data_3A1A
# 
_entry.id   3A1A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3A1A         
RCSB  RCSB028685   
WWPDB D_1000028685 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3A1B 
_pdbx_database_related.details        'DNMT3A ADD domain in complex with histone H3' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3A1A 
_pdbx_database_status.recvd_initial_deposition_date   2009-03-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Otani, J.'     1 
'Arita, K.'     2 
'Ariyoshi, M.'  3 
'Shirakawa, M.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for recognition of H3K4 methylation status by the DNA methyltransferase 3A ATRX-DNMT3-DNMT3L domain' 
_citation.journal_abbrev            'Embo Rep.' 
_citation.journal_volume            10 
_citation.page_first                1235 
_citation.page_last                 1241 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1469-221X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19834512 
_citation.pdbx_database_id_DOI      10.1038/embor.2009.218 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Otani, J.'     1 
primary 'Nankumo, T.'   2 
primary 'Arita, K.'     3 
primary 'Inamoto, S.'   4 
primary 'Ariyoshi, M.'  5 
primary 'Shirakawa, M.' 6 
# 
_cell.entry_id           3A1A 
_cell.length_a           57.581 
_cell.length_b           57.581 
_cell.length_c           138.949 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3A1A 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA (cytosine-5)-methyltransferase 3A' 16311.703 1  2.1.1.37 ? 
'ADD(ATRX-DNMT3-DNMT3L) domain, residues 476-614' ? 
2 non-polymer syn 'ZINC ION'                              65.409    3  ?        ? ? ? 
3 non-polymer syn 1,2-ETHANEDIOL                          62.068    1  ?        ? ? ? 
4 water       nat water                                   18.015    17 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dnmt3a, DNA methyltransferase HsaIIIA, DNA MTase HsaIIIA, M.HsaIIIA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCG
NNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCG
NNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   ARG n 
1 7   GLU n 
1 8   ARG n 
1 9   LEU n 
1 10  VAL n 
1 11  TYR n 
1 12  GLU n 
1 13  VAL n 
1 14  ARG n 
1 15  GLN n 
1 16  LYS n 
1 17  CYS n 
1 18  ARG n 
1 19  ASN n 
1 20  ILE n 
1 21  GLU n 
1 22  ASP n 
1 23  ILE n 
1 24  CYS n 
1 25  ILE n 
1 26  SER n 
1 27  CYS n 
1 28  GLY n 
1 29  SER n 
1 30  LEU n 
1 31  ASN n 
1 32  VAL n 
1 33  THR n 
1 34  LEU n 
1 35  GLU n 
1 36  HIS n 
1 37  PRO n 
1 38  LEU n 
1 39  PHE n 
1 40  VAL n 
1 41  GLY n 
1 42  GLY n 
1 43  MET n 
1 44  CYS n 
1 45  GLN n 
1 46  ASN n 
1 47  CYS n 
1 48  LYS n 
1 49  ASN n 
1 50  CYS n 
1 51  PHE n 
1 52  LEU n 
1 53  GLU n 
1 54  CYS n 
1 55  ALA n 
1 56  TYR n 
1 57  GLN n 
1 58  TYR n 
1 59  ASP n 
1 60  ASP n 
1 61  ASP n 
1 62  GLY n 
1 63  TYR n 
1 64  GLN n 
1 65  SER n 
1 66  TYR n 
1 67  CYS n 
1 68  THR n 
1 69  ILE n 
1 70  CYS n 
1 71  CYS n 
1 72  GLY n 
1 73  GLY n 
1 74  ARG n 
1 75  GLU n 
1 76  VAL n 
1 77  LEU n 
1 78  MET n 
1 79  CYS n 
1 80  GLY n 
1 81  ASN n 
1 82  ASN n 
1 83  ASN n 
1 84  CYS n 
1 85  CYS n 
1 86  ARG n 
1 87  CYS n 
1 88  PHE n 
1 89  CYS n 
1 90  VAL n 
1 91  GLU n 
1 92  CYS n 
1 93  VAL n 
1 94  ASP n 
1 95  LEU n 
1 96  LEU n 
1 97  VAL n 
1 98  GLY n 
1 99  PRO n 
1 100 GLY n 
1 101 ALA n 
1 102 ALA n 
1 103 GLN n 
1 104 ALA n 
1 105 ALA n 
1 106 ILE n 
1 107 LYS n 
1 108 GLU n 
1 109 ASP n 
1 110 PRO n 
1 111 TRP n 
1 112 ASN n 
1 113 CYS n 
1 114 TYR n 
1 115 MET n 
1 116 CYS n 
1 117 GLY n 
1 118 HIS n 
1 119 LYS n 
1 120 GLY n 
1 121 THR n 
1 122 TYR n 
1 123 GLY n 
1 124 LEU n 
1 125 LEU n 
1 126 ARG n 
1 127 ARG n 
1 128 ARG n 
1 129 GLU n 
1 130 ASP n 
1 131 TRP n 
1 132 PRO n 
1 133 SER n 
1 134 ARG n 
1 135 LEU n 
1 136 GLN n 
1 137 MET n 
1 138 PHE n 
1 139 PHE n 
1 140 ALA n 
1 141 ASN n 
1 142 ASN n 
1 143 HIS n 
1 144 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 DNMT3A 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DNM3A_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y6K1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCC
RCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHD
;
_struct_ref.pdbx_align_begin           476 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3A1A 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 144 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9Y6K1 
_struct_ref_seq.db_align_beg                  476 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  614 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       476 
_struct_ref_seq.pdbx_auth_seq_align_end       614 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3A1A GLY A 1 ? UNP Q9Y6K1 ? ? 'EXPRESSION TAG' 471 1 
1 3A1A PRO A 2 ? UNP Q9Y6K1 ? ? 'EXPRESSION TAG' 472 2 
1 3A1A LEU A 3 ? UNP Q9Y6K1 ? ? 'EXPRESSION TAG' 473 3 
1 3A1A GLY A 4 ? UNP Q9Y6K1 ? ? 'EXPRESSION TAG' 474 4 
1 3A1A SER A 5 ? UNP Q9Y6K1 ? ? 'EXPRESSION TAG' 475 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                 'Zn 2'           65.409  
# 
_exptl.entry_id          3A1A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.04 
_exptl_crystal.density_percent_sol   39.65 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'17% PEG 8000, 0.1M Tris-HCl, 0.2M magnesium sulfate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1   100.0 ? 1 
2   100.0 ? 1 
1,2 ?     ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 315' 2007-10-19 mirrors 
2 CCD 'ADSC QUANTUM 315' 2007-10-19 mirrors 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 1 M ? MAD                 x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0     1.0 
