555 H DT 12 O4 ? ? G DA 6  H DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? G DA 7  N1 ? ? ? 1_555 H DT 11 N3 ? ? G DA 7  H DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? G DA 7  N6 ? ? ? 1_555 H DT 11 O4 ? ? G DA 7  H DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? G DT 8  N3 ? ? ? 1_555 H DA 10 N1 ? ? G DT 8  H DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? G DT 8  O4 ? ? ? 1_555 H DA 10 N6 ? ? G DT 8  H DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? G DT 9  N3 ? ? ? 1_555 H DA 9  N1 ? ? G DT 9  H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? G DT 9  O4 ? ? ? 1_555 H DA 9  N6 ? ? G DT 9  H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? G DA 10 N1 ? ? ? 1_555 H DT 8  N3 ? ? G DA 10 H DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? G DA 10 N6 ? ? ? 1_555 H DT 8  O4 ? ? G DA 10 H DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65 hydrog ? ? G DA 11 N1 ? ? ? 1_555 H DT 7  N3 ? ? G DA 11 H DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66 hydrog ? ? G DA 11 N6 ? ? ? 1_555 H DT 7  O4 ? ? G DA 11 H DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67 hydrog ? ? G DT 12 N3 ? ? ? 1_555 H DA 6  N1 ? ? G DT 12 H DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68 hydrog ? ? G DT 12 O4 ? ? ? 1_555 H DA 6  N6 ? ? G DT 12 H DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69 hydrog ? ? G DT 13 N3 ? ? ? 1_555 H DA 5  N1 ? ? G DT 13 H DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70 hydrog ? ? G DT 13 O4 ? ? ? 1_555 H DA 5  N6 ? ? G DT 13 H DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71 hydrog ? ? G DG 14 N1 ? ? ? 1_555 H DC 4  N3 ? ? G DG 14 H DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72 hydrog ? ? G DG 14 N2 ? ? ? 1_555 H DC 4  O2 ? ? G DG 14 H DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73 hydrog ? ? G DG 14 O6 ? ? ? 1_555 H DC 4  N4 ? ? G DG 14 H DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74 hydrog ? ? G DC 15 N3 ? ? ? 1_555 H DG 3  N1 ? ? G DC 15 H DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75 hydrog ? ? G DC 15 N4 ? ? ? 1_555 H DG 3  O6 ? ? G DC 15 H DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76 hydrog ? ? G DC 15 O2 ? ? ? 1_555 H DG 3  N2 ? ? G DC 15 H DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77 hydrog ? ? G DG 16 N1 ? ? ? 1_555 H DC 2  N3 ? ? G DG 16 H DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78 hydrog ? ? G DG 16 N2 ? ? ? 1_555 H DC 2  O2 ? ? G DG 16 H DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79 hydrog ? ? G DG 16 O6 ? ? ? 1_555 H DC 2  N4 ? ? G DG 16 H DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80 hydrog ? ? G DG 17 N1 ? ? ? 1_555 H DC 1  N3 ? ? G DG 17 H DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81 hydrog ? ? G DG 17 N2 ? ? ? 1_555 H DC 1  O2 ? ? G DG 17 H DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82 hydrog ? ? G DG 17 O6 ? ? ? 1_555 H DC 1  N4 ? ? G DG 17 H DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 18 A . ? LYS 186 A LYS 19 A ? LYS 187 A 1 -15.21 
2 ARG 21 E . ? ARG 189 E THR 22 E ? THR 190 E 1 3.83   
# 
_database_PDB_matrix.entry_id          3A01 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3A01 
_atom_sites.fract_transf_matrix[1][1]   0.014098 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011710 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009035 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N     . ALA A 1 2  ? 11.141  -9.005  1.982   1.00 78.07  ? 170 ALA A N     1 
ATOM 2    C CA    . ALA A 1 2  ? 10.254  -10.149 1.619   1.00 77.80  ? 170 ALA A CA    1 
ATOM 3    C C     . ALA A 1 2  ? 10.817  -10.803 0.370   1.00 77.56  ? 170 ALA A C     1 
ATOM 4    O O     . ALA A 1 2  ? 10.769  -10.227 -0.719  1.00 77.98  ? 170 ALA A O     1 
ATOM 5    C CB    . ALA A 1 2  ? 8.796   -9.685  1.391   1.00 77.65  ? 170 ALA A CB    1 
ATOM 6    N N     . ARG A 1 3  ? 11.386  -11.994 0.547   1.00 76.86  ? 171 ARG A N     1 
ATOM 7    C CA    . ARG A 1 3  ? 11.881  -12.810 -0.556  1.00 75.72  ? 171 ARG A CA    1 
ATOM 8    C C     . ARG A 1 3  ? 11.842  -14.256 -0.095  1.00 75.14  ? 171 ARG A C     1 
ATOM 9    O O     . ARG A 1 3  ? 11.561  -15.176 -0.867  1.00 75.26  ? 171 ARG A O     1 
ATOM 10   C CB    . ARG A 1 3  ? 13.303  -12.403 -0.939  1.00 75.56  ? 171 ARG A CB    1 
ATOM 11   C CG    . ARG A 1 3  ? 13.779  -13.033 -2.219  1.00 75.27  ? 171 ARG A CG    1 
ATOM 12   C CD    . ARG A 1 3  ? 12.695  -12.968 -3.263  1.00 74.86  ? 171 ARG A CD    1 
ATOM 13   N NE    . ARG A 1 3  ? 13.176  -13.376 -4.572  1.00 74.88  ? 171 ARG A NE    1 
ATOM 14   C CZ    . ARG A 1 3  ? 13.843  -12.579 -5.401  1.00 75.36  ? 171 ARG A CZ    1 
ATOM 15   N NH1   . ARG A 1 3  ? 14.238  -13.038 -6.584  1.00 74.06  ? 171 ARG A NH1   1 
ATOM 16   N NH2   . ARG A 1 3  ? 14.123  -11.325 -5.044  1.00 75.53  ? 171 ARG A NH2   1 
ATOM 17   N N     . ARG A 1 4  ? 12.135  -14.430 1.188   1.00 74.25  ? 172 ARG A N     1 
ATOM 18   C CA    . ARG A 1 4  ? 12.015  -15.711 1.883   1.00 73.28  ? 172 ARG A CA    1 
ATOM 19   C C     . ARG A 1 4  ? 12.416  -16.917 1.020   1.00 71.70  ? 172 ARG A C     1 
ATOM 20   O O     . ARG A 1 4  ? 11.630  -17.824 0.760   1.00 71.61  ? 172 ARG A O     1 
ATOM 21   C CB    . ARG A 1 4  ? 10.626  -15.827 2.536   1.00 74.05  ? 172 ARG A CB    1 
ATOM 22   C CG    . ARG A 1 4  ? 10.209  -14.560 3.406   1.00 75.65  ? 172 ARG A CG    1 
ATOM 23   C CD    . ARG A 1 4  ? 11.404  -13.784 4.037   1.00 77.72  ? 172 ARG A CD    1 
ATOM 24   N NE    . ARG A 1 4  ? 12.379  -14.685 4.677   1.00 80.25  ? 172 ARG A NE    1 
ATOM 25   C CZ    . ARG A 1 4  ? 13.570  -14.324 5.161   1.00 80.42  ? 172 ARG A CZ    1 
ATOM 26   N NH1   . ARG A 1 4  ? 13.973  -13.056 5.095   1.00 81.28  ? 172 ARG A NH1   1 
ATOM 27   N NH2   . ARG A 1 4  ? 14.364  -15.238 5.719   1.00 79.17  ? 172 ARG A NH2   1 
ATOM 28   N N     . ILE A 1 5  ? 13.674  -16.858 0.583   1.00 69.63  ? 173 ILE A N     1 
ATOM 29   C CA    . ILE A 1 5  ? 14.401  -17.908 -0.132  1.00 67.43  ? 173 ILE A CA    1 
ATOM 30   C C     . ILE A 1 5  ? 14.631  -19.173 0.721   1.00 65.07  ? 173 ILE A C     1 
ATOM 31   O O     . ILE A 1 5  ? 14.808  -19.092 1.937   1.00 65.23  ? 173 ILE A O     1 
ATOM 32   C CB    . ILE A 1 5  ? 15.763  -17.325 -0.654  1.00 67.57  ? 173 ILE A CB    1 
ATOM 33   C CG1   . ILE A 1 5  ? 16.639  -18.426 -1.270  1.00 68.26  ? 173 ILE A CG1   1 
ATOM 34   C CG2   . ILE A 1 5  ? 16.503  -16.572 0.474   1.00 66.82  ? 173 ILE A CG2   1 
ATOM 35   C CD1   . ILE A 1 5  ? 17.639  -17.955 -2.369  1.00 68.21  ? 173 ILE A CD1   1 
ATOM 36   N N     . GLY A 1 6  ? 14.634  -20.336 0.075   1.00 62.41  ? 174 GLY A N     1 
ATOM 37   C CA    . GLY A 1 6  ? 14.749  -21.616 0.787   1.00 59.25  ? 174 GLY A CA    1 
ATOM 38   C C     . GLY A 1 6  ? 16.000  -22.377 0.418   1.00 56.73  ? 174 GLY A C     1 
ATOM 39   O O     . GLY A 1 6  ? 16.986  -21.774 0.052   1.00 56.69  ? 174 GLY A O     1 
ATOM 40   N N     . HIS A 1 7  ? 15.948  -23.704 0.487   1.00 54.70  ? 175 HIS A N     1 
ATOM 41   C CA    . HIS A 1 7  ? 17.150  -24.546 0.348   1.00 52.62  ? 175 HIS A CA    1 
ATOM 42   C C     . HIS A 1 7  ? 17.413  -25.193 -1.033  1.00 51.93  ? 175 HIS A C     1 
ATOM 43   O O     . HIS A 1 7  ? 16.508  -25.735 -1.673  1.00 51.67  ? 175 HIS A O     1 
ATOM 44   C CB    . HIS A 1 7  ? 17.156  -25.611 1.432   1.00 52.24  ? 175 HIS A CB    1 
ATOM 45   C CG    . HIS A 1 7  ? 15.913  -26.430 1.474   1.00 50.01  ? 175 HIS A CG    1 
ATOM 46   N ND1   . HIS A 1 7  ? 15.660  -27.438 0.573   1.00 48.67  ? 175 HIS A ND1   1 
ATOM 47   C CD2   . HIS A 1 7  ? 14.853  -26.396 2.312   1.00 48.34  ? 175 HIS A CD2   1 
ATOM 48   C CE1   . HIS A 1 7  ? 14.492  -27.984 0.851   1.00 48.12  ? 175 HIS A CE1   1 
ATOM 49   N NE2   . HIS A 1 7  ? 13.987  -27.379 1.909   1.00 46.92  ? 175 HIS A NE2   1 
ATOM 50   N N     . PRO A 1 8  ? 18.676  -25.175 -1.471  1.00 51.49  ? 176 PRO A N     1 
ATOM 51   C CA    . PRO A 1 8  ? 19.054  -25.590 -2.827  1.00 51.08  ? 176 PRO A CA    1 
ATOM 52   C C     . PRO A 1 8  ? 18.851  -27.083 -3.042  1.00 50.75  ? 176 PRO A C     1 
ATOM 53   O O     . PRO A 1 8  ? 18.945  -27.849 -2.093  1.00 50.92  ? 176 PRO A O     1 
ATOM 54   C CB    . PRO A 1 8  ? 20.538  -25.234 -2.902  1.00 50.52  ? 176 PRO A CB    1 
ATOM 55   C CG    . PRO A 1 8  ? 20.999  -25.275 -1.507  1.00 51.44  ? 176 PRO A CG    1 
ATOM 56   C CD    . PRO A 1 8  ? 19.853  -24.800 -0.661  1.00 51.53  ? 176 PRO A CD    1 
ATOM 57   N N     . TYR A 1 9  ? 18.586  -27.478 -4.285  1.00 50.88  ? 177 TYR A N     1 
ATOM 58   C CA    . TYR A 1 9  ? 18.110  -28.829 -4.611  1.00 51.35  ? 177 TYR A CA    1 
ATOM 59   C C     . TYR A 1 9  ? 19.170  -29.932 -4.587  1.00 51.85  ? 177 TYR A C     1 
ATOM 60   O O     . TYR A 1 9  ? 18.902  -31.062 -4.152  1.00 51.18  ? 177 TYR A O     1 
ATOM 61   C CB    . TYR A 1 9  ? 17.411  -28.821 -5.972  1.00 50.80  ? 177 TYR A CB    1 
ATOM 62   C CG    . TYR A 1 9  ? 16.995  -30.192 -6.477  1.00 50.00  ? 177 TYR A CG    1 
ATOM 63   C CD1   . TYR A 1 9  ? 15.827  -30.791 -6.022  1.00 48.49  ? 177 TYR A CD1   1 
ATOM 64   C CD2   . TYR A 1 9  ? 17.769  -30.879 -7.425  1.00 48.68  ? 177 TYR A CD2   1 
ATOM 65   C CE1   . TYR A 1 9  ? 15.425  -32.030 -6.495  1.00 49.10  ? 177 TYR A CE1   1 
ATOM 66   C CE2   . TYR A 1 9  ? 17.386  -32.125 -7.898  1.00 48.40  ? 177 TYR A CE2   1 
ATOM 67   C CZ    . TYR A 1 9  ? 16.207  -32.695 -7.429  1.00 49.86  ? 177 TYR A CZ    1 
ATOM 68   O OH    . TYR A 1 9  ? 15.801  -33.926 -7.878  1.00 50.84  ? 177 TYR A OH    1 
ATOM 69   N N     . GLN A 1 10 ? 20.363  -29.608 -5.079  1.00 52.81  ? 178 GLN A N     1 
ATOM 70   C CA    . GLN A 1 10 ? 21.474  -30.577 -5.049  1.00 54.01  ? 178 GLN A CA    1 
ATOM 71   C C     . GLN A 1 10 ? 21.777  -31.144 -3.656  1.00 54.04  ? 178 GLN A C     1 
ATOM 72   O O     . GLN A 1 10 ? 22.140  -32.314 -3.540  1.00 54.42  ? 178 GLN A O     1 
ATOM 73   C CB    . GLN A 1 10 ? 22.738  -30.008 -5.698  1.00 54.14  ? 178 GLN A CB    1 
ATOM 74   C CG    . GLN A 1 10 ? 22.711  -30.085 -7.229  1.00 55.29  ? 178 GLN A CG    1 
ATOM 75   C CD    . GLN A 1 10 ? 23.953  -29.480 -7.841  1.00 57.73  ? 178 GLN A CD    1 
ATOM 76   O OE1   . GLN A 1 10 ? 24.261  -28.294 -7.621  1.00 56.65  ? 178 GLN A OE1   1 
ATOM 77   N NE2   . GLN A 1 10 ? 24.694  -30.294 -8.610  1.00 58.77  ? 178 GLN A NE2   1 
ATOM 78   N N     . ASN A 1 11 ? 21.602  -30.336 -2.611  1.00 53.86  ? 179 ASN A N     1 
ATOM 79   C CA    . ASN A 1 11 ? 21.805  -30.818 -1.250  1.00 53.89  ? 179 ASN A CA    1 
ATOM 80   C C     . ASN A 1 11 ? 20.737  -31.746 -0.721  1.00 54.10  ? 179 ASN A C     1 
ATOM 81   O O     . ASN A 1 11 ? 20.940  -32.372 0.309   1.00 54.55  ? 179 ASN A O     1 
ATOM 82   C CB    . ASN A 1 11 ? 21.946  -29.661 -0.278  1.00 53.86  ? 179 ASN A CB    1 
ATOM 83   C CG    . ASN A 1 11 ? 23.044  -28.745 -0.654  1.00 53.61  ? 179 ASN A CG    1 
ATOM 84   O OD1   . ASN A 1 11 ? 23.820  -29.039 -1.559  1.00 54.78  ? 179 ASN A OD1   1 
ATOM 85   N ND2   . ASN A 1 11 ? 23.119  -27.610 0.018   1.00 53.46  ? 179 ASN A ND2   1 
ATOM 86   N N     . ARG A 1 12 ? 19.599  -31.829 -1.392  1.00 54.14  ? 180 ARG A N     1 
ATOM 87   C CA    . ARG A 1 12 ? 18.542  -32.690 -0.902  1.00 54.60  ? 180 ARG A CA    1 
ATOM 88   C C     . ARG A 1 12 ? 18.907  -34.127 -1.222  1.00 55.12  ? 180 ARG A C     1 
ATOM 89   O O     . ARG A 1 12 ? 19.666  -34.370 -2.156  1.00 55.20  ? 180 ARG A O     1 
ATOM 90   C CB    . ARG A 1 12 ? 17.204  -32.311 -1.532  1.00 54.26  ? 180 ARG A CB    1 
ATOM 91   C CG    . ARG A 1 12 ? 16.893  -30.821 -1.395  1.00 54.59  ? 180 ARG A CG    1 
ATOM 92   C CD    . ARG A 1 12 ? 15.611  -30.442 -2.101  1.00 54.05  ? 180 ARG A CD    1 
ATOM 93   N NE    . ARG A 1 12 ? 15.465  -28.998 -2.171  1.00 53.15  ? 180 ARG A NE    1 
ATOM 94   C CZ    . ARG A 1 12 ? 14.551  -28.375 -2.912  1.00 53.46  ? 180 ARG A CZ    1 
ATOM 95   N NH1   . ARG A 1 12 ? 14.492  -27.043 -2.909  1.00 51.09  ? 180 ARG A NH1   1 
ATOM 96   N NH2   . ARG A 1 12 ? 13.706  -29.084 -3.662  1.00 51.76  ? 180 ARG A NH2   1 
ATOM 97   N N     . THR A 1 13 ? 18.394  -35.072 -0.435  1.00 55.81  ? 181 THR A N     1 
ATOM 98   C CA    . THR A 1 13 ? 18.485  -36.477 -0.804  1.00 56.77  ? 181 THR A CA    1 
ATOM 99   C C     . THR A 1 13 ? 17.628  -36.709 -2.052  1.00 57.61  ? 181 THR A C     1 
ATOM 100  O O     . THR A 1 13 ? 16.513  -36.204 -2.140  1.00 57.83  ? 181 THR A O     1 
ATOM 101  C CB    . THR A 1 13 ? 18.027  -37.430 0.321   1.00 56.46  ? 181 THR A CB    1 
ATOM 102  O OG1   . THR A 1 13 ? 16.647  -37.210 0.590   1.00 57.46  ? 181 THR A OG1   1 
ATOM 103  C CG2   . THR A 1 13 ? 18.819  -37.213 1.594   1.00 56.21  ? 181 THR A CG2   1 
ATOM 104  N N     . PRO A 1 14 ? 18.153  -37.452 -3.034  1.00 58.57  ? 182 PRO A N     1 
ATOM 105  C CA    . PRO A 1 14 ? 17.368  -37.740 -4.215  1.00 59.59  ? 182 PRO A CA    1 
ATOM 106  C C     . PRO A 1 14 ? 15.960  -38.256 -3.913  1.00 60.80  ? 182 PRO A C     1 
ATOM 107  O O     . PRO A 1 14 ? 15.780  -39.054 -2.999  1.00 60.58  ? 182 PRO A O     1 
ATOM 108  C CB    . PRO A 1 14 ? 18.212  -38.799 -4.923  1.00 59.65  ? 182 PRO A CB    1 
ATOM 109  C CG    . PRO A 1 14 ? 19.596  -38.399 -4.589  1.00 58.70  ? 182 PRO A CG    1 
ATOM 110  C CD    . PRO A 1 14 ? 19.500  -38.042 -3.139  1.00 58.66  ? 182 PRO A CD    1 
ATOM 111  N N     . PRO A 1 15 ? 14.963  -37.768 -4.673  1.00 62.28  ? 183 PRO A N     1 
ATOM 112  C CA    . PRO A 1 15 ? 13.558  -38.147 -4.572  1.00 63.26  ? 183 PRO A CA    1 
ATOM 113  C C     . PRO A 1 15 ? 13.337  -39.628 -4.692  1.00 64.41  ? 183 PRO A C     1 
ATOM 114  O O     . PRO A 1 15 ? 14.217  -40.341 -5.163  1.00 65.05  ? 183 PRO A O     1 
ATOM 115  C CB    . PRO A 1 15 ? 12.925  -37.453 -5.779  1.00 63.14  ? 183 PRO A CB    1 
ATOM 116  C CG    . PRO A 1 15 ? 13.771  -36.237 -5.995  1.00 63.07  ? 183 PRO A CG    1 
ATOM 117  C CD    . PRO A 1 15 ? 15.168  -36.716 -5.694  1.00 62.70  ? 183 PRO A CD    1 
ATOM 118  N N     . LYS A 1 16 ? 12.172  -40.078 -4.235  1.00 65.69  ? 184 LYS A N     1 
ATOM 119  C CA    . LYS A 1 16 ? 11.683  -41.408 -4.529  1.00 67.01  ? 184 LYS A CA    1 
ATOM 120  C C     . LYS A 1 16 ? 10.320  -41.295 -5.190  1.00 67.71  ? 184 LYS A C     1 
ATOM 121  O O     . LYS A 1 16 ? 9.291   -41.364 -4.524  1.00 67.80  ? 184 LYS A O     1 
ATOM 122  C CB    . LYS A 1 16 ? 11.609  -42.259 -3.259  1.00 67.44  ? 184 LYS A CB    1 
ATOM 123  C CG    . LYS A 1 16 ? 12.905  -42.970 -2.915  1.00 68.53  ? 184 LYS A CG    1 
ATOM 124  C CD    . LYS A 1 16 ? 12.919  -43.411 -1.461  1.00 70.01  ? 184 LYS A CD    1 
ATOM 125  C CE    . LYS A 1 16 ? 14.179  -44.216 -1.138  1.00 70.75  ? 184 LYS A CE    1 
ATOM 126  N NZ    . LYS A 1 16 ? 15.437  -43.424 -1.289  1.00 71.25  ? 184 LYS A NZ    1 
ATOM 127  N N     . ARG A 1 17 ? 10.310  -41.098 -6.503  1.00 68.92  ? 185 ARG A N     1 
ATOM 128  C CA    . ARG A 1 17 ? 9.044   -41.040 -7.222  1.00 70.27  ? 185 ARG A CA    1 
ATOM 129  C C     . ARG A 1 17 ? 8.441   -42.437 -7.401  1.00 71.44  ? 185 ARG A C     1 
ATOM 130  O O     . ARG A 1 17 ? 8.811   -43.180 -8.316  1.00 71.91  ? 185 ARG A O     1 
ATOM 131  C CB    . ARG A 1 17 ? 9.180   -40.316 -8.568  1.00 70.21  ? 185 ARG A CB    1 
ATOM 132  C CG    . ARG A 1 17 ? 9.490   -38.827 -8.487  1.00 69.29  ? 185 ARG A CG    1 
ATOM 133  C CD    . ARG A 1 17 ? 10.942  -38.604 -8.811  1.00 69.60  ? 185 ARG A CD    1 
ATOM 134  N NE    . ARG A 1 17 ? 11.302  -37.204 -9.004  1.00 68.55  ? 185 ARG A NE    1 
ATOM 135  C CZ    . ARG A 1 17 ? 12.537  -36.791 -9.278  1.00 69.33  ? 185 ARG A CZ    1 
ATOM 136  N NH1   . ARG A 1 17 ? 12.780  -35.498 -9.422  1.00 70.35  ? 185 ARG A NH1   1 
ATOM 137  N NH2   . ARG A 1 17 ? 13.536  -37.665 -9.400  1.00 68.59  ? 185 ARG A NH2   1 
ATOM 138  N N     . LYS A 1 18 ? 7.526   -42.798 -6.506  1.00 72.79  ? 186 LYS A N     1 
ATOM 139  C CA    . LYS A 1 18 ? 6.811   -44.071 -6.622  1.00 74.02  ? 186 LYS A CA    1 
ATOM 140  C C     . LYS A 1 18 ? 5.303   -43.960 -6.299  1.00 74.32  ? 186 LYS A C     1 
ATOM 141  O O     . LYS A 1 18 ? 4.908   -44.028 -5.132  1.00 74.35  ? 186 LYS A O     1 
ATOM 142  C CB    . LYS A 1 18 ? 7.525   -45.187 -5.828  1.00 74.36  ? 186 LYS A CB    1 
ATOM 143  C CG    . LYS A 1 18 ? 7.538   -45.032 -4.307  1.00 75.91  ? 186 LYS A CG    1 
ATOM 144  C CD    . LYS A 1 18 ? 6.616   -46.081 -3.664  1.00 79.32  ? 186 LYS A CD    1 
ATOM 145  C CE    . LYS A 1 18 ? 6.713   -46.084 -2.139  1.00 81.22  ? 186 LYS A CE    1 
ATOM 146  N NZ    . LYS A 1 18 ? 5.950   -44.944 -1.518  1.00 83.04  ? 186 LYS A NZ    1 
ATOM 147  N N     . LYS A 1 19 ? 4.465   -43.712 -7.311  1.00 74.76  ? 187 LYS A N     1 
ATOM 148  C CA    . LYS A 1 19 ? 4.886   -43.225 -8.635  1.00 75.31  ? 187 LYS A CA    1 
ATOM 149  C C     . LYS A 1 19 ? 3.747   -42.650 -9.514  1.00 75.44  ? 187 LYS A C     1 
ATOM 150  O O     . LYS A 1 19 ? 3.805   -41.472 -9.899  1.00 75.56  ? 187 LYS A O     1 
ATOM 151  C CB    . LYS A 1 19 ? 5.751   -44.252 -9.425  1.00 75.58  ? 187 LYS A CB    1 
ATOM 152  C CG    . LYS A 1 19 ? 5.022   -45.378 -10.179 1.00 75.84  ? 187 LYS A CG    1 
ATOM 153  C CD    . LYS A 1 19 ? 4.874   -46.652 -9.345  1.00 76.24  ? 187 LYS A CD    1 
ATOM 154  C CE    . LYS A 1 19 ? 4.684   -47.877 -10.246 1.00 75.88  ? 187 LYS A CE    1 
ATOM 155  N NZ    . LYS A 1 19 ? 5.070   -49.157 -9.580  1.00 75.29  ? 187 LYS A NZ    1 
ATOM 156  N N     . PRO A 1 20 ? 2.681   -43.451 -9.765  1.00 75.30  ? 188 PRO A N     1 
ATOM 157  C CA    . PRO A 1 20 ? 2.023   -43.432 -11.086 1.00 75.11  ? 188 PRO A CA    1 
ATOM 158  C C     . PRO A 1 20 ? 1.708   -42.020 -11.583 1.00 74.79  ? 188 PRO A C     1 
ATOM 159  O O     . PRO A 1 20 ? 1.244   -41.184 -10.802 1.00 74.78  ? 188 PRO A O     1 
ATOM 160  C CB    . PRO A 1 20 ? 0.739   -44.259 -10.867 1.00 75.24  ? 188 PRO A CB    1 
ATOM 161  C CG    . PRO A 1 20 ? 0.561   -44.327 -9.365  1.00 75.39  ? 188 PRO A CG    1 
ATOM 162  C CD    . PRO A 1 20 ? 1.955   -44.312 -8.812  1.00 75.48  ? 188 PRO A CD    1 
ATOM 163  N N     . ARG A 1 21 ? 1.984   -41.754 -12.860 1.00 74.14  ? 189 ARG A N     1 
ATOM 164  C CA    . ARG A 1 21 ? 1.728   -40.433 -13.407 1.00 73.65  ? 189 ARG A CA    1 
ATOM 165  C C     . ARG A 1 21 ? 0.242   -40.242 -13.674 1.00 72.98  ? 189 ARG A C     1 
ATOM 166  O O     . ARG A 1 21 ? -0.238  -40.565 -14.761 1.00 73.09  ? 189 ARG A O     1 
ATOM 167  C CB    . ARG A 1 21 ? 2.516   -40.180 -14.696 1.00 73.91  ? 189 ARG A CB    1 
ATOM 168  C CG    . ARG A 1 21 ? 2.805   -38.683 -14.893 1.00 75.14  ? 189 ARG A CG    1 
ATOM 169  C CD    . ARG A 1 21 ? 2.419   -38.148 -16.274 1.00 77.05  ? 189 ARG A CD    1 
ATOM 170  N NE    . ARG A 1 21 ? 1.868   -36.789 -16.186 1.00 78.44  ? 189 ARG A NE    1 
ATOM 171  C CZ    . ARG A 1 21 ? 2.587   -35.664 -16.189 1.00 78.75  ? 189 ARG A CZ    1 
ATOM 172  N NH1   . ARG A 1 21 ? 3.916   -35.700 -16.280 1.00 77.64  ? 189 ARG A NH1   1 
ATOM 173  N NH2   . ARG A 1 21 ? 1.966   -34.492 -16.099 1.00 78.79  ? 189 ARG A NH2   1 
ATOM 174  N N     . THR A 1 22 ? -0.481  -39.714 -12.690 1.00 71.93  ? 190 THR A N     1 
ATOM 175  C CA    . THR A 1 22 ? -1.907  -39.412 -12.870 1.00 71.02  ? 190 THR A CA    1 
ATOM 176  C C     . THR A 1 22 ? -2.138  -38.113 -13.666 1.00 70.02  ? 190 THR A C     1 
ATOM 177  O O     . THR A 1 22 ? -1.240  -37.273 -13.811 1.00 70.01  ? 190 THR A O     1 
ATOM 178  C CB    . THR A 1 22 ? -2.689  -39.375 -11.524 1.00 71.07  ? 190 THR A CB    1 
ATOM 179  O OG1   . THR A 1 22 ? -2.171  -38.333 -10.691 1.00 71.27  ? 190 THR A OG1   1 
ATOM 180  C CG2   . THR A 1 22 ? -2.578  -40.713 -10.778 1.00 71.60  ? 190 THR A CG2   1 
ATOM 181  N N     . SER A 1 23 ? -3.342  -37.986 -14.203 1.00 68.58  ? 191 SER A N     1 
ATOM 182  C CA    . SER A 1 23 ? -3.766  -36.793 -14.891 1.00 67.39  ? 191 SER A CA    1 
ATOM 183  C C     . SER A 1 23 ? -5.234  -36.662 -14.597 1.00 66.72  ? 191 SER A C     1 
ATOM 184  O O     . SER A 1 23 ? -6.009  -37.550 -14.932 1.00 66.98  ? 191 SER A O     1 
ATOM 185  C CB    . SER A 1 23 ? -3.551  -36.926 -16.396 1.00 67.40  ? 191 SER A CB    1 
ATOM 186  O OG    . SER A 1 23 ? -3.846  -35.704 -17.059 1.00 66.96  ? 191 SER A OG    1 
ATOM 187  N N     . PHE A 1 24 ? -5.621  -35.564 -13.960 1.00 65.76  ? 192 PHE A N     1 
ATOM 188  C CA    . PHE A 1 24 ? -7.008  -35.392 -13.519 1.00 64.47  ? 192 PHE A CA    1 
ATOM 189  C C     . PHE A 1 24 ? -7.926  -35.094 -14.697 1.00 64.34  ? 192 PHE A C     1 
ATOM 190  O O     . PHE A 1 24 ? -7.516  -34.431 -15.644 1.00 64.13  ? 192 PHE A O     1 
ATOM 191  C CB    . PHE A 1 24 ? -7.091  -34.307 -12.444 1.00 63.48  ? 192 PHE A CB    1 
ATOM 192  C CG    . PHE A 1 24 ? -6.115  -34.502 -11.323 1.00 61.63  ? 192 PHE A CG    1 
ATOM 193  C CD1   . PHE A 1 24 ? -6.225  -35.583 -10.470 1.00 59.76  ? 192 PHE A CD1   1 
ATOM 194  C CD2   . PHE A 1 24 ? -5.077  -33.616 -11.129 1.00 60.97  ? 192 PHE A CD2   1 
ATOM 195  C CE1   . PHE A 1 24 ? -5.325  -35.772 -9.447  1.00 59.12  ? 192 PHE A CE1   1 
ATOM 196  C CE2   . PHE A 1 24 ? -4.171  -33.805 -10.099 1.00 59.60  ? 192 PHE A CE2   1 
ATOM 197  C CZ    . PHE A 1 24 ? -4.300  -34.882 -9.260  1.00 60.01  ? 192 PHE A CZ    1 
ATOM 198  N N     . THR A 1 25 ? -9.149  -35.621 -14.635 1.00 64.49  ? 193 THR A N     1 
ATOM 199  C CA    . THR A 1 25 ? -10.165 -35.474 -15.692 1.00 64.66  ? 193 THR A CA    1 
ATOM 200  C C     . THR A 1 25 ? -10.615 -34.031 -15.750 1.00 64.72  ? 193 THR A C     1 
ATOM 201  O O     . THR A 1 25 ? -10.493 -33.322 -14.755 1.00 65.21  ? 193 THR A O     1 
ATOM 202  C CB    . THR A 1 25 ? -11.407 -36.323 -15.389 1.00 64.73  ? 193 THR A CB    1 
ATOM 203  O OG1   . THR A 1 25 ? -12.277 -35.608 -14.492 1.00 64.88  ? 193 THR A OG1   1 
ATOM 204  C CG2   . THR A 1 25 ? -11.003 -37.658 -14.758 1.00 64.90  ? 193 THR A CG2   1 
ATOM 205  N N     . ARG A 1 26 ? -11.167 -33.593 -16.877 1.00 64.54  ? 194 ARG A N     1 
ATOM 206  C CA    . ARG A 1 26 ? -11.490 -32.174 -17.005 1.00 64.80  ? 194 ARG A CA    1 
ATOM 207  C C     . ARG A 1 26 ? -12.546 -31.719 -16.018 1.00 63.76  ? 194 ARG A C     1 
ATOM 208  O O     . ARG A 1 26 ? -12.531 -30.558 -15.607 1.00 64.07  ? 194 ARG A O     1 
ATOM 209  C CB    . ARG A 1 26 ? -11.814 -31.743 -18.444 1.00 64.86  ? 194 ARG A CB    1 
ATOM 210  C CG    . ARG A 1 26 ? -13.157 -32.179 -19.027 1.00 66.35  ? 194 ARG A CG    1 
ATOM 211  C CD    . ARG A 1 26 ? -13.116 -32.065 -20.568 1.00 67.12  ? 194 ARG A CD    1 
ATOM 212  N NE    . ARG A 1 26 ? -11.964 -32.799 -21.122 1.00 71.99  ? 194 ARG A NE    1 
ATOM 213  C CZ    . ARG A 1 26 ? -11.779 -33.085 -22.413 1.00 73.32  ? 194 ARG A CZ    1 
ATOM 214  N NH1   . ARG A 1 26 ? -12.671 -32.704 -23.326 1.00 74.22  ? 194 ARG A NH1   1 
ATOM 215  N NH2   . ARG A 1 26 ? -10.696 -33.762 -22.795 1.00 72.97  ? 194 ARG A NH2   1 
ATOM 216  N N     . ILE A 1 27 ? -13.429 -32.630 -15.612 1.00 62.47  ? 195 ILE A N     1 
ATOM 217  C CA    . ILE A 1 27 ? -14.419 -32.296 -14.583 1.00 61.58  ? 195 ILE A CA    1 
ATOM 218  C C     . ILE A 1 27 ? -13.706 -32.091 -13.244 1.00 60.44  ? 195 ILE A C     1 
ATOM 219  O O     . ILE A 1 27 ? -13.850 -31.021 -12.630 1.00 60.29  ? 195 ILE A O     1 
ATOM 220  C CB    . ILE A 1 27 ? -15.586 -33.343 -14.464 1.00 61.95  ? 195 ILE A CB    1 
ATOM 221  C CG1   . ILE A 1 27 ? -16.288 -33.595 -15.833 1.00 62.76  ? 195 ILE A CG1   1 
ATOM 222  C CG2   . ILE A 1 27 ? -16.588 -32.940 -13.342 1.00 62.05  ? 195 ILE A CG2   1 
ATOM 223  C CD1   . ILE A 1 27 ? -17.110 -32.413 -16.438 1.00 62.69  ? 195 ILE A CD1   1 
ATOM 224  N N     . GLN A 1 28 ? -12.922 -33.094 -12.821 1.00 58.95  ? 196 GLN A N     1 
ATOM 225  C CA    . GLN A 1 28 ? -12.028 -32.962 -11.672 1.00 57.28  ? 196 GLN A CA    1 
ATOM 226  C C     . GLN A 1 28 ? -11.331 -31.607 -11.754 1.00 57.40  ? 196 GLN A C     1 
ATOM 227  O O     . GLN A 1 28 ? -11.395 -30.807 -10.825 1.00 57.49  ? 196 GLN A O     1 
ATOM 228  C CB    . GLN A 1 28 ? -10.999 -34.093 -11.620 1.00 57.03  ? 196 GLN A CB    1 
ATOM 229  C CG    . GLN A 1 28 ? -11.554 -35.436 -11.143 1.00 56.44  ? 196 GLN A CG    1 
ATOM 230  C CD    . GLN A 1 28 ? -10.499 -36.531 -10.990 1.00 56.06  ? 196 GLN A CD    1 
ATOM 231  O OE1   . GLN A 1 28 ? -9.670  -36.745 -11.867 1.00 55.59  ? 196 GLN A OE1   1 
ATOM 232  N NE2   . GLN A 1 28 ? -10.548 -37.242 -9.878  1.00 53.57  ? 196 GLN A NE2   1 
ATOM 233  N N     . VAL A 1 29 ? -10.709 -31.317 -12.889 1.00 56.92  ? 197 VAL A N     1 
ATOM 234  C CA    . VAL A 1 29 ? -9.977  -30.067 -13.011 1.00 56.55  ? 197 VAL A CA    1 
ATOM 235  C C     . VAL A 1 29 ? -10.898 -28.854 -12.863 1.00 56.67  ? 197 VAL A C     1 
ATOM 236  O O     . VAL A 1 29 ? -10.670 -28.021 -12.001 1.00 57.00  ? 197 VAL A O     1 
ATOM 237  C CB    . VAL A 1 29 ? -9.136  -29.995 -14.310 1.00 56.50  ? 197 VAL A CB    1 
ATOM 238  C CG1   . VAL A 1 29 ? -8.541  -28.595 -14.488 1.00 55.49  ? 197 VAL A CG1   1 
ATOM 239  C CG2   . VAL A 1 29 ? -8.045  -31.053 -14.287 1.00 54.80  ? 197 VAL A CG2   1 
ATOM 240  N N     . ALA A 1 30 ? -11.947 -28.779 -13.672 1.00 56.56  ? 198 ALA A N     1 
ATOM 241  C CA    . ALA A 1 30 ? -12.803 -27.598 -13.684 1.00 56.63  ? 198 ALA A CA    1 
ATOM 242  C C     . ALA A 1 30 ? -13.486 -27.320 -12.335 1.00 56.77  ? 198 ALA A C     1 
ATOM 243  O O     . ALA A 1 30 ? -13.780 -26.163 -12.028 1.00 56.85  ? 198 ALA A O     1 
ATOM 244  C CB    . ALA A 1 30 ? -13.819 -27.686 -14.807 1.00 56.56  ? 198 ALA A CB    1 
ATOM 245  N N     . GLU A 1 31 ? -13.725 -28.364 -11.536 1.00 56.65  ? 199 GLU A N     1 
ATOM 246  C CA    . GLU A 1 31 ? -14.236 -28.172 -10.173 1.00 56.87  ? 199 GLU A CA    1 
ATOM 247  C C     . GLU A 1 31 ? -13.184 -27.529 -9.289  1.00 56.38  ? 199 GLU A C     1 
ATOM 248  O O     . GLU A 1 31 ? -13.479 -26.604 -8.522  1.00 56.39  ? 199 GLU A O     1 
ATOM 249  C CB    . GLU A 1 31 ? -14.660 -29.488 -9.517  1.00 56.92  ? 199 GLU A CB    1 
ATOM 250  C CG    . GLU A 1 31 ? -15.878 -30.170 -10.129 1.00 59.04  ? 199 GLU A CG    1 
ATOM 251  C CD    . GLU A 1 31 ? -17.143 -29.314 -10.168 1.00 60.88  ? 199 GLU A CD    1 
ATOM 252  O OE1   . GLU A 1 31 ? -17.429 -28.573 -9.198  1.00 62.37  ? 199 GLU A OE1   1 
ATOM 253  O OE2   . GLU A 1 31 ? -17.870 -29.413 -11.180 1.00 61.54  ? 199 GLU A OE2   1 
ATOM 254  N N     . LEU A 1 32 ? -11.962 -28.046 -9.391  1.00 55.68  ? 200 LEU A N     1 
ATOM 255  C CA    . LEU A 1 32 ? -10.843 -27.531 -8.633  1.00 55.22  ? 200 LEU A CA    1 
ATOM 256  C C     . LEU A 1 32 ? -10.676 -26.036 -8.953  1.00 55.25  ? 200 LEU A C     1 
ATOM 257  O O     . LEU A 1 32 ? -10.624 -25.194 -8.058  1.00 55.07  ? 200 LEU A O     1 
ATOM 258  C CB    . LEU A 1 32 ? -9.577  -28.360 -8.908  1.00 54.85  ? 200 LEU A CB    1 
ATOM 259  C CG    . LEU A 1 32 ? -9.500  -29.771 -8.269  1.00 54.96  ? 200 LEU A CG    1 
ATOM 260  C CD1   . LEU A 1 32 ? -8.568  -30.735 -8.978  1.00 53.92  ? 200 LEU A CD1   1 
ATOM 261  C CD2   . LEU A 1 32 ? -9.106  -29.725 -6.817  1.00 55.33  ? 200 LEU A CD2   1 
ATOM 262  N N     . GLU A 1 33 ? -10.674 -25.699 -10.231 1.00 55.35  ? 201 GLU A N     1 
ATOM 263  C CA    . GLU A 1 33 ? -10.541 -24.310 -10.634 1.00 55.75  ? 201 GLU A CA    1 
ATOM 264  C C     . GLU A 1 33 ? -11.689 -23.446 -10.092 1.00 55.47  ? 201 GLU A C     1 
ATOM 265  O O     . GLU A 1 33 ? -11.497 -22.285 -9.731  1.00 55.10  ? 201 GLU A O     1 
ATOM 266  C CB    . GLU A 1 33 ? -10.455 -24.218 -12.154 1.00 55.57  ? 201 GLU A CB    1 
ATOM 267  C CG    . GLU A 1 33 ? -9.535  -23.117 -12.647 1.00 57.74  ? 201 GLU A CG    1 
ATOM 268  C CD    . GLU A 1 33 ? -8.087  -23.572 -12.754 1.00 60.55  ? 201 GLU A CD    1 
ATOM 269  O OE1   . GLU A 1 33 ? -7.409  -23.611 -11.709 1.00 60.76  ? 201 GLU A OE1   1 
ATOM 270  O OE2   . GLU A 1 33 ? -7.621  -23.891 -13.882 1.00 62.43  ? 201 GLU A OE2   1 
ATOM 271  N N     . LYS A 1 34 ? -12.878 -24.036 -10.025 1.00 55.59  ? 202 LYS A N     1 
ATOM 272  C CA    . LYS A 1 34 ? -14.072 -23.315 -9.601  1.00 55.67  ? 202 LYS A CA    1 
ATOM 273  C C     . LYS A 1 34 ? -13.929 -22.958 -8.128  1.00 55.08  ? 202 LYS A C     1 
ATOM 274  O O     . LYS A 1 34 ? -14.068 -21.790 -7.754  1.00 55.48  ? 202 LYS A O     1 
ATOM 275  C CB    . LYS A 1 34 ? -15.338 -24.145 -9.883  1.00 56.11  ? 202 LYS A CB    1 
ATOM 276  C CG    . LYS A 1 34 ? -16.624 -23.339 -10.047 1.00 57.56  ? 202 LYS A CG    1 
ATOM 277  C CD    . LYS A 1 34 ? -17.659 -24.073 -10.924 1.00 60.75  ? 202 LYS A CD    1 
ATOM 278  C CE    . LYS A 1 34 ? -19.113 -23.867 -10.408 1.00 62.89  ? 202 LYS A CE    1 
ATOM 279  N NZ    . LYS A 1 34 ? -20.176 -24.002 -11.483 1.00 63.18  ? 202 LYS A NZ    1 
ATOM 280  N N     . ARG A 1 35 ? -13.606 -23.954 -7.304  1.00 54.18  ? 203 ARG A N     1 
ATOM 281  C CA    . ARG A 1 35 ? -13.301 -23.711 -5.897  1.00 53.32  ? 203 ARG A CA    1 
ATOM 282  C C     . ARG A 1 35 ? -12.161 -22.710 -5.705  1.00 53.42  ? 203 ARG A C     1 
ATOM 283  O O     . ARG A 1 35 ? -12.196 -21.880 -4.789  1.00 53.37  ? 203 ARG A O     1 
ATOM 284  C CB    . ARG A 1 35 ? -12.932 -25.004 -5.199  1.00 52.90  ? 203 ARG A CB    1 
ATOM 285  C CG    . ARG A 1 35 ? -12.734 -24.855 -3.717  1.00 51.03  ? 203 ARG A CG    1 
ATOM 286  C CD    . ARG A 1 35 ? -13.989 -24.378 -3.044  1.00 49.01  ? 203 ARG A CD    1 
ATOM 287  N NE    . ARG A 1 35 ? -13.979 -24.699 -1.620  1.00 48.27  ? 203 ARG A NE    1 
ATOM 288  C CZ    . ARG A 1 35 ? -14.396 -25.863 -1.116  1.00 49.62  ? 203 ARG A CZ    1 
ATOM 289  N NH1   . ARG A 1 35 ? -14.355 -26.075 0.200   1.00 48.87  ? 203 ARG A NH1   1 
ATOM 290  N NH2   . ARG A 1 35 ? -14.851 -26.821 -1.931  1.00 49.24  ? 203 ARG A NH2   1 
ATOM 291  N N     . PHE A 1 36 ? -11.154 -22.789 -6.573  1.00 53.22  ? 204 PHE A N     1 
ATOM 292  C CA    . PHE A 1 36 ? -9.968  -21.963 -6.428  1.00 52.93  ? 204 PHE A CA    1 
ATOM 293  C C     . PHE A 1 36 ? -10.316 -20.501 -6.521  1.00 53.27  ? 204 PHE A C     1 
ATOM 294  O O     . PHE A 1 36 ? -9.746  -19.666 -5.794  1.00 53.43  ? 204 PHE A O     1 
ATOM 295  C CB    . PHE A 1 36 ? -8.926  -22.277 -7.492  1.00 52.40  ? 204 PHE A CB    1 
ATOM 296  C CG    . PHE A 1 36 ? -7.644  -21.524 -7.295  1.00 51.91  ? 204 PHE A CG    1 
ATOM 297  C CD1   . PHE A 1 36 ? -6.803  -21.825 -6.223  1.00 50.29  ? 204 PHE A CD1   1 
ATOM 298  C CD2   . PHE A 1 36 ? -7.290  -20.489 -8.146  1.00 51.34  ? 204 PHE A CD2   1 
ATOM 299  C CE1   . PHE A 1 36 ? -5.633  -21.126 -6.025  1.00 48.68  ? 204 PHE A CE1   1 
ATOM 300  C CE2   . PHE A 1 36 ? -6.109  -19.794 -7.954  1.00 51.14  ? 204 PHE A CE2   1 
ATOM 301  C CZ    . PHE A 1 36 ? -5.284  -20.113 -6.896  1.00 50.51  ? 204 PHE A CZ    1 
ATOM 302  N N     . HIS A 1 37 ? -11.261 -20.212 -7.415  1.00 53.14  ? 205 HIS A N     1 
ATOM 303  C CA    . HIS A 1 37 ? -11.691 -18.857 -7.698  1.00 53.00  ? 205 HIS A CA    1 
ATOM 304  C C     . HIS A 1 37 ? -12.266 -18.181 -6.467  1.00 51.67  ? 205 HIS A C     1 
ATOM 305  O O     . HIS A 1 37 ? -12.045 -16.996 -6.253  1.00 51.75  ? 205 HIS A O     1 
ATOM 306  C CB    . HIS A 1 37 ? -12.710 -18.850 -8.830  1.00 53.90  ? 205 HIS A CB    1 
ATOM 307  C CG    . HIS A 1 37 ? -12.412 -17.850 -9.905  1.00 57.49  ? 205 HIS A CG    1 
ATOM 308  N ND1   . HIS A 1 37 ? -11.304 -17.947 -10.727 1.00 61.20  ? 205 HIS A ND1   1 
ATOM 309  C CD2   . HIS A 1 37 ? -13.087 -16.744 -10.309 1.00 59.94  ? 205 HIS A CD2   1 
ATOM 310  C CE1   . HIS A 1 37 ? -11.305 -16.936 -11.582 1.00 62.69  ? 205 HIS A CE1   1 
ATOM 311  N NE2   . HIS A 1 37 ? -12.379 -16.196 -11.355 1.00 61.67  ? 205 HIS A NE2   1 
ATOM 312  N N     . LYS A 1 38 ? -12.979 -18.923 -5.639  1.00 50.09  ? 206 LYS A N     1 
ATOM 313  C CA    . LYS A 1 38 ? -13.526 -18.285 -4.454  1.00 48.90  ? 206 LYS A CA    1 
ATOM 314  C C     . LYS A 1 38 ? -12.775 -18.562 -3.144  1.00 48.05  ? 206 LYS A C     1 
ATOM 315  O O     . LYS A 1 38 ? -13.096 -17.980 -2.104  1.00 47.79  ? 206 LYS A O     1 
ATOM 316  C CB    . LYS A 1 38 ? -15.046 -18.523 -4.336  1.00 48.91  ? 206 LYS A CB    1 
ATOM 317  C CG    . LYS A 1 38 ? -15.510 -19.958 -4.437  1.00 48.36  ? 206 LYS A CG    1 
ATOM 318  C CD    . LYS A 1 38 ? -17.023 -20.003 -4.291  1.00 49.63  ? 206 LYS A CD    1 
ATOM 319  C CE    . LYS A 1 38 ? -17.577 -21.402 -4.002  1.00 50.49  ? 206 LYS A CE    1 
ATOM 320  N NZ    . LYS A 1 38 ? -17.773 -22.176 -5.258  1.00 50.74  ? 206 LYS A NZ    1 
ATOM 321  N N     . GLN A 1 39 ? -11.767 -19.433 -3.194  1.00 47.20  ? 207 GLN A N     1 
ATOM 322  C CA    . GLN A 1 39 ? -11.073 -19.876 -1.971  1.00 46.55  ? 207 GLN A CA    1 
ATOM 323  C C     . GLN A 1 39 ? -9.649  -20.326 -2.298  1.00 46.10  ? 207 GLN A C     1 
ATOM 324  O O     . GLN A 1 39 ? -9.448  -21.423 -2.806  1.00 46.78  ? 207 GLN A O     1 
ATOM 325  C CB    . GLN A 1 39 ? -11.859 -21.018 -1.303  1.00 46.14  ? 207 GLN A CB    1 
ATOM 326  C CG    . GLN A 1 39 ? -11.462 -21.314 0.137   1.00 45.91  ? 207 GLN A CG    1 
ATOM 327  C CD    . GLN A 1 39 ? -12.436 -22.255 0.857   1.00 46.84  ? 207 GLN A CD    1 
ATOM 328  O OE1   . GLN A 1 39 ? -13.367 -22.810 0.254   1.00 47.30  ? 207 GLN A OE1   1 
ATOM 329  N NE2   . GLN A 1 39 ? -12.216 -22.445 2.152   1.00 46.47  ? 207 GLN A NE2   1 
ATOM 330  N N     . LYS A 1 40 ? -8.658  -19.495 -2.027  1.00 45.31  ? 208 LYS A N     1 
ATOM 331  C CA    . LYS A 1 40 ? -7.299  -19.839 -2.435  1.00 44.75  ? 208 LYS A CA    1 
ATOM 332  C C     . LYS A 1 40 ? -6.639  -20.816 -1.460  1.00 44.14  ? 208 LYS A C     1 
ATOM 333  O O     . LYS A 1 40 ? -5.689  -21.502 -1.806  1.00 44.08  ? 208 LYS A O     1 
ATOM 334  C CB    . LYS A 1 40 ? -6.438  -18.588 -2.632  1.00 45.23  ? 208 LYS A CB    1 
ATOM 335  C CG    . LYS A 1 40 ? -7.063  -17.494 -3.493  1.00 45.71  ? 208 LYS A CG    1 
ATOM 336  C CD    . LYS A 1 40 ? -6.671  -17.577 -4.947  1.00 47.91  ? 208 LYS A CD    1 
ATOM 337  C CE    . LYS A 1 40 ? -7.416  -16.525 -5.805  1.00 49.08  ? 208 LYS A CE    1 
ATOM 338  N NZ    . LYS A 1 40 ? -8.860  -16.839 -6.156  1.00 50.54  ? 208 LYS A NZ    1 
ATOM 339  N N     . TYR A 1 41 ? -7.145  -20.889 -0.243  1.00 43.42  ? 209 TYR A N     1 
ATOM 340  C CA    . TYR A 1 41 ? -6.594  -21.812 0.715   1.00 43.24  ? 209 TYR A CA    1 
ATOM 341  C C     . TYR A 1 41 ? -7.694  -22.721 1.253   1.00 43.46  ? 209 TYR A C     1 
ATOM 342  O O     . TYR A 1 41 ? -8.843  -22.311 1.384   1.00 44.24  ? 209 TYR A O     1 
ATOM 343  C CB    . TYR A 1 41 ? -5.873  -21.067 1.846   1.00 43.07  ? 209 TYR A CB    1 
ATOM 344  C CG    . TYR A 1 41 ? -4.671  -20.276 1.378   1.00 43.39  ? 209 TYR A CG    1 
ATOM 345  C CD1   . TYR A 1 41 ? -3.373  -20.740 1.599   1.00 44.21  ? 209 TYR A CD1   1 
ATOM 346  C CD2   . TYR A 1 41 ? -4.826  -19.070 0.685   1.00 43.48  ? 209 TYR A CD2   1 
ATOM 347  C CE1   . TYR A 1 41 ? -2.255  -20.007 1.160   1.00 44.06  ? 209 TYR A CE1   1 
ATOM 348  C CE2   . TYR A 1 41 ? -3.724  -18.337 0.237   1.00 43.02  ? 209 TYR A CE2   1 
ATOM 349  C CZ    . TYR A 1 41 ? -2.442  -18.802 0.483   1.00 43.95  ? 209 TYR A CZ    1 
ATOM 350  O OH    . TYR A 1 41 ? -1.354  -18.073 0.038   1.00 43.30  ? 209 TYR A OH    1 
ATOM 351  N N     . LEU A 1 42 ? -7.347  -23.964 1.552   1.00 42.98  ? 210 LEU A N     1 
ATOM 352  C CA    . LEU A 1 42 ? -8.324  -24.892 2.030   1.00 42.44  ? 210 LEU A CA    1 
ATOM 353  C C     . LEU A 1 42 ? -7.834  -25.446 3.332   1.00 42.69  ? 210 LEU A C     1 
ATOM 354  O O     . LEU A 1 42 ? -6.701  -25.875 3.433   1.00 43.13  ? 210 LEU A O     1 
ATOM 355  C CB    . LEU A 1 42 ? -8.537  -26.010 1.012   1.00 42.41  ? 210 LEU A CB    1 
ATOM 356  C CG    . LEU A 1 42 ? -9.148  -25.677 -0.366  1.00 41.82  ? 210 LEU A CG    1 
ATOM 357  C CD1   . LEU A 1 42 ? -9.310  -26.950 -1.156  1.00 40.82  ? 210 LEU A CD1   1 
ATOM 358  C CD2   . LEU A 1 42 ? -10.484 -24.943 -0.296  1.00 38.01  ? 210 LEU A CD2   1 
ATOM 359  N N     . ALA A 1 43 ? -8.680  -25.401 4.352   1.00 42.99  ? 211 ALA A N     1 
ATOM 360  C CA    . ALA A 1 43 ? -8.377  -26.060 5.605   1.00 43.01  ? 211 ALA A CA    1 
ATOM 361  C C     . ALA A 1 43 ? -8.431  -27.563 5.348   1.00 43.33  ? 211 ALA A C     1 
ATOM 362  O O     . ALA A 1 43 ? -9.000  -28.004 4.339   1.00 42.79  ? 211 ALA A O     1 
ATOM 363  C CB    . ALA A 1 43 ? -9.377  -25.669 6.658   1.00 42.87  ? 211 ALA A CB    1 
ATOM 364  N N     . SER A 1 44 ? -7.858  -28.340 6.264   1.00 43.63  ? 212 SER A N     1 
ATOM 365  C CA    . SER A 1 44 ? -7.738  -29.766 6.039   1.00 44.45  ? 212 SER A CA    1 
ATOM 366  C C     . SER A 1 44 ? -9.093  -30.481 5.927   1.00 44.90  ? 212 SER A C     1 
ATOM 367  O O     . SER A 1 44 ? -9.342  -31.129 4.922   1.00 45.44  ? 212 SER A O     1 
ATOM 368  C CB    . SER A 1 44 ? -6.761  -30.423 7.034   1.00 44.53  ? 212 SER A CB    1 
ATOM 369  O OG    . SER A 1 44 ? -7.374  -30.844 8.231   1.00 44.63  ? 212 SER A OG    1 
ATOM 370  N N     . ALA A 1 45 ? -9.985  -30.339 6.900   1.00 45.57  ? 213 ALA A N     1 
ATOM 371  C CA    . ALA A 1 45 ? -11.306 -30.983 6.789   1.00 46.58  ? 213 ALA A CA    1 
ATOM 372  C C     . ALA A 1 45 ? -12.002 -30.693 5.457   1.00 47.15  ? 213 ALA A C     1 
ATOM 373  O O     . ALA A 1 45 ? -12.620 -31.584 4.862   1.00 47.45  ? 213 ALA A O     1 
ATOM 374  C CB    . ALA A 1 45 ? -12.217 -30.615 7.961   1.00 46.28  ? 213 ALA A CB    1 
ATOM 375  N N     . GLU A 1 46 ? -11.895 -29.463 4.969   1.00 47.74  ? 214 GLU A N     1 
ATOM 376  C CA    . GLU A 1 46 ? -12.632 -29.126 3.761   1.00 48.54  ? 214 GLU A CA    1 
ATOM 377  C C     . GLU A 1 46 ? -11.873 -29.557 2.533   1.00 48.55  ? 214 GLU A C     1 
ATOM 378  O O     . GLU A 1 46 ? -12.426 -29.612 1.438   1.00 49.03  ? 214 GLU A O     1 
ATOM 379  C CB    . GLU A 1 46 ? -13.043 -27.651 3.709   1.00 48.62  ? 214 GLU A CB    1 
ATOM 380  C CG    . GLU A 1 46 ? -11.997 -26.693 3.253   1.00 50.42  ? 214 GLU A CG    1 
ATOM 381  C CD    . GLU A 1 46 ? -12.443 -25.251 3.390   1.00 52.81  ? 214 GLU A CD    1 
ATOM 382  O OE1   . GLU A 1 46 ? -13.512 -24.909 2.833   1.00 54.59  ? 214 GLU A OE1   1 
ATOM 383  O OE2   . GLU A 1 46 ? -11.713 -24.455 4.035   1.00 53.60  ? 214 GLU A OE2   1 
ATOM 384  N N     . ARG A 1 47 ? -10.602 -29.859 2.716   1.00 48.66  ? 215 ARG A N     1 
ATOM 385  C CA    . ARG A 1 47 ? -9.826  -30.423 1.634   1.00 49.36  ? 215 ARG A CA    1 
ATOM 386  C C     . ARG A 1 47 ? -10.283 -31.880 1.499   1.00 49.52  ? 215 ARG A C     1 
ATOM 387  O O     . ARG A 1 47 ? -10.614 -32.354 0.413   1.00 48.81  ? 215 ARG A O     1 
ATOM 388  C CB    . ARG A 1 47 ? -8.338  -30.333 1.960   1.00 49.15  ? 215 ARG A CB    1 
ATOM 389  C CG    . ARG A 1 47 ? -7.422  -30.692 0.815   1.00 49.39  ? 215 ARG A CG    1 
ATOM 390  C CD    . ARG A 1 47 ? -6.190  -31.397 1.336   1.00 49.57  ? 215 ARG A CD    1 
ATOM 391  N NE    . ARG A 1 47 ? -5.462  -30.583 2.305   1.00 50.33  ? 215 ARG A NE    1 
ATOM 392  C CZ    . ARG A 1 47 ? -4.863  -31.068 3.390   1.00 49.90  ? 215 ARG A CZ    1 
ATOM 393  N NH1   . ARG A 1 47 ? -4.248  -30.237 4.221   1.00 46.66  ? 215 ARG A NH1   1 
ATOM 394  N NH2   . ARG A 1 47 ? -4.902  -32.378 3.650   1.00 49.83  ? 215 ARG A NH2   1 
ATOM 395  N N     . ALA A 1 48 ? -10.331 -32.554 2.643   1.00 50.31  ? 216 ALA A N     1 
ATOM 396  C CA    . ALA A 1 48 ? -10.826 -33.918 2.745   1.00 50.86  ? 216 ALA A CA    1 
ATOM 397  C C     . ALA A 1 48 ? -12.144 -34.041 1.979   1.00 51.05  ? 216 ALA A C     1 
ATOM 398  O O     . ALA A 1 48 ? -12.275 -34.896 1.097   1.00 51.30  ? 216 ALA A O     1 
ATOM 399  C CB    . ALA A 1 48 ? -10.976 -34.332 4.226   1.00 50.37  ? 216 ALA A CB    1 
ATOM 400  N N     . ALA A 1 49 ? -13.092 -33.150 2.265   1.00 51.06  ? 217 ALA A N     1 
ATOM 401  C CA    . ALA A 1 49 ? -14.392 -33.215 1.594   1.00 50.85  ? 217 ALA A CA    1 
ATOM 402  C C     . ALA A 1 49 ? -14.251 -32.968 0.124   1.00 50.35  ? 217 ALA A C     1 
ATOM 403  O O     . ALA A 1 49 ? -14.863 -33.655 -0.658  1.00 50.94  ? 217 ALA A O     1 
ATOM 404  C CB    . ALA A 1 49 ? -15.397 -32.245 2.192   1.00 51.07  ? 217 ALA A CB    1 
ATOM 405  N N     . LEU A 1 50 ? -13.446 -31.999 -0.274  1.00 50.08  ? 218 LEU A N     1 
ATOM 406  C CA    . LEU A 1 50 ? -13.369 -31.711 -1.697  1.00 50.00  ? 218 LEU A CA    1 
ATOM 407  C C     . LEU A 1 50 ? -12.858 -32.933 -2.449  1.00 50.33  ? 218 LEU A C     1 
ATOM 408  O O     . LEU A 1 50 ? -13.369 -33.274 -3.516  1.00 50.36  ? 218 LEU A O     1 
ATOM 409  C CB    . LEU A 1 50 ? -12.495 -30.506 -1.968  1.00 49.48  ? 218 LEU A CB    1 
ATOM 410  C CG    . LEU A 1 50 ? -12.307 -30.175 -3.443  1.00 49.38  ? 218 LEU A CG    1 
ATOM 411  C CD1   . LEU A 1 50 ? -13.633 -29.840 -4.118  1.00 47.81  ? 218 LEU A CD1   1 
ATOM 412  C CD2   . LEU A 1 50 ? -11.278 -29.050 -3.616  1.00 49.48  ? 218 LEU A CD2   1 
ATOM 413  N N     . ALA A 1 51 ? -11.882 -33.614 -1.856  1.00 50.90  ? 219 ALA A N     1 
ATOM 414  C CA    . ALA A 1 51 ? -11.269 -34.786 -2.467  1.00 51.22  ? 219 ALA A CA    1 
ATOM 415  C C     . ALA A 1 51 ? -12.259 -35.919 -2.527  1.00 51.75  ? 219 ALA A C     1 
ATOM 416  O O     . ALA A 1 51 ? -12.491 -36.518 -3.591  1.00 51.60  ? 219 ALA A O     1 
ATOM 417  C CB    . ALA A 1 51 ? -10.053 -35.209 -1.688  1.00 51.21  ? 219 ALA A CB    1 
ATOM 418  N N     . ARG A 1 52 ? -12.861 -36.190 -1.377  1.00 52.34  ? 220 ARG A N     1 
ATOM 419  C CA    . ARG A 1 52 ? -13.743 -37.318 -1.242  1.00 53.28  ? 220 ARG A CA    1 
ATOM 420  C C     . ARG A 1 52 ? -14.858 -37.213 -2.271  1.00 53.26  ? 220 ARG A C     1 
ATOM 421  O O     . ARG A 1 52 ? -15.375 -38.229 -2.722  1.00 53.74  ? 220 ARG A O     1 
ATOM 422  C CB    . ARG A 1 52 ? -14.293 -37.387 0.170   1.00 53.75  ? 220 ARG A CB    1 
ATOM 423  C CG    . ARG A 1 52 ? -14.186 -38.766 0.817   1.00 56.05  ? 220 ARG A CG    1 
ATOM 424  C CD    . ARG A 1 52 ? -14.400 -38.718 2.332   1.00 59.94  ? 220 ARG A CD    1 
ATOM 425  N NE    . ARG A 1 52 ? -15.410 -37.725 2.727   1.00 63.77  ? 220 ARG A NE    1 
ATOM 426  C CZ    . ARG A 1 52 ? -15.186 -36.667 3.514   1.00 64.66  ? 220 ARG A CZ    1 
ATOM 427  N NH1   . ARG A 1 52 ? -13.980 -36.450 4.033   1.00 65.17  ? 220 ARG A NH1   1 
ATOM 428  N NH2   . ARG A 1 52 ? -16.177 -35.825 3.788   1.00 64.66  ? 220 ARG A NH2   1 
ATOM 429  N N     . GLY A 1 53 ? -15.176 -35.989 -2.686  1.00 53.00  ? 221 GLY A N     1 
ATOM 430  C CA    . GLY A 1 53 ? -16.260 -35.753 -3.641  1.00 52.80  ? 221 GLY A CA    1 
ATOM 431  C C     . GLY A 1 53 ? -15.802 -35.582 -5.068  1.00 53.03  ? 221 GLY A C     1 
ATOM 432  O O     . GLY A 1 53 ? -16.605 -35.313 -5.963  1.00 52.81  ? 221 GLY A O     1 
ATOM 433  N N     . LEU A 1 54 ? -14.497 -35.717 -5.282  1.00 53.27  ? 222 LEU A N     1 
ATOM 434  C CA    . LEU A 1 54 ? -13.938 -35.722 -6.632  1.00 53.06  ? 222 LEU A CA    1 
ATOM 435  C C     . LEU A 1 54 ? -13.129 -36.996 -6.836  1.00 52.98  ? 222 LEU A C     1 
ATOM 436  O O     . LEU A 1 54 ? -12.403 -37.142 -7.819  1.00 52.55  ? 222 LEU A O     1 
ATOM 437  C CB    . LEU A 1 54 ? -13.066 -34.485 -6.857  1.00 53.08  ? 222 LEU A CB    1 
ATOM 438  C CG    . LEU A 1 54 ? -13.684 -33.101 -6.694  1.00 52.47  ? 222 LEU A CG    1 
ATOM 439  C CD1   . LEU A 1 54 ? -12.601 -32.080 -6.926  1.00 52.57  ? 222 LEU A CD1   1 
ATOM 440  C CD2   . LEU A 1 54 ? -14.839 -32.878 -7.660  1.00 52.73  ? 222 LEU A CD2   1 
ATOM 441  N N     . LYS A 1 55 ? -13.288 -37.911 -5.881  1.00 53.32  ? 223 LYS A N     1 
ATOM 442  C CA    . LYS A 1 55 ? -12.582 -39.199 -5.834  1.00 53.66  ? 223 LYS A CA    1 
ATOM 443  C C     . LYS A 1 55 ? -11.107 -39.047 -6.194  1.00 53.13  ? 223 LYS A C     1 
ATOM 444  O O     . LYS A 1 55 ? -10.581 -39.731 -7.087  1.00 53.04  ? 223 LYS A O     1 
ATOM 445  C CB    . LYS A 1 55 ? -13.285 -40.281 -6.680  1.00 54.23  ? 223 LYS A CB    1 
ATOM 446  C CG    . LYS A 1 55 ? -14.634 -40.830 -6.089  1.00 56.34  ? 223 LYS A CG    1 
ATOM 447  C CD    . LYS A 1 55 ? -14.482 -41.575 -4.726  1.00 58.22  ? 223 LYS A CD    1 
ATOM 448  C CE    . LYS A 1 55 ? -13.971 -43.038 -4.889  1.00 59.96  ? 223 LYS A CE    1 
ATOM 449  N NZ    . LYS A 1 55 ? -14.340 -43.936 -3.734  1.00 58.05  ? 223 LYS A NZ    1 
ATOM 450  N N     . MET A 1 56 ? -10.470 -38.109 -5.496  1.00 52.10  ? 224 MET A N     1 
ATOM 451  C CA    . MET A 1 56 ? -9.042  -37.958 -5.509  1.00 51.29  ? 224 MET A CA    1 
ATOM 452  C C     . MET A 1 56 ? -8.596  -38.209 -4.096  1.00 51.28  ? 224 MET A C     1 
ATOM 453  O O     . MET A 1 56 ? -9.427  -38.225 -3.195  1.00 51.17  ? 224 MET A O     1 
ATOM 454  C CB    . MET A 1 56 ? -8.671  -36.542 -5.890  1.00 51.59  ? 224 MET A CB    1 
ATOM 455  C CG    . MET A 1 56 ? -9.285  -36.054 -7.167  1.00 51.17  ? 224 MET A CG    1 
ATOM 456  S SD    . MET A 1 56 ? -9.086  -34.280 -7.367  1.00 50.40  ? 224 MET A SD    1 
ATOM 457  C CE    . MET A 1 56 ? -7.359  -34.044 -6.957  1.00 49.41  ? 224 MET A CE    1 
ATOM 458  N N     . THR A 1 57 ? -7.295  -38.410 -3.898  1.00 51.42  ? 225 THR A N     1 
ATOM 459  C CA    . THR A 1 57 ? -6.717  -38.498 -2.549  1.00 51.73  ? 225 THR A CA    1 
ATOM 460  C C     . THR A 1 57 ? -6.546  -37.111 -1.927  1.00 52.00  ? 225 THR A C     1 
ATOM 461  O O     . THR A 1 57 ? -6.666  -36.069 -2.612  1.00 52.24  ? 225 THR A O     1 
ATOM 462  C CB    . THR A 1 57 ? -5.315  -39.139 -2.547  1.00 51.46  ? 225 THR A CB    1 
ATOM 463  O OG1   . THR A 1 57 ? -4.438  -38.347 -3.349  1.00 51.41  ? 225 THR A OG1   1 
ATOM 464  C CG2   . THR A 1 57 ? -5.356  -40.554 -3.087  1.00 50.96  ? 225 THR A CG2   1 
ATOM 465  N N     . ASP A 1 58 ? -6.241  -37.112 -0.632  1.00 51.84  ? 226 ASP A N     1 
ATOM 466  C CA    . ASP A 1 58 ? -5.898  -35.896 0.078   1.00 51.63  ? 226 ASP A CA    1 
ATOM 467  C C     . ASP A 1 58 ? -4.645  -35.237 -0.500  1.00 50.95  ? 226 ASP A C     1 
ATOM 468  O O     . ASP A 1 58 ? -4.684  -34.060 -0.924  1.00 50.80  ? 226 ASP A O     1 
ATOM 469  C CB    . ASP A 1 58 ? -5.692  -36.202 1.542   1.00 52.21  ? 226 ASP A CB    1 
ATOM 470  C CG    . ASP A 1 58 ? -6.764  -35.608 2.397   1.00 54.88  ? 226 ASP A CG    1 
ATOM 471  O OD1   . ASP A 1 58 ? -6.426  -34.701 3.202   1.00 58.94  ? 226 ASP A OD1   1 