2 1.28221 1.0 
3 1.28333 1.0 
4 1.25730 1.0 
5 1.29001 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'PHOTON FACTORY BEAMLINE BL-5A' 'Photon Factory' BL-5A ? 1.0                                  
2 SYNCHROTRON 'PHOTON FACTORY BEAMLINE BL-5A' 'Photon Factory' BL-5A ? '1.28221, 1.28333, 1.25730, 1.29001' 
# 
_reflns.entry_id                     3A1A 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.observed_criterion_sigma_I   1 
_reflns.d_resolution_high            2.3 
_reflns.d_resolution_low             28.796 
_reflns.number_all                   6567 
_reflns.number_obs                   6551 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              12.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   99.2 
_reflns_shell.Rmerge_I_obs           0.410 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        12.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 3A1A 
_refine.ls_number_reflns_obs                     6245 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.79 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.42 
_refine.ls_R_factor_obs                          0.21113 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20938 
_refine.ls_R_factor_R_free                       0.24968 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  306 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.939 
_refine.correlation_coeff_Fo_to_Fc_free          0.919 
_refine.B_iso_mean                               45.477 
_refine.aniso_B[1][1]                            0.17 
_refine.aniso_B[2][2]                            0.17 
_refine.aniso_B[3][3]                            -0.26 
_refine.aniso_B[1][2]                            0.09 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.360 
_refine.pdbx_overall_ESU_R_Free                  0.242 
_refine.overall_SU_ML                            0.170 
_refine.overall_SU_B                             12.429 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1035 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             17 
_refine_hist.number_atoms_total               1059 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        28.79 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.021  ? 1065 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.316  1.948  ? 1432 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.224  5.000  ? 132  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.672 23.333 ? 54   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.831 15.000 ? 179  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.497 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.099  0.200  ? 147  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 829  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.203  0.200  ? 453  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.302  0.200  ? 715  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.152  0.200  ? 37   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.189  0.200  ? 34   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.193  0.200  ? 6    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.463  1.500  ? 675  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.825  2.000  ? 1044 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.419  3.000  ? 451  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.999  4.500  ? 388  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.359 
_refine_ls_shell.number_reflns_R_work             431 
_refine_ls_shell.R_factor_R_work                  0.205 
_refine_ls_shell.percent_reflns_obs               99.13 
_refine_ls_shell.R_factor_R_free                  0.285 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             27 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3A1A 
_struct.title                     'Crystal Structure of the DNMT3A ADD domain' 
_struct.pdbx_descriptor           'DNA (cytosine-5)-methyltransferase 3A (E.C.2.1.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3A1A 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;zinc-finger, Alternative promoter usage, DNA-binding, Metal-binding, Methyltransferase, Nucleus, Phosphoprotein, S-adenosyl-L-methionine, Transferase
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 4   ? GLN A 15  ? GLY A 474 GLN A 485 1 ? 12 
HELX_P HELX_P2 2 ASN A 19  ? ILE A 23  ? ASN A 489 ILE A 493 5 ? 5  
HELX_P HELX_P3 3 CYS A 44  ? ALA A 55  ? CYS A 514 ALA A 525 1 ? 12 
HELX_P HELX_P4 4 VAL A 90  ? VAL A 97  ? VAL A 560 VAL A 567 1 ? 8  
HELX_P HELX_P5 5 GLY A 100 ? ILE A 106 ? GLY A 570 ILE A 576 1 ? 7  
HELX_P HELX_P6 6 ASP A 130 ? PHE A 139 ? ASP A 600 PHE A 609 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 24  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 494 A ZN 1 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc2  metalc ? ? A CYS 27  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 497 A ZN 1 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc3  metalc ? ? A CYS 44  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 514 A ZN 1 1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc4  metalc ? ? A CYS 47  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 517 A ZN 1 1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc5  metalc ? ? A CYS 67  SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 537 A ZN 2 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc6  metalc ? ? A CYS 70  SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 540 A ZN 2 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc7  metalc ? ? A CYS 79  SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 549 A ZN 3 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc8  metalc ? ? A CYS 84  SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 554 A ZN 3 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc9  metalc ? ? A CYS 89  SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 559 A ZN 2 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc10 metalc ? ? A CYS 92  SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 562 A ZN 2 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc11 metalc ? ? A CYS 113 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 583 A ZN 3 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc12 metalc ? ? A CYS 116 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 586 A ZN 3 1_555 ? ? ? ? ? ? ? 2.393 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 34  ? GLU A 35  ? LEU A 504 GLU A 505 
A 2 GLY A 42  ? MET A 43  ? GLY A 512 MET A 513 
B 1 VAL A 76  ? MET A 78  ? VAL A 546 MET A 548 
B 2 CYS A 87  ? CYS A 89  ? CYS A 557 CYS A 559 
C 1 THR A 121 ? TYR A 122 ? THR A 591 TYR A 592 
C 2 LEU A 125 ? ARG A 126 ? LEU A 595 ARG A 596 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 34  ? N LEU A 504 O MET A 43  ? O MET A 513 
B 1 2 N LEU A 77  ? N LEU A 547 O PHE A 88  ? O PHE A 558 
C 1 2 N TYR A 122 ? N TYR A 592 O LEU A 125 ? O LEU A 595 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 3'  
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EDO A 4' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 24  ? CYS A 494 . ? 1_555 ? 
2  AC1 4 CYS A 27  ? CYS A 497 . ? 1_555 ? 
3  AC1 4 CYS A 44  ? CYS A 514 . ? 1_555 ? 
4  AC1 4 CYS A 47  ? CYS A 517 . ? 1_555 ? 
5  AC2 4 CYS A 67  ? CYS A 537 . ? 1_555 ? 
6  AC2 4 CYS A 70  ? CYS A 540 . ? 1_555 ? 
7  AC2 4 CYS A 89  ? CYS A 559 . ? 1_555 ? 
8  AC2 4 CYS A 92  ? CYS A 562 . ? 1_555 ? 
9  AC3 4 CYS A 79  ? CYS A 549 . ? 1_555 ? 
10 AC3 4 CYS A 84  ? CYS A 554 . ? 1_555 ? 
11 AC3 4 CYS A 113 ? CYS A 583 . ? 1_555 ? 
12 AC3 4 CYS A 116 ? CYS A 586 . ? 1_555 ? 
13 AC4 7 HOH F .   ? HOH A 14  . ? 1_555 ? 
14 AC4 7 PHE A 51  ? PHE A 521 . ? 1_555 ? 
15 AC4 7 CYS A 54  ? CYS A 524 . ? 1_555 ? 
16 AC4 7 ALA A 55  ? ALA A 525 . ? 1_555 ? 
17 AC4 7 TYR A 66  ? TYR A 536 . ? 1_555 ? 
18 AC4 7 CYS A 67  ? CYS A 537 . ? 1_555 ? 
19 AC4 7 CYS A 71  ? CYS A 541 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3A1A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3A1A 
_atom_sites.fract_transf_matrix[1][1]   0.017367 
_atom_sites.fract_transf_matrix[1][2]   0.010027 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020053 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007197 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 4   ? 4.241   -11.723 -15.252 1.00 46.88 ? 474 GLY A N   1 
ATOM   2    C  CA  . GLY A 1 4   ? 4.863   -12.416 -14.084 1.00 46.56 ? 474 GLY A CA  1 
ATOM   3    C  C   . GLY A 1 4   ? 5.023   -11.491 -12.891 1.00 46.69 ? 474 GLY A C   1 
ATOM   4    O  O   . GLY A 1 4   ? 6.044   -11.517 -12.200 1.00 46.47 ? 474 GLY A O   1 
ATOM   5    N  N   . SER A 1 5   ? 3.993   -10.693 -12.636 1.00 46.84 ? 475 SER A N   1 
ATOM   6    C  CA  . SER A 1 5   ? 4.062   -9.617  -11.653 1.00 47.64 ? 475 SER A CA  1 
ATOM   7    C  C   . SER A 1 5   ? 4.070   -10.122 -10.218 1.00 47.82 ? 475 SER A C   1 
ATOM   8    O  O   . SER A 1 5   ? 4.741   -9.573  -9.356  1.00 47.69 ? 475 SER A O   1 
ATOM   9    C  CB  . SER A 1 5   ? 2.897   -8.646  -11.859 1.00 47.85 ? 475 SER A CB  1 
ATOM   10   O  OG  . SER A 1 5   ? 3.086   -7.463  -11.109 1.00 47.90 ? 475 SER A OG  1 
ATOM   11   N  N   . ARG A 1 6   ? 3.314   -11.177 -9.979  1.00 48.25 ? 476 ARG A N   1 
ATOM   12   C  CA  . ARG A 1 6   ? 3.125   -11.729 -8.646  1.00 48.78 ? 476 ARG A CA  1 
ATOM   13   C  C   . ARG A 1 6   ? 4.368   -12.515 -8.230  1.00 49.10 ? 476 ARG A C   1 
ATOM   14   O  O   . ARG A 1 6   ? 4.819   -12.447 -7.087  1.00 49.08 ? 476 ARG A O   1 
ATOM   15   C  CB  . ARG A 1 6   ? 1.893   -12.624 -8.693  1.00 48.90 ? 476 ARG A CB  1 
ATOM   16   C  CG  . ARG A 1 6   ? 1.321   -13.087 -7.389  1.00 49.10 ? 476 ARG A CG  1 
ATOM   17   C  CD  . ARG A 1 6   ? 0.492   -14.302 -7.739  1.00 49.92 ? 476 ARG A CD  1 
ATOM   18   N  NE  . ARG A 1 6   ? -0.245  -14.817 -6.608  1.00 50.75 ? 476 ARG A NE  1 
ATOM   19   C  CZ  . ARG A 1 6   ? -0.656  -16.073 -6.495  1.00 51.64 ? 476 ARG A CZ  1 
ATOM   20   N  NH1 . ARG A 1 6   ? -0.365  -16.972 -7.433  1.00 51.32 ? 476 ARG A NH1 1 
ATOM   21   N  NH2 . ARG A 1 6   ? -1.339  -16.432 -5.419  1.00 49.89 ? 476 ARG A NH2 1 
ATOM   22   N  N   . GLU A 1 7   ? 4.911   -13.255 -9.186  1.00 49.31 ? 477 GLU A N   1 
ATOM   23   C  CA  . GLU A 1 7   ? 6.158   -13.963 -9.033  1.00 49.56 ? 477 GLU A CA  1 
ATOM   24   C  C   . GLU A 1 7   ? 7.266   -12.973 -8.630  1.00 49.35 ? 477 GLU A C   1 
ATOM   25   O  O   . GLU A 1 7   ? 7.974   -13.201 -7.648  1.00 48.76 ? 477 GLU A O   1 
ATOM   26   C  CB  . GLU A 1 7   ? 6.490   -14.679 -10.348 1.00 49.21 ? 477 GLU A CB  1 
ATOM   27   C  CG  . GLU A 1 7   ? 7.371   -15.910 -10.203 1.00 50.76 ? 477 GLU A CG  1 
ATOM   28   C  CD  . GLU A 1 7   ? 7.270   -16.858 -11.399 1.00 51.09 ? 477 GLU A CD  1 
ATOM   29   O  OE1 . GLU A 1 7   ? 6.293   -17.648 -11.459 1.00 53.89 ? 477 GLU A OE1 1 
ATOM   30   O  OE2 . GLU A 1 7   ? 8.170   -16.824 -12.269 1.00 51.42 ? 477 GLU A OE2 1 
ATOM   31   N  N   . ARG A 1 8   ? 7.375   -11.864 -9.364  1.00 49.18 ? 478 ARG A N   1 
ATOM   32   C  CA  . ARG A 1 8   ? 8.432   -10.885 -9.135  1.00 49.72 ? 478 ARG A CA  1 
ATOM   33   C  C   . ARG A 1 8   ? 8.250   -10.177 -7.800  1.00 49.24 ? 478 ARG A C   1 
ATOM   34   O  O   . ARG A 1 8   ? 9.224   -9.930  -7.092  1.00 49.14 ? 478 ARG A O   1 