ATOM 472  O OD2   . ASP A 1 58 ? -7.943  -36.017 2.249   1.00 57.01  ? 226 ASP A OD2   1 
ATOM 473  N N     . ALA A 1 59 ? -3.550  -36.004 -0.538  1.00 49.55  ? 227 ALA A N     1 
ATOM 474  C CA    . ALA A 1 59 ? -2.299  -35.531 -1.123  1.00 48.11  ? 227 ALA A CA    1 
ATOM 475  C C     . ALA A 1 59 ? -2.543  -34.857 -2.468  1.00 47.16  ? 227 ALA A C     1 
ATOM 476  O O     . ALA A 1 59 ? -2.012  -33.778 -2.725  1.00 47.28  ? 227 ALA A O     1 
ATOM 477  C CB    . ALA A 1 59 ? -1.300  -36.666 -1.258  1.00 48.08  ? 227 ALA A CB    1 
ATOM 478  N N     . GLN A 1 60 ? -3.382  -35.451 -3.305  1.00 45.66  ? 228 GLN A N     1 
ATOM 479  C CA    . GLN A 1 60 ? -3.586  -34.887 -4.623  1.00 45.17  ? 228 GLN A CA    1 
ATOM 480  C C     . GLN A 1 60 ? -4.190  -33.493 -4.626  1.00 44.28  ? 228 GLN A C     1 
ATOM 481  O O     . GLN A 1 60 ? -3.709  -32.622 -5.352  1.00 43.83  ? 228 GLN A O     1 
ATOM 482  C CB    . GLN A 1 60 ? -4.364  -35.831 -5.523  1.00 45.36  ? 228 GLN A CB    1 
ATOM 483  C CG    . GLN A 1 60 ? -3.449  -36.816 -6.208  1.00 48.19  ? 228 GLN A CG    1 
ATOM 484  C CD    . GLN A 1 60 ? -4.145  -38.079 -6.700  1.00 51.16  ? 228 GLN A CD    1 
ATOM 485  O OE1   . GLN A 1 60 ? -5.122  -38.556 -6.109  1.00 51.30  ? 228 GLN A OE1   1 
ATOM 486  N NE2   . GLN A 1 60 ? -3.633  -38.627 -7.800  1.00 51.99  ? 228 GLN A NE2   1 
ATOM 487  N N     . VAL A 1 61 ? -5.226  -33.277 -3.815  1.00 43.38  ? 229 VAL A N     1 
ATOM 488  C CA    . VAL A 1 61 ? -5.878  -31.964 -3.779  1.00 42.43  ? 229 VAL A CA    1 
ATOM 489  C C     . VAL A 1 61 ? -4.945  -30.963 -3.122  1.00 41.51  ? 229 VAL A C     1 
ATOM 490  O O     . VAL A 1 61 ? -4.728  -29.873 -3.648  1.00 40.82  ? 229 VAL A O     1 
ATOM 491  C CB    . VAL A 1 61 ? -7.272  -31.989 -3.084  1.00 42.73  ? 229 VAL A CB    1 
ATOM 492  C CG1   . VAL A 1 61 ? -7.818  -30.579 -2.900  1.00 42.77  ? 229 VAL A CG1   1 
ATOM 493  C CG2   . VAL A 1 61 ? -8.252  -32.776 -3.916  1.00 42.65  ? 229 VAL A CG2   1 
ATOM 494  N N     . LYS A 1 62 ? -4.369  -31.352 -1.994  1.00 40.60  ? 230 LYS A N     1 
ATOM 495  C CA    . LYS A 1 62 ? -3.387  -30.511 -1.371  1.00 40.43  ? 230 LYS A CA    1 
ATOM 496  C C     . LYS A 1 62 ? -2.300  -30.086 -2.347  1.00 40.51  ? 230 LYS A C     1 
ATOM 497  O O     . LYS A 1 62 ? -1.889  -28.921 -2.320  1.00 41.35  ? 230 LYS A O     1 
ATOM 498  C CB    . LYS A 1 62 ? -2.749  -31.182 -0.179  1.00 40.54  ? 230 LYS A CB    1 
ATOM 499  C CG    . LYS A 1 62 ? -1.670  -30.328 0.443   1.00 40.43  ? 230 LYS A CG    1 
ATOM 500  C CD    . LYS A 1 62 ? -1.123  -30.944 1.693   1.00 40.88  ? 230 LYS A CD    1 
ATOM 501  C CE    . LYS A 1 62 ? 0.245   -30.390 1.946   1.00 44.14  ? 230 LYS A CE    1 
ATOM 502  N NZ    . LYS A 1 62 ? 0.624   -30.609 3.366   1.00 49.12  ? 230 LYS A NZ    1 
ATOM 503  N N     . THR A 1 63 ? -1.837  -30.999 -3.206  1.00 39.70  ? 231 THR A N     1 
ATOM 504  C CA    . THR A 1 63 ? -0.707  -30.673 -4.091  1.00 38.62  ? 231 THR A CA    1 
ATOM 505  C C     . THR A 1 63 ? -1.189  -29.797 -5.222  1.00 38.04  ? 231 THR A C     1 
ATOM 506  O O     . THR A 1 63 ? -0.499  -28.852 -5.627  1.00 37.79  ? 231 THR A O     1 
ATOM 507  C CB    . THR A 1 63 ? 0.023   -31.932 -4.636  1.00 38.46  ? 231 THR A CB    1 
ATOM 508  O OG1   . THR A 1 63 ? 0.802   -32.490 -3.585  1.00 39.42  ? 231 THR A OG1   1 
ATOM 509  C CG2   . THR A 1 63 ? 0.977   -31.586 -5.760  1.00 37.32  ? 231 THR A CG2   1 
ATOM 510  N N     . TRP A 1 64 ? -2.380  -30.119 -5.720  1.00 37.28  ? 232 TRP A N     1 
ATOM 511  C CA    . TRP A 1 64 ? -2.996  -29.357 -6.788  1.00 36.75  ? 232 TRP A CA    1 
ATOM 512  C C     . TRP A 1 64 ? -3.151  -27.919 -6.340  1.00 37.35  ? 232 TRP A C     1 
ATOM 513  O O     . TRP A 1 64 ? -2.882  -26.979 -7.091  1.00 37.38  ? 232 TRP A O     1 
ATOM 514  C CB    . TRP A 1 64 ? -4.369  -29.914 -7.115  1.00 35.63  ? 232 TRP A CB    1 
ATOM 515  C CG    . TRP A 1 64 ? -4.888  -29.352 -8.372  1.00 34.92  ? 232 TRP A CG    1 
ATOM 516  C CD1   . TRP A 1 64 ? -4.723  -29.863 -9.623  1.00 33.46  ? 232 TRP A CD1   1 
ATOM 517  C CD2   . TRP A 1 64 ? -5.631  -28.143 -8.525  1.00 34.01  ? 232 TRP A CD2   1 
ATOM 518  N NE1   . TRP A 1 64 ? -5.321  -29.052 -10.544 1.00 33.62  ? 232 TRP A NE1   1 
ATOM 519  C CE2   . TRP A 1 64 ? -5.885  -27.985 -9.898  1.00 33.09  ? 232 TRP A CE2   1 
ATOM 520  C CE3   . TRP A 1 64 ? -6.096  -27.174 -7.635  1.00 33.69  ? 232 TRP A CE3   1 
ATOM 521  C CZ2   . TRP A 1 64 ? -6.589  -26.905 -10.407 1.00 33.08  ? 232 TRP A CZ2   1 
ATOM 522  C CZ3   . TRP A 1 64 ? -6.782  -26.104 -8.139  1.00 33.94  ? 232 TRP A CZ3   1 
ATOM 523  C CH2   . TRP A 1 64 ? -7.034  -25.981 -9.516  1.00 34.12  ? 232 TRP A CH2   1 
ATOM 524  N N     . PHE A 1 65 ? -3.590  -27.761 -5.098  1.00 38.08  ? 233 PHE A N     1 
ATOM 525  C CA    . PHE A 1 65 ? -3.814  -26.459 -4.579  1.00 38.40  ? 233 PHE A CA    1 
ATOM 526  C C     . PHE A 1 65 ? -2.492  -25.744 -4.489  1.00 39.35  ? 233 PHE A C     1 
ATOM 527  O O     . PHE A 1 65 ? -2.350  -24.648 -5.046  1.00 40.19  ? 233 PHE A O     1 
ATOM 528  C CB    . PHE A 1 65 ? -4.674  -26.484 -3.305  1.00 38.10  ? 233 PHE A CB    1 
ATOM 529  C CG    . PHE A 1 65 ? -6.105  -26.129 -3.594  1.00 38.10  ? 233 PHE A CG    1 
ATOM 530  C CD1   . PHE A 1 65 ? -6.970  -27.072 -4.140  1.00 37.68  ? 233 PHE A CD1   1 
ATOM 531  C CD2   . PHE A 1 65 ? -6.557  -24.810 -3.456  1.00 37.74  ? 233 PHE A CD2   1 
ATOM 532  C CE1   . PHE A 1 65 ? -8.280  -26.721 -4.494  1.00 37.16  ? 233 PHE A CE1   1 
ATOM 533  C CE2   . PHE A 1 65 ? -7.855  -24.457 -3.802  1.00 36.93  ? 233 PHE A CE2   1 
ATOM 534  C CZ    . PHE A 1 65 ? -8.718  -25.423 -4.323  1.00 37.25  ? 233 PHE A CZ    1 
ATOM 535  N N     . GLN A 1 66 ? -1.493  -26.388 -3.899  1.00 39.53  ? 234 GLN A N     1 
ATOM 536  C CA    . GLN A 1 66 ? -0.170  -25.766 -3.862  1.00 40.00  ? 234 GLN A CA    1 
ATOM 537  C C     . GLN A 1 66 ? 0.332   -25.376 -5.248  1.00 39.89  ? 234 GLN A C     1 
ATOM 538  O O     . GLN A 1 66 ? 0.882   -24.287 -5.412  1.00 40.34  ? 234 GLN A O     1 
ATOM 539  C CB    . GLN A 1 66 ? 0.867   -26.626 -3.118  1.00 40.04  ? 234 GLN A CB    1 
ATOM 540  C CG    . GLN A 1 66 ? 2.184   -25.901 -2.770  1.00 41.48  ? 234 GLN A CG    1 
ATOM 541  C CD    . GLN A 1 66 ? 2.008   -24.466 -2.181  1.00 44.11  ? 234 GLN A CD    1 
ATOM 542  O OE1   . GLN A 1 66 ? 1.272   -24.260 -1.214  1.00 45.20  ? 234 GLN A OE1   1 
ATOM 543  N NE2   . GLN A 1 66 ? 2.714   -23.487 -2.764  1.00 43.35  ? 234 GLN A NE2   1 
ATOM 544  N N     . ASN A 1 67 ? 0.133   -26.235 -6.246  1.00 39.63  ? 235 ASN A N     1 
ATOM 545  C CA    . ASN A 1 67 ? 0.687   -25.954 -7.578  1.00 39.01  ? 235 ASN A CA    1 
ATOM 546  C C     . ASN A 1 67 ? -0.083  -24.845 -8.261  1.00 39.19  ? 235 ASN A C     1 
ATOM 547  O O     . ASN A 1 67 ? 0.512   -24.031 -8.990  1.00 39.70  ? 235 ASN A O     1 
ATOM 548  C CB    . ASN A 1 67 ? 0.809   -27.207 -8.452  1.00 38.10  ? 235 ASN A CB    1 
ATOM 549  C CG    . ASN A 1 67 ? 2.004   -28.076 -8.061  1.00 39.05  ? 235 ASN A CG    1 
ATOM 550  O OD1   . ASN A 1 67 ? 3.018   -27.579 -7.587  1.00 38.88  ? 235 ASN A OD1   1 
ATOM 551  N ND2   . ASN A 1 67 ? 1.879   -29.385 -8.244  1.00 40.77  ? 235 ASN A ND2   1 
ATOM 552  N N     . ARG A 1 68 ? -1.387  -24.791 -7.993  1.00 38.92  ? 236 ARG A N     1 
ATOM 553  C CA    . ARG A 1 68 ? -2.237  -23.718 -8.496  1.00 39.54  ? 236 ARG A CA    1 
ATOM 554  C C     . ARG A 1 68 ? -1.786  -22.339 -7.979  1.00 39.65  ? 236 ARG A C     1 
ATOM 555  O O     . ARG A 1 68 ? -1.627  -21.410 -8.766  1.00 39.78  ? 236 ARG A O     1 
ATOM 556  C CB    . ARG A 1 68 ? -3.694  -23.974 -8.113  1.00 39.75  ? 236 ARG A CB    1 
ATOM 557  C CG    . ARG A 1 68 ? -4.740  -23.099 -8.804  1.00 41.64  ? 236 ARG A CG    1 
ATOM 558  C CD    . ARG A 1 68 ? -4.755  -23.221 -10.315 1.00 45.42  ? 236 ARG A CD    1 
ATOM 559  N NE    . ARG A 1 68 ? -4.315  -21.977 -10.932 1.00 51.30  ? 236 ARG A NE    1 
ATOM 560  C CZ    . ARG A 1 68 ? -5.133  -21.018 -11.369 1.00 53.72  ? 236 ARG A CZ    1 
ATOM 561  N NH1   . ARG A 1 68 ? -6.441  -21.158 -11.271 1.00 55.12  ? 236 ARG A NH1   1 
ATOM 562  N NH2   . ARG A 1 68 ? -4.646  -19.921 -11.934 1.00 54.93  ? 236 ARG A NH2   1 
ATOM 563  N N     . ARG A 1 69 ? -1.567  -22.221 -6.669  1.00 39.37  ? 237 ARG A N     1 
ATOM 564  C CA    . ARG A 1 69 ? -1.111  -20.977 -6.064  1.00 39.29  ? 237 ARG A CA    1 
ATOM 565  C C     . ARG A 1 69 ? 0.214   -20.504 -6.662  1.00 40.04  ? 237 ARG A C     1 
ATOM 566  O O     . ARG A 1 69 ? 0.434   -19.298 -6.869  1.00 39.45  ? 237 ARG A O     1 
ATOM 567  C CB    . ARG A 1 69 ? -0.984  -21.140 -4.549  1.00 38.83  ? 237 ARG A CB    1 
ATOM 568  C CG    . ARG A 1 69 ? -2.288  -20.998 -3.818  1.00 37.99  ? 237 ARG A CG    1 
ATOM 569  C CD    . ARG A 1 69 ? -2.095  -20.884 -2.328  1.00 36.81  ? 237 ARG A CD    1 
ATOM 570  N NE    . ARG A 1 69 ? -1.518  -22.093 -1.758  1.00 38.75  ? 237 ARG A NE    1 
ATOM 571  C CZ    . ARG A 1 69 ? -2.238  -23.089 -1.239  1.00 39.89  ? 237 ARG A CZ    1 
ATOM 572  N NH1   . ARG A 1 69 ? -3.563  -23.018 -1.215  1.00 40.20  ? 237 ARG A NH1   1 
ATOM 573  N NH2   . ARG A 1 69 ? -1.637  -24.161 -0.745  1.00 37.97  ? 237 ARG A NH2   1 
ATOM 574  N N     . THR A 1 70 ? 1.094   -21.458 -6.953  1.00 40.73  ? 238 THR A N     1 
ATOM 575  C CA    . THR A 1 70 ? 2.367   -21.110 -7.549  1.00 41.90  ? 238 THR A CA    1 
ATOM 576  C C     . THR A 1 70 ? 2.093   -20.443 -8.893  1.00 43.64  ? 238 THR A C     1 
ATOM 577  O O     . THR A 1 70 ? 2.620   -19.358 -9.172  1.00 43.79  ? 238 THR A O     1 
ATOM 578  C CB    . THR A 1 70 ? 3.283   -22.333 -7.698  1.00 41.40  ? 238 THR A CB    1 
ATOM 579  O OG1   . THR A 1 70 ? 3.706   -22.750 -6.402  1.00 41.89  ? 238 THR A OG1   1 
ATOM 580  C CG2   . THR A 1 70 ? 4.493   -22.007 -8.510  1.00 38.94  ? 238 THR A CG2   1 
ATOM 581  N N     . LYS A 1 71 ? 1.238   -21.084 -9.697  1.00 45.04  ? 239 LYS A N     1 
ATOM 582  C CA    . LYS A 1 71 ? 0.856   -20.572 -11.004 1.00 46.46  ? 239 LYS A CA    1 
ATOM 583  C C     . LYS A 1 71 ? 0.203   -19.209 -10.834 1.00 47.39  ? 239 LYS A C     1 
ATOM 584  O O     . LYS A 1 71 ? 0.488   -18.287 -11.573 1.00 47.57  ? 239 LYS A O     1 
ATOM 585  C CB    . LYS A 1 71 ? -0.076  -21.570 -11.683 1.00 46.32  ? 239 LYS A CB    1 
ATOM 586  C CG    . LYS A 1 71 ? -0.781  -21.104 -12.943 1.00 47.62  ? 239 LYS A CG    1 
ATOM 587  C CD    . LYS A 1 71 ? -1.753  -22.166 -13.487 1.00 46.96  ? 239 LYS A CD    1 
ATOM 588  C CE    . LYS A 1 71 ? -2.199  -21.804 -14.898 1.00 47.99  ? 239 LYS A CE    1 
ATOM 589  N NZ    . LYS A 1 71 ? -2.256  -23.021 -15.767 1.00 49.62  ? 239 LYS A NZ    1 
ATOM 590  N N     . TRP A 1 72 ? -0.624  -19.082 -9.812  1.00 49.03  ? 240 TRP A N     1 
ATOM 591  C CA    . TRP A 1 72 ? -1.413  -17.888 -9.596  1.00 50.95  ? 240 TRP A CA    1 
ATOM 592  C C     . TRP A 1 72 ? -0.510  -16.686 -9.350  1.00 52.53  ? 240 TRP A C     1 
ATOM 593  O O     . TRP A 1 72 ? -0.618  -15.692 -10.046 1.00 52.78  ? 240 TRP A O     1 
ATOM 594  C CB    . TRP A 1 72 ? -2.388  -18.132 -8.443  1.00 50.54  ? 240 TRP A CB    1 
ATOM 595  C CG    . TRP A 1 72 ? -3.070  -16.933 -7.908  1.00 50.69  ? 240 TRP A CG    1 
ATOM 596  C CD1   . TRP A 1 72 ? -3.712  -15.954 -8.624  1.00 50.86  ? 240 TRP A CD1   1 
ATOM 597  C CD2   . TRP A 1 72 ? -3.224  -16.586 -6.524  1.00 49.96  ? 240 TRP A CD2   1 
ATOM 598  N NE1   . TRP A 1 72 ? -4.242  -15.011 -7.764  1.00 50.46  ? 240 TRP A NE1   1 
ATOM 599  C CE2   . TRP A 1 72 ? -3.957  -15.373 -6.474  1.00 49.20  ? 240 TRP A CE2   1 
ATOM 600  C CE3   . TRP A 1 72 ? -2.803  -17.175 -5.322  1.00 49.66  ? 240 TRP A CE3   1 
ATOM 601  C CZ2   . TRP A 1 72 ? -4.283  -14.744 -5.276  1.00 49.59  ? 240 TRP A CZ2   1 
ATOM 602  C CZ3   . TRP A 1 72 ? -3.134  -16.550 -4.116  1.00 50.31  ? 240 TRP A CZ3   1 
ATOM 603  C CH2   . TRP A 1 72 ? -3.866  -15.347 -4.105  1.00 50.69  ? 240 TRP A CH2   1 
ATOM 604  N N     . ARG A 1 73 ? 0.395   -16.801 -8.380  1.00 54.70  ? 241 ARG A N     1 
ATOM 605  C CA    . ARG A 1 73 ? 1.368   -15.754 -8.077  1.00 56.21  ? 241 ARG A CA    1 
ATOM 606  C C     . ARG A 1 73 ? 2.284   -15.467 -9.254  1.00 57.78  ? 241 ARG A C     1 
ATOM 607  O O     . ARG A 1 73 ? 2.430   -14.327 -9.667  1.00 58.09  ? 241 ARG A O     1 
ATOM 608  C CB    . ARG A 1 73 ? 2.183   -16.140 -6.856  1.00 55.73  ? 241 ARG A CB    1 
ATOM 609  C CG    . ARG A 1 73 ? 1.418   -15.938 -5.597  1.00 56.03  ? 241 ARG A CG    1 
ATOM 610  C CD    . ARG A 1 73 ? 2.293   -16.060 -4.409  1.00 55.75  ? 241 ARG A CD    1 
ATOM 611  N NE    . ARG A 1 73 ? 2.222   -17.408 -3.871  1.00 58.04  ? 241 ARG A NE    1 
ATOM 612  C CZ    . ARG A 1 73 ? 1.324   -17.832 -2.979  1.00 59.00  ? 241 ARG A CZ    1 
ATOM 613  N NH1   . ARG A 1 73 ? 0.378   -17.019 -2.503  1.00 60.15  ? 241 ARG A NH1   1 
ATOM 614  N NH2   . ARG A 1 73 ? 1.370   -19.088 -2.565  1.00 59.01  ? 241 ARG A NH2   1 
ATOM 615  N N     . ARG A 1 74 ? 2.884   -16.507 -9.808  1.00 59.95  ? 242 ARG A N     1 
ATOM 616  C CA    . ARG A 1 74 ? 3.737   -16.354 -10.971 1.00 62.44  ? 242 ARG A CA    1 
ATOM 617  C C     . ARG A 1 74 ? 2.987   -15.642 -12.091 1.00 64.07  ? 242 ARG A C     1 
ATOM 618  O O     . ARG A 1 74 ? 3.607   -15.075 -12.992 1.00 64.58  ? 242 ARG A O     1 
ATOM 619  C CB    . ARG A 1 74 ? 4.227   -17.716 -11.452 1.00 62.34  ? 242 ARG A CB    1 
ATOM 620  C CG    . ARG A 1 74 ? 5.279   -17.679 -12.548 1.00 62.56  ? 242 ARG A CG    1 
ATOM 621  C CD    . ARG A 1 74 ? 5.596   -19.102 -13.046 1.00 63.05  ? 242 ARG A CD    1 
ATOM 622  N NE    . ARG A 1 74 ? 4.440   -19.750 -13.667 1.00 63.20  ? 242 ARG A NE    1 
ATOM 623  C CZ    . ARG A 1 74 ? 3.988   -19.474 -14.887 1.00 63.33  ? 242 ARG A CZ    1 
ATOM 624  N NH1   . ARG A 1 74 ? 4.589   -18.558 -15.637 1.00 63.80  ? 242 ARG A NH1   1 
ATOM 625  N NH2   . ARG A 1 74 ? 2.926   -20.112 -15.358 1.00 62.97  ? 242 ARG A NH2   1 
ATOM 626  N N     . GLN A 1 75 ? 1.660   -15.676 -12.049 1.00 65.73  ? 243 GLN A N     1 
ATOM 627  C CA    . GLN A 1 75 ? 0.889   -14.915 -13.017 1.00 67.46  ? 243 GLN A CA    1 
ATOM 628  C C     . GLN A 1 75 ? 0.658   -13.516 -12.486 1.00 68.77  ? 243 GLN A C     1 
ATOM 629  O O     . GLN A 1 75 ? 1.001   -12.549 -13.169 1.00 68.95  ? 243 GLN A O     1 
ATOM 630  C CB    . GLN A 1 75 ? -0.423  -15.607 -13.392 1.00 67.28  ? 243 GLN A CB    1 
ATOM 631  C CG    . GLN A 1 75 ? -0.362  -16.387 -14.725 1.00 68.16  ? 243 GLN A CG    1 
ATOM 632  C CD    . GLN A 1 75 ? -1.292  -17.615 -14.767 1.00 69.44  ? 243 GLN A CD    1 
ATOM 633  O OE1   . GLN A 1 75 ? -2.219  -17.742 -13.958 1.00 70.00  ? 243 GLN A OE1   1 
ATOM 634  N NE2   . GLN A 1 75 ? -1.029  -18.531 -15.708 1.00 69.57  ? 243 GLN A NE2   1 
ATOM 635  N N     . THR A 1 76 ? 0.100   -13.418 -11.271 1.00 70.26  ? 244 THR A N     1 
ATOM 636  C CA    . THR A 1 76 ? -0.167  -12.139 -10.615 1.00 71.79  ? 244 THR A CA    1 
ATOM 637  C C     . THR A 1 76 ? 1.014   -11.241 -10.920 1.00 73.14  ? 244 THR A C     1 
ATOM 638  O O     . THR A 1 76 ? 0.976   -10.442 -11.862 1.00 73.45  ? 244 THR A O     1 
ATOM 639  C CB    . THR A 1 76 ? -0.311  -12.259 -9.057  1.00 71.83  ? 244 THR A CB    1 
ATOM 640  O OG1   . THR A 1 76 ? -1.108  -13.398 -8.702  1.00 72.98  ? 244 THR A OG1   1 
ATOM 641  C CG2   . THR A 1 76 ? -0.942  -10.999 -8.448  1.00 71.41  ? 244 THR A CG2   1 
ATOM 642  N N     . ALA A 1 77 ? 2.089   -11.419 -10.156 1.00 74.49  ? 245 ALA A N     1 
ATOM 643  C CA    . ALA A 1 77 ? 3.257   -10.567 -10.271 1.00 75.67  ? 245 ALA A CA    1 
ATOM 644  C C     . ALA A 1 77 ? 4.076   -10.771 -11.567 1.00 76.65  ? 245 ALA A C     1 
ATOM 645  O O     . ALA A 1 77 ? 5.232   -10.344 -11.623 1.00 77.14  ? 245 ALA A O     1 
ATOM 646  C CB    . ALA A 1 77 ? 4.134   -10.706 -9.017  1.00 75.45  ? 245 ALA A CB    1 
ATOM 647  N N     . GLU A 1 78 ? 3.495   -11.397 -12.600 1.00 77.56  ? 246 GLU A N     1 
ATOM 648  C CA    . GLU A 1 78 ? 4.157   -11.472 -13.927 1.00 78.38  ? 246 GLU A CA    1 
ATOM 649  C C     . GLU A 1 78 ? 3.599   -10.405 -14.885 1.00 79.13  ? 246 GLU A C     1 
ATOM 650  O O     . GLU A 1 78 ? 3.041   -10.725 -15.938 1.00 79.46  ? 246 GLU A O     1 
ATOM 651  C CB    . GLU A 1 78 ? 4.072   -12.891 -14.550 1.00 78.45  ? 246 GLU A CB    1 
ATOM 652  C CG    . GLU A 1 78 ? 5.170   -13.253 -15.606 1.00 77.79  ? 246 GLU A CG    1 
ATOM 653  C CD    . GLU A 1 78 ? 5.200   -14.753 -16.002 1.00 78.25  ? 246 GLU A CD    1 
ATOM 654  O OE1   . GLU A 1 78 ? 4.267   -15.500 -15.632 1.00 79.09  ? 246 GLU A OE1   1 
ATOM 655  O OE2   . GLU A 1 78 ? 6.155   -15.196 -16.691 1.00 76.47  ? 246 GLU A OE2   1 
ATOM 656  N N     . GLU A 1 79 ? 3.754   -9.135  -14.509 1.00 79.79  ? 247 GLU A N     1 
ATOM 657  C CA    . GLU A 1 79 ? 3.350   -8.009  -15.367 1.00 80.21  ? 247 GLU A CA    1 
ATOM 658  C C     . GLU A 1 79 ? 4.546   -7.212  -15.909 1.00 80.45  ? 247 GLU A C     1 
ATOM 659  O O     . GLU A 1 79 ? 5.617   -7.160  -15.289 1.00 80.52  ? 247 GLU A O     1 
ATOM 660  C CB    . GLU A 1 79 ? 2.380   -7.084  -14.622 1.00 80.29  ? 247 GLU A CB    1 
ATOM 661  C CG    . GLU A 1 79 ? 2.711   -6.875  -13.142 1.00 80.01  ? 247 GLU A CG    1 
ATOM 662  C CD    . GLU A 1 79 ? 1.470   -6.948  -12.272 1.00 79.56  ? 247 GLU A CD    1 
ATOM 663  O OE1   . GLU A 1 79 ? 1.594   -6.887  -11.026 1.00 78.60  ? 247 GLU A OE1   1 
ATOM 664  O OE2   . GLU A 1 79 ? 0.366   -7.083  -12.846 1.00 79.24  ? 247 GLU A OE2   1 
ATOM 665  N N     . ARG B 2 7  ? -1.142  -22.332 -31.148 1.00 76.79  ? 86  ARG B N     1 
ATOM 666  C CA    . ARG B 2 7  ? -1.410  -20.868 -31.095 1.00 76.81  ? 86  ARG B CA    1 
ATOM 667  C C     . ARG B 2 7  ? -1.248  -20.308 -29.663 1.00 76.02  ? 86  ARG B C     1 
ATOM 668  O O     . ARG B 2 7  ? -1.255  -19.082 -29.466 1.00 76.19  ? 86  ARG B O     1 
ATOM 669  C CB    . ARG B 2 7  ? -2.793  -20.564 -31.684 1.00 76.93  ? 86  ARG B CB    1 
ATOM 670  C CG    . ARG B 2 7  ? -2.941  -19.161 -32.268 1.00 77.48  ? 86  ARG B CG    1 
ATOM 671  C CD    . ARG B 2 7  ? -4.164  -19.028 -33.199 1.00 78.09  ? 86  ARG B CD    1 
ATOM 672  N NE    . ARG B 2 7  ? -5.359  -19.778 -32.770 1.00 80.47  ? 86  ARG B NE    1 
ATOM 673  C CZ    . ARG B 2 7  ? -6.036  -19.589 -31.632 1.00 80.80  ? 86  ARG B CZ    1 
ATOM 674  N NH1   . ARG B 2 7  ? -5.641  -18.685 -30.742 1.00 80.88  ? 86  ARG B NH1   1 
ATOM 675  N NH2   . ARG B 2 7  ? -7.107  -20.331 -31.370 1.00 81.13  ? 86  ARG B NH2   1 
ATOM 676  N N     . ARG B 2 8  ? -1.092  -21.207 -28.683 1.00 74.90  ? 87  ARG B N     1 
ATOM 677  C CA    . ARG B 2 8  ? -0.620  -20.862 -27.327 1.00 73.69  ? 87  ARG B CA    1 
ATOM 678  C C     . ARG B 2 8  ? 0.699   -20.049 -27.417 1.00 73.29  ? 87  ARG B C     1 
ATOM 679  O O     . ARG B 2 8  ? 1.538   -20.334 -28.288 1.00 73.19  ? 87  ARG B O     1 
ATOM 680  C CB    . ARG B 2 8  ? -0.418  -22.155 -26.512 1.00 73.83  ? 87  ARG B CB    1 
ATOM 681  C CG    . ARG B 2 8  ? 0.264   -22.006 -25.139 1.00 73.25  ? 87  ARG B CG    1 
ATOM 682  C CD    . ARG B 2 8  ? 0.382   -23.347 -24.411 1.00 72.57  ? 87  ARG B CD    1 
ATOM 683  N NE    . ARG B 2 8  ? 1.509   -24.169 -24.855 1.00 70.37  ? 87  ARG B NE    1 
ATOM 684  C CZ    . ARG B 2 8  ? 1.753   -25.411 -24.422 1.00 69.64  ? 87  ARG B CZ    1 
ATOM 685  N NH1   . ARG B 2 8  ? 0.951   -25.980 -23.533 1.00 68.66  ? 87  ARG B NH1   1 
ATOM 686  N NH2   . ARG B 2 8  ? 2.802   -26.094 -24.872 1.00 68.43  ? 87  ARG B NH2   1 
ATOM 687  N N     . TYR B 2 9  ? 0.891   -19.057 -26.538 1.00 72.09  ? 88  TYR B N     1 
ATOM 688  C CA    . TYR B 2 9  ? 2.113   -18.239 -26.591 1.00 71.15  ? 88  TYR B CA    1 
ATOM 689  C C     . TYR B 2 9  ? 3.387   -19.095 -26.551 1.00 70.05  ? 88  TYR B C     1 
ATOM 690  O O     . TYR B 2 9  ? 3.379   -20.196 -25.998 1.00 70.08  ? 88  TYR B O     1 
ATOM 691  C CB    . TYR B 2 9  ? 2.142   -17.157 -25.502 1.00 71.62  ? 88  TYR B CB    1 
ATOM 692  C CG    . TYR B 2 9  ? 3.280   -16.172 -25.709 1.00 72.65  ? 88  TYR B CG    1 
ATOM 693  C CD1   . TYR B 2 9  ? 3.479   -15.566 -26.951 1.00 72.72  ? 88  TYR B CD1   1 
ATOM 694  C CD2   . TYR B 2 9  ? 4.172   -15.859 -24.673 1.00 73.96  ? 88  TYR B CD2   1 
ATOM 695  C CE1   . TYR B 2 9  ? 4.534   -14.674 -27.164 1.00 73.66  ? 88  TYR B CE1   1 
ATOM 696  C CE2   . TYR B 2 9  ? 5.235   -14.958 -24.877 1.00 73.84  ? 88  TYR B CE2   1 
ATOM 697  C CZ    . TYR B 2 9  ? 5.405   -14.373 -26.129 1.00 73.28  ? 88  TYR B CZ    1 
ATOM 698  O OH    . TYR B 2 9  ? 6.432   -13.487 -26.367 1.00 72.84  ? 88  TYR B OH    1 
ATOM 699  N N     . ARG B 2 10 ? 4.463   -18.598 -27.162 1.00 68.58  ? 89  ARG B N     1 
ATOM 700  C CA    . ARG B 2 10 ? 5.722   -19.339 -27.253 1.00 67.18  ? 89  ARG B CA    1 
ATOM 701  C C     . ARG B 2 10 ? 6.888   -18.406 -27.516 1.00 66.60  ? 89  ARG B C     1 
ATOM 702  O O     . ARG B 2 10 ? 7.031   -17.911 -28.626 1.00 66.81  ? 89  ARG B O     1 
ATOM 703  C CB    . ARG B 2 10 ? 5.636   -20.355 -28.386 1.00 67.04  ? 89  ARG B CB    1 
ATOM 704  C CG    . ARG B 2 10 ? 6.310   -21.675 -28.100 1.00 65.63  ? 89  ARG B CG    1 
ATOM 705  C CD    . ARG B 2 10 ? 7.626   -21.872 -28.848 1.00 62.47  ? 89  ARG B CD    1 
ATOM 706  N NE    . ARG B 2 10 ? 8.017   -23.276 -28.723 1.00 60.63  ? 89  ARG B NE    1 
ATOM 707  C CZ    . ARG B 2 10 ? 9.230   -23.763 -28.957 1.00 60.20  ? 89  ARG B CZ    1 
ATOM 708  N NH1   . ARG B 2 10 ? 10.220  -22.957 -29.348 1.00 60.86  ? 89  ARG B NH1   1 
ATOM 709  N NH2   . ARG B 2 10 ? 9.451   -25.064 -28.784 1.00 58.09  ? 89  ARG B NH2   1 
ATOM 710  N N     . THR B 2 11 ? 7.724   -18.177 -26.503 1.00 65.76  ? 90  THR B N     1 
ATOM 711  C CA    . THR B 2 11 ? 8.827   -17.228 -26.616 1.00 64.98  ? 90  THR B CA    1 
ATOM 712  C C     . THR B 2 11 ? 9.878   -17.721 -27.600 1.00 64.74  ? 90  THR B C     1 
ATOM 713  O O     . THR B 2 11 ? 10.351  -18.858 -27.504 1.00 64.77  ? 90  THR B O     1 
ATOM 714  C CB    . THR B 2 11 ? 9.516   -16.935 -25.244 1.00 65.02  ? 90  THR B CB    1 
ATOM 715  O OG1   . THR B 2 11 ? 8.557   -16.969 -24.179 1.00 64.93  ? 90  THR B OG1   1 
ATOM 716  C CG2   . THR B 2 11 ? 10.190  -15.562 -25.252 1.00 64.35  ? 90  THR B CG2   1 
ATOM 717  N N     . THR B 2 12 ? 10.217  -16.868 -28.566 1.00 64.35  ? 91  THR B N     1 
ATOM 718  C CA    . THR B 2 12 ? 11.423  -17.055 -29.377 1.00 63.80  ? 91  THR B CA    1 
ATOM 719  C C     . THR B 2 12 ? 12.509  -16.131 -28.815 1.00 63.01  ? 91  THR B C     1 
ATOM 720  O O     . THR B 2 12 ? 12.318  -14.916 -28.709 1.00 62.81  ? 91  THR B O     1 
ATOM 721  C CB    . THR B 2 12 ? 11.175  -16.751 -30.874 1.00 64.16  ? 91  THR B CB    1 
ATOM 722  O OG1   . THR B 2 12 ? 10.437  -15.528 -30.991 1.00 65.08  ? 91  THR B OG1   1 
ATOM 723  C CG2   . THR B 2 12 ? 10.391  -17.901 -31.563 1.00 64.07  ? 91  THR B CG2   1 
ATOM 724  N N     . PHE B 2 13 ? 13.634  -16.711 -28.410 1.00 62.17  ? 92  PHE B N     1 
ATOM 725  C CA    . PHE B 2 13 ? 14.713  -15.918 -27.823 1.00 61.27  ? 92  PHE B CA    1 
ATOM 726  C C     . PHE B 2 13 ? 15.549  -15.261 -28.918 1.00 61.28  ? 92  PHE B C     1 
ATOM 727  O O     . PHE B 2 13 ? 15.848  -15.888 -29.939 1.00 61.13  ? 92  PHE B O     1 
ATOM 728  C CB    . PHE B 2 13 ? 15.628  -16.773 -26.942 1.00 60.49  ? 92  PHE B CB    1 
ATOM 729  C CG    . PHE B 2 13 ? 14.917  -17.517 -25.855 1.00 58.90  ? 92  PHE B CG    1 
ATOM 730  C CD1   . PHE B 2 13 ? 14.495  -16.864 -24.709 1.00 56.13  ? 92  PHE B CD1   1 
ATOM 731  C CD2   . PHE B 2 13 ? 14.698  -18.897 -25.969 1.00 58.89  ? 92  PHE B CD2   1 
ATOM 732  C CE1   . PHE B 2 13 ? 13.845  -17.553 -23.695 1.00 55.54  ? 92  PHE B CE1   1 
ATOM 733  C CE2   . PHE B 2 13 ? 14.040  -19.602 -24.962 1.00 57.30  ? 92  PHE B CE2   1 
ATOM 734  C CZ    . PHE B 2 13 ? 13.612  -18.919 -23.818 1.00 57.67  ? 92  PHE B CZ    1 
ATOM 735  N N     . THR B 2 14 ? 15.929  -14.004 -28.702 1.00 61.17  ? 93  THR B N     1 
ATOM 736  C CA    . THR B 2 14 ? 16.917  -13.351 -29.558 1.00 61.07  ? 93  THR B CA    1 
ATOM 737  C C     . THR B 2 14 ? 18.193  -14.183 -29.546 1.00 61.04  ? 93  THR B C     1 
ATOM 738  O O     . THR B 2 14 ? 18.421  -14.998 -28.645 1.00 60.93  ? 93  THR B O     1 
ATOM 739  C CB    . THR B 2 14 ? 17.253  -11.886 -29.109 1.00 61.27  ? 93  THR B CB    1 
ATOM 740  O OG1   . THR B 2 14 ? 17.979  -11.893 -27.874 1.00 61.10  ? 93  THR B OG1   1 
ATOM 741  C CG2   . THR B 2 14 ? 15.986  -11.024 -28.941 1.00 61.53  ? 93  THR B CG2   1 
ATOM 742  N N     . SER B 2 15 ? 19.025  -13.983 -30.557 1.00 61.36  ? 94  SER B N     1 
ATOM 743  C CA    . SER B 2 15 ? 20.331  -14.630 -30.604 1.00 61.16  ? 94  SER B CA    1 
ATOM 744  C C     . SER B 2 15 ? 21.258  -14.093 -29.516 1.00 60.59  ? 94  SER B C     1 
ATOM 745  O O     . SER B 2 15 ? 22.216  -14.765 -29.143 1.00 61.03  ? 94  SER B O     1 
ATOM 746  C CB    . SER B 2 15 ? 20.966  -14.467 -31.981 1.00 61.19  ? 94  SER B CB    1 
ATOM 747  O OG    . SER B 2 15 ? 22.133  -15.261 -32.069 1.00 62.49  ? 94  SER B OG    1 
ATOM 748  N N     . PHE B 2 16 ? 20.964  -12.890 -29.022 1.00 59.85  ? 95  PHE B N     1 
ATOM 749  C CA    . PHE B 2 16 ? 21.702  -12.287 -27.927 1.00 59.06  ? 95  PHE B CA    1 
ATOM 750  C C     . PHE B 2 16 ? 21.316  -12.893 -26.591 1.00 59.04  ? 95  PHE B C     1 
ATOM 751  O O     . PHE B 2 16 ? 22.178  -13.210 -25.770 1.00 59.13  ? 95  PHE B O     1 
ATOM 752  C CB    . PHE B 2 16 ? 21.486  -10.772 -27.881 1.00 58.87  ? 95  PHE B CB    1 
ATOM 753  C CG    . PHE B 2 16 ? 21.941  -10.130 -26.584 1.00 58.48  ? 95  PHE B CG    1 
ATOM 754  C CD1   . PHE B 2 16 ? 23.279  -10.171 -26.195 1.00 58.40  ? 95  PHE B CD1   1 
ATOM 755  C CD2   . PHE B 2 16 ? 21.034  -9.481  -25.758 1.00 58.15  ? 95  PHE B CD2   1 
ATOM 756  C CE1   . PHE B 2 16 ? 23.702  -9.589  -24.996 1.00 58.84  ? 95  PHE B CE1   1 
ATOM 757  C CE2   . PHE B 2 16 ? 21.445  -8.881  -24.571 1.00 58.81  ? 95  PHE B CE2   1 
ATOM 758  C CZ    . PHE B 2 16 ? 22.781  -8.940  -24.186 1.00 59.61  ? 95  PHE B CZ    1 
ATOM 759  N N     . GLN B 2 17 ? 20.021  -13.026 -26.341 1.00 58.85  ? 96  GLN B N     1 
ATOM 760  C CA    . GLN B 2 17 ? 19.608  -13.604 -25.078 1.00 58.71  ? 96  GLN B CA    1 
ATOM 761  C C     . GLN B 2 17 ? 19.952  -15.112 -25.017 1.00 58.86  ? 96  GLN B C     1 
ATOM 762  O O     . GLN B 2 17 ? 20.328  -15.631 -23.961 1.00 58.77  ? 96  GLN B O     1 
ATOM 763  C CB    . GLN B 2 17 ? 18.146  -13.263 -24.749 1.00 58.58  ? 96  GLN B CB    1 
ATOM 764  C CG    . GLN B 2 17 ? 17.153  -13.453 -25.880 1.00 58.56  ? 96  GLN B CG    1 
ATOM 765  C CD    . GLN B 2 17 ? 15.768  -12.831 -25.634 1.00 58.63  ? 96  GLN B CD    1 
ATOM 766  O OE1   . GLN B 2 17 ? 14.781  -13.283 -26.210 1.00 59.13  ? 96  GLN B OE1   1 
ATOM 767  N NE2   . GLN B 2 17 ? 15.697  -11.790 -24.801 1.00 57.65  ? 96  GLN B NE2   1 
ATOM 768  N N     . LEU B 2 18 ? 19.885  -15.798 -26.155 1.00 58.85  ? 97  LEU B N     1 
ATOM 769  C CA    . LEU B 2 18 ? 20.290  -17.204 -26.218 1.00 59.07  ? 97  LEU B CA    1 
ATOM 770  C C     . LEU B 2 18 ? 21.775  -17.342 -25.930 1.00 58.66  ? 97  LEU B C     1 
ATOM 771  O O     . LEU B 2 18 ? 22.238  -18.341 -25.352 1.00 58.89  ? 97  LEU B O     1 
ATOM 772  C CB    . LEU B 2 18 ? 20.001  -17.789 -27.592 1.00 59.47  ? 97  LEU B CB    1 
ATOM 773  C CG    . LEU B 2 18 ? 19.664  -19.276 -27.572 1.00 60.79  ? 97  LEU B CG    1 
ATOM 774  C CD1   . LEU B 2 18 ? 18.153  -19.460 -27.714 1.00 60.23  ? 97  LEU B CD1   1 
ATOM 775  C CD2   . LEU B 2 18 ? 20.444  -20.058 -28.670 1.00 62.91  ? 97  LEU B CD2   1 
ATOM 776  N N     . GLU B 2 19 ? 22.513  -16.331 -26.367 1.00 57.99  ? 98  GLU B N     1 
ATOM 777  C CA    . GLU B 2 19 ? 23.930  -16.195 -26.082 1.00 57.36  ? 98  GLU B CA    1 
ATOM 778  C C     . GLU B 2 19 ? 24.156  -16.149 -24.577 1.00 56.37  ? 98  GLU B C     1 
ATOM 779  O O     . GLU B 2 19 ? 24.921  -16.936 -24.034 1.00 56.46  ? 98  GLU B O     1 
ATOM 780  C CB    . GLU B 2 19 ? 24.447  -14.922 -26.759 1.00 57.91  ? 98  GLU B CB    1 
ATOM 781  C CG    . GLU B 2 19 ? 25.890  -14.545 -26.485 1.00 59.41  ? 98  GLU B CG    1 
ATOM 782  C CD    . GLU B 2 19 ? 26.418  -13.544 -27.499 1.00 61.44  ? 98  GLU B CD    1 
ATOM 783  O OE1   . GLU B 2 19 ? 26.798  -12.417 -27.091 1.00 62.22  ? 98  GLU B OE1   1 
ATOM 784  O OE2   . GLU B 2 19 ? 26.444  -13.891 -28.704 1.00 62.52  ? 98  GLU B OE2   1 
ATOM 785  N N     . GLU B 2 20 ? 23.460  -15.246 -23.900 1.00 55.36  ? 99  GLU B N     1 
ATOM 786  C CA    . GLU B 2 20 ? 23.676  -15.043 -22.473 1.00 54.30  ? 99  GLU B CA    1 
ATOM 787  C C     . GLU B 2 20 ? 23.205  -16.197 -21.616 1.00 52.91  ? 99  GLU B C     1 
ATOM 788  O O     . GLU B 2 20 ? 23.801  -16.472 -20.576 1.00 53.07  ? 99  GLU B O     1 
ATOM 789  C CB    . GLU B 2 20 ? 23.029  -13.740 -22.011 1.00 54.39  ? 99  GLU B CB    1 
ATOM 790  C CG    . GLU B 2 20 ? 23.696  -12.503 -22.591 1.00 56.23  ? 99  GLU B CG    1 
ATOM 791  C CD    . GLU B 2 20 ? 25.031  -12.169 -21.932 1.00 57.86  ? 99  GLU B CD    1 
ATOM 792  O OE1   . GLU B 2 20 ? 25.201  -12.499 -20.738 1.00 57.30  ? 99  GLU B OE1   1 
ATOM 793  O OE2   . GLU B 2 20 ? 25.904  -11.565 -22.612 1.00 60.05  ? 99  GLU B OE2   1 
ATOM 794  N N     . LEU B 2 21 ? 22.139  -16.863 -22.050 1.00 51.42  ? 100 LEU B N     1 
ATOM 795  C CA    . LEU B 2 21 ? 21.633  -18.038 -21.355 1.00 50.07  ? 100 LEU B CA    1 
ATOM 796  C C     . LEU B 2 21 ? 22.649  -19.191 -21.436 1.00 49.64  ? 100 LEU B C     1 
ATOM 797  O O     . LEU B 2 21 ? 23.003  -19.760 -20.419 1.00 48.43  ? 100 LEU B O     1 
ATOM 798  C CB    . LEU B 2 21 ? 20.245  -18.440 -21.888 1.00 50.10  ? 100 LEU B CB    1 
ATOM 799  C CG    . LEU B 2 21 ? 18.996  -17.600 -21.524 1.00 48.71  ? 100 LEU B CG    1 
ATOM 800  C CD1   . LEU B 2 21 ? 17.893  -17.748 -22.535 1.00 47.38  ? 100 LEU B CD1   1 
ATOM 801  C CD2   . LEU B 2 21 ? 18.445  -17.976 -20.182 1.00 47.62  ? 100 LEU B CD2   1 
ATOM 802  N N     . GLU B 2 22 ? 23.154  -19.497 -22.632 1.00 49.63  ? 101 GLU B N     1 
ATOM 803  C CA    . GLU B 2 22 ? 24.173  -20.550 -22.781 1.00 50.11  ? 101 GLU B CA    1 
ATOM 804  C C     . GLU B 2 22 ? 25.470  -20.249 -22.025 1.00 49.98  ? 101 GLU B C     1 
ATOM 805  O O     . GLU B 2 22 ? 26.112  -21.161 -21.485 1.00 50.12  ? 101 GLU B O     1 
ATOM 806  C CB    . GLU B 2 22 ? 24.479  -20.842 -24.250 1.00 49.95  ? 101 GLU B CB    1 
ATOM 807  C CG    . GLU B 2 22 ? 23.480  -21.755 -24.966 1.00 50.69  ? 101 GLU B CG    1 
ATOM 808  C CD    . GLU B 2 22 ? 24.001  -22.238 -26.325 1.00 51.70  ? 101 GLU B CD    1 
ATOM 809  O OE1   . GLU B 2 22 ? 23.286  -22.127 -27.355 1.00 54.96  ? 101 GLU B OE1   1 
ATOM 810  O OE2   . GLU B 2 22 ? 25.148  -22.732 -26.376 1.00 54.83  ? 101 GLU B OE2   1 
ATOM 811  N N     . LYS B 2 23 ? 25.845  -18.974 -21.965 1.00 50.06  ? 102 LYS B N     1 
ATOM 812  C CA    . LYS B 2 23 ? 27.066  -18.559 -21.264 1.00 49.98  ? 102 LYS B CA    1 
ATOM 813  C C     . LYS B 2 23 ? 26.922  -18.757 -19.761 1.00 49.90  ? 102 LYS B C     1 
ATOM 814  O O     . LYS B 2 23 ? 27.871  -19.164 -19.094 1.00 50.30  ? 102 LYS B O     1 
ATOM 815  C CB    . LYS B 2 23 ? 27.392  -17.091 -21.573 1.00 50.24  ? 102 LYS B CB    1 
ATOM 816  C CG    . LYS B 2 23 ? 28.738  -16.596 -21.028 1.00 49.92  ? 102 LYS B CG    1 
ATOM 817  C CD    . LYS B 2 23 ? 28.908  -15.088 -21.153 1.00 50.34  ? 102 LYS B CD    1 
ATOM 818  C CE    . LYS B 2 23 ? 28.582  -14.573 -22.555 1.00 51.58  ? 102 LYS B CE    1 
ATOM 819  N NZ    . LYS B 2 23 ? 29.078  -13.175 -22.771 1.00 52.93  ? 102 LYS B NZ    1 
ATOM 820  N N     . ALA B 2 24 ? 25.734  -18.455 -19.235 1.00 49.57  ? 103 ALA B N     1 
ATOM 821  C CA    . ALA B 2 24 ? 25.433  -18.627 -17.812 1.00 49.19  ? 103 ALA B CA    1 
ATOM 822  C C     . ALA B 2 24 ? 25.327  -20.103 -17.447 1.00 49.04  ? 103 ALA B C     1 
ATOM 823  O O     . ALA B 2 24 ? 25.865  -20.545 -16.444 1.00 48.75  ? 103 ALA B O     1 
ATOM 824  C CB    . ALA B 2 24 ? 24.147  -17.901 -17.458 1.00 48.95  ? 103 ALA B CB    1 
ATOM 825  N N     . PHE B 2 25 ? 24.626  -20.859 -18.280 1.00 49.47  ? 104 PHE B N     1 
ATOM 826  C CA    . PHE B 2 25 ? 24.478  -22.281 -18.082 1.00 50.00  ? 104 PHE B CA    1 
ATOM 827  C C     . PHE B 2 25 ? 25.863  -22.921 -18.007 1.00 50.71  ? 104 PHE B C     1 
ATOM 828  O O     . PHE B 2 25 ? 26.064  -23.928 -17.303 1.00 50.39  ? 104 PHE B O     1 
ATOM 829  C CB    . PHE B 2 25 ? 23.628  -22.906 -19.204 1.00 49.87  ? 104 PHE B CB    1 
ATOM 830  C CG    . PHE B 2 25 ? 23.431  -24.379 -19.045 1.00 49.18  ? 104 PHE B CG    1 
ATOM 831  C CD1   . PHE B 2 25 ? 22.518  -24.870 -18.132 1.00 48.47  ? 104 PHE B CD1   1 
ATOM 832  C CD2   . PHE B 2 25 ? 24.183  -25.275 -19.784 1.00 49.70  ? 104 PHE B CD2   1 
ATOM 833  C CE1   . PHE B 2 25 ? 22.351  -26.233 -17.947 1.00 49.23  ? 104 PHE B CE1   1 
ATOM 834  C CE2   . PHE B 2 25 ? 24.023  -26.659 -19.614 1.00 50.37  ? 104 PHE B CE2   1 
ATOM 835  C CZ    . PHE B 2 25 ? 23.104  -27.135 -18.694 1.00 49.91  ? 104 PHE B CZ    1 
ATOM 836  N N     . SER B 2 26 ? 26.814  -22.316 -18.724 1.00 51.40  ? 105 SER B N     1 
ATOM 837  C CA    . SER B 2 26 ? 28.193  -22.803 -18.733 1.00 52.34  ? 105 SER B CA    1 
ATOM 838  C C     . SER B 2 26 ? 28.901  -22.664 -17.372 1.00 52.34  ? 105 SER B C     1 
ATOM 839  O O     . SER B 2 26 ? 29.660  -23.551 -16.995 1.00 52.60  ? 105 SER B O     1 
ATOM 840  C CB    . SER B 2 26 ? 29.003  -22.184 -19.888 1.00 52.45  ? 105 SER B CB    1 
ATOM 841  O OG    . SER B 2 26 ? 29.420  -20.853 -19.606 1.00 54.38  ? 105 SER B OG    1 
ATOM 842  N N     . ARG B 2 27 ? 28.631  -21.577 -16.640 1.00 52.59  ? 106 ARG B N     1 
ATOM 843  C CA    . ARG B 2 27 ? 29.127  -21.384 -15.264 1.00 52.76  ? 106 ARG B CA    1 
ATOM 844  C C     . ARG B 2 27 ? 28.498  -22.371 -14.296 1.00 52.24  ? 106 ARG B C     1 
ATOM 845  O O     . ARG B 2 27 ? 29.151  -23.305 -13.874 1.00 52.28  ? 106 ARG B O     1 
ATOM 846  C CB    . ARG B 2 27 ? 28.884  -19.951 -14.795 1.00 52.70  ? 106 ARG B CB    1 
ATOM 847  C CG    . ARG B 2 27 ? 29.735  -18.915 -15.521 1.00 54.05  ? 106 ARG B CG    1 
ATOM 848  C CD    . ARG B 2 27 ? 29.531  -17.508 -14.965 1.00 54.65  ? 106 ARG B CD    1 
ATOM 849  N NE    . ARG B 2 27 ? 28.323  -16.834 -15.476 1.00 59.39  ? 106 ARG B NE    1 
ATOM 850  C CZ    . ARG B 2 27 ? 28.247  -16.148 -16.624 1.00 60.68  ? 106 ARG B CZ    1 
ATOM 851  N NH1   . ARG B 2 27 ? 29.306  -16.040 -17.431 1.00 61.14  ? 106 ARG B NH1   1 
ATOM 852  N NH2   . ARG B 2 27 ? 27.102  -15.566 -16.973 1.00 60.47  ? 106 ARG B NH2   1 
ATOM 853  N N     . THR B 2 28 ? 27.233  -22.160 -13.944 1.00 52.34  ? 107 THR B N     1 
ATOM 854  C CA    . THR B 2 28 ? 26.447  -23.145 -13.170 1.00 52.36  ? 107 THR B CA    1 
ATOM 855  C C     . THR B 2 28 ? 25.272  -23.683 -13.961 1.00 51.85  ? 107 THR B C     1 
ATOM 856  O O     . THR B 2 28 ? 24.652  -22.964 -14.741 1.00 51.45  ? 107 THR B O     1 
ATOM 857  C CB    . THR B 2 28 ? 25.803  -22.560 -11.882 1.00 52.74  ? 107 THR B CB    1 
ATOM 858  O OG1   . THR B 2 28 ? 25.676  -21.131 -12.001 1.00 53.94  ? 107 THR B OG1   1 
ATOM 859  C CG2   . THR B 2 28 ? 26.580  -22.957 -10.621 1.00 52.44  ? 107 THR B CG2   1 
ATOM 860  N N     . HIS B 2 29 ? 24.949  -24.944 -13.703 1.00 51.53  ? 108 HIS B N     1 
ATOM 861  C CA    . HIS B 2 29 ? 23.778  -25.598 -14.266 1.00 51.09  ? 108 HIS B CA    1 
ATOM 862  C C     . HIS B 2 29 ? 22.568  -25.351 -13.358 1.00 49.87  ? 108 HIS B C     1 
ATOM 863  O O     . HIS B 2 29 ? 21.417  -25.575 -13.761 1.00 49.36  ? 108 HIS B O     1 
ATOM 864  C CB    . HIS B 2 29 ? 24.081  -27.085 -14.482 1.00 51.82  ? 108 HIS B CB    1 
ATOM 865  C CG    . HIS B 2 29 ? 25.267  -27.323 -15.377 1.00 55.81  ? 108 HIS B CG    1 
ATOM 866  N ND1   . HIS B 2 29 ? 26.572  -27.120 -14.964 1.00 59.68  ? 108 HIS B ND1   1 
ATOM 867  C CD2   . HIS B 2 29 ? 25.347  -27.722 -16.672 1.00 58.19  ? 108 HIS B CD2   1 
ATOM 868  C CE1   . HIS B 2 29 ? 27.401  -27.388 -15.963 1.00 60.12  ? 108 HIS B CE1   1 
ATOM 869  N NE2   . HIS B 2 29 ? 26.684  -27.752 -17.012 1.00 59.51  ? 108 HIS B NE2   1 
ATOM 870  N N     . TYR B 2 30 ? 22.845  -24.849 -12.145 1.00 48.69  ? 109 TYR B N     1 
ATOM 871  C CA    . TYR B 2 30 ? 21.818  -24.470 -11.159 1.00 47.25  ? 109 TYR B CA    1 
ATOM 872  C C     . TYR B 2 30 ? 22.003  -23.083 -10.598 1.00 46.54  ? 109 TYR B C     1 
ATOM 873  O O     . TYR B 2 30 ? 22.343  -22.953 -9.432  1.00 46.79  ? 109 TYR B O     1 
ATOM 874  C CB    . TYR B 2 30 ? 21.824  -25.424 -9.979  1.00 46.80  ? 109 TYR B CB    1 
ATOM 875  C CG    . TYR B 2 30 ? 21.252  -26.758 -10.288 1.00 46.81  ? 109 TYR B CG    1 
ATOM 876  C CD1   . TYR B 2 30 ? 19.882  -26.933 -10.357 1.00 47.50  ? 109 TYR B CD1   1 
ATOM 877  C CD2   . TYR B 2 30 ? 22.077  -27.856 -10.513 1.00 45.78  ? 109 TYR B CD2   1 
ATOM 878  C CE1   . TYR B 2 30 ? 19.338  -28.165 -10.645 1.00 47.83  ? 109 TYR B CE1   1 
ATOM 879  C CE2   . TYR B 2 30 ? 21.545  -29.094 -10.802 1.00 46.28  ? 109 TYR B CE2   1 
ATOM 880  C CZ    . TYR B 2 30 ? 20.170  -29.239 -10.870 1.00 47.50  ? 109 TYR B CZ    1 
ATOM 881  O OH    . TYR B 2 30 ? 19.598  -30.460 -11.153 1.00 48.45  ? 109 TYR B OH    1 
ATOM 882  N N     . PRO B 2 31 ? 21.741  -22.035 -11.393 1.00 45.85  ? 110 PRO B N     1 
ATOM 883  C CA    . PRO B 2 31 ? 21.925  -20.707 -10.806 1.00 45.16  ? 110 PRO B CA    1 
ATOM 884  C C     . PRO B 2 31 ? 20.862  -20.448 -9.761  1.00 45.14  ? 110 PRO B C     1 
ATOM 885  O O     . PRO B 2 31 ? 19.770  -20.987 -9.844  1.00 44.77  ? 110 PRO B O     1 
ATOM 886  C CB    . PRO B 2 31 ? 21.730  -19.763 -11.978 1.00 44.90  ? 110 PRO B CB    1 
ATOM 887  C CG    . PRO B 2 31 ? 20.945  -20.531 -12.978 1.00 45.72  ? 110 PRO B CG    1 
ATOM 888  C CD    . PRO B 2 31 ? 21.250  -21.986 -12.779 1.00 45.34  ? 110 PRO B CD    1 
ATOM 889  N N     . ASP B 2 32 ? 21.218  -19.651 -8.766  1.00 45.80  ? 111 ASP B N     1 
ATOM 890  C CA    . ASP B 2 32 ? 20.308  -19.168 -7.731  1.00 46.28  ? 111 ASP B CA    1 
ATOM 891  C C     . ASP B 2 32 ? 19.351  -18.120 -8.314  1.00 46.25  ? 111 ASP B C     1 
ATOM 892  O O     . ASP B 2 32 ? 19.615  -17.528 -9.389  1.00 45.02  ? 111 ASP B O     1 
ATOM 893  C CB    . ASP B 2 32 ? 21.122  -18.484 -6.637  1.00 46.63  ? 111 ASP B CB    1 
ATOM 894  C CG    . ASP B 2 32 ? 21.935  -17.311 -7.190  1.00 48.06  ? 111 ASP B CG    1 
ATOM 895  O OD1   . ASP B 2 32 ? 21.418  -16.158 -7.184  1.00 49.13  ? 111 ASP B OD1   1 
ATOM 896  O OD2   . ASP B 2 32 ? 23.057  -17.561 -7.702  1.00 47.74  ? 111 ASP B OD2   1 
ATOM 897  N N     . VAL B 2 33 ? 18.279  -17.863 -7.555  1.00 46.35  ? 112 VAL B N     1 
ATOM 898  C CA    . VAL B 2 33 ? 17.205  -16.953 -7.960  1.00 46.67  ? 112 VAL B CA    1 
ATOM 899  C C     . VAL B 2 33 ? 17.731  -15.565 -8.312  1.00 47.31  ? 112 VAL B C     1 
ATOM 900  O O     . VAL B 2 33 ? 17.327  -14.985 -9.320  1.00 47.30  ? 112 VAL B O     1 
ATOM 901  C CB    . VAL B 2 33 ? 16.111  -16.793 -6.867  1.00 46.62  ? 112 VAL B CB    1 
ATOM 902  C CG1   . VAL B 2 33 ? 14.736  -16.735 -7.510  1.00 45.29  ? 112 VAL B CG1   1 
ATOM 903  C CG2   . VAL B 2 33 ? 16.166  -17.930 -5.842  1.00 47.24  ? 112 VAL B CG2   1 
ATOM 904  N N     . PHE B 2 34 ? 18.639  -15.043 -7.490  1.00 47.82  ? 113 PHE B N     1 
ATOM 905  C CA    . PHE B 2 34 ? 19.143  -13.680 -7.683  1.00 48.64  ? 113 PHE B CA    1 
ATOM 906  C C     . PHE B 2 34 ? 19.940  -13.466 -8.969  1.00 49.39  ? 113 PHE B C     1 
ATOM 907  O O     . PHE B 2 34 ? 19.805  -12.423 -9.630  1.00 49.44  ? 113 PHE B O     1 
ATOM 908  C CB    . PHE B 2 34 ? 19.943  -13.254 -6.461  1.00 48.63  ? 113 PHE B CB    1 
ATOM 909  C CG    . PHE B 2 34 ? 19.118  -13.191 -5.220  1.00 47.67  ? 113 PHE B CG    1 
ATOM 910  C CD1   . PHE B 2 34 ? 18.273  -12.107 -4.996  1.00 47.20  ? 113 PHE B CD1   1 
ATOM 911  C CD2   . PHE B 2 34 ? 19.132  -14.240 -4.314  1.00 45.83  ? 113 PHE B CD2   1 
ATOM 912  C CE1   . PHE B 2 34 ? 17.483  -12.061 -3.859  1.00 48.38  ? 113 PHE B CE1   1 
ATOM 913  C CE2   . PHE B 2 34 ? 18.354  -14.212 -3.171  1.00 45.54  ? 113 PHE B CE2   1 
ATOM 914  C CZ    . PHE B 2 34 ? 17.529  -13.126 -2.931  1.00 47.56  ? 113 PHE B CZ    1 
ATOM 915  N N     . THR B 2 35 ? 20.755  -14.463 -9.307  1.00 50.02  ? 114 THR B N     1 
ATOM 916  C CA    . THR B 2 35 ? 21.510  -14.507 -10.558 1.00 50.46  ? 114 THR B CA    1 
ATOM 917  C C     . THR B 2 35 ? 20.531  -14.535 -11.720 1.00 50.69  ? 114 THR B C     1 
ATOM 918  O O     . THR B 2 35 ? 20.674  -13.792 -12.703 1.00 50.27  ? 114 THR B O     1 
ATOM 919  C CB    . THR B 2 35 ? 22.408  -15.802 -10.628 1.00 50.69  ? 114 THR B CB    1 
ATOM 920  O OG1   . THR B 2 35 ? 23.115  -16.002 -9.392  1.00 50.38  ? 114 THR B OG1   1 
ATOM 921  C CG2   . THR B 2 35 ? 23.411  -15.708 -11.754 1.00 50.79  ? 114 THR B CG2   1 
ATOM 922  N N     . ARG B 2 36 ? 19.529  -15.404 -11.585 1.00 51.56  ? 115 ARG B N     1 
ATOM 923  C CA    . ARG B 2 36 ? 18.494  -15.569 -12.596 1.00 52.23  ? 115 ARG B CA    1 
ATOM 924  C C     . ARG B 2 36 ? 17.849  -14.219 -12.824 1.00 53.12  ? 115 ARG B C     1 
ATOM 925  O O     . ARG B 2 36 ? 17.764  -13.751 -13.956 1.00 53.50  ? 115 ARG B O     1 
ATOM 926  C CB    . ARG B 2 36 ? 17.439  -16.592 -12.153 1.00 52.19  ? 115 ARG B CB    1 
ATOM 927  C CG    . ARG B 2 36 ? 17.856  -18.053 -12.248 1.00 50.64  ? 115 ARG B CG    1 
ATOM 928  C CD    . ARG B 2 36 ? 16.653  -18.960 -12.561 1.00 49.72  ? 115 ARG B CD    1 
ATOM 929  N NE    . ARG B 2 36 ? 15.616  -18.965 -11.522 1.00 47.94  ? 115 ARG B NE    1 
ATOM 930  C CZ    . ARG B 2 36 ? 15.722  -19.614 -10.366 1.00 46.68  ? 115 ARG B CZ    1 
ATOM 931  N NH1   . ARG B 2 36 ? 16.826  -20.292 -10.087 1.00 46.94  ? 115 ARG B NH1   1 
ATOM 932  N NH2   . ARG B 2 36 ? 14.741  -19.572 -9.472  1.00 45.88  ? 115 ARG B NH2   1 
ATOM 933  N N     . GLU B 2 37 ? 17.432  -13.586 -11.732 1.00 54.32  ? 116 GLU B N     1 
ATOM 934  C CA    . GLU B 2 37 ? 16.846  -12.264 -11.781 1.00 55.46  ? 116 GLU B CA    1 
ATOM 935  C C     . GLU B 2 37 ? 17.769  -11.271 -12.473 1.00 55.85  ? 116 GLU B C     1 
ATOM 936  O O     . GLU B 2 37 ? 17.408  -10.690 -13.488 1.00 56.14  ? 116 GLU B O     1 
ATOM 937  C CB    . GLU B 2 37 ? 16.501  -11.806 -10.381 1.00 55.54  ? 116 GLU B CB    1 
ATOM 938  C CG    . GLU B 2 37 ? 15.442  -10.734 -10.362 1.00 58.57  ? 116 GLU B CG    1 
ATOM 939  C CD    . GLU B 2 37 ? 14.310  -11.076 -9.396  1.00 63.16  ? 116 GLU B CD    1 
ATOM 940  O OE1   . GLU B 2 37 ? 14.485  -10.875 -8.161  1.00 64.26  ? 116 GLU B OE1   1 
ATOM 941  O OE2   . GLU B 2 37 ? 13.242  -11.544 -9.882  1.00 64.30  ? 116 GLU B OE2   1 
ATOM 942  N N     . GLU B 2 38 ? 18.972  -11.113 -11.945 1.00 56.53  ? 117 GLU B N     1 
ATOM 943  C CA    . GLU B 2 38 ? 19.964  -10.211 -12.519 1.00 57.68  ? 117 GLU B CA    1 
ATOM 944  C C     . GLU B 2 38 ? 20.126  -10.407 -14.020 1.00 57.55  ? 117 GLU B C     1 
ATOM 945  O O     . GLU B 2 38 ? 20.281  -9.430  -14.769 1.00 57.80  ? 117 GLU B O     1 
ATOM 946  C CB    . GLU B 2 38 ? 21.302  -10.420 -11.817 1.00 57.80  ? 117 GLU B CB    1 
ATOM 947  C CG    . GLU B 2 38 ? 22.425  -9.485  -12.243 1.00 59.36  ? 117 GLU B CG    1 
ATOM 948  C CD    . GLU B 2 38 ? 23.678  -9.698  -11.402 1.00 59.46  ? 117 GLU B CD    1 
ATOM 949  O OE1   . GLU B 2 38 ? 24.712  -10.117 -11.965 1.00 60.50  ? 117 GLU B OE1   1 
ATOM 950  O OE2   . GLU B 2 38 ? 23.612  -9.472  -10.168 1.00 62.30  ? 117 GLU B OE2   1 
ATOM 951  N N     . LEU B 2 39 ? 20.089  -11.668 -14.451 1.00 57.58  ? 118 LEU B N     1 
ATOM 952  C CA    . LEU B 2 39 ? 20.166  -12.002 -15.869 1.00 57.43  ? 118 LEU B CA    1 
ATOM 953  C C     . LEU B 2 39 ? 18.922  -11.492 -16.588 1.00 58.10  ? 118 LEU B C     1 
ATOM 954  O O     . LEU B 2 39 ? 19.009  -10.886 -17.653 1.00 58.04  ? 118 LEU B O     1 
ATOM 955  C CB    . LEU B 2 39 ? 20.274  -13.512 -16.045 1.00 56.87  ? 118 LEU B CB    1 
ATOM 956  C CG    . LEU B 2 39 ? 21.131  -14.121 -17.159 1.00 55.40  ? 118 LEU B CG    1 
ATOM 957  C CD1   . LEU B 2 39 ? 20.817  -15.609 -17.293 1.00 54.67  ? 118 LEU B CD1   1 
ATOM 958  C CD2   . LEU B 2 39 ? 20.943  -13.439 -18.474 1.00 54.10  ? 118 LEU B CD2   1 
ATOM 959  N N     . ALA B 2 40 ? 17.767  -11.744 -15.988 1.00 58.85  ? 119 ALA B N     1 
ATOM 960  C CA    . ALA B 2 40 ? 16.502  -11.329 -16.544 1.00 59.99  ? 119 ALA B CA    1 
ATOM 961  C C     . ALA B 2 40 ? 16.490  -9.840  -16.907 1.00 60.92  ? 119 ALA B C     1 
ATOM 962  O O     . ALA B 2 40 ? 16.089  -9.460  -18.018 1.00 60.87  ? 119 ALA B O     1 
ATOM 963  C CB    . ALA B 2 40 ? 15.403  -11.641 -15.557 1.00 60.36  ? 119 ALA B CB    1 
ATOM 964  N N     . MET B 2 41 ? 16.926  -9.005  -15.970 1.00 61.51  ? 120 MET B N     1 
ATOM 965  C CA    . MET B 2 41 ? 17.067  -7.587  -16.236 1.00 63.36  ? 120 MET B CA    1 
ATOM 966  C C     . MET B 2 41 ? 17.994  -7.356  -17.417 1.00 62.52  ? 120 MET B C     1 
ATOM 967  O O     . MET B 2 41 ? 17.656  -6.628  -18.354 1.00 62.62  ? 120 MET B O     1 
ATOM 968  C CB    . MET B 2 41 ? 17.679  -6.891  -15.034 1.00 63.32  ? 120 MET B CB    1 
ATOM 969  C CG    . MET B 2 41 ? 16.707  -6.482  -13.958 1.00 65.18  ? 120 MET B CG    1 
ATOM 970  S SD    . MET B 2 41 ? 17.236  -4.882  -13.290 1.00 67.92  ? 120 MET B SD    1 
ATOM 971  C CE    . MET B 2 41 ? 18.887  -5.236  -12.603 1.00 68.41  ? 120 MET B CE    1 
ATOM 972  N N     . LYS B 2 42 ? 19.163  -7.993  -17.350 1.00 61.77  ? 121 LYS B N     1 
ATOM 973  C CA    . LYS B 2 42 ? 20.246  -7.803  -18.303 1.00 60.96  ? 121 LYS B CA    1 
ATOM 974  C C     . LYS B 2 42 ? 19.859  -8.163  -19.733 1.00 60.43  ? 121 LYS B C     1 
ATOM 975  O O     . LYS B 2 42 ? 20.510  -7.721  -20.667 1.00 60.52  ? 121 LYS B O     1 
ATOM 976  C CB    . LYS B 2 42 ? 21.453  -8.633  -17.845 1.00 61.37  ? 121 LYS B CB    1 
ATOM 977  C CG    . LYS B 2 42 ? 22.829  -8.167  -18.311 1.00 61.30  ? 121 LYS B CG    1 
ATOM 978  C CD    . LYS B 2 42 ? 23.357  -9.002  -19.480 1.00 61.00  ? 121 LYS B CD    1 
ATOM 979  C CE    . LYS B 2 42 ? 24.856  -8.797  -19.710 1.00 59.80  ? 121 LYS B CE    1 