ATOM   35   C  CB  . ARG A 1 8   ? 8.553   -9.879  -10.304 1.00 49.74 ? 478 ARG A CB  1 
ATOM   36   C  CG  . ARG A 1 8   ? 8.292   -8.392  -9.962  1.00 50.76 ? 478 ARG A CG  1 
ATOM   37   C  CD  . ARG A 1 8   ? 8.521   -7.455  -11.175 1.00 51.12 ? 478 ARG A CD  1 
ATOM   38   N  NE  . ARG A 1 8   ? 7.648   -7.859  -12.278 1.00 54.17 ? 478 ARG A NE  1 
ATOM   39   C  CZ  . ARG A 1 8   ? 7.864   -7.622  -13.567 1.00 54.83 ? 478 ARG A CZ  1 
ATOM   40   N  NH1 . ARG A 1 8   ? 8.938   -6.949  -13.970 1.00 56.76 ? 478 ARG A NH1 1 
ATOM   41   N  NH2 . ARG A 1 8   ? 6.987   -8.064  -14.460 1.00 55.79 ? 478 ARG A NH2 1 
ATOM   42   N  N   . LEU A 1 9   ? 7.008   -9.865  -7.446  1.00 49.14 ? 479 LEU A N   1 
ATOM   43   C  CA  . LEU A 1 9   ? 6.756   -9.173  -6.180  1.00 49.32 ? 479 LEU A CA  1 
ATOM   44   C  C   . LEU A 1 9   ? 7.069   -10.067 -4.986  1.00 49.27 ? 479 LEU A C   1 
ATOM   45   O  O   . LEU A 1 9   ? 7.647   -9.618  -3.992  1.00 49.87 ? 479 LEU A O   1 
ATOM   46   C  CB  . LEU A 1 9   ? 5.330   -8.627  -6.108  1.00 48.91 ? 479 LEU A CB  1 
ATOM   47   C  CG  . LEU A 1 9   ? 5.064   -7.404  -6.986  1.00 49.18 ? 479 LEU A CG  1 
ATOM   48   C  CD1 . LEU A 1 9   ? 3.589   -7.092  -6.968  1.00 49.69 ? 479 LEU A CD1 1 
ATOM   49   C  CD2 . LEU A 1 9   ? 5.868   -6.197  -6.556  1.00 46.86 ? 479 LEU A CD2 1 
ATOM   50   N  N   . VAL A 1 10  ? 6.722   -11.340 -5.113  1.00 48.79 ? 480 VAL A N   1 
ATOM   51   C  CA  . VAL A 1 10  ? 7.045   -12.338 -4.094  1.00 48.87 ? 480 VAL A CA  1 
ATOM   52   C  C   . VAL A 1 10  ? 8.561   -12.564 -4.003  1.00 49.30 ? 480 VAL A C   1 
ATOM   53   O  O   . VAL A 1 10  ? 9.088   -12.831 -2.923  1.00 49.62 ? 480 VAL A O   1 
ATOM   54   C  CB  . VAL A 1 10  ? 6.258   -13.647 -4.341  1.00 48.76 ? 480 VAL A CB  1 
ATOM   55   C  CG1 . VAL A 1 10  ? 6.724   -14.780 -3.441  1.00 48.11 ? 480 VAL A CG1 1 
ATOM   56   C  CG2 . VAL A 1 10  ? 4.751   -13.379 -4.174  1.00 46.80 ? 480 VAL A CG2 1 
ATOM   57   N  N   . TYR A 1 11  ? 9.252   -12.415 -5.132  1.00 49.25 ? 481 TYR A N   1 
ATOM   58   C  CA  . TYR A 1 11  ? 10.696  -12.564 -5.181  1.00 49.26 ? 481 TYR A CA  1 
ATOM   59   C  C   . TYR A 1 11  ? 11.372  -11.444 -4.410  1.00 49.32 ? 481 TYR A C   1 
ATOM   60   O  O   . TYR A 1 11  ? 12.397  -11.666 -3.752  1.00 49.27 ? 481 TYR A O   1 
ATOM   61   C  CB  . TYR A 1 11  ? 11.193  -12.598 -6.627  1.00 49.51 ? 481 TYR A CB  1 
ATOM   62   C  CG  . TYR A 1 11  ? 10.912  -13.898 -7.364  1.00 50.28 ? 481 TYR A CG  1 
ATOM   63   C  CD1 . TYR A 1 11  ? 10.148  -14.924 -6.776  1.00 49.96 ? 481 TYR A CD1 1 
ATOM   64   C  CD2 . TYR A 1 11  ? 11.390  -14.096 -8.660  1.00 50.37 ? 481 TYR A CD2 1 
ATOM   65   C  CE1 . TYR A 1 11  ? 9.882   -16.103 -7.456  1.00 49.88 ? 481 TYR A CE1 1 
ATOM   66   C  CE2 . TYR A 1 11  ? 11.135  -15.282 -9.342  1.00 50.56 ? 481 TYR A CE2 1 
ATOM   67   C  CZ  . TYR A 1 11  ? 10.382  -16.274 -8.728  1.00 49.90 ? 481 TYR A CZ  1 
ATOM   68   O  OH  . TYR A 1 11  ? 10.127  -17.440 -9.395  1.00 51.20 ? 481 TYR A OH  1 
ATOM   69   N  N   . GLU A 1 12  ? 10.790  -10.249 -4.465  1.00 48.89 ? 482 GLU A N   1 
ATOM   70   C  CA  . GLU A 1 12  ? 11.352  -9.146  -3.714  1.00 48.96 ? 482 GLU A CA  1 
ATOM   71   C  C   . GLU A 1 12  ? 10.915  -9.074  -2.238  1.00 48.62 ? 482 GLU A C   1 
ATOM   72   O  O   . GLU A 1 12  ? 11.622  -8.484  -1.410  1.00 48.26 ? 482 GLU A O   1 
ATOM   73   C  CB  . GLU A 1 12  ? 11.232  -7.813  -4.463  1.00 49.30 ? 482 GLU A CB  1 
ATOM   74   C  CG  . GLU A 1 12  ? 9.847   -7.272  -4.711  1.00 50.96 ? 482 GLU A CG  1 
ATOM   75   C  CD  . GLU A 1 12  ? 9.859   -6.227  -5.819  1.00 53.56 ? 482 GLU A CD  1 
ATOM   76   O  OE1 . GLU A 1 12  ? 10.078  -6.610  -6.988  1.00 56.29 ? 482 GLU A OE1 1 
ATOM   77   O  OE2 . GLU A 1 12  ? 9.670   -5.023  -5.532  1.00 54.72 ? 482 GLU A OE2 1 
ATOM   78   N  N   . VAL A 1 13  ? 9.774   -9.683  -1.909  1.00 48.23 ? 483 VAL A N   1 
ATOM   79   C  CA  . VAL A 1 13  ? 9.447   -9.962  -0.504  1.00 47.98 ? 483 VAL A CA  1 
ATOM   80   C  C   . VAL A 1 13  ? 10.583  -10.780 0.126   1.00 47.54 ? 483 VAL A C   1 
ATOM   81   O  O   . VAL A 1 13  ? 11.143  -10.403 1.164   1.00 48.07 ? 483 VAL A O   1 
ATOM   82   C  CB  . VAL A 1 13  ? 8.085   -10.714 -0.340  1.00 48.23 ? 483 VAL A CB  1 
ATOM   83   C  CG1 . VAL A 1 13  ? 7.889   -11.168 1.113   1.00 47.70 ? 483 VAL A CG1 1 
ATOM   84   C  CG2 . VAL A 1 13  ? 6.908   -9.823  -0.789  1.00 46.87 ? 483 VAL A CG2 1 
ATOM   85   N  N   . ARG A 1 14  ? 10.944  -11.869 -0.540  1.00 46.99 ? 484 ARG A N   1 
ATOM   86   C  CA  . ARG A 1 14  ? 11.973  -12.799 -0.067  1.00 46.73 ? 484 ARG A CA  1 
ATOM   87   C  C   . ARG A 1 14  ? 13.343  -12.139 0.004   1.00 46.59 ? 484 ARG A C   1 
ATOM   88   O  O   . ARG A 1 14  ? 14.132  -12.443 0.899   1.00 47.14 ? 484 ARG A O   1 
ATOM   89   C  CB  . ARG A 1 14  ? 12.004  -14.042 -0.968  1.00 46.19 ? 484 ARG A CB  1 
ATOM   90   C  CG  . ARG A 1 14  ? 13.019  -15.074 -0.586  1.00 45.51 ? 484 ARG A CG  1 
ATOM   91   C  CD  . ARG A 1 14  ? 12.977  -16.271 -1.519  1.00 43.98 ? 484 ARG A CD  1 
ATOM   92   N  NE  . ARG A 1 14  ? 11.778  -17.085 -1.325  1.00 42.27 ? 484 ARG A NE  1 
ATOM   93   C  CZ  . ARG A 1 14  ? 10.831  -17.275 -2.240  1.00 41.96 ? 484 ARG A CZ  1 
ATOM   94   N  NH1 . ARG A 1 14  ? 10.924  -16.714 -3.451  1.00 39.92 ? 484 ARG A NH1 1 
ATOM   95   N  NH2 . ARG A 1 14  ? 9.782   -18.036 -1.941  1.00 41.29 ? 484 ARG A NH2 1 
ATOM   96   N  N   . GLN A 1 15  ? 13.617  -11.222 -0.926  1.00 46.74 ? 485 GLN A N   1 
ATOM   97   C  CA  . GLN A 1 15  ? 14.875  -10.475 -0.939  1.00 46.48 ? 485 GLN A CA  1 
ATOM   98   C  C   . GLN A 1 15  ? 14.834  -9.293  0.029   1.00 45.87 ? 485 GLN A C   1 
ATOM   99   O  O   . GLN A 1 15  ? 15.814  -8.551  0.143   1.00 45.31 ? 485 GLN A O   1 
ATOM   100  C  CB  . GLN A 1 15  ? 15.218  -9.981  -2.348  1.00 46.94 ? 485 GLN A CB  1 
ATOM   101  C  CG  . GLN A 1 15  ? 15.414  -11.079 -3.394  1.00 48.88 ? 485 GLN A CG  1 
ATOM   102  C  CD  . GLN A 1 15  ? 16.536  -12.057 -3.059  1.00 50.40 ? 485 GLN A CD  1 
ATOM   103  O  OE1 . GLN A 1 15  ? 17.714  -11.694 -3.028  1.00 49.39 ? 485 GLN A OE1 1 
ATOM   104  N  NE2 . GLN A 1 15  ? 16.166  -13.318 -2.825  1.00 51.32 ? 485 GLN A NE2 1 
ATOM   105  N  N   . LYS A 1 16  ? 13.692  -9.129  0.703   1.00 44.87 ? 486 LYS A N   1 
ATOM   106  C  CA  . LYS A 1 16  ? 13.452  -8.073  1.704   1.00 44.36 ? 486 LYS A CA  1 
ATOM   107  C  C   . LYS A 1 16  ? 13.442  -6.645  1.133   1.00 44.15 ? 486 LYS A C   1 
ATOM   108  O  O   . LYS A 1 16  ? 13.738  -5.685  1.841   1.00 44.08 ? 486 LYS A O   1 
ATOM   109  C  CB  . LYS A 1 16  ? 14.389  -8.212  2.922   1.00 44.24 ? 486 LYS A CB  1 
ATOM   110  C  CG  . LYS A 1 16  ? 14.136  -9.466  3.750   1.00 43.65 ? 486 LYS A CG  1 
ATOM   111  C  CD  . LYS A 1 16  ? 14.882  -9.444  5.068   1.00 44.30 ? 486 LYS A CD  1 
ATOM   112  C  CE  . LYS A 1 16  ? 14.541  -10.672 5.913   1.00 45.06 ? 486 LYS A CE  1 
ATOM   113  N  NZ  . LYS A 1 16  ? 15.554  -10.939 7.000   1.00 46.46 ? 486 LYS A NZ  1 
ATOM   114  N  N   . CYS A 1 17  ? 13.078  -6.525  -0.144  1.00 43.93 ? 487 CYS A N   1 
ATOM   115  C  CA  . CYS A 1 17  ? 12.917  -5.236  -0.817  1.00 43.81 ? 487 CYS A CA  1 
ATOM   116  C  C   . CYS A 1 17  ? 11.475  -4.764  -0.733  1.00 43.95 ? 487 CYS A C   1 
ATOM   117  O  O   . CYS A 1 17  ? 11.171  -3.628  -1.086  1.00 43.62 ? 487 CYS A O   1 
ATOM   118  C  CB  . CYS A 1 17  ? 13.294  -5.351  -2.292  1.00 43.73 ? 487 CYS A CB  1 
ATOM   119  S  SG  . CYS A 1 17  ? 14.960  -5.932  -2.600  1.00 43.89 ? 487 CYS A SG  1 
ATOM   120  N  N   . ARG A 1 18  ? 10.587  -5.648  -0.277  1.00 44.11 ? 488 ARG A N   1 
ATOM   121  C  CA  . ARG A 1 18  ? 9.168   -5.343  -0.222  1.00 44.08 ? 488 ARG A CA  1 
ATOM   122  C  C   . ARG A 1 18  ? 8.461   -6.046  0.915   1.00 44.28 ? 488 ARG A C   1 
ATOM   123  O  O   . ARG A 1 18  ? 8.817   -7.178  1.282   1.00 44.33 ? 488 ARG A O   1 
ATOM   124  C  CB  . ARG A 1 18  ? 8.509   -5.731  -1.528  1.00 44.60 ? 488 ARG A CB  1 
ATOM   125  C  CG  . ARG A 1 18  ? 7.370   -4.811  -1.898  1.00 46.45 ? 488 ARG A CG  1 
ATOM   126  C  CD  . ARG A 1 18  ? 6.912   -5.044  -3.309  1.00 47.39 ? 488 ARG A CD  1 
ATOM   127  N  NE  . ARG A 1 18  ? 7.693   -4.319  -4.304  1.00 47.03 ? 488 ARG A NE  1 
ATOM   128  C  CZ  . ARG A 1 18  ? 7.371   -3.119  -4.774  1.00 47.66 ? 488 ARG A CZ  1 
ATOM   129  N  NH1 . ARG A 1 18  ? 6.296   -2.500  -4.307  1.00 48.61 ? 488 ARG A NH1 1 
ATOM   130  N  NH2 . ARG A 1 18  ? 8.122   -2.538  -5.700  1.00 46.69 ? 488 ARG A NH2 1 
ATOM   131  N  N   . ASN A 1 19  ? 7.470   -5.364  1.485   1.00 44.12 ? 489 ASN A N   1 
ATOM   132  C  CA  . ASN A 1 19  ? 6.586   -5.971  2.469   1.00 44.57 ? 489 ASN A CA  1 
ATOM   133  C  C   . ASN A 1 19  ? 5.418   -6.671  1.767   1.00 44.31 ? 489 ASN A C   1 
ATOM   134  O  O   . ASN A 1 19  ? 4.790   -6.124  0.850   1.00 45.36 ? 489 ASN A O   1 
ATOM   135  C  CB  . ASN A 1 19  ? 6.064   -4.949  3.488   1.00 44.84 ? 489 ASN A CB  1 
ATOM   136  C  CG  . ASN A 1 19  ? 7.178   -4.182  4.191   1.00 46.27 ? 489 ASN A CG  1 
ATOM   137  O  OD1 . ASN A 1 19  ? 7.807   -3.292  3.611   1.00 47.84 ? 489 ASN A OD1 1 
ATOM   138  N  ND2 . ASN A 1 19  ? 7.406   -4.502  5.453   1.00 46.47 ? 489 ASN A ND2 1 
ATOM   139  N  N   . ILE A 1 20  ? 5.128   -7.879  2.206   1.00 43.70 ? 490 ILE A N   1 
ATOM   140  C  CA  . ILE A 1 20  ? 4.039   -8.676  1.645   1.00 43.36 ? 490 ILE A CA  1 
ATOM   141  C  C   . ILE A 1 20  ? 2.651   -8.036  1.838   1.00 43.88 ? 490 ILE A C   1 
ATOM   142  O  O   . ILE A 1 20  ? 1.707   -8.302  1.068   1.00 43.97 ? 490 ILE A O   1 
ATOM   143  C  CB  . ILE A 1 20  ? 4.096   -10.130 2.192   1.00 42.85 ? 490 ILE A CB  1 
ATOM   144  C  CG1 . ILE A 1 20  ? 3.224   -11.065 1.342   1.00 42.29 ? 490 ILE A CG1 1 
ATOM   145  C  CG2 . ILE A 1 20  ? 3.826   -10.172 3.733   1.00 41.97 ? 490 ILE A CG2 1 
ATOM   146  C  CD1 . ILE A 1 20  ? 3.493   -12.529 1.567   1.00 39.44 ? 490 ILE A CD1 1 
ATOM   147  N  N   . GLU A 1 21  ? 2.539   -7.183  2.849   1.00 43.88 ? 491 GLU A N   1 
ATOM   148  C  CA  . GLU A 1 21  ? 1.286   -6.513  3.171   1.00 44.60 ? 491 GLU A CA  1 
ATOM   149  C  C   . GLU A 1 21  ? 0.982   -5.460  2.096   1.00 44.75 ? 491 GLU A C   1 
ATOM   150  O  O   . GLU A 1 21  ? -0.141  -4.942  1.997   1.00 44.64 ? 491 GLU A O   1 
ATOM   151  C  CB  . GLU A 1 21  ? 1.352   -5.876  4.578   1.00 44.29 ? 491 GLU A CB  1 
ATOM   152  C  CG  . GLU A 1 21  ? 1.687   -6.855  5.733   1.00 44.64 ? 491 GLU A CG  1 
ATOM   153  C  CD  . GLU A 1 21  ? 1.122   -6.425  7.102   1.00 46.15 ? 491 GLU A CD  1 
ATOM   154  O  OE1 . GLU A 1 21  ? 1.312   -5.249  7.525   1.00 47.19 ? 491 GLU A OE1 1 
ATOM   155  O  OE2 . GLU A 1 21  ? 0.490   -7.276  7.776   1.00 47.74 ? 491 GLU A OE2 1 
ATOM   156  N  N   . ASP A 1 22  ? 1.993   -5.165  1.282   1.00 45.09 ? 492 ASP A N   1 
ATOM   157  C  CA  . ASP A 1 22  ? 1.906   -4.126  0.260   1.00 45.80 ? 492 ASP A CA  1 
ATOM   158  C  C   . ASP A 1 22  ? 1.583   -4.678  -1.128  1.00 45.99 ? 492 ASP A C   1 
ATOM   159  O  O   . ASP A 1 22  ? 1.452   -3.905  -2.077  1.00 46.13 ? 492 ASP A O   1 
ATOM   160  C  CB  . ASP A 1 22  ? 3.199   -3.282  0.215   1.00 45.55 ? 492 ASP A CB  1 
ATOM   161  C  CG  . ASP A 1 22  ? 3.144   -2.066  1.137   1.00 46.93 ? 492 ASP A CG  1 