ATOM 980  N NZ    . LYS B 2 42 ? 25.682  -9.542  -18.714 1.00 59.75  ? 121 LYS B NZ    1 
ATOM 981  N N     . ILE B 2 43 ? 18.812  -8.965  -19.913 1.00 59.84  ? 122 ILE B N     1 
ATOM 982  C CA    . ILE B 2 43 ? 18.417  -9.397  -21.262 1.00 59.28  ? 122 ILE B CA    1 
ATOM 983  C C     . ILE B 2 43 ? 16.913  -9.323  -21.547 1.00 59.04  ? 122 ILE B C     1 
ATOM 984  O O     . ILE B 2 43 ? 16.435  -9.895  -22.538 1.00 59.24  ? 122 ILE B O     1 
ATOM 985  C CB    . ILE B 2 43 ? 18.933  -10.810 -21.594 1.00 59.36  ? 122 ILE B CB    1 
ATOM 986  C CG1   . ILE B 2 43 ? 18.284  -11.855 -20.680 1.00 59.24  ? 122 ILE B CG1   1 
ATOM 987  C CG2   . ILE B 2 43 ? 20.451  -10.853 -21.497 1.00 59.57  ? 122 ILE B CG2   1 
ATOM 988  C CD1   . ILE B 2 43 ? 18.440  -13.268 -21.158 1.00 59.10  ? 122 ILE B CD1   1 
ATOM 989  N N     . GLY B 2 44 ? 16.171  -8.640  -20.677 1.00 58.29  ? 123 GLY B N     1 
ATOM 990  C CA    . GLY B 2 44 ? 14.789  -8.292  -20.963 1.00 57.54  ? 123 GLY B CA    1 
ATOM 991  C C     . GLY B 2 44 ? 13.884  -9.498  -21.097 1.00 57.30  ? 123 GLY B C     1 
ATOM 992  O O     . GLY B 2 44 ? 13.057  -9.591  -22.010 1.00 57.91  ? 123 GLY B O     1 
ATOM 993  N N     . LEU B 2 45 ? 14.051  -10.447 -20.195 1.00 56.25  ? 124 LEU B N     1 
ATOM 994  C CA    . LEU B 2 45 ? 13.072  -11.486 -20.051 1.00 55.25  ? 124 LEU B CA    1 
ATOM 995  C C     . LEU B 2 45 ? 12.699  -11.456 -18.591 1.00 54.85  ? 124 LEU B C     1 
ATOM 996  O O     . LEU B 2 45 ? 13.425  -10.903 -17.771 1.00 54.91  ? 124 LEU B O     1 
ATOM 997  C CB    . LEU B 2 45 ? 13.645  -12.845 -20.444 1.00 55.20  ? 124 LEU B CB    1 
ATOM 998  C CG    . LEU B 2 45 ? 14.121  -13.053 -21.883 1.00 55.89  ? 124 LEU B CG    1 
ATOM 999  C CD1   . LEU B 2 45 ? 15.004  -14.286 -22.022 1.00 55.66  ? 124 LEU B CD1   1 
ATOM 1000 C CD2   . LEU B 2 45 ? 12.951  -13.122 -22.862 1.00 57.05  ? 124 LEU B CD2   1 
ATOM 1001 N N     . THR B 2 46 ? 11.551  -12.031 -18.275 1.00 54.26  ? 125 THR B N     1 
ATOM 1002 C CA    . THR B 2 46 ? 11.107  -12.208 -16.910 1.00 53.51  ? 125 THR B CA    1 
ATOM 1003 C C     . THR B 2 46 ? 11.827  -13.404 -16.282 1.00 53.01  ? 125 THR B C     1 
ATOM 1004 O O     . THR B 2 46 ? 12.323  -14.286 -16.996 1.00 52.67  ? 125 THR B O     1 
ATOM 1005 C CB    . THR B 2 46 ? 9.626   -12.503 -16.932 1.00 53.62  ? 125 THR B CB    1 
ATOM 1006 O OG1   . THR B 2 46 ? 9.436   -13.863 -17.334 1.00 53.54  ? 125 THR B OG1   1 
ATOM 1007 C CG2   . THR B 2 46 ? 8.951   -11.606 -17.951 1.00 53.66  ? 125 THR B CG2   1 
ATOM 1008 N N     . GLU B 2 47 ? 11.864  -13.438 -14.953 1.00 52.46  ? 126 GLU B N     1 
ATOM 1009 C CA    . GLU B 2 47 ? 12.515  -14.519 -14.221 1.00 52.60  ? 126 GLU B CA    1 
ATOM 1010 C C     . GLU B 2 47 ? 11.989  -15.898 -14.641 1.00 51.78  ? 126 GLU B C     1 
ATOM 1011 O O     . GLU B 2 47 ? 12.771  -16.817 -14.912 1.00 52.15  ? 126 GLU B O     1 
ATOM 1012 C CB    . GLU B 2 47 ? 12.361  -14.314 -12.712 1.00 53.15  ? 126 GLU B CB    1 
ATOM 1013 C CG    . GLU B 2 47 ? 13.466  -14.933 -11.859 1.00 57.14  ? 126 GLU B CG    1 
ATOM 1014 C CD    . GLU B 2 47 ? 13.187  -16.397 -11.454 1.00 62.69  ? 126 GLU B CD    1 
ATOM 1015 O OE1   . GLU B 2 47 ? 13.543  -17.337 -12.219 1.00 62.69  ? 126 GLU B OE1   1 
ATOM 1016 O OE2   . GLU B 2 47 ? 12.631  -16.599 -10.343 1.00 64.49  ? 126 GLU B OE2   1 
ATOM 1017 N N     . ALA B 2 48 ? 10.669  -16.029 -14.734 1.00 50.46  ? 127 ALA B N     1 
ATOM 1018 C CA    . ALA B 2 48 ? 10.043  -17.313 -15.040 1.00 48.87  ? 127 ALA B CA    1 
ATOM 1019 C C     . ALA B 2 48 ? 10.506  -17.907 -16.373 1.00 47.71  ? 127 ALA B C     1 
ATOM 1020 O O     . ALA B 2 48 ? 10.726  -19.119 -16.473 1.00 47.36  ? 127 ALA B O     1 
ATOM 1021 C CB    . ALA B 2 48 ? 8.525   -17.200 -14.988 1.00 49.17  ? 127 ALA B CB    1 
ATOM 1022 N N     . ARG B 2 49 ? 10.671  -17.065 -17.388 1.00 46.25  ? 128 ARG B N     1 
ATOM 1023 C CA    . ARG B 2 49 ? 11.187  -17.544 -18.672 1.00 45.11  ? 128 ARG B CA    1 
ATOM 1024 C C     . ARG B 2 49 ? 12.575  -18.172 -18.522 1.00 44.07  ? 128 ARG B C     1 
ATOM 1025 O O     . ARG B 2 49 ? 12.915  -19.146 -19.203 1.00 44.01  ? 128 ARG B O     1 
ATOM 1026 C CB    . ARG B 2 49 ? 11.202  -16.436 -19.732 1.00 45.45  ? 128 ARG B CB    1 
ATOM 1027 C CG    . ARG B 2 49 ? 9.802   -16.004 -20.317 1.00 46.94  ? 128 ARG B CG    1 
ATOM 1028 C CD    . ARG B 2 49 ? 8.829   -17.178 -20.544 1.00 47.17  ? 128 ARG B CD    1 
ATOM 1029 N NE    . ARG B 2 49 ? 7.956   -17.366 -19.375 1.00 49.17  ? 128 ARG B NE    1 
ATOM 1030 C CZ    . ARG B 2 49 ? 7.438   -18.531 -18.973 1.00 48.92  ? 128 ARG B CZ    1 
ATOM 1031 N NH1   . ARG B 2 49 ? 6.664   -18.549 -17.897 1.00 48.20  ? 128 ARG B NH1   1 
ATOM 1032 N NH2   . ARG B 2 49 ? 7.694   -19.673 -19.624 1.00 47.38  ? 128 ARG B NH2   1 
ATOM 1033 N N     . ILE B 2 50 ? 13.361  -17.636 -17.594 1.00 42.67  ? 129 ILE B N     1 
ATOM 1034 C CA    . ILE B 2 50 ? 14.730  -18.081 -17.428 1.00 40.63  ? 129 ILE B CA    1 
ATOM 1035 C C     . ILE B 2 50 ? 14.725  -19.338 -16.610 1.00 39.80  ? 129 ILE B C     1 
ATOM 1036 O O     . ILE B 2 50 ? 15.418  -20.306 -16.946 1.00 40.16  ? 129 ILE B O     1 
ATOM 1037 C CB    . ILE B 2 50 ? 15.573  -17.008 -16.786 1.00 40.50  ? 129 ILE B CB    1 
ATOM 1038 C CG1   . ILE B 2 50 ? 16.000  -16.017 -17.861 1.00 41.10  ? 129 ILE B CG1   1 
ATOM 1039 C CG2   . ILE B 2 50 ? 16.782  -17.610 -16.137 1.00 39.76  ? 129 ILE B CG2   1 
ATOM 1040 C CD1   . ILE B 2 50 ? 16.392  -14.683 -17.314 1.00 43.49  ? 129 ILE B CD1   1 
ATOM 1041 N N     . GLN B 2 51 ? 13.912  -19.340 -15.558 1.00 38.32  ? 130 GLN B N     1 
ATOM 1042 C CA    . GLN B 2 51 ? 13.744  -20.523 -14.716 1.00 36.93  ? 130 GLN B CA    1 
ATOM 1043 C C     . GLN B 2 51 ? 13.430  -21.769 -15.558 1.00 35.70  ? 130 GLN B C     1 
ATOM 1044 O O     . GLN B 2 51 ? 13.961  -22.845 -15.294 1.00 35.47  ? 130 GLN B O     1 
ATOM 1045 C CB    . GLN B 2 51 ? 12.641  -20.283 -13.698 1.00 36.71  ? 130 GLN B CB    1 
ATOM 1046 C CG    . GLN B 2 51 ? 12.591  -21.263 -12.584 1.00 36.64  ? 130 GLN B CG    1 
ATOM 1047 C CD    . GLN B 2 51 ? 11.231  -21.246 -11.909 1.00 41.66  ? 130 GLN B CD    1 
ATOM 1048 O OE1   . GLN B 2 51 ? 10.920  -20.366 -11.065 1.00 41.89  ? 130 GLN B OE1   1 
ATOM 1049 N NE2   . GLN B 2 51 ? 10.394  -22.223 -12.275 1.00 42.28  ? 130 GLN B NE2   1 
ATOM 1050 N N     . VAL B 2 52 ? 12.595  -21.602 -16.584 1.00 34.53  ? 131 VAL B N     1 
ATOM 1051 C CA    . VAL B 2 52 ? 12.130  -22.729 -17.373 1.00 33.20  ? 131 VAL B CA    1 
ATOM 1052 C C     . VAL B 2 52 ? 13.196  -23.148 -18.333 1.00 33.42  ? 131 VAL B C     1 
ATOM 1053 O O     . VAL B 2 52 ? 13.475  -24.354 -18.455 1.00 33.40  ? 131 VAL B O     1 
ATOM 1054 C CB    . VAL B 2 52 ? 10.828  -22.436 -18.121 1.00 33.10  ? 131 VAL B CB    1 
ATOM 1055 C CG1   . VAL B 2 52 ? 10.604  -23.465 -19.202 1.00 31.05  ? 131 VAL B CG1   1 
ATOM 1056 C CG2   . VAL B 2 52 ? 9.664   -22.444 -17.138 1.00 31.25  ? 131 VAL B CG2   1 
ATOM 1057 N N     . TRP B 2 53 ? 13.800  -22.153 -18.992 1.00 32.78  ? 132 TRP B N     1 
ATOM 1058 C CA    . TRP B 2 53 ? 14.934  -22.374 -19.861 1.00 32.28  ? 132 TRP B CA    1 
ATOM 1059 C C     . TRP B 2 53 ? 15.941  -23.276 -19.168 1.00 33.29  ? 132 TRP B C     1 
ATOM 1060 O O     . TRP B 2 53 ? 16.314  -24.331 -19.713 1.00 33.80  ? 132 TRP B O     1 
ATOM 1061 C CB    . TRP B 2 53 ? 15.613  -21.061 -20.203 1.00 31.73  ? 132 TRP B CB    1 
ATOM 1062 C CG    . TRP B 2 53 ? 16.541  -21.228 -21.334 1.00 31.34  ? 132 TRP B CG    1 
ATOM 1063 C CD1   . TRP B 2 53 ? 16.247  -21.095 -22.657 1.00 30.52  ? 132 TRP B CD1   1 
ATOM 1064 C CD2   . TRP B 2 53 ? 17.927  -21.580 -21.263 1.00 30.87  ? 132 TRP B CD2   1 
ATOM 1065 N NE1   . TRP B 2 53 ? 17.361  -21.350 -23.418 1.00 31.00  ? 132 TRP B NE1   1 
ATOM 1066 C CE2   . TRP B 2 53 ? 18.405  -21.657 -22.588 1.00 31.50  ? 132 TRP B CE2   1 
ATOM 1067 C CE3   . TRP B 2 53 ? 18.805  -21.861 -20.210 1.00 30.42  ? 132 TRP B CE3   1 
ATOM 1068 C CZ2   . TRP B 2 53 ? 19.727  -21.991 -22.888 1.00 32.38  ? 132 TRP B CZ2   1 
ATOM 1069 C CZ3   . TRP B 2 53 ? 20.117  -22.204 -20.505 1.00 30.62  ? 132 TRP B CZ3   1 
ATOM 1070 C CH2   . TRP B 2 53 ? 20.569  -22.260 -21.826 1.00 31.69  ? 132 TRP B CH2   1 
ATOM 1071 N N     . PHE B 2 54 ? 16.378  -22.871 -17.970 1.00 33.42  ? 133 PHE B N     1 
ATOM 1072 C CA    . PHE B 2 54 ? 17.343  -23.653 -17.227 1.00 33.94  ? 133 PHE B CA    1 
ATOM 1073 C C     . PHE B 2 54 ? 16.814  -25.047 -16.935 1.00 35.09  ? 133 PHE B C     1 
ATOM 1074 O O     . PHE B 2 54 ? 17.577  -26.028 -17.005 1.00 35.44  ? 133 PHE B O     1 
ATOM 1075 C CB    . PHE B 2 54 ? 17.812  -22.951 -15.943 1.00 33.57  ? 133 PHE B CB    1 
ATOM 1076 C CG    . PHE B 2 54 ? 18.928  -21.995 -16.175 1.00 32.42  ? 133 PHE B CG    1 
ATOM 1077 C CD1   . PHE B 2 54 ? 18.671  -20.709 -16.671 1.00 31.21  ? 133 PHE B CD1   1 
ATOM 1078 C CD2   . PHE B 2 54 ? 20.236  -22.380 -15.950 1.00 31.56  ? 133 PHE B CD2   1 
ATOM 1079 C CE1   . PHE B 2 54 ? 19.693  -19.835 -16.935 1.00 29.70  ? 133 PHE B CE1   1 
ATOM 1080 C CE2   . PHE B 2 54 ? 21.283  -21.501 -16.200 1.00 31.94  ? 133 PHE B CE2   1 
ATOM 1081 C CZ    . PHE B 2 54 ? 21.010  -20.225 -16.692 1.00 31.53  ? 133 PHE B CZ    1 
ATOM 1082 N N     . GLN B 2 55 ? 15.521  -25.142 -16.634 1.00 35.43  ? 134 GLN B N     1 
ATOM 1083 C CA    . GLN B 2 55 ? 14.908  -26.433 -16.386 1.00 36.39  ? 134 GLN B CA    1 
ATOM 1084 C C     . GLN B 2 55 ? 15.032  -27.347 -17.597 1.00 37.20  ? 134 GLN B C     1 
ATOM 1085 O O     . GLN B 2 55 ? 15.510  -28.486 -17.489 1.00 36.90  ? 134 GLN B O     1 
ATOM 1086 C CB    . GLN B 2 55 ? 13.446  -26.258 -16.038 1.00 36.35  ? 134 GLN B CB    1 
ATOM 1087 C CG    . GLN B 2 55 ? 13.216  -26.050 -14.582 1.00 36.77  ? 134 GLN B CG    1 
ATOM 1088 C CD    . GLN B 2 55 ? 11.838  -25.531 -14.283 1.00 36.12  ? 134 GLN B CD    1 
ATOM 1089 O OE1   . GLN B 2 55 ? 11.580  -25.059 -13.176 1.00 38.07  ? 134 GLN B OE1   1 
ATOM 1090 N NE2   . GLN B 2 55 ? 10.943  -25.611 -15.258 1.00 34.60  ? 134 GLN B NE2   1 
ATOM 1091 N N     . ASN B 2 56 ? 14.593  -26.830 -18.744 1.00 37.88  ? 135 ASN B N     1 
ATOM 1092 C CA    . ASN B 2 56 ? 14.564  -27.587 -19.978 1.00 38.54  ? 135 ASN B CA    1 
ATOM 1093 C C     . ASN B 2 56 ? 15.977  -27.936 -20.377 1.00 39.48  ? 135 ASN B C     1 
ATOM 1094 O O     . ASN B 2 56 ? 16.295  -29.112 -20.593 1.00 39.84  ? 135 ASN B O     1 
ATOM 1095 C CB    . ASN B 2 56 ? 13.842  -26.798 -21.082 1.00 38.33  ? 135 ASN B CB    1 
ATOM 1096 C CG    . ASN B 2 56 ? 12.327  -26.799 -20.901 1.00 38.04  ? 135 ASN B CG    1 
ATOM 1097 O OD1   . ASN B 2 56 ? 11.784  -27.698 -20.262 1.00 39.84  ? 135 ASN B OD1   1 
ATOM 1098 N ND2   . ASN B 2 56 ? 11.645  -25.791 -21.445 1.00 36.12  ? 135 ASN B ND2   1 
ATOM 1099 N N     . ARG B 2 57 ? 16.832  -26.916 -20.424 1.00 40.10  ? 136 ARG B N     1 
ATOM 1100 C CA    . ARG B 2 57 ? 18.221  -27.105 -20.794 1.00 40.67  ? 136 ARG B CA    1 
ATOM 1101 C C     . ARG B 2 57 ? 18.906  -28.193 -19.963 1.00 40.72  ? 136 ARG B C     1 
ATOM 1102 O O     . ARG B 2 57 ? 19.716  -28.944 -20.481 1.00 41.12  ? 136 ARG B O     1 
ATOM 1103 C CB    . ARG B 2 57 ? 18.983  -25.782 -20.671 1.00 41.16  ? 136 ARG B CB    1 
ATOM 1104 C CG    . ARG B 2 57 ? 20.475  -25.874 -20.998 1.00 41.60  ? 136 ARG B CG    1 
ATOM 1105 C CD    . ARG B 2 57 ? 20.745  -25.912 -22.507 1.00 42.37  ? 136 ARG B CD    1 
ATOM 1106 N NE    . ARG B 2 57 ? 22.162  -25.679 -22.710 1.00 44.19  ? 136 ARG B NE    1 
ATOM 1107 C CZ    . ARG B 2 57 ? 22.717  -25.236 -23.825 1.00 46.04  ? 136 ARG B CZ    1 
ATOM 1108 N NH1   . ARG B 2 57 ? 21.987  -24.983 -24.898 1.00 46.08  ? 136 ARG B NH1   1 
ATOM 1109 N NH2   . ARG B 2 57 ? 24.025  -25.047 -23.857 1.00 48.40  ? 136 ARG B NH2   1 
ATOM 1110 N N     . ARG B 2 58 ? 18.584  -28.271 -18.681 1.00 40.56  ? 137 ARG B N     1 
ATOM 1111 C CA    . ARG B 2 58 ? 19.204  -29.263 -17.825 1.00 41.04  ? 137 ARG B CA    1 
ATOM 1112 C C     . ARG B 2 58 ? 18.731  -30.657 -18.206 1.00 42.24  ? 137 ARG B C     1 
ATOM 1113 O O     . ARG B 2 58 ? 19.499  -31.633 -18.173 1.00 42.07  ? 137 ARG B O     1 
ATOM 1114 C CB    . ARG B 2 58 ? 18.867  -29.017 -16.353 1.00 40.34  ? 137 ARG B CB    1 
ATOM 1115 C CG    . ARG B 2 58 ? 19.820  -28.133 -15.636 1.00 37.81  ? 137 ARG B CG    1 
ATOM 1116 C CD    . ARG B 2 58 ? 19.657  -28.267 -14.129 1.00 36.59  ? 137 ARG B CD    1 
ATOM 1117 N NE    . ARG B 2 58 ? 18.320  -27.980 -13.575 1.00 34.91  ? 137 ARG B NE    1 
ATOM 1118 C CZ    . ARG B 2 58 ? 17.858  -26.760 -13.265 1.00 33.05  ? 137 ARG B CZ    1 
ATOM 1119 N NH1   . ARG B 2 58 ? 18.590  -25.671 -13.476 1.00 32.80  ? 137 ARG B NH1   1 
ATOM 1120 N NH2   . ARG B 2 58 ? 16.658  -26.628 -12.737 1.00 27.84  ? 137 ARG B NH2   1 
ATOM 1121 N N     . ALA B 2 59 ? 17.448  -30.746 -18.542 1.00 43.62  ? 138 ALA B N     1 
ATOM 1122 C CA    . ALA B 2 59 ? 16.861  -32.020 -18.930 1.00 44.83  ? 138 ALA B CA    1 
ATOM 1123 C C     . ALA B 2 59 ? 17.647  -32.544 -20.137 1.00 45.83  ? 138 ALA B C     1 
ATOM 1124 O O     . ALA B 2 59 ? 18.115  -33.697 -20.120 1.00 45.92  ? 138 ALA B O     1 
ATOM 1125 C CB    . ALA B 2 59 ? 15.406  -31.853 -19.254 1.00 44.36  ? 138 ALA B CB    1 
ATOM 1126 N N     . LYS B 2 60 ? 17.839  -31.677 -21.139 1.00 46.55  ? 139 LYS B N     1 
ATOM 1127 C CA    . LYS B 2 60 ? 18.603  -32.033 -22.318 1.00 47.90  ? 139 LYS B CA    1 
ATOM 1128 C C     . LYS B 2 60 ? 19.952  -32.662 -21.923 1.00 49.11  ? 139 LYS B C     1 
ATOM 1129 O O     . LYS B 2 60 ? 20.292  -33.781 -22.345 1.00 48.95  ? 139 LYS B O     1 
ATOM 1130 C CB    . LYS B 2 60 ? 18.807  -30.811 -23.196 1.00 47.39  ? 139 LYS B CB    1 
ATOM 1131 C CG    . LYS B 2 60 ? 19.207  -31.136 -24.621 1.00 47.41  ? 139 LYS B CG    1 
ATOM 1132 C CD    . LYS B 2 60 ? 19.053  -29.904 -25.510 1.00 50.07  ? 139 LYS B CD    1 
ATOM 1133 C CE    . LYS B 2 60 ? 19.928  -29.999 -26.770 1.00 52.30  ? 139 LYS B CE    1 
ATOM 1134 N NZ    . LYS B 2 60 ? 20.048  -28.662 -27.453 1.00 52.50  ? 139 LYS B NZ    1 
ATOM 1135 N N     . TRP B 2 61 ? 20.686  -31.948 -21.076 1.00 50.42  ? 140 TRP B N     1 
ATOM 1136 C CA    . TRP B 2 61 ? 21.985  -32.388 -20.624 1.00 51.99  ? 140 TRP B CA    1 
ATOM 1137 C C     . TRP B 2 61 ? 22.002  -33.744 -19.982 1.00 53.08  ? 140 TRP B C     1 
ATOM 1138 O O     . TRP B 2 61 ? 22.929  -34.518 -20.182 1.00 53.49  ? 140 TRP B O     1 
ATOM 1139 C CB    . TRP B 2 61 ? 22.591  -31.384 -19.653 1.00 52.12  ? 140 TRP B CB    1 
ATOM 1140 C CG    . TRP B 2 61 ? 23.765  -30.775 -20.247 1.00 52.56  ? 140 TRP B CG    1 
ATOM 1141 C CD1   . TRP B 2 61 ? 25.016  -30.682 -19.708 1.00 52.81  ? 140 TRP B CD1   1 
ATOM 1142 C CD2   . TRP B 2 61 ? 23.839  -30.207 -21.558 1.00 52.56  ? 140 TRP B CD2   1 
ATOM 1143 N NE1   . TRP B 2 61 ? 25.863  -30.055 -20.600 1.00 52.99  ? 140 TRP B NE1   1 
ATOM 1144 C CE2   . TRP B 2 61 ? 25.164  -29.761 -21.743 1.00 52.85  ? 140 TRP B CE2   1 
ATOM 1145 C CE3   . TRP B 2 61 ? 22.905  -30.020 -22.590 1.00 51.63  ? 140 TRP B CE3   1 
ATOM 1146 C CZ2   . TRP B 2 61 ? 25.580  -29.141 -22.921 1.00 53.72  ? 140 TRP B CZ2   1 
ATOM 1147 C CZ3   . TRP B 2 61 ? 23.312  -29.399 -23.755 1.00 52.77  ? 140 TRP B CZ3   1 
ATOM 1148 C CH2   . TRP B 2 61 ? 24.640  -28.964 -23.915 1.00 53.32  ? 140 TRP B CH2   1 
ATOM 1149 N N     . ARG B 2 62 ? 20.989  -34.024 -19.186 1.00 54.35  ? 141 ARG B N     1 
ATOM 1150 C CA    . ARG B 2 62 ? 21.041  -35.194 -18.348 1.00 55.28  ? 141 ARG B CA    1 
ATOM 1151 C C     . ARG B 2 62 ? 21.059  -36.453 -19.215 1.00 55.76  ? 141 ARG B C     1 
ATOM 1152 O O     . ARG B 2 62 ? 21.876  -37.356 -18.984 1.00 55.77  ? 141 ARG B O     1 
ATOM 1153 C CB    . ARG B 2 62 ? 19.871  -35.174 -17.374 1.00 55.53  ? 141 ARG B CB    1 
ATOM 1154 C CG    . ARG B 2 62 ? 20.300  -35.373 -15.957 1.00 55.89  ? 141 ARG B CG    1 
ATOM 1155 C CD    . ARG B 2 62 ? 19.142  -35.195 -15.017 1.00 56.16  ? 141 ARG B CD    1 
ATOM 1156 N NE    . ARG B 2 62 ? 19.062  -33.831 -14.532 1.00 57.07  ? 141 ARG B NE    1 
ATOM 1157 C CZ    . ARG B 2 62 ? 18.013  -33.030 -14.687 1.00 57.46  ? 141 ARG B CZ    1 
ATOM 1158 N NH1   . ARG B 2 62 ? 16.916  -33.444 -15.323 1.00 55.91  ? 141 ARG B NH1   1 
ATOM 1159 N NH2   . ARG B 2 62 ? 18.067  -31.808 -14.183 1.00 57.40  ? 141 ARG B NH2   1 
ATOM 1160 N N     . LYS B 2 63 ? 20.191  -36.476 -20.232 1.00 56.10  ? 142 LYS B N     1 
ATOM 1161 C CA    . LYS B 2 63 ? 20.063  -37.632 -21.117 1.00 57.02  ? 142 LYS B CA    1 
ATOM 1162 C C     . LYS B 2 63 ? 21.079  -37.611 -22.263 1.00 56.81  ? 142 LYS B C     1 
ATOM 1163 O O     . LYS B 2 63 ? 22.253  -37.932 -22.063 1.00 56.48  ? 142 LYS B O     1 
ATOM 1164 C CB    . LYS B 2 63 ? 18.627  -37.779 -21.648 1.00 57.43  ? 142 LYS B CB    1 
ATOM 1165 C CG    . LYS B 2 63 ? 18.144  -36.634 -22.526 1.00 59.05  ? 142 LYS B CG    1 
ATOM 1166 C CD    . LYS B 2 63 ? 16.833  -37.000 -23.212 1.00 62.44  ? 142 LYS B CD    1 
ATOM 1167 C CE    . LYS B 2 63 ? 15.980  -35.752 -23.548 1.00 64.78  ? 142 LYS B CE    1 
ATOM 1168 N NZ    . LYS B 2 63 ? 16.474  -34.873 -24.674 1.00 65.12  ? 142 LYS B NZ    1 
ATOM 1169 O "O5'" . DG  C 3 1  ? 3.454   -34.688 -43.434 1.00 74.10  ? 1   DG  C "O5'" 1 
ATOM 1170 C "C5'" . DG  C 3 1  ? 3.320   -35.738 -42.448 1.00 72.33  ? 1   DG  C "C5'" 1 
ATOM 1171 C "C4'" . DG  C 3 1  ? 4.671   -36.179 -41.879 1.00 70.31  ? 1   DG  C "C4'" 1 
ATOM 1172 O "O4'" . DG  C 3 1  ? 5.600   -35.070 -41.812 1.00 68.85  ? 1   DG  C "O4'" 1 
ATOM 1173 C "C3'" . DG  C 3 1  ? 4.711   -36.702 -40.452 1.00 69.47  ? 1   DG  C "C3'" 1 
ATOM 1174 O "O3'" . DG  C 3 1  ? 5.935   -37.419 -40.366 1.00 69.96  ? 1   DG  C "O3'" 1 
ATOM 1175 C "C2'" . DG  C 3 1  ? 4.715   -35.404 -39.636 1.00 67.35  ? 1   DG  C "C2'" 1 
ATOM 1176 C "C1'" . DG  C 3 1  ? 5.687   -34.581 -40.481 1.00 64.72  ? 1   DG  C "C1'" 1 
ATOM 1177 N N9    . DG  C 3 1  ? 5.467   -33.139 -40.595 1.00 63.64  ? 1   DG  C N9    1 
ATOM 1178 C C8    . DG  C 3 1  ? 4.289   -32.419 -40.516 1.00 63.46  ? 1   DG  C C8    1 
ATOM 1179 N N7    . DG  C 3 1  ? 4.449   -31.125 -40.678 1.00 63.12  ? 1   DG  C N7    1 
ATOM 1180 C C5    . DG  C 3 1  ? 5.818   -30.990 -40.888 1.00 62.50  ? 1   DG  C C5    1 
ATOM 1181 C C6    . DG  C 3 1  ? 6.585   -29.828 -41.124 1.00 62.03  ? 1   DG  C C6    1 
ATOM 1182 O O6    . DG  C 3 1  ? 6.158   -28.682 -41.187 1.00 62.28  ? 1   DG  C O6    1 
ATOM 1183 N N1    . DG  C 3 1  ? 7.953   -30.101 -41.292 1.00 63.05  ? 1   DG  C N1    1 
ATOM 1184 C C2    . DG  C 3 1  ? 8.506   -31.387 -41.224 1.00 63.59  ? 1   DG  C C2    1 
ATOM 1185 N N2    . DG  C 3 1  ? 9.837   -31.511 -41.392 1.00 63.04  ? 1   DG  C N2    1 
ATOM 1186 N N3    . DG  C 3 1  ? 7.787   -32.495 -41.003 1.00 62.39  ? 1   DG  C N3    1 
ATOM 1187 C C4    . DG  C 3 1  ? 6.458   -32.218 -40.845 1.00 62.66  ? 1   DG  C C4    1 
ATOM 1188 P P     . DG  C 3 2  ? 6.358   -38.291 -39.080 1.00 72.63  ? 2   DG  C P     1 
ATOM 1189 O OP1   . DG  C 3 2  ? 6.514   -39.711 -39.503 1.00 72.57  ? 2   DG  C OP1   1 
ATOM 1190 O OP2   . DG  C 3 2  ? 5.415   -37.960 -37.975 1.00 71.59  ? 2   DG  C OP2   1 
ATOM 1191 O "O5'" . DG  C 3 2  ? 7.842   -37.753 -38.728 1.00 69.79  ? 2   DG  C "O5'" 1 
ATOM 1192 C "C5'" . DG  C 3 2  ? 8.707   -37.179 -39.720 1.00 66.64  ? 2   DG  C "C5'" 1 
ATOM 1193 C "C4'" . DG  C 3 2  ? 10.037  -36.654 -39.168 1.00 64.16  ? 2   DG  C "C4'" 1 
ATOM 1194 O "O4'" . DG  C 3 2  ? 10.113  -35.189 -39.147 1.00 61.65  ? 2   DG  C "O4'" 1 
ATOM 1195 C "C3'" . DG  C 3 2  ? 10.405  -37.070 -37.757 1.00 63.38  ? 2   DG  C "C3'" 1 
ATOM 1196 O "O3'" . DG  C 3 2  ? 11.803  -37.263 -37.786 1.00 65.29  ? 2   DG  C "O3'" 1 
ATOM 1197 C "C2'" . DG  C 3 2  ? 9.926   -35.880 -36.911 1.00 60.38  ? 2   DG  C "C2'" 1 
ATOM 1198 C "C1'" . DG  C 3 2  ? 10.172  -34.689 -37.825 1.00 56.16  ? 2   DG  C "C1'" 1 
ATOM 1199 N N9    . DG  C 3 2  ? 9.158   -33.653 -37.768 1.00 54.65  ? 2   DG  C N9    1 
ATOM 1200 C C8    . DG  C 3 2  ? 7.803   -33.830 -37.619 1.00 54.41  ? 2   DG  C C8    1 
ATOM 1201 N N7    . DG  C 3 2  ? 7.121   -32.713 -37.618 1.00 53.73  ? 2   DG  C N7    1 
ATOM 1202 C C5    . DG  C 3 2  ? 8.086   -31.734 -37.786 1.00 53.67  ? 2   DG  C C5    1 
ATOM 1203 C C6    . DG  C 3 2  ? 7.938   -30.325 -37.868 1.00 54.02  ? 2   DG  C C6    1 
ATOM 1204 O O6    . DG  C 3 2  ? 6.894   -29.670 -37.799 1.00 54.05  ? 2   DG  C O6    1 
ATOM 1205 N N1    . DG  C 3 2  ? 9.157   -29.665 -38.046 1.00 54.12  ? 2   DG  C N1    1 
ATOM 1206 C C2    . DG  C 3 2  ? 10.375  -30.308 -38.129 1.00 54.43  ? 2   DG  C C2    1 
ATOM 1207 N N2    . DG  C 3 2  ? 11.428  -29.498 -38.290 1.00 54.50  ? 2   DG  C N2    1 
ATOM 1208 N N3    . DG  C 3 2  ? 10.540  -31.634 -38.061 1.00 53.94  ? 2   DG  C N3    1 
ATOM 1209 C C4    . DG  C 3 2  ? 9.350   -32.289 -37.888 1.00 54.09  ? 2   DG  C C4    1 
ATOM 1210 P P     . DC  C 3 3  ? 12.639  -37.396 -36.433 1.00 69.38  ? 3   DC  C P     1 
ATOM 1211 O OP1   . DC  C 3 3  ? 13.973  -37.965 -36.748 1.00 68.13  ? 3   DC  C OP1   1 
ATOM 1212 O OP2   . DC  C 3 3  ? 11.753  -38.051 -35.434 1.00 68.65  ? 3   DC  C OP2   1 
ATOM 1213 O "O5'" . DC  C 3 3  ? 12.818  -35.861 -36.001 1.00 67.62  ? 3   DC  C "O5'" 1 
ATOM 1214 C "C5'" . DC  C 3 3  ? 13.479  -34.926 -36.841 1.00 65.85  ? 3   DC  C "C5'" 1 
ATOM 1215 C "C4'" . DC  C 3 3  ? 13.900  -33.785 -35.945 1.00 64.92  ? 3   DC  C "C4'" 1 
ATOM 1216 O "O4'" . DC  C 3 3  ? 12.821  -32.824 -35.832 1.00 64.40  ? 3   DC  C "O4'" 1 
ATOM 1217 C "C3'" . DC  C 3 3  ? 14.235  -34.218 -34.523 1.00 64.51  ? 3   DC  C "C3'" 1 
ATOM 1218 O "O3'" . DC  C 3 3  ? 15.470  -33.620 -34.147 1.00 65.29  ? 3   DC  C "O3'" 1 
ATOM 1219 C "C2'" . DC  C 3 3  ? 13.065  -33.715 -33.681 1.00 63.64  ? 3   DC  C "C2'" 1 
ATOM 1220 C "C1'" . DC  C 3 3  ? 12.541  -32.533 -34.483 1.00 60.43  ? 3   DC  C "C1'" 1 
ATOM 1221 N N1    . DC  C 3 3  ? 11.075  -32.344 -34.442 1.00 58.54  ? 3   DC  C N1    1 
ATOM 1222 C C2    . DC  C 3 3  ? 10.582  -31.054 -34.648 1.00 58.04  ? 3   DC  C C2    1 
ATOM 1223 O O2    . DC  C 3 3  ? 11.388  -30.138 -34.834 1.00 57.66  ? 3   DC  C O2    1 
ATOM 1224 N N3    . DC  C 3 3  ? 9.233   -30.851 -34.630 1.00 58.27  ? 3   DC  C N3    1 
ATOM 1225 C C4    . DC  C 3 3  ? 8.402   -31.890 -34.429 1.00 58.48  ? 3   DC  C C4    1 
ATOM 1226 N N4    . DC  C 3 3  ? 7.094   -31.631 -34.428 1.00 58.21  ? 3   DC  C N4    1 
ATOM 1227 C C5    . DC  C 3 3  ? 8.881   -33.227 -34.218 1.00 57.36  ? 3   DC  C C5    1 
ATOM 1228 C C6    . DC  C 3 3  ? 10.214  -33.401 -34.242 1.00 57.89  ? 3   DC  C C6    1 
ATOM 1229 P P     . DT  C 3 4  ? 16.233  -33.910 -32.757 1.00 65.07  ? 4   DT  C P     1 
ATOM 1230 O OP1   . DT  C 3 4  ? 17.664  -34.092 -33.106 1.00 65.91  ? 4   DT  C OP1   1 
ATOM 1231 O OP2   . DT  C 3 4  ? 15.530  -34.936 -31.957 1.00 62.44  ? 4   DT  C OP2   1 
ATOM 1232 O "O5'" . DT  C 3 4  ? 16.105  -32.454 -32.093 1.00 64.33  ? 4   DT  C "O5'" 1 
ATOM 1233 C "C5'" . DT  C 3 4  ? 16.702  -31.325 -32.760 1.00 60.66  ? 4   DT  C "C5'" 1 
ATOM 1234 C "C4'" . DT  C 3 4  ? 16.051  -30.043 -32.281 1.00 59.31  ? 4   DT  C "C4'" 1 
ATOM 1235 O "O4'" . DT  C 3 4  ? 14.602  -30.142 -32.423 1.00 58.84  ? 4   DT  C "O4'" 1 
ATOM 1236 C "C3'" . DT  C 3 4  ? 16.303  -29.658 -30.814 1.00 57.61  ? 4   DT  C "C3'" 1 
ATOM 1237 O "O3'" . DT  C 3 4  ? 16.605  -28.236 -30.715 1.00 55.49  ? 4   DT  C "O3'" 1 
ATOM 1238 C "C2'" . DT  C 3 4  ? 14.970  -30.040 -30.155 1.00 56.95  ? 4   DT  C "C2'" 1 
ATOM 1239 C "C1'" . DT  C 3 4  ? 14.011  -29.588 -31.263 1.00 55.86  ? 4   DT  C "C1'" 1 
ATOM 1240 N N1    . DT  C 3 4  ? 12.581  -30.031 -31.189 1.00 54.17  ? 4   DT  C N1    1 
ATOM 1241 C C2    . DT  C 3 4  ? 11.565  -29.101 -31.295 1.00 53.86  ? 4   DT  C C2    1 
ATOM 1242 O O2    . DT  C 3 4  ? 11.756  -27.905 -31.445 1.00 53.42  ? 4   DT  C O2    1 
ATOM 1243 N N3    . DT  C 3 4  ? 10.294  -29.638 -31.220 1.00 54.05  ? 4   DT  C N3    1 
ATOM 1244 C C4    . DT  C 3 4  ? 9.941   -30.981 -31.062 1.00 54.20  ? 4   DT  C C4    1 
ATOM 1245 O O4    . DT  C 3 4  ? 8.767   -31.368 -31.011 1.00 53.32  ? 4   DT  C O4    1 
ATOM 1246 C C5    . DT  C 3 4  ? 11.066  -31.886 -30.955 1.00 53.76  ? 4   DT  C C5    1 
ATOM 1247 C C7    . DT  C 3 4  ? 10.869  -33.358 -30.766 1.00 54.08  ? 4   DT  C C7    1 
ATOM 1248 C C6    . DT  C 3 4  ? 12.302  -31.374 -31.024 1.00 54.27  ? 4   DT  C C6    1 
ATOM 1249 P P     . DT  C 3 5  ? 17.015  -27.555 -29.319 1.00 53.42  ? 5   DT  C P     1 
ATOM 1250 O OP1   . DT  C 3 5  ? 17.799  -26.327 -29.614 1.00 53.39  ? 5   DT  C OP1   1 
ATOM 1251 O OP2   . DT  C 3 5  ? 17.553  -28.630 -28.458 1.00 52.08  ? 5   DT  C OP2   1 
ATOM 1252 O "O5'" . DT  C 3 5  ? 15.622  -27.065 -28.729 1.00 51.63  ? 5   DT  C "O5'" 1 
ATOM 1253 C "C5'" . DT  C 3 5  ? 15.071  -25.820 -29.181 1.00 49.12  ? 5   DT  C "C5'" 1 
ATOM 1254 C "C4'" . DT  C 3 5  ? 13.803  -25.565 -28.388 1.00 48.19  ? 5   DT  C "C4'" 1 
ATOM 1255 O "O4'" . DT  C 3 5  ? 12.864  -26.656 -28.616 1.00 48.72  ? 5   DT  C "O4'" 1 
ATOM 1256 C "C3'" . DT  C 3 5  ? 13.981  -25.508 -26.868 1.00 47.05  ? 5   DT  C "C3'" 1 
ATOM 1257 O "O3'" . DT  C 3 5  ? 13.122  -24.519 -26.344 1.00 45.08  ? 5   DT  C "O3'" 1 
ATOM 1258 C "C2'" . DT  C 3 5  ? 13.573  -26.906 -26.394 1.00 46.86  ? 5   DT  C "C2'" 1 
ATOM 1259 C "C1'" . DT  C 3 5  ? 12.401  -27.102 -27.353 1.00 47.09  ? 5   DT  C "C1'" 1 
ATOM 1260 N N1    . DT  C 3 5  ? 11.789  -28.468 -27.430 1.00 46.56  ? 5   DT  C N1    1 
ATOM 1261 C C2    . DT  C 3 5  ? 10.422  -28.515 -27.666 1.00 46.34  ? 5   DT  C C2    1 
ATOM 1262 O O2    . DT  C 3 5  ? 9.735   -27.507 -27.815 1.00 45.86  ? 5   DT  C O2    1 
ATOM 1263 N N3    . DT  C 3 5  ? 9.896   -29.787 -27.717 1.00 45.49  ? 5   DT  C N3    1 
ATOM 1264 C C4    . DT  C 3 5  ? 10.589  -30.979 -27.572 1.00 46.34  ? 5   DT  C C4    1 
ATOM 1265 O O4    . DT  C 3 5  ? 10.042  -32.074 -27.640 1.00 46.74  ? 5   DT  C O4    1 
ATOM 1266 C C5    . DT  C 3 5  ? 12.009  -30.860 -27.337 1.00 46.24  ? 5   DT  C C5    1 
ATOM 1267 C C7    . DT  C 3 5  ? 12.821  -32.112 -27.161 1.00 46.23  ? 5   DT  C C7    1 
ATOM 1268 C C6    . DT  C 3 5  ? 12.546  -29.624 -27.279 1.00 46.17  ? 5   DT  C C6    1 
ATOM 1269 P P     . DA  C 3 6  ? 13.722  -23.206 -25.671 1.00 43.44  ? 6   DA  C P     1 
ATOM 1270 O OP1   . DA  C 3 6  ? 14.414  -22.410 -26.708 1.00 41.99  ? 6   DA  C OP1   1 
ATOM 1271 O OP2   . DA  C 3 6  ? 14.310  -23.561 -24.368 1.00 40.60  ? 6   DA  C OP2   1 
ATOM 1272 O "O5'" . DA  C 3 6  ? 12.377  -22.458 -25.333 1.00 42.80  ? 6   DA  C "O5'" 1 
ATOM 1273 C "C5'" . DA  C 3 6  ? 11.542  -21.932 -26.337 1.00 41.19  ? 6   DA  C "C5'" 1 
ATOM 1274 C "C4'" . DA  C 3 6  ? 10.129  -21.953 -25.789 1.00 41.96  ? 6   DA  C "C4'" 1 
ATOM 1275 O "O4'" . DA  C 3 6  ? 9.679   -23.324 -25.825 1.00 42.24  ? 6   DA  C "O4'" 1 
ATOM 1276 C "C3'" . DA  C 3 6  ? 9.917   -21.505 -24.340 1.00 41.31  ? 6   DA  C "C3'" 1 
ATOM 1277 O "O3'" . DA  C 3 6  ? 8.777   -20.750 -24.362 1.00 41.35  ? 6   DA  C "O3'" 1 
ATOM 1278 C "C2'" . DA  C 3 6  ? 9.704   -22.807 -23.566 1.00 42.33  ? 6   DA  C "C2'" 1 
ATOM 1279 C "C1'" . DA  C 3 6  ? 9.083   -23.709 -24.623 1.00 42.29  ? 6   DA  C "C1'" 1 
ATOM 1280 N N9    . DA  C 3 6  ? 9.472   -25.098 -24.567 1.00 42.09  ? 6   DA  C N9    1 
ATOM 1281 C C8    . DA  C 3 6  ? 10.725  -25.597 -24.415 1.00 42.48  ? 6   DA  C C8    1 
ATOM 1282 N N7    . DA  C 3 6  ? 10.770  -26.902 -24.415 1.00 42.61  ? 6   DA  C N7    1 
ATOM 1283 C C5    . DA  C 3 6  ? 9.456   -27.269 -24.604 1.00 41.92  ? 6   DA  C C5    1 
ATOM 1284 C C6    . DA  C 3 6  ? 8.824   -28.520 -24.713 1.00 42.67  ? 6   DA  C C6    1 
ATOM 1285 N N6    . DA  C 3 6  ? 9.474   -29.683 -24.647 1.00 42.37  ? 6   DA  C N6    1 
ATOM 1286 N N1    . DA  C 3 6  ? 7.485   -28.534 -24.902 1.00 42.96  ? 6   DA  C N1    1 
ATOM 1287 C C2    . DA  C 3 6  ? 6.820   -27.375 -24.974 1.00 43.00  ? 6   DA  C C2    1 
ATOM 1288 N N3    . DA  C 3 6  ? 7.318   -26.144 -24.886 1.00 44.13  ? 6   DA  C N3    1 
ATOM 1289 C C4    . DA  C 3 6  ? 8.649   -26.170 -24.706 1.00 42.27  ? 6   DA  C C4    1 
ATOM 1290 P P     . DA  C 3 7  ? 8.085   -20.185 -23.058 1.00 44.65  ? 7   DA  C P     1 
ATOM 1291 O OP1   . DA  C 3 7  ? 7.378   -18.971 -23.524 1.00 45.95  ? 7   DA  C OP1   1 
ATOM 1292 O OP2   . DA  C 3 7  ? 9.015   -20.112 -21.908 1.00 45.21  ? 7   DA  C OP2   1 
ATOM 1293 O "O5'" . DA  C 3 7  ? 7.010   -21.300 -22.708 1.00 44.43  ? 7   DA  C "O5'" 1 
ATOM 1294 C "C5'" . DA  C 3 7  ? 5.801   -21.366 -23.416 1.00 43.84  ? 7   DA  C "C5'" 1 
ATOM 1295 C "C4'" . DA  C 3 7  ? 4.990   -22.492 -22.827 1.00 44.13  ? 7   DA  C "C4'" 1 
ATOM 1296 O "O4'" . DA  C 3 7  ? 5.770   -23.709 -22.885 1.00 44.73  ? 7   DA  C "O4'" 1 
ATOM 1297 C "C3'" . DA  C 3 7  ? 4.622   -22.287 -21.369 1.00 44.92  ? 7   DA  C "C3'" 1 
ATOM 1298 O "O3'" . DA  C 3 7  ? 3.211   -22.110 -21.349 1.00 45.76  ? 7   DA  C "O3'" 1 
ATOM 1299 C "C2'" . DA  C 3 7  ? 5.119   -23.566 -20.664 1.00 45.57  ? 7   DA  C "C2'" 1 
ATOM 1300 C "C1'" . DA  C 3 7  ? 5.389   -24.536 -21.817 1.00 44.95  ? 7   DA  C "C1'" 1 
ATOM 1301 N N9    . DA  C 3 7  ? 6.505   -25.457 -21.651 1.00 44.70  ? 7   DA  C N9    1 
ATOM 1302 C C8    . DA  C 3 7  ? 7.828   -25.126 -21.568 1.00 44.99  ? 7   DA  C C8    1 
ATOM 1303 N N7    . DA  C 3 7  ? 8.648   -26.151 -21.443 1.00 44.80  ? 7   DA  C N7    1 
ATOM 1304 C C5    . DA  C 3 7  ? 7.802   -27.236 -21.443 1.00 45.27  ? 7   DA  C C5    1 
ATOM 1305 C C6    . DA  C 3 7  ? 8.057   -28.633 -21.346 1.00 45.77  ? 7   DA  C C6    1 
ATOM 1306 N N6    . DA  C 3 7  ? 9.294   -29.140 -21.215 1.00 43.88  ? 7   DA  C N6    1 
ATOM 1307 N N1    . DA  C 3 7  ? 6.969   -29.471 -21.401 1.00 45.58  ? 7   DA  C N1    1 
ATOM 1308 C C2    . DA  C 3 7  ? 5.740   -28.918 -21.542 1.00 44.92  ? 7   DA  C C2    1 
ATOM 1309 N N3    . DA  C 3 7  ? 5.386   -27.624 -21.635 1.00 43.52  ? 7   DA  C N3    1 
ATOM 1310 C C4    . DA  C 3 7  ? 6.470   -26.827 -21.584 1.00 44.84  ? 7   DA  C C4    1 
ATOM 1311 P P     . DT  C 3 8  ? 2.348   -22.120 -19.999 1.00 46.32  ? 8   DT  C P     1 
ATOM 1312 O OP1   . DT  C 3 8  ? 1.048   -21.576 -20.403 1.00 48.77  ? 8   DT  C OP1   1 
ATOM 1313 O OP2   . DT  C 3 8  ? 3.099   -21.461 -18.919 1.00 46.23  ? 8   DT  C OP2   1 
ATOM 1314 O "O5'" . DT  C 3 8  ? 2.163   -23.659 -19.607 1.00 44.13  ? 8   DT  C "O5'" 1 
ATOM 1315 C "C5'" . DT  C 3 8  ? 1.255   -24.443 -20.310 1.00 42.82  ? 8   DT  C "C5'" 1 
ATOM 1316 C "C4'" . DT  C 3 8  ? 1.170   -25.795 -19.651 1.00 43.07  ? 8   DT  C "C4'" 1 
ATOM 1317 O "O4'" . DT  C 3 8  ? 2.468   -26.414 -19.701 1.00 43.03  ? 8   DT  C "O4'" 1 
ATOM 1318 C "C3'" . DT  C 3 8  ? 0.770   -25.767 -18.187 1.00 43.74  ? 8   DT  C "C3'" 1 
ATOM 1319 O "O3'" . DT  C 3 8  ? -0.474  -26.470 -18.089 1.00 45.60  ? 8   DT  C "O3'" 1 
ATOM 1320 C "C2'" . DT  C 3 8  ? 1.927   -26.455 -17.454 1.00 42.81  ? 8   DT  C "C2'" 1 
ATOM 1321 C "C1'" . DT  C 3 8  ? 2.620   -27.217 -18.571 1.00 41.91  ? 8   DT  C "C1'" 1 
ATOM 1322 N N1    . DT  C 3 8  ? 4.075   -27.478 -18.401 1.00 41.79  ? 8   DT  C N1    1 
ATOM 1323 C C2    . DT  C 3 8  ? 4.509   -28.801 -18.305 1.00 42.46  ? 8   DT  C C2    1 
ATOM 1324 O O2    . DT  C 3 8  ? 3.773   -29.777 -18.342 1.00 41.89  ? 8   DT  C O2    1 
ATOM 1325 N N3    . DT  C 3 8  ? 5.864   -28.965 -18.140 1.00 42.55  ? 8   DT  C N3    1 
ATOM 1326 C C4    . DT  C 3 8  ? 6.817   -27.970 -18.071 1.00 42.26  ? 8   DT  C C4    1 
ATOM 1327 O O4    . DT  C 3 8  ? 8.011   -28.241 -17.937 1.00 41.51  ? 8   DT  C O4    1 
ATOM 1328 C C5    . DT  C 3 8  ? 6.299   -26.617 -18.181 1.00 42.07  ? 8   DT  C C5    1 
ATOM 1329 C C7    . DT  C 3 8  ? 7.239   -25.453 -18.121 1.00 41.87  ? 8   DT  C C7    1 
ATOM 1330 C C6    . DT  C 3 8  ? 4.976   -26.432 -18.339 1.00 41.48  ? 8   DT  C C6    1 
ATOM 1331 P P     . DT  C 3 9  ? -1.263  -26.633 -16.701 1.00 46.59  ? 9   DT  C P     1 
ATOM 1332 O OP1   . DT  C 3 9  ? -2.680  -26.900 -17.041 1.00 46.02  ? 9   DT  C OP1   1 
ATOM 1333 O OP2   . DT  C 3 9  ? -0.901  -25.475 -15.837 1.00 45.36  ? 9   DT  C OP2   1 
ATOM 1334 O "O5'" . DT  C 3 9  ? -0.673  -27.996 -16.119 1.00 45.33  ? 9   DT  C "O5'" 1 
ATOM 1335 C "C5'" . DT  C 3 9  ? -0.950  -29.161 -16.891 1.00 46.46  ? 9   DT  C "C5'" 1 
ATOM 1336 C "C4'" . DT  C 3 9  ? -0.441  -30.398 -16.190 1.00 47.51  ? 9   DT  C "C4'" 1 
ATOM 1337 O "O4'" . DT  C 3 9  ? 1.002   -30.437 -16.271 1.00 46.32  ? 9   DT  C "O4'" 1 
ATOM 1338 C "C3'" . DT  C 3 9  ? -0.780  -30.441 -14.708 1.00 48.47  ? 9   DT  C "C3'" 1 
ATOM 1339 O "O3'" . DT  C 3 9  ? -1.358  -31.685 -14.448 1.00 51.26  ? 9   DT  C "O3'" 1 
ATOM 1340 C "C2'" . DT  C 3 9  ? 0.542   -30.328 -13.970 1.00 46.47  ? 9   DT  C "C2'" 1 
ATOM 1341 C "C1'" . DT  C 3 9  ? 1.516   -30.827 -15.025 1.00 45.50  ? 9   DT  C "C1'" 1 
ATOM 1342 N N1    . DT  C 3 9  ? 2.887   -30.251 -14.963 1.00 45.34  ? 9   DT  C N1    1 
ATOM 1343 C C2    . DT  C 3 9  ? 3.943   -31.127 -15.022 1.00 45.53  ? 9   DT  C C2    1 
ATOM 1344 O O2    . DT  C 3 9  ? 3.794   -32.325 -15.124 1.00 45.64  ? 9   DT  C O2    1 
ATOM 1345 N N3    . DT  C 3 9  ? 5.184   -30.553 -14.961 1.00 46.15  ? 9   DT  C N3    1 
ATOM 1346 C C4    . DT  C 3 9  ? 5.465   -29.202 -14.859 1.00 45.64  ? 9   DT  C C4    1 
ATOM 1347 O O4    . DT  C 3 9  ? 6.628   -28.815 -14.819 1.00 45.57  ? 9   DT  C O4    1 
ATOM 1348 C C5    . DT  C 3 9  ? 4.309   -28.329 -14.784 1.00 45.05  ? 9   DT  C C5    1 
ATOM 1349 C C7    . DT  C 3 9  ? 4.450   -26.844 -14.655 1.00 44.97  ? 9   DT  C C7    1 
ATOM 1350 C C6    . DT  C 3 9  ? 3.093   -28.888 -14.843 1.00 45.10  ? 9   DT  C C6    1 
ATOM 1351 P P     . DA  C 3 10 ? -2.371  -31.817 -13.221 1.00 52.36  ? 10  DA  C P     1 
ATOM 1352 O OP1   . DA  C 3 10 ? -3.524  -32.582 -13.766 1.00 51.61  ? 10  DA  C OP1   1 
ATOM 1353 O OP2   . DA  C 3 10 ? -2.510  -30.484 -12.574 1.00 51.52  ? 10  DA  C OP2   1 
ATOM 1354 O "O5'" . DA  C 3 10 ? -1.543  -32.778 -12.228 1.00 49.94  ? 10  DA  C "O5'" 1 
ATOM 1355 C "C5'" . DA  C 3 10 ? -1.391  -34.175 -12.544 1.00 45.64  ? 10  DA  C "C5'" 1 
ATOM 1356 C "C4'" . DA  C 3 10 ? -0.313  -34.764 -11.662 1.00 43.08  ? 10  DA  C "C4'" 1 
ATOM 1357 O "O4'" . DA  C 3 10 ? 0.843   -33.978 -11.930 1.00 40.87  ? 10  DA  C "O4'" 1 
ATOM 1358 C "C3'" . DA  C 3 10 ? -0.533  -34.672 -10.155 1.00 43.20  ? 10  DA  C "C3'" 1 
ATOM 1359 O "O3'" . DA  C 3 10 ? -0.618  -36.012 -9.677  1.00 44.15  ? 10  DA  C "O3'" 1 
ATOM 1360 C "C2'" . DA  C 3 10 ? 0.635   -33.837 -9.619  1.00 41.67  ? 10  DA  C "C2'" 1 
ATOM 1361 C "C1'" . DA  C 3 10 ? 1.612   -33.833 -10.770 1.00 40.74  ? 10  DA  C "C1'" 1 
ATOM 1362 N N9    . DA  C 3 10 ? 2.367   -32.609 -11.012 1.00 40.52  ? 10  DA  C N9    1 
ATOM 1363 C C8    . DA  C 3 10 ? 1.880   -31.350 -11.173 1.00 40.41  ? 10  DA  C C8    1 
ATOM 1364 N N7    . DA  C 3 10 ? 2.807   -30.458 -11.408 1.00 40.27  ? 10  DA  C N7    1 
ATOM 1365 C C5    . DA  C 3 10 ? 3.976   -31.182 -11.417 1.00 39.64  ? 10  DA  C C5    1 
ATOM 1366 C C6    . DA  C 3 10 ? 5.322   -30.815 -11.601 1.00 40.65  ? 10  DA  C C6    1 
ATOM 1367 N N6    . DA  C 3 10 ? 5.705   -29.559 -11.852 1.00 40.30  ? 10  DA  C N6    1 
ATOM 1368 N N1    . DA  C 3 10 ? 6.269   -31.790 -11.527 1.00 41.61  ? 10  DA  C N1    1 
ATOM 1369 C C2    . DA  C 3 10 ? 5.886   -33.062 -11.306 1.00 40.87  ? 10  DA  C C2    1 
ATOM 1370 N N3    . DA  C 3 10 ? 4.639   -33.506 -11.106 1.00 40.24  ? 10  DA  C N3    1 
ATOM 1371 C C4    . DA  C 3 10 ? 3.728   -32.512 -11.184 1.00 39.84  ? 10  DA  C C4    1 
ATOM 1372 P P     . DA  C 3 11 ? -0.196  -36.600 -8.246  1.00 45.92  ? 11  DA  C P     1 
ATOM 1373 O OP1   . DA  C 3 11 ? -0.808  -37.950 -8.177  1.00 46.60  ? 11  DA  C OP1   1 
ATOM 1374 O OP2   . DA  C 3 11 ? -0.468  -35.684 -7.117  1.00 47.00  ? 11  DA  C OP2   1 
ATOM 1375 O "O5'" . DA  C 3 11 ? 1.374   -36.706 -8.411  1.00 43.69  ? 11  DA  C "O5'" 1 
ATOM 1376 C "C5'" . DA  C 3 11 ? 2.147   -36.970 -7.282  1.00 42.71  ? 11  DA  C "C5'" 1 
ATOM 1377 C "C4'" . DA  C 3 11 ? 3.594   -36.663 -7.594  1.00 42.29  ? 11  DA  C "C4'" 1 
ATOM 1378 O "O4'" . DA  C 3 11 ? 3.750   -35.448 -8.348  1.00 40.20  ? 11  DA  C "O4'" 1 
ATOM 1379 C "C3'" . DA  C 3 11 ? 4.333   -36.363 -6.320  1.00 44.23  ? 11  DA  C "C3'" 1 
ATOM 1380 O "O3'" . DA  C 3 11 ? 4.709   -37.608 -5.772  1.00 48.03  ? 11  DA  C "O3'" 1 
ATOM 1381 C "C2'" . DA  C 3 11 ? 5.516   -35.505 -6.767  1.00 41.85  ? 11  DA  C "C2'" 1 
ATOM 1382 C "C1'" . DA  C 3 11 ? 5.028   -34.905 -8.079  1.00 39.45  ? 11  DA  C "C1'" 1 
ATOM 1383 N N9    . DA  C 3 11 ? 4.924   -33.448 -8.097  1.00 38.51  ? 11  DA  C N9    1 
ATOM 1384 C C8    . DA  C 3 11 ? 3.778   -32.721 -8.072  1.00 38.50  ? 11  DA  C C8    1 
ATOM 1385 N N7    . DA  C 3 11 ? 3.956   -31.428 -8.114  1.00 38.86  ? 11  DA  C N7    1 
ATOM 1386 C C5    . DA  C 3 11 ? 5.320   -31.287 -8.160  1.00 38.63  ? 11  DA  C C5    1 
ATOM 1387 C C6    . DA  C 3 11 ? 6.152   -30.149 -8.219  1.00 37.84  ? 11  DA  C C6    1 
ATOM 1388 N N6    . DA  C 3 11 ? 5.692   -28.912 -8.228  1.00 37.31  ? 11  DA  C N6    1 
ATOM 1389 N N1    . DA  C 3 11 ? 7.490   -30.333 -8.264  1.00 39.03  ? 11  DA  C N1    1 
ATOM 1390 C C2    . DA  C 3 11 ? 7.953   -31.599 -8.252  1.00 39.72  ? 11  DA  C C2    1 
ATOM 1391 N N3    . DA  C 3 11 ? 7.257   -32.757 -8.195  1.00 39.69  ? 11  DA  C N3    1 
ATOM 1392 C C4    . DA  C 3 11 ? 5.932   -32.527 -8.148  1.00 38.91  ? 11  DA  C C4    1 
ATOM 1393 P P     . DT  C 3 12 ? 4.989   -37.614 -4.222  1.00 52.52  ? 12  DT  C P     1 
ATOM 1394 O OP1   . DT  C 3 12 ? 5.156   -39.003 -3.702  1.00 53.33  ? 12  DT  C OP1   1 
ATOM 1395 O OP2   . DT  C 3 12 ? 3.985   -36.657 -3.675  1.00 51.46  ? 12  DT  C OP2   1 
ATOM 1396 O "O5'" . DT  C 3 12 ? 6.440   -36.953 -4.180  1.00 51.55  ? 12  DT  C "O5'" 1 
ATOM 1397 C "C5'" . DT  C 3 12 ? 7.551   -37.743 -4.544  1.00 50.29  ? 12  DT  C "C5'" 1 
ATOM 1398 C "C4'" . DT  C 3 12 ? 8.755   -36.853 -4.414  1.00 49.40  ? 12  DT  C "C4'" 1 
ATOM 1399 O "O4'" . DT  C 3 12 ? 8.441   -35.565 -5.000  1.00 48.96  ? 12  DT  C "O4'" 1 
ATOM 1400 C "C3'" . DT  C 3 12 ? 9.119   -36.583 -2.966  1.00 49.53  ? 12  DT  C "C3'" 1 
ATOM 1401 O "O3'" . DT  C 3 12 ? 10.281  -37.324 -2.723  1.00 50.80  ? 12  DT  C "O3'" 1 
ATOM 1402 C "C2'" . DT  C 3 12 ? 9.380   -35.074 -2.893  1.00 49.08  ? 12  DT  C "C2'" 1 
ATOM 1403 C "C1'" . DT  C 3 12 ? 9.099   -34.529 -4.295  1.00 46.57  ? 12  DT  C "C1'" 1 
ATOM 1404 N N1    . DT  C 3 12 ? 8.232   -33.307 -4.413  1.00 45.53  ? 12  DT  C N1    1 
ATOM 1405 C C2    . DT  C 3 12 ? 8.809   -32.074 -4.648  1.00 44.50  ? 12  DT  C C2    1 
ATOM 1406 O O2    . DT  C 3 12 ? 9.995   -31.888 -4.728  1.00 44.68  ? 12  DT  C O2    1 
ATOM 1407 N N3    . DT  C 3 12 ? 7.945   -31.023 -4.767  1.00 44.72  ? 12  DT  C N3    1 
ATOM 1408 C C4    . DT  C 3 12 ? 6.563   -31.066 -4.692  1.00 45.94  ? 12  DT  C C4    1 
ATOM 1409 O O4    . DT  C 3 12 ? 5.866   -30.054 -4.821  1.00 46.33  ? 12  DT  C O4    1 
ATOM 1410 C C5    . DT  C 3 12 ? 6.012   -32.381 -4.461  1.00 45.19  ? 12  DT  C C5    1 
ATOM 1411 C C7    . DT  C 3 12 ? 4.534   -32.545 -4.362  1.00 44.38  ? 12  DT  C C7    1 
ATOM 1412 C C6    . DT  C 3 12 ? 6.852   -33.426 -4.332  1.00 45.33  ? 12  DT  C C6    1 
ATOM 1413 P P     . DT  C 3 13 ? 10.860  -37.449 -1.259  1.00 51.17  ? 13  DT  C P     1 
ATOM 1414 O OP1   . DT  C 3 13 ? 11.717  -38.654 -1.207  1.00 51.32  ? 13  DT  C OP1   1 
ATOM 1415 O OP2   . DT  C 3 13 ? 9.707   -37.313 -0.344  1.00 52.75  ? 13  DT  C OP2   1 
ATOM 1416 O "O5'" . DT  C 3 13 ? 11.684  -36.109 -1.110  1.00 47.24  ? 13  DT  C "O5'" 1 
ATOM 1417 C "C5'" . DT  C 3 13 ? 12.940  -35.976 -1.671  1.00 44.90  ? 13  DT  C "C5'" 1 
ATOM 1418 C "C4'" . DT  C 3 13 ? 13.543  -34.735 -1.042  1.00 43.60  ? 13  DT  C "C4'" 1 
ATOM 1419 O "O4'" . DT  C 3 13 ? 12.658  -33.634 -1.342  1.00 40.71  ? 13  DT  C "O4'" 1 
ATOM 1420 C "C3'" . DT  C 3 13 ? 13.701  -34.755 0.484   1.00 42.85  ? 13  DT  C "C3'" 1 
ATOM 1421 O "O3'" . DT  C 3 13 ? 15.010  -34.308 0.781   1.00 43.54  ? 13  DT  C "O3'" 1 
ATOM 1422 C "C2'" . DT  C 3 13 ? 12.621  -33.791 1.001   1.00 41.32  ? 13  DT  C "C2'" 1 
ATOM 1423 C "C1'" . DT  C 3 13 ? 12.457  -32.849 -0.185  1.00 38.97  ? 13  DT  C "C1'" 1 
ATOM 1424 N N1    . DT  C 3 13 ? 11.139  -32.198 -0.463  1.00 38.05  ? 13  DT  C N1    1 
ATOM 1425 C C2    . DT  C 3 13 ? 11.120  -30.855 -0.784  1.00 36.40  ? 13  DT  C C2    1 
ATOM 1426 O O2    . DT  C 3 13 ? 12.125  -30.154 -0.825  1.00 36.92  ? 13  DT  C O2    1 
ATOM 1427 N N3    . DT  C 3 13 ? 9.877   -30.368 -1.062  1.00 34.37  ? 13  DT  C N3    1 
ATOM 1428 C C4    . DT  C 3 13 ? 8.681   -31.052 -1.049  1.00 36.73  ? 13  DT  C C4    1 
ATOM 1429 O O4    . DT  C 3 13 ? 7.616   -30.500 -1.316  1.00 37.88  ? 13  DT  C O4    1 
ATOM 1430 C C5    . DT  C 3 13 ? 8.761   -32.448 -0.701  1.00 37.41  ? 13  DT  C C5    1 
ATOM 1431 C C7    . DT  C 3 13 ? 7.539   -33.321 -0.635  1.00 36.69  ? 13  DT  C C7    1 
ATOM 1432 C C6    . DT  C 3 13 ? 9.982   -32.945 -0.449  1.00 38.81  ? 13  DT  C C6    1 
ATOM 1433 P P     . DG  C 3 14 ? 15.560  -34.351 2.282   1.00 46.02  ? 14  DG  C P     1 
ATOM 1434 O OP1   . DG  C 3 14 ? 17.039  -34.452 2.250   1.00 45.95  ? 14  DG  C OP1   1 
ATOM 1435 O OP2   . DG  C 3 14 ? 14.727  -35.359 2.972   1.00 46.59  ? 14  DG  C OP2   1 
ATOM 1436 O "O5'" . DG  C 3 14 ? 15.226  -32.929 2.880   1.00 43.99  ? 14  DG  C "O5'" 1 
ATOM 1437 C "C5'" . DG  C 3 14 ? 15.944  -31.762 2.462   1.00 43.31  ? 14  DG  C "C5'" 1 
ATOM 1438 C "C4'" . DG  C 3 14 ? 15.301  -30.546 3.113   1.00 43.47  ? 14  DG  C "C4'" 1 
ATOM 1439 O "O4'" . DG  C 3 14 ? 13.976  -30.272 2.539   1.00 42.48  ? 14  DG  C "O4'" 1 
ATOM 1440 C "C3'" . DG  C 3 14 ? 15.083  -30.683 4.622   1.00 42.73  ? 14  DG  C "C3'" 1 
ATOM 1441 O "O3'" . DG  C 3 14 ? 15.274  -29.417 5.108   1.00 46.29  ? 14  DG  C "O3'" 1 
ATOM 1442 C "C2'" . DG  C 3 14 ? 13.617  -31.095 4.723   1.00 40.61  ? 14  DG  C "C2'" 1 
ATOM 1443 C "C1'" . DG  C 3 14 ? 13.046  -30.220 3.607   1.00 39.79  ? 14  DG  C "C1'" 1 
ATOM 1444 N N9    . DG  C 3 14 ? 11.650  -30.473 3.215   1.00 39.93  ? 14  DG  C N9    1 
ATOM 1445 C C8    . DG  C 3 14 ? 10.882  -31.629 3.306   1.00 39.44  ? 14  DG  C C8    1 
ATOM 1446 N N7    . DG  C 3 14 ? 9.645   -31.474 2.889   1.00 38.32  ? 14  DG  C N7    1 
ATOM 1447 C C5    . DG  C 3 14 ? 9.585   -30.128 2.515   1.00 37.79  ? 14  DG  C C5    1 
ATOM 1448 C C6    . DG  C 3 14 ? 8.535   -29.347 1.994   1.00 38.46  ? 14  DG  C C6    1 
ATOM 1449 O O6    . DG  C 3 14 ? 7.377   -29.695 1.739   1.00 40.05  ? 14  DG  C O6    1 
ATOM 1450 N N1    . DG  C 3 14 ? 8.894   -28.027 1.743   1.00 38.93  ? 14  DG  C N1    1 
ATOM 1451 C C2    . DG  C 3 14 ? 10.132  -27.514 1.986   1.00 39.00  ? 14  DG  C C2    1 
ATOM 1452 N N2    . DG  C 3 14 ? 10.329  -26.224 1.712   1.00 38.87  ? 14  DG  C N2    1 
ATOM 1453 N N3    . DG  C 3 14 ? 11.130  -28.228 2.472   1.00 39.90  ? 14  DG  C N3    1 
ATOM 1454 C C4    . DG  C 3 14 ? 10.797  -29.517 2.702   1.00 38.88  ? 14  DG  C C4    1 
ATOM 1455 P P     . DC  C 3 15 ? 16.261  -29.157 6.316   1.00 51.36  ? 15  DC  C P     1 
ATOM 1456 O OP1   . DC  C 3 15 ? 17.643  -28.965 5.810   1.00 52.25  ? 15  DC  C OP1   1 
ATOM 1457 O OP2   . DC  C 3 15 ? 15.953  -30.137 7.394   1.00 50.19  ? 15  DC  C OP2   1 
ATOM 1458 O "O5'" . DC  C 3 15 ? 15.787  -27.712 6.742   1.00 49.95  ? 15  DC  C "O5'" 1 
ATOM 1459 C "C5'" . DC  C 3 15 ? 16.422  -26.663 6.082   1.00 50.25  ? 15  DC  C "C5'" 1 
ATOM 1460 C "C4'" . DC  C 3 15 ? 15.445  -25.534 5.922   1.00 51.59  ? 15  DC  C "C4'" 1 
ATOM 1461 O "O4'" . DC  C 3 15 ? 14.187  -26.028 5.378   1.00 50.33  ? 15  DC  C "O4'" 1 
ATOM 1462 C "C3'" . DC  C 3 15 ? 15.123  -24.815 7.213   1.00 52.25  ? 15  DC  C "C3'" 1 
ATOM 1463 O "O3'" . DC  C 3 15 ? 15.405  -23.483 6.847   1.00 57.69  ? 15  DC  C "O3'" 1 
ATOM 1464 C "C2'" . DC  C 3 15 ? 13.636  -25.119 7.443   1.00 48.93  ? 15  DC  C "C2'" 1 
ATOM 1465 C "C1'" . DC  C 3 15 ? 13.101  -25.442 6.051   1.00 45.15  ? 15  DC  C "C1'" 1 
ATOM 1466 N N1    . DC  C 3 15 ? 11.972  -26.453 5.921   1.00 43.41  ? 15  DC  C N1    1 
ATOM 1467 C C2    . DC  C 3 15 ? 10.760  -26.056 5.337   1.00 39.52  ? 15  DC  C C2    1 
ATOM 1468 O O2    . DC  C 3 15 ? 10.614  -24.886 4.963   1.00 38.74  ? 15  DC  C O2    1 
ATOM 1469 N N3    . DC  C 3 15 ? 9.773   -26.964 5.214   1.00 38.15  ? 15  DC  C N3    1 
ATOM 1470 C C4    . DC  C 3 15 ? 9.935   -28.226 5.634   1.00 41.60  ? 15  DC  C C4    1 
ATOM 1471 N N4    . DC  C 3 15 ? 8.898   -29.086 5.488   1.00 41.93  ? 15  DC  C N4    1 
ATOM 1472 C C5    . DC  C 3 15 ? 11.166  -28.670 6.212   1.00 39.86  ? 15  DC  C C5    1 
ATOM 1473 C C6    . DC  C 3 15 ? 12.149  -27.761 6.323   1.00 41.93  ? 15  DC  C C6    1 
ATOM 1474 P P     . DG  C 3 16 ? 15.560  -22.312 7.922   1.00 62.06  ? 16  DG  C P     1 
ATOM 1475 O OP1   . DG  C 3 16 ? 16.363  -21.210 7.308   1.00 60.28  ? 16  DG  C OP1   1 
ATOM 1476 O OP2   . DG  C 3 16 ? 15.897  -22.945 9.227   1.00 61.07  ? 16  DG  C OP2   1 
ATOM 1477 O "O5'" . DG  C 3 16 ? 14.051  -21.834 8.068   1.00 60.64  ? 16  DG  C "O5'" 1 
ATOM 1478 C "C5'" . DG  C 3 16 ? 13.452  -20.957 7.109   1.00 59.03  ? 16  DG  C "C5'" 1 
ATOM 1479 C "C4'" . DG  C 3 16 ? 12.020  -20.778 7.562   1.00 56.22  ? 16  DG  C "C4'" 1 
ATOM 1480 O "O4'" . DG  C 3 16 ? 11.304  -22.040 7.503   1.00 53.76  ? 16  DG  C "O4'" 1 
ATOM 1481 C "C3'" . DG  C 3 16 ? 11.954  -20.381 9.017   1.00 56.73  ? 16  DG  C "C3'" 1 
ATOM 1482 O "O3'" . DG  C 3 16 ? 10.955  -19.384 9.048   1.00 59.78  ? 16  DG  C "O3'" 1 
ATOM 1483 C "C2'" . DG  C 3 16 ? 11.626  -21.694 9.769   1.00 53.53  ? 16  DG  C "C2'" 1 
ATOM 1484 C "C1'" . DG  C 3 16 ? 10.697  -22.323 8.741   1.00 49.17  ? 16  DG  C "C1'" 1 
ATOM 1485 N N9    . DG  C 3 16 ? 10.378  -23.756 8.808   1.00 47.92  ? 16  DG  C N9    1 
ATOM 1486 C C8    . DG  C 3 16 ? 11.117  -24.827 9.250   1.00 46.81  ? 16  DG  C C8    1 
ATOM 1487 N N7    . DG  C 3 16 ? 10.494  -25.971 9.145   1.00 46.30  ? 16  DG  C N7    1 
ATOM 1488 C C5    . DG  C 3 16 ? 9.250   -25.642 8.613   1.00 46.57  ? 16  DG  C C5    1 