ATOM   162  O  OD1 . ASP A 1 22  ? 2.061   -1.769  1.692   1.00 47.82 ? 492 ASP A OD1 1 
ATOM   163  O  OD2 . ASP A 1 22  ? 4.191   -1.394  1.310   1.00 48.47 ? 492 ASP A OD2 1 
ATOM   164  N  N   . ILE A 1 23  ? 1.463   -6.004  -1.236  1.00 46.26 ? 493 ILE A N   1 
ATOM   165  C  CA  . ILE A 1 23  ? 1.101   -6.664  -2.492  1.00 46.59 ? 493 ILE A CA  1 
ATOM   166  C  C   . ILE A 1 23  ? -0.210  -7.448  -2.359  1.00 46.93 ? 493 ILE A C   1 
ATOM   167  O  O   . ILE A 1 23  ? -0.555  -7.937  -1.282  1.00 47.56 ? 493 ILE A O   1 
ATOM   168  C  CB  . ILE A 1 23  ? 2.234   -7.596  -3.025  1.00 46.54 ? 493 ILE A CB  1 
ATOM   169  C  CG1 . ILE A 1 23  ? 2.228   -8.958  -2.318  1.00 46.96 ? 493 ILE A CG1 1 
ATOM   170  C  CG2 . ILE A 1 23  ? 3.615   -6.919  -2.905  1.00 46.49 ? 493 ILE A CG2 1 
ATOM   171  C  CD1 . ILE A 1 23  ? 2.990   -10.058 -3.066  1.00 46.87 ? 493 ILE A CD1 1 
ATOM   172  N  N   . CYS A 1 24  ? -0.958  -7.562  -3.448  1.00 47.09 ? 494 CYS A N   1 
ATOM   173  C  CA  . CYS A 1 24  ? -2.081  -8.476  -3.453  1.00 47.43 ? 494 CYS A CA  1 
ATOM   174  C  C   . CYS A 1 24  ? -1.578  -9.905  -3.641  1.00 47.56 ? 494 CYS A C   1 
ATOM   175  O  O   . CYS A 1 24  ? -1.138  -10.275 -4.712  1.00 47.47 ? 494 CYS A O   1 
ATOM   176  C  CB  . CYS A 1 24  ? -3.089  -8.133  -4.551  1.00 47.57 ? 494 CYS A CB  1 
ATOM   177  S  SG  . CYS A 1 24  ? -4.495  -9.287  -4.529  1.00 47.39 ? 494 CYS A SG  1 
ATOM   178  N  N   . ILE A 1 25  ? -1.670  -10.710 -2.594  1.00 48.06 ? 495 ILE A N   1 
ATOM   179  C  CA  . ILE A 1 25  ? -1.143  -12.073 -2.633  1.00 47.48 ? 495 ILE A CA  1 
ATOM   180  C  C   . ILE A 1 25  ? -1.943  -13.020 -3.533  1.00 47.81 ? 495 ILE A C   1 
ATOM   181  O  O   . ILE A 1 25  ? -1.483  -14.128 -3.847  1.00 47.51 ? 495 ILE A O   1 
ATOM   182  C  CB  . ILE A 1 25  ? -0.953  -12.676 -1.218  1.00 47.24 ? 495 ILE A CB  1 
ATOM   183  C  CG1 . ILE A 1 25  ? -2.264  -12.727 -0.428  1.00 46.71 ? 495 ILE A CG1 1 
ATOM   184  C  CG2 . ILE A 1 25  ? 0.157   -11.941 -0.447  1.00 47.53 ? 495 ILE A CG2 1 
ATOM   185  C  CD1 . ILE A 1 25  ? -2.177  -13.683 0.767   1.00 47.09 ? 495 ILE A CD1 1 
ATOM   186  N  N   . SER A 1 26  ? -3.133  -12.576 -3.937  1.00 47.90 ? 496 SER A N   1 
ATOM   187  C  CA  . SER A 1 26  ? -3.946  -13.300 -4.922  1.00 48.14 ? 496 SER A CA  1 
ATOM   188  C  C   . SER A 1 26  ? -3.489  -13.129 -6.368  1.00 48.08 ? 496 SER A C   1 
ATOM   189  O  O   . SER A 1 26  ? -3.354  -14.121 -7.085  1.00 48.44 ? 496 SER A O   1 
ATOM   190  C  CB  . SER A 1 26  ? -5.411  -12.880 -4.836  1.00 47.40 ? 496 SER A CB  1 
ATOM   191  O  OG  . SER A 1 26  ? -5.855  -13.054 -3.528  1.00 48.89 ? 496 SER A OG  1 
ATOM   192  N  N   . CYS A 1 27  ? -3.289  -11.880 -6.793  1.00 47.77 ? 497 CYS A N   1 
ATOM   193  C  CA  . CYS A 1 27  ? -3.040  -11.568 -8.212  1.00 47.95 ? 497 CYS A CA  1 
ATOM   194  C  C   . CYS A 1 27  ? -1.726  -10.788 -8.457  1.00 48.28 ? 497 CYS A C   1 
ATOM   195  O  O   . CYS A 1 27  ? -1.267  -10.676 -9.611  1.00 48.17 ? 497 CYS A O   1 
ATOM   196  C  CB  . CYS A 1 27  ? -4.223  -10.776 -8.790  1.00 47.54 ? 497 CYS A CB  1 
ATOM   197  S  SG  . CYS A 1 27  ? -4.292  -9.037  -8.212  1.00 47.70 ? 497 CYS A SG  1 
ATOM   198  N  N   . GLY A 1 28  ? -1.127  -10.248 -7.392  1.00 47.96 ? 498 GLY A N   1 
ATOM   199  C  CA  . GLY A 1 28  ? 0.106   -9.462  -7.527  1.00 47.87 ? 498 GLY A CA  1 
ATOM   200  C  C   . GLY A 1 28  ? -0.104  -7.990  -7.874  1.00 47.96 ? 498 GLY A C   1 
ATOM   201  O  O   . GLY A 1 28  ? 0.856   -7.277  -8.193  1.00 47.68 ? 498 GLY A O   1 
ATOM   202  N  N   . SER A 1 29  ? -1.351  -7.519  -7.825  1.00 47.85 ? 499 SER A N   1 
ATOM   203  C  CA  . SER A 1 29  ? -1.615  -6.079  -7.931  1.00 47.84 ? 499 SER A CA  1 
ATOM   204  C  C   . SER A 1 29  ? -0.918  -5.357  -6.792  1.00 47.73 ? 499 SER A C   1 
ATOM   205  O  O   . SER A 1 29  ? -0.843  -5.882  -5.680  1.00 47.68 ? 499 SER A O   1 
ATOM   206  C  CB  . SER A 1 29  ? -3.113  -5.776  -7.875  1.00 47.96 ? 499 SER A CB  1 
ATOM   207  O  OG  . SER A 1 29  ? -3.373  -4.394  -8.115  1.00 48.65 ? 499 SER A OG  1 
ATOM   208  N  N   . LEU A 1 30  ? -0.404  -4.163  -7.075  1.00 47.49 ? 500 LEU A N   1 
ATOM   209  C  CA  . LEU A 1 30  ? 0.188   -3.311  -6.048  1.00 47.48 ? 500 LEU A CA  1 
ATOM   210  C  C   . LEU A 1 30  ? -0.863  -2.370  -5.493  1.00 47.62 ? 500 LEU A C   1 
ATOM   211  O  O   . LEU A 1 30  ? -0.580  -1.544  -4.610  1.00 47.39 ? 500 LEU A O   1 
ATOM   212  C  CB  . LEU A 1 30  ? 1.365   -2.498  -6.614  1.00 47.34 ? 500 LEU A CB  1 
ATOM   213  C  CG  . LEU A 1 30  ? 2.691   -3.252  -6.716  1.00 47.38 ? 500 LEU A CG  1 
ATOM   214  C  CD1 . LEU A 1 30  ? 3.790   -2.379  -7.281  1.00 46.68 ? 500 LEU A CD1 1 
ATOM   215  C  CD2 . LEU A 1 30  ? 3.093   -3.820  -5.361  1.00 47.54 ? 500 LEU A CD2 1 
ATOM   216  N  N   . ASN A 1 31  ? -2.076  -2.486  -6.027  1.00 47.62 ? 501 ASN A N   1 
ATOM   217  C  CA  . ASN A 1 31  ? -3.172  -1.597  -5.649  1.00 47.54 ? 501 ASN A CA  1 
ATOM   218  C  C   . ASN A 1 31  ? -3.946  -2.218  -4.492  1.00 46.86 ? 501 ASN A C   1 
ATOM   219  O  O   . ASN A 1 31  ? -5.149  -2.487  -4.595  1.00 46.79 ? 501 ASN A O   1 
ATOM   220  C  CB  . ASN A 1 31  ? -4.079  -1.287  -6.849  1.00 47.74 ? 501 ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 31  ? -3.415  -0.368  -7.872  1.00 48.81 ? 501 ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 31  ? -2.897  0.699   -7.526  1.00 51.09 ? 501 ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 31  ? -3.448  -0.768  -9.141  1.00 49.02 ? 501 ASN A ND2 1 
ATOM   224  N  N   . VAL A 1 32  ? -3.227  -2.433  -3.392  1.00 45.98 ? 502 VAL A N   1 
ATOM   225  C  CA  . VAL A 1 32  ? -3.773  -3.079  -2.212  1.00 45.47 ? 502 VAL A CA  1 
ATOM   226  C  C   . VAL A 1 32  ? -4.816  -2.202  -1.555  1.00 45.23 ? 502 VAL A C   1 
ATOM   227  O  O   . VAL A 1 32  ? -4.586  -1.032  -1.291  1.00 44.48 ? 502 VAL A O   1 
ATOM   228  C  CB  . VAL A 1 32  ? -2.666  -3.473  -1.212  1.00 45.35 ? 502 VAL A CB  1 
ATOM   229  C  CG1 . VAL A 1 32  ? -3.260  -3.953  0.095   1.00 44.96 ? 502 VAL A CG1 1 
ATOM   230  C  CG2 . VAL A 1 32  ? -1.810  -4.553  -1.808  1.00 44.88 ? 502 VAL A CG2 1 
ATOM   231  N  N   . THR A 1 33  ? -5.977  -2.791  -1.309  1.00 45.24 ? 503 THR A N   1 
ATOM   232  C  CA  . THR A 1 33  ? -7.108  -2.051  -0.787  1.00 45.57 ? 503 THR A CA  1 
ATOM   233  C  C   . THR A 1 33  ? -7.470  -2.523  0.615   1.00 45.46 ? 503 THR A C   1 
ATOM   234  O  O   . THR A 1 33  ? -8.262  -1.899  1.320   1.00 45.45 ? 503 THR A O   1 
ATOM   235  C  CB  . THR A 1 33  ? -8.304  -2.156  -1.773  1.00 45.62 ? 503 THR A CB  1 
ATOM   236  O  OG1 . THR A 1 33  ? -8.376  -0.933  -2.531  1.00 45.75 ? 503 THR A OG1 1 
ATOM   237  C  CG2 . THR A 1 33  ? -9.630  -2.365  -1.039  1.00 45.78 ? 503 THR A CG2 1 
ATOM   238  N  N   . LEU A 1 34  ? -6.850  -3.613  1.035   1.00 45.55 ? 504 LEU A N   1 
ATOM   239  C  CA  . LEU A 1 34  ? -7.386  -4.359  2.143   1.00 45.58 ? 504 LEU A CA  1 
ATOM   240  C  C   . LEU A 1 34  ? -6.352  -5.353  2.636   1.00 45.53 ? 504 LEU A C   1 
ATOM   241  O  O   . LEU A 1 34  ? -5.431  -5.711  1.903   1.00 45.69 ? 504 LEU A O   1 
ATOM   242  C  CB  . LEU A 1 34  ? -8.627  -5.084  1.629   1.00 45.73 ? 504 LEU A CB  1 
ATOM   243  C  CG  . LEU A 1 34  ? -9.764  -5.518  2.533   1.00 46.80 ? 504 LEU A CG  1 
ATOM   244  C  CD1 . LEU A 1 34  ? -10.693 -4.350  2.856   1.00 48.63 ? 504 LEU A CD1 1 
ATOM   245  C  CD2 . LEU A 1 34  ? -10.506 -6.596  1.787   1.00 47.46 ? 504 LEU A CD2 1 
ATOM   246  N  N   . GLU A 1 35  ? -6.498  -5.788  3.882   1.00 45.35 ? 505 GLU A N   1 
ATOM   247  C  CA  . GLU A 1 35  ? -5.707  -6.888  4.405   1.00 45.16 ? 505 GLU A CA  1 
ATOM   248  C  C   . GLU A 1 35  ? -6.390  -8.216  4.064   1.00 45.10 ? 505 GLU A C   1 
ATOM   249  O  O   . GLU A 1 35  ? -7.588  -8.373  4.305   1.00 45.73 ? 505 GLU A O   1 
ATOM   250  C  CB  . GLU A 1 35  ? -5.505  -6.730  5.915   1.00 45.19 ? 505 GLU A CB  1 
ATOM   251  C  CG  . GLU A 1 35  ? -4.519  -5.606  6.291   1.00 45.18 ? 505 GLU A CG  1 
ATOM   252  C  CD  . GLU A 1 35  ? -4.175  -5.573  7.769   1.00 45.59 ? 505 GLU A CD  1 
ATOM   253  O  OE1 . GLU A 1 35  ? -5.024  -5.983  8.588   1.00 45.85 ? 505 GLU A OE1 1 
ATOM   254  O  OE2 . GLU A 1 35  ? -3.053  -5.121  8.120   1.00 46.48 ? 505 GLU A OE2 1 
ATOM   255  N  N   . HIS A 1 36  ? -5.643  -9.152  3.474   1.00 44.53 ? 506 HIS A N   1 
ATOM   256  C  CA  . HIS A 1 36  ? -6.177  -10.492 3.173   1.00 44.13 ? 506 HIS A CA  1 
ATOM   257  C  C   . HIS A 1 36  ? -6.684  -11.126 4.467   1.00 43.53 ? 506 HIS A C   1 
ATOM   258  O  O   . HIS A 1 36  ? -5.976  -11.138 5.473   1.00 43.88 ? 506 HIS A O   1 
ATOM   259  C  CB  . HIS A 1 36  ? -5.131  -11.406 2.511   1.00 43.48 ? 506 HIS A CB  1 
ATOM   260  C  CG  . HIS A 1 36  ? -5.722  -12.628 1.872   1.00 44.22 ? 506 HIS A CG  1 
ATOM   261  N  ND1 . HIS A 1 36  ? -6.315  -13.643 2.600   1.00 44.62 ? 506 HIS A ND1 1 
ATOM   262  C  CD2 . HIS A 1 36  ? -5.825  -12.994 0.570   1.00 44.12 ? 506 HIS A CD2 1 
ATOM   263  C  CE1 . HIS A 1 36  ? -6.744  -14.584 1.775   1.00 45.52 ? 506 HIS A CE1 1 
ATOM   264  N  NE2 . HIS A 1 36  ? -6.469  -14.210 0.537   1.00 44.07 ? 506 HIS A NE2 1 
ATOM   265  N  N   . PRO A 1 37  ? -7.914  -11.643 4.457   1.00 43.01 ? 507 PRO A N   1 
ATOM   266  C  CA  . PRO A 1 37  ? -8.464  -12.010 5.768   1.00 42.68 ? 507 PRO A CA  1 
ATOM   267  C  C   . PRO A 1 37  ? -7.882  -13.283 6.368   1.00 42.40 ? 507 PRO A C   1 
ATOM   268  O  O   . PRO A 1 37  ? -7.963  -13.462 7.578   1.00 42.32 ? 507 PRO A O   1 
ATOM   269  C  CB  . PRO A 1 37  ? -9.973  -12.134 5.501   1.00 42.02 ? 507 PRO A CB  1 
ATOM   270  C  CG  . PRO A 1 37  ? -10.046 -12.546 4.041   1.00 42.17 ? 507 PRO A CG  1 
ATOM   271  C  CD  . PRO A 1 37  ? -8.866  -11.882 3.354   1.00 43.02 ? 507 PRO A CD  1 
ATOM   272  N  N   . LEU A 1 38  ? -7.297  -14.147 5.543   1.00 42.52 ? 508 LEU A N   1 
ATOM   273  C  CA  . LEU A 1 38  ? -6.766  -15.441 6.015   1.00 42.66 ? 508 LEU A CA  1 
ATOM   274  C  C   . LEU A 1 38  ? -5.260  -15.447 6.236   1.00 43.04 ? 508 LEU A C   1 
ATOM   275  O  O   . LEU A 1 38  ? -4.767  -16.152 7.105   1.00 43.31 ? 508 LEU A O   1 
ATOM   276  C  CB  . LEU A 1 38  ? -7.110  -16.569 5.042   1.00 42.59 ? 508 LEU A CB  1 
ATOM   277  C  CG  . LEU A 1 38  ? -8.579  -16.783 4.665   1.00 43.68 ? 508 LEU A CG  1 
ATOM   278  C  CD1 . LEU A 1 38  ? -8.672  -17.967 3.760   1.00 42.91 ? 508 LEU A CD1 1 
ATOM   279  C  CD2 . LEU A 1 38  ? -9.468  -16.979 5.889   1.00 42.26 ? 508 LEU A CD2 1 
ATOM   280  N  N   . PHE A 1 39  ? -4.534  -14.677 5.434   1.00 43.06 ? 509 PHE A N   1 
ATOM   281  C  CA  . PHE A 1 39  ? -3.093  -14.734 5.443   1.00 43.80 ? 509 PHE A CA  1 
ATOM   282  C  C   . PHE A 1 39  ? -2.556  -13.317 5.461   1.00 44.35 ? 509 PHE A C   1 
ATOM   283  O  O   . PHE A 1 39  ? -3.225  -12.388 4.993   1.00 45.27 ? 509 PHE A O   1 
ATOM   284  C  CB  . PHE A 1 39  ? -2.561  -15.497 4.217   1.00 43.46 ? 509 PHE A CB  1 
ATOM   285  C  CG  . PHE A 1 39  ? -3.038  -16.937 4.125   1.00 42.87 ? 509 PHE A CG  1 
ATOM   286  C  CD1 . PHE A 1 39  ? -2.443  -17.937 4.896   1.00 40.84 ? 509 PHE A CD1 1 
ATOM   287  C  CD2 . PHE A 1 39  ? -4.064  -17.287 3.245   1.00 43.28 ? 509 PHE A CD2 1 
ATOM   288  C  CE1 . PHE A 1 39  ? -2.874  -19.265 4.822   1.00 41.45 ? 509 PHE A CE1 1 