ATOM 1489 C C6    . DG  C 3 16 ? 8.122   -26.443 8.275   1.00 46.57  ? 16  DG  C C6    1 
ATOM 1490 O O6    . DG  C 3 16 ? 7.959   -27.664 8.376   1.00 47.56  ? 16  DG  C O6    1 
ATOM 1491 N N1    . DG  C 3 16 ? 7.078   -25.699 7.763   1.00 46.39  ? 16  DG  C N1    1 
ATOM 1492 C C2    . DG  C 3 16 ? 7.104   -24.333 7.587   1.00 47.27  ? 16  DG  C C2    1 
ATOM 1493 N N2    . DG  C 3 16 ? 5.982   -23.774 7.084   1.00 47.41  ? 16  DG  C N2    1 
ATOM 1494 N N3    . DG  C 3 16 ? 8.146   -23.563 7.892   1.00 46.30  ? 16  DG  C N3    1 
ATOM 1495 C C4    . DG  C 3 16 ? 9.174   -24.283 8.402   1.00 46.81  ? 16  DG  C C4    1 
ATOM 1496 P P     . DG  C 3 17 ? 10.668  -18.738 10.471  1.00 62.51  ? 17  DG  C P     1 
ATOM 1497 O OP1   . DG  C 3 17 ? 11.773  -17.751 10.591  1.00 62.21  ? 17  DG  C OP1   1 
ATOM 1498 O OP2   . DG  C 3 17 ? 10.474  -19.842 11.467  1.00 60.87  ? 17  DG  C OP2   1 
ATOM 1499 O "O5'" . DG  C 3 17 ? 9.265   -17.952 10.354  1.00 60.71  ? 17  DG  C "O5'" 1 
ATOM 1500 C "C5'" . DG  C 3 17 ? 8.298   -18.206 9.331   1.00 58.11  ? 17  DG  C "C5'" 1 
ATOM 1501 C "C4'" . DG  C 3 17 ? 7.086   -18.985 9.822   1.00 54.28  ? 17  DG  C "C4'" 1 
ATOM 1502 O "O4'" . DG  C 3 17 ? 7.325   -20.411 9.667   1.00 52.59  ? 17  DG  C "O4'" 1 
ATOM 1503 C "C3'" . DG  C 3 17 ? 6.653   -18.787 11.278  1.00 53.79  ? 17  DG  C "C3'" 1 
ATOM 1504 O "O3'" . DG  C 3 17 ? 5.299   -18.392 11.312  1.00 55.20  ? 17  DG  C "O3'" 1 
ATOM 1505 C "C2'" . DG  C 3 17 ? 6.735   -20.179 11.888  1.00 51.87  ? 17  DG  C "C2'" 1 
ATOM 1506 C "C1'" . DG  C 3 17 ? 6.498   -21.022 10.640  1.00 48.44  ? 17  DG  C "C1'" 1 
ATOM 1507 N N9    . DG  C 3 17 ? 6.898   -22.387 10.894  1.00 46.43  ? 17  DG  C N9    1 
ATOM 1508 C C8    . DG  C 3 17 ? 8.147   -22.804 11.275  1.00 46.18  ? 17  DG  C C8    1 
ATOM 1509 N N7    . DG  C 3 17 ? 8.220   -24.095 11.469  1.00 46.14  ? 17  DG  C N7    1 
ATOM 1510 C C5    . DG  C 3 17 ? 6.930   -24.545 11.199  1.00 45.74  ? 17  DG  C C5    1 
ATOM 1511 C C6    . DG  C 3 17 ? 6.395   -25.863 11.238  1.00 46.20  ? 17  DG  C C6    1 
ATOM 1512 O O6    . DG  C 3 17 ? 6.961   -26.923 11.530  1.00 45.78  ? 17  DG  C O6    1 
ATOM 1513 N N1    . DG  C 3 17 ? 5.045   -25.890 10.899  1.00 46.63  ? 17  DG  C N1    1 
ATOM 1514 C C2    . DG  C 3 17 ? 4.315   -24.776 10.564  1.00 46.30  ? 17  DG  C C2    1 
ATOM 1515 N N2    . DG  C 3 17 ? 3.036   -25.029 10.281  1.00 45.93  ? 17  DG  C N2    1 
ATOM 1516 N N3    . DG  C 3 17 ? 4.802   -23.533 10.516  1.00 45.03  ? 17  DG  C N3    1 
ATOM 1517 C C4    . DG  C 3 17 ? 6.108   -23.496 10.846  1.00 44.82  ? 17  DG  C C4    1 
ATOM 1518 O "O5'" . DC  D 4 1  ? 1.008   -33.516 9.378   1.00 65.06  ? 1   DC  D "O5'" 1 
ATOM 1519 C "C5'" . DC  D 4 1  ? -0.401  -33.357 9.573   1.00 63.96  ? 1   DC  D "C5'" 1 
ATOM 1520 C "C4'" . DC  D 4 1  ? -0.775  -31.944 9.998   1.00 63.20  ? 1   DC  D "C4'" 1 
ATOM 1521 O "O4'" . DC  D 4 1  ? 0.114   -31.466 11.035  1.00 62.50  ? 1   DC  D "O4'" 1 
ATOM 1522 C "C3'" . DC  D 4 1  ? -0.650  -30.926 8.884   1.00 63.17  ? 1   DC  D "C3'" 1 
ATOM 1523 O "O3'" . DC  D 4 1  ? -1.887  -30.854 8.260   1.00 65.21  ? 1   DC  D "O3'" 1 
ATOM 1524 C "C2'" . DC  D 4 1  ? -0.332  -29.617 9.584   1.00 61.24  ? 1   DC  D "C2'" 1 
ATOM 1525 C "C1'" . DC  D 4 1  ? 0.408   -30.094 10.828  1.00 59.24  ? 1   DC  D "C1'" 1 
ATOM 1526 N N1    . DC  D 4 1  ? 1.889   -29.905 10.769  1.00 57.21  ? 1   DC  D N1    1 
ATOM 1527 C C2    . DC  D 4 1  ? 2.424   -28.609 10.898  1.00 57.24  ? 1   DC  D C2    1 
ATOM 1528 O O2    . DC  D 4 1  ? 1.654   -27.647 11.045  1.00 57.85  ? 1   DC  D O2    1 
ATOM 1529 N N3    . DC  D 4 1  ? 3.773   -28.423 10.856  1.00 56.15  ? 1   DC  D N3    1 
ATOM 1530 C C4    . DC  D 4 1  ? 4.570   -29.479 10.702  1.00 57.02  ? 1   DC  D C4    1 
ATOM 1531 N N4    . DC  D 4 1  ? 5.889   -29.258 10.663  1.00 56.93  ? 1   DC  D N4    1 
ATOM 1532 C C5    . DC  D 4 1  ? 4.042   -30.807 10.566  1.00 56.99  ? 1   DC  D C5    1 
ATOM 1533 C C6    . DC  D 4 1  ? 2.713   -30.979 10.605  1.00 56.18  ? 1   DC  D C6    1 
ATOM 1534 P P     . DC  D 4 2  ? -1.917  -30.521 6.701   1.00 67.94  ? 2   DC  D P     1 
ATOM 1535 O OP1   . DC  D 4 2  ? -3.344  -30.554 6.296   1.00 68.51  ? 2   DC  D OP1   1 
ATOM 1536 O OP2   . DC  D 4 2  ? -0.902  -31.366 6.006   1.00 67.23  ? 2   DC  D OP2   1 
ATOM 1537 O "O5'" . DC  D 4 2  ? -1.416  -29.000 6.647   1.00 65.95  ? 2   DC  D "O5'" 1 
ATOM 1538 C "C5'" . DC  D 4 2  ? -2.202  -27.905 7.136   1.00 60.75  ? 2   DC  D "C5'" 1 
ATOM 1539 C "C4'" . DC  D 4 2  ? -1.366  -26.673 6.871   1.00 57.53  ? 2   DC  D "C4'" 1 
ATOM 1540 O "O4'" . DC  D 4 2  ? -0.136  -26.812 7.625   1.00 56.62  ? 2   DC  D "O4'" 1 
ATOM 1541 C "C3'" . DC  D 4 2  ? -0.936  -26.586 5.416   1.00 54.87  ? 2   DC  D "C3'" 1 
ATOM 1542 O "O3'" . DC  D 4 2  ? -1.790  -25.698 4.721   1.00 52.42  ? 2   DC  D "O3'" 1 
ATOM 1543 C "C2'" . DC  D 4 2  ? 0.495   -26.069 5.462   1.00 54.33  ? 2   DC  D "C2'" 1 
ATOM 1544 C "C1'" . DC  D 4 2  ? 0.939   -26.257 6.898   1.00 53.71  ? 2   DC  D "C1'" 1 
ATOM 1545 N N1    . DC  D 4 2  ? 2.130   -27.139 7.007   1.00 53.38  ? 2   DC  D N1    1 
ATOM 1546 C C2    . DC  D 4 2  ? 3.385   -26.539 7.092   1.00 52.62  ? 2   DC  D C2    1 
ATOM 1547 O O2    . DC  D 4 2  ? 3.461   -25.302 7.074   1.00 54.00  ? 2   DC  D O2    1 
ATOM 1548 N N3    . DC  D 4 2  ? 4.481   -27.324 7.199   1.00 51.61  ? 2   DC  D N3    1 
ATOM 1549 C C4    . DC  D 4 2  ? 4.369   -28.648 7.225   1.00 52.14  ? 2   DC  D C4    1 
ATOM 1550 N N4    . DC  D 4 2  ? 5.502   -29.340 7.332   1.00 53.17  ? 2   DC  D N4    1 
ATOM 1551 C C5    . DC  D 4 2  ? 3.106   -29.304 7.137   1.00 52.85  ? 2   DC  D C5    1 
ATOM 1552 C C6    . DC  D 4 2  ? 2.021   -28.512 7.025   1.00 54.45  ? 2   DC  D C6    1 
ATOM 1553 P P     . DG  D 4 3  ? -1.682  -25.496 3.128   1.00 51.27  ? 3   DG  D P     1 
ATOM 1554 O OP1   . DG  D 4 3  ? -2.933  -24.798 2.781   1.00 52.91  ? 3   DG  D OP1   1 
ATOM 1555 O OP2   . DG  D 4 3  ? -1.333  -26.755 2.422   1.00 49.81  ? 3   DG  D OP2   1 
ATOM 1556 O "O5'" . DG  D 4 3  ? -0.419  -24.502 2.949   1.00 48.57  ? 3   DG  D "O5'" 1 
ATOM 1557 C "C5'" . DG  D 4 3  ? -0.374  -23.264 3.626   1.00 45.30  ? 3   DG  D "C5'" 1 
ATOM 1558 C "C4'" . DG  D 4 3  ? 0.857   -22.455 3.247   1.00 44.51  ? 3   DG  D "C4'" 1 
ATOM 1559 O "O4'" . DG  D 4 3  ? 2.091   -22.954 3.853   1.00 43.04  ? 3   DG  D "O4'" 1 
ATOM 1560 C "C3'" . DG  D 4 3  ? 1.124   -22.243 1.770   1.00 42.22  ? 3   DG  D "C3'" 1 
ATOM 1561 O "O3'" . DG  D 4 3  ? 1.485   -20.886 1.611   1.00 44.12  ? 3   DG  D "O3'" 1 
ATOM 1562 C "C2'" . DG  D 4 3  ? 2.314   -23.142 1.522   1.00 41.38  ? 3   DG  D "C2'" 1 
ATOM 1563 C "C1'" . DG  D 4 3  ? 3.053   -23.174 2.856   1.00 40.73  ? 3   DG  D "C1'" 1 
ATOM 1564 N N9    . DG  D 4 3  ? 3.581   -24.488 3.199   1.00 40.32  ? 3   DG  D N9    1 
ATOM 1565 C C8    . DG  D 4 3  ? 2.881   -25.673 3.203   1.00 39.29  ? 3   DG  D C8    1 
ATOM 1566 N N7    . DG  D 4 3  ? 3.596   -26.695 3.568   1.00 39.44  ? 3   DG  D N7    1 
ATOM 1567 C C5    . DG  D 4 3  ? 4.835   -26.142 3.822   1.00 39.09  ? 3   DG  D C5    1 
ATOM 1568 C C6    . DG  D 4 3  ? 6.007   -26.770 4.245   1.00 39.48  ? 3   DG  D C6    1 
ATOM 1569 O O6    . DG  D 4 3  ? 6.159   -27.975 4.478   1.00 40.31  ? 3   DG  D O6    1 
ATOM 1570 N N1    . DG  D 4 3  ? 7.058   -25.871 4.380   1.00 39.36  ? 3   DG  D N1    1 
ATOM 1571 C C2    . DG  D 4 3  ? 6.977   -24.521 4.132   1.00 39.26  ? 3   DG  D C2    1 
ATOM 1572 N N2    . DG  D 4 3  ? 8.095   -23.800 4.337   1.00 39.21  ? 3   DG  D N2    1 
ATOM 1573 N N3    . DG  D 4 3  ? 5.867   -23.920 3.734   1.00 39.06  ? 3   DG  D N3    1 
ATOM 1574 C C4    . DG  D 4 3  ? 4.849   -24.790 3.602   1.00 39.18  ? 3   DG  D C4    1 
ATOM 1575 P P     . DC  D 4 4  ? 1.680   -20.240 0.148   1.00 48.84  ? 4   DC  D P     1 
ATOM 1576 O OP1   . DC  D 4 4  ? 1.378   -18.800 0.273   1.00 49.23  ? 4   DC  D OP1   1 
ATOM 1577 O OP2   . DC  D 4 4  ? 0.997   -21.067 -0.900  1.00 47.47  ? 4   DC  D OP2   1 
ATOM 1578 O "O5'" . DC  D 4 4  ? 3.256   -20.392 -0.147  1.00 47.01  ? 4   DC  D "O5'" 1 
ATOM 1579 C "C5'" . DC  D 4 4  ? 4.243   -20.093 0.853   1.00 44.39  ? 4   DC  D "C5'" 1 
ATOM 1580 C "C4'" . DC  D 4 4  ? 5.592   -20.689 0.472   1.00 42.58  ? 4   DC  D "C4'" 1 
ATOM 1581 O "O4'" . DC  D 4 4  ? 5.747   -22.072 0.908   1.00 40.63  ? 4   DC  D "O4'" 1 
ATOM 1582 C "C3'" . DC  D 4 4  ? 5.840   -20.670 -1.031  1.00 41.59  ? 4   DC  D "C3'" 1 
ATOM 1583 O "O3'" . DC  D 4 4  ? 6.804   -19.672 -1.206  1.00 41.36  ? 4   DC  D "O3'" 1 
ATOM 1584 C "C2'" . DC  D 4 4  ? 6.295   -22.088 -1.399  1.00 39.68  ? 4   DC  D "C2'" 1 
ATOM 1585 C "C1'" . DC  D 4 4  ? 6.480   -22.804 -0.056  1.00 38.80  ? 4   DC  D "C1'" 1 
ATOM 1586 N N1    . DC  D 4 4  ? 6.092   -24.258 0.107   1.00 37.19  ? 4   DC  D N1    1 
ATOM 1587 C C2    . DC  D 4 4  ? 7.027   -25.124 0.679   1.00 38.36  ? 4   DC  D C2    1 
ATOM 1588 O O2    . DC  D 4 4  ? 8.140   -24.696 1.003   1.00 38.96  ? 4   DC  D O2    1 
ATOM 1589 N N3    . DC  D 4 4  ? 6.712   -26.427 0.867   1.00 38.31  ? 4   DC  D N3    1 
ATOM 1590 C C4    . DC  D 4 4  ? 5.504   -26.872 0.523   1.00 37.96  ? 4   DC  D C4    1 
ATOM 1591 N N4    . DC  D 4 4  ? 5.278   -28.161 0.754   1.00 37.62  ? 4   DC  D N4    1 
ATOM 1592 C C5    . DC  D 4 4  ? 4.506   -26.022 -0.047  1.00 36.44  ? 4   DC  D C5    1 
ATOM 1593 C C6    . DC  D 4 4  ? 4.854   -24.736 -0.226  1.00 37.42  ? 4   DC  D C6    1 
ATOM 1594 P P     . DA  D 4 5  ? 7.330   -19.371 -2.661  1.00 43.61  ? 5   DA  D P     1 
ATOM 1595 O OP1   . DA  D 4 5  ? 7.490   -17.919 -2.828  1.00 43.93  ? 5   DA  D OP1   1 
ATOM 1596 O OP2   . DA  D 4 5  ? 6.554   -20.165 -3.623  1.00 44.25  ? 5   DA  D OP2   1 
ATOM 1597 O "O5'" . DA  D 4 5  ? 8.764   -20.075 -2.641  1.00 45.62  ? 5   DA  D "O5'" 1 
ATOM 1598 C "C5'" . DA  D 4 5  ? 9.767   -19.704 -1.697  1.00 42.09  ? 5   DA  D "C5'" 1 
ATOM 1599 C "C4'" . DA  D 4 5  ? 10.998  -20.595 -1.824  1.00 39.45  ? 5   DA  D "C4'" 1 
ATOM 1600 O "O4'" . DA  D 4 5  ? 10.710  -21.974 -1.484  1.00 36.29  ? 5   DA  D "O4'" 1 
ATOM 1601 C "C3'" . DA  D 4 5  ? 11.651  -20.600 -3.194  1.00 39.30  ? 5   DA  D "C3'" 1 
ATOM 1602 O "O3'" . DA  D 4 5  ? 13.049  -20.578 -2.952  1.00 40.15  ? 5   DA  D "O3'" 1 
ATOM 1603 C "C2'" . DA  D 4 5  ? 11.140  -21.901 -3.803  1.00 38.34  ? 5   DA  D "C2'" 1 
ATOM 1604 C "C1'" . DA  D 4 5  ? 11.037  -22.808 -2.573  1.00 37.27  ? 5   DA  D "C1'" 1 
ATOM 1605 N N9    . DA  D 4 5  ? 10.006  -23.860 -2.655  1.00 37.47  ? 5   DA  D N9    1 
ATOM 1606 C C8    . DA  D 4 5  ? 8.737   -23.724 -3.152  1.00 36.47  ? 5   DA  D C8    1 
ATOM 1607 N N7    . DA  D 4 5  ? 8.034   -24.835 -3.103  1.00 37.39  ? 5   DA  D N7    1 
ATOM 1608 C C5    . DA  D 4 5  ? 8.893   -25.763 -2.539  1.00 36.31  ? 5   DA  D C5    1 
ATOM 1609 C C6    . DA  D 4 5  ? 8.738   -27.124 -2.213  1.00 34.83  ? 5   DA  D C6    1 
ATOM 1610 N N6    . DA  D 4 5  ? 7.616   -27.775 -2.421  1.00 35.06  ? 5   DA  D N6    1 
ATOM 1611 N N1    . DA  D 4 5  ? 9.776   -27.788 -1.670  1.00 35.60  ? 5   DA  D N1    1 
ATOM 1612 C C2    . DA  D 4 5  ? 10.915  -27.099 -1.453  1.00 36.39  ? 5   DA  D C2    1 
ATOM 1613 N N3    . DA  D 4 5  ? 11.181  -25.801 -1.720  1.00 35.34  ? 5   DA  D N3    1 
ATOM 1614 C C4    . DA  D 4 5  ? 10.119  -25.182 -2.263  1.00 35.96  ? 5   DA  D C4    1 
ATOM 1615 P P     . DA  D 4 6  ? 14.188  -20.611 -4.081  1.00 42.75  ? 6   DA  D P     1 
ATOM 1616 O OP1   . DA  D 4 6  ? 15.424  -20.302 -3.336  1.00 41.57  ? 6   DA  D OP1   1 
ATOM 1617 O OP2   . DA  D 4 6  ? 13.832  -19.828 -5.298  1.00 40.97  ? 6   DA  D OP2   1 
ATOM 1618 O "O5'" . DA  D 4 6  ? 14.163  -22.157 -4.493  1.00 38.88  ? 6   DA  D "O5'" 1 
ATOM 1619 C "C5'" . DA  D 4 6  ? 14.979  -23.096 -3.862  1.00 35.42  ? 6   DA  D "C5'" 1 
ATOM 1620 C "C4'" . DA  D 4 6  ? 14.817  -24.385 -4.642  1.00 36.77  ? 6   DA  D "C4'" 1 
ATOM 1621 O "O4'" . DA  D 4 6  ? 13.449  -24.882 -4.531  1.00 36.17  ? 6   DA  D "O4'" 1 
ATOM 1622 C "C3'" . DA  D 4 6  ? 15.093  -24.281 -6.142  1.00 37.01  ? 6   DA  D "C3'" 1 
ATOM 1623 O "O3'" . DA  D 4 6  ? 15.973  -25.321 -6.468  1.00 37.85  ? 6   DA  D "O3'" 1 
ATOM 1624 C "C2'" . DA  D 4 6  ? 13.728  -24.504 -6.799  1.00 35.46  ? 6   DA  D "C2'" 1 
ATOM 1625 C "C1'" . DA  D 4 6  ? 13.082  -25.418 -5.768  1.00 34.73  ? 6   DA  D "C1'" 1 
ATOM 1626 N N9    . DA  D 4 6  ? 11.632  -25.575 -5.854  1.00 35.53  ? 6   DA  D N9    1 
ATOM 1627 C C8    . DA  D 4 6  ? 10.663  -24.679 -6.248  1.00 35.43  ? 6   DA  D C8    1 
ATOM 1628 N N7    . DA  D 4 6  ? 9.446   -25.174 -6.210  1.00 34.99  ? 6   DA  D N7    1 
ATOM 1629 C C5    . DA  D 4 6  ? 9.637   -26.482 -5.788  1.00 34.79  ? 6   DA  D C5    1 
ATOM 1630 C C6    . DA  D 4 6  ? 8.763   -27.565 -5.564  1.00 34.83  ? 6   DA  D C6    1 
ATOM 1631 N N6    . DA  D 4 6  ? 7.441   -27.498 -5.717  1.00 34.18  ? 6   DA  D N6    1 
ATOM 1632 N N1    . DA  D 4 6  ? 9.301   -28.738 -5.149  1.00 34.97  ? 6   DA  D N1    1 
ATOM 1633 C C2    . DA  D 4 6  ? 10.617  -28.828 -4.967  1.00 34.34  ? 6   DA  D C2    1 
ATOM 1634 N N3    . DA  D 4 6  ? 11.537  -27.892 -5.157  1.00 34.54  ? 6   DA  D N3    1 
ATOM 1635 C C4    . DA  D 4 6  ? 10.973  -26.739 -5.564  1.00 35.03  ? 6   DA  D C4    1 
ATOM 1636 P P     . DT  D 4 7  ? 17.202  -25.132 -7.446  1.00 40.10  ? 7   DT  D P     1 
ATOM 1637 O OP1   . DT  D 4 7  ? 18.338  -25.616 -6.638  1.00 38.43  ? 7   DT  D OP1   1 
ATOM 1638 O OP2   . DT  D 4 7  ? 17.279  -23.764 -8.023  1.00 41.44  ? 7   DT  D OP2   1 
ATOM 1639 O "O5'" . DT  D 4 7  ? 16.689  -26.008 -8.694  1.00 39.49  ? 7   DT  D "O5'" 1 
ATOM 1640 C "C5'" . DT  D 4 7  ? 16.733  -27.399 -8.694  1.00 41.63  ? 7   DT  D "C5'" 1 
ATOM 1641 C "C4'" . DT  D 4 7  ? 15.420  -28.168 -8.786  1.00 39.65  ? 7   DT  D "C4'" 1 
ATOM 1642 O "O4'" . DT  D 4 7  ? 14.218  -27.629 -8.218  1.00 41.22  ? 7   DT  D "O4'" 1 
ATOM 1643 C "C3'" . DT  D 4 7  ? 14.886  -28.624 -10.115 1.00 38.64  ? 7   DT  D "C3'" 1 
ATOM 1644 O "O3'" . DT  D 4 7  ? 15.885  -29.351 -10.746 1.00 38.21  ? 7   DT  D "O3'" 1 
ATOM 1645 C "C2'" . DT  D 4 7  ? 13.883  -29.569 -9.463  1.00 39.76  ? 7   DT  D "C2'" 1 
ATOM 1646 C "C1'" . DT  D 4 7  ? 13.317  -28.728 -8.316  1.00 38.82  ? 7   DT  D "C1'" 1 
ATOM 1647 N N1    . DT  D 4 7  ? 11.912  -28.275 -8.588  1.00 37.98  ? 7   DT  D N1    1 
ATOM 1648 C C2    . DT  D 4 7  ? 10.870  -29.157 -8.329  1.00 38.53  ? 7   DT  D C2    1 
ATOM 1649 O O2    . DT  D 4 7  ? 11.004  -30.282 -7.884  1.00 39.45  ? 7   DT  D O2    1 
ATOM 1650 N N3    . DT  D 4 7  ? 9.609   -28.686 -8.585  1.00 38.66  ? 7   DT  D N3    1 
ATOM 1651 C C4    . DT  D 4 7  ? 9.296   -27.432 -9.086  1.00 39.42  ? 7   DT  D C4    1 
ATOM 1652 O O4    . DT  D 4 7  ? 8.125   -27.118 -9.292  1.00 39.02  ? 7   DT  D O4    1 
ATOM 1653 C C5    . DT  D 4 7  ? 10.429  -26.545 -9.354  1.00 38.65  ? 7   DT  D C5    1 
ATOM 1654 C C7    . DT  D 4 7  ? 10.178  -25.178 -9.912  1.00 37.16  ? 7   DT  D C7    1 
ATOM 1655 C C6    . DT  D 4 7  ? 11.673  -27.000 -9.097  1.00 37.04  ? 7   DT  D C6    1 
ATOM 1656 P P     . DT  D 4 8  ? 15.866  -29.815 -12.268 1.00 37.05  ? 8   DT  D P     1 
ATOM 1657 O OP1   . DT  D 4 8  ? 17.292  -30.083 -12.520 1.00 36.28  ? 8   DT  D OP1   1 
ATOM 1658 O OP2   . DT  D 4 8  ? 15.091  -28.943 -13.166 1.00 31.96  ? 8   DT  D OP2   1 
ATOM 1659 O "O5'" . DT  D 4 8  ? 15.101  -31.210 -12.104 1.00 39.40  ? 8   DT  D "O5'" 1 
ATOM 1660 C "C5'" . DT  D 4 8  ? 15.526  -32.168 -11.129 1.00 39.42  ? 8   DT  D "C5'" 1 
ATOM 1661 C "C4'" . DT  D 4 8  ? 14.496  -33.276 -11.158 1.00 41.78  ? 8   DT  D "C4'" 1 
ATOM 1662 O "O4'" . DT  D 4 8  ? 13.224  -32.799 -10.636 1.00 41.41  ? 8   DT  D "O4'" 1 
ATOM 1663 C "C3'" . DT  D 4 8  ? 14.234  -33.798 -12.575 1.00 42.20  ? 8   DT  D "C3'" 1 
ATOM 1664 O "O3'" . DT  D 4 8  ? 14.589  -35.173 -12.667 1.00 44.83  ? 8   DT  D "O3'" 1 
ATOM 1665 C "C2'" . DT  D 4 8  ? 12.748  -33.629 -12.830 1.00 40.75  ? 8   DT  D "C2'" 1 
ATOM 1666 C "C1'" . DT  D 4 8  ? 12.167  -33.180 -11.503 1.00 40.35  ? 8   DT  D "C1'" 1 
ATOM 1667 N N1    . DT  D 4 8  ? 11.209  -32.039 -11.692 1.00 40.53  ? 8   DT  D N1    1 
ATOM 1668 C C2    . DT  D 4 8  ? 9.867   -32.296 -11.501 1.00 39.11  ? 8   DT  D C2    1 
ATOM 1669 O O2    . DT  D 4 8  ? 9.451   -33.390 -11.177 1.00 39.01  ? 8   DT  D O2    1 
ATOM 1670 N N3    . DT  D 4 8  ? 9.027   -31.231 -11.691 1.00 37.89  ? 8   DT  D N3    1 
ATOM 1671 C C4    . DT  D 4 8  ? 9.388   -29.954 -12.041 1.00 38.50  ? 8   DT  D C4    1 
ATOM 1672 O O4    . DT  D 4 8  ? 8.560   -29.061 -12.178 1.00 39.58  ? 8   DT  D O4    1 
ATOM 1673 C C5    . DT  D 4 8  ? 10.799  -29.736 -12.243 1.00 39.36  ? 8   DT  D C5    1 
ATOM 1674 C C7    . DT  D 4 8  ? 11.264  -28.366 -12.642 1.00 39.05  ? 8   DT  D C7    1 
ATOM 1675 C C6    . DT  D 4 8  ? 11.651  -30.772 -12.070 1.00 40.00  ? 8   DT  D C6    1 
ATOM 1676 P P     . DA  D 4 9  ? 14.704  -35.925 -14.079 1.00 47.08  ? 9   DA  D P     1 
ATOM 1677 O OP1   . DA  D 4 9  ? 15.796  -36.892 -13.880 1.00 47.19  ? 9   DA  D OP1   1 
ATOM 1678 O OP2   . DA  D 4 9  ? 14.669  -34.983 -15.225 1.00 45.13  ? 9   DA  D OP2   1 
ATOM 1679 O "O5'" . DA  D 4 9  ? 13.318  -36.697 -14.166 1.00 46.95  ? 9   DA  D "O5'" 1 
ATOM 1680 C "C5'" . DA  D 4 9  ? 12.802  -37.512 -13.145 1.00 45.40  ? 9   DA  D "C5'" 1 
ATOM 1681 C "C4'" . DA  D 4 9  ? 11.467  -37.956 -13.721 1.00 47.16  ? 9   DA  D "C4'" 1 
ATOM 1682 O "O4'" . DA  D 4 9  ? 10.555  -36.832 -13.874 1.00 47.54  ? 9   DA  D "O4'" 1 
ATOM 1683 C "C3'" . DA  D 4 9  ? 11.461  -38.574 -15.108 1.00 47.15  ? 9   DA  D "C3'" 1 
ATOM 1684 O "O3'" . DA  D 4 9  ? 10.384  -39.425 -15.016 1.00 49.12  ? 9   DA  D "O3'" 1 
ATOM 1685 C "C2'" . DA  D 4 9  ? 11.135  -37.408 -16.043 1.00 47.03  ? 9   DA  D "C2'" 1 
ATOM 1686 C "C1'" . DA  D 4 9  ? 10.130  -36.615 -15.205 1.00 46.00  ? 9   DA  D "C1'" 1 
ATOM 1687 N N9    . DA  D 4 9  ? 10.124  -35.158 -15.310 1.00 44.85  ? 9   DA  D N9    1 
ATOM 1688 C C8    . DA  D 4 9  ? 11.192  -34.354 -15.569 1.00 45.83  ? 9   DA  D C8    1 
ATOM 1689 N N7    . DA  D 4 9  ? 10.923  -33.071 -15.582 1.00 45.81  ? 9   DA  D N7    1 
ATOM 1690 C C5    . DA  D 4 9  ? 9.577   -33.031 -15.286 1.00 45.07  ? 9   DA  D C5    1 
ATOM 1691 C C6    . DA  D 4 9  ? 8.680   -31.944 -15.139 1.00 45.80  ? 9   DA  D C6    1 
ATOM 1692 N N6    . DA  D 4 9  ? 9.039   -30.659 -15.285 1.00 45.33  ? 9   DA  D N6    1 
ATOM 1693 N N1    . DA  D 4 9  ? 7.393   -32.231 -14.852 1.00 45.52  ? 9   DA  D N1    1 
ATOM 1694 C C2    . DA  D 4 9  ? 7.063   -33.528 -14.715 1.00 46.07  ? 9   DA  D C2    1 
ATOM 1695 N N3    . DA  D 4 9  ? 7.822   -34.626 -14.830 1.00 44.81  ? 9   DA  D N3    1 
ATOM 1696 C C4    . DA  D 4 9  ? 9.079   -34.306 -15.119 1.00 43.79  ? 9   DA  D C4    1 
ATOM 1697 P P     . DA  D 4 10 ? 10.055  -40.547 -16.088 1.00 51.39  ? 10  DA  D P     1 
ATOM 1698 O OP1   . DA  D 4 10 ? 10.129  -41.817 -15.317 1.00 52.85  ? 10  DA  D OP1   1 
ATOM 1699 O OP2   . DA  D 4 10 ? 10.825  -40.329 -17.324 1.00 50.79  ? 10  DA  D OP2   1 
ATOM 1700 O "O5'" . DA  D 4 10 ? 8.548   -40.271 -16.460 1.00 49.13  ? 10  DA  D "O5'" 1 
ATOM 1701 C "C5'" . DA  D 4 10 ? 8.445   -39.608 -17.624 1.00 50.48  ? 10  DA  D "C5'" 1 
ATOM 1702 C "C4'" . DA  D 4 10 ? 7.193   -38.804 -17.630 1.00 52.39  ? 10  DA  D "C4'" 1 
ATOM 1703 O "O4'" . DA  D 4 10 ? 7.521   -37.458 -17.224 1.00 51.42  ? 10  DA  D "O4'" 1 
ATOM 1704 C "C3'" . DA  D 4 10 ? 6.794   -38.737 -19.084 1.00 54.45  ? 10  DA  D "C3'" 1 
ATOM 1705 O "O3'" . DA  D 4 10 ? 5.432   -38.913 -19.259 1.00 58.19  ? 10  DA  D "O3'" 1 
ATOM 1706 C "C2'" . DA  D 4 10 ? 7.202   -37.356 -19.528 1.00 54.18  ? 10  DA  D "C2'" 1 
ATOM 1707 C "C1'" . DA  D 4 10 ? 7.053   -36.579 -18.234 1.00 51.59  ? 10  DA  D "C1'" 1 
ATOM 1708 N N9    . DA  D 4 10 ? 7.853   -35.364 -18.320 1.00 51.07  ? 10  DA  D N9    1 
ATOM 1709 C C8    . DA  D 4 10 ? 9.214   -35.283 -18.394 1.00 50.61  ? 10  DA  D C8    1 
ATOM 1710 N N7    . DA  D 4 10 ? 9.655   -34.052 -18.467 1.00 51.35  ? 10  DA  D N7    1 
ATOM 1711 C C5    . DA  D 4 10 ? 8.506   -33.273 -18.455 1.00 50.98  ? 10  DA  D C5    1 
ATOM 1712 C C6    . DA  D 4 10 ? 8.281   -31.878 -18.510 1.00 49.73  ? 10  DA  D C6    1 
ATOM 1713 N N6    . DA  D 4 10 ? 9.242   -30.971 -18.593 1.00 49.46  ? 10  DA  D N6    1 
ATOM 1714 N N1    . DA  D 4 10 ? 7.009   -31.443 -18.477 1.00 50.68  ? 10  DA  D N1    1 
ATOM 1715 C C2    . DA  D 4 10 ? 6.020   -32.343 -18.380 1.00 50.90  ? 10  DA  D C2    1 
ATOM 1716 N N3    . DA  D 4 10 ? 6.108   -33.678 -18.331 1.00 50.72  ? 10  DA  D N3    1 
ATOM 1717 C C4    . DA  D 4 10 ? 7.384   -34.079 -18.374 1.00 50.68  ? 10  DA  D C4    1 
ATOM 1718 P P     . DT  D 4 11 ? 4.997   -39.866 -20.476 1.00 61.17  ? 11  DT  D P     1 
ATOM 1719 O OP1   . DT  D 4 11 ? 3.879   -40.683 -19.904 1.00 59.29  ? 11  DT  D OP1   1 
ATOM 1720 O OP2   . DT  D 4 11 ? 6.208   -40.504 -21.070 1.00 59.10  ? 11  DT  D OP2   1 
ATOM 1721 O "O5'" . DT  D 4 11 ? 4.412   -38.817 -21.533 1.00 58.87  ? 11  DT  D "O5'" 1 
ATOM 1722 C "C5'" . DT  D 4 11 ? 3.258   -38.177 -21.093 1.00 59.22  ? 11  DT  D "C5'" 1 
ATOM 1723 C "C4'" . DT  D 4 11 ? 3.421   -36.678 -21.068 1.00 60.08  ? 11  DT  D "C4'" 1 
ATOM 1724 O "O4'" . DT  D 4 11 ? 4.769   -36.159 -20.951 1.00 57.68  ? 11  DT  D "O4'" 1 
ATOM 1725 C "C3'" . DT  D 4 11 ? 2.965   -36.085 -22.373 1.00 61.10  ? 11  DT  D "C3'" 1 
ATOM 1726 O "O3'" . DT  D 4 11 ? 1.574   -35.975 -22.292 1.00 64.70  ? 11  DT  D "O3'" 1 
ATOM 1727 C "C2'" . DT  D 4 11 ? 3.624   -34.709 -22.384 1.00 59.31  ? 11  DT  D "C2'" 1 
ATOM 1728 C "C1'" . DT  D 4 11 ? 4.578   -34.780 -21.208 1.00 54.87  ? 11  DT  D "C1'" 1 
ATOM 1729 N N1    . DT  D 4 11 ? 5.844   -34.085 -21.443 1.00 53.48  ? 11  DT  D N1    1 
ATOM 1730 C C2    . DT  D 4 11 ? 5.860   -32.709 -21.425 1.00 52.76  ? 11  DT  D C2    1 
ATOM 1731 O O2    . DT  D 4 11 ? 4.874   -32.029 -21.242 1.00 52.36  ? 11  DT  D O2    1 
ATOM 1732 N N3    . DT  D 4 11 ? 7.089   -32.150 -21.623 1.00 52.75  ? 11  DT  D N3    1 
ATOM 1733 C C4    . DT  D 4 11 ? 8.269   -32.837 -21.843 1.00 53.29  ? 11  DT  D C4    1 
ATOM 1734 O O4    . DT  D 4 11 ? 9.308   -32.217 -22.014 1.00 52.77  ? 11  DT  D O4    1 
ATOM 1735 C C5    . DT  D 4 11 ? 8.185   -34.293 -21.862 1.00 53.06  ? 11  DT  D C5    1 
ATOM 1736 C C7    . DT  D 4 11 ? 9.369   -35.193 -22.082 1.00 51.70  ? 11  DT  D C7    1 
ATOM 1737 C C6    . DT  D 4 11 ? 6.980   -34.825 -21.668 1.00 53.59  ? 11  DT  D C6    1 
ATOM 1738 P P     . DT  D 4 12 ? 0.800   -35.810 -23.671 1.00 69.31  ? 12  DT  D P     1 
ATOM 1739 O OP1   . DT  D 4 12 ? -0.604  -36.202 -23.383 1.00 70.43  ? 12  DT  D OP1   1 
ATOM 1740 O OP2   . DT  D 4 12 ? 1.606   -36.428 -24.766 1.00 67.89  ? 12  DT  D OP2   1 
ATOM 1741 O "O5'" . DT  D 4 12 ? 0.811   -34.237 -23.915 1.00 67.57  ? 12  DT  D "O5'" 1 
ATOM 1742 C "C5'" . DT  D 4 12 ? 0.147   -33.377 -23.023 1.00 66.31  ? 12  DT  D "C5'" 1 
ATOM 1743 C "C4'" . DT  D 4 12 ? 0.179   -32.008 -23.657 1.00 65.65  ? 12  DT  D "C4'" 1 
ATOM 1744 O "O4'" . DT  D 4 12 ? 1.556   -31.553 -23.725 1.00 65.39  ? 12  DT  D "O4'" 1 
ATOM 1745 C "C3'" . DT  D 4 12 ? -0.349  -31.942 -25.082 1.00 64.96  ? 12  DT  D "C3'" 1 
ATOM 1746 O "O3'" . DT  D 4 12 ? -1.111  -30.745 -25.117 1.00 65.80  ? 12  DT  D "O3'" 1 
ATOM 1747 C "C2'" . DT  D 4 12 ? 0.930   -31.893 -25.943 1.00 65.00  ? 12  DT  D "C2'" 1 
ATOM 1748 C "C1'" . DT  D 4 12 ? 1.880   -31.112 -25.037 1.00 63.49  ? 12  DT  D "C1'" 1 
ATOM 1749 N N1    . DT  D 4 12 ? 3.358   -31.325 -25.083 1.00 62.23  ? 12  DT  D N1    1 
ATOM 1750 C C2    . DT  D 4 12 ? 4.180   -30.224 -24.989 1.00 62.02  ? 12  DT  D C2    1 
ATOM 1751 O O2    . DT  D 4 12 ? 3.764   -29.078 -24.937 1.00 62.37  ? 12  DT  D O2    1 
ATOM 1752 N N3    . DT  D 4 12 ? 5.521   -30.512 -24.979 1.00 61.30  ? 12  DT  D N3    1 
ATOM 1753 C C4    . DT  D 4 12 ? 6.121   -31.759 -25.041 1.00 62.44  ? 12  DT  D C4    1 
ATOM 1754 O O4    . DT  D 4 12 ? 7.343   -31.919 -25.035 1.00 62.10  ? 12  DT  D O4    1 
ATOM 1755 C C5    . DT  D 4 12 ? 5.202   -32.868 -25.121 1.00 62.66  ? 12  DT  D C5    1 
ATOM 1756 C C7    . DT  D 4 12 ? 5.727   -34.277 -25.194 1.00 62.67  ? 12  DT  D C7    1 
ATOM 1757 C C6    . DT  D 4 12 ? 3.885   -32.597 -25.125 1.00 62.18  ? 12  DT  D C6    1 
ATOM 1758 P P     . DA  D 4 13 ? -1.785  -30.198 -26.454 1.00 66.17  ? 13  DA  D P     1 
ATOM 1759 O OP1   . DA  D 4 13 ? -2.869  -29.263 -26.076 1.00 65.44  ? 13  DA  D OP1   1 
ATOM 1760 O OP2   . DA  D 4 13 ? -2.004  -31.391 -27.304 1.00 65.64  ? 13  DA  D OP2   1 
ATOM 1761 O "O5'" . DA  D 4 13 ? -0.633  -29.331 -27.134 1.00 64.49  ? 13  DA  D "O5'" 1 
ATOM 1762 C "C5'" . DA  D 4 13 ? -0.621  -27.929 -26.944 1.00 62.49  ? 13  DA  D "C5'" 1 
ATOM 1763 C "C4'" . DA  D 4 13 ? 0.572   -27.378 -27.699 1.00 60.51  ? 13  DA  D "C4'" 1 
ATOM 1764 O "O4'" . DA  D 4 13 ? 1.715   -28.248 -27.467 1.00 59.22  ? 13  DA  D "O4'" 1 
ATOM 1765 C "C3'" . DA  D 4 13 ? 0.411   -27.336 -29.213 1.00 59.86  ? 13  DA  D "C3'" 1 
ATOM 1766 O "O3'" . DA  D 4 13 ? 0.973   -26.123 -29.663 1.00 61.25  ? 13  DA  D "O3'" 1 
ATOM 1767 C "C2'" . DA  D 4 13 ? 1.264   -28.505 -29.690 1.00 58.41  ? 13  DA  D "C2'" 1 
ATOM 1768 C "C1'" . DA  D 4 13 ? 2.395   -28.345 -28.689 1.00 56.38  ? 13  DA  D "C1'" 1 
ATOM 1769 N N9    . DA  D 4 13 ? 3.313   -29.456 -28.615 1.00 55.39  ? 13  DA  D N9    1 
ATOM 1770 C C8    . DA  D 4 13 ? 3.011   -30.777 -28.664 1.00 55.05  ? 13  DA  D C8    1 
ATOM 1771 N N7    . DA  D 4 13 ? 4.059   -31.556 -28.572 1.00 54.70  ? 13  DA  D N7    1 
ATOM 1772 C C5    . DA  D 4 13 ? 5.121   -30.691 -28.458 1.00 54.30  ? 13  DA  D C5    1 
ATOM 1773 C C6    . DA  D 4 13 ? 6.512   -30.896 -28.333 1.00 54.44  ? 13  DA  D C6    1 
ATOM 1774 N N6    . DA  D 4 13 ? 7.082   -32.096 -28.283 1.00 54.93  ? 13  DA  D N6    1 
ATOM 1775 N N1    . DA  D 4 13 ? 7.304   -29.808 -28.249 1.00 54.93  ? 13  DA  D N1    1 
ATOM 1776 C C2    . DA  D 4 13 ? 6.726   -28.595 -28.272 1.00 55.28  ? 13  DA  D C2    1 
ATOM 1777 N N3    . DA  D 4 13 ? 5.426   -28.274 -28.378 1.00 55.29  ? 13  DA  D N3    1 
ATOM 1778 C C4    . DA  D 4 13 ? 4.672   -29.383 -28.473 1.00 55.14  ? 13  DA  D C4    1 
ATOM 1779 P P     . DA  D 4 14 ? 0.065   -24.949 -30.251 1.00 61.18  ? 14  DA  D P     1 
ATOM 1780 O OP1   . DA  D 4 14 ? -0.857  -24.505 -29.171 1.00 59.01  ? 14  DA  D OP1   1 
ATOM 1781 O OP2   . DA  D 4 14 ? -0.416  -25.409 -31.578 1.00 60.03  ? 14  DA  D OP2   1 
ATOM 1782 O "O5'" . DA  D 4 14 ? 1.125   -23.793 -30.563 1.00 60.56  ? 14  DA  D "O5'" 1 
ATOM 1783 C "C5'" . DA  D 4 14 ? 2.126   -23.460 -29.628 1.00 59.73  ? 14  DA  D "C5'" 1 
ATOM 1784 C "C4'" . DA  D 4 14 ? 3.389   -22.964 -30.318 1.00 59.43  ? 14  DA  D "C4'" 1 
ATOM 1785 O "O4'" . DA  D 4 14 ? 4.445   -23.956 -30.399 1.00 58.50  ? 14  DA  D "O4'" 1 
ATOM 1786 C "C3'" . DA  D 4 14 ? 3.270   -22.423 -31.730 1.00 59.52  ? 14  DA  D "C3'" 1 
ATOM 1787 O "O3'" . DA  D 4 14 ? 4.249   -21.424 -31.728 1.00 61.49  ? 14  DA  D "O3'" 1 
ATOM 1788 C "C2'" . DA  D 4 14 ? 3.698   -23.614 -32.590 1.00 58.50  ? 14  DA  D "C2'" 1 
ATOM 1789 C "C1'" . DA  D 4 14 ? 4.803   -24.228 -31.745 1.00 56.21  ? 14  DA  D "C1'" 1 
ATOM 1790 N N9    . DA  D 4 14 ? 4.909   -25.673 -31.728 1.00 55.32  ? 14  DA  D N9    1 
ATOM 1791 C C8    . DA  D 4 14 ? 3.894   -26.586 -31.694 1.00 55.67  ? 14  DA  D C8    1 
ATOM 1792 N N7    . DA  D 4 14 ? 4.302   -27.846 -31.633 1.00 55.51  ? 14  DA  D N7    1 
ATOM 1793 C C5    . DA  D 4 14 ? 5.676   -27.747 -31.605 1.00 54.74  ? 14  DA  D C5    1 
ATOM 1794 C C6    . DA  D 4 14 ? 6.700   -28.714 -31.532 1.00 55.00  ? 14  DA  D C6    1 
ATOM 1795 N N6    . DA  D 4 14 ? 6.470   -30.022 -31.486 1.00 55.35  ? 14  DA  D N6    1 
ATOM 1796 N N1    . DA  D 4 14 ? 7.984   -28.286 -31.498 1.00 55.43  ? 14  DA  D N1    1 
ATOM 1797 C C2    . DA  D 4 14 ? 8.213   -26.963 -31.552 1.00 55.53  ? 14  DA  D C2    1 
ATOM 1798 N N3    . DA  D 4 14 ? 7.329   -25.956 -31.616 1.00 55.27  ? 14  DA  D N3    1 
ATOM 1799 C C4    . DA  D 4 14 ? 6.065   -26.413 -31.639 1.00 55.02  ? 14  DA  D C4    1 
ATOM 1800 P P     . DG  D 4 15 ? 4.172   -20.097 -32.596 1.00 63.36  ? 15  DG  D P     1 
ATOM 1801 O OP1   . DG  D 4 15 ? 4.686   -18.960 -31.786 1.00 64.06  ? 15  DG  D OP1   1 
ATOM 1802 O OP2   . DG  D 4 15 ? 2.788   -20.019 -33.132 1.00 62.67  ? 15  DG  D OP2   1 
ATOM 1803 O "O5'" . DG  D 4 15 ? 5.248   -20.421 -33.742 1.00 61.82  ? 15  DG  D "O5'" 1 
ATOM 1804 C "C5'" . DG  D 4 15 ? 6.634   -20.593 -33.444 1.00 62.55  ? 15  DG  D "C5'" 1 
ATOM 1805 C "C4'" . DG  D 4 15 ? 7.375   -21.406 -34.512 1.00 63.37  ? 15  DG  D "C4'" 1 
ATOM 1806 O "O4'" . DG  D 4 15 ? 7.287   -22.837 -34.266 1.00 62.48  ? 15  DG  D "O4'" 1 
ATOM 1807 C "C3'" . DG  D 4 15 ? 6.954   -21.231 -35.977 1.00 64.29  ? 15  DG  D "C3'" 1 
ATOM 1808 O "O3'" . DG  D 4 15 ? 8.123   -21.300 -36.792 1.00 69.25  ? 15  DG  D "O3'" 1 
ATOM 1809 C "C2'" . DG  D 4 15 ? 6.086   -22.455 -36.223 1.00 60.98  ? 15  DG  D "C2'" 1 
ATOM 1810 C "C1'" . DG  D 4 15 ? 6.999   -23.446 -35.514 1.00 57.64  ? 15  DG  D "C1'" 1 
ATOM 1811 N N9    . DG  D 4 15 ? 6.436   -24.782 -35.348 1.00 55.98  ? 15  DG  D N9    1 
ATOM 1812 C C8    . DG  D 4 15 ? 5.102   -25.116 -35.331 1.00 55.06  ? 15  DG  D C8    1 
ATOM 1813 N N7    . DG  D 4 15 ? 4.882   -26.388 -35.167 1.00 54.58  ? 15  DG  D N7    1 
ATOM 1814 C C5    . DG  D 4 15 ? 6.162   -26.931 -35.082 1.00 54.97  ? 15  DG  D C5    1 
ATOM 1815 C C6    . DG  D 4 15 ? 6.554   -28.288 -34.907 1.00 55.45  ? 15  DG  D C6    1 
ATOM 1816 O O6    . DG  D 4 15 ? 5.832   -29.286 -34.794 1.00 55.36  ? 15  DG  D O6    1 
ATOM 1817 N N1    . DG  D 4 15 ? 7.940   -28.433 -34.863 1.00 55.20  ? 15  DG  D N1    1 
ATOM 1818 C C2    . DG  D 4 15 ? 8.831   -27.385 -34.976 1.00 54.97  ? 15  DG  D C2    1 
ATOM 1819 N N2    . DG  D 4 15 ? 10.110  -27.774 -34.913 1.00 54.88  ? 15  DG  D N2    1 
ATOM 1820 N N3    . DG  D 4 15 ? 8.491   -26.096 -35.137 1.00 52.95  ? 15  DG  D N3    1 
ATOM 1821 C C4    . DG  D 4 15 ? 7.139   -25.953 -35.184 1.00 54.10  ? 15  DG  D C4    1 
ATOM 1822 P P     . DC  D 4 16 ? 8.905   -19.975 -37.257 1.00 72.97  ? 16  DC  D P     1 
ATOM 1823 O OP1   . DC  D 4 16 ? 9.626   -19.444 -36.070 1.00 73.52  ? 16  DC  D OP1   1 
ATOM 1824 O OP2   . DC  D 4 16 ? 7.946   -19.084 -37.966 1.00 72.41  ? 16  DC  D OP2   1 
ATOM 1825 O "O5'" . DC  D 4 16 ? 10.003  -20.542 -38.282 1.00 71.40  ? 16  DC  D "O5'" 1 
ATOM 1826 C "C5'" . DC  D 4 16 ? 11.372  -20.334 -37.975 1.00 71.14  ? 16  DC  D "C5'" 1 
ATOM 1827 C "C4'" . DC  D 4 16 ? 12.078  -21.655 -37.773 1.00 70.83  ? 16  DC  D "C4'" 1 
ATOM 1828 O "O4'" . DC  D 4 16 ? 11.155  -22.707 -37.383 1.00 70.15  ? 16  DC  D "O4'" 1 
ATOM 1829 C "C3'" . DC  D 4 16 ? 12.741  -22.142 -39.048 1.00 71.63  ? 16  DC  D "C3'" 1 
ATOM 1830 O "O3'" . DC  D 4 16 ? 14.097  -22.397 -38.788 1.00 74.52  ? 16  DC  D "O3'" 1 
ATOM 1831 C "C2'" . DC  D 4 16 ? 12.019  -23.429 -39.434 1.00 69.85  ? 16  DC  D "C2'" 1 
ATOM 1832 C "C1'" . DC  D 4 16 ? 11.495  -23.899 -38.086 1.00 67.22  ? 16  DC  D "C1'" 1 
ATOM 1833 N N1    . DC  D 4 16 ? 10.294  -24.780 -38.212 1.00 64.88  ? 16  DC  D N1    1 
ATOM 1834 C C2    . DC  D 4 16 ? 10.434  -26.184 -38.167 1.00 63.66  ? 16  DC  D C2    1 
ATOM 1835 O O2    . DC  D 4 16 ? 11.543  -26.700 -38.033 1.00 63.20  ? 16  DC  D O2    1 
ATOM 1836 N N3    . DC  D 4 16 ? 9.329   -26.962 -38.277 1.00 62.99  ? 16  DC  D N3    1 
ATOM 1837 C C4    . DC  D 4 16 ? 8.136   -26.370 -38.434 1.00 64.15  ? 16  DC  D C4    1 
ATOM 1838 N N4    . DC  D 4 16 ? 7.074   -27.162 -38.544 1.00 64.17  ? 16  DC  D N4    1 
ATOM 1839 C C5    . DC  D 4 16 ? 7.965   -24.946 -38.487 1.00 63.33  ? 16  DC  D C5    1 
ATOM 1840 C C6    . DC  D 4 16 ? 9.063   -24.197 -38.376 1.00 63.25  ? 16  DC  D C6    1 
ATOM 1841 P P     . DC  D 4 17 ? 15.097  -22.194 -40.017 1.00 76.94  ? 17  DC  D P     1 
ATOM 1842 O OP1   . DC  D 4 17 ? 16.489  -22.140 -39.494 1.00 77.62  ? 17  DC  D OP1   1 
ATOM 1843 O OP2   . DC  D 4 17 ? 14.539  -21.041 -40.782 1.00 76.68  ? 17  DC  D OP2   1 
ATOM 1844 O "O5'" . DC  D 4 17 ? 14.975  -23.575 -40.843 1.00 75.53  ? 17  DC  D "O5'" 1 
ATOM 1845 C "C5'" . DC  D 4 17 ? 15.950  -24.622 -40.583 1.00 73.24  ? 17  DC  D "C5'" 1 
ATOM 1846 C "C4'" . DC  D 4 17 ? 15.538  -25.993 -41.102 1.00 70.98  ? 17  DC  D "C4'" 1 
ATOM 1847 O "O4'" . DC  D 4 17 ? 14.177  -26.316 -40.689 1.00 69.52  ? 17  DC  D "O4'" 1 
ATOM 1848 C "C3'" . DC  D 4 17 ? 15.556  -26.087 -42.620 1.00 70.46  ? 17  DC  D "C3'" 1 
ATOM 1849 O "O3'" . DC  D 4 17 ? 16.735  -26.791 -43.042 1.00 72.31  ? 17  DC  D "O3'" 1 
ATOM 1850 C "C2'" . DC  D 4 17 ? 14.255  -26.815 -42.987 1.00 68.76  ? 17  DC  D "C2'" 1 
ATOM 1851 C "C1'" . DC  D 4 17 ? 13.591  -27.170 -41.649 1.00 64.66  ? 17  DC  D "C1'" 1 
ATOM 1852 N N1    . DC  D 4 17 ? 12.074  -27.031 -41.651 1.00 61.58  ? 17  DC  D N1    1 
ATOM 1853 C C2    . DC  D 4 17 ? 11.266  -28.174 -41.491 1.00 59.63  ? 17  DC  D C2    1 
ATOM 1854 O O2    . DC  D 4 17 ? 11.785  -29.294 -41.339 1.00 59.84  ? 17  DC  D O2    1 
ATOM 1855 N N3    . DC  D 4 17 ? 9.920   -28.026 -41.513 1.00 58.39  ? 17  DC  D N3    1 
ATOM 1856 C C4    . DC  D 4 17 ? 9.378   -26.812 -41.690 1.00 60.77  ? 17  DC  D C4    1 
ATOM 1857 N N4    . DC  D 4 17 ? 8.037   -26.721 -41.700 1.00 61.43  ? 17  DC  D N4    1 
ATOM 1858 C C5    . DC  D 4 17 ? 10.172  -25.633 -41.857 1.00 59.34  ? 17  DC  D C5    1 
ATOM 1859 C C6    . DC  D 4 17 ? 11.501  -25.799 -41.833 1.00 60.19  ? 17  DC  D C6    1 
ATOM 1860 N N     . HIS E 1 7  ? 29.581  -44.449 -30.194 1.00 109.53 ? 175 HIS E N     1 
ATOM 1861 C CA    . HIS E 1 7  ? 28.105  -44.183 -30.223 1.00 109.66 ? 175 HIS E CA    1 
ATOM 1862 C C     . HIS E 1 7  ? 27.400  -44.527 -28.889 1.00 109.54 ? 175 HIS E C     1 
ATOM 1863 O O     . HIS E 1 7  ? 27.572  -45.638 -28.368 1.00 109.59 ? 175 HIS E O     1 
ATOM 1864 C CB    . HIS E 1 7  ? 27.436  -44.887 -31.425 1.00 109.73 ? 175 HIS E CB    1 
ATOM 1865 C CG    . HIS E 1 7  ? 27.580  -46.383 -31.430 1.00 110.01 ? 175 HIS E CG    1 
ATOM 1866 N ND1   . HIS E 1 7  ? 26.510  -47.234 -31.241 1.00 110.01 ? 175 HIS E ND1   1 
ATOM 1867 C CD2   . HIS E 1 7  ? 28.661  -47.178 -31.620 1.00 110.11 ? 175 HIS E CD2   1 
ATOM 1868 C CE1   . HIS E 1 7  ? 26.928  -48.485 -31.308 1.00 109.97 ? 175 HIS E CE1   1 
ATOM 1869 N NE2   . HIS E 1 7  ? 28.228  -48.479 -31.538 1.00 110.08 ? 175 HIS E NE2   1 
ATOM 1870 N N     . PRO E 1 8  ? 26.609  -43.570 -28.336 1.00 109.32 ? 176 PRO E N     1 
ATOM 1871 C CA    . PRO E 1 8  ? 25.968  -43.726 -27.020 1.00 108.98 ? 176 PRO E CA    1 
ATOM 1872 C C     . PRO E 1 8  ? 24.697  -44.583 -27.039 1.00 108.73 ? 176 PRO E C     1 
ATOM 1873 O O     . PRO E 1 8  ? 24.183  -44.908 -28.112 1.00 108.62 ? 176 PRO E O     1 
ATOM 1874 C CB    . PRO E 1 8  ? 25.641  -42.285 -26.623 1.00 108.95 ? 176 PRO E CB    1 
ATOM 1875 C CG    . PRO E 1 8  ? 25.416  -41.584 -27.911 1.00 109.04 ? 176 PRO E CG    1 
ATOM 1876 C CD    . PRO E 1 8  ? 26.281  -42.265 -28.949 1.00 109.27 ? 176 PRO E CD    1 
ATOM 1877 N N     . TYR E 1 9  ? 24.204  -44.928 -25.849 1.00 108.51 ? 177 TYR E N     1 
ATOM 1878 C CA    . TYR E 1 9  ? 23.075  -45.850 -25.678 1.00 108.31 ? 177 TYR E CA    1 
ATOM 1879 C C     . TYR E 1 9  ? 21.708  -45.229 -25.960 1.00 108.52 ? 177 TYR E C     1 
ATOM 1880 O O     . TYR E 1 9  ? 20.773  -45.938 -26.355 1.00 108.67 ? 177 TYR E O     1 
ATOM 1881 C CB    . TYR E 1 9  ? 23.096  -46.409 -24.261 1.00 108.09 ? 177 TYR E CB    1 
ATOM 1882 C CG    . TYR E 1 9  ? 21.994  -47.379 -23.918 1.00 107.47 ? 177 TYR E CG    1 
ATOM 1883 C CD1   . TYR E 1 9  ? 22.060  -48.703 -24.325 1.00 107.23 ? 177 TYR E CD1   1 
ATOM 1884 C CD2   . TYR E 1 9  ? 20.900  -46.976 -23.160 1.00 107.38 ? 177 TYR E CD2   1 
ATOM 1885 C CE1   . TYR E 1 9  ? 21.055  -49.601 -24.004 1.00 107.53 ? 177 TYR E CE1   1 
ATOM 1886 C CE2   . TYR E 1 9  ? 19.887  -47.864 -22.834 1.00 107.50 ? 177 TYR E CE2   1 
ATOM 1887 C CZ    . TYR E 1 9  ? 19.974  -49.176 -23.259 1.00 107.58 ? 177 TYR E CZ    1 
ATOM 1888 O OH    . TYR E 1 9  ? 18.982  -50.069 -22.940 1.00 107.70 ? 177 TYR E OH    1 
ATOM 1889 N N     . GLN E 1 10 ? 21.589  -43.921 -25.738 1.00 108.58 ? 178 GLN E N     1 
ATOM 1890 C CA    . GLN E 1 10 ? 20.342  -43.189 -26.004 1.00 108.62 ? 178 GLN E CA    1 
ATOM 1891 C C     . GLN E 1 10 ? 20.038  -43.017 -27.504 1.00 108.55 ? 178 GLN E C     1 
ATOM 1892 O O     . GLN E 1 10 ? 18.898  -42.725 -27.878 1.00 108.47 ? 178 GLN E O     1 
ATOM 1893 C CB    . GLN E 1 10 ? 20.329  -41.832 -25.283 1.00 108.74 ? 178 GLN E CB    1 
ATOM 1894 C CG    . GLN E 1 10 ? 21.651  -41.053 -25.329 1.00 108.90 ? 178 GLN E CG    1 
ATOM 1895 C CD    . GLN E 1 10 ? 22.464  -41.206 -24.058 1.00 108.21 ? 178 GLN E CD    1 
ATOM 1896 O OE1   . GLN E 1 10 ? 22.160  -40.584 -23.043 1.00 108.27 ? 178 GLN E OE1   1 
ATOM 1897 N NE2   . GLN E 1 10 ? 23.503  -42.030 -24.109 1.00 107.50 ? 178 GLN E NE2   1 
ATOM 1898 N N     . ASN E 1 11 ? 21.061  -43.199 -28.344 1.00 108.54 ? 179 ASN E N     1 
ATOM 1899 C CA    . ASN E 1 11 ? 20.919  -43.188 -29.809 1.00 108.50 ? 179 ASN E CA    1 
ATOM 1900 C C     . ASN E 1 11 ? 20.612  -44.560 -30.416 1.00 108.61 ? 179 ASN E C     1 
ATOM 1901 O O     . ASN E 1 11 ? 20.416  -44.674 -31.634 1.00 108.74 ? 179 ASN E O     1 
ATOM 1902 C CB    . ASN E 1 11 ? 22.171  -42.604 -30.474 1.00 108.39 ? 179 ASN E CB    1 
ATOM 1903 C CG    . ASN E 1 11 ? 22.081  -41.109 -30.679 1.00 108.00 ? 179 ASN E CG    1 
ATOM 1904 O OD1   . ASN E 1 11 ? 21.063  -40.596 -31.144 1.00 107.77 ? 179 ASN E OD1   1 
ATOM 1905 N ND2   . ASN E 1 11 ? 23.152  -40.401 -30.344 1.00 107.43 ? 179 ASN E ND2   1 
ATOM 1906 N N     . ARG E 1 12 ? 20.588  -45.590 -29.566 1.00 108.69 ? 180 ARG E N     1 
ATOM 1907 C CA    . ARG E 1 12 ? 20.240  -46.960 -29.966 1.00 108.66 ? 180 ARG E CA    1 
ATOM 1908 C C     . ARG E 1 12 ? 18.850  -47.314 -29.459 1.00 108.83 ? 180 ARG E C     1 
ATOM 1909 O O     . ARG E 1 12 ? 18.544  -47.107 -28.280 1.00 108.72 ? 180 ARG E O     1 
ATOM 1910 C CB    . ARG E 1 12 ? 21.225  -47.991 -29.387 1.00 108.63 ? 180 ARG E CB    1 
ATOM 1911 C CG    . ARG E 1 12 ? 22.703  -47.694 -29.570 1.00 108.41 ? 180 ARG E CG    1 
ATOM 1912 C CD    . ARG E 1 12 ? 23.544  -48.707 -28.805 1.00 108.14 ? 180 ARG E CD    1 
ATOM 1913 N NE    . ARG E 1 12 ? 24.912  -48.238 -28.593 1.00 106.78 ? 180 ARG E NE    1 
ATOM 1914 C CZ    . ARG E 1 12 ? 25.729  -48.691 -27.644 1.00 106.38 ? 180 ARG E CZ    1 
ATOM 1915 N NH1   . ARG E 1 12 ? 26.953  -48.196 -27.535 1.00 106.18 ? 180 ARG E NH1   1 
ATOM 1916 N NH2   . ARG E 1 12 ? 25.332  -49.636 -26.802 1.00 105.86 ? 180 ARG E NH2   1 
ATOM 1917 N N     . THR E 1 13 ? 18.017  -47.857 -30.342 1.00 109.11 ? 181 THR E N     1 
ATOM 1918 C CA    . THR E 1 13 ? 16.740  -48.429 -29.914 1.00 109.67 ? 181 THR E CA    1 
ATOM 1919 C C     . THR E 1 13 ? 16.992  -49.691 -29.062 1.00 109.87 ? 181 THR E C     1 
ATOM 1920 O O     . THR E 1 13 ? 17.766  -50.564 -29.469 1.00 110.00 ? 181 THR E O     1 
ATOM 1921 C CB    . THR E 1 13 ? 15.742  -48.691 -31.110 1.00 109.72 ? 181 THR E CB    1 
ATOM 1922 O OG1   . THR E 1 13 ? 14.528  -49.282 -30.618 1.00 109.54 ? 181 THR E OG1   1 
ATOM 1923 C CG2   . THR E 1 13 ? 16.351  -49.596 -32.196 1.00 109.76 ? 181 THR E CG2   1 
ATOM 1924 N N     . PRO E 1 14 ? 16.377  -49.762 -27.858 1.00 110.03 ? 182 PRO E N     1 
ATOM 1925 C CA    . PRO E 1 14 ? 16.475  -50.936 -26.972 1.00 110.07 ? 182 PRO E CA    1 
ATOM 1926 C C     . PRO E 1 14 ? 16.120  -52.278 -27.656 1.00 110.02 ? 182 PRO E C     1 
ATOM 1927 O O     . PRO E 1 14 ? 15.344  -52.285 -28.621 1.00 109.94 ? 182 PRO E O     1 
ATOM 1928 C CB    . PRO E 1 14 ? 15.474  -50.606 -25.855 1.00 110.11 ? 182 PRO E CB    1 
ATOM 1929 C CG    . PRO E 1 14 ? 15.449  -49.113 -25.811 1.00 109.96 ? 182 PRO E CG    1 
ATOM 1930 C CD    . PRO E 1 14 ? 15.562  -48.689 -27.247 1.00 109.99 ? 182 PRO E CD    1 
ATOM 1931 N N     . PRO E 1 15 ? 16.694  -53.402 -27.158 1.00 109.94 ? 183 PRO E N     1 
ATOM 1932 C CA    . PRO E 1 15 ? 16.501  -54.763 -27.669 1.00 109.90 ? 183 PRO E CA    1 
ATOM 1933 C C     . PRO E 1 15 ? 15.189  -54.998 -28.425 1.00 109.79 ? 183 PRO E C     1 
ATOM 1934 O O     . PRO E 1 15 ? 14.108  -54.859 -27.855 1.00 109.74 ? 183 PRO E O     1 
ATOM 1935 C CB    . PRO E 1 15 ? 16.549  -55.614 -26.392 1.00 109.86 ? 183 PRO E CB    1 
ATOM 1936 C CG    . PRO E 1 15 ? 17.370  -54.785 -25.395 1.00 109.94 ? 183 PRO E CG    1 
ATOM 1937 C CD    . PRO E 1 15 ? 17.616  -53.420 -26.008 1.00 109.94 ? 183 PRO E CD    1 
ATOM 1938 N N     . ARG E 1 21 ? 20.048  -66.330 -19.909 1.00 82.18  ? 189 ARG E N     1 
ATOM 1939 C CA    . ARG E 1 21 ? 20.798  -67.079 -18.896 1.00 82.31  ? 189 ARG E CA    1 
ATOM 1940 C C     . ARG E 1 21 ? 20.013  -68.347 -18.516 1.00 81.86  ? 189 ARG E C     1 
ATOM 1941 O O     . ARG E 1 21 ? 18.987  -68.239 -17.836 1.00 82.12  ? 189 ARG E O     1 
ATOM 1942 C CB    . ARG E 1 21 ? 21.066  -66.213 -17.655 1.00 82.67  ? 189 ARG E CB    1 
ATOM 1943 C CG    . ARG E 1 21 ? 21.256  -64.715 -17.964 1.00 84.16  ? 189 ARG E CG    1 
ATOM 1944 C CD    . ARG E 1 21 ? 20.905  -63.841 -16.769 1.00 85.94  ? 189 ARG E CD    1 
ATOM 1945 N NE    . ARG E 1 21 ? 22.084  -63.480 -15.977 1.00 87.57  ? 189 ARG E NE    1 
ATOM 1946 C CZ    . ARG E 1 21 ? 22.692  -62.293 -16.022 1.00 87.88  ? 189 ARG E CZ    1 
ATOM 1947 N NH1   . ARG E 1 21 ? 22.235  -61.340 -16.825 1.00 88.21  ? 189 ARG E NH1   1 
ATOM 1948 N NH2   . ARG E 1 21 ? 23.754  -62.051 -15.257 1.00 87.05  ? 189 ARG E NH2   1 
ATOM 1949 N N     . THR E 1 22 ? 20.446  -69.546 -18.939 1.00 80.92  ? 190 THR E N     1 
ATOM 1950 C CA    . THR E 1 22 ? 21.694  -69.833 -19.706 1.00 79.72  ? 190 THR E CA    1 
ATOM 1951 C C     . THR E 1 22 ? 23.000  -69.386 -19.025 1.00 78.73  ? 190 THR E C     1 
ATOM 1952 O O     . THR E 1 22 ? 23.989  -69.094 -19.700 1.00 78.68  ? 190 THR E O     1 
ATOM 1953 C CB    . THR E 1 22 ? 21.670  -69.432 -21.266 1.00 79.83  ? 190 THR E CB    1 
ATOM 1954 O OG1   . THR E 1 22 ? 21.902  -68.026 -21.444 1.00 79.12  ? 190 THR E OG1   1 
ATOM 1955 C CG2   . THR E 1 22 ? 20.367  -69.870 -21.980 1.00 79.40  ? 190 THR E CG2   1 
ATOM 1956 N N     . SER E 1 23 ? 22.995  -69.334 -17.694 1.00 77.27  ? 191 SER E N     1 
ATOM 1957 C CA    . SER E 1 23 ? 24.242  -69.227 -16.961 1.00 75.70  ? 191 SER E CA    1 
ATOM 1958 C C     . SER E 1 23 ? 24.989  -70.539 -17.182 1.00 74.63  ? 191 SER E C     1 
ATOM 1959 O O     . SER E 1 23 ? 24.499  -71.608 -16.817 1.00 74.62  ? 191 SER E O     1 
ATOM 1960 C CB    . SER E 1 23 ? 23.985  -69.001 -15.483 1.00 75.56  ? 191 SER E CB    1 
ATOM 1961 O OG    . SER E 1 23 ? 25.203  -69.105 -14.780 1.00 75.45  ? 191 SER E OG    1 
ATOM 1962 N N     . PHE E 1 24 ? 26.161  -70.459 -17.801 1.00 73.22  ? 192 PHE E N     1 
ATOM 1963 C CA    . PHE E 1 24 ? 26.871  -71.666 -18.224 1.00 71.70  ? 192 PHE E CA    1 
ATOM 1964 C C     . PHE E 1 24 ? 27.409  -72.475 -17.050 1.00 71.09  ? 192 PHE E C     1 
ATOM 1965 O O     . PHE E 1 24 ? 27.836  -71.913 -16.036 1.00 70.82  ? 192 PHE E O     1 
ATOM 1966 C CB    . PHE E 1 24 ? 28.016  -71.331 -19.187 1.00 71.17  ? 192 PHE E CB    1 
ATOM 1967 C CG    . PHE E 1 24 ? 27.633  -70.387 -20.274 1.00 69.48  ? 192 PHE E CG    1 
ATOM 1968 C CD1   . PHE E 1 24 ? 26.761  -70.778 -21.273 1.00 68.20  ? 192 PHE E CD1   1 
ATOM 1969 C CD2   . PHE E 1 24 ? 28.151  -69.099 -20.298 1.00 68.23  ? 192 PHE E CD2   1 
ATOM 1970 C CE1   . PHE E 1 24 ? 26.401  -69.898 -22.283 1.00 68.04  ? 192 PHE E CE1   1 
ATOM 1971 C CE2   . PHE E 1 24 ? 27.805  -68.219 -21.298 1.00 67.72  ? 192 PHE E CE2   1 
ATOM 1972 C CZ    . PHE E 1 24 ? 26.923  -68.618 -22.295 1.00 68.67  ? 192 PHE E CZ    1 
ATOM 1973 N N     . THR E 1 25 ? 27.393  -73.796 -17.220 1.00 70.32  ? 193 THR E N     1 
ATOM 1974 C CA    . THR E 1 25 ? 27.861  -74.741 -16.216 1.00 69.86  ? 193 THR E CA    1 
ATOM 1975 C C     . THR E 1 25 ? 29.329  -74.540 -15.916 1.00 69.50  ? 193 THR E C     1 
ATOM 1976 O O     . THR E 1 25 ? 30.059  -73.962 -16.718 1.00 69.66  ? 193 THR E O     1 
ATOM 1977 C CB    . THR E 1 25 ? 27.674  -76.175 -16.688 1.00 69.85  ? 193 THR E CB    1 
ATOM 1978 O OG1   . THR E 1 25 ? 28.474  -76.393 -17.858 1.00 70.71  ? 193 THR E OG1   1 
ATOM 1979 C CG2   . THR E 1 25 ? 26.211  -76.438 -17.014 1.00 69.77  ? 193 THR E CG2   1 
ATOM 1980 N N     . ARG E 1 26 ? 29.769  -75.031 -14.764 1.00 69.09  ? 194 ARG E N     1 
ATOM 1981 C CA    . ARG E 1 26 ? 31.152  -74.835 -14.365 1.00 68.71  ? 194 ARG E CA    1 
ATOM 1982 C C     . ARG E 1 26 ? 32.097  -75.617 -15.286 1.00 67.81  ? 194 ARG E C     1 
ATOM 1983 O O     . ARG E 1 26 ? 33.308  -75.364 -15.309 1.00 68.21  ? 194 ARG E O     1 
ATOM 1984 C CB    . ARG E 1 26 ? 31.369  -75.161 -12.877 1.00 68.93  ? 194 ARG E CB    1 
ATOM 1985 C CG    . ARG E 1 26 ? 31.975  -76.525 -12.595 1.00 70.83  ? 194 ARG E CG    1 
ATOM 1986 C CD    . ARG E 1 26 ? 33.148  -76.396 -11.621 1.00 73.33  ? 194 ARG E CD    1 
ATOM 1987 N NE    . ARG E 1 26 ? 32.736  -76.568 -10.222 1.00 75.21  ? 194 ARG E NE    1 
ATOM 1988 C CZ    . ARG E 1 26 ? 33.502  -76.296 -9.163  1.00 76.18  ? 194 ARG E CZ    1 
ATOM 1989 N NH1   . ARG E 1 26 ? 34.736  -75.817 -9.322  1.00 76.60  ? 194 ARG E NH1   1 
ATOM 1990 N NH2   . ARG E 1 26 ? 33.031  -76.496 -7.935  1.00 76.27  ? 194 ARG E NH2   1 
ATOM 1991 N N     . ILE E 1 27 ? 31.537  -76.547 -16.058 1.00 66.41  ? 195 ILE E N     1 
ATOM 1992 C CA    . ILE E 1 27 ? 32.324  -77.296 -17.049 1.00 65.12  ? 195 ILE E CA    1 
ATOM 1993 C C     . ILE E 1 27 ? 32.514  -76.432 -18.306 1.00 63.76  ? 195 ILE E C     1 
ATOM 1994 O O     . ILE E 1 27 ? 33.641  -76.218 -18.775 1.00 63.59  ? 195 ILE E O     1 
ATOM 1995 C CB    . ILE E 1 27 ? 31.687  -78.691 -17.374 1.00 65.16  ? 195 ILE E CB    1 
ATOM 1996 C CG1   . ILE E 1 27 ? 31.623  -79.570 -16.108 1.00 65.66  ? 195 ILE E CG1   1 
ATOM 1997 C CG2   . ILE E 1 27 ? 32.417  -79.397 -18.527 1.00 65.14  ? 195 ILE E CG2   1 
ATOM 1998 C CD1   . ILE E 1 27 ? 32.958  -79.768 -15.353 1.00 65.93  ? 195 ILE E CD1   1 
ATOM 1999 N N     . GLN E 1 28 ? 31.402  -75.927 -18.831 1.00 61.69  ? 196 GLN E N     1 
ATOM 2000 C CA    . GLN E 1 28 ? 31.441  -74.969 -19.910 1.00 59.62  ? 196 GLN E CA    1 
ATOM 2001 C C     . GLN E 1 28 ? 32.445  -73.847 -19.610 1.00 58.55  ? 196 GLN E C     1 
ATOM 2002 O O     . GLN E 1 28 ? 33.293  -73.534 -20.440 1.00 57.95  ? 196 GLN E O     1 
ATOM 2003 C CB    . GLN E 1 28 ? 30.047  -74.408 -20.128 1.00 59.32  ? 196 GLN E CB    1 
ATOM 2004 C CG    . GLN E 1 28 ? 29.180  -75.267 -21.004 1.00 58.24  ? 196 GLN E CG    1 
ATOM 2005 C CD    . GLN E 1 28 ? 27.723  -74.939 -20.854 1.00 56.82  ? 196 GLN E CD    1 
ATOM 2006 O OE1   . GLN E 1 28 ? 27.268  -74.594 -19.769 1.00 57.70  ? 196 GLN E OE1   1 
ATOM 2007 N NE2   . GLN E 1 28 ? 26.973  -75.057 -21.938 1.00 56.32  ? 196 GLN E NE2   1 
ATOM 2008 N N     . VAL E 1 29 ? 32.368  -73.282 -18.409 1.00 57.34  ? 197 VAL E N     1 
ATOM 2009 C CA    . VAL E 1 29 ? 33.213  -72.149 -18.039 1.00 56.61  ? 197 VAL E CA    1 
ATOM 2010 C C     . VAL E 1 29 ? 34.687  -72.543 -18.021 1.00 56.50  ? 197 VAL E C     1 
ATOM 2011 O O     . VAL E 1 29 ? 35.488  -71.995 -18.765 1.00 56.40  ? 197 VAL E O     1 
ATOM 2012 C CB    . VAL E 1 29 ? 32.785  -71.498 -16.686 1.00 56.42  ? 197 VAL E CB    1 
ATOM 2013 C CG1   . VAL E 1 29 ? 33.833  -70.527 -16.201 1.00 55.72  ? 197 VAL E CG1   1 
ATOM 2014 C CG2   . VAL E 1 29 ? 31.443  -70.791 -16.817 1.00 55.43  ? 197 VAL E CG2   1 
ATOM 2015 N N     . ALA E 1 30 ? 35.028  -73.517 -17.188 1.00 56.75  ? 198 ALA E N     1 
ATOM 2016 C CA    . ALA E 1 30 ? 36.408  -73.993 -17.062 1.00 56.54  ? 198 ALA E CA    1 
ATOM 2017 C C     . ALA E 1 30 ? 37.049  -74.264 -18.422 1.00 56.06  ? 198 ALA E C     1 
ATOM 2018 O O     . ALA E 1 30 ? 38.232  -73.979 -18.624 1.00 55.86  ? 198 ALA E O     1 
ATOM 2019 C CB    . ALA E 1 30 ? 36.458  -75.242 -16.187 1.00 56.44  ? 198 ALA E CB    1 
ATOM 2020 N N     . GLU E 1 31 ? 36.249  -74.786 -19.349 1.00 55.57  ? 199 GLU E N     1 
ATOM 2021 C CA    . GLU E 1 31 ? 36.732  -75.126 -20.680 1.00 55.58  ? 199 GLU E CA    1 
ATOM 2022 C C     . GLU E 1 31 ? 37.003  -73.900 -21.537 1.00 55.19  ? 199 GLU E C     1 
ATOM 2023 O O     . GLU E 1 31 ? 38.108  -73.766 -22.065 1.00 55.51  ? 199 GLU E O     1 
ATOM 2024 C CB    . GLU E 1 31 ? 35.776  -76.082 -21.397 1.00 55.60  ? 199 GLU E CB    1 
ATOM 2025 C CG    . GLU E 1 31 ? 35.920  -77.553 -20.978 1.00 57.24  ? 199 GLU E CG    1 
ATOM 2026 C CD    . GLU E 1 31 ? 37.328  -78.146 -21.182 1.00 58.56  ? 199 GLU E CD    1 
ATOM 2027 O OE1   . GLU E 1 31 ? 37.983  -77.904 -22.227 1.00 58.25  ? 199 GLU E OE1   1 
ATOM 2028 O OE2   . GLU E 1 31 ? 37.773  -78.877 -20.277 1.00 59.92  ? 199 GLU E OE2   1 
ATOM 2029 N N     . LEU E 1 32 ? 35.999  -73.024 -21.678 1.00 54.29  ? 200 LEU E N     1 
ATOM 2030 C CA    . LEU E 1 32 ? 36.173  -71.727 -22.323 1.00 53.28  ? 200 LEU E CA    1 
ATOM 2031 C C     . LEU E 1 32 ? 37.392  -71.026 -21.742 1.00 53.43  ? 200 LEU E C     1 
ATOM 2032 O O     . LEU E 1 32 ? 38.268  -70.570 -22.473 1.00 52.91  ? 200 LEU E O     1 
ATOM 2033 C CB    . LEU E 1 32 ? 34.941  -70.850 -22.122 1.00 52.57  ? 200 LEU E CB    1 
ATOM 2034 C CG    . LEU E 1 32 ? 33.643  -71.325 -22.765 1.00 51.01  ? 200 LEU E CG    1 
ATOM 2035 C CD1   . LEU E 1 32 ? 32.500  -70.488 -22.254 1.00 49.81  ? 200 LEU E CD1   1 
ATOM 2036 C CD2   . LEU E 1 32 ? 33.684  -71.279 -24.258 1.00 48.19  ? 200 LEU E CD2   1 
ATOM 2037 N N     . GLU E 1 33 ? 37.443  -70.972 -20.416 1.00 53.85  ? 201 GLU E N     1 
ATOM 2038 C CA    . GLU E 1 33 ? 38.551  -70.378 -19.680 1.00 54.71  ? 201 GLU E CA    1 
ATOM 2039 C C     . GLU E 1 33 ? 39.904  -70.951 -20.102 1.00 55.14  ? 201 GLU E C     1 
ATOM 2040 O O     . GLU E 1 33 ? 40.908  -70.215 -20.215 1.00 55.07  ? 201 GLU E O     1 
ATOM 2041 C CB    . GLU E 1 33 ? 38.327  -70.599 -18.192 1.00 54.67  ? 201 GLU E CB    1 
ATOM 2042 C CG    . GLU E 1 33 ? 39.048  -69.627 -17.313 1.00 57.25  ? 201 GLU E CG    1 
ATOM 2043 C CD    . GLU E 1 33 ? 38.530  -68.205 -17.473 1.00 60.52  ? 201 GLU E CD    1 
ATOM 2044 O OE1   . GLU E 1 33 ? 37.283  -68.005 -17.459 1.00 61.29  ? 201 GLU E OE1   1 
ATOM 2045 O OE2   . GLU E 1 33 ? 39.380  -67.296 -17.612 1.00 59.83  ? 201 GLU E OE2   1 
ATOM 2046 N N     . LYS E 1 34 ? 39.912  -72.267 -20.348 1.00 55.83  ? 202 LYS E N     1 
ATOM 2047 C CA    . LYS E 1 34 ? 41.130  -73.023 -20.668 1.00 55.97  ? 202 LYS E CA    1 
ATOM 2048 C C     . LYS E 1 34 ? 41.619  -72.725 -22.084 1.00 55.42  ? 202 LYS E C     1 
ATOM 2049 O O     . LYS E 1 34 ? 42.803  -72.438 -22.290 1.00 55.49  ? 202 LYS E O     1 
ATOM 2050 C CB    . LYS E 1 34 ? 40.889  -74.523 -20.480 1.00 56.59  ? 202 LYS E CB    1 
ATOM 2051 C CG    . LYS E 1 34 ? 42.123  -75.378 -20.677 1.00 57.87  ? 202 LYS E CG    1 
ATOM 2052 C CD    . LYS E 1 34 ? 41.768  -76.731 -21.333 1.00 60.55  ? 202 LYS E CD    1 
ATOM 2053 C CE    . LYS E 1 34 ? 43.011  -77.594 -21.645 1.00 59.70  ? 202 LYS E CE    1 
ATOM 2054 N NZ    . LYS E 1 34 ? 43.823  -77.866 -20.420 1.00 60.58  ? 202 LYS E NZ    1 
ATOM 2055 N N     . ARG E 1 35 ? 40.706  -72.775 -23.054 1.00 54.78  ? 203 ARG E N     1 
ATOM 2056 C CA    . ARG E 1 35 ? 41.043  -72.415 -24.431 1.00 54.38  ? 203 ARG E CA    1 
ATOM 2057 C C     . ARG E 1 35 ? 41.514  -70.964 -24.544 1.00 54.62  ? 203 ARG E C     1 
ATOM 2058 O O     . ARG E 1 35 ? 42.469  -70.675 -25.256 1.00 54.90  ? 203 ARG E O     1 
ATOM 2059 C CB    . ARG E 1 35 ? 39.880  -72.679 -25.374 1.00 53.74  ? 203 ARG E CB    1 
ATOM 2060 C CG    . ARG E 1 35 ? 40.227  -72.475 -26.825 1.00 53.02  ? 203 ARG E CG    1 
ATOM 2061 C CD    . ARG E 1 35 ? 41.059  -73.612 -27.383 1.00 52.77  ? 203 ARG E CD    1 
ATOM 2062 N NE    . ARG E 1 35 ? 40.884  -73.723 -28.833 1.00 53.70  ? 203 ARG E NE    1 
ATOM 2063 C CZ    . ARG E 1 35 ? 39.899  -74.409 -29.419 1.00 54.14  ? 203 ARG E CZ    1 
ATOM 2064 N NH1   . ARG E 1 35 ? 39.779  -74.451 -30.742 1.00 54.51  ? 203 ARG E NH1   1 
ATOM 2065 N NH2   . ARG E 1 35 ? 39.013  -75.052 -28.677 1.00 55.63  ? 203 ARG E NH2   1 
ATOM 2066 N N     . PHE E 1 36 ? 40.853  -70.067 -23.825 1.00 54.68  ? 204 PHE E N     1 
ATOM 2067 C CA    . PHE E 1 36 ? 41.225  -68.664 -23.790 1.00 55.03  ? 204 PHE E CA    1 
ATOM 2068 C C     . PHE E 1 36 ? 42.697  -68.435 -23.441 1.00 55.44  ? 204 PHE E C     1 
ATOM 2069 O O     . PHE E 1 36 ? 43.375  -67.636 -24.100 1.00 55.75  ? 204 PHE E O     1 
ATOM 2070 C CB    . PHE E 1 36 ? 40.339  -67.917 -22.794 1.00 55.12  ? 204 PHE E CB    1 
ATOM 2071 C CG    . PHE E 1 36 ? 40.582  -66.447 -22.757 1.00 54.87  ? 204 PHE E CG    1 
ATOM 2072 C CD1   . PHE E 1 36 ? 40.058  -65.619 -23.742 1.00 54.85  ? 204 PHE E CD1   1 
ATOM 2073 C CD2   . PHE E 1 36 ? 41.335  -65.882 -21.739 1.00 55.43  ? 204 PHE E CD2   1 
ATOM 2074 C CE1   . PHE E 1 36 ? 40.280  -64.237 -23.711 1.00 55.10  ? 204 PHE E CE1   1 
ATOM 2075 C CE2   . PHE E 1 36 ? 41.561  -64.496 -21.698 1.00 56.68  ? 204 PHE E CE2   1 
ATOM 2076 C CZ    . PHE E 1 36 ? 41.036  -63.676 -22.694 1.00 55.39  ? 204 PHE E CZ    1 
ATOM 2077 N N     . HIS E 1 37 ? 43.187  -69.120 -22.407 1.00 55.48  ? 205 HIS E N     1 
ATOM 2078 C CA    . HIS E 1 37 ? 44.593  -68.996 -22.000 1.00 55.58  ? 205 HIS E CA    1 
ATOM 2079 C C     . HIS E 1 37 ? 45.546  -69.564 -23.082 1.00 54.78  ? 205 HIS E C     1 
ATOM 2080 O O     . HIS E 1 37 ? 46.701  -69.160 -23.190 1.00 54.79  ? 205 HIS E O     1 
ATOM 2081 C CB    . HIS E 1 37 ? 44.802  -69.653 -20.623 1.00 56.18  ? 205 HIS E CB    1 
ATOM 2082 C CG    . HIS E 1 37 ? 46.206  -69.553 -20.097 1.00 59.47  ? 205 HIS E CG    1 
ATOM 2083 N ND1   . HIS E 1 37 ? 46.554  -68.724 -19.048 1.00 62.05  ? 205 HIS E ND1   1 
ATOM 2084 C CD2   . HIS E 1 37 ? 47.347  -70.196 -20.462 1.00 61.65  ? 205 HIS E CD2   1 
ATOM 2085 C CE1   . HIS E 1 37 ? 47.848  -68.850 -18.800 1.00 62.78  ? 205 HIS E CE1   1 
ATOM 2086 N NE2   . HIS E 1 37 ? 48.353  -69.735 -19.646 1.00 62.89  ? 205 HIS E NE2   1 
ATOM 2087 N N     . LYS E 1 38 ? 45.063  -70.498 -23.890 1.00 53.83  ? 206 LYS E N     1 
ATOM 2088 C CA    . LYS E 1 38 ? 45.858  -70.972 -25.015 1.00 53.12  ? 206 LYS E CA    1 
ATOM 2089 C C     . LYS E 1 38 ? 45.805  -69.953 -26.145 1.00 52.00  ? 206 LYS E C     1 
ATOM 2090 O O     . LYS E 1 38 ? 46.744  -69.827 -26.916 1.00 52.14  ? 206 LYS E O     1 
ATOM 2091 C CB    . LYS E 1 38 ? 45.356  -72.335 -25.530 1.00 53.17  ? 206 LYS E CB    1 
ATOM 2092 C CG    . LYS E 1 38 ? 45.411  -73.525 -24.520 1.00 53.85  ? 206 LYS E CG    1 
ATOM 2093 C CD    . LYS E 1 38 ? 44.709  -74.775 -25.109 1.00 53.95  ? 206 LYS E CD    1 
ATOM 2094 C CE    . LYS E 1 38 ? 45.394  -76.102 -24.714 1.00 55.77  ? 206 LYS E CE    1 
ATOM 2095 N NZ    . LYS E 1 38 ? 45.051  -77.224 -25.672 1.00 54.23  ? 206 LYS E NZ    1 
ATOM 2096 N N     . GLN E 1 39 ? 44.715  -69.202 -26.226 1.00 50.68  ? 207 GLN E N     1 
ATOM 2097 C CA    . GLN E 1 39 ? 44.378  -68.531 -27.462 1.00 49.53  ? 207 GLN E CA    1 
ATOM 2098 C C     . GLN E 1 39 ? 43.324  -67.418 -27.277 1.00 48.88  ? 207 GLN E C     1 
ATOM 2099 O O     . GLN E 1 39 ? 42.129  -67.709 -27.167 1.00 49.02  ? 207 GLN E O     1 
ATOM 2100 C CB    . GLN E 1 39 ? 43.838  -69.615 -28.368 1.00 49.53  ? 207 GLN E CB    1 
ATOM 2101 C CG    . GLN E 1 39 ? 43.721  -69.283 -29.806 1.00 49.76  ? 207 GLN E CG    1 
ATOM 2102 C CD    . GLN E 1 39 ? 42.926  -70.343 -30.529 1.00 49.59  ? 207 GLN E CD    1 
ATOM 2103 O OE1   . GLN E 1 39 ? 42.806  -71.481 -30.045 1.00 49.20  ? 207 GLN E OE1   1 
ATOM 2104 N NE2   . GLN E 1 39 ? 42.373  -69.987 -31.692 1.00 48.44  ? 207 GLN E NE2   1 
ATOM 2105 N N     . LYS E 1 40 ? 43.755  -66.154 -27.267 1.00 47.50  ? 208 LYS E N     1 
ATOM 2106 C CA    . LYS E 1 40 ? 42.844  -65.021 -26.999 1.00 46.20  ? 208 LYS E CA    1 
ATOM 2107 C C     . LYS E 1 40 ? 41.805  -64.756 -28.111 1.00 45.49  ? 208 LYS E C     1 
ATOM 2108 O O     . LYS E 1 40 ? 40.794  -64.091 -27.855 1.00 45.53  ? 208 LYS E O     1 
ATOM 2109 C CB    . LYS E 1 40 ? 43.598  -63.708 -26.682 1.00 45.96  ? 208 LYS E CB    1 
ATOM 2110 C CG    . LYS E 1 40 ? 44.887  -63.814 -25.866 1.00 46.09  ? 208 LYS E CG    1 
ATOM 2111 C CD    . LYS E 1 40 ? 44.743  -63.411 -24.408 1.00 46.06  ? 208 LYS E CD    1 
ATOM 2112 C CE    . LYS E 1 40 ? 44.371  -64.587 -23.497 1.00 47.45  ? 208 LYS E CE    1 
ATOM 2113 N NZ    . LYS E 1 40 ? 45.359  -65.713 -23.432 1.00 47.08  ? 208 LYS E NZ    1 
ATOM 2114 N N     . TYR E 1 41 ? 42.041  -65.239 -29.331 1.00 44.13  ? 209 TYR E N     1 
ATOM 2115 C CA    . TYR E 1 41 ? 41.074  -65.027 -30.415 1.00 43.27  ? 209 TYR E CA    1 
ATOM 2116 C C     . TYR E 1 41 ? 40.845  -66.310 -31.160 1.00 43.02  ? 209 TYR E C     1 
ATOM 2117 O O     . TYR E 1 41 ? 41.692  -67.198 -31.118 1.00 43.76  ? 209 TYR E O     1 
ATOM 2118 C CB    . TYR E 1 41 ? 41.571  -63.978 -31.404 1.00 43.41  ? 209 TYR E CB    1 
ATOM 2119 C CG    . TYR E 1 41 ? 41.601  -62.567 -30.864 1.00 43.42  ? 209 TYR E CG    1 
ATOM 2120 C CD1   . TYR E 1 41 ? 40.573  -61.677 -31.144 1.00 43.43  ? 209 TYR E CD1   1 
ATOM 2121 C CD2   . TYR E 1 41 ? 42.667  -62.123 -30.087 1.00 42.57  ? 209 TYR E CD2   1 
ATOM 2122 C CE1   . TYR E 1 41 ? 40.593  -60.383 -30.640 1.00 44.64  ? 209 TYR E CE1   1 
ATOM 2123 C CE2   . TYR E 1 41 ? 42.704  -60.843 -29.594 1.00 42.51  ? 209 TYR E CE2   1 
ATOM 2124 C CZ    . TYR E 1 41 ? 41.672  -59.974 -29.868 1.00 44.08  ? 209 TYR E CZ    1 
ATOM 2125 O OH    . TYR E 1 41 ? 41.717  -58.696 -29.372 1.00 43.72  ? 209 TYR E OH    1 
ATOM 2126 N N     . LEU E 1 42 ? 39.720  -66.425 -31.858 1.00 42.05  ? 210 LEU E N     1 
ATOM 2127 C CA    . LEU E 1 42 ? 39.442  -67.655 -32.579 1.00 41.17  ? 210 LEU E CA    1 
ATOM 2128 C C     . LEU E 1 42 ? 39.099  -67.435 -34.037 1.00 41.53  ? 210 LEU E C     1 
ATOM 2129 O O     . LEU E 1 42 ? 38.376  -66.496 -34.370 1.00 40.82  ? 210 LEU E O     1 
ATOM 2130 C CB    . LEU E 1 42 ? 38.284  -68.389 -31.928 1.00 41.01  ? 210 LEU E CB    1 
ATOM 2131 C CG    . LEU E 1 42 ? 38.314  -68.741 -30.449 1.00 38.90  ? 210 LEU E CG    1 
ATOM 2132 C CD1   . LEU E 1 42 ? 36.944  -69.219 -30.097 1.00 37.65  ? 210 LEU E CD1   1 
ATOM 2133 C CD2   . LEU E 1 42 ? 39.325  -69.810 -30.191 1.00 38.46  ? 210 LEU E CD2   1 
ATOM 2134 N N     . ALA E 1 43 ? 39.599  -68.316 -34.908 1.00 41.93  ? 211 ALA E N     1 
ATOM 2135 C CA    . ALA E 1 43 ? 39.091  -68.394 -36.291 1.00 42.16  ? 211 ALA E CA    1 
ATOM 2136 C C     . ALA E 1 43 ? 37.643  -68.869 -36.255 1.00 42.66  ? 211 ALA E C     1 
ATOM 2137 O O     . ALA E 1 43 ? 37.182  -69.392 -35.236 1.00 42.46  ? 211 ALA E O     1 
ATOM 2138 C CB    . ALA E 1 43 ? 39.936  -69.334 -37.131 1.00 41.63  ? 211 ALA E CB    1 
ATOM 2139 N N     . SER E 1 44 ? 36.933  -68.685 -37.359 1.00 43.99  ? 212 SER E N     1 
ATOM 2140 C CA    . SER E 1 44 ? 35.529  -69.103 -37.475 1.00 45.89  ? 212 SER E CA    1 
ATOM 2141 C C     . SER E 1 44 ? 35.299  -70.589 -37.199 1.00 46.27  ? 212 SER E C     1 
ATOM 2142 O O     . SER E 1 44 ? 34.504  -70.950 -36.341 1.00 46.35  ? 212 SER E O     1 
ATOM 2143 C CB    . SER E 1 44 ? 34.975  -68.749 -38.856 1.00 46.12  ? 212 SER E CB    1 
ATOM 2144 O OG    . SER E 1 44 ? 34.584  -67.385 -38.883 1.00 49.50  ? 212 SER E OG    1 
ATOM 2145 N N     . ALA E 1 45 ? 35.998  -71.448 -37.929 1.00 46.98  ? 213 ALA E N     1 
ATOM 2146 C CA    . ALA E 1 45 ? 35.848  -72.884 -37.724 1.00 47.75  ? 213 ALA E CA    1 
ATOM 2147 C C     . ALA E 1 45 ? 36.227  -73.303 -36.290 1.00 48.12  ? 213 ALA E C     1 
ATOM 2148 O O     . ALA E 1 45 ? 35.581  -74.189 -35.699 1.00 47.87  ? 213 ALA E O     1 
ATOM 2149 C CB    . ALA E 1 45 ? 36.672  -73.666 -38.762 1.00 47.42  ? 213 ALA E CB    1 
ATOM 2150 N N     . GLU E 1 46 ? 37.256  -72.657 -35.739 1.00 47.85  ? 214 GLU E N     1 
ATOM 2151 C CA    . GLU E 1 46 ? 37.762  -73.037 -34.443 1.00 48.52  ? 214 GLU E CA    1 
ATOM 2152 C C     . GLU E 1 46 ? 36.680  -72.823 -33.418 1.00 48.79  ? 214 GLU E C     1 
ATOM 2153 O O     . GLU E 1 46 ? 36.623  -73.527 -32.399 1.00 48.87  ? 214 GLU E O     1 
ATOM 2154 C CB    . GLU E 1 46 ? 38.938  -72.174 -34.069 1.00 48.58  ? 214 GLU E CB    1 
ATOM 2155 C CG    . GLU E 1 46 ? 40.183  -72.396 -34.863 1.00 50.80  ? 214 GLU E CG    1 
ATOM 2156 C CD    . GLU E 1 46 ? 41.295  -71.514 -34.359 1.00 54.38  ? 214 GLU E CD    1 
ATOM 2157 O OE1   . GLU E 1 46 ? 42.462  -71.962 -34.324 1.00 56.31  ? 214 GLU E OE1   1 
ATOM 2158 O OE2   . GLU E 1 46 ? 40.991  -70.362 -33.970 1.00 56.46  ? 214 GLU E OE2   1 
ATOM 2159 N N     . ARG E 1 47 ? 35.831  -71.836 -33.713 1.00 48.94  ? 215 ARG E N     1 
ATOM 2160 C CA    . ARG E 1 47 ? 34.785  -71.352 -32.816 1.00 48.93  ? 215 ARG E CA    1 
ATOM 2161 C C     . ARG E 1 47 ? 33.560  -72.217 -32.907 1.00 48.47  ? 215 ARG E C     1 
ATOM 2162 O O     . ARG E 1 47 ? 33.015  -72.611 -31.896 1.00 48.27  ? 215 ARG E O     1 
ATOM 2163 C CB    . ARG E 1 47 ? 34.419  -69.921 -33.192 1.00 49.26  ? 215 ARG E CB    1 
ATOM 2164 C CG    . ARG E 1 47 ? 33.778  -69.154 -32.083 1.00 51.42  ? 215 ARG E CG    1 
ATOM 2165 C CD    . ARG E 1 47 ? 32.321  -68.933 -32.337 1.00 54.45  ? 215 ARG E CD    1 
ATOM 2166 N NE    . ARG E 1 47 ? 32.122  -67.710 -33.090 1.00 57.88  ? 215 ARG E NE    1 
ATOM 2167 C CZ    . ARG E 1 47 ? 31.973  -67.649 -34.412 1.00 61.10  ? 215 ARG E CZ    1 
ATOM 2168 N NH1   . ARG E 1 47 ? 31.797  -66.467 -34.989 1.00 60.51  ? 215 ARG E NH1   1 
ATOM 2169 N NH2   . ARG E 1 47 ? 31.980  -68.758 -35.159 1.00 62.34  ? 215 ARG E NH2   1 
ATOM 2170 N N     . ALA E 1 48 ? 33.131  -72.492 -34.134 1.00 48.50  ? 216 ALA E N     1 
ATOM 2171 C CA    . ALA E 1 48 ? 32.077  -73.458 -34.419 1.00 49.07  ? 216 ALA E CA    1 
ATOM 2172 C C     . ALA E 1 48 ? 32.337  -74.823 -33.743 1.00 49.23  ? 216 ALA E C     1 
ATOM 2173 O O     . ALA E 1 48 ? 31.443  -75.416 -33.144 1.00 49.41  ? 216 ALA E O     1 
ATOM 2174 C CB    . ALA E 1 48 ? 31.923  -73.625 -35.916 1.00 48.61  ? 216 ALA E CB    1 
ATOM 2175 N N     . ALA E 1 49 ? 33.570  -75.294 -33.821 1.00 49.50  ? 217 ALA E N     1 
ATOM 2176 C CA    . ALA E 1 49 ? 33.933  -76.556 -33.205 1.00 49.91  ? 217 ALA E CA    1 
ATOM 2177 C C     . ALA E 1 49 ? 33.841  -76.460 -31.699 1.00 50.08  ? 217 ALA E C     1 
ATOM 2178 O O     . ALA E 1 49 ? 33.467  -77.427 -31.047 1.00 50.28  ? 217 ALA E O     1 
ATOM 2179 C CB    . ALA E 1 49 ? 35.339  -76.995 -33.631 1.00 49.77  ? 217 ALA E CB    1 
ATOM 2180 N N     . LEU E 1 50 ? 34.171  -75.298 -31.145 1.00 50.57  ? 218 LEU E N     1 
ATOM 2181 C CA    . LEU E 1 50 ? 34.166  -75.141 -29.698 1.00 51.06  ? 218 LEU E CA    1 
ATOM 2182 C C     . LEU E 1 50 ? 32.732  -75.084 -29.220 1.00 51.84  ? 218 LEU E C     1 
ATOM 2183 O O     . LEU E 1 50 ? 32.404  -75.613 -28.150 1.00 51.85  ? 218 LEU E O     1 
ATOM 2184 C CB    . LEU E 1 50 ? 34.930  -73.896 -29.272 1.00 51.01  ? 218 LEU E CB    1 
ATOM 2185 C CG    . LEU E 1 50 ? 35.024  -73.611 -27.768 1.00 51.27  ? 218 LEU E CG    1 
ATOM 2186 C CD1   . LEU E 1 50 ? 35.927  -74.600 -27.016 1.00 50.00  ? 218 LEU E CD1   1 
ATOM 2187 C CD2   . LEU E 1 50 ? 35.534  -72.215 -27.593 1.00 50.64  ? 218 LEU E CD2   1 
ATOM 2188 N N     . ALA E 1 51 ? 31.881  -74.456 -30.033 1.00 52.53  ? 219 ALA E N     1 
ATOM 2189 C CA    . ALA E 1 51 ? 30.450  -74.408 -29.778 1.00 53.21  ? 219 ALA E CA    1 
ATOM 2190 C C     . ALA E 1 51 ? 29.900  -75.826 -29.655 1.00 53.92  ? 219 ALA E C     1 
ATOM 2191 O O     . ALA E 1 51 ? 29.325  -76.186 -28.623 1.00 54.11  ? 219 ALA E O     1 
ATOM 2192 C CB    . ALA E 1 51 ? 29.735  -73.647 -30.884 1.00 52.85  ? 219 ALA E CB    1 
ATOM 2193 N N     . ARG E 1 52 ? 30.108  -76.635 -30.694 1.00 54.75  ? 220 ARG E N     1 
ATOM 2194 C CA    . ARG E 1 52 ? 29.524  -77.969 -30.739 1.00 55.80  ? 220 ARG E CA    1 
ATOM 2195 C C     . ARG E 1 52 ? 29.989  -78.810 -29.556 1.00 55.76  ? 220 ARG E C     1 
ATOM 2196 O O     . ARG E 1 52 ? 29.190  -79.488 -28.914 1.00 55.50  ? 220 ARG E O     1 
ATOM 2197 C CB    . ARG E 1 52 ? 29.818  -78.671 -32.065 1.00 56.01  ? 220 ARG E CB    1 
ATOM 2198 C CG    . ARG E 1 52 ? 28.915  -79.897 -32.304 1.00 58.10  ? 220 ARG E CG    1 
ATOM 2199 C CD    . ARG E 1 52 ? 29.364  -80.692 -33.517 1.00 61.26  ? 220 ARG E CD    1 
ATOM 2200 N NE    . ARG E 1 52 ? 29.678  -79.763 -34.593 1.00 64.10  ? 220 ARG E NE    1 
ATOM 2201 C CZ    . ARG E 1 52 ? 28.883  -79.514 -35.623 1.00 65.07  ? 220 ARG E CZ    1 
ATOM 2202 N NH1   . ARG E 1 52 ? 29.261  -78.624 -36.542 1.00 65.05  ? 220 ARG E NH1   1 
ATOM 2203 N NH2   . ARG E 1 52 ? 27.725  -80.167 -35.738 1.00 64.99  ? 220 ARG E NH2   1 
ATOM 2204 N N     . GLY E 1 53 ? 31.276  -78.723 -29.252 1.00 55.95  ? 221 GLY E N     1 
ATOM 2205 C CA    . GLY E 1 53 ? 31.832  -79.419 -28.111 1.00 56.65  ? 221 GLY E CA    1 
ATOM 2206 C C     . GLY E 1 53 ? 31.194  -79.072 -26.778 1.00 57.40  ? 221 GLY E C     1 
ATOM 2207 O O     . GLY E 1 53 ? 31.189  -79.895 -25.871 1.00 57.91  ? 221 GLY E O     1 
ATOM 2208 N N     . LEU E 1 54 ? 30.662  -77.862 -26.632 1.00 57.95  ? 222 LEU E N     1 
ATOM 2209 C CA    . LEU E 1 54 ? 30.176  -77.440 -25.318 1.00 58.29  ? 222 LEU E CA    1 
ATOM 2210 C C     . LEU E 1 54 ? 28.664  -77.308 -25.240 1.00 58.76  ? 222 LEU E C     1 
ATOM 2211 O O     . LEU E 1 54 ? 28.125  -76.873 -24.210 1.00 59.01  ? 222 LEU E O     1 
ATOM 2212 C CB    . LEU E 1 54 ? 30.866  -76.156 -24.857 1.00 57.98  ? 222 LEU E CB    1 
ATOM 2213 C CG    . LEU E 1 54 ? 32.384  -76.247 -24.675 1.00 57.87  ? 222 LEU E CG    1 
ATOM 2214 C CD1   . LEU E 1 54 ? 32.944  -74.962 -24.098 1.00 57.44  ? 222 LEU E CD1   1 
ATOM 2215 C CD2   . LEU E 1 54 ? 32.771  -77.420 -23.802 1.00 57.15  ? 222 LEU E CD2   1 
ATOM 2216 N N     . LYS E 1 55 ? 27.989  -77.724 -26.317 1.00 58.87  ? 223 LYS E N     1 
ATOM 2217 C CA    . LYS E 1 55 ? 26.532  -77.598 -26.449 1.00 58.93  ? 223 LYS E CA    1 
ATOM 2218 C C     . LYS E 1 55 ? 26.093  -76.142 -26.283 1.00 58.06  ? 223 LYS E C     1 
ATOM 2219 O O     . LYS E 1 55 ? 25.060  -75.853 -25.670 1.00 58.25  ? 223 LYS E O     1 
ATOM 2220 C CB    . LYS E 1 55 ? 25.790  -78.501 -25.448 1.00 59.68  ? 223 LYS E CB    1 
ATOM 2221 C CG    . LYS E 1 55 ? 26.281  -79.952 -25.375 1.00 61.75  ? 223 LYS E CG    1 
ATOM 2222 C CD    . LYS E 1 55 ? 25.729  -80.823 -26.518 1.00 65.11  ? 223 LYS E CD    1 
ATOM 2223 C CE    . LYS E 1 55 ? 26.011  -82.316 -26.295 1.00 64.41  ? 223 LYS E CE    1 
ATOM 2224 N NZ    . LYS E 1 55 ? 25.792  -83.089 -27.564 1.00 66.95  ? 223 LYS E NZ    1 
ATOM 2225 N N     . MET E 1 56 ? 26.897  -75.232 -26.820 1.00 57.06  ? 224 MET E N     1 
ATOM 2226 C CA    . MET E 1 56 ? 26.579  -73.809 -26.828 1.00 56.00  ? 224 MET E CA    1 
ATOM 2227 C C     . MET E 1 56 ? 26.390  -73.400 -28.257 1.00 55.62  ? 224 MET E C     1 
ATOM 2228 O O     . MET E 1 56 ? 26.978  -74.002 -29.155 1.00 55.68  ? 224 MET E O     1 
ATOM 2229 C CB    . MET E 1 56 ? 27.724  -72.995 -26.250 1.00 55.85  ? 224 MET E CB    1 
ATOM 2230 C CG    . MET E 1 56 ? 27.996  -73.248 -24.796 1.00 55.16  ? 224 MET E CG    1 
ATOM 2231 S SD    . MET E 1 56 ? 29.569  -72.523 -24.302 1.00 55.69  ? 224 MET E SD    1 
ATOM 2232 C CE    . MET E 1 56 ? 29.165  -70.779 -24.323 1.00 56.57  ? 224 MET E CE    1 
ATOM 2233 N N     . THR E 1 57 ? 25.580  -72.370 -28.478 1.00 55.19  ? 225 THR E N     1 
ATOM 2234 C CA    . THR E 1 57 ? 25.440  -71.798 -29.821 1.00 54.81  ? 225 THR E CA    1 
ATOM 2235 C C     . THR E 1 57 ? 26.700  -71.025 -30.207 1.00 53.98  ? 225 THR E C     1 
ATOM 2236 O O     . THR E 1 57 ? 27.522  -70.674 -29.352 1.00 53.94  ? 225 THR E O     1 
ATOM 2237 C CB    . THR E 1 57 ? 24.247  -70.859 -29.929 1.00 54.90  ? 225 THR E CB    1 
ATOM 2238 O OG1   . THR E 1 57 ? 24.528  -69.666 -29.192 1.00 56.69  ? 225 THR E OG1   1 
ATOM 2239 C CG2   . THR E 1 57 ? 22.982  -71.521 -29.386 1.00 55.21  ? 225 THR E CG2   1 
ATOM 2240 N N     . ASP E 1 58 ? 26.851  -70.767 -31.497 1.00 53.17  ? 226 ASP E N     1 
ATOM 2241 C CA    . ASP E 1 58 ? 28.040  -70.107 -31.991 1.00 52.61  ? 226 ASP E CA    1 
ATOM 2242 C C     . ASP E 1 58 ? 28.121  -68.691 -31.409 1.00 51.57  ? 226 ASP E C     1 
ATOM 2243 O O     . ASP E 1 58 ? 29.166  -68.273 -30.888 1.00 51.42  ? 226 ASP E O     1 
ATOM 2244 C CB    . ASP E 1 58 ? 28.023  -70.101 -33.520 1.00 53.15  ? 226 ASP E CB    1 
ATOM 2245 C CG    . ASP E 1 58 ? 29.308  -69.565 -34.114 1.00 55.28  ? 226 ASP E CG    1 
ATOM 2246 O OD1   . ASP E 1 58 ? 29.475  -68.328 -34.185 1.00 57.06  ? 226 ASP E OD1   1 
ATOM 2247 O OD2   . ASP E 1 58 ? 30.162  -70.378 -34.529 1.00 58.67  ? 226 ASP E OD2   1 
ATOM 2248 N N     . ALA E 1 59 ? 26.991  -67.987 -31.455 1.00 50.19  ? 227 ALA E N     1 
ATOM 2249 C CA    . ALA E 1 59 ? 26.875  -66.625 -30.940 1.00 49.01  ? 227 ALA E CA    1 
ATOM 2250 C C     . ALA E 1 59 ? 27.361  -66.489 -29.492 1.00 48.26  ? 227 ALA E C     1 
ATOM 2251 O O     . ALA E 1 59 ? 28.104  -65.551 -29.144 1.00 47.83  ? 227 ALA E O     1 
ATOM 2252 C CB    . ALA E 1 59 ? 25.456  -66.156 -31.062 1.00 48.98  ? 227 ALA E CB    1 
ATOM 2253 N N     . GLN E 1 60 ? 26.951  -67.437 -28.657 1.00 47.05  ? 228 GLN E N     1 
ATOM 2254 C CA    . GLN E 1 60 ? 27.327  -67.433 -27.253 1.00 46.26  ? 228 GLN E CA    1 
ATOM 2255 C C     . GLN E 1 60 ? 28.821  -67.590 -27.040 1.00 45.29  ? 228 GLN E C     1 
ATOM 2256 O O     . GLN E 1 60 ? 29.379  -67.067 -26.068 1.00 44.83  ? 228 GLN E O     1 
ATOM 2257 C CB    . GLN E 1 60 ? 26.580  -68.525 -26.511 1.00 46.48  ? 228 GLN E CB    1 
ATOM 2258 C CG    . GLN E 1 60 ? 25.121  -68.211 -26.346 1.00 48.27  ? 228 GLN E CG    1 
ATOM 2259 C CD    . GLN E 1 60 ? 24.382  -69.326 -25.687 1.00 50.25  ? 228 GLN E CD    1 
ATOM 2260 O OE1   . GLN E 1 60 ? 23.857  -69.170 -24.581 1.00 50.26  ? 228 GLN E OE1   1 
ATOM 2261 N NE2   . GLN E 1 60 ? 24.353  -70.484 -26.347 1.00 52.03  ? 228 GLN E NE2   1 
ATOM 2262 N N     . VAL E 1 61 ? 29.471  -68.306 -27.951 1.00 44.35  ? 229 VAL E N     1 
ATOM 2263 C CA    . VAL E 1 61 ? 30.908  -68.457 -27.845 1.00 43.42  ? 229 VAL E CA    1 
ATOM 2264 C C     . VAL E 1 61 ? 31.539  -67.164 -28.320 1.00 42.26  ? 229 VAL E C     1 
ATOM 2265 O O     . VAL E 1 61 ? 32.452  -66.646 -27.674 1.00 41.75  ? 229 VAL E O     1 
ATOM 2266 C CB    . VAL E 1 61 ? 31.445  -69.684 -28.604 1.00 43.57  ? 229 VAL E CB    1 
ATOM 2267 C CG1   . VAL E 1 61 ? 32.956  -69.708 -28.547 1.00 43.39  ? 229 VAL E CG1   1 
ATOM 2268 C CG2   . VAL E 1 61 ? 30.909  -70.954 -27.964 1.00 44.18  ? 229 VAL E CG2   1 
ATOM 2269 N N     . LYS E 1 62 ? 31.020  -66.633 -29.427 1.00 41.17  ? 230 LYS E N     1 
ATOM 2270 C CA    . LYS E 1 62 ? 31.480  -65.343 -29.922 1.00 40.36  ? 230 LYS E CA    1 
ATOM 2271 C C     . LYS E 1 62 ? 31.423  -64.349 -28.781 1.00 39.16  ? 230 LYS E C     1 
ATOM 2272 O O     . LYS E 1 62 ? 32.438  -63.781 -28.380 1.00 38.49  ? 230 LYS E O     1 
ATOM 2273 C CB    . LYS E 1 62 ? 30.640  -64.860 -31.097 1.00 40.29  ? 230 LYS E CB    1 
ATOM 2274 C CG    . LYS E 1 62 ? 31.278  -63.697 -31.816 1.00 40.98  ? 230 LYS E CG    1 
ATOM 2275 C CD    . LYS E 1 62 ? 30.438  -63.234 -32.983 1.00 43.25  ? 230 LYS E CD    1 
ATOM 2276 C CE    . LYS E 1 62 ? 29.231  -62.455 -32.484 1.00 45.81  ? 230 LYS E CE    1 
ATOM 2277 N NZ    . LYS E 1 62 ? 28.037  -62.674 -33.349 1.00 48.09  ? 230 LYS E NZ    1 
ATOM 2278 N N     . THR E 1 63 ? 30.234  -64.208 -28.212 1.00 38.64  ? 231 THR E N     1 
ATOM 2279 C CA    . THR E 1 63 ? 30.020  -63.269 -27.110 1.00 37.68  ? 231 THR E CA    1 
ATOM 2280 C C     . THR E 1 63 ? 30.856  -63.566 -25.872 1.00 37.25  ? 231 THR E C     1 
ATOM 2281 O O     . THR E 1 63 ? 31.472  -62.649 -25.297 1.00 36.94  ? 231 THR E O     1 
ATOM 2282 C CB    . THR E 1 63 ? 28.544  -63.140 -26.770 1.00 37.39  ? 231 THR E CB    1 
ATOM 2283 O OG1   . THR E 1 63 ? 27.879  -62.557 -27.901 1.00 38.32  ? 231 THR E OG1   1 
ATOM 2284 C CG2   . THR E 1 63 ? 28.359  -62.268 -25.547 1.00 35.40  ? 231 THR E CG2   1 
ATOM 2285 N N     . TRP E 1 64 ? 30.910  -64.839 -25.476 1.00 36.68  ? 232 TRP E N     1 
ATOM 2286 C CA    . TRP E 1 64 ? 31.680  -65.183 -24.297 1.00 36.01  ? 232 TRP E CA    1 
ATOM 2287 C C     . TRP E 1 64 ? 33.096  -64.684 -24.485 1.00 36.51  ? 232 TRP E C     1 
ATOM 2288 O O     . TRP E 1 64 ? 33.689  -64.121 -23.577 1.00 36.53  ? 232 TRP E O     1 
ATOM 2289 C CB    . TRP E 1 64 ? 31.676  -66.682 -24.013 1.00 35.54  ? 232 TRP E CB    1 
ATOM 2290 C CG    . TRP E 1 64 ? 32.287  -66.940 -22.686 1.00 34.56  ? 232 TRP E CG    1 
ATOM 2291 C CD1   . TRP E 1 64 ? 31.645  -66.979 -21.488 1.00 33.54  ? 232 TRP E CD1   1 
ATOM 2292 C CD2   . TRP E 1 64 ? 33.678  -67.126 -22.401 1.00 33.04  ? 232 TRP E CD2   1 
ATOM 2293 N NE1   . TRP E 1 64 ? 32.544  -67.191 -20.477 1.00 32.77  ? 232 TRP E NE1   1 
ATOM 2294 C CE2   . TRP E 1 64 ? 33.800  -67.275 -21.007 1.00 32.53  ? 232 TRP E CE2   1 
ATOM 2295 C CE3   . TRP E 1 64 ? 34.824  -67.187 -23.188 1.00 32.35  ? 232 TRP E CE3   1 
ATOM 2296 C CZ2   . TRP E 1 64 ? 35.018  -67.489 -20.382 1.00 34.59  ? 232 TRP E CZ2   1 
ATOM 2297 C CZ3   . TRP E 1 64 ? 36.040  -67.378 -22.563 1.00 34.63  ? 232 TRP E CZ3   1 
ATOM 2298 C CH2   . TRP E 1 64 ? 36.132  -67.526 -21.177 1.00 34.56  ? 232 TRP E CH2   1 
ATOM 2299 N N     . PHE E 1 65 ? 33.642  -64.868 -25.677 1.00 37.55  ? 233 PHE E N     1 
ATOM 2300 C CA    . PHE E 1 65 ? 35.021  -64.484 -25.882 1.00 39.15  ? 233 PHE E CA    1 
ATOM 2301 C C     . PHE E 1 65 ? 35.205  -62.956 -25.851 1.00 40.12  ? 233 PHE E C     1 
ATOM 2302 O O     . PHE E 1 65 ? 36.164  -62.432 -25.257 1.00 40.16  ? 233 PHE E O     1 
ATOM 2303 C CB    . PHE E 1 65 ? 35.588  -65.121 -27.144 1.00 38.94  ? 233 PHE E CB    1 
ATOM 2304 C CG    . PHE E 1 65 ? 36.267  -66.432 -26.892 1.00 39.79  ? 233 PHE E CG    1 
ATOM 2305 C CD1   . PHE E 1 65 ? 35.543  -67.607 -26.834 1.00 40.04  ? 233 PHE E CD1   1 
ATOM 2306 C CD2   . PHE E 1 65 ? 37.642  -66.491 -26.696 1.00 40.95  ? 233 PHE E CD2   1 
ATOM 2307 C CE1   . PHE E 1 65 ? 36.178  -68.814 -26.590 1.00 39.26  ? 233 PHE E CE1   1 
ATOM 2308 C CE2   . PHE E 1 65 ? 38.273  -67.692 -26.448 1.00 40.65  ? 233 PHE E CE2   1 
ATOM 2309 C CZ    . PHE E 1 65 ? 37.542  -68.854 -26.400 1.00 39.28  ? 233 PHE E CZ    1 
ATOM 2310 N N     . GLN E 1 66 ? 34.259  -62.254 -26.464 1.00 40.78  ? 234 GLN E N     1 
ATOM 2311 C CA    . GLN E 1 66 ? 34.305  -60.818 -26.498 1.00 40.82  ? 234 GLN E CA    1 
ATOM 2312 C C     . GLN E 1 66 ? 34.348  -60.309 -25.074 1.00 40.97  ? 234 GLN E C     1 
ATOM 2313 O O     . GLN E 1 66 ? 35.257  -59.532 -24.723 1.00 40.91  ? 234 GLN E O     1 
ATOM 2314 C CB    . GLN E 1 66 ? 33.102  -60.252 -27.256 1.00 41.00  ? 234 GLN E CB    1 
ATOM 2315 C CG    . GLN E 1 66 ? 33.265  -58.766 -27.627 1.00 41.19  ? 234 GLN E CG    1 
ATOM 2316 C CD    . GLN E 1 66 ? 34.583  -58.484 -28.316 1.00 39.80  ? 234 GLN E CD    1 
ATOM 2317 O OE1   . GLN E 1 66 ? 34.814  -58.929 -29.419 1.00 41.33  ? 234 GLN E OE1   1 
ATOM 2318 N NE2   . GLN E 1 66 ? 35.448  -57.753 -27.659 1.00 39.72  ? 234 GLN E NE2   1 
ATOM 2319 N N     . ASN E 1 67 ? 33.392  -60.771 -24.251 1.00 40.89  ? 235 ASN E N     1 
ATOM 2320 C CA    . ASN E 1 67 ? 33.351  -60.400 -22.824 1.00 40.37  ? 235 ASN E CA    1 
ATOM 2321 C C     . ASN E 1 67 ? 34.626  -60.809 -22.138 1.00 40.61  ? 235 ASN E C     1 
ATOM 2322 O O     . ASN E 1 67 ? 35.193  -60.032 -21.389 1.00 41.11  ? 235 ASN E O     1 
ATOM 2323 C CB    . ASN E 1 67 ? 32.150  -60.997 -22.090 1.00 39.83  ? 235 ASN E CB    1 
ATOM 2324 C CG    . ASN E 1 67 ? 30.829  -60.335 -22.477 1.00 39.79  ? 235 ASN E CG    1 
ATOM 2325 O OD1   . ASN E 1 67 ? 30.776  -59.143 -22.757 1.00 39.95  ? 235 ASN E OD1   1 
ATOM 2326 N ND2   . ASN E 1 67 ? 29.757  -61.117 -22.501 1.00 38.87  ? 235 ASN E ND2   1 
ATOM 2327 N N     . ARG E 1 68 ? 35.112  -62.009 -22.419 1.00 40.98  ? 236 ARG E N     1 
ATOM 2328 C CA    . ARG E 1 68 ? 36.328  -62.433 -21.760 1.00 41.94  ? 236 ARG E CA    1 
ATOM 2329 C C     . ARG E 1 68 ? 37.514  -61.491 -22.075 1.00 42.07  ? 236 ARG E C     1 
ATOM 2330 O O     . ARG E 1 68 ? 38.298  -61.165 -21.183 1.00 42.21  ? 236 ARG E O     1 
ATOM 2331 C CB    . ARG E 1 68 ? 36.649  -63.898 -22.086 1.00 42.28  ? 236 ARG E CB    1 
ATOM 2332 C CG    . ARG E 1 68 ? 37.855  -64.479 -21.320 1.00 43.14  ? 236 ARG E CG    1 
ATOM 2333 C CD    . ARG E 1 68 ? 37.597  -64.545 -19.804 1.00 47.49  ? 236 ARG E CD    1 
ATOM 2334 N NE    . ARG E 1 68 ? 38.470  -63.626 -19.073 1.00 51.10  ? 236 ARG E NE    1 
ATOM 2335 C CZ    . ARG E 1 68 ? 39.506  -63.990 -18.318 1.00 51.11  ? 236 ARG E CZ    1 
ATOM 2336 N NH1   . ARG E 1 68 ? 39.814  -65.260 -18.148 1.00 51.35  ? 236 ARG E NH1   1 
ATOM 2337 N NH2   . ARG E 1 68 ? 40.237  -63.072 -17.719 1.00 52.86  ? 236 ARG E NH2   1 
ATOM 2338 N N     . ARG E 1 69 ? 37.631  -61.044 -23.322 1.00 42.09  ? 237 ARG E N     1 
ATOM 2339 C CA    . ARG E 1 69 ? 38.683  -60.115 -23.691 1.00 43.06  ? 237 ARG E CA    1 
ATOM 2340 C C     . ARG E 1 69 ? 38.575  -58.720 -23.025 1.00 44.94  ? 237 ARG E C     1 
ATOM 2341 O O     . ARG E 1 69 ? 39.590  -58.144 -22.594 1.00 44.63  ? 237 ARG E O     1 
ATOM 2342 C CB    . ARG E 1 69 ? 38.774  -59.983 -25.204 1.00 42.52  ? 237 ARG E CB    1 
ATOM 2343 C CG    . ARG E 1 69 ? 39.421  -61.172 -25.864 1.00 40.10  ? 237 ARG E CG    1 
ATOM 2344 C CD    . ARG E 1 69 ? 39.687  -60.876 -27.301 1.00 38.32  ? 237 ARG E CD    1 
ATOM 2345 N NE    . ARG E 1 69 ? 38.470  -60.686 -28.076 1.00 37.47  ? 237 ARG E NE    1 
ATOM 2346 C CZ    . ARG E 1 69 ? 37.808  -61.662 -28.697 1.00 40.09  ? 237 ARG E CZ    1 
ATOM 2347 N NH1   . ARG E 1 69 ? 38.246  -62.925 -28.657 1.00 38.90  ? 237 ARG E NH1   1 
ATOM 2348 N NH2   . ARG E 1 69 ? 36.702  -61.380 -29.380 1.00 40.16  ? 237 ARG E NH2   1 
ATOM 2349 N N     . THR E 1 70 ? 37.349  -58.183 -22.936 1.00 46.62  ? 238 THR E N     1 
ATOM 2350 C CA    . THR E 1 70 ? 37.123  -56.904 -22.249 1.00 47.58  ? 238 THR E CA    1 
ATOM 2351 C C     . THR E 1 70 ? 37.621  -57.003 -20.808 1.00 48.77  ? 238 THR E C     1 
ATOM 2352 O O     . THR E 1 70 ? 38.379  -56.137 -20.351 1.00 49.16  ? 238 THR E O     1 
ATOM 2353 C CB    . THR E 1 70 ? 35.642  -56.484 -22.270 1.00 47.19  ? 238 THR E CB    1 
ATOM 2354 O OG1   . THR E 1 70 ? 35.154  -56.569 -23.607 1.00 47.59  ? 238 THR E OG1   1 
ATOM 2355 C CG2   . THR E 1 70 ? 35.478  -55.065 -21.781 1.00 45.82  ? 238 THR E CG2   1 
ATOM 2356 N N     . LYS E 1 71 ? 37.198  -58.060 -20.112 1.00 49.90  ? 239 LYS E N     1 
ATOM 2357 C CA    . LYS E 1 71 ? 37.649  -58.337 -18.757 1.00 51.58  ? 239 LYS E CA    1 
ATOM 2358 C C     . LYS E 1 71 ? 39.170  -58.448 -18.733 1.00 52.66  ? 239 LYS E C     1 
ATOM 2359 O O     . LYS E 1 71 ? 39.835  -57.819 -17.903 1.00 53.10  ? 239 LYS E O     1 
ATOM 2360 C CB    . LYS E 1 71 ? 36.990  -59.613 -18.236 1.00 51.69  ? 239 LYS E CB    1 
ATOM 2361 C CG    . LYS E 1 71 ? 37.501  -60.102 -16.907 1.00 52.95  ? 239 LYS E CG    1 
ATOM 2362 C CD    . LYS E 1 71 ? 36.579  -61.157 -16.286 1.00 55.57  ? 239 LYS E CD    1 
ATOM 2363 C CE    . LYS E 1 71 ? 37.198  -61.659 -14.962 1.00 58.22  ? 239 LYS E CE    1 
ATOM 2364 N NZ    . LYS E 1 71 ? 36.314  -62.536 -14.136 1.00 59.15  ? 239 LYS E NZ    1 
ATOM 2365 N N     . TRP E 1 72 ? 39.721  -59.220 -19.666 1.00 53.82  ? 240 TRP E N     1 
ATOM 2366 C CA    . TRP E 1 72 ? 41.158  -59.393 -19.738 1.00 55.12  ? 240 TRP E CA    1 
ATOM 2367 C C     . TRP E 1 72 ? 41.840  -58.046 -19.906 1.00 55.82  ? 240 TRP E C     1 
ATOM 2368 O O     . TRP E 1 72 ? 42.754  -57.722 -19.178 1.00 55.73  ? 240 TRP E O     1 
ATOM 2369 C CB    . TRP E 1 72 ? 41.549  -60.366 -20.863 1.00 55.30  ? 240 TRP E CB    1 
ATOM 2370 C CG    . TRP E 1 72 ? 43.045  -60.405 -21.159 1.00 55.63  ? 240 TRP E CG    1 
ATOM 2371 C CD1   . TRP E 1 72 ? 44.045  -60.579 -20.258 1.00 54.76  ? 240 TRP E CD1   1 
ATOM 2372 C CD2   . TRP E 1 72 ? 43.689  -60.261 -22.450 1.00 56.19  ? 240 TRP E CD2   1 
ATOM 2373 N NE1   . TRP E 1 72 ? 45.267  -60.546 -20.891 1.00 55.47  ? 240 TRP E NE1   1 
ATOM 2374 C CE2   . TRP E 1 72 ? 45.078  -60.357 -22.235 1.00 55.59  ? 240 TRP E CE2   1 
ATOM 2375 C CE3   . TRP E 1 72 ? 43.224  -60.055 -23.758 1.00 55.97  ? 240 TRP E CE3   1 
ATOM 2376 C CZ2   . TRP E 1 72 ? 46.011  -60.262 -23.278 1.00 55.26  ? 240 TRP E CZ2   1 
ATOM 2377 C CZ3   . TRP E 1 72 ? 44.157  -59.965 -24.796 1.00 55.42  ? 240 TRP E CZ3   1 
ATOM 2378 C CH2   . TRP E 1 72 ? 45.533  -60.067 -24.543 1.00 55.32  ? 240 TRP E CH2   1 
ATOM 2379 N N     . ARG E 1 73 ? 41.375  -57.253 -20.859 1.00 57.55  ? 241 ARG E N     1 
ATOM 2380 C CA    . ARG E 1 73 ? 42.002  -55.970 -21.152 1.00 58.78  ? 241 ARG E CA    1 
ATOM 2381 C C     . ARG E 1 73 ? 41.956  -54.961 -20.009 1.00 60.59  ? 241 ARG E C     1 
ATOM 2382 O O     . ARG E 1 73 ? 42.953  -54.291 -19.753 1.00 60.69  ? 241 ARG E O     1 
ATOM 2383 C CB    . ARG E 1 73 ? 41.410  -55.365 -22.402 1.00 58.10  ? 241 ARG E CB    1 
ATOM 2384 C CG    . ARG E 1 73 ? 42.174  -55.733 -23.624 1.00 56.79  ? 241 ARG E CG    1 
ATOM 2385 C CD    . ARG E 1 73 ? 41.801  -54.839 -24.767 1.00 55.14  ? 241 ARG E CD    1 
ATOM 2386 N NE    . ARG E 1 73 ? 40.524  -55.215 -25.345 1.00 53.88  ? 241 ARG E NE    1 
ATOM 2387 C CZ    . ARG E 1 73 ? 40.403  -56.163 -26.261 1.00 55.93  ? 241 ARG E CZ    1 
ATOM 2388 N NH1   . ARG E 1 73 ? 41.487  -56.811 -26.676 1.00 56.05  ? 241 ARG E NH1   1 
ATOM 2389 N NH2   . ARG E 1 73 ? 39.209  -56.462 -26.762 1.00 56.42  ? 241 ARG E NH2   1 
ATOM 2390 N N     . ARG E 1 74 ? 40.819  -54.865 -19.319 1.00 62.72  ? 242 ARG E N     1 
ATOM 2391 C CA    . ARG E 1 74 ? 40.689  -53.900 -18.225 1.00 65.10  ? 242 ARG E CA    1 
ATOM 2392 C C     . ARG E 1 74 ? 41.384  -54.333 -16.936 1.00 66.53  ? 242 ARG E C     1 
ATOM 2393 O O     . ARG E 1 74 ? 41.545  -53.522 -16.028 1.00 66.87  ? 242 ARG E O     1 
ATOM 2394 C CB    . ARG E 1 74 ? 39.225  -53.551 -17.928 1.00 65.00  ? 242 ARG E CB    1 
ATOM 2395 C CG    . ARG E 1 74 ? 38.502  -54.632 -17.161 1.00 65.82  ? 242 ARG E CG    1 
ATOM 2396 C CD    . ARG E 1 74 ? 37.894  -54.158 -15.847 1.00 65.61  ? 242 ARG E CD    1 
ATOM 2397 N NE    . ARG E 1 74 ? 37.020  -55.214 -15.336 1.00 66.98  ? 242 ARG E NE    1 
ATOM 2398 C CZ    . ARG E 1 74 ? 37.379  -56.161 -14.470 1.00 67.74  ? 242 ARG E CZ    1 
ATOM 2399 N NH1   . ARG E 1 74 ? 38.600  -56.194 -13.951 1.00 69.41  ? 242 ARG E NH1   1 
ATOM 2400 N NH2   . ARG E 1 74 ? 36.503  -57.077 -14.107 1.00 68.61  ? 242 ARG E NH2   1 
ATOM 2401 N N     . GLN E 1 75 ? 41.757  -55.608 -16.844 1.00 68.59  ? 243 GLN E N     1 
ATOM 2402 C CA    . GLN E 1 75 ? 42.567  -56.095 -15.725 1.00 70.53  ? 243 GLN E CA    1 
ATOM 2403 C C     . GLN E 1 75 ? 44.025  -55.812 -16.017 1.00 71.99  ? 243 GLN E C     1 
ATOM 2404 O O     . GLN E 1 75 ? 44.766  -55.339 -15.155 1.00 72.31  ? 243 GLN E O     1 
ATOM 2405 C CB    . GLN E 1 75 ? 42.388  -57.593 -15.520 1.00 70.24  ? 243 GLN E CB    1 
ATOM 2406 C CG    . GLN E 1 75 ? 41.141  -57.955 -14.777 1.00 70.68  ? 243 GLN E CG    1 
ATOM 2407 C CD    . GLN E 1 75 ? 41.084  -59.416 -14.410 1.00 70.42  ? 243 GLN E CD    1 
ATOM 2408 O OE1   . GLN E 1 75 ? 41.855  -60.228 -14.915 1.00 70.89  ? 243 GLN E OE1   1 
ATOM 2409 N NE2   . GLN E 1 75 ? 40.159  -59.763 -13.530 1.00 70.16  ? 243 GLN E NE2   1 
ATOM 2410 N N     . THR E 1 76 ? 44.430  -56.132 -17.239 1.00 73.78  ? 244 THR E N     1 
ATOM 2411 C CA    . THR E 1 76 ? 45.772  -55.881 -17.698 1.00 75.76  ? 244 THR E CA    1 
ATOM 2412 C C     . THR E 1 76 ? 46.015  -54.397 -17.559 1.00 77.29  ? 244 THR E C     1 
ATOM 2413 O O     . THR E 1 76 ? 46.808  -53.966 -16.711 1.00 77.50  ? 244 THR E O     1 
ATOM 2414 C CB    . THR E 1 76 ? 45.922  -56.329 -19.159 1.00 75.68  ? 244 THR E CB    1 
ATOM 2415 O OG1   . THR E 1 76 ? 46.187  -57.736 -19.187 1.00 76.23  ? 244 THR E OG1   1 
ATOM 2416 C CG2   . THR E 1 76 ? 47.043  -55.584 -19.883 1.00 76.04  ? 244 THR E CG2   1 
ATOM 2417 N N     . ALA E 1 77 ? 45.270  -53.623 -18.348 1.00 79.24  ? 245 ALA E N     1 
ATOM 2418 C CA    . ALA E 1 77 ? 45.502  -52.189 -18.499 1.00 80.80  ? 245 ALA E CA    1 
ATOM 2419 C C     . ALA E 1 77 ? 45.334  -51.381 -17.214 1.00 82.04  ? 245 ALA E C     1 
ATOM 2420 O O     . ALA E 1 77 ? 45.812  -50.252 -17.153 1.00 82.63  ? 245 ALA E O     1 
ATOM 2421 C CB    . ALA E 1 77 ? 44.640  -51.613 -19.625 1.00 80.65  ? 245 ALA E CB    1 
ATOM 2422 N N     . GLU E 1 78 ? 44.681  -51.939 -16.191 1.00 83.42  ? 246 GLU E N     1 
ATOM 2423 C CA    . GLU E 1 78 ? 44.568  -51.219 -14.906 1.00 84.64  ? 246 GLU E CA    1 
ATOM 2424 C C     . GLU E 1 78 ? 45.528  -51.703 -13.809 1.00 85.32  ? 246 GLU E C     1 
ATOM 2425 O O     . GLU E 1 78 ? 46.006  -50.879 -13.027 1.00 85.75  ? 246 GLU E O     1 
ATOM 2426 C CB    . GLU E 1 78 ? 43.107  -51.109 -14.404 1.00 84.63  ? 246 GLU E CB    1 
ATOM 2427 C CG    . GLU E 1 78 ? 42.696  -52.018 -13.221 1.00 84.88  ? 246 GLU E CG    1 
ATOM 2428 C CD    . GLU E 1 78 ? 41.187  -51.947 -12.900 1.00 85.01  ? 246 GLU E CD    1 
ATOM 2429 O OE1   . GLU E 1 78 ? 40.590  -53.016 -12.613 1.00 85.54  ? 246 GLU E OE1   1 
ATOM 2430 O OE2   . GLU E 1 78 ? 40.594  -50.834 -12.938 1.00 84.36  ? 246 GLU E OE2   1 
ATOM 2431 N N     . GLU E 1 79 ? 45.811  -53.018 -13.780 1.00 85.99  ? 247 GLU E N     1 
ATOM 2432 C CA    . GLU E 1 79 ? 46.620  -53.682 -12.723 1.00 86.55  ? 247 GLU E CA    1 
ATOM 2433 C C     . GLU E 1 79 ? 47.343  -52.773 -11.717 1.00 86.62  ? 247 GLU E C     1 
ATOM 2434 O O     . GLU E 1 79 ? 48.269  -52.028 -12.070 1.00 86.87  ? 247 GLU E O     1 
ATOM 2435 C CB    . GLU E 1 79 ? 47.619  -54.680 -13.331 1.00 86.62  ? 247 GLU E CB    1 
ATOM 2436 C CG    . GLU E 1 79 ? 47.238  -56.161 -13.163 1.00 87.12  ? 247 GLU E CG    1 
ATOM 2437 C CD    . GLU E 1 79 ? 48.132  -57.116 -13.975 1.00 87.03  ? 247 GLU E CD    1 
ATOM 2438 O OE1   . GLU E 1 79 ? 48.366  -58.258 -13.517 1.00 87.20  ? 247 GLU E OE1   1 
ATOM 2439 O OE2   . GLU E 1 79 ? 48.596  -56.732 -15.073 1.00 87.41  ? 247 GLU E OE2   1 
ATOM 2440 N N     . ARG F 2 7  ? 37.658  -62.290 0.228   1.00 87.15  ? 86  ARG F N     1 
ATOM 2441 C CA    . ARG F 2 7  ? 38.948  -61.727 -0.282  1.00 87.21  ? 86  ARG F CA    1 
ATOM 2442 C C     . ARG F 2 7  ? 38.882  -61.255 -1.756  1.00 86.83  ? 86  ARG F C     1 
ATOM 2443 O O     . ARG F 2 7  ? 39.907  -60.877 -2.332  1.00 87.14  ? 86  ARG F O     1 
ATOM 2444 C CB    . ARG F 2 7  ? 40.148  -62.678 -0.018  1.00 87.38  ? 86  ARG F CB    1 
ATOM 2445 C CG    . ARG F 2 7  ? 40.276  -63.909 -0.943  1.00 88.91  ? 86  ARG F CG    1 
ATOM 2446 C CD    . ARG F 2 7  ? 39.469  -65.123 -0.435  1.00 91.87  ? 86  ARG F CD    1 
ATOM 2447 N NE    . ARG F 2 7  ? 40.092  -65.775 0.728   1.00 94.09  ? 86  ARG F NE    1 
ATOM 2448 C CZ    . ARG F 2 7  ? 39.432  -66.449 1.677   1.00 94.79  ? 86  ARG F CZ    1 
ATOM 2449 N NH1   . ARG F 2 7  ? 38.106  -66.567 1.631   1.00 94.44  ? 86  ARG F NH1   1 
ATOM 2450 N NH2   . ARG F 2 7  ? 40.100  -66.998 2.690   1.00 94.30  ? 86  ARG F NH2   1 
ATOM 2451 N N     . ARG F 2 8  ? 37.692  -61.273 -2.365  1.00 86.02  ? 87  ARG F N     1 
ATOM 2452 C CA    . ARG F 2 8  ? 37.505  -60.568 -3.637  1.00 85.02  ? 87  ARG F CA    1 
ATOM 2453 C C     . ARG F 2 8  ? 37.433  -59.076 -3.347  1.00 84.69  ? 87  ARG F C     1 
ATOM 2454 O O     . ARG F 2 8  ? 36.737  -58.646 -2.432  1.00 84.58  ? 87  ARG F O     1 
ATOM 2455 C CB    . ARG F 2 8  ? 36.251  -61.016 -4.381  1.00 84.85  ? 87  ARG F CB    1 
ATOM 2456 C CG    . ARG F 2 8  ? 36.041  -60.240 -5.664  1.00 83.86  ? 87  ARG F CG    1 
ATOM 2457 C CD    . ARG F 2 8  ? 34.956  -60.833 -6.507  1.00 82.65  ? 87  ARG F CD    1 
ATOM 2458 N NE    . ARG F 2 8  ? 33.658  -60.216 -6.250  1.00 81.75  ? 87  ARG F NE    1 
ATOM 2459 C CZ    . ARG F 2 8  ? 32.535  -60.561 -6.878  1.00 80.88  ? 87  ARG F CZ    1 
ATOM 2460 N NH1   . ARG F 2 8  ? 32.552  -61.517 -7.798  1.00 81.08  ? 87  ARG F NH1   1 
ATOM 2461 N NH2   . ARG F 2 8  ? 31.394  -59.956 -6.590  1.00 79.69  ? 87  ARG F NH2   1 
ATOM 2462 N N     . TYR F 2 9  ? 38.156  -58.292 -4.131  1.00 84.31  ? 88  TYR F N     1 
ATOM 2463 C CA    . TYR F 2 9  ? 38.329  -56.881 -3.846  1.00 84.07  ? 88  TYR F CA    1 
ATOM 2464 C C     . TYR F 2 9  ? 37.065  -56.035 -4.047  1.00 83.73  ? 88  TYR F C     1 
ATOM 2465 O O     . TYR F 2 9  ? 36.249  -56.293 -4.941  1.00 83.80  ? 88  TYR F O     1 
ATOM 2466 C CB    . TYR F 2 9  ? 39.473  -56.334 -4.685  1.00 84.37  ? 88  TYR F CB    1 
ATOM 2467 C CG    . TYR F 2 9  ? 40.046  -55.041 -4.177  1.00 84.81  ? 88  TYR F CG    1 
ATOM 2468 C CD1   . TYR F 2 9  ? 40.983  -55.032 -3.143  1.00 85.26  ? 88  TYR F CD1   1 
ATOM 2469 C CD2   . TYR F 2 9  ? 39.663  -53.824 -4.739  1.00 85.25  ? 88  TYR F CD2   1 
ATOM 2470 C CE1   . TYR F 2 9  ? 41.521  -53.840 -2.676  1.00 85.33  ? 88  TYR F CE1   1 
ATOM 2471 C CE2   . TYR F 2 9  ? 40.195  -52.625 -4.284  1.00 85.59  ? 88  TYR F CE2   1 
ATOM 2472 C CZ    . TYR F 2 9  ? 41.124  -52.643 -3.254  1.00 85.28  ? 88  TYR F CZ    1 
ATOM 2473 O OH    . TYR F 2 9  ? 41.650  -51.460 -2.807  1.00 85.30  ? 88  TYR F OH    1 
ATOM 2474 N N     . ARG F 2 10 ? 36.913  -55.039 -3.180  1.00 83.13  ? 89  ARG F N     1 
ATOM 2475 C CA    . ARG F 2 10 ? 35.876  -54.023 -3.306  1.00 82.66  ? 89  ARG F CA    1 
ATOM 2476 C C     . ARG F 2 10 ? 36.484  -52.690 -2.924  1.00 82.96  ? 89  ARG F C     1 
ATOM 2477 O O     . ARG F 2 10 ? 37.304  -52.614 -2.005  1.00 83.16  ? 89  ARG F O     1 
ATOM 2478 C CB    . ARG F 2 10 ? 34.692  -54.307 -2.386  1.00 82.28  ? 89  ARG F CB    1 
ATOM 2479 C CG    . ARG F 2 10 ? 33.496  -53.399 -2.635  1.00 80.30  ? 89  ARG F CG    1 
ATOM 2480 C CD    . ARG F 2 10 ? 32.539  -53.379 -1.464  1.00 76.36  ? 89  ARG F CD    1 
ATOM 2481 N NE    . ARG F 2 10 ? 31.212  -53.811 -1.886  1.00 73.95  ? 89  ARG F NE    1 
ATOM 2482 C CZ    . ARG F 2 10 ? 30.131  -53.039 -1.967  1.00 72.62  ? 89  ARG F CZ    1 
ATOM 2483 N NH1   . ARG F 2 10 ? 30.178  -51.755 -1.640  1.00 72.86  ? 89  ARG F NH1   1 
ATOM 2484 N NH2   . ARG F 2 10 ? 28.987  -53.564 -2.378  1.00 71.03  ? 89  ARG F NH2   1 
ATOM 2485 N N     . THR F 2 11 ? 36.081  -51.639 -3.626  1.00 83.04  ? 90  THR F N     1 
ATOM 2486 C CA    . THR F 2 11 ? 36.572  -50.311 -3.324  1.00 83.08  ? 90  THR F CA    1 
ATOM 2487 C C     . THR F 2 11 ? 35.572  -49.600 -2.411  1.00 83.01  ? 90  THR F C     1 
ATOM 2488 O O     . THR F 2 11 ? 34.363  -49.869 -2.476  1.00 83.12  ? 90  THR F O     1 
ATOM 2489 C CB    . THR F 2 11 ? 36.854  -49.504 -4.614  1.00 83.10  ? 90  THR F CB    1 
ATOM 2490 O OG1   . THR F 2 11 ? 37.506  -50.347 -5.571  1.00 83.36  ? 90  THR F OG1   1 
ATOM 2491 C CG2   . THR F 2 11 ? 37.772  -48.309 -4.325  1.00 83.67  ? 90  THR F CG2   1 
ATOM 2492 N N     . THR F 2 12 ? 36.093  -48.739 -1.529  1.00 82.81  ? 91  THR F N     1 
ATOM 2493 C CA    . THR F 2 12 ? 35.272  -47.793 -0.752  1.00 82.42  ? 91  THR F CA    1 
ATOM 2494 C C     . THR F 2 12 ? 35.808  -46.358 -0.937  1.00 81.86  ? 91  THR F C     1 
ATOM 2495 O O     . THR F 2 12 ? 36.908  -46.029 -0.501  1.00 81.63  ? 91  THR F O     1 
ATOM 2496 C CB    . THR F 2 12 ? 35.134  -48.204 0.754   1.00 82.54  ? 91  THR F CB    1 
ATOM 2497 O OG1   . THR F 2 12 ? 36.405  -48.638 1.261   1.00 82.25  ? 91  THR F OG1   1 
ATOM 2498 C CG2   . THR F 2 12 ? 34.093  -49.345 0.927   1.00 82.40  ? 91  THR F CG2   1 
ATOM 2499 N N     . PHE F 2 13 ? 35.015  -45.527 -1.608  1.00 81.41  ? 92  PHE F N     1 
ATOM 2500 C CA    . PHE F 2 13 ? 35.431  -44.189 -2.052  1.00 81.03  ? 92  PHE F CA    1 
ATOM 2501 C C     . PHE F 2 13 ? 35.437  -43.180 -0.918  1.00 80.69  ? 92  PHE F C     1 
ATOM 2502 O O     . PHE F 2 13 ? 34.487  -43.135 -0.134  1.00 80.96  ? 92  PHE F O     1 
ATOM 2503 C CB    . PHE F 2 13 ? 34.476  -43.651 -3.138  1.00 80.93  ? 92  PHE F CB    1 
ATOM 2504 C CG    . PHE F 2 13 ? 34.079  -44.667 -4.190  1.00 80.35  ? 92  PHE F CG    1 
ATOM 2505 C CD1   . PHE F 2 13 ? 34.857  -44.855 -5.327  1.00 79.59  ? 92  PHE F CD1   1 
ATOM 2506 C CD2   . PHE F 2 13 ? 32.907  -45.406 -4.053  1.00 79.74  ? 92  PHE F CD2   1 
ATOM 2507 C CE1   . PHE F 2 13 ? 34.483  -45.772 -6.300  1.00 79.09  ? 92  PHE F CE1   1 
ATOM 2508 C CE2   . PHE F 2 13 ? 32.532  -46.326 -5.014  1.00 79.06  ? 92  PHE F CE2   1 
ATOM 2509 C CZ    . PHE F 2 13 ? 33.321  -46.509 -6.142  1.00 79.52  ? 92  PHE F CZ    1 
ATOM 2510 N N     . THR F 2 14 ? 36.479  -42.347 -0.850  1.00 80.30  ? 93  THR F N     1 
ATOM 2511 C CA    . THR F 2 14 ? 36.511  -41.248 0.131   1.00 79.74  ? 93  THR F CA    1 
ATOM 2512 C C     . THR F 2 14 ? 35.345  -40.307 -0.131  1.00 79.60  ? 93  THR F C     1 
ATOM 2513 O O     . THR F 2 14 ? 34.971  -40.072 -1.284  1.00 79.55  ? 93  THR F O     1 
ATOM 2514 C CB    . THR F 2 14 ? 37.833  -40.428 0.127   1.00 79.66  ? 93  THR F CB    1 
ATOM 2515 O OG1   . THR F 2 14 ? 38.033  -39.816 -1.153  1.00 79.30  ? 93  THR F OG1   1 
ATOM 2516 C CG2   . THR F 2 14 ? 39.032  -41.296 0.482   1.00 79.45  ? 93  THR F CG2   1 
ATOM 2517 N N     . SER F 2 15 ? 34.770  -39.787 0.947   1.00 79.26  ? 94  SER F N     1 
ATOM 2518 C CA    . SER F 2 15 ? 33.641  -38.871 0.863   1.00 79.05  ? 94  SER F CA    1 
ATOM 2519 C C     . SER F 2 15 ? 33.827  -37.822 -0.236  1.00 78.50  ? 94  SER F C     1 
ATOM 2520 O O     . SER F 2 15 ? 32.842  -37.400 -0.865  1.00 78.48  ? 94  SER F O     1 
ATOM 2521 C CB    . SER F 2 15 ? 33.424  -38.177 2.209   1.00 79.27  ? 94  SER F CB    1 
ATOM 2522 O OG    . SER F 2 15 ? 33.311  -39.135 3.243   1.00 80.47  ? 94  SER F OG    1 
ATOM 2523 N N     . PHE F 2 16 ? 35.085  -37.413 -0.453  1.00 77.58  ? 95  PHE F N     1 
ATOM 2524 C CA    . PHE F 2 16 ? 35.432  -36.403 -1.456  1.00 76.70  ? 95  PHE F CA    1 
ATOM 2525 C C     . PHE F 2 16 ? 35.072  -36.851 -2.868  1.00 75.87  ? 95  PHE F C     1 
ATOM 2526 O O     . PHE F 2 16 ? 34.264  -36.198 -3.544  1.00 75.76  ? 95  PHE F O     1 
ATOM 2527 C CB    . PHE F 2 16 ? 36.921  -36.034 -1.387  1.00 77.02  ? 95  PHE F CB    1 
ATOM 2528 C CG    . PHE F 2 16 ? 37.415  -35.255 -2.596  1.00 77.43  ? 95  PHE F CG    1 
ATOM 2529 C CD1   . PHE F 2 16 ? 36.947  -33.961 -2.855  1.00 77.38  ? 95  PHE F CD1   1 
ATOM 2530 C CD2   . PHE F 2 16 ? 38.341  -35.819 -3.472  1.00 77.25  ? 95  PHE F CD2   1 
ATOM 2531 C CE1   . PHE F 2 16 ? 37.393  -33.252 -3.965  1.00 77.34  ? 95  PHE F CE1   1 
ATOM 2532 C CE2   . PHE F 2 16 ? 38.800  -35.111 -4.584  1.00 77.08  ? 95  PHE F CE2   1 
ATOM 2533 C CZ    . PHE F 2 16 ? 38.326  -33.829 -4.831  1.00 77.19  ? 95  PHE F CZ    1 
ATOM 2534 N N     . GLN F 2 17 ? 35.679  -37.959 -3.302  1.00 74.74  ? 96  GLN F N     1 
ATOM 2535 C CA    . GLN F 2 17 ? 35.394  -38.535 -4.616  1.00 73.16  ? 96  GLN F CA    1 
ATOM 2536 C C     . GLN F 2 17 ? 33.933  -38.965 -4.703  1.00 72.93  ? 96  GLN F C     1 
ATOM 2537 O O     . GLN F 2 17 ? 33.262  -38.738 -5.714  1.00 72.85  ? 96  GLN F O     1 
ATOM 2538 C CB    . GLN F 2 17 ? 36.362  -39.677 -4.960  1.00 73.05  ? 96  GLN F CB    1 
ATOM 2539 C CG    . GLN F 2 17 ? 36.773  -40.558 -3.803  1.00 71.95  ? 96  GLN F CG    1 
ATOM 2540 C CD    . GLN F 2 17 ? 37.871  -41.553 -4.161  1.00 71.77  ? 96  GLN F CD    1 
ATOM 2541 O OE1   . GLN F 2 17 ? 37.865  -42.686 -3.687  1.00 70.63  ? 96  GLN F OE1   1 
ATOM 2542 N NE2   . GLN F 2 17 ? 38.816  -41.135 -4.991  1.00 69.06  ? 96  GLN F NE2   1 
ATOM 2543 N N     . LEU F 2 18 ? 33.439  -39.552 -3.622  1.00 72.33  ? 97  LEU F N     1 
ATOM 2544 C CA    . LEU F 2 18 ? 32.060  -39.973 -3.545  1.00 72.29  ? 97  LEU F CA    1 
ATOM 2545 C C     . LEU F 2 18 ? 31.115  -38.856 -4.013  1.00 72.22  ? 97  LEU F C     1 
ATOM 2546 O O     . LEU F 2 18 ? 30.395  -39.013 -5.010  1.00 72.08  ? 97  LEU F O     1 
ATOM 2547 C CB    . LEU F 2 18 ? 31.754  -40.428 -2.112  1.00 72.47  ? 97  LEU F CB    1 
ATOM 2548 C CG    . LEU F 2 18 ? 30.718  -41.512 -1.787  1.00 72.60  ? 97  LEU F CG    1 
ATOM 2549 C CD1   . LEU F 2 18 ? 30.466  -42.468 -2.949  1.00 72.74  ? 97  LEU F CD1   1 
ATOM 2550 C CD2   . LEU F 2 18 ? 31.169  -42.282 -0.542  1.00 72.74  ? 97  LEU F CD2   1 
ATOM 2551 N N     . GLU F 2 19 ? 31.157  -37.716 -3.326  1.00 72.05  ? 98  GLU F N     1 
ATOM 2552 C CA    . GLU F 2 19 ? 30.233  -36.617 -3.607  1.00 72.17  ? 98  GLU F CA    1 
ATOM 2553 C C     . GLU F 2 19 ? 30.542  -35.912 -4.932  1.00 71.88  ? 98  GLU F C     1 
ATOM 2554 O O     . GLU F 2 19 ? 29.658  -35.287 -5.537  1.00 72.04  ? 98  GLU F O     1 
ATOM 2555 C CB    . GLU F 2 19 ? 30.243  -35.599 -2.469  1.00 72.34  ? 98  GLU F CB    1 
ATOM 2556 C CG    . GLU F 2 19 ? 31.321  -34.534 -2.633  1.00 73.41  ? 98  GLU F CG    1 
ATOM 2557 C CD    . GLU F 2 19 ? 31.626  -33.815 -1.350  1.00 75.09  ? 98  GLU F CD    1 
ATOM 2558 O OE1   . GLU F 2 19 ? 32.674  -34.129 -0.727  1.00 75.81  ? 98  GLU F OE1   1 
ATOM 2559 O OE2   . GLU F 2 19 ? 30.810  -32.949 -0.961  1.00 75.66  ? 98  GLU F OE2   1 
ATOM 2560 N N     . GLU F 2 20 ? 31.796  -35.991 -5.366  1.00 71.20  ? 99  GLU F N     1 
ATOM 2561 C CA    . GLU F 2 20 ? 32.178  -35.453 -6.666  1.00 70.84  ? 99  GLU F CA    1 
ATOM 2562 C C     . GLU F 2 20 ? 31.488  -36.218 -7.795  1.00 70.01  ? 99  GLU F C     1 
ATOM 2563 O O     . GLU F 2 20 ? 30.911  -35.627 -8.710  1.00 69.74  ? 99  GLU F O     1 
ATOM 2564 C CB    . GLU F 2 20 ? 33.696  -35.492 -6.822  1.00 71.07  ? 99  GLU F CB    1 
ATOM 2565 C CG    . GLU F 2 20 ? 34.395  -34.248 -6.294  1.00 72.68  ? 99  GLU F CG    1 
ATOM 2566 C CD    . GLU F 2 20 ? 34.587  -33.176 -7.368  1.00 75.50  ? 99  GLU F CD    1 
ATOM 2567 O OE1   . GLU F 2 20 ? 33.595  -32.795 -8.038  1.00 76.51  ? 99  GLU F OE1   1 
ATOM 2568 O OE2   . GLU F 2 20 ? 35.740  -32.713 -7.544  1.00 76.77  ? 99  GLU F OE2   1 
ATOM 2569 N N     . LEU F 2 21 ? 31.540  -37.540 -7.699  1.00 69.15  ? 100 LEU F N     1 
ATOM 2570 C CA    . LEU F 2 21 ? 30.846  -38.411 -8.623  1.00 68.58  ? 100 LEU F CA    1 
ATOM 2571 C C     . LEU F 2 21 ? 29.365  -38.070 -8.652  1.00 67.94  ? 100 LEU F C     1 
ATOM 2572 O O     . LEU F 2 21 ? 28.736  -38.050 -9.719  1.00 67.57  ? 100 LEU F O     1 
ATOM 2573 C CB    . LEU F 2 21 ? 31.069  -39.870 -8.221  1.00 68.84  ? 100 LEU F CB    1 
ATOM 2574 C CG    . LEU F 2 21 ? 32.423  -40.449 -8.661  1.00 68.75  ? 100 LEU F CG    1 
ATOM 2575 C CD1   . LEU F 2 21 ? 32.968  -41.511 -7.703  1.00 68.58  ? 100 LEU F CD1   1 
ATOM 2576 C CD2   . LEU F 2 21 ? 32.288  -41.012 -10.053 1.00 69.30  ? 100 LEU F CD2   1 
ATOM 2577 N N     . GLU F 2 22 ? 28.826  -37.778 -7.471  1.00 67.24  ? 101 GLU F N     1 
ATOM 2578 C CA    . GLU F 2 22 ? 27.454  -37.305 -7.345  1.00 66.68  ? 101 GLU F CA    1 
ATOM 2579 C C     . GLU F 2 22 ? 27.247  -35.973 -8.051  1.00 66.03  ? 101 GLU F C     1 
ATOM 2580 O O     . GLU F 2 22 ? 26.211  -35.763 -8.673  1.00 65.83  ? 101 GLU F O     1 
ATOM 2581 C CB    . GLU F 2 22 ? 27.036  -37.210 -5.873  1.00 66.92  ? 101 GLU F CB    1 
ATOM 2582 C CG    . GLU F 2 22 ? 26.262  -38.430 -5.362  1.00 67.81  ? 101 GLU F CG    1 
ATOM 2583 C CD    . GLU F 2 22 ? 24.946  -38.652 -6.115  1.00 68.99  ? 101 GLU F CD    1 
ATOM 2584 O OE1   . GLU F 2 22 ? 24.681  -39.805 -6.519  1.00 68.32  ? 101 GLU F OE1   1 
ATOM 2585 O OE2   . GLU F 2 22 ? 24.183  -37.674 -6.312  1.00 69.28  ? 101 GLU F OE2   1 
ATOM 2586 N N     . LYS F 2 23 ? 28.233  -35.084 -7.967  1.00 65.40  ? 102 LYS F N     1 
ATOM 2587 C CA    . LYS F 2 23 ? 28.143  -33.793 -8.642  1.00 65.14  ? 102 LYS F CA    1 
ATOM 2588 C C     . LYS F 2 23 ? 28.166  -34.001 -10.158 1.00 64.24  ? 102 LYS F C     1 
ATOM 2589 O O     . LYS F 2 23 ? 27.390  -33.377 -10.901 1.00 64.05  ? 102 LYS F O     1 
ATOM 2590 C CB    . LYS F 2 23 ? 29.282  -32.861 -8.198  1.00 65.52  ? 102 LYS F CB    1 
ATOM 2591 C CG    . LYS F 2 23 ? 29.223  -31.416 -8.783  1.00 66.70  ? 102 LYS F CG    1 
ATOM 2592 C CD    . LYS F 2 23 ? 30.404  -30.513 -8.318  1.00 66.11  ? 102 LYS F CD    1 
ATOM 2593 C CE    . LYS F 2 23 ? 30.111  -29.795 -6.984  1.00 67.13  ? 102 LYS F CE    1 
ATOM 2594 N NZ    . LYS F 2 23 ? 29.649  -30.716 -5.890  1.00 65.50  ? 102 LYS F NZ    1 
ATOM 2595 N N     . ALA F 2 24 ? 29.052  -34.895 -10.601 1.00 63.05  ? 103 ALA F N     1 
ATOM 2596 C CA    . ALA F 2 24 ? 29.186  -35.228 -12.011 1.00 61.57  ? 103 ALA F CA    1 
ATOM 2597 C C     . ALA F 2 24 ? 27.891  -35.825 -12.555 1.00 60.69  ? 103 ALA F C     1 
ATOM 2598 O O     . ALA F 2 24 ? 27.470  -35.516 -13.672 1.00 60.51  ? 103 ALA F O     1 
ATOM 2599 C CB    . ALA F 2 24 ? 30.326  -36.180 -12.200 1.00 61.66  ? 103 ALA F CB    1 
ATOM 2600 N N     . PHE F 2 25 ? 27.249  -36.666 -11.755 1.00 59.59  ? 104 PHE F N     1 
ATOM 2601 C CA    . PHE F 2 25 ? 25.988  -37.273 -12.165 1.00 58.74  ? 104 PHE F CA    1 
ATOM 2602 C C     . PHE F 2 25 ? 24.875  -36.252 -12.323 1.00 58.34  ? 104 PHE F C     1 
ATOM 2603 O O     . PHE F 2 25 ? 24.063  -36.358 -13.242 1.00 58.11  ? 104 PHE F O     1 
ATOM 2604 C CB    . PHE F 2 25 ? 25.568  -38.350 -11.179 1.00 58.40  ? 104 PHE F CB    1 
ATOM 2605 C CG    . PHE F 2 25 ? 24.371  -39.130 -11.608 1.00 57.36  ? 104 PHE F CG    1 
ATOM 2606 C CD1   . PHE F 2 25 ? 24.404  -39.902 -12.766 1.00 57.08  ? 104 PHE F CD1   1 
ATOM 2607 C CD2   . PHE F 2 25 ? 23.215  -39.120 -10.842 1.00 55.99  ? 104 PHE F CD2   1 
ATOM 2608 C CE1   . PHE F 2 25 ? 23.298  -40.662 -13.147 1.00 56.46  ? 104 PHE F CE1   1 
ATOM 2609 C CE2   . PHE F 2 25 ? 22.107  -39.859 -11.222 1.00 55.53  ? 104 PHE F CE2   1 
ATOM 2610 C CZ    . PHE F 2 25 ? 22.151  -40.638 -12.373 1.00 56.62  ? 104 PHE F CZ    1 
ATOM 2611 N N     . SER F 2 26 ? 24.844  -35.265 -11.432 1.00 58.29  ? 105 SER F N     1 
ATOM 2612 C CA    . SER F 2 26 ? 23.837  -34.202 -11.517 1.00 58.41  ? 105 SER F CA    1 
ATOM 2613 C C     . SER F 2 26 ? 23.897  -33.426 -12.824 1.00 58.11  ? 105 SER F C     1 
ATOM 2614 O O     . SER F 2 26 ? 22.846  -33.025 -13.316 1.00 58.53  ? 105 SER F O     1 
ATOM 2615 C CB    . SER F 2 26 ? 23.849  -33.265 -10.305 1.00 58.53  ? 105 SER F CB    1 
ATOM 2616 O OG    . SER F 2 26 ? 25.034  -33.391 -9.538  1.00 59.85  ? 105 SER F OG    1 
ATOM 2617 N N     . ARG F 2 27 ? 25.098  -33.245 -13.392 1.00 57.68  ? 106 ARG F N     1 
ATOM 2618 C CA    . ARG F 2 27 ? 25.255  -32.717 -14.774 1.00 57.48  ? 106 ARG F CA    1 
ATOM 2619 C C     . ARG F 2 27 ? 24.756  -33.687 -15.849 1.00 56.66  ? 106 ARG F C     1 
ATOM 2620 O O     . ARG F 2 27 ? 23.861  -33.337 -16.612 1.00 56.64  ? 106 ARG F O     1 
ATOM 2621 C CB    . ARG F 2 27 ? 26.713  -32.301 -15.115 1.00 57.91  ? 106 ARG F CB    1 
ATOM 2622 C CG    . ARG F 2 27 ? 27.200  -30.979 -14.522 1.00 59.62  ? 106 ARG F CG    1 
ATOM 2623 C CD    . ARG F 2 27 ? 27.563  -31.176 -13.030 1.00 62.92  ? 106 ARG F CD    1 
ATOM 2624 N NE    . ARG F 2 27 ? 27.402  -29.996 -12.155 1.00 65.78  ? 106 ARG F NE    1 
ATOM 2625 C CZ    . ARG F 2 27 ? 26.245  -29.385 -11.833 1.00 65.76  ? 106 ARG F CZ    1 
ATOM 2626 N NH1   . ARG F 2 27 ? 25.060  -29.766 -12.331 1.00 63.02  ? 106 ARG F NH1   1 
ATOM 2627 N NH2   . ARG F 2 27 ? 26.287  -28.345 -11.004 1.00 67.43  ? 106 ARG F NH2   1 
ATOM 2628 N N     . THR F 2 28 ? 25.345  -34.883 -15.922 1.00 55.86  ? 107 THR F N     1 
ATOM 2629 C CA    . THR F 2 28 ? 24.944  -35.889 -16.924 1.00 55.52  ? 107 THR F CA    1 
ATOM 2630 C C     . THR F 2 28 ? 24.914  -37.301 -16.363 1.00 54.37  ? 107 THR F C     1 
ATOM 2631 O O     . THR F 2 28 ? 25.789  -37.683 -15.578 1.00 53.82  ? 107 THR F O     1 
ATOM 2632 C CB    . THR F 2 28 ? 25.896  -35.943 -18.174 1.00 55.97  ? 107 THR F CB    1 
ATOM 2633 O OG1   . THR F 2 28 ? 27.255  -36.102 -17.738 1.00 56.52  ? 107 THR F OG1   1 
ATOM 2634 C CG2   . THR F 2 28 ? 25.785  -34.699 -19.034 1.00 56.67  ? 107 THR F CG2   1 
ATOM 2635 N N     . HIS F 2 29 ? 23.927  -38.076 -16.814 1.00 53.33  ? 108 HIS F N     1 
ATOM 2636 C CA    . HIS F 2 29 ? 23.811  -39.477 -16.453 1.00 52.61  ? 108 HIS F CA    1 
ATOM 2637 C C     . HIS F 2 29 ? 24.779  -40.306 -17.272 1.00 52.23  ? 108 HIS F C     1 
ATOM 2638 O O     . HIS F 2 29 ? 25.268  -41.341 -16.815 1.00 52.42  ? 108 HIS F O     1 
ATOM 2639 C CB    . HIS F 2 29 ? 22.398  -40.007 -16.714 1.00 52.90  ? 108 HIS F CB    1 
ATOM 2640 C CG    . HIS F 2 29 ? 21.332  -39.413 -15.843 1.00 53.20  ? 108 HIS F CG    1 
ATOM 2641 N ND1   . HIS F 2 29 ? 21.590  -38.851 -14.611 1.00 52.84  ? 108 HIS F ND1   1 
ATOM 2642 C CD2   . HIS F 2 29 ? 19.995  -39.310 -16.029 1.00 53.87  ? 108 HIS F CD2   1 
ATOM 2643 C CE1   . HIS F 2 29 ? 20.461  -38.421 -14.078 1.00 53.12  ? 108 HIS F CE1   1 
ATOM 2644 N NE2   . HIS F 2 29 ? 19.478  -38.687 -14.919 1.00 54.21  ? 108 HIS F NE2   1 
ATOM 2645 N N     . TYR F 2 30 ? 25.038  -39.849 -18.494 1.00 51.53  ? 109 TYR F N     1 
ATOM 2646 C CA    . TYR F 2 30 ? 25.841  -40.580 -19.459 1.00 50.44  ? 109 TYR F CA    1 
ATOM 2647 C C     . TYR F 2 30 ? 27.131  -39.868 -19.844 1.00 50.11  ? 109 TYR F C     1 
ATOM 2648 O O     . TYR F 2 30 ? 27.315  -39.498 -21.014 1.00 50.41  ? 109 TYR F O     1 
ATOM 2649 C CB    . TYR F 2 30 ? 25.004  -40.854 -20.701 1.00 50.07  ? 109 TYR F CB    1 
ATOM 2650 C CG    . TYR F 2 30 ? 23.965  -41.903 -20.455 1.00 50.95  ? 109 TYR F CG    1 
ATOM 2651 C CD1   . TYR F 2 30 ? 24.314  -43.263 -20.437 1.00 50.69  ? 109 TYR F CD1   1 
ATOM 2652 C CD2   . TYR F 2 30 ? 22.633  -41.555 -20.208 1.00 50.64  ? 109 TYR F CD2   1 
ATOM 2653 C CE1   . TYR F 2 30 ? 23.363  -44.241 -20.198 1.00 50.35  ? 109 TYR F CE1   1 
ATOM 2654 C CE2   . TYR F 2 30 ? 21.665  -42.540 -19.963 1.00 50.86  ? 109 TYR F CE2   1 
ATOM 2655 C CZ    . TYR F 2 30 ? 22.045  -43.878 -19.958 1.00 50.88  ? 109 TYR F CZ    1 
ATOM 2656 O OH    . TYR F 2 30 ? 21.118  -44.864 -19.720 1.00 51.43  ? 109 TYR F OH    1 
ATOM 2657 N N     . PRO F 2 31 ? 28.064  -39.715 -18.894 1.00 49.54  ? 110 PRO F N     1 
ATOM 2658 C CA    . PRO F 2 31 ? 29.283  -39.063 -19.342 1.00 49.64  ? 110 PRO F CA    1 
ATOM 2659 C C     . PRO F 2 31 ? 29.927  -39.966 -20.389 1.00 50.19  ? 110 PRO F C     1 
ATOM 2660 O O     . PRO F 2 31 ? 29.736  -41.189 -20.348 1.00 50.94  ? 110 PRO F O     1 
ATOM 2661 C CB    . PRO F 2 31 ? 30.143  -38.992 -18.078 1.00 49.01  ? 110 PRO F CB    1 
ATOM 2662 C CG    . PRO F 2 31 ? 29.612  -40.024 -17.180 1.00 48.95  ? 110 PRO F CG    1 
ATOM 2663 C CD    . PRO F 2 31 ? 28.147  -40.149 -17.494 1.00 49.39  ? 110 PRO F CD    1 
ATOM 2664 N N     . ASP F 2 32 ? 30.631  -39.378 -21.346 1.00 50.28  ? 111 ASP F N     1 
ATOM 2665 C CA    . ASP F 2 32 ? 31.400  -40.154 -22.296 1.00 50.40  ? 111 ASP F CA    1 
ATOM 2666 C C     . ASP F 2 32 ? 32.750  -40.537 -21.659 1.00 50.39  ? 111 ASP F C     1 
ATOM 2667 O O     . ASP F 2 32 ? 33.066  -40.093 -20.547 1.00 50.58  ? 111 ASP F O     1 
ATOM 2668 C CB    . ASP F 2 32 ? 31.551  -39.404 -23.625 1.00 50.49  ? 111 ASP F CB    1 
ATOM 2669 C CG    . ASP F 2 32 ? 32.413  -38.126 -23.514 1.00 51.88  ? 111 ASP F CG    1 
ATOM 2670 O OD1   . ASP F 2 32 ? 32.906  -37.754 -22.412 1.00 51.90  ? 111 ASP F OD1   1 
ATOM 2671 O OD2   . ASP F 2 32 ? 32.607  -37.492 -24.571 1.00 53.10  ? 111 ASP F OD2   1 
ATOM 2672 N N     . VAL F 2 33 ? 33.532  -41.369 -22.345 1.00 50.25  ? 112 VAL F N     1 
ATOM 2673 C CA    . VAL F 2 33 ? 34.768  -41.884 -21.762 1.00 50.07  ? 112 VAL F CA    1 
ATOM 2674 C C     . VAL F 2 33 ? 35.649  -40.735 -21.360 1.00 49.92  ? 112 VAL F C     1 
ATOM 2675 O O     . VAL F 2 33 ? 36.166  -40.711 -20.241 1.00 50.23  ? 112 VAL F O     1 
ATOM 2676 C CB    . VAL F 2 33 ? 35.606  -42.765 -22.718 1.00 50.12  ? 112 VAL F CB    1 
ATOM 2677 C CG1   . VAL F 2 33 ? 36.078  -43.982 -21.971 1.00 49.65  ? 112 VAL F CG1   1 
ATOM 2678 C CG2   . VAL F 2 33 ? 34.824  -43.152 -23.953 1.00 49.97  ? 112 VAL F CG2   1 
ATOM 2679 N N     . PHE F 2 34 ? 35.807  -39.783 -22.277 1.00 49.41  ? 113 PHE F N     1 
ATOM 2680 C CA    . PHE F 2 34 ? 36.724  -38.674 -22.078 1.00 49.00  ? 113 PHE F CA    1 
ATOM 2681 C C     . PHE F 2 34 ? 36.328  -37.873 -20.853 1.00 49.53  ? 113 PHE F C     1 
ATOM 2682 O O     . PHE F 2 34 ? 37.191  -37.374 -20.127 1.00 50.06  ? 113 PHE F O     1 
ATOM 2683 C CB    . PHE F 2 34 ? 36.833  -37.808 -23.331 1.00 48.18  ? 113 PHE F CB    1 
ATOM 2684 C CG    . PHE F 2 34 ? 37.122  -38.595 -24.570 1.00 47.21  ? 113 PHE F CG    1 
ATOM 2685 C CD1   . PHE F 2 34 ? 38.302  -39.353 -24.673 1.00 45.61  ? 113 PHE F CD1   1 
ATOM 2686 C CD2   . PHE F 2 34 ? 36.211  -38.617 -25.622 1.00 46.38  ? 113 PHE F CD2   1 
ATOM 2687 C CE1   . PHE F 2 34 ? 38.571  -40.125 -25.806 1.00 44.72  ? 113 PHE F CE1   1 
ATOM 2688 C CE2   . PHE F 2 34 ? 36.476  -39.380 -26.777 1.00 47.19  ? 113 PHE F CE2   1 
ATOM 2689 C CZ    . PHE F 2 34 ? 37.656  -40.139 -26.865 1.00 46.11  ? 113 PHE F CZ    1 
ATOM 2690 N N     . THR F 2 35 ? 35.036  -37.795 -20.575 1.00 49.63  ? 114 THR F N     1 
ATOM 2691 C CA    . THR F 2 35 ? 34.629  -37.173 -19.335 1.00 50.21  ? 114 THR F CA    1 
ATOM 2692 C C     . THR F 2 35 ? 35.057  -37.995 -18.125 1.00 50.89  ? 114 THR F C     1 
ATOM 2693 O O     . THR F 2 35 ? 35.564  -37.446 -17.138 1.00 50.78  ? 114 THR F O     1 
ATOM 2694 C CB    . THR F 2 35 ? 33.143  -36.895 -19.319 1.00 50.08  ? 114 THR F CB    1 
ATOM 2695 O OG1   . THR F 2 35 ? 32.763  -36.422 -20.614 1.00 50.37  ? 114 THR F OG1   1 
ATOM 2696 C CG2   . THR F 2 35 ? 32.820  -35.833 -18.292 1.00 49.97  ? 114 THR F CG2   1 
ATOM 2697 N N     . ARG F 2 36 ? 34.893  -39.314 -18.212 1.00 52.04  ? 115 ARG F N     1 
ATOM 2698 C CA    . ARG F 2 36 ? 35.154  -40.178 -17.058 1.00 53.00  ? 115 ARG F CA    1 
ATOM 2699 C C     . ARG F 2 36 ? 36.641  -40.285 -16.763 1.00 54.05  ? 115 ARG F C     1 
ATOM 2700 O O     . ARG F 2 36 ? 37.052  -40.202 -15.591 1.00 53.90  ? 115 ARG F O     1 
ATOM 2701 C CB    . ARG F 2 36 ? 34.494  -41.542 -17.225 1.00 53.05  ? 115 ARG F CB    1 
ATOM 2702 C CG    . ARG F 2 36 ? 32.991  -41.434 -17.490 1.00 52.32  ? 115 ARG F CG    1 
ATOM 2703 C CD    . ARG F 2 36 ? 32.290  -42.756 -17.347 1.00 51.04  ? 115 ARG F CD    1 
ATOM 2704 N NE    . ARG F 2 36 ? 32.980  -43.801 -18.087 1.00 51.15  ? 115 ARG F NE    1 
ATOM 2705 C CZ    . ARG F 2 36 ? 32.746  -44.123 -19.358 1.00 51.99  ? 115 ARG F CZ    1 
ATOM 2706 N NH1   . ARG F 2 36 ? 31.825  -43.482 -20.089 1.00 49.90  ? 115 ARG F NH1   1 
ATOM 2707 N NH2   . ARG F 2 36 ? 33.458  -45.098 -19.907 1.00 53.76  ? 115 ARG F NH2   1 
ATOM 2708 N N     . GLU F 2 37 ? 37.430  -40.436 -17.832 1.00 55.52  ? 116 GLU F N     1 
ATOM 2709 C CA    . GLU F 2 37 ? 38.891  -40.298 -17.797 1.00 56.99  ? 116 GLU F CA    1 
ATOM 2710 C C     . GLU F 2 37 ? 39.251  -39.071 -16.988 1.00 57.88  ? 116 GLU F C     1 
ATOM 2711 O O     . GLU F 2 37 ? 39.875  -39.165 -15.932 1.00 57.86  ? 116 GLU F O     1 
ATOM 2712 C CB    . GLU F 2 37 ? 39.412  -40.040 -19.201 1.00 57.16  ? 116 GLU F CB    1 
ATOM 2713 C CG    . GLU F 2 37 ? 40.631  -40.835 -19.609 1.00 58.05  ? 116 GLU F CG    1 
ATOM 2714 C CD    . GLU F 2 37 ? 40.272  -41.850 -20.677 1.00 57.93  ? 116 GLU F CD    1 
ATOM 2715 O OE1   . GLU F 2 37 ? 40.733  -41.696 -21.829 1.00 57.63  ? 116 GLU F OE1   1 
ATOM 2716 O OE2   . GLU F 2 37 ? 39.484  -42.769 -20.369 1.00 58.53  ? 116 GLU F OE2   1 
ATOM 2717 N N     . GLU F 2 38 ? 38.831  -37.917 -17.505 1.00 59.00  ? 117 GLU F N     1 
ATOM 2718 C CA    . GLU F 2 38 ? 39.128  -36.634 -16.900 1.00 60.36  ? 117 GLU F CA    1 
ATOM 2719 C C     . GLU F 2 38 ? 38.717  -36.601 -15.426 1.00 60.54  ? 117 GLU F C     1 
ATOM 2720 O O     . GLU F 2 38 ? 39.459  -36.077 -14.585 1.00 60.40  ? 117 GLU F O     1 
ATOM 2721 C CB    . GLU F 2 38 ? 38.532  -35.481 -17.741 1.00 60.78  ? 117 GLU F CB    1 
ATOM 2722 C CG    . GLU F 2 38 ? 37.882  -34.317 -16.955 1.00 64.15  ? 117 GLU F CG    1 
ATOM 2723 C CD    . GLU F 2 38 ? 36.328  -34.344 -16.979 1.00 67.72  ? 117 GLU F CD    1 
ATOM 2724 O OE1   . GLU F 2 38 ? 35.685  -34.697 -15.944 1.00 67.96  ? 117 GLU F OE1   1 
ATOM 2725 O OE2   . GLU F 2 38 ? 35.754  -34.005 -18.047 1.00 68.52  ? 117 GLU F OE2   1 
ATOM 2726 N N     . LEU F 2 39 ? 37.565  -37.192 -15.108 1.00 61.04  ? 118 LEU F N     1 
ATOM 2727 C CA    . LEU F 2 39 ? 37.122  -37.270 -13.714 1.00 61.54  ? 118 LEU F CA    1 
ATOM 2728 C C     . LEU F 2 39 ? 38.075  -38.125 -12.864 1.00 62.30  ? 118 LEU F C     1 
ATOM 2729 O O     . LEU F 2 39 ? 38.535  -37.680 -11.803 1.00 62.03  ? 118 LEU F O     1 
ATOM 2730 C CB    . LEU F 2 39 ? 35.706  -37.832 -13.622 1.00 61.23  ? 118 LEU F CB    1 
ATOM 2731 C CG    . LEU F 2 39 ? 34.662  -37.169 -12.718 1.00 60.86  ? 118 LEU F CG    1 
ATOM 2732 C CD1   . LEU F 2 39 ? 33.515  -38.129 -12.471 1.00 60.50  ? 118 LEU F CD1   1 
ATOM 2733 C CD2   . LEU F 2 39 ? 35.215  -36.660 -11.396 1.00 61.04  ? 118 LEU F CD2   1 
ATOM 2734 N N     . ALA F 2 40 ? 38.367  -39.343 -13.340 1.00 63.18  ? 119 ALA F N     1 
ATOM 2735 C CA    . ALA F 2 40 ? 39.206  -40.312 -12.602 1.00 63.87  ? 119 ALA F CA    1 
ATOM 2736 C C     . ALA F 2 40 ? 40.569  -39.739 -12.303 1.00 64.30  ? 119 ALA F C     1 
ATOM 2737 O O     . ALA F 2 40 ? 41.109  -39.922 -11.214 1.00 64.19  ? 119 ALA F O     1 
ATOM 2738 C CB    . ALA F 2 40 ? 39.349  -41.603 -13.387 1.00 63.65  ? 119 ALA F CB    1 
ATOM 2739 N N     . MET F 2 41 ? 41.102  -39.034 -13.297 1.00 65.36  ? 120 MET F N     1 
ATOM 2740 C CA    . MET F 2 41 ? 42.409  -38.398 -13.232 1.00 66.43  ? 120 MET F CA    1 
ATOM 2741 C C     . MET F 2 41 ? 42.334  -37.286 -12.199 1.00 66.53  ? 120 MET F C     1 
ATOM 2742 O O     . MET F 2 41 ? 43.323  -36.963 -11.558 1.00 67.11  ? 120 MET F O     1 
ATOM 2743 C CB    . MET F 2 41 ? 42.791  -37.857 -14.619 1.00 66.77  ? 120 MET F CB    1 
ATOM 2744 C CG    . MET F 2 41 ? 44.251  -38.038 -15.051 1.00 68.75  ? 120 MET F CG    1 
ATOM 2745 S SD    . MET F 2 41 ? 45.389  -36.696 -14.554 1.00 74.05  ? 120 MET F SD    1 
ATOM 2746 C CE    . MET F 2 41 ? 44.731  -35.227 -15.384 1.00 74.09  ? 120 MET F CE    1 
ATOM 2747 N N     . LYS F 2 42 ? 41.142  -36.732 -12.016 1.00 66.70  ? 121 LYS F N     1 
ATOM 2748 C CA    . LYS F 2 42 ? 40.930  -35.656 -11.062 1.00 66.71  ? 121 LYS F CA    1 
ATOM 2749 C C     . LYS F 2 42 ? 40.771  -36.190 -9.633  1.00 66.57  ? 121 LYS F C     1 
ATOM 2750 O O     . LYS F 2 42 ? 41.286  -35.598 -8.697  1.00 66.71  ? 121 LYS F O     1 
ATOM 2751 C CB    . LYS F 2 42 ? 39.702  -34.834 -11.475 1.00 66.94  ? 121 LYS F CB    1 
ATOM 2752 C CG    . LYS F 2 42 ? 39.769  -33.346 -11.177 1.00 67.44  ? 121 LYS F CG    1 
ATOM 2753 C CD    . LYS F 2 42 ? 39.370  -33.046 -9.739  1.00 68.16  ? 121 LYS F CD    1 
ATOM 2754 C CE    . LYS F 2 42 ? 38.311  -31.954 -9.675  1.00 69.28  ? 121 LYS F CE    1 
ATOM 2755 N NZ    . LYS F 2 42 ? 36.973  -32.505 -10.027 1.00 67.93  ? 121 LYS F NZ    1 
ATOM 2756 N N     . ILE F 2 43 ? 40.062  -37.298 -9.450  1.00 66.43  ? 122 ILE F N     1 
ATOM 2757 C CA    . ILE F 2 43 ? 39.784  -37.771 -8.081  1.00 66.00  ? 122 ILE F CA    1 
ATOM 2758 C C     . ILE F 2 43 ? 40.563  -39.020 -7.662  1.00 66.07  ? 122 ILE F C     1 
ATOM 2759 O O     . ILE F 2 43 ? 40.200  -39.692 -6.693  1.00 65.89  ? 122 ILE F O     1 
ATOM 2760 C CB    . ILE F 2 43 ? 38.268  -37.921 -7.806  1.00 65.95  ? 122 ILE F CB    1 
ATOM 2761 C CG1   . ILE F 2 43 ? 37.616  -38.898 -8.785  1.00 65.48  ? 122 ILE F CG1   1 
ATOM 2762 C CG2   . ILE F 2 43 ? 37.610  -36.568 -7.885  1.00 66.19  ? 122 ILE F CG2   1 
ATOM 2763 C CD1   . ILE F 2 43 ? 36.134  -39.070 -8.583  1.00 65.21  ? 122 ILE F CD1   1 
ATOM 2764 N N     . GLY F 2 44 ? 41.648  -39.301 -8.385  1.00 66.05  ? 123 GLY F N     1 
ATOM 2765 C CA    . GLY F 2 44 ? 42.481  -40.483 -8.145  1.00 65.82  ? 123 GLY F CA    1 
ATOM 2766 C C     . GLY F 2 44 ? 41.702  -41.790 -8.169  1.00 65.60  ? 123 GLY F C     1 
ATOM 2767 O O     . GLY F 2 44 ? 41.467  -42.394 -7.110  1.00 65.82  ? 123 GLY F O     1 
ATOM 2768 N N     . LEU F 2 45 ? 41.278  -42.211 -9.364  1.00 64.76  ? 124 LEU F N     1 
ATOM 2769 C CA    . LEU F 2 45 ? 40.626  -43.513 -9.552  1.00 64.24  ? 124 LEU F CA    1 
ATOM 2770 C C     . LEU F 2 45 ? 40.886  -44.064 -10.940 1.00 63.86  ? 124 LEU F C     1 
ATOM 2771 O O     . LEU F 2 45 ? 41.428  -43.365 -11.794 1.00 64.14  ? 124 LEU F O     1 
ATOM 2772 C CB    . LEU F 2 45 ? 39.115  -43.411 -9.344  1.00 64.18  ? 124 LEU F CB    1 
ATOM 2773 C CG    . LEU F 2 45 ? 38.561  -43.288 -7.930  1.00 64.10  ? 124 LEU F CG    1 
ATOM 2774 C CD1   . LEU F 2 45 ? 37.056  -43.066 -8.015  1.00 64.79  ? 124 LEU F CD1   1 
ATOM 2775 C CD2   . LEU F 2 45 ? 38.896  -44.500 -7.069  1.00 63.01  ? 124 LEU F CD2   1 
ATOM 2776 N N     . THR F 2 46 ? 40.494  -45.315 -11.169 1.00 63.21  ? 125 THR F N     1 
ATOM 2777 C CA    . THR F 2 46 ? 40.527  -45.868 -12.521 1.00 62.53  ? 125 THR F CA    1 
ATOM 2778 C C     . THR F 2 46 ? 39.249  -45.486 -13.246 1.00 62.03  ? 125 THR F C     1 
ATOM 2779 O O     . THR F 2 46 ? 38.159  -45.438 -12.652 1.00 62.18  ? 125 THR F O     1 
ATOM 2780 C CB    . THR F 2 46 ? 40.705  -47.426 -12.568 1.00 62.72  ? 125 THR F CB    1 
ATOM 2781 O OG1   . THR F 2 46 ? 39.612  -48.084 -11.906 1.00 63.02  ? 125 THR F OG1   1 
ATOM 2782 C CG2   . THR F 2 46 ? 42.036  -47.857 -11.953 1.00 62.00  ? 125 THR F CG2   1 
ATOM 2783 N N     . GLU F 2 47 ? 39.374  -45.211 -14.534 1.00 61.03  ? 126 GLU F N     1 
ATOM 2784 C CA    . GLU F 2 47 ? 38.192  -44.945 -15.319 1.00 60.29  ? 126 GLU F CA    1 
ATOM 2785 C C     . GLU F 2 47 ? 37.219  -46.115 -15.130 1.00 59.39  ? 126 GLU F C     1 
ATOM 2786 O O     . GLU F 2 47 ? 36.015  -45.912 -14.928 1.00 59.40  ? 126 GLU F O     1 
ATOM 2787 C CB    . GLU F 2 47 ? 38.562  -44.740 -16.788 1.00 60.51  ? 126 GLU F CB    1 
ATOM 2788 C CG    . GLU F 2 47 ? 37.425  -44.230 -17.650 1.00 61.97  ? 126 GLU F CG    1 
ATOM 2789 C CD    . GLU F 2 47 ? 36.511  -45.343 -18.118 1.00 64.13  ? 126 GLU F CD    1 
ATOM 2790 O OE1   . GLU F 2 47 ? 35.301  -45.299 -17.786 1.00 64.94  ? 126 GLU F OE1   1 
ATOM 2791 O OE2   . GLU F 2 47 ? 37.014  -46.263 -18.807 1.00 64.35  ? 126 GLU F OE2   1 
ATOM 2792 N N     . ALA F 2 48 ? 37.752  -47.336 -15.150 1.00 58.04  ? 127 ALA F N     1 
ATOM 2793 C CA    . ALA F 2 48 ? 36.910  -48.516 -15.013 1.00 56.76  ? 127 ALA F CA    1 
ATOM 2794 C C     . ALA F 2 48 ? 36.045  -48.453 -13.739 1.00 55.75  ? 127 ALA F C     1 
ATOM 2795 O O     . ALA F 2 48 ? 34.834  -48.653 -13.819 1.00 55.61  ? 127 ALA F O     1 
ATOM 2796 C CB    . ALA F 2 48 ? 37.741  -49.799 -15.093 1.00 56.64  ? 127 ALA F CB    1 
ATOM 2797 N N     . ARG F 2 49 ? 36.657  -48.133 -12.595 1.00 54.46  ? 128 ARG F N     1 
ATOM 2798 C CA    . ARG F 2 49 ? 35.925  -47.907 -11.341 1.00 53.56  ? 128 ARG F CA    1 
ATOM 2799 C C     . ARG F 2 49 ? 34.763  -46.906 -11.483 1.00 53.14  ? 128 ARG F C     1 
ATOM 2800 O O     . ARG F 2 49 ? 33.640  -47.166 -11.026 1.00 52.60  ? 128 ARG F O     1 
ATOM 2801 C CB    . ARG F 2 49 ? 36.894  -47.478 -10.238 1.00 53.67  ? 128 ARG F CB    1 
ATOM 2802 C CG    . ARG F 2 49 ? 37.307  -48.560 -9.209  1.00 53.26  ? 128 ARG F CG    1 
ATOM 2803 C CD    . ARG F 2 49 ? 37.879  -49.817 -9.818  1.00 52.84  ? 128 ARG F CD    1 
ATOM 2804 N NE    . ARG F 2 49 ? 36.823  -50.640 -10.394 1.00 53.80  ? 128 ARG F NE    1 
ATOM 2805 C CZ    . ARG F 2 49 ? 36.955  -51.373 -11.495 1.00 53.65  ? 128 ARG F CZ    1 
ATOM 2806 N NH1   . ARG F 2 49 ? 38.112  -51.390 -12.140 1.00 54.45  ? 128 ARG F NH1   1 
ATOM 2807 N NH2   . ARG F 2 49 ? 35.932  -52.090 -11.952 1.00 52.95  ? 128 ARG F NH2   1 
ATOM 2808 N N     . ILE F 2 50 ? 35.023  -45.789 -12.159 1.00 52.71  ? 129 ILE F N     1 
ATOM 2809 C CA    . ILE F 2 50 ? 33.966  -44.823 -12.459 1.00 52.64  ? 129 ILE F CA    1 
ATOM 2810 C C     . ILE F 2 50 ? 32.905  -45.342 -13.443 1.00 52.53  ? 129 ILE F C     1 
ATOM 2811 O O     . ILE F 2 50 ? 31.695  -45.110 -13.257 1.00 52.83  ? 129 ILE F O     1 
ATOM 2812 C CB    . ILE F 2 50 ? 34.530  -43.476 -12.942 1.00 52.71  ? 129 ILE F CB    1 
ATOM 2813 C CG1   . ILE F 2 50 ? 35.143  -42.734 -11.757 1.00 53.87  ? 129 ILE F CG1   1 
ATOM 2814 C CG2   . ILE F 2 50 ? 33.437  -42.617 -13.566 1.00 51.84  ? 129 ILE F CG2   1 
ATOM 2815 C CD1   . ILE F 2 50 ? 36.144  -41.658 -12.145 1.00 55.85  ? 129 ILE F CD1   1 
ATOM 2816 N N     . GLN F 2 51 ? 33.333  -46.039 -14.485 1.00 51.77  ? 130 GLN F N     1 
ATOM 2817 C CA    . GLN F 2 51 ? 32.356  -46.572 -15.411 1.00 51.54  ? 130 GLN F CA    1 
ATOM 2818 C C     . GLN F 2 51 ? 31.357  -47.475 -14.673 1.00 51.05  ? 130 GLN F C     1 
ATOM 2819 O O     . GLN F 2 51 ? 30.155  -47.467 -14.954 1.00 50.77  ? 130 GLN F O     1 
ATOM 2820 C CB    . GLN F 2 51 ? 33.058  -47.315 -16.520 1.00 51.80  ? 130 GLN F CB    1 
ATOM 2821 C CG    . GLN F 2 51 ? 32.189  -47.648 -17.693 1.00 53.71  ? 130 GLN F CG    1 
ATOM 2822 C CD    . GLN F 2 51 ? 32.723  -48.856 -18.462 1.00 57.59  ? 130 GLN F CD    1 
ATOM 2823 O OE1   . GLN F 2 51 ? 33.772  -49.430 -18.108 1.00 56.95  ? 130 GLN F OE1   1 
ATOM 2824 N NE2   . GLN F 2 51 ? 32.008  -49.242 -19.528 1.00 58.37  ? 130 GLN F NE2   1 
ATOM 2825 N N     . VAL F 2 52 ? 31.864  -48.224 -13.700 1.00 50.63  ? 131 VAL F N     1 
ATOM 2826 C CA    . VAL F 2 52 ? 31.049  -49.132 -12.921 1.00 49.92  ? 131 VAL F CA    1 
ATOM 2827 C C     . VAL F 2 52 ? 30.151  -48.306 -12.017 1.00 50.33  ? 131 VAL F C     1 
ATOM 2828 O O     . VAL F 2 52 ? 28.941  -48.537 -11.947 1.00 49.89  ? 131 VAL F O     1 
ATOM 2829 C CB    . VAL F 2 52 ? 31.938  -50.129 -12.137 1.00 49.77  ? 131 VAL F CB    1 
ATOM 2830 C CG1   . VAL F 2 52 ? 31.168  -50.833 -11.037 1.00 48.46  ? 131 VAL F CG1   1 
ATOM 2831 C CG2   . VAL F 2 52 ? 32.523  -51.143 -13.090 1.00 49.45  ? 131 VAL F CG2   1 
ATOM 2832 N N     . TRP F 2 53 ? 30.745  -47.327 -11.336 1.00 50.89  ? 132 TRP F N     1 
ATOM 2833 C CA    . TRP F 2 53 ? 29.964  -46.409 -10.514 1.00 51.11  ? 132 TRP F CA    1 
ATOM 2834 C C     . TRP F 2 53 ? 28.751  -45.848 -11.269 1.00 50.58  ? 132 TRP F C     1 
ATOM 2835 O O     . TRP F 2 53 ? 27.628  -45.897 -10.774 1.00 50.86  ? 132 TRP F O     1 
ATOM 2836 C CB    . TRP F 2 53 ? 30.827  -45.265 -9.988  1.00 52.06  ? 132 TRP F CB    1 
ATOM 2837 C CG    . TRP F 2 53 ? 30.128  -44.524 -8.897  1.00 53.06  ? 132 TRP F CG    1 
ATOM 2838 C CD1   . TRP F 2 53 ? 30.163  -44.806 -7.558  1.00 53.88  ? 132 TRP F CD1   1 
ATOM 2839 C CD2   . TRP F 2 53 ? 29.252  -43.408 -9.047  1.00 53.93  ? 132 TRP F CD2   1 
ATOM 2840 N NE1   . TRP F 2 53 ? 29.371  -43.924 -6.864  1.00 54.37  ? 132 TRP F NE1   1 
ATOM 2841 C CE2   . TRP F 2 53 ? 28.793  -43.059 -7.754  1.00 54.60  ? 132 TRP F CE2   1 
ATOM 2842 C CE3   . TRP F 2 53 ? 28.809  -42.665 -10.146 1.00 54.08  ? 132 TRP F CE3   1 
ATOM 2843 C CZ2   . TRP F 2 53 ? 27.919  -41.995 -7.531  1.00 54.04  ? 132 TRP F CZ2   1 
ATOM 2844 C CZ3   . TRP F 2 53 ? 27.935  -41.609 -9.925  1.00 54.17  ? 132 TRP F CZ3   1 
ATOM 2845 C CH2   . TRP F 2 53 ? 27.504  -41.281 -8.624  1.00 54.04  ? 132 TRP F CH2   1 
ATOM 2846 N N     . PHE F 2 54 ? 28.959  -45.333 -12.474 1.00 49.77  ? 133 PHE F N     1 
ATOM 2847 C CA    . PHE F 2 54 ? 27.817  -44.831 -13.239 1.00 49.47  ? 133 PHE F CA    1 
ATOM 2848 C C     . PHE F 2 54 ? 26.781  -45.901 -13.634 1.00 49.01  ? 133 PHE F C     1 
ATOM 2849 O O     . PHE F 2 54 ? 25.588  -45.608 -13.718 1.00 48.62  ? 133 PHE F O     1 
ATOM 2850 C CB    . PHE F 2 54 ? 28.268  -43.999 -14.446 1.00 49.54  ? 133 PHE F CB    1 
ATOM 2851 C CG    . PHE F 2 54 ? 28.610  -42.587 -14.099 1.00 49.93  ? 133 PHE F CG    1 
ATOM 2852 C CD1   . PHE F 2 54 ? 29.856  -42.274 -13.539 1.00 50.13  ? 133 PHE F CD1   1 
ATOM 2853 C CD2   . PHE F 2 54 ? 27.680  -41.562 -14.308 1.00 50.13  ? 133 PHE F CD2   1 
ATOM 2854 C CE1   . PHE F 2 54 ? 30.175  -40.954 -13.201 1.00 51.28  ? 133 PHE F CE1   1 
ATOM 2855 C CE2   . PHE F 2 54 ? 27.979  -40.227 -13.967 1.00 50.18  ? 133 PHE F CE2   1 
ATOM 2856 C CZ    . PHE F 2 54 ? 29.233  -39.918 -13.421 1.00 50.53  ? 133 PHE F CZ    1 
ATOM 2857 N N     . GLN F 2 55 ? 27.240  -47.129 -13.870 1.00 48.83  ? 134 GLN F N     1 
ATOM 2858 C CA    . GLN F 2 55 ? 26.344  -48.242 -14.173 1.00 48.26  ? 134 GLN F CA    1 
ATOM 2859 C C     . GLN F 2 55 ? 25.398  -48.494 -13.013 1.00 48.01  ? 134 GLN F C     1 
ATOM 2860 O O     . GLN F 2 55 ? 24.189  -48.593 -13.209 1.00 47.50  ? 134 GLN F O     1 
ATOM 2861 C CB    . GLN F 2 55 ? 27.135  -49.483 -14.545 1.00 47.98  ? 134 GLN F CB    1 
ATOM 2862 C CG    . GLN F 2 55 ? 27.396  -49.562 -16.044 1.00 48.87  ? 134 GLN F CG    1 
ATOM 2863 C CD    . GLN F 2 55 ? 28.698  -50.276 -16.435 1.00 50.34  ? 134 GLN F CD    1 
ATOM 2864 O OE1   . GLN F 2 55 ? 29.241  -50.030 -17.522 1.00 52.38  ? 134 GLN F OE1   1 
ATOM 2865 N NE2   . GLN F 2 55 ? 29.200  -51.153 -15.562 1.00 48.28  ? 134 GLN F NE2   1 
ATOM 2866 N N     . ASN F 2 56 ? 25.948  -48.525 -11.804 1.00 48.13  ? 135 ASN F N     1 
ATOM 2867 C CA    . ASN F 2 56 ? 25.156  -48.757 -10.599 1.00 48.66  ? 135 ASN F CA    1 
ATOM 2868 C C     . ASN F 2 56 ? 24.270  -47.586 -10.237 1.00 49.40  ? 135 ASN F C     1 
ATOM 2869 O O     . ASN F 2 56 ? 23.098  -47.785 -9.873  1.00 49.39  ? 135 ASN F O     1 
ATOM 2870 C CB    . ASN F 2 56 ? 26.054  -49.082 -9.416  1.00 48.42  ? 135 ASN F CB    1 
ATOM 2871 C CG    . ASN F 2 56 ? 26.768  -50.399 -9.584  1.00 48.65  ? 135 ASN F CG    1 
ATOM 2872 O OD1   . ASN F 2 56 ? 26.158  -51.407 -9.968  1.00 47.68  ? 135 ASN F OD1   1 
ATOM 2873 N ND2   . ASN F 2 56 ? 28.076  -50.404 -9.309  1.00 47.87  ? 135 ASN F ND2   1 
ATOM 2874 N N     . ARG F 2 57 ? 24.829  -46.371 -10.337 1.00 49.81  ? 136 ARG F N     1 
ATOM 2875 C CA    . ARG F 2 57 ? 24.096  -45.151 -10.012 1.00 49.69  ? 136 ARG F CA    1 
ATOM 2876 C C     . ARG F 2 57 ? 22.941  -44.904 -10.986 1.00 49.78  ? 136 ARG F C     1 
ATOM 2877 O O     . ARG F 2 57 ? 21.870  -44.474 -10.567 1.00 50.23  ? 136 ARG F O     1 
ATOM 2878 C CB    . ARG F 2 57 ? 25.041  -43.947 -9.928  1.00 50.02  ? 136 ARG F CB    1 
ATOM 2879 C CG    . ARG F 2 57 ? 24.383  -42.618 -9.494  1.00 50.14  ? 136 ARG F CG    1 
ATOM 2880 C CD    . ARG F 2 57 ? 23.829  -42.684 -8.059  1.00 50.98  ? 136 ARG F CD    1 
ATOM 2881 N NE    . ARG F 2 57 ? 23.039  -41.498 -7.719  1.00 51.71  ? 136 ARG F NE    1 
ATOM 2882 C CZ    . ARG F 2 57 ? 21.754  -41.323 -8.020  1.00 50.68  ? 136 ARG F CZ    1 
ATOM 2883 N NH1   . ARG F 2 57 ? 21.072  -42.260 -8.670  1.00 51.39  ? 136 ARG F NH1   1 
ATOM 2884 N NH2   . ARG F 2 57 ? 21.149  -40.204 -7.668  1.00 50.08  ? 136 ARG F NH2   1 
ATOM 2885 N N     . ARG F 2 58 ? 23.147  -45.188 -12.271 1.00 49.92  ? 137 ARG F N     1 
ATOM 2886 C CA    . ARG F 2 58 ? 22.064  -45.127 -13.252 1.00 50.36  ? 137 ARG F CA    1 
ATOM 2887 C C     . ARG F 2 58 ? 21.036  -46.181 -12.928 1.00 50.89  ? 137 ARG F C     1 
ATOM 2888 O O     . ARG F 2 58 ? 19.853  -45.987 -13.184 1.00 51.15  ? 137 ARG F O     1 
ATOM 2889 C CB    . ARG F 2 58 ? 22.564  -45.391 -14.674 1.00 50.31  ? 137 ARG F CB    1 
ATOM 2890 C CG    . ARG F 2 58 ? 23.145  -44.197 -15.387 1.00 50.62  ? 137 ARG F CG    1 
ATOM 2891 C CD    . ARG F 2 58 ? 23.318  -44.457 -16.885 1.00 50.51  ? 137 ARG F CD    1 
ATOM 2892 N NE    . ARG F 2 58 ? 24.324  -45.483 -17.173 1.00 50.96  ? 137 ARG F NE    1 
ATOM 2893 C CZ    . ARG F 2 58 ? 25.633  -45.250 -17.272 1.00 50.15  ? 137 ARG F CZ    1 
ATOM 2894 N NH1   . ARG F 2 58 ? 26.110  -44.018 -17.103 1.00 48.92  ? 137 ARG F NH1   1 
ATOM 2895 N NH2   . ARG F 2 58 ? 26.467  -46.251 -17.523 1.00 48.46  ? 137 ARG F NH2   1 
ATOM 2896 N N     . ALA F 2 59 ? 21.489  -47.319 -12.398 1.00 51.28  ? 138 ALA F N     1 
ATOM 2897 C CA    . ALA F 2 59 ? 20.569  -48.406 -12.082 1.00 51.53  ? 138 ALA F CA    1 
ATOM 2898 C C     . ALA F 2 59 ? 19.692  -48.011 -10.904 1.00 51.71  ? 138 ALA F C     1 
ATOM 2899 O O     . ALA F 2 59 ? 18.494  -48.282 -10.903 1.00 51.53  ? 138 ALA F O     1 
ATOM 2900 C CB    . ALA F 2 59 ? 21.321  -49.709 -11.808 1.00 51.36  ? 138 ALA F CB    1 
ATOM 2901 N N     . LYS F 2 60 ? 20.302  -47.359 -9.916  1.00 52.16  ? 139 LYS F N     1 
ATOM 2902 C CA    . LYS F 2 60 ? 19.586  -46.895 -8.731  1.00 52.92  ? 139 LYS F CA    1 
ATOM 2903 C C     . LYS F 2 60 ? 18.610  -45.780 -9.070  1.00 53.40  ? 139 LYS F C     1 
ATOM 2904 O O     . LYS F 2 60 ? 17.477  -45.785 -8.589  1.00 53.66  ? 139 LYS F O     1 
ATOM 2905 C CB    . LYS F 2 60 ? 20.554  -46.427 -7.654  1.00 52.88  ? 139 LYS F CB    1 
ATOM 2906 C CG    . LYS F 2 60 ? 19.915  -46.133 -6.320  1.00 52.48  ? 139 LYS F CG    1 
ATOM 2907 C CD    . LYS F 2 60 ? 21.006  -45.749 -5.357  1.00 54.12  ? 139 LYS F CD    1 
ATOM 2908 C CE    . LYS F 2 60 ? 20.453  -45.200 -4.065  1.00 56.42  ? 139 LYS F CE    1 
ATOM 2909 N NZ    . LYS F 2 60 ? 21.518  -44.454 -3.317  1.00 58.11  ? 139 LYS F NZ    1 
ATOM 2910 N N     . TRP F 2 61 ? 19.053  -44.832 -9.893  1.00 53.55  ? 140 TRP F N     1 
ATOM 2911 C CA    . TRP F 2 61 ? 18.188  -43.767 -10.365 1.00 54.10  ? 140 TRP F CA    1 
ATOM 2912 C C     . TRP F 2 61 ? 16.992  -44.376 -11.084 1.00 54.84  ? 140 TRP F C     1 
ATOM 2913 O O     . TRP F 2 61 ? 15.872  -43.884 -10.973 1.00 55.07  ? 140 TRP F O     1 
ATOM 2914 C CB    . TRP F 2 61 ? 18.956  -42.849 -11.315 1.00 53.41  ? 140 TRP F CB    1 
ATOM 2915 C CG    . TRP F 2 61 ? 18.144  -41.747 -11.932 1.00 52.84  ? 140 TRP F CG    1 
ATOM 2916 C CD1   . TRP F 2 61 ? 18.122  -40.445 -11.543 1.00 52.29  ? 140 TRP F CD1   1 
ATOM 2917 C CD2   . TRP F 2 61 ? 17.266  -41.839 -13.074 1.00 52.14  ? 140 TRP F CD2   1 
ATOM 2918 N NE1   . TRP F 2 61 ? 17.284  -39.713 -12.362 1.00 52.41  ? 140 TRP F NE1   1 
ATOM 2919 C CE2   . TRP F 2 61 ? 16.741  -40.547 -13.303 1.00 52.39  ? 140 TRP F CE2   1 
ATOM 2920 C CE3   . TRP F 2 61 ? 16.875  -42.881 -13.922 1.00 51.67  ? 140 TRP F CE3   1 
ATOM 2921 C CZ2   . TRP F 2 61 ? 15.832  -40.274 -14.339 1.00 52.35  ? 140 TRP F CZ2   1 
ATOM 2922 C CZ3   . TRP F 2 61 ? 15.967  -42.608 -14.961 1.00 52.11  ? 140 TRP F CZ3   1 
ATOM 2923 C CH2   . TRP F 2 61 ? 15.459  -41.318 -15.156 1.00 52.14  ? 140 TRP F CH2   1 
ATOM 2924 N N     . ARG F 2 62 ? 17.245  -45.456 -11.817 1.00 55.85  ? 141 ARG F N     1 
ATOM 2925 C CA    . ARG F 2 62 ? 16.237  -46.097 -12.667 1.00 56.63  ? 141 ARG F CA    1 
ATOM 2926 C C     . ARG F 2 62 ? 15.102  -46.680 -11.842 1.00 56.99  ? 141 ARG F C     1 
ATOM 2927 O O     . ARG F 2 62 ? 13.954  -46.664 -12.264 1.00 56.79  ? 141 ARG F O     1 
ATOM 2928 C CB    . ARG F 2 62 ? 16.896  -47.191 -13.510 1.00 56.75  ? 141 ARG F CB    1 
ATOM 2929 C CG    . ARG F 2 62 ? 16.117  -47.639 -14.725 1.00 57.45  ? 141 ARG F CG    1 
ATOM 2930 C CD    . ARG F 2 62 ? 16.939  -48.632 -15.535 1.00 58.78  ? 141 ARG F CD    1 
ATOM 2931 N NE    . ARG F 2 62 ? 18.067  -47.980 -16.207 1.00 59.63  ? 141 ARG F NE    1 
ATOM 2932 C CZ    . ARG F 2 62 ? 19.354  -48.181 -15.931 1.00 58.25  ? 141 ARG F CZ    1 
ATOM 2933 N NH1   . ARG F 2 62 ? 19.726  -49.044 -15.004 1.00 58.58  ? 141 ARG F NH1   1 
ATOM 2934 N NH2   . ARG F 2 62 ? 20.276  -47.521 -16.608 1.00 57.57  ? 141 ARG F NH2   1 
ATOM 2935 N N     . LYS F 2 63 ? 15.435  -47.187 -10.657 1.00 58.02  ? 142 LYS F N     1 
ATOM 2936 C CA    . LYS F 2 63 ? 14.450  -47.843 -9.790  1.00 58.92  ? 142 LYS F CA    1 
ATOM 2937 C C     . LYS F 2 63 ? 13.801  -46.935 -8.731  1.00 59.32  ? 142 LYS F C     1 
ATOM 2938 O O     . LYS F 2 63 ? 12.869  -47.354 -8.049  1.00 59.40  ? 142 LYS F O     1 
ATOM 2939 C CB    . LYS F 2 63 ? 15.028  -49.129 -9.145  1.00 59.15  ? 142 LYS F CB    1 
ATOM 2940 C CG    . LYS F 2 63 ? 16.400  -49.005 -8.499  1.00 59.04  ? 142 LYS F CG    1 
ATOM 2941 C CD    . LYS F 2 63 ? 16.551  -49.897 -7.252  1.00 59.89  ? 142 LYS F CD    1 
ATOM 2942 C CE    . LYS F 2 63 ? 18.037  -49.990 -6.810  1.00 60.68  ? 142 LYS F CE    1 
ATOM 2943 N NZ    . LYS F 2 63 ? 18.320  -49.860 -5.328  1.00 59.51  ? 142 LYS F NZ    1 
ATOM 2944 N N     . GLN F 2 64 ? 14.271  -45.695 -8.602  1.00 59.60  ? 143 GLN F N     1 
ATOM 2945 C CA    . GLN F 2 64 ? 13.752  -44.824 -7.553  1.00 60.08  ? 143 GLN F CA    1 
ATOM 2946 C C     . GLN F 2 64 ? 13.462  -43.377 -7.979  1.00 59.98  ? 143 GLN F C     1 
ATOM 2947 O O     . GLN F 2 64 ? 12.664  -42.685 -7.356  1.00 60.39  ? 143 GLN F O     1 
ATOM 2948 C CB    . GLN F 2 64 ? 14.640  -44.879 -6.295  1.00 59.68  ? 143 GLN F CB    1 
ATOM 2949 C CG    . GLN F 2 64 ? 15.936  -44.092 -6.393  1.00 60.68  ? 143 GLN F CG    1 
ATOM 2950 C CD    . GLN F 2 64 ? 16.692  -43.993 -5.073  1.00 61.11  ? 143 GLN F CD    1 
ATOM 2951 O OE1   . GLN F 2 64 ? 16.298  -44.591 -4.062  1.00 61.33  ? 143 GLN F OE1   1 
ATOM 2952 N NE2   . GLN F 2 64 ? 17.801  -43.231 -5.082  1.00 62.71  ? 143 GLN F NE2   1 
ATOM 2953 N N     . GLU F 2 65 ? 14.095  -42.901 -9.030  1.00 59.90  ? 144 GLU F N     1 
ATOM 2954 C CA    . GLU F 2 65 ? 13.880  -41.512 -9.379  1.00 59.73  ? 144 GLU F CA    1 
ATOM 2955 C C     . GLU F 2 65 ? 12.949  -41.396 -10.565 1.00 59.79  ? 144 GLU F C     1 
ATOM 2956 O O     . GLU F 2 65 ? 12.442  -40.323 -10.865 1.00 59.60  ? 144 GLU F O     1 
ATOM 2957 C CB    . GLU F 2 65 ? 15.208  -40.824 -9.639  1.00 59.70  ? 144 GLU F CB    1 
ATOM 2958 C CG    . GLU F 2 65 ? 16.208  -41.016 -8.518  1.00 59.61  ? 144 GLU F CG    1 
ATOM 2959 C CD    . GLU F 2 65 ? 17.173  -39.867 -8.422  1.00 59.97  ? 144 GLU F CD    1 
ATOM 2960 O OE1   . GLU F 2 65 ? 16.784  -38.747 -8.844  1.00 59.36  ? 144 GLU F OE1   1 
ATOM 2961 O OE2   . GLU F 2 65 ? 18.309  -40.088 -7.928  1.00 60.11  ? 144 GLU F OE2   1 
ATOM 2962 N N     . LYS F 2 66 ? 12.712  -42.521 -11.219 1.00 60.15  ? 145 LYS F N     1 
ATOM 2963 C CA    . LYS F 2 66 ? 11.881  -42.561 -12.401 1.00 61.05  ? 145 LYS F CA    1 
ATOM 2964 C C     . LYS F 2 66 ? 10.422  -42.778 -12.003 1.00 61.48  ? 145 LYS F C     1 
ATOM 2965 O O     . LYS F 2 66 ? 10.112  -43.701 -11.273 1.00 61.71  ? 145 LYS F O     1 
ATOM 2966 C CB    . LYS F 2 66 ? 12.410  -43.649 -13.349 1.00 60.97  ? 145 LYS F CB    1 
ATOM 2967 C CG    . LYS F 2 66 ? 11.446  -44.083 -14.407 1.00 61.24  ? 145 LYS F CG    1 
ATOM 2968 C CD    . LYS F 2 66 ? 12.150  -44.572 -15.643 1.00 61.16  ? 145 LYS F CD    1 
ATOM 2969 C CE    . LYS F 2 66 ? 11.109  -44.961 -16.669 1.00 61.46  ? 145 LYS F CE    1 
ATOM 2970 N NZ    . LYS F 2 66 ? 11.600  -44.734 -18.043 1.00 62.60  ? 145 LYS F NZ    1 
ATOM 2971 N N     . VAL F 2 67 ? 9.529   -41.909 -12.463 1.00 62.32  ? 146 VAL F N     1 
ATOM 2972 C CA    . VAL F 2 67 ? 8.096   -42.025 -12.131 1.00 62.79  ? 146 VAL F CA    1 
ATOM 2973 C C     . VAL F 2 67 ? 7.542   -43.412 -12.463 1.00 63.05  ? 146 VAL F C     1 
ATOM 2974 O O     . VAL F 2 67 ? 7.760   -43.920 -13.565 1.00 63.65  ? 146 VAL F O     1 
ATOM 2975 C CB    . VAL F 2 67 ? 7.245   -40.915 -12.834 1.00 62.75  ? 146 VAL F CB    1 
ATOM 2976 C CG1   . VAL F 2 67 ? 5.769   -41.312 -12.942 1.00 62.14  ? 146 VAL F CG1   1 
ATOM 2977 C CG2   . VAL F 2 67 ? 7.397   -39.593 -12.091 1.00 63.05  ? 146 VAL F CG2   1 
ATOM 2978 O "O5'" . DG  G 3 1  ? 23.781  -64.021 11.546  1.00 72.55  ? 1   DG  G "O5'" 1 
ATOM 2979 C "C5'" . DG  G 3 1  ? 22.355  -63.923 11.701  1.00 72.34  ? 1   DG  G "C5'" 1 
ATOM 2980 C "C4'" . DG  G 3 1  ? 21.785  -62.614 11.157  1.00 72.22  ? 1   DG  G "C4'" 1 
ATOM 2981 O "O4'" . DG  G 3 1  ? 22.774  -61.544 11.236  1.00 71.01  ? 1   DG  G "O4'" 1 
ATOM 2982 C "C3'" . DG  G 3 1  ? 21.356  -62.613 9.689   1.00 73.20  ? 1   DG  G "C3'" 1 
ATOM 2983 O "O3'" . DG  G 3 1  ? 20.363  -61.574 9.507   1.00 76.29  ? 1   DG  G "O3'" 1 
ATOM 2984 C "C2'" . DG  G 3 1  ? 22.675  -62.252 8.993   1.00 71.46  ? 1   DG  G "C2'" 1 
ATOM 2985 C "C1'" . DG  G 3 1  ? 23.123  -61.117 9.921   1.00 66.09  ? 1   DG  G "C1'" 1 
ATOM 2986 N N9    . DG  G 3 1  ? 24.541  -60.746 9.930   1.00 64.59  ? 1   DG  G N9    1 
ATOM 2987 C C8    . DG  G 3 1  ? 25.670  -61.533 9.803   1.00 63.92  ? 1   DG  G C8    1 
ATOM 2988 N N7    . DG  G 3 1  ? 26.785  -60.843 9.876   1.00 63.70  ? 1   DG  G N7    1 
ATOM 2989 C C5    . DG  G 3 1  ? 26.369  -59.523 10.066  1.00 62.98  ? 1   DG  G C5    1 
ATOM 2990 C C6    . DG  G 3 1  ? 27.110  -58.320 10.224  1.00 63.34  ? 1   DG  G C6    1 
ATOM 2991 O O6    . DG  G 3 1  ? 28.345  -58.172 10.225  1.00 63.74  ? 1   DG  G O6    1 
ATOM 2992 N N1    . DG  G 3 1  ? 26.275  -57.208 10.393  1.00 63.44  ? 1   DG  G N1    1 
ATOM 2993 C C2    . DG  G 3 1  ? 24.893  -57.260 10.414  1.00 63.31  ? 1   DG  G C2    1 
ATOM 2994 N N2    . DG  G 3 1  ? 24.229  -56.118 10.590  1.00 63.45  ? 1   DG  G N2    1 
ATOM 2995 N N3    . DG  G 3 1  ? 24.189  -58.367 10.270  1.00 63.00  ? 1   DG  G N3    1 
ATOM 2996 C C4    . DG  G 3 1  ? 24.991  -59.456 10.103  1.00 63.68  ? 1   DG  G C4    1 
ATOM 2997 P P     . DG  G 3 2  ? 19.362  -61.454 8.243   1.00 78.16  ? 2   DG  G P     1 
ATOM 2998 O OP1   . DG  G 3 2  ? 17.994  -61.668 8.783   1.00 78.18  ? 2   DG  G OP1   1 
ATOM 2999 O OP2   . DG  G 3 2  ? 19.908  -62.283 7.133   1.00 78.55  ? 2   DG  G OP2   1 
ATOM 3000 O "O5'" . DG  G 3 2  ? 19.413  -59.916 7.825   1.00 76.76  ? 2   DG  G "O5'" 1 
ATOM 3001 C "C5'" . DG  G 3 2  ? 19.000  -58.978 8.819   1.00 76.00  ? 2   DG  G "C5'" 1 
ATOM 3002 C "C4'" . DG  G 3 2  ? 19.305  -57.561 8.380   1.00 75.11  ? 2   DG  G "C4'" 1 
ATOM 3003 O "O4'" . DG  G 3 2  ? 20.728  -57.217 8.452   1.00 74.27  ? 2   DG  G "O4'" 1 
ATOM 3004 C "C3'" . DG  G 3 2  ? 18.858  -57.278 6.964   1.00 74.21  ? 2   DG  G "C3'" 1 
ATOM 3005 O "O3'" . DG  G 3 2  ? 18.257  -55.999 7.054   1.00 75.80  ? 2   DG  G "O3'" 1 
ATOM 3006 C "C2'" . DG  G 3 2  ? 20.164  -57.343 6.162   1.00 72.94  ? 2   DG  G "C2'" 1 
ATOM 3007 C "C1'" . DG  G 3 2  ? 21.249  -56.929 7.168   1.00 70.63  ? 2   DG  G "C1'" 1 
ATOM 3008 N N9    . DG  G 3 2  ? 22.573  -57.580 7.086   1.00 69.93  ? 2   DG  G N9    1 
ATOM 3009 C C8    . DG  G 3 2  ? 22.894  -58.928 6.998   1.00 69.42  ? 2   DG  G C8    1 
ATOM 3010 N N7    . DG  G 3 2  ? 24.186  -59.176 6.949   1.00 68.62  ? 2   DG  G N7    1 
ATOM 3011 C C5    . DG  G 3 2  ? 24.774  -57.908 7.021   1.00 68.99  ? 2   DG  G C5    1 
ATOM 3012 C C6    . DG  G 3 2  ? 26.151  -57.503 7.015   1.00 69.67  ? 2   DG  G C6    1 
ATOM 3013 O O6    . DG  G 3 2  ? 27.177  -58.219 6.946   1.00 69.61  ? 2   DG  G O6    1 
ATOM 3014 N N1    . DG  G 3 2  ? 26.295  -56.108 7.105   1.00 69.34  ? 2   DG  G N1    1 
ATOM 3015 C C2    . DG  G 3 2  ? 25.241  -55.209 7.179   1.00 69.33  ? 2   DG  G C2    1 
ATOM 3016 N N2    . DG  G 3 2  ? 25.538  -53.899 7.256   1.00 68.89  ? 2   DG  G N2    1 
ATOM 3017 N N3    . DG  G 3 2  ? 23.960  -55.576 7.183   1.00 69.29  ? 2   DG  G N3    1 
ATOM 3018 C C4    . DG  G 3 2  ? 23.795  -56.927 7.108   1.00 69.26  ? 2   DG  G C4    1 
ATOM 3019 P P     . DC  G 3 3  ? 17.100  -55.573 6.035   1.00 77.59  ? 3   DC  G P     1 
ATOM 3020 O OP1   . DC  G 3 3  ? 15.958  -54.931 6.742   1.00 76.54  ? 3   DC  G OP1   1 
ATOM 3021 O OP2   . DC  G 3 3  ? 16.904  -56.755 5.158   1.00 78.32  ? 3   DC  G OP2   1 
ATOM 3022 O "O5'" . DC  G 3 3  ? 17.842  -54.440 5.179   1.00 76.99  ? 3   DC  G "O5'" 1 
ATOM 3023 C "C5'" . DC  G 3 3  ? 18.349  -53.284 5.832   1.00 74.81  ? 3   DC  G "C5'" 1 
ATOM 3024 C "C4'" . DC  G 3 3  ? 19.509  -52.772 5.020   1.00 73.21  ? 3   DC  G "C4'" 1 
ATOM 3025 O "O4'" . DC  G 3 3  ? 20.601  -53.711 5.026   1.00 72.70  ? 3   DC  G "O4'" 1 
ATOM 3026 C "C3'" . DC  G 3 3  ? 19.177  -52.575 3.560   1.00 72.65  ? 3   DC  G "C3'" 1 
ATOM 3027 O "O3'" . DC  G 3 3  ? 19.359  -51.196 3.405   1.00 73.74  ? 3   DC  G "O3'" 1 
ATOM 3028 C "C2'" . DC  G 3 3  ? 20.217  -53.400 2.802   1.00 71.48  ? 3   DC  G "C2'" 1 
ATOM 3029 C "C1'" . DC  G 3 3  ? 21.324  -53.546 3.833   1.00 69.94  ? 3   DC  G "C1'" 1 
ATOM 3030 N N1    . DC  G 3 3  ? 22.217  -54.758 3.731   1.00 69.36  ? 3   DC  G N1    1 
ATOM 3031 C C2    . DC  G 3 3  ? 23.620  -54.622 3.798   1.00 68.93  ? 3   DC  G C2    1 
ATOM 3032 O O2    . DC  G 3 3  ? 24.113  -53.483 3.924   1.00 68.59  ? 3   DC  G O2    1 
ATOM 3033 N N3    . DC  G 3 3  ? 24.393  -55.756 3.713   1.00 68.33  ? 3   DC  G N3    1 
ATOM 3034 C C4    . DC  G 3 3  ? 23.831  -56.972 3.584   1.00 68.37  ? 3   DC  G C4    1 
ATOM 3035 N N4    . DC  G 3 3  ? 24.612  -58.053 3.511   1.00 68.08  ? 3   DC  G N4    1 
ATOM 3036 C C5    . DC  G 3 3  ? 22.413  -57.131 3.526   1.00 68.50  ? 3   DC  G C5    1 
ATOM 3037 C C6    . DC  G 3 3  ? 21.665  -56.013 3.604   1.00 69.27  ? 3   DC  G C6    1 
ATOM 3038 P P     . DT  G 3 4  ? 18.809  -50.415 2.125   1.00 73.33  ? 4   DT  G P     1 
ATOM 3039 O OP1   . DT  G 3 4  ? 18.138  -49.173 2.588   1.00 73.37  ? 4   DT  G OP1   1 
ATOM 3040 O OP2   . DT  G 3 4  ? 18.072  -51.401 1.282   1.00 71.88  ? 4   DT  G OP2   1 
ATOM 3041 O "O5'" . DT  G 3 4  ? 20.207  -49.943 1.490   1.00 70.88  ? 4   DT  G "O5'" 1 
ATOM 3042 C "C5'" . DT  G 3 4  ? 21.122  -49.218 2.327   1.00 66.83  ? 4   DT  G "C5'" 1 
ATOM 3043 C "C4'" . DT  G 3 4  ? 22.511  -49.156 1.710   1.00 64.64  ? 4   DT  G "C4'" 1 
ATOM 3044 O "O4'" . DT  G 3 4  ? 23.187  -50.442 1.795   1.00 62.30  ? 4   DT  G "O4'" 1 
ATOM 3045 C "C3'" . DT  G 3 4  ? 22.554  -48.736 0.240   1.00 63.34  ? 4   DT  G "C3'" 1 
ATOM 3046 O "O3'" . DT  G 3 4  ? 23.573  -47.740 0.149   1.00 64.42  ? 4   DT  G "O3'" 1 
ATOM 3047 C "C2'" . DT  G 3 4  ? 22.855  -50.045 -0.496  1.00 61.17  ? 4   DT  G "C2'" 1 
ATOM 3048 C "C1'" . DT  G 3 4  ? 23.744  -50.757 0.527   1.00 57.75  ? 4   DT  G "C1'" 1 
ATOM 3049 N N1    . DT  G 3 4  ? 23.851  -52.264 0.472   1.00 55.46  ? 4   DT  G N1    1 
ATOM 3050 C C2    . DT  G 3 4  ? 25.098  -52.811 0.711   1.00 54.16  ? 4   DT  G C2    1 
ATOM 3051 O O2    . DT  G 3 4  ? 26.101  -52.141 0.929   1.00 53.03  ? 4   DT  G O2    1 
ATOM 3052 N N3    . DT  G 3 4  ? 25.128  -54.183 0.674   1.00 53.88  ? 4   DT  G N3    1 
ATOM 3053 C C4    . DT  G 3 4  ? 24.072  -55.038 0.440   1.00 54.50  ? 4   DT  G C4    1 
ATOM 3054 O O4    . DT  G 3 4  ? 24.232  -56.256 0.436   1.00 54.58  ? 4   DT  G O4    1 
ATOM 3055 C C5    . DT  G 3 4  ? 22.791  -54.402 0.205   1.00 53.66  ? 4   DT  G C5    1 
ATOM 3056 C C7    . DT  G 3 4  ? 21.568  -55.239 -0.059  1.00 53.81  ? 4   DT  G C7    1 
ATOM 3057 C C6    . DT  G 3 4  ? 22.741  -53.061 0.236   1.00 53.39  ? 4   DT  G C6    1 
ATOM 3058 P P     . DT  G 3 5  ? 24.121  -47.109 -1.230  1.00 66.64  ? 5   DT  G P     1 
ATOM 3059 O OP1   . DT  G 3 5  ? 24.960  -45.924 -0.875  1.00 65.63  ? 5   DT  G OP1   1 
ATOM 3060 O OP2   . DT  G 3 5  ? 23.001  -46.971 -2.208  1.00 64.37  ? 5   DT  G OP2   1 
ATOM 3061 O "O5'" . DT  G 3 5  ? 25.092  -48.289 -1.728  1.00 64.36  ? 5   DT  G "O5'" 1 
ATOM 3062 C "C5'" . DT  G 3 5  ? 26.441  -48.412 -1.267  1.00 60.72  ? 5   DT  G "C5'" 1 
ATOM 3063 C "C4'" . DT  G 3 5  ? 27.125  -49.420 -2.172  1.00 59.15  ? 5   DT  G "C4'" 1 
ATOM 3064 O "O4'" . DT  G 3 5  ? 26.581  -50.761 -1.960  1.00 56.82  ? 5   DT  G "O4'" 1 
ATOM 3065 C "C3'" . DT  G 3 5  ? 26.936  -49.100 -3.659  1.00 57.61  ? 5   DT  G "C3'" 1 
ATOM 3066 O "O3'" . DT  G 3 5  ? 28.166  -49.329 -4.316  1.00 57.60  ? 5   DT  G "O3'" 1 
ATOM 3067 C "C2'" . DT  G 3 5  ? 25.858  -50.091 -4.072  1.00 55.86  ? 5   DT  G "C2'" 1 
ATOM 3068 C "C1'" . DT  G 3 5  ? 26.295  -51.282 -3.220  1.00 53.57  ? 5   DT  G "C1'" 1 
ATOM 3069 N N1    . DT  G 3 5  ? 25.319  -52.377 -3.162  1.00 52.87  ? 5   DT  G N1    1 
ATOM 3070 C C2    . DT  G 3 5  ? 25.735  -53.642 -2.791  1.00 52.22  ? 5   DT  G C2    1 
ATOM 3071 O O2    . DT  G 3 5  ? 26.871  -53.919 -2.455  1.00 52.20  ? 5   DT  G O2    1 
ATOM 3072 N N3    . DT  G 3 5  ? 24.764  -54.602 -2.811  1.00 51.60  ? 5   DT  G N3    1 
ATOM 3073 C C4    . DT  G 3 5  ? 23.444  -54.429 -3.182  1.00 53.31  ? 5   DT  G C4    1 
ATOM 3074 O O4    . DT  G 3 5  ? 22.666  -55.389 -3.152  1.00 53.36  ? 5   DT  G O4    1 
ATOM 3075 C C5    . DT  G 3 5  ? 23.073  -53.070 -3.584  1.00 52.50  ? 5   DT  G C5    1 
ATOM 3076 C C7    . DT  G 3 5  ? 21.682  -52.696 -4.010  1.00 51.98  ? 5   DT  G C7    1 
ATOM 3077 C C6    . DT  G 3 5  ? 24.020  -52.127 -3.554  1.00 52.63  ? 5   DT  G C6    1 
ATOM 3078 P P     . DA  G 3 6  ? 29.095  -48.102 -4.721  1.00 56.25  ? 6   DA  G P     1 
ATOM 3079 O OP1   . DA  G 3 6  ? 29.294  -47.197 -3.575  1.00 57.88  ? 6   DA  G OP1   1 
ATOM 3080 O OP2   . DA  G 3 6  ? 28.536  -47.618 -5.997  1.00 58.00  ? 6   DA  G OP2   1 
ATOM 3081 O "O5'" . DA  G 3 6  ? 30.527  -48.746 -5.022  1.00 56.35  ? 6   DA  G "O5'" 1 
ATOM 3082 C "C5'" . DA  G 3 6  ? 31.311  -49.428 -4.041  1.00 52.96  ? 6   DA  G "C5'" 1 
ATOM 3083 C "C4'" . DA  G 3 6  ? 31.699  -50.818 -4.540  1.00 51.70  ? 6   DA  G "C4'" 1 
ATOM 3084 O "O4'" . DA  G 3 6  ? 30.524  -51.663 -4.618  1.00 49.95  ? 6   DA  G "O4'" 1 
ATOM 3085 C "C3'" . DA  G 3 6  ? 32.318  -50.899 -5.934  1.00 51.79  ? 6   DA  G "C3'" 1 
ATOM 3086 O "O3'" . DA  G 3 6  ? 33.555  -51.613 -5.857  1.00 52.34  ? 6   DA  G "O3'" 1 
ATOM 3087 C "C2'" . DA  G 3 6  ? 31.248  -51.588 -6.806  1.00 50.71  ? 6   DA  G "C2'" 1 
ATOM 3088 C "C1'" . DA  G 3 6  ? 30.555  -52.462 -5.773  1.00 47.48  ? 6   DA  G "C1'" 1 
ATOM 3089 N N9    . DA  G 3 6  ? 29.157  -52.775 -5.974  1.00 45.86  ? 6   DA  G N9    1 
ATOM 3090 C C8    . DA  G 3 6  ? 28.159  -51.876 -6.169  1.00 46.48  ? 6   DA  G C8    1 
ATOM 3091 N N7    . DA  G 3 6  ? 26.962  -52.417 -6.283  1.00 46.50  ? 6   DA  G N7    1 
ATOM 3092 C C5    . DA  G 3 6  ? 27.200  -53.763 -6.125  1.00 45.42  ? 6   DA  G C5    1 
ATOM 3093 C C6    . DA  G 3 6  ? 26.329  -54.859 -6.140  1.00 45.86  ? 6   DA  G C6    1 
ATOM 3094 N N6    . DA  G 3 6  ? 25.013  -54.734 -6.324  1.00 45.70  ? 6   DA  G N6    1 
ATOM 3095 N N1    . DA  G 3 6  ? 26.875  -56.074 -5.963  1.00 45.65  ? 6   DA  G N1    1 
ATOM 3096 C C2    . DA  G 3 6  ? 28.202  -56.162 -5.785  1.00 45.69  ? 6   DA  G C2    1 
ATOM 3097 N N3    . DA  G 3 6  ? 29.123  -55.202 -5.745  1.00 44.38  ? 6   DA  G N3    1 
ATOM 3098 C C4    . DA  G 3 6  ? 28.548  -54.007 -5.926  1.00 45.27  ? 6   DA  G C4    1 
ATOM 3099 P P     . DA  G 3 7  ? 34.344  -51.899 -7.221  1.00 52.90  ? 7   DA  G P     1 
ATOM 3100 O OP1   . DA  G 3 7  ? 35.800  -51.979 -6.935  1.00 49.77  ? 7   DA  G OP1   1 
ATOM 3101 O OP2   . DA  G 3 7  ? 33.799  -50.945 -8.232  1.00 53.70  ? 7   DA  G OP2   1 
ATOM 3102 O "O5'" . DA  G 3 7  ? 33.774  -53.349 -7.621  1.00 51.05  ? 7   DA  G "O5'" 1 
ATOM 3103 C "C5'" . DA  G 3 7  ? 34.016  -54.498 -6.810  1.00 49.33  ? 7   DA  G "C5'" 1 
ATOM 3104 C "C4'" . DA  G 3 7  ? 33.405  -55.702 -7.496  1.00 48.40  ? 7   DA  G "C4'" 1 
ATOM 3105 O "O4'" . DA  G 3 7  ? 31.961  -55.573 -7.549  1.00 47.33  ? 7   DA  G "O4'" 1 
ATOM 3106 C "C3'" . DA  G 3 7  ? 33.852  -55.871 -8.939  1.00 48.05  ? 7   DA  G "C3'" 1 
ATOM 3107 O "O3'" . DA  G 3 7  ? 34.328  -57.184 -9.063  1.00 49.91  ? 7   DA  G "O3'" 1 
ATOM 3108 C "C2'" . DA  G 3 7  ? 32.580  -55.633 -9.759  1.00 47.59  ? 7   DA  G "C2'" 1 
ATOM 3109 C "C1'" . DA  G 3 7  ? 31.474  -56.008 -8.797  1.00 44.98  ? 7   DA  G "C1'" 1 
ATOM 3110 N N9    . DA  G 3 7  ? 30.207  -55.324 -8.994  1.00 44.90  ? 7   DA  G N9    1 
ATOM 3111 C C8    . DA  G 3 7  ? 29.946  -53.971 -9.010  1.00 45.04  ? 7   DA  G C8    1 
ATOM 3112 N N7    . DA  G 3 7  ? 28.670  -53.653 -9.188  1.00 44.17  ? 7   DA  G N7    1 
ATOM 3113 C C5    . DA  G 3 7  ? 28.053  -54.893 -9.276  1.00 44.28  ? 7   DA  G C5    1 
ATOM 3114 C C6    . DA  G 3 7  ? 26.714  -55.282 -9.439  1.00 44.20  ? 7   DA  G C6    1 
ATOM 3115 N N6    . DA  G 3 7  ? 25.704  -54.418 -9.578  1.00 44.63  ? 7   DA  G N6    1 
ATOM 3116 N N1    . DA  G 3 7  ? 26.431  -56.599 -9.469  1.00 44.66  ? 7   DA  G N1    1 
ATOM 3117 C C2    . DA  G 3 7  ? 27.430  -57.469 -9.339  1.00 44.60  ? 7   DA  G C2    1 
ATOM 3118 N N3    . DA  G 3 7  ? 28.728  -57.229 -9.165  1.00 44.21  ? 7   DA  G N3    1 
ATOM 3119 C C4    . DA  G 3 7  ? 28.977  -55.919 -9.148  1.00 44.65  ? 7   DA  G C4    1 
ATOM 3120 P P     . DT  G 3 8  ? 35.128  -57.730 -10.355 1.00 52.07  ? 8   DT  G P     1 
ATOM 3121 O OP1   . DT  G 3 8  ? 36.526  -57.968 -9.890  1.00 51.17  ? 8   DT  G OP1   1 
ATOM 3122 O OP2   . DT  G 3 8  ? 34.884  -56.853 -11.515 1.00 48.28  ? 8   DT  G OP2   1 
ATOM 3123 O "O5'" . DT  G 3 8  ? 34.346  -59.123 -10.634 1.00 47.65  ? 8   DT  G "O5'" 1 
ATOM 3124 C "C5'" . DT  G 3 8  ? 32.957  -59.038 -10.461 1.00 43.71  ? 8   DT  G "C5'" 1 
ATOM 3125 C "C4'" . DT  G 3 8  ? 32.161  -60.172 -11.038 1.00 42.88  ? 8   DT  G "C4'" 1 
ATOM 3126 O "O4'" . DT  G 3 8  ? 30.777  -59.754 -11.049 1.00 42.27  ? 8   DT  G "O4'" 1 
ATOM 3127 C "C3'" . DT  G 3 8  ? 32.460  -60.622 -12.445 1.00 43.40  ? 8   DT  G "C3'" 1 
ATOM 3128 O "O3'" . DT  G 3 8  ? 32.144  -62.024 -12.559 1.00 44.54  ? 8   DT  G "O3'" 1 
ATOM 3129 C "C2'" . DT  G 3 8  ? 31.517  -59.731 -13.260 1.00 42.65  ? 8   DT  G "C2'" 1 
ATOM 3130 C "C1'" . DT  G 3 8  ? 30.288  -59.626 -12.351 1.00 41.02  ? 8   DT  G "C1'" 1 
ATOM 3131 N N1    . DT  G 3 8  ? 29.497  -58.360 -12.427 1.00 39.43  ? 8   DT  G N1    1 
ATOM 3132 C C2    . DT  G 3 8  ? 28.117  -58.440 -12.589 1.00 40.51  ? 8   DT  G C2    1 
ATOM 3133 O O2    . DT  G 3 8  ? 27.473  -59.472 -12.669 1.00 41.53  ? 8   DT  G O2    1 
ATOM 3134 N N3    . DT  G 3 8  ? 27.455  -57.242 -12.679 1.00 41.58  ? 8   DT  G N3    1 
ATOM 3135 C C4    . DT  G 3 8  ? 28.044  -55.984 -12.624 1.00 41.55  ? 8   DT  G C4    1 
ATOM 3136 O O4    . DT  G 3 8  ? 27.361  -54.978 -12.696 1.00 40.20  ? 8   DT  G O4    1 
ATOM 3137 C C5    . DT  G 3 8  ? 29.487  -55.951 -12.460 1.00 41.19  ? 8   DT  G C5    1 
ATOM 3138 C C7    . DT  G 3 8  ? 30.183  -54.627 -12.383 1.00 40.15  ? 8   DT  G C7    1 
ATOM 3139 C C6    . DT  G 3 8  ? 30.147  -57.130 -12.374 1.00 39.96  ? 8   DT  G C6    1 
ATOM 3140 P P     . DT  G 3 9  ? 32.616  -62.914 -13.825 1.00 47.54  ? 9   DT  G P     1 
ATOM 3141 O OP1   . DT  G 3 9  ? 32.929  -64.292 -13.338 1.00 47.09  ? 9   DT  G OP1   1 
ATOM 3142 O OP2   . DT  G 3 9  ? 33.619  -62.111 -14.581 1.00 44.39  ? 9   DT  G OP2   1 
ATOM 3143 O "O5'" . DT  G 3 9  ? 31.308  -63.102 -14.716 1.00 44.80  ? 9   DT  G "O5'" 1 
ATOM 3144 C "C5'" . DT  G 3 9  ? 30.267  -63.814 -14.117 1.00 47.78  ? 9   DT  G "C5'" 1 
ATOM 3145 C "C4'" . DT  G 3 9  ? 29.085  -63.878 -15.057 1.00 50.89  ? 9   DT  G "C4'" 1 
ATOM 3146 O "O4'" . DT  G 3 9  ? 28.249  -62.672 -15.020 1.00 51.10  ? 9   DT  G "O4'" 1 
ATOM 3147 C "C3'" . DT  G 3 9  ? 29.554  -64.039 -16.491 1.00 53.08  ? 9   DT  G "C3'" 1 
ATOM 3148 O "O3'" . DT  G 3 9  ? 28.727  -65.027 -17.110 1.00 54.35  ? 9   DT  G "O3'" 1 
ATOM 3149 C "C2'" . DT  G 3 9  ? 29.376  -62.627 -17.076 1.00 52.80  ? 9   DT  G "C2'" 1 
ATOM 3150 C "C1'" . DT  G 3 9  ? 28.130  -62.134 -16.323 1.00 50.85  ? 9   DT  G "C1'" 1 
ATOM 3151 N N1    . DT  G 3 9  ? 28.003  -60.641 -16.221 1.00 50.25  ? 9   DT  G N1    1 
ATOM 3152 C C2    . DT  G 3 9  ? 26.749  -60.050 -16.187 1.00 51.04  ? 9   DT  G C2    1 
ATOM 3153 O O2    . DT  G 3 9  ? 25.679  -60.659 -16.223 1.00 51.07  ? 9   DT  G O2    1 
ATOM 3154 N N3    . DT  G 3 9  ? 26.780  -58.679 -16.095 1.00 49.95  ? 9   DT  G N3    1 
ATOM 3155 C C4    . DT  G 3 9  ? 27.888  -57.868 -16.037 1.00 49.43  ? 9   DT  G C4    1 
ATOM 3156 O O4    . DT  G 3 9  ? 27.781  -56.660 -15.951 1.00 49.94  ? 9   DT  G O4    1 
ATOM 3157 C C5    . DT  G 3 9  ? 29.154  -58.540 -16.098 1.00 49.74  ? 9   DT  G C5    1 
ATOM 3158 C C7    . DT  G 3 9  ? 30.437  -57.766 -16.056 1.00 50.25  ? 9   DT  G C7    1 
ATOM 3159 C C6    . DT  G 3 9  ? 29.146  -59.872 -16.174 1.00 49.85  ? 9   DT  G C6    1 
ATOM 3160 P P     . DA  G 3 10 ? 29.151  -65.612 -18.532 1.00 55.53  ? 10  DA  G P     1 
ATOM 3161 O OP1   . DA  G 3 10 ? 29.713  -66.949 -18.228 1.00 56.69  ? 10  DA  G OP1   1 
ATOM 3162 O OP2   . DA  G 3 10 ? 30.000  -64.631 -19.272 1.00 53.64  ? 10  DA  G OP2   1 
ATOM 3163 O "O5'" . DA  G 3 10 ? 27.757  -65.703 -19.312 1.00 52.58  ? 10  DA  G "O5'" 1 
ATOM 3164 C "C5'" . DA  G 3 10 ? 26.486  -65.750 -18.684 1.00 49.06  ? 10  DA  G "C5'" 1 
ATOM 3165 C "C4'" . DA  G 3 10 ? 25.427  -65.100 -19.572 1.00 46.73  ? 10  DA  G "C4'" 1 
ATOM 3166 O "O4'" . DA  G 3 10 ? 25.446  -63.694 -19.255 1.00 46.90  ? 10  DA  G "O4'" 1 
ATOM 3167 C "C3'" . DA  G 3 10 ? 25.598  -65.186 -21.087 1.00 45.43  ? 10  DA  G "C3'" 1 
ATOM 3168 O "O3'" . DA  G 3 10 ? 24.419  -65.707 -21.633 1.00 45.03  ? 10  DA  G "O3'" 1 
ATOM 3169 C "C2'" . DA  G 3 10 ? 25.886  -63.747 -21.551 1.00 45.57  ? 10  DA  G "C2'" 1 
ATOM 3170 C "C1'" . DA  G 3 10 ? 25.387  -62.879 -20.412 1.00 44.29  ? 10  DA  G "C1'" 1 
ATOM 3171 N N9    . DA  G 3 10 ? 26.198  -61.687 -20.125 1.00 43.49  ? 10  DA  G N9    1 
ATOM 3172 C C8    . DA  G 3 10 ? 27.527  -61.643 -19.851 1.00 43.14  ? 10  DA  G C8    1 
ATOM 3173 N N7    . DA  G 3 10 ? 27.998  -60.450 -19.597 1.00 42.04  ? 10  DA  G N7    1 
ATOM 3174 C C5    . DA  G 3 10 ? 26.902  -59.646 -19.700 1.00 41.87  ? 10  DA  G C5    1 
ATOM 3175 C C6    . DA  G 3 10 ? 26.739  -58.262 -19.555 1.00 42.17  ? 10  DA  G C6    1 
ATOM 3176 N N6    . DA  G 3 10 ? 27.720  -57.423 -19.264 1.00 42.46  ? 10  DA  G N6    1 
ATOM 3177 N N1    . DA  G 3 10 ? 25.509  -57.761 -19.708 1.00 43.25  ? 10  DA  G N1    1 
ATOM 3178 C C2    . DA  G 3 10 ? 24.501  -58.591 -19.997 1.00 43.42  ? 10  DA  G C2    1 
ATOM 3179 N N3    . DA  G 3 10 ? 24.540  -59.914 -20.180 1.00 43.93  ? 10  DA  G N3    1 
ATOM 3180 C C4    . DA  G 3 10 ? 25.784  -60.386 -20.007 1.00 42.93  ? 10  DA  G C4    1 
ATOM 3181 P P     . DA  G 3 11 ? 23.993  -65.610 -23.184 1.00 46.83  ? 11  DA  G P     1 
ATOM 3182 O OP1   . DA  G 3 11 ? 22.905  -66.587 -23.405 1.00 46.67  ? 11  DA  G OP1   1 
ATOM 3183 O OP2   . DA  G 3 11 ? 25.177  -65.643 -24.082 1.00 47.86  ? 11  DA  G OP2   1 
ATOM 3184 O "O5'" . DA  G 3 11 ? 23.375  -64.148 -23.200 1.00 46.56  ? 11  DA  G "O5'" 1 
ATOM 3185 C "C5'" . DA  G 3 11 ? 22.607  -63.680 -24.264 1.00 46.20  ? 11  DA  G "C5'" 1 
ATOM 3186 C "C4'" . DA  G 3 11 ? 22.433  -62.172 -24.120 1.00 47.97  ? 11  DA  G "C4'" 1 
ATOM 3187 O "O4'" . DA  G 3 11 ? 23.232  -61.531 -23.075 1.00 45.65  ? 11  DA  G "O4'" 1 
ATOM 3188 C "C3'" . DA  G 3 11 ? 22.992  -61.469 -25.320 1.00 49.99  ? 11  DA  G "C3'" 1 
ATOM 3189 O "O3'" . DA  G 3 11 ? 22.249  -61.893 -26.450 1.00 54.84  ? 11  DA  G "O3'" 1 
ATOM 3190 C "C2'" . DA  G 3 11 ? 22.821  -60.038 -24.846 1.00 47.09  ? 11  DA  G "C2'" 1 
ATOM 3191 C "C1'" . DA  G 3 11 ? 23.291  -60.150 -23.413 1.00 43.59  ? 11  DA  G "C1'" 1 
ATOM 3192 N N9    . DA  G 3 11 ? 24.633  -59.612 -23.236 1.00 43.52  ? 11  DA  G N9    1 
ATOM 3193 C C8    . DA  G 3 11 ? 25.786  -60.343 -23.167 1.00 42.99  ? 11  DA  G C8    1 
ATOM 3194 N N7    . DA  G 3 11 ? 26.873  -59.641 -22.977 1.00 41.62  ? 11  DA  G N7    1 
ATOM 3195 C C5    . DA  G 3 11 ? 26.403  -58.345 -22.934 1.00 42.39  ? 11  DA  G C5    1 
ATOM 3196 C C6    . DA  G 3 11 ? 27.083  -57.132 -22.758 1.00 41.88  ? 11  DA  G C6    1 
ATOM 3197 N N6    . DA  G 3 11 ? 28.398  -57.088 -22.598 1.00 41.13  ? 11  DA  G N6    1 
ATOM 3198 N N1    . DA  G 3 11 ? 26.357  -55.997 -22.756 1.00 42.55  ? 11  DA  G N1    1 
ATOM 3199 C C2    . DA  G 3 11 ? 25.023  -56.101 -22.907 1.00 42.53  ? 11  DA  G C2    1 
ATOM 3200 N N3    . DA  G 3 11 ? 24.263  -57.192 -23.077 1.00 42.24  ? 11  DA  G N3    1 
ATOM 3201 C C4    . DA  G 3 11 ? 25.025  -58.298 -23.091 1.00 42.74  ? 11  DA  G C4    1 
ATOM 3202 P P     . DT  G 3 12 ? 21.185  -61.030 -27.275 1.00 60.09  ? 12  DT  G P     1 
ATOM 3203 O OP1   . DT  G 3 12 ? 19.846  -61.583 -26.890 1.00 58.81  ? 12  DT  G OP1   1 
ATOM 3204 O OP2   . DT  G 3 12 ? 21.709  -60.992 -28.661 1.00 56.95  ? 12  DT  G OP2   1 
ATOM 3205 O "O5'" . DT  G 3 12 ? 21.278  -59.504 -26.816 1.00 58.13  ? 12  DT  G "O5'" 1 
ATOM 3206 C "C5'" . DT  G 3 12 ? 20.109  -58.780 -26.478 1.00 56.24  ? 12  DT  G "C5'" 1 
ATOM 3207 C "C4'" . DT  G 3 12 ? 20.351  -57.343 -26.877 1.00 55.13  ? 12  DT  G "C4'" 1 
ATOM 3208 O "O4'" . DT  G 3 12 ? 21.582  -56.847 -26.282 1.00 52.88  ? 12  DT  G "O4'" 1 
ATOM 3209 C "C3'" . DT  G 3 12 ? 20.473  -57.188 -28.378 1.00 55.08  ? 12  DT  G "C3'" 1 
ATOM 3210 O "O3'" . DT  G 3 12 ? 19.500  -56.234 -28.780 1.00 57.43  ? 12  DT  G "O3'" 1 
ATOM 3211 C "C2'" . DT  G 3 12 ? 21.921  -56.743 -28.583 1.00 53.86  ? 12  DT  G "C2'" 1 
ATOM 3212 C "C1'" . DT  G 3 12 ? 22.353  -56.175 -27.235 1.00 51.09  ? 12  DT  G "C1'" 1 
ATOM 3213 N N1    . DT  G 3 12 ? 23.785  -56.395 -26.867 1.00 50.38  ? 12  DT  G N1    1 
ATOM 3214 C C2    . DT  G 3 12 ? 24.526  -55.322 -26.432 1.00 50.05  ? 12  DT  G C2    1 
ATOM 3215 O O2    . DT  G 3 12 ? 24.095  -54.206 -26.339 1.00 50.48  ? 12  DT  G O2    1 
ATOM 3216 N N3    . DT  G 3 12 ? 25.819  -55.580 -26.098 1.00 50.06  ? 12  DT  G N3    1 
ATOM 3217 C C4    . DT  G 3 12 ? 26.447  -56.795 -26.168 1.00 49.86  ? 12  DT  G C4    1 
ATOM 3218 O O4    . DT  G 3 12 ? 27.618  -56.913 -25.861 1.00 49.61  ? 12  DT  G O4    1 
ATOM 3219 C C5    . DT  G 3 12 ? 25.637  -57.893 -26.628 1.00 49.99  ? 12  DT  G C5    1 
ATOM 3220 C C7    . DT  G 3 12 ? 26.240  -59.266 -26.736 1.00 50.18  ? 12  DT  G C7    1 
ATOM 3221 C C6    . DT  G 3 12 ? 24.355  -57.650 -26.947 1.00 49.54  ? 12  DT  G C6    1 
ATOM 3222 P P     . DT  G 3 13 ? 19.295  -55.832 -30.322 1.00 61.37  ? 13  DT  G P     1 
ATOM 3223 O OP1   . DT  G 3 13 ? 17.841  -55.590 -30.532 1.00 60.44  ? 13  DT  G OP1   1 
ATOM 3224 O OP2   . DT  G 3 13 ? 20.007  -56.812 -31.185 1.00 60.18  ? 13  DT  G OP2   1 
ATOM 3225 O "O5'" . DT  G 3 13 ? 20.122  -54.451 -30.414 1.00 60.71  ? 13  DT  G "O5'" 1 
ATOM 3226 C "C5'" . DT  G 3 13 ? 19.853  -53.372 -29.551 1.00 60.36  ? 13  DT  G "C5'" 1 
ATOM 3227 C "C4'" . DT  G 3 13 ? 20.752  -52.230 -29.944 1.00 61.65  ? 13  DT  G "C4'" 1 
ATOM 3228 O "O4'" . DT  G 3 13 ? 22.088  -52.535 -29.502 1.00 61.40  ? 13  DT  G "O4'" 1 
ATOM 3229 C "C3'" . DT  G 3 13 ? 20.852  -51.926 -31.441 1.00 63.69  ? 13  DT  G "C3'" 1 
ATOM 3230 O "O3'" . DT  G 3 13 ? 20.661  -50.499 -31.663 1.00 66.47  ? 13  DT  G "O3'" 1 
ATOM 3231 C "C2'" . DT  G 3 13 ? 22.251  -52.397 -31.845 1.00 62.44  ? 13  DT  G "C2'" 1 
ATOM 3232 C "C1'" . DT  G 3 13 ? 23.000  -52.204 -30.534 1.00 61.45  ? 13  DT  G "C1'" 1 
ATOM 3233 N N1    . DT  G 3 13 ? 24.160  -53.077 -30.276 1.00 60.99  ? 13  DT  G N1    1 
ATOM 3234 C C2    . DT  G 3 13 ? 25.323  -52.480 -29.875 1.00 60.86  ? 13  DT  G C2    1 
ATOM 3235 O O2    . DT  G 3 13 ? 25.437  -51.278 -29.772 1.00 60.87  ? 13  DT  G O2    1 
ATOM 3236 N N3    . DT  G 3 13 ? 26.349  -53.347 -29.614 1.00 60.50  ? 13  DT  G N3    1 
ATOM 3237 C C4    . DT  G 3 13 ? 26.298  -54.719 -29.700 1.00 60.50  ? 13  DT  G C4    1 
ATOM 3238 O O4    . DT  G 3 13 ? 27.266  -55.407 -29.452 1.00 61.23  ? 13  DT  G O4    1 
ATOM 3239 C C5    . DT  G 3 13 ? 25.045  -55.292 -30.108 1.00 60.46  ? 13  DT  G C5    1 
ATOM 3240 C C7    . DT  G 3 13 ? 24.895  -56.780 -30.250 1.00 60.79  ? 13  DT  G C7    1 
ATOM 3241 C C6    . DT  G 3 13 ? 24.044  -54.450 -30.370 1.00 60.63  ? 13  DT  G C6    1 
ATOM 3242 P P     . DG  G 3 14 ? 20.175  -49.889 -33.075 1.00 67.34  ? 14  DG  G P     1 
ATOM 3243 O OP1   . DG  G 3 14 ? 19.321  -48.710 -32.812 1.00 68.55  ? 14  DG  G OP1   1 
ATOM 3244 O OP2   . DG  G 3 14 ? 19.653  -50.977 -33.933 1.00 67.25  ? 14  DG  G OP2   1 
ATOM 3245 O "O5'" . DG  G 3 14 ? 21.556  -49.372 -33.673 1.00 65.80  ? 14  DG  G "O5'" 1 
ATOM 3246 C "C5'" . DG  G 3 14 ? 22.321  -48.437 -32.931 1.00 65.58  ? 14  DG  G "C5'" 1 
ATOM 3247 C "C4'" . DG  G 3 14 ? 23.774  -48.443 -33.374 1.00 65.69  ? 14  DG  G "C4'" 1 
ATOM 3248 O "O4'" . DG  G 3 14 ? 24.440  -49.651 -32.906 1.00 64.87  ? 14  DG  G "O4'" 1 
ATOM 3249 C "C3'" . DG  G 3 14 ? 23.985  -48.392 -34.892 1.00 66.22  ? 14  DG  G "C3'" 1 
ATOM 3250 O "O3'" . DG  G 3 14 ? 25.057  -47.504 -35.151 1.00 69.55  ? 14  DG  G "O3'" 1 
ATOM 3251 C "C2'" . DG  G 3 14 ? 24.357  -49.832 -35.245 1.00 64.77  ? 14  DG  G "C2'" 1 
ATOM 3252 C "C1'" . DG  G 3 14 ? 25.192  -50.157 -34.002 1.00 62.14  ? 14  DG  G "C1'" 1 
ATOM 3253 N N9    . DG  G 3 14 ? 25.537  -51.565 -33.801 1.00 61.03  ? 14  DG  G N9    1 
ATOM 3254 C C8    . DG  G 3 14 ? 24.784  -52.681 -34.118 1.00 60.52  ? 14  DG  G C8    1 
ATOM 3255 N N7    . DG  G 3 14 ? 25.381  -53.806 -33.818 1.00 60.33  ? 14  DG  G N7    1 
ATOM 3256 C C5    . DG  G 3 14 ? 26.605  -53.400 -33.267 1.00 60.19  ? 14  DG  G C5    1 
ATOM 3257 C C6    . DG  G 3 14 ? 27.680  -54.165 -32.750 1.00 60.31  ? 14  DG  G C6    1 
ATOM 3258 O O6    . DG  G 3 14 ? 27.775  -55.402 -32.675 1.00 60.26  ? 14  DG  G O6    1 
ATOM 3259 N N1    . DG  G 3 14 ? 28.724  -53.357 -32.299 1.00 60.46  ? 14  DG  G N1    1 
ATOM 3260 C C2    . DG  G 3 14 ? 28.738  -51.982 -32.340 1.00 59.97  ? 14  DG  G C2    1 
ATOM 3261 N N2    . DG  G 3 14 ? 29.839  -51.382 -31.857 1.00 59.62  ? 14  DG  G N2    1 
ATOM 3262 N N3    . DG  G 3 14 ? 27.733  -51.257 -32.817 1.00 58.74  ? 14  DG  G N3    1 
ATOM 3263 C C4    . DG  G 3 14 ? 26.713  -52.025 -33.257 1.00 59.47  ? 14  DG  G C4    1 
ATOM 3264 P P     . DC  G 3 15 ? 25.313  -46.848 -36.592 1.00 72.45  ? 15  DC  G P     1 
ATOM 3265 O OP1   . DC  G 3 15 ? 24.502  -45.605 -36.588 1.00 73.14  ? 15  DC  G OP1   1 
ATOM 3266 O OP2   . DC  G 3 15 ? 25.152  -47.846 -37.684 1.00 71.67  ? 15  DC  G OP2   1 
ATOM 3267 O "O5'" . DC  G 3 15 ? 26.865  -46.485 -36.546 1.00 70.87  ? 15  DC  G "O5'" 1 
ATOM 3268 C "C5'" . DC  G 3 15 ? 27.466  -45.823 -35.439 1.00 71.19  ? 15  DC  G "C5'" 1 
ATOM 3269 C "C4'" . DC  G 3 15 ? 28.958  -46.074 -35.558 1.00 71.98  ? 15  DC  G "C4'" 1 
ATOM 3270 O "O4'" . DC  G 3 15 ? 29.307  -47.395 -35.031 1.00 71.94  ? 15  DC  G "O4'" 1 
ATOM 3271 C "C3'" . DC  G 3 15 ? 29.434  -46.063 -37.004 1.00 72.31  ? 15  DC  G "C3'" 1 
ATOM 3272 O "O3'" . DC  G 3 15 ? 30.606  -45.282 -37.082 1.00 74.75  ? 15  DC  G "O3'" 1 
ATOM 3273 C "C2'" . DC  G 3 15 ? 29.707  -47.533 -37.328 1.00 70.59  ? 15  DC  G "C2'" 1 
ATOM 3274 C "C1'" . DC  G 3 15 ? 30.055  -48.141 -35.969 1.00 69.00  ? 15  DC  G "C1'" 1 
ATOM 3275 N N1    . DC  G 3 15 ? 29.692  -49.597 -35.915 1.00 67.83  ? 15  DC  G N1    1 
ATOM 3276 C C2    . DC  G 3 15 ? 30.576  -50.582 -35.438 1.00 66.48  ? 15  DC  G C2    1 
ATOM 3277 O O2    . DC  G 3 15 ? 31.694  -50.266 -35.011 1.00 66.41  ? 15  DC  G O2    1 
ATOM 3278 N N3    . DC  G 3 15 ? 30.161  -51.874 -35.457 1.00 65.71  ? 15  DC  G N3    1 
ATOM 3279 C C4    . DC  G 3 15 ? 28.942  -52.196 -35.924 1.00 67.16  ? 15  DC  G C4    1 
ATOM 3280 N N4    . DC  G 3 15 ? 28.548  -53.471 -35.929 1.00 67.45  ? 15  DC  G N4    1 
ATOM 3281 C C5    . DC  G 3 15 ? 28.035  -51.223 -36.419 1.00 67.16  ? 15  DC  G C5    1 
ATOM 3282 C C6    . DC  G 3 15 ? 28.457  -49.956 -36.393 1.00 68.18  ? 15  DC  G C6    1 
ATOM 3283 P P     . DG  G 3 16 ? 31.427  -45.172 -38.453 1.00 76.24  ? 16  DG  G P     1 
ATOM 3284 O OP1   . DG  G 3 16 ? 32.154  -43.882 -38.328 1.00 76.92  ? 16  DG  G OP1   1 
ATOM 3285 O OP2   . DG  G 3 16 ? 30.496  -45.476 -39.578 1.00 74.26  ? 16  DG  G OP2   1 
ATOM 3286 O "O5'" . DG  G 3 16 ? 32.547  -46.317 -38.399 1.00 75.12  ? 16  DG  G "O5'" 1 
ATOM 3287 C "C5'" . DG  G 3 16 ? 33.717  -46.180 -37.572 1.00 73.67  ? 16  DG  G "C5'" 1 
ATOM 3288 C "C4'" . DG  G 3 16 ? 34.725  -47.281 -37.890 1.00 72.51  ? 16  DG  G "C4'" 1 
ATOM 3289 O "O4'" . DG  G 3 16 ? 34.151  -48.575 -37.562 1.00 71.46  ? 16  DG  G "O4'" 1 
ATOM 3290 C "C3'" . DG  G 3 16 ? 35.158  -47.398 -39.354 1.00 72.67  ? 16  DG  G "C3'" 1 
ATOM 3291 O "O3'" . DG  G 3 16 ? 36.495  -47.897 -39.420 1.00 74.17  ? 16  DG  G "O3'" 1 
ATOM 3292 C "C2'" . DG  G 3 16 ? 34.166  -48.405 -39.934 1.00 71.13  ? 16  DG  G "C2'" 1 
ATOM 3293 C "C1'" . DG  G 3 16 ? 34.101  -49.366 -38.744 1.00 68.99  ? 16  DG  G "C1'" 1 
ATOM 3294 N N9    . DG  G 3 16 ? 32.958  -50.296 -38.730 1.00 68.24  ? 16  DG  G N9    1 
ATOM 3295 C C8    . DG  G 3 16 ? 31.636  -50.060 -39.036 1.00 67.47  ? 16  DG  G C8    1 
ATOM 3296 N N7    . DG  G 3 16 ? 30.877  -51.115 -38.931 1.00 67.09  ? 16  DG  G N7    1 
ATOM 3297 C C5    . DG  G 3 16 ? 31.754  -52.113 -38.534 1.00 67.08  ? 16  DG  G C5    1 
ATOM 3298 C C6    . DG  G 3 16 ? 31.518  -53.470 -38.260 1.00 66.69  ? 16  DG  G C6    1 
ATOM 3299 O O6    . DG  G 3 16 ? 30.452  -54.074 -38.317 1.00 66.86  ? 16  DG  G O6    1 
ATOM 3300 N N1    . DG  G 3 16 ? 32.677  -54.133 -37.886 1.00 67.46  ? 16  DG  G N1    1 
ATOM 3301 C C2    . DG  G 3 16 ? 33.927  -53.557 -37.788 1.00 67.62  ? 16  DG  G C2    1 
ATOM 3302 N N2    . DG  G 3 16 ? 34.948  -54.347 -37.414 1.00 67.51  ? 16  DG  G N2    1 
ATOM 3303 N N3    . DG  G 3 16 ? 34.162  -52.281 -38.038 1.00 67.12  ? 16  DG  G N3    1 
ATOM 3304 C C4    . DG  G 3 16 ? 33.032  -51.628 -38.405 1.00 67.39  ? 16  DG  G C4    1 
ATOM 3305 P P     . DG  G 3 17 ? 37.422  -47.645 -40.711 1.00 75.74  ? 17  DG  G P     1 
ATOM 3306 O OP1   . DG  G 3 17 ? 38.474  -46.690 -40.250 1.00 73.93  ? 17  DG  G OP1   1 
ATOM 3307 O OP2   . DG  G 3 17 ? 36.528  -47.403 -41.882 1.00 73.10  ? 17  DG  G OP2   1 
ATOM 3308 O "O5'" . DG  G 3 17 ? 38.119  -49.060 -40.994 1.00 73.47  ? 17  DG  G "O5'" 1 
ATOM 3309 C "C5'" . DG  G 3 17 ? 38.852  -49.735 -39.970 1.00 71.36  ? 17  DG  G "C5'" 1 
ATOM 3310 C "C4'" . DG  G 3 17 ? 38.664  -51.225 -40.155 1.00 69.80  ? 17  DG  G "C4'" 1 
ATOM 3311 O "O4'" . DG  G 3 17 ? 37.255  -51.546 -40.026 1.00 68.20  ? 17  DG  G "O4'" 1 
ATOM 3312 C "C3'" . DG  G 3 17 ? 39.084  -51.719 -41.540 1.00 70.30  ? 17  DG  G "C3'" 1 
ATOM 3313 O "O3'" . DG  G 3 17 ? 40.290  -52.515 -41.442 1.00 72.34  ? 17  DG  G "O3'" 1 
ATOM 3314 C "C2'" . DG  G 3 17 ? 37.864  -52.484 -42.087 1.00 68.56  ? 17  DG  G "C2'" 1 
ATOM 3315 C "C1'" . DG  G 3 17 ? 36.974  -52.657 -40.857 1.00 65.89  ? 17  DG  G "C1'" 1 
ATOM 3316 N N9    . DG  G 3 17 ? 35.526  -52.733 -41.108 1.00 65.23  ? 17  DG  G N9    1 
ATOM 3317 C C8    . DG  G 3 17 ? 34.669  -51.683 -41.344 1.00 64.42  ? 17  DG  G C8    1 
ATOM 3318 N N7    . DG  G 3 17 ? 33.431  -52.052 -41.518 1.00 64.33  ? 17  DG  G N7    1 
ATOM 3319 C C5    . DG  G 3 17 ? 33.453  -53.436 -41.386 1.00 64.26  ? 17  DG  G C5    1 
ATOM 3320 C C6    . DG  G 3 17 ? 32.399  -54.386 -41.475 1.00 64.07  ? 17  DG  G C6    1 
ATOM 3321 O O6    . DG  G 3 17 ? 31.202  -54.192 -41.706 1.00 64.24  ? 17  DG  G O6    1 
ATOM 3322 N N1    . DG  G 3 17 ? 32.843  -55.691 -41.282 1.00 64.59  ? 17  DG  G N1    1 
ATOM 3323 C C2    . DG  G 3 17 ? 34.157  -56.042 -41.031 1.00 64.86  ? 17  DG  G C2    1 
ATOM 3324 N N2    . DG  G 3 17 ? 34.392  -57.356 -40.874 1.00 64.41  ? 17  DG  G N2    1 
ATOM 3325 N N3    . DG  G 3 17 ? 35.160  -55.161 -40.940 1.00 64.08  ? 17  DG  G N3    1 
ATOM 3326 C C4    . DG  G 3 17 ? 34.739  -53.876 -41.131 1.00 64.66  ? 17  DG  G C4    1 
ATOM 3327 O "O5'" . DC  H 4 1  ? 27.068  -63.864 -39.957 1.00 57.37  ? 1   DC  H "O5'" 1 
ATOM 3328 C "C5'" . DC  H 4 1  ? 27.952  -62.750 -39.899 1.00 55.25  ? 1   DC  H "C5'" 1 
ATOM 3329 C "C4'" . DC  H 4 1  ? 29.353  -63.180 -40.283 1.00 53.67  ? 1   DC  H "C4'" 1 
ATOM 3330 O "O4'" . DC  H 4 1  ? 29.733  -62.517 -41.498 1.00 53.37  ? 1   DC  H "O4'" 1 
ATOM 3331 C "C3'" . DC  H 4 1  ? 30.400  -62.760 -39.279 1.00 54.25  ? 1   DC  H "C3'" 1 
ATOM 3332 O "O3'" . DC  H 4 1  ? 30.781  -63.892 -38.569 1.00 55.76  ? 1   DC  H "O3'" 1 
ATOM 3333 C "C2'" . DC  H 4 1  ? 31.574  -62.247 -40.103 1.00 53.03  ? 1   DC  H "C2'" 1 
ATOM 3334 C "C1'" . DC  H 4 1  ? 30.820  -61.633 -41.265 1.00 51.73  ? 1   DC  H "C1'" 1 
ATOM 3335 N N1    . DC  H 4 1  ? 30.385  -60.174 -41.095 1.00 50.03  ? 1   DC  H N1    1 
ATOM 3336 C C2    . DC  H 4 1  ? 31.357  -59.189 -41.248 1.00 49.24  ? 1   DC  H C2    1 
ATOM 3337 O O2    . DC  H 4 1  ? 32.499  -59.544 -41.494 1.00 50.43  ? 1   DC  H O2    1 
ATOM 3338 N N3    . DC  H 4 1  ? 31.038  -57.875 -41.120 1.00 50.18  ? 1   DC  H N3    1 
ATOM 3339 C C4    . DC  H 4 1  ? 29.771  -57.531 -40.862 1.00 50.56  ? 1   DC  H C4    1 
ATOM 3340 N N4    . DC  H 4 1  ? 29.520  -56.233 -40.757 1.00 50.12  ? 1   DC  H N4    1 
ATOM 3341 C C5    . DC  H 4 1  ? 28.727  -58.502 -40.696 1.00 50.05  ? 1   DC  H C5    1 
ATOM 3342 C C6    . DC  H 4 1  ? 29.081  -59.795 -40.829 1.00 50.32  ? 1   DC  H C6    1 
ATOM 3343 P P     . DC  H 4 2  ? 31.135  -63.772 -37.015 1.00 56.05  ? 2   DC  H P     1 
ATOM 3344 O OP1   . DC  H 4 2  ? 31.753  -65.079 -36.664 1.00 57.62  ? 2   DC  H OP1   1 
ATOM 3345 O OP2   . DC  H 4 2  ? 29.934  -63.244 -36.323 1.00 52.47  ? 2   DC  H OP2   1 
ATOM 3346 O "O5'" . DC  H 4 2  ? 32.358  -62.739 -36.973 1.00 52.41  ? 2   DC  H "O5'" 1 
ATOM 3347 C "C5'" . DC  H 4 2  ? 33.581  -63.103 -37.546 1.00 48.31  ? 2   DC  H "C5'" 1 
ATOM 3348 C "C4'" . DC  H 4 2  ? 34.577  -62.044 -37.144 1.00 48.14  ? 2   DC  H "C4'" 1 
ATOM 3349 O "O4'" . DC  H 4 2  ? 34.308  -60.839 -37.927 1.00 47.25  ? 2   DC  H "O4'" 1 
ATOM 3350 C "C3'" . DC  H 4 2  ? 34.511  -61.691 -35.660 1.00 46.34  ? 2   DC  H "C3'" 1 
ATOM 3351 O "O3'" . DC  H 4 2  ? 35.731  -62.004 -35.040 1.00 45.29  ? 2   DC  H "O3'" 1 
ATOM 3352 C "C2'" . DC  H 4 2  ? 34.377  -60.178 -35.628 1.00 47.21  ? 2   DC  H "C2'" 1 
ATOM 3353 C "C1'" . DC  H 4 2  ? 34.288  -59.719 -37.078 1.00 45.09  ? 2   DC  H "C1'" 1 
ATOM 3354 N N1    . DC  H 4 2  ? 33.037  -58.979 -37.277 1.00 44.39  ? 2   DC  H N1    1 
ATOM 3355 C C2    . DC  H 4 2  ? 33.123  -57.596 -37.330 1.00 42.57  ? 2   DC  H C2    1 
ATOM 3356 O O2    . DC  H 4 2  ? 34.232  -57.085 -37.217 1.00 42.68  ? 2   DC  H O2    1 
ATOM 3357 N N3    . DC  H 4 2  ? 31.999  -56.881 -37.509 1.00 41.48  ? 2   DC  H N3    1 
ATOM 3358 C C4    . DC  H 4 2  ? 30.841  -57.501 -37.635 1.00 42.19  ? 2   DC  H C4    1 
ATOM 3359 N N4    . DC  H 4 2  ? 29.779  -56.740 -37.812 1.00 43.17  ? 2   DC  H N4    1 
ATOM 3360 C C5    . DC  H 4 2  ? 30.703  -58.918 -37.578 1.00 43.03  ? 2   DC  H C5    1 
ATOM 3361 C C6    . DC  H 4 2  ? 31.829  -59.622 -37.391 1.00 44.00  ? 2   DC  H C6    1 
ATOM 3362 P P     . DG  H 4 3  ? 35.908  -62.027 -33.458 1.00 42.49  ? 3   DG  H P     1 
ATOM 3363 O OP1   . DG  H 4 3  ? 37.086  -62.885 -33.159 1.00 41.41  ? 3   DG  H OP1   1 
ATOM 3364 O OP2   . DG  H 4 3  ? 34.578  -62.342 -32.902 1.00 42.12  ? 3   DG  H OP2   1 
ATOM 3365 O "O5'" . DG  H 4 3  ? 36.295  -60.519 -33.080 1.00 40.44  ? 3   DG  H "O5'" 1 
ATOM 3366 C "C5'" . DG  H 4 3  ? 37.527  -59.992 -33.514 1.00 40.29  ? 3   DG  H "C5'" 1 
ATOM 3367 C "C4'" . DG  H 4 3  ? 37.649  -58.502 -33.233 1.00 41.27  ? 3   DG  H "C4'" 1 
ATOM 3368 O "O4'" . DG  H 4 3  ? 36.581  -57.837 -33.928 1.00 41.62  ? 3   DG  H "O4'" 1 
ATOM 3369 C "C3'" . DG  H 4 3  ? 37.538  -58.075 -31.775 1.00 41.37  ? 3   DG  H "C3'" 1 
ATOM 3370 O "O3'" . DG  H 4 3  ? 38.559  -57.173 -31.384 1.00 41.94  ? 3   DG  H "O3'" 1 
ATOM 3371 C "C2'" . DG  H 4 3  ? 36.189  -57.401 -31.671 1.00 41.62  ? 3   DG  H "C2'" 1 
ATOM 3372 C "C1'" . DG  H 4 3  ? 35.954  -56.904 -33.078 1.00 42.91  ? 3   DG  H "C1'" 1 
ATOM 3373 N N9    . DG  H 4 3  ? 34.547  -56.867 -33.467 1.00 43.36  ? 3   DG  H N9    1 
ATOM 3374 C C8    . DG  H 4 3  ? 33.659  -57.907 -33.578 1.00 43.18  ? 3   DG  H C8    1 
ATOM 3375 N N7    . DG  H 4 3  ? 32.468  -57.557 -33.989 1.00 43.26  ? 3   DG  H N7    1 
ATOM 3376 C C5    . DG  H 4 3  ? 32.573  -56.190 -34.151 1.00 43.88  ? 3   DG  H C5    1 
ATOM 3377 C C6    . DG  H 4 3  ? 31.596  -55.249 -34.557 1.00 43.80  ? 3   DG  H C6    1 
ATOM 3378 O O6    . DG  H 4 3  ? 30.406  -55.463 -34.874 1.00 43.71  ? 3   DG  H O6    1 
ATOM 3379 N N1    . DG  H 4 3  ? 32.134  -53.963 -34.589 1.00 42.62  ? 3   DG  H N1    1 
ATOM 3380 C C2    . DG  H 4 3  ? 33.431  -53.647 -34.268 1.00 43.14  ? 3   DG  H C2    1 
ATOM 3381 N N2    . DG  H 4 3  ? 33.779  -52.358 -34.362 1.00 43.57  ? 3   DG  H N2    1 
ATOM 3382 N N3    . DG  H 4 3  ? 34.349  -54.516 -33.875 1.00 43.56  ? 3   DG  H N3    1 
ATOM 3383 C C4    . DG  H 4 3  ? 33.845  -55.758 -33.841 1.00 43.45  ? 3   DG  H C4    1 
ATOM 3384 P P     . DC  H 4 4  ? 38.773  -56.947 -29.806 1.00 43.32  ? 4   DC  H P     1 
ATOM 3385 O OP1   . DC  H 4 4  ? 40.205  -56.745 -29.548 1.00 42.36  ? 4   DC  H OP1   1 
ATOM 3386 O OP2   . DC  H 4 4  ? 38.065  -57.962 -29.007 1.00 43.60  ? 4   DC  H OP2   1 
ATOM 3387 O "O5'" . DC  H 4 4  ? 37.903  -55.607 -29.610 1.00 44.05  ? 4   DC  H "O5'" 1 
ATOM 3388 C "C5'" . DC  H 4 4  ? 38.126  -54.431 -30.372 1.00 42.53  ? 4   DC  H "C5'" 1 
ATOM 3389 C "C4'" . DC  H 4 4  ? 36.983  -53.458 -30.223 1.00 42.79  ? 4   DC  H "C4'" 1 
ATOM 3390 O "O4'" . DC  H 4 4  ? 35.810  -54.080 -30.763 1.00 43.98  ? 4   DC  H "O4'" 1 
ATOM 3391 C "C3'" . DC  H 4 4  ? 36.563  -53.108 -28.803 1.00 43.92  ? 4   DC  H "C3'" 1 
ATOM 3392 O "O3'" . DC  H 4 4  ? 37.217  -51.923 -28.437 1.00 44.30  ? 4   DC  H "O3'" 1 
ATOM 3393 C "C2'" . DC  H 4 4  ? 35.033  -52.946 -28.841 1.00 41.79  ? 4   DC  H "C2'" 1 
ATOM 3394 C "C1'" . DC  H 4 4  ? 34.676  -53.413 -30.240 1.00 41.88  ? 4   DC  H "C1'" 1 
ATOM 3395 N N1    . DC  H 4 4  ? 33.522  -54.330 -30.476 1.00 41.66  ? 4   DC  H N1    1 
ATOM 3396 C C2    . DC  H 4 4  ? 32.370  -53.759 -31.010 1.00 42.12  ? 4   DC  H C2    1 
ATOM 3397 O O2    . DC  H 4 4  ? 32.389  -52.548 -31.179 1.00 42.09  ? 4   DC  H O2    1 
ATOM 3398 N N3    . DC  H 4 4  ? 31.272  -54.521 -31.295 1.00 42.67  ? 4   DC  H N3    1 
ATOM 3399 C C4    . DC  H 4 4  ? 31.319  -55.847 -31.085 1.00 42.67  ? 4   DC  H C4    1 
ATOM 3400 N N4    . DC  H 4 4  ? 30.217  -56.559 -31.394 1.00 41.84  ? 4   DC  H N4    1 
ATOM 3401 C C5    . DC  H 4 4  ? 32.507  -56.469 -30.551 1.00 41.19  ? 4   DC  H C5    1 
ATOM 3402 C C6    . DC  H 4 4  ? 33.566  -55.683 -30.266 1.00 40.68  ? 4   DC  H C6    1 
ATOM 3403 P P     . DA  H 4 5  ? 37.274  -51.476 -26.915 1.00 46.93  ? 5   DA  H P     1 
ATOM 3404 O OP1   . DA  H 4 5  ? 38.600  -50.913 -26.601 1.00 47.72  ? 5   DA  H OP1   1 
ATOM 3405 O OP2   . DA  H 4 5  ? 36.755  -52.548 -26.033 1.00 46.41  ? 5   DA  H OP2   1 
ATOM 3406 O "O5'" . DA  H 4 5  ? 36.184  -50.301 -26.939 1.00 48.38  ? 5   DA  H "O5'" 1 
ATOM 3407 C "C5'" . DA  H 4 5  ? 35.926  -49.456 -28.080 1.00 46.94  ? 5   DA  H "C5'" 1 
ATOM 3408 C "C4'" . DA  H 4 5  ? 34.623  -48.670 -27.938 1.00 45.35  ? 5   DA  H "C4'" 1 
ATOM 3409 O "O4'" . DA  H 4 5  ? 33.476  -49.506 -28.249 1.00 45.63  ? 5   DA  H "O4'" 1 
ATOM 3410 C "C3'" . DA  H 4 5  ? 34.282  -48.087 -26.573 1.00 45.40  ? 5   DA  H "C3'" 1 
ATOM 3411 O "O3'" . DA  H 4 5  ? 33.588  -46.836 -26.802 1.00 46.56  ? 5   DA  H "O3'" 1 
ATOM 3412 C "C2'" . DA  H 4 5  ? 33.416  -49.191 -25.930 1.00 43.44  ? 5   DA  H "C2'" 1 
ATOM 3413 C "C1'" . DA  H 4 5  ? 32.588  -49.612 -27.139 1.00 42.50  ? 5   DA  H "C1'" 1 
ATOM 3414 N N9    . DA  H 4 5  ? 32.063  -50.972 -27.213 1.00 41.93  ? 5   DA  H N9    1 
ATOM 3415 C C8    . DA  H 4 5  ? 32.637  -52.136 -26.764 1.00 41.50  ? 5   DA  H C8    1 
ATOM 3416 N N7    . DA  H 4 5  ? 31.910  -53.205 -27.022 1.00 40.53  ? 5   DA  H N7    1 
ATOM 3417 C C5    . DA  H 4 5  ? 30.791  -52.707 -27.674 1.00 41.23  ? 5   DA  H C5    1 
ATOM 3418 C C6    . DA  H 4 5  ? 29.623  -53.309 -28.212 1.00 42.26  ? 5   DA  H C6    1 
ATOM 3419 N N6    . DA  H 4 5  ? 29.396  -54.613 -28.167 1.00 42.25  ? 5   DA  H N6    1 
ATOM 3420 N N1    . DA  H 4 5  ? 28.674  -52.538 -28.790 1.00 42.07  ? 5   DA  H N1    1 
ATOM 3421 C C2    . DA  H 4 5  ? 28.906  -51.221 -28.841 1.00 41.67  ? 5   DA  H C2    1 
ATOM 3422 N N3    . DA  H 4 5  ? 29.968  -50.551 -28.378 1.00 41.64  ? 5   DA  H N3    1 
ATOM 3423 C C4    . DA  H 4 5  ? 30.878  -51.342 -27.803 1.00 40.51  ? 5   DA  H C4    1 
ATOM 3424 P P     . DA  H 4 6  ? 33.163  -45.896 -25.560 1.00 49.74  ? 6   DA  H P     1 
ATOM 3425 O OP1   . DA  H 4 6  ? 33.255  -44.494 -26.035 1.00 52.28  ? 6   DA  H OP1   1 
ATOM 3426 O OP2   . DA  H 4 6  ? 33.888  -46.285 -24.322 1.00 50.39  ? 6   DA  H OP2   1 
ATOM 3427 O "O5'" . DA  H 4 6  ? 31.642  -46.245 -25.274 1.00 48.47  ? 6   DA  H "O5'" 1 
ATOM 3428 C "C5'" . DA  H 4 6  ? 30.726  -46.517 -26.333 1.00 48.57  ? 6   DA  H "C5'" 1 
ATOM 3429 C "C4'" . DA  H 4 6  ? 29.363  -46.838 -25.719 1.00 48.62  ? 6   DA  H "C4'" 1 
ATOM 3430 O "O4'" . DA  H 4 6  ? 29.051  -48.262 -25.761 1.00 48.28  ? 6   DA  H "O4'" 1 
ATOM 3431 C "C3'" . DA  H 4 6  ? 29.179  -46.470 -24.246 1.00 48.05  ? 6   DA  H "C3'" 1 
ATOM 3432 O "O3'" . DA  H 4 6  ? 27.810  -46.055 -24.144 1.00 48.36  ? 6   DA  H "O3'" 1 
ATOM 3433 C "C2'" . DA  H 4 6  ? 29.536  -47.762 -23.496 1.00 44.89  ? 6   DA  H "C2'" 1 
ATOM 3434 C "C1'" . DA  H 4 6  ? 28.871  -48.762 -24.441 1.00 44.51  ? 6   DA  H "C1'" 1 
ATOM 3435 N N9    . DA  H 4 6  ? 29.306  -50.165 -24.398 1.00 43.89  ? 6   DA  H N9    1 
ATOM 3436 C C8    . DA  H 4 6  ? 30.490  -50.665 -23.918 1.00 43.22  ? 6   DA  H C8    1 
ATOM 3437 N N7    . DA  H 4 6  ? 30.561  -51.967 -24.024 1.00 42.90  ? 6   DA  H N7    1 
ATOM 3438 C C5    . DA  H 4 6  ? 29.348  -52.334 -24.605 1.00 42.45  ? 6   DA  H C5    1 
ATOM 3439 C C6    . DA  H 4 6  ? 28.791  -53.582 -24.983 1.00 42.55  ? 6   DA  H C6    1 
ATOM 3440 N N6    . DA  H 4 6  ? 29.436  -54.722 -24.811 1.00 42.12  ? 6   DA  H N6    1 
ATOM 3441 N N1    . DA  H 4 6  ? 27.558  -53.623 -25.542 1.00 43.13  ? 6   DA  H N1    1 
ATOM 3442 C C2    . DA  H 4 6  ? 26.912  -52.458 -25.706 1.00 43.29  ? 6   DA  H C2    1 
ATOM 3443 N N3    . DA  H 4 6  ? 27.343  -51.230 -25.383 1.00 42.71  ? 6   DA  H N3    1 
ATOM 3444 C C4    . DA  H 4 6  ? 28.569  -51.236 -24.841 1.00 41.68  ? 6   DA  H C4    1 
ATOM 3445 P P     . DT  H 4 7  ? 27.289  -45.199 -22.909 1.00 48.64  ? 7   DT  H P     1 
ATOM 3446 O OP1   . DT  H 4 7  ? 26.266  -44.303 -23.490 1.00 48.88  ? 7   DT  H OP1   1 
ATOM 3447 O OP2   . DT  H 4 7  ? 28.436  -44.735 -22.064 1.00 48.60  ? 7   DT  H OP2   1 
ATOM 3448 O "O5'" . DT  H 4 7  ? 26.626  -46.289 -21.971 1.00 47.18  ? 7   DT  H "O5'" 1 
ATOM 3449 C "C5'" . DT  H 4 7  ? 25.308  -46.600 -22.102 1.00 44.86  ? 7   DT  H "C5'" 1 
ATOM 3450 C "C4'" . DT  H 4 7  ? 25.087  -48.087 -21.980 1.00 44.74  ? 7   DT  H "C4'" 1 
ATOM 3451 O "O4'" . DT  H 4 7  ? 26.235  -48.897 -22.309 1.00 43.30  ? 7   DT  H "O4'" 1 
ATOM 3452 C "C3'" . DT  H 4 7  ? 24.770  -48.673 -20.621 1.00 45.15  ? 7   DT  H "C3'" 1 
ATOM 3453 O "O3'" . DT  H 4 7  ? 23.551  -48.119 -20.057 1.00 44.13  ? 7   DT  H "O3'" 1 
ATOM 3454 C "C2'" . DT  H 4 7  ? 24.598  -50.100 -21.153 1.00 44.78  ? 7   DT  H "C2'" 1 
ATOM 3455 C "C1'" . DT  H 4 7  ? 25.645  -50.182 -22.274 1.00 42.67  ? 7   DT  H "C1'" 1 
ATOM 3456 N N1    . DT  H 4 7  ? 26.632  -51.301 -22.034 1.00 41.76  ? 7   DT  H N1    1 
ATOM 3457 C C2    . DT  H 4 7  ? 26.257  -52.567 -22.398 1.00 40.77  ? 7   DT  H C2    1 
ATOM 3458 O O2    . DT  H 4 7  ? 25.181  -52.789 -22.917 1.00 40.92  ? 7   DT  H O2    1 
ATOM 3459 N N3    . DT  H 4 7  ? 27.185  -53.550 -22.146 1.00 40.65  ? 7   DT  H N3    1 
ATOM 3460 C C4    . DT  H 4 7  ? 28.420  -53.354 -21.569 1.00 41.45  ? 7   DT  H C4    1 
ATOM 3461 O O4    . DT  H 4 7  ? 29.183  -54.276 -21.363 1.00 41.30  ? 7   DT  H O4    1 
ATOM 3462 C C5    . DT  H 4 7  ? 28.757  -51.996 -21.201 1.00 40.91  ? 7   DT  H C5    1 
ATOM 3463 C C7    . DT  H 4 7  ? 30.064  -51.671 -20.549 1.00 39.87  ? 7   DT  H C7    1 
ATOM 3464 C C6    . DT  H 4 7  ? 27.854  -51.048 -21.447 1.00 41.45  ? 7   DT  H C6    1 
ATOM 3465 P P     . DT  H 4 8  ? 23.076  -48.448 -18.556 1.00 42.04  ? 8   DT  H P     1 
ATOM 3466 O OP1   . DT  H 4 8  ? 22.177  -47.315 -18.262 1.00 43.23  ? 8   DT  H OP1   1 
ATOM 3467 O OP2   . DT  H 4 8  ? 24.215  -48.755 -17.670 1.00 37.70  ? 8   DT  H OP2   1 
ATOM 3468 O "O5'" . DT  H 4 8  ? 22.180  -49.735 -18.772 1.00 41.69  ? 8   DT  H "O5'" 1 
ATOM 3469 C "C5'" . DT  H 4 8  ? 21.299  -49.735 -19.867 1.00 43.96  ? 8   DT  H "C5'" 1 
ATOM 3470 C "C4'" . DT  H 4 8  ? 20.598  -51.078 -19.944 1.00 48.42  ? 8   DT  H "C4'" 1 
ATOM 3471 O "O4'" . DT  H 4 8  ? 21.525  -52.095 -20.400 1.00 48.48  ? 8   DT  H "O4'" 1 
ATOM 3472 C "C3'" . DT  H 4 8  ? 20.068  -51.559 -18.597 1.00 49.82  ? 8   DT  H "C3'" 1 
ATOM 3473 O "O3'" . DT  H 4 8  ? 18.732  -51.975 -18.648 1.00 54.57  ? 8   DT  H "O3'" 1 
ATOM 3474 C "C2'" . DT  H 4 8  ? 20.907  -52.750 -18.198 1.00 48.13  ? 8   DT  H "C2'" 1 
ATOM 3475 C "C1'" . DT  H 4 8  ? 21.574  -53.163 -19.481 1.00 45.29  ? 8   DT  H "C1'" 1 
ATOM 3476 N N1    . DT  H 4 8  ? 22.993  -53.484 -19.248 1.00 45.10  ? 8   DT  H N1    1 
ATOM 3477 C C2    . DT  H 4 8  ? 23.347  -54.754 -19.629 1.00 43.36  ? 8   DT  H C2    1 
ATOM 3478 O O2    . DT  H 4 8  ? 22.532  -55.512 -20.106 1.00 43.16  ? 8   DT  H O2    1 
ATOM 3479 N N3    . DT  H 4 8  ? 24.660  -55.081 -19.436 1.00 41.67  ? 8   DT  H N3    1 
ATOM 3480 C C4    . DT  H 4 8  ? 25.628  -54.269 -18.905 1.00 42.17  ? 8   DT  H C4    1 
ATOM 3481 O O4    . DT  H 4 8  ? 26.778  -54.668 -18.786 1.00 42.99  ? 8   DT  H O4    1 
ATOM 3482 C C5    . DT  H 4 8  ? 25.197  -52.942 -18.515 1.00 42.66  ? 8   DT  H C5    1 
ATOM 3483 C C7    . DT  H 4 8  ? 26.208  -52.006 -17.938 1.00 43.22  ? 8   DT  H C7    1 
ATOM 3484 C C6    . DT  H 4 8  ? 23.908  -52.588 -18.694 1.00 42.71  ? 8   DT  H C6    1 
ATOM 3485 P P     . DA  H 4 9  ? 17.934  -51.927 -17.250 1.00 58.85  ? 9   DA  H P     1 
ATOM 3486 O OP1   . DA  H 4 9  ? 16.637  -51.308 -17.607 1.00 58.27  ? 9   DA  H OP1   1 
ATOM 3487 O OP2   . DA  H 4 9  ? 18.771  -51.427 -16.108 1.00 54.26  ? 9   DA  H OP2   1 
ATOM 3488 O "O5'" . DA  H 4 9  ? 17.687  -53.478 -17.021 1.00 57.92  ? 9   DA  H "O5'" 1 
ATOM 3489 C "C5'" . DA  H 4 9  ? 17.255  -54.258 -18.106 1.00 59.01  ? 9   DA  H "C5'" 1 
ATOM 3490 C "C4'" . DA  H 4 9  ? 17.500  -55.661 -17.625 1.00 60.14  ? 9   DA  H "C4'" 1 
ATOM 3491 O "O4'" . DA  H 4 9  ? 18.931  -55.831 -17.576 1.00 59.65  ? 9   DA  H "O4'" 1 
ATOM 3492 C "C3'" . DA  H 4 9  ? 16.974  -55.846 -16.206 1.00 61.10  ? 9   DA  H "C3'" 1 
ATOM 3493 O "O3'" . DA  H 4 9  ? 15.984  -56.881 -16.219 1.00 64.30  ? 9   DA  H "O3'" 1 
ATOM 3494 C "C2'" . DA  H 4 9  ? 18.213  -56.075 -15.330 1.00 59.78  ? 9   DA  H "C2'" 1 
ATOM 3495 C "C1'" . DA  H 4 9  ? 19.299  -56.394 -16.338 1.00 57.00  ? 9   DA  H "C1'" 1 
ATOM 3496 N N9    . DA  H 4 9  ? 20.603  -55.839 -16.043 1.00 55.78  ? 9   DA  H N9    1 
ATOM 3497 C C8    . DA  H 4 9  ? 20.947  -54.570 -15.665 1.00 55.36  ? 9   DA  H C8    1 
ATOM 3498 N N7    . DA  H 4 9  ? 22.249  -54.399 -15.500 1.00 54.90  ? 9   DA  H N7    1 
ATOM 3499 C C5    . DA  H 4 9  ? 22.780  -55.657 -15.790 1.00 55.80  ? 9   DA  H C5    1 
ATOM 3500 C C6    . DA  H 4 9  ? 24.096  -56.187 -15.810 1.00 55.25  ? 9   DA  H C6    1 
ATOM 3501 N N6    . DA  H 4 9  ? 25.194  -55.490 -15.518 1.00 54.66  ? 9   DA  H N6    1 
ATOM 3502 N N1    . DA  H 4 9  ? 24.246  -57.484 -16.147 1.00 55.27  ? 9   DA  H N1    1 
ATOM 3503 C C2    . DA  H 4 9  ? 23.164  -58.207 -16.451 1.00 55.30  ? 9   DA  H C2    1 
ATOM 3504 N N3    . DA  H 4 9  ? 21.889  -57.838 -16.478 1.00 53.96  ? 9   DA  H N3    1 
ATOM 3505 C C4    . DA  H 4 9  ? 21.769  -56.547 -16.135 1.00 55.54  ? 9   DA  H C4    1 
ATOM 3506 P P     . DA  H 4 10 ? 15.771  -58.000 -15.077 1.00 68.77  ? 10  DA  H P     1 
ATOM 3507 O OP1   . DA  H 4 10 ? 14.395  -58.534 -15.294 1.00 67.68  ? 10  DA  H OP1   1 
ATOM 3508 O OP2   . DA  H 4 10 ? 16.143  -57.464 -13.737 1.00 67.75  ? 10  DA  H OP2   1 
ATOM 3509 O "O5'" . DA  H 4 10 ? 16.858  -59.123 -15.475 1.00 65.44  ? 10  DA  H "O5'" 1 
ATOM 3510 C "C5'" . DA  H 4 10 ? 16.946  -60.317 -14.746 1.00 61.95  ? 10  DA  H "C5'" 1 
ATOM 3511 C "C4'" . DA  H 4 10 ? 18.216  -60.368 -13.933 1.00 60.91  ? 10  DA  H "C4'" 1 
ATOM 3512 O "O4'" . DA  H 4 10 ? 19.049  -59.195 -14.100 1.00 59.67  ? 10  DA  H "O4'" 1 
ATOM 3513 C "C3'" . DA  H 4 10 ? 17.999  -60.461 -12.432 1.00 62.02  ? 10  DA  H "C3'" 1 
ATOM 3514 O "O3'" . DA  H 4 10 ? 18.346  -61.780 -12.079 1.00 66.35  ? 10  DA  H "O3'" 1 
ATOM 3515 C "C2'" . DA  H 4 10 ? 19.016  -59.479 -11.858 1.00 59.67  ? 10  DA  H "C2'" 1 
ATOM 3516 C "C1'" . DA  H 4 10 ? 19.968  -59.300 -13.032 1.00 57.17  ? 10  DA  H "C1'" 1 
ATOM 3517 N N9    . DA  H 4 10 ? 20.858  -58.142 -12.859 1.00 56.61  ? 10  DA  H N9    1 
ATOM 3518 C C8    . DA  H 4 10 ? 20.500  -56.839 -12.619 1.00 55.62  ? 10  DA  H C8    1 
ATOM 3519 N N7    . DA  H 4 10 ? 21.513  -56.015 -12.481 1.00 55.48  ? 10  DA  H N7    1 
ATOM 3520 C C5    . DA  H 4 10 ? 22.626  -56.823 -12.637 1.00 55.82  ? 10  DA  H C5    1 
ATOM 3521 C C6    . DA  H 4 10 ? 24.021  -56.558 -12.605 1.00 56.15  ? 10  DA  H C6    1 
ATOM 3522 N N6    . DA  H 4 10 ? 24.543  -55.350 -12.395 1.00 54.94  ? 10  DA  H N6    1 
ATOM 3523 N N1    . DA  H 4 10 ? 24.871  -57.598 -12.804 1.00 55.93  ? 10  DA  H N1    1 
ATOM 3524 C C2    . DA  H 4 10 ? 24.336  -58.810 -13.020 1.00 55.58  ? 10  DA  H C2    1 
ATOM 3525 N N3    . DA  H 4 10 ? 23.052  -59.177 -13.069 1.00 54.36  ? 10  DA  H N3    1 
ATOM 3526 C C4    . DA  H 4 10 ? 22.238  -58.137 -12.870 1.00 55.44  ? 10  DA  H C4    1 
ATOM 3527 P P     . DT  H 4 11 ? 18.077  -62.443 -10.637 1.00 68.74  ? 11  DT  H P     1 
ATOM 3528 O OP1   . DT  H 4 11 ? 16.647  -62.806 -10.646 1.00 68.16  ? 11  DT  H OP1   1 
ATOM 3529 O OP2   . DT  H 4 11 ? 18.643  -61.665 -9.505  1.00 67.00  ? 11  DT  H OP2   1 
ATOM 3530 O "O5'" . DT  H 4 11 ? 18.973  -63.771 -10.799 1.00 70.02  ? 11  DT  H "O5'" 1 
ATOM 3531 C "C5'" . DT  H 4 11 ? 20.138  -63.742 -11.640 1.00 71.07  ? 11  DT  H "C5'" 1 
ATOM 3532 C "C4'" . DT  H 4 11 ? 21.322  -63.091 -10.938 1.00 71.40  ? 11  DT  H "C4'" 1 
ATOM 3533 O "O4'" . DT  H 4 11 ? 21.263  -61.633 -10.970 1.00 70.12  ? 11  DT  H "O4'" 1 
ATOM 3534 C "C3'" . DT  H 4 11 ? 21.509  -63.441 -9.453  1.00 72.78  ? 11  DT  H "C3'" 1 
ATOM 3535 O "O3'" . DT  H 4 11 ? 22.811  -64.017 -9.251  1.00 75.65  ? 11  DT  H "O3'" 1 
ATOM 3536 C "C2'" . DT  H 4 11 ? 21.436  -62.080 -8.761  1.00 71.29  ? 11  DT  H "C2'" 1 
ATOM 3537 C "C1'" . DT  H 4 11 ? 22.109  -61.313 -9.888  1.00 68.33  ? 11  DT  H "C1'" 1 
ATOM 3538 N N1    . DT  H 4 11 ? 22.416  -59.873 -9.664  1.00 66.32  ? 11  DT  H N1    1 
ATOM 3539 C C2    . DT  H 4 11 ? 23.753  -59.557 -9.637  1.00 66.54  ? 11  DT  H C2    1 
ATOM 3540 O O2    . DT  H 4 11 ? 24.622  -60.390 -9.803  1.00 67.40  ? 11  DT  H O2    1 
ATOM 3541 N N3    . DT  H 4 11 ? 24.056  -58.242 -9.418  1.00 65.48  ? 11  DT  H N3    1 
ATOM 3542 C C4    . DT  H 4 11 ? 23.136  -57.235 -9.228  1.00 66.49  ? 11  DT  H C4    1 
ATOM 3543 O O4    . DT  H 4 11 ? 23.510  -56.090 -9.044  1.00 66.66  ? 11  DT  H O4    1 
ATOM 3544 C C5    . DT  H 4 11 ? 21.736  -57.623 -9.254  1.00 66.80  ? 11  DT  H C5    1 
ATOM 3545 C C7    . DT  H 4 11 ? 20.646  -56.602 -9.047  1.00 66.84  ? 11  DT  H C7    1 
ATOM 3546 C C6    . DT  H 4 11 ? 21.445  -58.918 -9.468  1.00 66.23  ? 11  DT  H C6    1 
ATOM 3547 P P     . DT  H 4 12 ? 23.053  -65.019 -8.023  1.00 76.99  ? 12  DT  H P     1 
ATOM 3548 O OP1   . DT  H 4 12 ? 22.267  -66.241 -8.374  1.00 75.58  ? 12  DT  H OP1   1 
ATOM 3549 O OP2   . DT  H 4 12 ? 22.813  -64.272 -6.756  1.00 76.79  ? 12  DT  H OP2   1 
ATOM 3550 O "O5'" . DT  H 4 12 ? 24.624  -65.326 -8.035  1.00 74.15  ? 12  DT  H "O5'" 1 
ATOM 3551 C "C5'" . DT  H 4 12 ? 25.490  -64.453 -8.698  1.00 72.46  ? 12  DT  H "C5'" 1 
ATOM 3552 C "C4'" . DT  H 4 12 ? 26.663  -64.016 -7.841  1.00 71.32  ? 12  DT  H "C4'" 1 
ATOM 3553 O "O4'" . DT  H 4 12 ? 26.576  -62.575 -7.687  1.00 70.77  ? 12  DT  H "O4'" 1 
ATOM 3554 C "C3'" . DT  H 4 12 ? 26.797  -64.519 -6.412  1.00 71.71  ? 12  DT  H "C3'" 1 
ATOM 3555 O "O3'" . DT  H 4 12 ? 28.191  -64.351 -6.048  1.00 73.80  ? 12  DT  H "O3'" 1 
ATOM 3556 C "C2'" . DT  H 4 12 ? 25.919  -63.499 -5.678  1.00 70.49  ? 12  DT  H "C2'" 1 
ATOM 3557 C "C1'" . DT  H 4 12 ? 26.517  -62.233 -6.306  1.00 66.96  ? 12  DT  H "C1'" 1 
ATOM 3558 N N1    . DT  H 4 12 ? 25.816  -60.886 -6.210  1.00 64.70  ? 12  DT  H N1    1 
ATOM 3559 C C2    . DT  H 4 12 ? 26.605  -59.744 -6.210  1.00 63.29  ? 12  DT  H C2    1 
ATOM 3560 O O2    . DT  H 4 12 ? 27.823  -59.741 -6.254  1.00 62.66  ? 12  DT  H O2    1 
ATOM 3561 N N3    . DT  H 4 12 ? 25.907  -58.569 -6.141  1.00 62.76  ? 12  DT  H N3    1 
ATOM 3562 C C4    . DT  H 4 12 ? 24.534  -58.409 -6.084  1.00 64.09  ? 12  DT  H C4    1 
ATOM 3563 O O4    . DT  H 4 12 ? 24.034  -57.286 -6.028  1.00 64.04  ? 12  DT  H O4    1 
ATOM 3564 C C5    . DT  H 4 12 ? 23.759  -59.639 -6.089  1.00 63.12  ? 12  DT  H C5    1 
ATOM 3565 C C7    . DT  H 4 12 ? 22.257  -59.603 -6.028  1.00 63.34  ? 12  DT  H C7    1 
ATOM 3566 C C6    . DT  H 4 12 ? 24.431  -60.801 -6.159  1.00 63.23  ? 12  DT  H C6    1 
ATOM 3567 P P     . DA  H 4 13 ? 28.986  -65.361 -5.085  1.00 75.57  ? 13  DA  H P     1 
ATOM 3568 O OP1   . DA  H 4 13 ? 30.290  -65.719 -5.704  1.00 75.22  ? 13  DA  H OP1   1 
ATOM 3569 O OP2   . DA  H 4 13 ? 27.981  -66.410 -4.757  1.00 75.21  ? 13  DA  H OP2   1 
ATOM 3570 O "O5'" . DA  H 4 13 ? 29.384  -64.527 -3.776  1.00 73.35  ? 13  DA  H "O5'" 1 
ATOM 3571 C "C5'" . DA  H 4 13 ? 30.732  -64.090 -3.670  1.00 70.51  ? 13  DA  H "C5'" 1 
ATOM 3572 C "C4'" . DA  H 4 13 ? 30.797  -62.599 -3.402  1.00 69.09  ? 13  DA  H "C4'" 1 
ATOM 3573 O "O4'" . DA  H 4 13 ? 29.552  -61.892 -3.671  1.00 67.55  ? 13  DA  H "O4'" 1 
ATOM 3574 C "C3'" . DA  H 4 13 ? 31.128  -62.311 -1.951  1.00 68.58  ? 13  DA  H "C3'" 1 
ATOM 3575 O "O3'" . DA  H 4 13 ? 32.336  -61.602 -1.995  1.00 69.87  ? 13  DA  H "O3'" 1 
ATOM 3576 C "C2'" . DA  H 4 13 ? 29.949  -61.500 -1.390  1.00 66.77  ? 13  DA  H "C2'" 1 
ATOM 3577 C "C1'" . DA  H 4 13 ? 29.331  -60.918 -2.651  1.00 64.88  ? 13  DA  H "C1'" 1 
ATOM 3578 N N9    . DA  H 4 13 ? 27.897  -60.564 -2.626  1.00 64.27  ? 13  DA  H N9    1 
ATOM 3579 C C8    . DA  H 4 13 ? 26.816  -61.418 -2.701  1.00 63.94  ? 13  DA  H C8    1 
ATOM 3580 N N7    . DA  H 4 13 ? 25.637  -60.829 -2.702  1.00 62.73  ? 13  DA  H N7    1 
ATOM 3581 C C5    . DA  H 4 13 ? 25.961  -59.487 -2.634  1.00 62.50  ? 13  DA  H C5    1 
ATOM 3582 C C6    . DA  H 4 13 ? 25.157  -58.330 -2.602  1.00 62.86  ? 13  DA  H C6    1 
ATOM 3583 N N6    . DA  H 4 13 ? 23.823  -58.370 -2.636  1.00 63.21  ? 13  DA  H N6    1 
ATOM 3584 N N1    . DA  H 4 13 ? 25.779  -57.133 -2.534  1.00 63.28  ? 13  DA  H N1    1 
ATOM 3585 C C2    . DA  H 4 13 ? 27.124  -57.102 -2.512  1.00 63.03  ? 13  DA  H C2    1 
ATOM 3586 N N3    . DA  H 4 13 ? 27.990  -58.119 -2.538  1.00 62.57  ? 13  DA  H N3    1 
ATOM 3587 C C4    . DA  H 4 13 ? 27.341  -59.300 -2.595  1.00 63.16  ? 13  DA  H C4    1 
ATOM 3588 P P     . DA  H 4 14 ? 33.208  -61.437 -0.668  1.00 71.67  ? 14  DA  H P     1 
ATOM 3589 O OP1   . DA  H 4 14 ? 34.630  -61.765 -0.989  1.00 70.23  ? 14  DA  H OP1   1 
ATOM 3590 O OP2   . DA  H 4 14 ? 32.481  -62.136 0.421   1.00 71.97  ? 14  DA  H OP2   1 
ATOM 3591 O "O5'" . DA  H 4 14 ? 33.075  -59.876 -0.367  1.00 69.59  ? 14  DA  H "O5'" 1 
ATOM 3592 C "C5'" . DA  H 4 14 ? 33.734  -58.971 -1.222  1.00 67.58  ? 14  DA  H "C5'" 1 
ATOM 3593 C "C4'" . DA  H 4 14 ? 33.987  -57.661 -0.520  1.00 66.49  ? 14  DA  H "C4'" 1 
ATOM 3594 O "O4'" . DA  H 4 14 ? 32.721  -56.987 -0.325  1.00 65.60  ? 14  DA  H "O4'" 1 
ATOM 3595 C "C3'" . DA  H 4 14 ? 34.628  -57.661 0.855   1.00 66.49  ? 14  DA  H "C3'" 1 
ATOM 3596 O "O3'" . DA  H 4 14 ? 35.298  -56.419 0.892   1.00 69.57  ? 14  DA  H "O3'" 1 
ATOM 3597 C "C2'" . DA  H 4 14 ? 33.426  -57.714 1.807   1.00 65.00  ? 14  DA  H "C2'" 1 
ATOM 3598 C "C1'" . DA  H 4 14 ? 32.302  -57.013 1.033   1.00 61.60  ? 14  DA  H "C1'" 1 
ATOM 3599 N N9    . DA  H 4 14 ? 30.942  -57.583 0.958   1.00 60.15  ? 14  DA  H N9    1 
ATOM 3600 C C8    . DA  H 4 14 ? 30.549  -58.896 0.901   1.00 59.63  ? 14  DA  H C8    1 
ATOM 3601 N N7    . DA  H 4 14 ? 29.244  -59.070 0.794   1.00 59.53  ? 14  DA  H N7    1 
ATOM 3602 C C5    . DA  H 4 14 ? 28.738  -57.778 0.760   1.00 59.00  ? 14  DA  H C5    1 
ATOM 3603 C C6    . DA  H 4 14 ? 27.425  -57.249 0.657   1.00 58.80  ? 14  DA  H C6    1 
ATOM 3604 N N6    . DA  H 4 14 ? 26.336  -58.000 0.559   1.00 59.40  ? 14  DA  H N6    1 
ATOM 3605 N N1    . DA  H 4 14 ? 27.254  -55.910 0.645   1.00 59.06  ? 14  DA  H N1    1 
ATOM 3606 C C2    . DA  H 4 14 ? 28.345  -55.133 0.736   1.00 59.66  ? 14  DA  H C2    1 
ATOM 3607 N N3    . DA  H 4 14 ? 29.632  -55.503 0.842   1.00 59.45  ? 14  DA  H N3    1 
ATOM 3608 C C4    . DA  H 4 14 ? 29.770  -56.852 0.847   1.00 59.60  ? 14  DA  H C4    1 
ATOM 3609 P P     . DG  H 4 15 ? 36.263  -55.970 2.088   1.00 73.72  ? 15  DG  H P     1 
ATOM 3610 O OP1   . DG  H 4 15 ? 37.255  -54.974 1.591   1.00 72.51  ? 15  DG  H OP1   1 
ATOM 3611 O OP2   . DG  H 4 15 ? 36.742  -57.214 2.733   1.00 74.13  ? 15  DG  H OP2   1 
ATOM 3612 O "O5'" . DG  H 4 15 ? 35.271  -55.212 3.092   1.00 73.46  ? 15  DG  H "O5'" 1 
ATOM 3613 C "C5'" . DG  H 4 15 ? 34.596  -54.002 2.682   1.00 74.12  ? 15  DG  H "C5'" 1 
ATOM 3614 C "C4'" . DG  H 4 15 ? 33.602  -53.537 3.738   1.00 73.40  ? 15  DG  H "C4'" 1 
ATOM 3615 O "O4'" . DG  H 4 15 ? 32.292  -54.160 3.544   1.00 71.59  ? 15  DG  H "O4'" 1 
ATOM 3616 C "C3'" . DG  H 4 15 ? 34.028  -53.886 5.165   1.00 74.22  ? 15  DG  H "C3'" 1 
ATOM 3617 O "O3'" . DG  H 4 15 ? 33.574  -52.858 6.036   1.00 77.95  ? 15  DG  H "O3'" 1 
ATOM 3618 C "C2'" . DG  H 4 15 ? 33.314  -55.215 5.414   1.00 71.86  ? 15  DG  H "C2'" 1 
ATOM 3619 C "C1'" . DG  H 4 15 ? 31.982  -54.878 4.731   1.00 67.05  ? 15  DG  H "C1'" 1 
ATOM 3620 N N9    . DG  H 4 15 ? 31.119  -56.030 4.498   1.00 65.37  ? 15  DG  H N9    1 
ATOM 3621 C C8    . DG  H 4 15 ? 31.466  -57.356 4.416   1.00 64.61  ? 15  DG  H C8    1 
ATOM 3622 N N7    . DG  H 4 15 ? 30.441  -58.145 4.220   1.00 64.37  ? 15  DG  H N7    1 
ATOM 3623 C C5    . DG  H 4 15 ? 29.346  -57.291 4.189   1.00 63.81  ? 15  DG  H C5    1 
ATOM 3624 C C6    . DG  H 4 15 ? 27.964  -57.573 4.013   1.00 64.50  ? 15  DG  H C6    1 
ATOM 3625 O O6    . DG  H 4 15 ? 27.408  -58.685 3.845   1.00 64.87  ? 15  DG  H O6    1 
ATOM 3626 N N1    . DG  H 4 15 ? 27.203  -56.397 4.043   1.00 64.46  ? 15  DG  H N1    1 
ATOM 3627 C C2    . DG  H 4 15 ? 27.712  -55.120 4.225   1.00 64.70  ? 15  DG  H C2    1 
ATOM 3628 N N2    . DG  H 4 15 ? 26.831  -54.110 4.235   1.00 64.61  ? 15  DG  H N2    1 
ATOM 3629 N N3    . DG  H 4 15 ? 29.004  -54.848 4.392   1.00 64.20  ? 15  DG  H N3    1 
ATOM 3630 C C4    . DG  H 4 15 ? 29.754  -55.982 4.359   1.00 64.56  ? 15  DG  H C4    1 
ATOM 3631 P P     . DC  H 4 16 ? 34.551  -51.648 6.427   1.00 80.84  ? 16  DC  H P     1 
ATOM 3632 O OP1   . DC  H 4 16 ? 35.212  -51.125 5.192   1.00 80.81  ? 16  DC  H OP1   1 
ATOM 3633 O OP2   . DC  H 4 16 ? 35.364  -52.158 7.570   1.00 79.52  ? 16  DC  H OP2   1 
ATOM 3634 O "O5'" . DC  H 4 16 ? 33.524  -50.518 6.939   1.00 79.39  ? 16  DC  H "O5'" 1 
ATOM 3635 C "C5'" . DC  H 4 16 ? 32.741  -49.706 6.037   1.00 77.00  ? 16  DC  H "C5'" 1 
ATOM 3636 C "C4'" . DC  H 4 16 ? 31.372  -49.361 6.634   1.00 75.60  ? 16  DC  H "C4'" 1 
ATOM 3637 O "O4'" . DC  H 4 16 ? 30.455  -50.487 6.546   1.00 75.05  ? 16  DC  H "O4'" 1 
ATOM 3638 C "C3'" . DC  H 4 16 ? 31.297  -48.949 8.104   1.00 74.54  ? 16  DC  H "C3'" 1 
ATOM 3639 O "O3'" . DC  H 4 16 ? 30.147  -48.142 8.248   1.00 73.97  ? 16  DC  H "O3'" 1 
ATOM 3640 C "C2'" . DC  H 4 16 ? 31.086  -50.282 8.816   1.00 74.29  ? 16  DC  H "C2'" 1 
ATOM 3641 C "C1'" . DC  H 4 16 ? 30.125  -50.964 7.841   1.00 73.62  ? 16  DC  H "C1'" 1 
ATOM 3642 N N1    . DC  H 4 16 ? 30.117  -52.479 7.802   1.00 73.10  ? 16  DC  H N1    1 
ATOM 3643 C C2    . DC  H 4 16 ? 28.888  -53.115 7.543   1.00 73.52  ? 16  DC  H C2    1 
ATOM 3644 O O2    . DC  H 4 16 ? 27.880  -52.397 7.376   1.00 73.65  ? 16  DC  H O2    1 
ATOM 3645 N N3    . DC  H 4 16 ? 28.833  -54.483 7.490   1.00 72.62  ? 16  DC  H N3    1 
ATOM 3646 C C4    . DC  H 4 16 ? 29.943  -55.208 7.687   1.00 73.03  ? 16  DC  H C4    1 
ATOM 3647 N N4    . DC  H 4 16 ? 29.839  -56.547 7.635   1.00 72.73  ? 16  DC  H N4    1 
ATOM 3648 C C5    . DC  H 4 16 ? 31.204  -54.575 7.952   1.00 72.43  ? 16  DC  H C5    1 
ATOM 3649 C C6    . DC  H 4 16 ? 31.247  -53.230 7.989   1.00 72.27  ? 16  DC  H C6    1 
ATOM 3650 P P     . DC  H 4 17 ? 30.073  -46.945 9.305   1.00 73.64  ? 17  DC  H P     1 
ATOM 3651 O OP1   . DC  H 4 17 ? 29.744  -45.693 8.575   1.00 73.26  ? 17  DC  H OP1   1 
ATOM 3652 O OP2   . DC  H 4 17 ? 31.316  -47.057 10.111  1.00 73.07  ? 17  DC  H OP2   1 
ATOM 3653 O "O5'" . DC  H 4 17 ? 28.790  -47.331 10.209  1.00 72.18  ? 17  DC  H "O5'" 1 
ATOM 3654 C "C5'" . DC  H 4 17 ? 27.454  -47.383 9.665   1.00 69.02  ? 17  DC  H "C5'" 1 
ATOM 3655 C "C4'" . DC  H 4 17 ? 26.635  -48.539 10.231  1.00 67.72  ? 17  DC  H "C4'" 1 
ATOM 3656 O "O4'" . DC  H 4 17 ? 27.293  -49.821 10.021  1.00 67.16  ? 17  DC  H "O4'" 1 
ATOM 3657 C "C3'" . DC  H 4 17 ? 26.372  -48.537 11.737  1.00 66.96  ? 17  DC  H "C3'" 1 
ATOM 3658 O "O3'" . DC  H 4 17 ? 25.115  -47.894 12.020  1.00 67.13  ? 17  DC  H "O3'" 1 
ATOM 3659 C "C2'" . DC  H 4 17 ? 26.382  -50.029 12.132  1.00 65.36  ? 17  DC  H "C2'" 1 
ATOM 3660 C "C1'" . DC  H 4 17 ? 26.591  -50.764 10.811  1.00 62.81  ? 17  DC  H "C1'" 1 
ATOM 3661 N N1    . DC  H 4 17 ? 27.348  -52.070 10.835  1.00 60.71  ? 17  DC  H N1    1 
ATOM 3662 C C2    . DC  H 4 17 ? 26.658  -53.282 10.749  1.00 59.99  ? 17  DC  H C2    1 
ATOM 3663 O O2    . DC  H 4 17 ? 25.431  -53.261 10.678  1.00 60.23  ? 17  DC  H O2    1 
ATOM 3664 N N3    . DC  H 4 17 ? 27.341  -54.463 10.754  1.00 59.54  ? 17  DC  H N3    1 
ATOM 3665 C C4    . DC  H 4 17 ? 28.676  -54.455 10.839  1.00 60.78  ? 17  DC  H C4    1 
ATOM 3666 N N4    . DC  H 4 17 ? 29.310  -55.632 10.843  1.00 60.90  ? 17  DC  H N4    1 
ATOM 3667 C C5    . DC  H 4 17 ? 29.417  -53.234 10.924  1.00 60.47  ? 17  DC  H C5    1 
ATOM 3668 C C6    . DC  H 4 17 ? 28.716  -52.087 10.911  1.00 61.27  ? 17  DC  H C6    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  169 ?   ?   ?   A . n 
A 1 2  ALA 2  170 170 ALA ALA A . n 
A 1 3  ARG 3  171 171 ARG ARG A . n 
A 1 4  ARG 4  172 172 ARG ARG A . n 
A 1 5  ILE 5  173 173 ILE ILE A . n 
A 1 6  GLY 6  174 174 GLY GLY A . n 
A 1 7  HIS 7  175 175 HIS HIS A . n 
A 1 8  PRO 8  176 176 PRO PRO A . n 
A 1 9  TYR 9  177 177 TYR TYR A . n 
A 1 10 GLN 10 178 178 GLN GLN A . n 
A 1 11 ASN 11 179 179 ASN ASN A . n 
A 1 12 ARG 12 180 180 ARG ARG A . n 
A 1 13 THR 13 181 181 THR THR A . n 
A 1 14 PRO 14 182 182 PRO PRO A . n 
A 1 15 PRO 15 183 183 PRO PRO A . n 
A 1 16 LYS 16 184 184 LYS LYS A . n 
A 1 17 ARG 17 185 185 ARG ARG A . n 
A 1 18 LYS 18 186 186 LYS LYS A . n 
A 1 19 LYS 19 187 187 LYS LYS A . n 
A 1 20 PRO 20 188 188 PRO PRO A . n 
A 1 21 ARG 21 189 189 ARG ARG A . n 
A 1 22 THR 22 190 190 THR THR A . n 
A 1 23 SER 23 191 191 SER SER A . n 
A 1 24 PHE 24 192 192 PHE PHE A . n 
A 1 25 THR 25 193 193 THR THR A . n 
A 1 26 ARG 26 194 194 ARG ARG A . n 
A 1 27 ILE 27 195 195 ILE ILE A . n 
A 1 28 GLN 28 196 196 GLN GLN A . n 
A 1 29 VAL 29 197 197 VAL VAL A . n 
A 1 30 ALA 30 198 198 ALA ALA A . n 
A 1 31 GLU 31 199 199 GLU GLU A . n 
A 1 32 LEU 32 200 200 LEU LEU A . n 
A 1 33 GLU 33 201 201 GLU GLU A . n 
A 1 34 LYS 34 202 202 LYS LYS A . n 
A 1 35 ARG 35 203 203 ARG ARG A . n 
A 1 36 PHE 36 204 204 PHE PHE A . n 
A 1 37 HIS 37 205 205 HIS HIS A . n 
A 1 38 LYS 38 206 206 LYS LYS A . n 
A 1 39 GLN 39 207 207 GLN GLN A . n 
A 1 40 LYS 40 208 208 LYS LYS A . n 
A 1 41 TYR 41 209 209 TYR TYR A . n 
A 1 42 LEU 42 210 210 LEU LEU A . n 
A 1 43 ALA 43 211 211 ALA ALA A . n 
A 1 44 SER 44 212 212 SER SER A . n 
A 1 45 ALA 45 213 213 ALA ALA A . n 
A 1 46 GLU 46 214 214 GLU GLU A . n 
A 1 47 ARG 47 215 215 ARG ARG A . n 
A 1 48 ALA 48 216 216 ALA ALA A . n 
A 1 49 ALA 49 217 217 ALA ALA A . n 
A 1 50 LEU 50 218 218 LEU LEU A . n 
A 1 51 ALA 51 219 219 ALA ALA A . n 
A 1 52 ARG 52 220 220 ARG ARG A . n 
A 1 53 GLY 53 221 221 GLY GLY A . n 
A 1 54 LEU 54 222 222 LEU LEU A . n 
A 1 55 LYS 55 223 223 LYS LYS A . n 
A 1 56 MET 56 224 224 MET MET A . n 
A 1 57 THR 57 225 225 THR THR A . n 
A 1 58 ASP 58 226 226 ASP ASP A . n 
A 1 59 ALA 59 227 227 ALA ALA A . n 
A 1 60 GLN 60 228 228 GLN GLN A . n 
A 1 61 VAL 61 229 229 VAL VAL A . n 
A 1 62 LYS 62 230 230 LYS LYS A . n 
A 1 63 THR 63 231 231 THR THR A . n 
A 1 64 TRP 64 232 232 TRP TRP A . n 
A 1 65 PHE 65 233 233 PHE PHE A . n 
A 1 66 GLN 66 234 234 GLN GLN A . n 
A 1 67 ASN 67 235 235 ASN ASN A . n 
A 1 68 ARG 68 236 236 ARG ARG A . n 
A 1 69 ARG 69 237 237 ARG ARG A . n 
A 1 70 THR 70 238 238 THR THR A . n 
A 1 71 LYS 71 239 239 LYS LYS A . n 
A 1 72 TRP 72 240 240 TRP TRP A . n 
A 1 73 ARG 73 241 241 ARG ARG A . n 
A 1 74 ARG 74 242 242 ARG ARG A . n 
A 1 75 GLN 75 243 243 GLN GLN A . n 
A 1 76 THR 76 244 244 THR THR A . n 
A 1 77 ALA 77 245 245 ALA ALA A . n 
A 1 78 GLU 78 246 246 GLU GLU A . n 
A 1 79 GLU 79 247 247 GLU GLU A . n 
A 1 80 ARG 80 248 ?   ?   ?   A . n 
A 1 81 GLU 81 249 ?   ?   ?   A . n 
A 1 82 ALA 82 250 ?   ?   ?   A . n 
A 1 83 GLU 83 251 ?   ?   ?   A . n 
A 1 84 ARG 84 252 ?   ?   ?   A . n 
A 1 85 GLN 85 253 ?   ?   ?   A . n 
A 1 86 ALA 86 254 ?   ?   ?   A . n 
A 1 87 ALA 87 255 ?   ?   ?   A . n 
A 1 88 ASN 88 256 ?   ?   ?   A . n 
A 1 89 ARG 89 257 ?   ?   ?   A . n 
A 1 90 LEU 90 258 ?   ?   ?   A . n 
A 1 91 MET 91 259 ?   ?   ?   A . n 
A 1 92 LEU 92 260 ?   ?   ?   A . n 
A 1 93 SER 93 261 ?   ?   ?   A . n 
B 2 1  ALA 1  80  ?   ?   ?   B . n 
B 2 2  PRO 2  81  ?   ?   ?   B . n 
B 2 3  LYS 3  82  ?   ?   ?   B . n 
B 2 4  ARG 4  83  ?   ?   ?   B . n 
B 2 5  LYS 5  84  ?   ?   ?   B . n 
B 2 6  GLN 6  85  ?   ?   ?   B . n 
B 2 7  ARG 7  86  86  ARG ARG B . n 
B 2 8  ARG 8  87  87  ARG ARG B . n 
B 2 9  TYR 9  88  88  TYR TYR B . n 
B 2 10 ARG 10 89  89  ARG ARG B . n 
B 2 11 THR 11 90  90  THR THR B . n 
B 2 12 THR 12 91  91  THR THR B . n 
B 2 13 PHE 13 92  92  PHE PHE B . n 
B 2 14 THR 14 93  93  THR THR B . n 
B 2 15 SER 15 94  94  SER SER B . n 
B 2 16 PHE 16 95  95  PHE PHE B . n 
B 2 17 GLN 17 96  96  GLN GLN B . n 
B 2 18 LEU 18 97  97  LEU LEU B . n 
B 2 19 GLU 19 98  98  GLU GLU B . n 
B 2 20 GLU 20 99  99  GLU GLU B . n 
B 2 21 LEU 21 100 100 LEU LEU B . n 
B 2 22 GLU 22 101 101 GLU GLU B . n 
B 2 23 LYS 23 102 102 LYS LYS B . n 
B 2 24 ALA 24 103 103 ALA ALA B . n 
B 2 25 PHE 25 104 104 PHE PHE B . n 
B 2 26 SER 26 105 105 SER SER B . n 
B 2 27 ARG 27 106 106 ARG ARG B . n 
B 2 28 THR 28 107 107 THR THR B . n 
B 2 29 HIS 29 108 108 HIS HIS B . n 
B 2 30 TYR 30 109 109 TYR TYR B . n 
B 2 31 PRO 31 110 110 PRO PRO B . n 
B 2 32 ASP 32 111 111 ASP ASP B . n 
B 2 33 VAL 33 112 112 VAL VAL B . n 
B 2 34 PHE 34 113 113 PHE PHE B . n 
B 2 35 THR 35 114 114 THR THR B . n 
B 2 36 ARG 36 115 115 ARG ARG B . n 
B 2 37 GLU 37 116 116 GLU GLU B . n 
B 2 38 GLU 38 117 117 GLU GLU B . n 
B 2 39 LEU 39 118 118 LEU LEU B . n 
B 2 40 ALA 40 119 119 ALA ALA B . n 
B 2 41 MET 41 120 120 MET MET B . n 
B 2 42 LYS 42 121 121 LYS LYS B . n 
B 2 43 ILE 43 122 122 ILE ILE B . n 
B 2 44 GLY 44 123 123 GLY GLY B . n 
B 2 45 LEU 45 124 124 LEU LEU B . n 
B 2 46 THR 46 125 125 THR THR B . n 
B 2 47 GLU 47 126 126 GLU GLU B . n 
B 2 48 ALA 48 127 127 ALA ALA B . n 
B 2 49 ARG 49 128 128 ARG ARG B . n 
B 2 50 ILE 50 129 129 ILE ILE B . n 
B 2 51 GLN 51 130 130 GLN GLN B . n 
B 2 52 VAL 52 131 131 VAL VAL B . n 
B 2 53 TRP 53 132 132 TRP TRP B . n 
B 2 54 PHE 54 133 133 PHE PHE B . n 
B 2 55 GLN 55 134 134 GLN GLN B . n 
B 2 56 ASN 56 135 135 ASN ASN B . n 
B 2 57 ARG 57 136 136 ARG ARG B . n 
B 2 58 ARG 58 137 137 ARG ARG B . n 
B 2 59 ALA 59 138 138 ALA ALA B . n 
B 2 60 LYS 60 139 139 LYS LYS B . n 
B 2 61 TRP 61 140 140 TRP TRP B . n 
B 2 62 ARG 62 141 141 ARG ARG B . n 
B 2 63 LYS 63 142 142 LYS LYS B . n 
B 2 64 GLN 64 143 ?   ?   ?   B . n 
B 2 65 GLU 65 144 ?   ?   ?   B . n 
B 2 66 LYS 66 145 ?   ?   ?   B . n 
B 2 67 VAL 67 146 ?   ?   ?   B . n 
C 3 1  DG  1  1   1   DG  DG  C . n 
C 3 2  DG  2  2   2   DG  DG  C . n 
C 3 3  DC  3  3   3   DC  DC  C . n 
C 3 4  DT  4  4   4   DT  DT  C . n 
C 3 5  DT  5  5   5   DT  DT  C . n 
C 3 6  DA  6  6   6   DA  DA  C . n 
C 3 7  DA  7  7   7   DA  DA  C . n 
C 3 8  DT  8  8   8   DT  DT  C . n 
C 3 9  DT  9  9   9   DT  DT  C . n 
C 3 10 DA  10 10  10  DA  DA  C . n 
C 3 11 DA  11 11  11  DA  DA  C . n 
C 3 12 DT  12 12  12  DT  DT  C . n 
C 3 13 DT  13 13  13  DT  DT  C . n 
C 3 14 DG  14 14  14  DG  DG  C . n 
C 3 15 DC  15 15  15  DC  DC  C . n 
C 3 16 DG  16 16  16  DG  DG  C . n 
C 3 17 DG  17 17  17  DG  DG  C . n 
D 4 1  DC  1  1   1   DC  DC  D . n 
D 4 2  DC  2  2   2   DC  DC  D . n 
D 4 3  DG  3  3   3   DG  DG  D . n 
D 4 4  DC  4  4   4   DC  DC  D . n 
D 4 5  DA  5  5   5   DA  DA  D . n 
D 4 6  DA  6  6   6   DA  DA  D . n 
D 4 7  DT  7  7   7   DT  DT  D . n 
D 4 8  DT  8  8   8   DT  DT  D . n 
D 4 9  DA  9  9   9   DA  DA  D . n 
D 4 10 DA  10 10  10  DA  DA  D . n 
D 4 11 DT  11 11  11  DT  DT  D . n 
D 4 12 DT  12 12  12  DT  DT  D . n 
D 4 13 DA  13 13  13  DA  DA  D . n 
D 4 14 DA  14 14  14  DA  DA  D . n 
D 4 15 DG  15 15  15  DG  DG  D . n 
D 4 16 DC  16 16  16  DC  DC  D . n 
D 4 17 DC  17 17  17  DC  DC  D . n 
E 1 1  MET 1  169 ?   ?   ?   E . n 
E 1 2  ALA 2  170 ?   ?   ?   E . n 
E 1 3  ARG 3  171 ?   ?   ?   E . n 
E 1 4  ARG 4  172 ?   ?   ?   E . n 
E 1 5  ILE 5  173 ?   ?   ?   E . n 
E 1 6  GLY 6  174 ?   ?   ?   E . n 
E 1 7  HIS 7  175 175 HIS HIS E . n 
E 1 8  PRO 8  176 176 PRO PRO E . n 
E 1 9  TYR 9  177 177 TYR TYR E . n 
E 1 10 GLN 10 178 178 GLN GLN E . n 
E 1 11 ASN 11 179 179 ASN ASN E . n 
E 1 12 ARG 12 180 180 ARG ARG E . n 
E 1 13 THR 13 181 181 THR THR E . n 
E 1 14 PRO 14 182 182 PRO PRO E . n 
E 1 15 PRO 15 183 183 PRO PRO E . n 
E 1 16 LYS 16 184 ?   ?   ?   E . n 
E 1 17 ARG 17 185 ?   ?   ?   E . n 
E 1 18 LYS 18 186 ?   ?   ?   E . n 
E 1 19 LYS 19 187 ?   ?   ?   E . n 
E 1 20 PRO 20 188 ?   ?   ?   E . n 
E 1 21 ARG 21 189 189 ARG ARG E . n 
E 1 22 THR 22 190 190 THR THR E . n 
E 1 23 SER 23 191 191 SER SER E . n 
E 1 24 PHE 24 192 192 PHE PHE E . n 
E 1 25 THR 25 193 193 THR THR E . n 
E 1 26 ARG 26 194 194 ARG ARG E . n 
E 1 27 ILE 27 195 195 ILE ILE E . n 
E 1 28 GLN 28 196 196 GLN GLN E . n 
E 1 29 VAL 29 197 197 VAL VAL E . n 
E 1 30 ALA 30 198 198 ALA ALA E . n 
E 1 31 GLU 31 199 199 GLU GLU E . n 
E 1 32 LEU 32 200 200 LEU LEU E . n 
E 1 33 GLU 33 201 201 GLU GLU E . n 
E 1 34 LYS 34 202 202 LYS LYS E . n 
E 1 35 ARG 35 203 203 ARG ARG E . n 
E 1 36 PHE 36 204 204 PHE PHE E . n 
E 1 37 HIS 37 205 205 HIS HIS E . n 
E 1 38 LYS 38 206 206 LYS LYS E . n 
E 1 39 GLN 39 207 207 GLN GLN E . n 
E 1 40 LYS 40 208 208 LYS LYS E . n 
E 1 41 TYR 41 209 209 TYR TYR E . n 
E 1 42 LEU 42 210 210 LEU LEU E . n 
E 1 43 ALA 43 211 211 ALA ALA E . n 
E 1 44 SER 44 212 212 SER SER E . n 
E 1 45 ALA 45 213 213 ALA ALA E . n 
E 1 46 GLU 46 214 214 GLU GLU E . n 
E 1 47 ARG 47 215 215 ARG ARG E . n 
E 1 48 ALA 48 216 216 ALA ALA E . n 
E 1 49 ALA 49 217 217 ALA ALA E . n 
E 1 50 LEU 50 218 218 LEU LEU E . n 
E 1 51 ALA 51 219 219 ALA ALA E . n 
E 1 52 ARG 52 220 220 ARG ARG E . n 
E 1 53 GLY 53 221 221 GLY GLY E . n 
E 1 54 LEU 54 222 222 LEU LEU E . n 
E 1 55 LYS 55 223 223 LYS LYS E . n 
E 1 56 MET 56 224 224 MET MET E . n 
E 1 57 THR 57 225 225 THR THR E . n 
E 1 58 ASP 58 226 226 ASP ASP E . n 
E 1 59 ALA 59 227 227 ALA ALA E . n 
E 1 60 GLN 60 228 228 GLN GLN E . n 
E 1 61 VAL 61 229 229 VAL VAL E . n 
E 1 62 LYS 62 230 230 LYS LYS E . n 
E 1 63 THR 63 231 231 THR THR E . n 
E 1 64 TRP 64 232 232 TRP TRP E . n 
E 1 65 PHE 65 233 233 PHE PHE E . n 
E 1 66 GLN 66 234 234 GLN GLN E . n 
E 1 67 ASN 67 235 235 ASN ASN E . n 
E 1 68 ARG 68 236 236 ARG ARG E . n 
E 1 69 ARG 69 237 237 ARG ARG E . n 
E 1 70 THR 70 238 238 THR THR E . n 
E 1 71 LYS 71 239 239 LYS LYS E . n 
E 1 72 TRP 72 240 240 TRP TRP E . n 
E 1 73 ARG 73 241 241 ARG ARG E . n 
E 1 74 ARG 74 242 242 ARG ARG E . n 
E 1 75 GLN 75 243 243 GLN GLN E . n 
E 1 76 THR 76 244 244 THR THR E . n 
E 1 77 ALA 77 245 245 ALA ALA E . n 
E 1 78 GLU 78 246 246 GLU GLU E . n 
E 1 79 GLU 79 247 247 GLU GLU E . n 
E 1 80 ARG 80 248 ?   ?   ?   E . n 
E 1 81 GLU 81 249 ?   ?   ?   E . n 
E 1 82 ALA 82 250 ?   ?   ?   E . n 
E 1 83 GLU 83 251 ?   ?   ?   E . n 
E 1 84 ARG 84 252 ?   ?   ?   E . n 
E 1 85 GLN 85 253 ?   ?   ?   E . n 
E 1 86 ALA 86 254 ?   ?   ?   E . n 
E 1 87 ALA 87 255 ?   ?   ?   E . n 
E 1 88 ASN 88 256 ?   ?   ?   E . n 
E 1 89 ARG 89 257 ?   ?   ?   E . n 
E 1 90 LEU 90 258 ?   ?   ?   E . n 
E 1 91 MET 91 259 ?   ?   ?   E . n 
E 1 92 LEU 92 260 ?   ?   ?   E . n 
E 1 93 SER 93 261 ?   ?   ?   E . n 
F 2 1  ALA 1  80  ?   ?   ?   F . n 
F 2 2  PRO 2  81  ?   ?   ?   F . n 
F 2 3  LYS 3  82  ?   ?   ?   F . n 
F 2 4  ARG 4  83  ?   ?   ?   F . n 
F 2 5  LYS 5  84  ?   ?   ?   F . n 
F 2 6  GLN 6  85  ?   ?   ?   F . n 
F 2 7  ARG 7  86  86  ARG ARG F . n 
F 2 8  ARG 8  87  87  ARG ARG F . n 
F 2 9  TYR 9  88  88  TYR TYR F . n 
F 2 10 ARG 10 89  89  ARG ARG F . n 
F 2 11 THR 11 90  90  THR THR F . n 
F 2 12 THR 12 91  91  THR THR F . n 
F 2 13 PHE 13 92  92  PHE PHE F . n 
F 2 14 THR 14 93  93  THR THR F . n 
F 2 15 SER 15 94  94  SER SER F . n 
F 2 16 PHE 16 95  95  PHE PHE F . n 
F 2 17 GLN 17 96  96  GLN GLN F . n 
F 2 18 LEU 18 97  97  LEU LEU F . n 
F 2 19 GLU 19 98  98  GLU GLU F . n 
F 2 20 GLU 20 99  99  GLU GLU F . n 
F 2 21 LEU 21 100 100 LEU LEU F . n 
F 2 22 GLU 22 101 101 GLU GLU F . n 
F 2 23 LYS 23 102 102 LYS LYS F . n 
F 2 24 ALA 24 103 103 ALA ALA F . n 
F 2 25 PHE 25 104 104 PHE PHE F . n 
F 2 26 SER 26 105 105 SER SER F . n 
F 2 27 ARG 27 106 106 ARG ARG F . n 
F 2 28 THR 28 107 107 THR THR F . n 
F 2 29 HIS 29 108 108 HIS HIS F . n 
F 2 30 TYR 30 109 109 TYR TYR F . n 
F 2 31 PRO 31 110 110 PRO PRO F . n 
F 2 32 ASP 32 111 111 ASP ASP F . n 
F 2 33 VAL 33 112 112 VAL VAL F . n 
F 2 34 PHE 34 113 113 PHE PHE F . n 
F 2 35 THR 35 114 114 THR THR F . n 
F 2 36 ARG 36 115 115 ARG ARG F . n 
F 2 37 GLU 37 116 116 GLU GLU F . n 
F 2 38 GLU 38 117 117 GLU GLU F . n 
F 2 39 LEU 39 118 118 LEU LEU F . n 
F 2 40 ALA 40 119 119 ALA ALA F . n 
F 2 41 MET 41 120 120 MET MET F . n 
F 2 42 LYS 42 121 121 LYS LYS F . n 
F 2 43 ILE 43 122 122 ILE ILE F . n 
F 2 44 GLY 44 123 123 GLY GLY F . n 
F 2 45 LEU 45 124 124 LEU LEU F . n 
F 2 46 THR 46 125 125 THR THR F . n 
F 2 47 GLU 47 126 126 GLU GLU F . n 
F 2 48 ALA 48 127 127 ALA ALA F . n 
F 2 49 ARG 49 128 128 ARG ARG F . n 
F 2 50 ILE 50 129 129 ILE ILE F . n 
F 2 51 GLN 51 130 130 GLN GLN F . n 
F 2 52 VAL 52 131 131 VAL VAL F . n 
F 2 53 TRP 53 132 132 TRP TRP F . n 
F 2 54 PHE 54 133 133 PHE PHE F . n 
F 2 55 GLN 55 134 134 GLN GLN F . n 
F 2 56 ASN 56 135 135 ASN ASN F . n 
F 2 57 ARG 57 136 136 ARG ARG F . n 
F 2 58 ARG 58 137 137 ARG ARG F . n 
F 2 59 ALA 59 138 138 ALA ALA F . n 
F 2 60 LYS 60 139 139 LYS LYS F . n 
F 2 61 TRP 61 140 140 TRP TRP F . n 
F 2 62 ARG 62 141 141 ARG ARG F . n 
F 2 63 LYS 63 142 142 LYS LYS F . n 
F 2 64 GLN 64 143 143 GLN GLN F . n 
F 2 65 GLU 65 144 144 GLU GLU F . n 
F 2 66 LYS 66 145 145 LYS LYS F . n 
F 2 67 VAL 67 146 146 VAL VAL F . n 
G 3 1  DG  1  1   1   DG  DG  G . n 
G 3 2  DG  2  2   2   DG  DG  G . n 
G 3 3  DC  3  3   3   DC  DC  G . n 
G 3 4  DT  4  4   4   DT  DT  G . n 
G 3 5  DT  5  5   5   DT  DT  G . n 
G 3 6  DA  6  6   6   DA  DA  G . n 
G 3 7  DA  7  7   7   DA  DA  G . n 
G 3 8  DT  8  8   8   DT  DT  G . n 
G 3 9  DT  9  9   9   DT  DT  G . n 
G 3 10 DA  10 10  10  DA  DA  G . n 
G 3 11 DA  11 11  11  DA  DA  G . n 
G 3 12 DT  12 12  12  DT  DT  G . n 
G 3 13 DT  13 13  13  DT  DT  G . n 
G 3 14 DG  14 14  14  DG  DG  G . n 
G 3 15 DC  15 15  15  DC  DC  G . n 
G 3 16 DG  16 16  16  DG  DG  G . n 
G 3 17 DG  17 17  17  DG  DG  G . n 
H 4 1  DC  1  1   1   DC  DC  H . n 
H 4 2  DC  2  2   2   DC  DC  H . n 
H 4 3  DG  3  3   3   DG  DG  H . n 
H 4 4  DC  4  4   4   DC  DC  H . n 
H 4 5  DA  5  5   5   DA  DA  H . n 
H 4 6  DA  6  6   6   DA  DA  H . n 
H 4 7  DT  7  7   7   DT  DT  H . n 
H 4 8  DT  8  8   8   DT  DT  H . n 
H 4 9  DA  9  9   9   DA  DA  H . n 
H 4 10 DA  10 10  10  DA  DA  H . n 
H 4 11 DT  11 11  11  DT  DT  H . n 
H 4 12 DT  12 12  12  DT  DT  H . n 
H 4 13 DA  13 13  13  DA  DA  H . n 
H 4 14 DA  14 14  14  DA  DA  H . n 
H 4 15 DG  15 15  15  DG  DG  H . n 
H 4 16 DC  16 16  16  DC  DC  H . n 
H 4 17 DC  17 17  17  DC  DC  H . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D 
2 1 E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6760  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  13040 ? 
2 'ABSA (A^2)' 6190  ? 
2 MORE         -29   ? 
2 'SSA (A^2)'  12620 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-03-09 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement     5.2.0019 ? 1 
XSCALE 'data scaling' .        ? 2 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH2 F ARG 89  ? ? O2  G DT  5   ? ? 2.15 
2 1 OE2 E GLU 201 ? ? NH1 E ARG 236 ? ? 2.15 
3 1 NH1 E ARG 215 ? ? OP1 H DC  2   ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" C DA 6  ? ? "C3'" C DA 6  ? ? 1.368 1.419 -0.051 0.006 N 
2 1 "O3'" C DG 14 ? ? "C3'" C DG 14 ? ? 1.369 1.419 -0.050 0.006 N 
3 1 "O3'" D DA 9  ? ? "C3'" D DA 9  ? ? 1.376 1.419 -0.043 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" C DG 1  ? ? "C4'" C DG 1  ? ? "C3'" C DG 1  ? ? 101.72 104.50 -2.78  0.40 N 
2  1 "C3'" C DT 5  ? ? "C2'" C DT 5  ? ? "C1'" C DT 5  ? ? 97.31  102.40 -5.09  0.80 N 
3  1 "O4'" C DT 5  ? ? "C1'" C DT 5  ? ? N1    C DT 5  ? ? 111.99 108.30 3.69   0.30 N 
4  1 "O4'" C DA 6  ? ? "C1'" C DA 6  ? ? N9    C DA 6  ? ? 100.59 108.00 -7.41  0.70 N 
5  1 "O4'" C DA 10 ? ? "C1'" C DA 10 ? ? N9    C DA 10 ? ? 103.53 108.00 -4.47  0.70 N 
6  1 "C3'" C DA 10 ? ? "O3'" C DA 10 ? ? P     C DA 11 ? ? 128.93 119.70 9.23   1.20 Y 
7  1 "O4'" C DT 13 ? ? "C1'" C DT 13 ? ? N1    C DT 13 ? ? 102.41 108.00 -5.59  0.70 N 
8  1 "O4'" C DG 14 ? ? "C1'" C DG 14 ? ? N9    C DG 14 ? ? 114.54 108.30 6.24   0.30 N 
9  1 "O4'" C DG 17 ? ? "C1'" C DG 17 ? ? N9    C DG 17 ? ? 111.52 108.30 3.22   0.30 N 
10 1 "O4'" D DG 3  ? ? "C1'" D DG 3  ? ? N9    D DG 3  ? ? 102.86 108.00 -5.14  0.70 N 
11 1 "O4'" D DA 6  ? ? "C1'" D DA 6  ? ? N9    D DA 6  ? ? 110.73 108.30 2.43   0.30 N 
12 1 "O5'" D DT 7  ? ? P     D DT 7  ? ? OP1   D DT 7  ? ? 119.45 110.70 8.75   1.20 N 
13 1 "O4'" D DT 7  ? ? "C4'" D DT 7  ? ? "C3'" D DT 7  ? ? 99.58  104.50 -4.92  0.40 N 
14 1 "C5'" D DT 7  ? ? "C4'" D DT 7  ? ? "O4'" D DT 7  ? ? 120.55 109.80 10.75  1.10 N 
15 1 "C1'" D DT 7  ? ? "O4'" D DT 7  ? ? "C4'" D DT 7  ? ? 102.29 110.10 -7.81  1.00 N 
16 1 "C4'" D DT 7  ? ? "C3'" D DT 7  ? ? "C2'" D DT 7  ? ? 92.50  102.20 -9.70  0.70 N 
17 1 "O4'" D DT 7  ? ? "C1'" D DT 7  ? ? N1    D DT 7  ? ? 111.82 108.30 3.52   0.30 N 
18 1 "O4'" D DT 8  ? ? "C1'" D DT 8  ? ? N1    D DT 8  ? ? 110.37 108.30 2.07   0.30 N 
19 1 "O5'" D DA 9  ? ? "C5'" D DA 9  ? ? "C4'" D DA 9  ? ? 102.51 109.40 -6.89  0.80 N 
20 1 "O4'" D DA 9  ? ? "C1'" D DA 9  ? ? N9    D DA 9  ? ? 102.82 108.00 -5.18  0.70 N 
21 1 "O4'" D DA 10 ? ? "C1'" D DA 10 ? ? N9    D DA 10 ? ? 112.18 108.30 3.88   0.30 N 
22 1 "C5'" D DT 11 ? ? "C4'" D DT 11 ? ? "O4'" D DT 11 ? ? 117.25 109.80 7.45   1.10 N 
23 1 "C1'" D DT 11 ? ? "O4'" D DT 11 ? ? "C4'" D DT 11 ? ? 102.05 110.10 -8.05  1.00 N 
24 1 "O4'" D DT 11 ? ? "C1'" D DT 11 ? ? N1    D DT 11 ? ? 112.03 108.30 3.73   0.30 N 
25 1 C4    D DT 11 ? ? C5    D DT 11 ? ? C7    D DT 11 ? ? 123.65 119.00 4.65   0.60 N 
26 1 "O4'" D DT 12 ? ? "C1'" D DT 12 ? ? N1    D DT 12 ? ? 102.10 108.00 -5.90  0.70 N 
27 1 "C3'" D DA 13 ? ? "C2'" D DA 13 ? ? "C1'" D DA 13 ? ? 97.45  102.40 -4.95  0.80 N 
28 1 "O4'" D DA 14 ? ? "C1'" D DA 14 ? ? N9    D DA 14 ? ? 101.45 108.00 -6.55  0.70 N 
29 1 "C3'" D DG 15 ? ? "C2'" D DG 15 ? ? "C1'" D DG 15 ? ? 96.10  102.40 -6.30  0.80 N 
30 1 "O4'" D DG 15 ? ? "C1'" D DG 15 ? ? N9    D DG 15 ? ? 111.80 108.30 3.50   0.30 N 
31 1 "O4'" D DC 17 ? ? "C1'" D DC 17 ? ? N1    D DC 17 ? ? 111.03 108.30 2.73   0.30 N 
32 1 "O4'" G DT 5  ? ? "C1'" G DT 5  ? ? N1    G DT 5  ? ? 112.32 108.30 4.02   0.30 N 
33 1 C4    G DT 5  ? ? C5    G DT 5  ? ? C7    G DT 5  ? ? 122.91 119.00 3.91   0.60 N 
34 1 C6    G DT 5  ? ? C5    G DT 5  ? ? C7    G DT 5  ? ? 119.13 122.90 -3.77  0.60 N 
35 1 "O4'" G DA 6  ? ? "C1'" G DA 6  ? ? N9    G DA 6  ? ? 102.47 108.00 -5.53  0.70 N 
36 1 N3    G DT 8  ? ? C2    G DT 8  ? ? O2    G DT 8  ? ? 118.69 122.30 -3.61  0.60 N 
37 1 "O4'" G DA 11 ? ? "C4'" G DA 11 ? ? "C3'" G DA 11 ? ? 99.36  104.50 -5.14  0.40 N 
38 1 "O4'" G DA 11 ? ? "C1'" G DA 11 ? ? N9    G DA 11 ? ? 111.58 108.30 3.28   0.30 N 
39 1 "O4'" G DG 14 ? ? "C1'" G DG 14 ? ? N9    G DG 14 ? ? 111.17 108.30 2.87   0.30 N 
40 1 "O4'" G DC 15 ? ? "C1'" G DC 15 ? ? N1    G DC 15 ? ? 111.11 108.30 2.81   0.30 N 
41 1 "O4'" G DG 16 ? ? "C1'" G DG 16 ? ? N9    G DG 16 ? ? 111.72 108.30 3.42   0.30 N 
42 1 "O4'" H DC 1  ? ? "C1'" H DC 1  ? ? N1    H DC 1  ? ? 113.18 108.30 4.88   0.30 N 
43 1 "O4'" H DT 7  ? ? "C4'" H DT 7  ? ? "C3'" H DT 7  ? ? 98.86  104.50 -5.64  0.40 N 
44 1 "C1'" H DT 7  ? ? "O4'" H DT 7  ? ? "C4'" H DT 7  ? ? 99.93  110.10 -10.17 1.00 N 
45 1 "C4'" H DT 7  ? ? "C3'" H DT 7  ? ? "C2'" H DT 7  ? ? 94.15  102.20 -8.05  0.70 N 
46 1 "O4'" H DT 7  ? ? "C1'" H DT 7  ? ? N1    H DT 7  ? ? 113.84 108.30 5.54   0.30 N 
47 1 "O5'" H DA 9  ? ? "C5'" H DA 9  ? ? "C4'" H DA 9  ? ? 102.77 109.40 -6.63  0.80 N 
48 1 "C1'" H DA 10 ? ? "O4'" H DA 10 ? ? "C4'" H DA 10 ? ? 103.11 110.10 -6.99  1.00 N 
49 1 "O4'" H DA 10 ? ? "C1'" H DA 10 ? ? "C2'" H DA 10 ? ? 100.66 105.90 -5.24  0.80 N 
50 1 "O4'" H DA 10 ? ? "C1'" H DA 10 ? ? N9    H DA 10 ? ? 115.09 108.30 6.79   0.30 N 
51 1 "C1'" H DT 11 ? ? "O4'" H DT 11 ? ? "C4'" H DT 11 ? ? 100.70 110.10 -9.40  1.00 N 
52 1 "C3'" H DT 11 ? ? "C2'" H DT 11 ? ? "C1'" H DT 11 ? ? 95.31  102.40 -7.09  0.80 N 
53 1 "O4'" H DT 11 ? ? "C1'" H DT 11 ? ? "C2'" H DT 11 ? ? 100.88 105.90 -5.02  0.80 N 
54 1 "O4'" H DT 11 ? ? "C1'" H DT 11 ? ? N1    H DT 11 ? ? 117.29 108.30 8.99   0.30 N 
55 1 "C3'" H DT 12 ? ? "C2'" H DT 12 ? ? "C1'" H DT 12 ? ? 97.46  102.40 -4.94  0.80 N 
56 1 "O4'" H DA 14 ? ? "C1'" H DA 14 ? ? N9    H DA 14 ? ? 103.30 108.00 -4.70  0.70 N 
57 1 "O4'" H DG 15 ? ? "C1'" H DG 15 ? ? N9    H DG 15 ? ? 113.25 108.30 4.95   0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 171 ? ? -154.07 -36.01 
2 1 ARG A 172 ? ? 37.51   59.29  
3 1 LYS A 187 ? ? -164.26 -55.96 
4 1 THR A 244 ? ? -39.41  -81.25 
5 1 ARG B 106 ? ? -67.37  -74.37 
6 1 GLN E 207 ? ? -164.28 102.49 
7 1 TYR F 109 ? ? -116.22 66.05  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    187 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    188 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -142.41 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 169 ? A MET 1  
2  1 Y 1 A ARG 248 ? A ARG 80 
3  1 Y 1 A GLU 249 ? A GLU 81 
4  1 Y 1 A ALA 250 ? A ALA 82 
5  1 Y 1 A GLU 251 ? A GLU 83 
6  1 Y 1 A ARG 252 ? A ARG 84 
7  1 Y 1 A GLN 253 ? A GLN 85 
8  1 Y 1 A ALA 254 ? A ALA 86 
9  1 Y 1 A ALA 255 ? A ALA 87 
10 1 Y 1 A ASN 256 ? A ASN 88 
11 1 Y 1 A ARG 257 ? A ARG 89 
12 1 Y 1 A LEU 258 ? A LEU 90 
13 1 Y 1 A MET 259 ? A MET 91 
14 1 Y 1 A LEU 260 ? A LEU 92 
15 1 Y 1 A SER 261 ? A SER 93 
16 1 Y 1 B ALA 80  ? B ALA 1  
17 1 Y 1 B PRO 81  ? B PRO 2  
18 1 Y 1 B LYS 82  ? B LYS 3  
19 1 Y 1 B ARG 83  ? B ARG 4  
20 1 Y 1 B LYS 84  ? B LYS 5  
21 1 Y 1 B GLN 85  ? B GLN 6  
22 1 Y 1 B GLN 143 ? B GLN 64 
23 1 Y 1 B GLU 144 ? B GLU 65 
24 1 Y 1 B LYS 145 ? B LYS 66 
25 1 Y 1 B VAL 146 ? B VAL 67 
26 1 Y 1 E MET 169 ? E MET 1  
27 1 Y 1 E ALA 170 ? E ALA 2  
28 1 Y 1 E ARG 171 ? E ARG 3  
29 1 Y 1 E ARG 172 ? E ARG 4  
30 1 Y 1 E ILE 173 ? E ILE 5  
31 1 Y 1 E GLY 174 ? E GLY 6  
32 1 Y 1 E LYS 184 ? E LYS 16 
33 1 Y 1 E ARG 185 ? E ARG 17 
34 1 Y 1 E LYS 186 ? E LYS 18 
35 1 Y 1 E LYS 187 ? E LYS 19 
36 1 Y 1 E PRO 188 ? E PRO 20 
37 1 Y 1 E ARG 248 ? E ARG 80 
38 1 Y 1 E GLU 249 ? E GLU 81 
39 1 Y 1 E ALA 250 ? E ALA 82 
40 1 Y 1 E GLU 251 ? E GLU 83 
41 1 Y 1 E ARG 252 ? E ARG 84 
42 1 Y 1 E GLN 253 ? E GLN 85 
43 1 Y 1 E ALA 254 ? E ALA 86 
44 1 Y 1 E ALA 255 ? E ALA 87 
45 1 Y 1 E ASN 256 ? E ASN 88 
46 1 Y 1 E ARG 257 ? E ARG 89 
47 1 Y 1 E LEU 258 ? E LEU 90 
48 1 Y 1 E MET 259 ? E MET 91 
49 1 Y 1 E LEU 260 ? E LEU 92 
50 1 Y 1 E SER 261 ? E SER 93 
51 1 Y 1 F ALA 80  ? F ALA 1  
52 1 Y 1 F PRO 81  ? F PRO 2  
53 1 Y 1 F LYS 82  ? F LYS 3  
54 1 Y 1 F ARG 83  ? F ARG 4  
55 1 Y 1 F LYS 84  ? F LYS 5  
56 1 Y 1 F GLN 85  ? F GLN 6  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3A01 'double helix'        
3A01 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 1  1_555 D DC 17 1_555 0.260  -0.141 -0.051 4.484   -7.062  -4.683 1  C_DG1:DC17_D C 1  ? D 17 ? 19 1 
1 C DG 2  1_555 D DC 16 1_555 0.297  -0.286 0.268  3.777   -12.592 -6.171 2  C_DG2:DC16_D C 2  ? D 16 ? 19 1 
1 C DC 3  1_555 D DG 15 1_555 -0.246 -0.235 -0.086 0.589   -3.872  -2.187 3  C_DC3:DG15_D C 3  ? D 15 ? 19 1 
1 C DT 4  1_555 D DA 14 1_555 -0.547 -0.269 0.165  0.645   -4.860  -3.552 4  C_DT4:DA14_D C 4  ? D 14 ? 20 1 
1 C DT 5  1_555 D DA 13 1_555 0.015  -0.246 0.146  3.882   -2.986  5.597  5  C_DT5:DA13_D C 5  ? D 13 ? 20 1 
1 C DA 6  1_555 D DT 12 1_555 0.453  -0.128 -0.039 2.645   -6.541  5.079  6  C_DA6:DT12_D C 6  ? D 12 ? 20 1 
1 C DA 7  1_555 D DT 11 1_555 -0.129 -0.200 0.360  -2.970  -15.131 5.972  7  C_DA7:DT11_D C 7  ? D 11 ? 20 1 
1 C DT 8  1_555 D DA 10 1_555 -0.386 -0.179 0.606  -3.049  -8.577  4.131  8  C_DT8:DA10_D C 8  ? D 10 ? 20 1 
1 C DT 9  1_555 D DA 9  1_555 -0.160 -0.123 -0.147 -6.194  -13.298 5.135  9  C_DT9:DA9_D  C 9  ? D 9  ? 20 1 
1 C DA 10 1_555 D DT 8  1_555 0.053  -0.148 -0.200 -0.374  -5.203  -1.144 10 C_DA10:DT8_D C 10 ? D 8  ? 20 1 
1 C DA 11 1_555 D DT 7  1_555 0.215  -0.129 0.086  -7.669  -18.772 6.932  11 C_DA11:DT7_D C 11 ? D 7  ? 20 1 
1 C DT 12 1_555 D DA 6  1_555 0.119  -0.202 0.069  -3.958  -11.131 8.629  12 C_DT12:DA6_D C 12 ? D 6  ? 20 1 
1 C DT 13 1_555 D DA 5  1_555 -0.087 -0.264 0.096  -3.441  -11.570 2.398  13 C_DT13:DA5_D C 13 ? D 5  ? 20 1 
1 C DG 14 1_555 D DC 4  1_555 -0.328 -0.221 -0.219 -1.335  -3.820  -0.330 14 C_DG14:DC4_D C 14 ? D 4  ? 19 1 
1 C DC 15 1_555 D DG 3  1_555 0.231  -0.001 -0.312 6.135   -4.222  1.561  15 C_DC15:DG3_D C 15 ? D 3  ? 19 1 
1 C DG 16 1_555 D DC 2  1_555 -0.355 0.096  0.396  14.046  -11.033 1.599  16 C_DG16:DC2_D C 16 ? D 2  ? 19 1 
1 C DG 17 1_555 D DC 1  1_555 0.066  -0.192 0.063  -2.771  -21.864 -5.988 17 C_DG17:DC1_D C 17 ? D 1  ? 19 1 
1 G DG 1  1_555 H DC 17 1_555 0.333  -0.045 0.219  4.217   -6.416  -5.063 18 G_DG1:DC17_H G 1  ? H 17 ? 19 1 
1 G DG 2  1_555 H DC 16 1_555 0.252  0.145  0.047  -9.186  -8.200  4.669  19 G_DG2:DC16_H G 2  ? H 16 ? 19 1 
1 G DC 3  1_555 H DG 15 1_555 -0.812 -0.132 0.251  -4.250  0.512   -0.700 20 G_DC3:DG15_H G 3  ? H 15 ? 19 1 
1 G DT 4  1_555 H DA 14 1_555 -0.765 -0.233 -0.341 4.726   -4.542  -2.465 21 G_DT4:DA14_H G 4  ? H 14 ? 20 1 
1 G DT 5  1_555 H DA 13 1_555 0.048  -0.066 -0.291 17.793  -7.717  10.005 22 G_DT5:DA13_H G 5  ? H 13 ? 20 1 
1 G DA 6  1_555 H DT 12 1_555 0.622  -0.296 -0.086 1.952   -11.702 -1.835 23 G_DA6:DT12_H G 6  ? H 12 ? 20 1 
1 G DA 7  1_555 H DT 11 1_555 1.012  -0.156 0.335  -4.021  -12.636 -7.764 24 G_DA7:DT11_H G 7  ? H 11 ? 20 1 
1 G DT 8  1_555 H DA 10 1_555 0.125  -0.305 0.257  -7.591  -10.642 1.919  25 G_DT8:DA10_H G 8  ? H 10 ? 20 1 
1 G DT 9  1_555 H DA 9  1_555 0.002  -0.177 -0.005 -1.736  -12.674 -0.426 26 G_DT9:DA9_H  G 9  ? H 9  ? 20 1 
1 G DA 10 1_555 H DT 8  1_555 0.247  -0.106 -0.326 -10.723 -6.403  0.760  27 G_DA10:DT8_H G 10 ? H 8  ? 20 1 
1 G DA 11 1_555 H DT 7  1_555 -0.036 -0.229 0.102  -8.161  -15.742 5.376  28 G_DA11:DT7_H G 11 ? H 7  ? 20 1 
1 G DT 12 1_555 H DA 6  1_555 -0.373 -0.208 -0.247 -0.931  -9.426  5.566  29 G_DT12:DA6_H G 12 ? H 6  ? 20 1 
1 G DT 13 1_555 H DA 5  1_555 -0.361 -0.346 0.107  -7.710  -11.721 -4.548 30 G_DT13:DA5_H G 13 ? H 5  ? 20 1 
1 G DG 14 1_555 H DC 4  1_555 0.046  0.004  -0.052 1.724   -7.272  1.102  31 G_DG14:DC4_H G 14 ? H 4  ? 19 1 
1 G DC 15 1_555 H DG 3  1_555 0.205  -0.080 -0.078 2.270   -6.206  -3.310 32 G_DC15:DG3_H G 15 ? H 3  ? 19 1 
1 G DG 16 1_555 H DC 2  1_555 -0.552 -0.294 0.266  10.335  -2.250  -1.920 33 G_DG16:DC2_H G 16 ? H 2  ? 19 1 
1 G DG 17 1_555 H DC 1  1_555 0.171  -0.160 0.174  -5.842  -21.161 -4.157 34 G_DG17:DC1_H G 17 ? H 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 1  1_555 D DC 17 1_555 C DG 2  1_555 D DC 16 1_555 -0.579 -0.204 3.222 -6.038 1.886  39.936 -0.507 0.162  3.260 2.740  
8.774   40.414 1  CC_DG1DG2:DC16DC17_DD C 1  ? D 17 ? C 2  ? D 16 ? 
1 C DG 2  1_555 D DC 16 1_555 C DC 3  1_555 D DG 15 1_555 1.046  0.156  3.312 5.400  -1.966 35.246 0.549  -0.897 3.417 -3.220 
-8.845  35.697 2  CC_DG2DC3:DG15DC16_DD C 2  ? D 16 ? C 3  ? D 15 ? 
1 C DC 3  1_555 D DG 15 1_555 C DT 4  1_555 D DA 14 1_555 -0.267 0.308  3.434 -1.832 3.386  26.987 -0.241 0.083  3.456 7.209  
3.900   27.255 3  CC_DC3DT4:DA14DG15_DD C 3  ? D 15 ? C 4  ? D 14 ? 
1 C DT 4  1_555 D DA 14 1_555 C DT 5  1_555 D DA 13 1_555 1.761  0.269  3.209 5.470  5.908  39.576 -0.291 -1.922 3.417 8.617  
-7.978  40.354 4  CC_DT4DT5:DA13DA14_DD C 4  ? D 14 ? C 5  ? D 13 ? 
1 C DT 5  1_555 D DA 13 1_555 C DA 6  1_555 D DT 12 1_555 -1.111 0.736  3.254 -1.535 3.267  41.727 0.686  1.393  3.337 4.576  
2.150   41.876 5  CC_DT5DA6:DT12DA13_DD C 5  ? D 13 ? C 6  ? D 12 ? 
1 C DA 6  1_555 D DT 12 1_555 C DA 7  1_555 D DT 11 1_555 0.460  -0.564 3.374 -5.530 5.320  36.162 -1.615 -1.480 3.160 8.454  
8.788   36.940 6  CC_DA6DA7:DT11DT12_DD C 6  ? D 12 ? C 7  ? D 11 ? 
1 C DA 7  1_555 D DT 11 1_555 C DT 8  1_555 D DA 10 1_555 -0.554 -0.964 3.246 -2.179 -4.196 28.355 -0.982 0.617  3.382 -8.491 
4.410   28.738 7  CC_DA7DT8:DA10DT11_DD C 7  ? D 11 ? C 8  ? D 10 ? 
1 C DT 8  1_555 D DA 10 1_555 C DT 9  1_555 D DA 9  1_555 -0.449 -0.503 3.257 7.692  3.913  32.076 -1.519 2.041  2.992 6.927  
-13.615 33.187 8  CC_DT8DT9:DA9DA10_DD  C 8  ? D 10 ? C 9  ? D 9  ? 
1 C DT 9  1_555 D DA 9  1_555 C DA 10 1_555 D DT 8  1_555 -0.200 1.010  3.309 -3.618 12.114 38.648 0.022  -0.139 3.464 17.735 
5.297   40.588 9  CC_DT9DA10:DT8DA9_DD  C 9  ? D 9  ? C 10 ? D 8  ? 
1 C DA 10 1_555 D DT 8  1_555 C DA 11 1_555 D DT 7  1_555 0.518  -0.879 3.543 -6.041 1.895  33.318 -1.832 -1.921 3.346 3.268  
10.419  33.898 10 CC_DA10DA11:DT7DT8_DD C 10 ? D 8  ? C 11 ? D 7  ? 
1 C DA 11 1_555 D DT 7  1_555 C DT 12 1_555 D DA 6  1_555 -0.739 -0.752 3.210 0.961  1.831  29.241 -1.869 1.662  3.133 3.621  
-1.901  29.312 11 CC_DA11DT12:DA6DT7_DD C 11 ? D 7  ? C 12 ? D 6  ? 
1 C DT 12 1_555 D DA 6  1_555 C DT 13 1_555 D DA 5  1_555 -1.252 0.113  3.387 -0.351 11.387 29.663 -1.985 2.222  3.225 21.279 
0.656   31.729 12 CC_DT12DT13:DA5DA6_DD C 12 ? D 6  ? C 13 ? D 5  ? 
1 C DT 13 1_555 D DA 5  1_555 C DG 14 1_555 D DC 4  1_555 0.687  0.539  3.447 1.898  4.624  31.138 0.069  -0.886 3.523 8.545  
-3.507  31.526 13 CC_DT13DG14:DC4DA5_DD C 13 ? D 5  ? C 14 ? D 4  ? 
1 C DG 14 1_555 D DC 4  1_555 C DC 15 1_555 D DG 3  1_555 -0.896 0.140  3.101 -1.318 1.306  36.629 0.051  1.252  3.133 2.076  
2.096   36.675 14 CC_DG14DC15:DG3DC4_DD C 14 ? D 4  ? C 15 ? D 3  ? 
1 C DC 15 1_555 D DG 3  1_555 C DG 16 1_555 D DC 2  1_555 0.394  0.072  3.118 -4.245 7.768  30.871 -1.194 -1.438 2.969 14.229 
7.776   32.085 15 CC_DC15DG16:DC2DG3_DD C 15 ? D 3  ? C 16 ? D 2  ? 
1 C DG 16 1_555 D DC 2  1_555 C DG 17 1_555 D DC 1  1_555 -0.515 -0.794 3.681 -3.286 7.510  37.989 -2.211 0.330  3.499 11.375 
4.977   38.831 16 CC_DG16DG17:DC1DC2_DD C 16 ? D 2  ? C 17 ? D 1  ? 
1 G DG 1  1_555 H DC 17 1_555 G DG 2  1_555 H DC 16 1_555 -0.175 -0.249 3.480 0.513  4.222  37.469 -0.964 0.342  3.430 6.546  
-0.796  37.701 17 GG_DG1DG2:DC16DC17_HH G 1  ? H 17 ? G 2  ? H 16 ? 
1 G DG 2  1_555 H DC 16 1_555 G DC 3  1_555 H DG 15 1_555 0.380  0.921  3.180 -0.125 -2.875 35.093 1.934  -0.646 3.095 -4.758 
0.207   35.207 18 GG_DG2DC3:DG15DC16_HH G 2  ? H 16 ? G 3  ? H 15 ? 
1 G DC 3  1_555 H DG 15 1_555 G DT 4  1_555 H DA 14 1_555 -0.454 0.362  3.066 5.143  3.057  29.016 0.106  1.901  2.965 6.021  
-10.129 29.614 19 GG_DC3DT4:DA14DG15_HH G 3  ? H 15 ? G 4  ? H 14 ? 
1 G DT 4  1_555 H DA 14 1_555 G DT 5  1_555 H DA 13 1_555 2.301  0.662  2.951 4.388  3.885  40.380 0.543  -2.843 3.220 5.592  
-6.317  40.786 20 GG_DT4DT5:DA13DA14_HH G 4  ? H 14 ? G 5  ? H 13 ? 
1 G DT 5  1_555 H DA 13 1_555 G DA 6  1_555 H DT 12 1_555 -1.068 0.934  3.746 -2.871 5.332  43.816 0.657  1.105  3.887 7.105  
3.825   44.212 21 GG_DT5DA6:DT12DA13_HH G 5  ? H 13 ? G 6  ? H 12 ? 
1 G DA 6  1_555 H DT 12 1_555 G DA 7  1_555 H DT 11 1_555 0.086  -0.806 3.315 -4.810 4.330  39.608 -1.668 -0.674 3.181 6.339  
7.040   40.112 22 GG_DA6DA7:DT11DT12_HH G 6  ? H 12 ? G 7  ? H 11 ? 
1 G DA 7  1_555 H DT 11 1_555 G DT 8  1_555 H DA 10 1_555 -0.292 -0.914 3.327 0.030  0.000  26.426 -1.999 0.648  3.326 0.001  
-0.065  26.426 23 GG_DA7DT8:DA10DT11_HH G 7  ? H 11 ? G 8  ? H 10 ? 
1 G DT 8  1_555 H DA 10 1_555 G DT 9  1_555 H DA 9  1_555 -0.798 -0.189 3.094 1.786  4.362  30.780 -1.132 1.806  2.989 8.158  
-3.340  31.130 24 GG_DT8DT9:DA9DA10_HH  G 8  ? H 10 ? G 9  ? H 9  ? 
1 G DT 9  1_555 H DA 9  1_555 G DA 10 1_555 H DT 8  1_555 -0.083 0.799  3.750 -2.246 9.859  37.000 -0.240 -0.205 3.830 15.190 
3.460   38.310 25 GG_DT9DA10:DT8DA9_HH  G 9  ? H 9  ? G 10 ? H 8  ? 
1 G DA 10 1_555 H DT 8  1_555 G DA 11 1_555 H DT 7  1_555 0.526  -0.719 3.267 -7.255 2.902  32.342 -1.728 -2.100 3.008 5.117  
12.793  33.248 26 GG_DA10DA11:DT7DT8_HH G 10 ? H 8  ? G 11 ? H 7  ? 
1 G DA 11 1_555 H DT 7  1_555 G DT 12 1_555 H DA 6  1_555 -0.840 -0.872 3.017 3.928  3.627  25.893 -2.761 2.762  2.716 7.987  
-8.648  26.430 27 GG_DA11DT12:DA6DT7_HH G 11 ? H 7  ? G 12 ? H 6  ? 
1 G DT 12 1_555 H DA 6  1_555 G DT 13 1_555 H DA 5  1_555 -1.074 -0.099 3.596 -3.578 9.611  32.220 -1.905 1.202  3.519 16.795 
6.253   33.771 28 GG_DT12DT13:DA5DA6_HH G 12 ? H 6  ? G 13 ? H 5  ? 
1 G DT 13 1_555 H DA 5  1_555 G DG 14 1_555 H DC 4  1_555 0.940  0.676  3.299 0.275  2.924  34.064 0.680  -1.554 3.351 4.980  
-0.469  34.187 29 GG_DT13DG14:DC4DA5_HH G 13 ? H 5  ? G 14 ? H 4  ? 
1 G DG 14 1_555 H DC 4  1_555 G DC 15 1_555 H DG 3  1_555 -1.107 -0.397 3.223 -1.152 3.752  36.595 -1.131 1.599  3.200 5.954  
1.828   36.798 30 GG_DG14DC15:DG3DC4_HH G 14 ? H 4  ? G 15 ? H 3  ? 
1 G DC 15 1_555 H DG 3  1_555 G DG 16 1_555 H DC 2  1_555 0.298  -0.346 3.055 -2.786 9.940  28.013 -2.566 -1.110 2.734 19.708 
5.523   29.819 31 GG_DC15DG16:DC2DG3_HH G 15 ? H 3  ? G 16 ? H 2  ? 
1 G DG 16 1_555 H DC 2  1_555 G DG 17 1_555 H DC 1  1_555 -0.265 -0.767 3.656 -3.735 11.172 41.055 -2.285 -0.047 3.356 15.548 
5.198   42.641 32 GG_DG16DG17:DC1DC2_HH G 16 ? H 2  ? G 17 ? H 1  ? 
#