ATOM   289  C  CE2 . PHE A 1 39  ? -4.501  -18.616 3.140   1.00 42.06 ? 509 PHE A CE2 1 
ATOM   290  C  CZ  . PHE A 1 39  ? -3.903  -19.609 3.936   1.00 42.87 ? 509 PHE A CZ  1 
ATOM   291  N  N   . VAL A 1 40  ? -1.372  -13.163 6.043   1.00 44.42 ? 510 VAL A N   1 
ATOM   292  C  CA  . VAL A 1 40  ? -0.635  -11.907 6.033   1.00 44.43 ? 510 VAL A CA  1 
ATOM   293  C  C   . VAL A 1 40  ? -0.244  -11.560 4.598   1.00 45.16 ? 510 VAL A C   1 
ATOM   294  O  O   . VAL A 1 40  ? 0.388   -12.355 3.889   1.00 45.29 ? 510 VAL A O   1 
ATOM   295  C  CB  . VAL A 1 40  ? 0.601   -11.948 6.960   1.00 44.44 ? 510 VAL A CB  1 
ATOM   296  C  CG1 . VAL A 1 40  ? 1.335   -10.599 6.957   1.00 42.43 ? 510 VAL A CG1 1 
ATOM   297  C  CG2 . VAL A 1 40  ? 0.196   -12.363 8.402   1.00 42.29 ? 510 VAL A CG2 1 
ATOM   298  N  N   . GLY A 1 41  ? -0.665  -10.373 4.180   1.00 45.68 ? 511 GLY A N   1 
ATOM   299  C  CA  . GLY A 1 41  ? -0.563  -9.951  2.802   1.00 46.17 ? 511 GLY A CA  1 
ATOM   300  C  C   . GLY A 1 41  ? -1.746  -9.077  2.444   1.00 46.70 ? 511 GLY A C   1 
ATOM   301  O  O   . GLY A 1 41  ? -2.807  -9.156  3.070   1.00 46.71 ? 511 GLY A O   1 
ATOM   302  N  N   . GLY A 1 42  ? -1.557  -8.232  1.431   1.00 46.97 ? 512 GLY A N   1 
ATOM   303  C  CA  . GLY A 1 42  ? -2.629  -7.395  0.930   1.00 46.85 ? 512 GLY A CA  1 
ATOM   304  C  C   . GLY A 1 42  ? -3.582  -8.104  -0.007  1.00 47.19 ? 512 GLY A C   1 
ATOM   305  O  O   . GLY A 1 42  ? -3.383  -9.258  -0.388  1.00 47.32 ? 512 GLY A O   1 
ATOM   306  N  N   . MET A 1 43  ? -4.629  -7.384  -0.386  1.00 47.42 ? 513 MET A N   1 
ATOM   307  C  CA  . MET A 1 43  ? -5.623  -7.880  -1.318  1.00 47.44 ? 513 MET A CA  1 
ATOM   308  C  C   . MET A 1 43  ? -6.182  -6.658  -2.040  1.00 47.16 ? 513 MET A C   1 
ATOM   309  O  O   . MET A 1 43  ? -6.460  -5.642  -1.402  1.00 46.88 ? 513 MET A O   1 
ATOM   310  C  CB  . MET A 1 43  ? -6.725  -8.611  -0.548  1.00 47.36 ? 513 MET A CB  1 
ATOM   311  C  CG  . MET A 1 43  ? -7.801  -9.248  -1.403  1.00 48.27 ? 513 MET A CG  1 
ATOM   312  S  SD  . MET A 1 43  ? -9.095  -10.018 -0.405  1.00 47.92 ? 513 MET A SD  1 
ATOM   313  C  CE  . MET A 1 43  ? -8.852  -11.733 -0.787  1.00 48.38 ? 513 MET A CE  1 
ATOM   314  N  N   . CYS A 1 44  ? -6.311  -6.743  -3.363  1.00 46.67 ? 514 CYS A N   1 
ATOM   315  C  CA  . CYS A 1 44  ? -6.980  -5.694  -4.118  1.00 46.63 ? 514 CYS A CA  1 
ATOM   316  C  C   . CYS A 1 44  ? -8.511  -5.894  -4.113  1.00 46.94 ? 514 CYS A C   1 
ATOM   317  O  O   . CYS A 1 44  ? -9.020  -6.932  -3.671  1.00 46.59 ? 514 CYS A O   1 
ATOM   318  C  CB  . CYS A 1 44  ? -6.438  -5.634  -5.542  1.00 46.38 ? 514 CYS A CB  1 
ATOM   319  S  SG  . CYS A 1 44  ? -7.056  -6.926  -6.615  1.00 46.22 ? 514 CYS A SG  1 
ATOM   320  N  N   . GLN A 1 45  ? -9.229  -4.885  -4.593  1.00 47.54 ? 515 GLN A N   1 
ATOM   321  C  CA  . GLN A 1 45  ? -10.691 -4.885  -4.609  1.00 48.29 ? 515 GLN A CA  1 
ATOM   322  C  C   . GLN A 1 45  ? -11.283 -5.931  -5.551  1.00 48.17 ? 515 GLN A C   1 
ATOM   323  O  O   . GLN A 1 45  ? -12.294 -6.564  -5.226  1.00 47.74 ? 515 GLN A O   1 
ATOM   324  C  CB  . GLN A 1 45  ? -11.229 -3.500  -4.990  1.00 48.24 ? 515 GLN A CB  1 
ATOM   325  C  CG  . GLN A 1 45  ? -11.541 -2.597  -3.816  1.00 50.49 ? 515 GLN A CG  1 
ATOM   326  C  CD  . GLN A 1 45  ? -12.665 -3.115  -2.907  1.00 52.73 ? 515 GLN A CD  1 
ATOM   327  O  OE1 . GLN A 1 45  ? -12.620 -2.930  -1.687  1.00 53.41 ? 515 GLN A OE1 1 
ATOM   328  N  NE2 . GLN A 1 45  ? -13.675 -3.758  -3.499  1.00 52.65 ? 515 GLN A NE2 1 
ATOM   329  N  N   . ASN A 1 46  ? -10.667 -6.085  -6.720  1.00 48.28 ? 516 ASN A N   1 
ATOM   330  C  CA  . ASN A 1 46  ? -11.116 -7.067  -7.683  1.00 48.92 ? 516 ASN A CA  1 
ATOM   331  C  C   . ASN A 1 46  ? -11.041 -8.458  -7.079  1.00 48.99 ? 516 ASN A C   1 
ATOM   332  O  O   . ASN A 1 46  ? -11.967 -9.239  -7.217  1.00 49.66 ? 516 ASN A O   1 
ATOM   333  C  CB  . ASN A 1 46  ? -10.343 -6.964  -9.005  1.00 48.92 ? 516 ASN A CB  1 
ATOM   334  C  CG  . ASN A 1 46  ? -10.959 -5.950  -9.969  1.00 50.64 ? 516 ASN A CG  1 
ATOM   335  O  OD1 . ASN A 1 46  ? -12.086 -5.483  -9.774  1.00 51.82 ? 516 ASN A OD1 1 
ATOM   336  N  ND2 . ASN A 1 46  ? -10.213 -5.602  -11.017 1.00 52.06 ? 516 ASN A ND2 1 
ATOM   337  N  N   . CYS A 1 47  ? -9.956  -8.744  -6.377  1.00 48.88 ? 517 CYS A N   1 
ATOM   338  C  CA  . CYS A 1 47  ? -9.801  -10.026 -5.709  1.00 49.18 ? 517 CYS A CA  1 
ATOM   339  C  C   . CYS A 1 47  ? -10.738 -10.142 -4.507  1.00 49.51 ? 517 CYS A C   1 
ATOM   340  O  O   . CYS A 1 47  ? -11.159 -11.262 -4.152  1.00 49.23 ? 517 CYS A O   1 
ATOM   341  C  CB  . CYS A 1 47  ? -8.349  -10.247 -5.274  1.00 49.34 ? 517 CYS A CB  1 
ATOM   342  S  SG  . CYS A 1 47  ? -7.194  -10.569 -6.633  1.00 46.17 ? 517 CYS A SG  1 
ATOM   343  N  N   . LYS A 1 48  ? -11.060 -8.999  -3.880  1.00 49.29 ? 518 LYS A N   1 
ATOM   344  C  CA  . LYS A 1 48  ? -12.026 -9.001  -2.782  1.00 48.98 ? 518 LYS A CA  1 
ATOM   345  C  C   . LYS A 1 48  ? -13.371 -9.512  -3.321  1.00 49.04 ? 518 LYS A C   1 
ATOM   346  O  O   . LYS A 1 48  ? -13.997 -10.376 -2.700  1.00 49.35 ? 518 LYS A O   1 
ATOM   347  C  CB  . LYS A 1 48  ? -12.167 -7.630  -2.126  1.00 48.53 ? 518 LYS A CB  1 
ATOM   348  C  CG  . LYS A 1 48  ? -13.194 -7.612  -1.005  1.00 49.18 ? 518 LYS A CG  1 
ATOM   349  C  CD  . LYS A 1 48  ? -13.559 -6.191  -0.573  1.00 50.50 ? 518 LYS A CD  1 
ATOM   350  C  CE  . LYS A 1 48  ? -14.634 -6.189  0.515   1.00 50.57 ? 518 LYS A CE  1 
ATOM   351  N  NZ  . LYS A 1 48  ? -14.777 -4.851  1.178   1.00 51.18 ? 518 LYS A NZ  1 
ATOM   352  N  N   . ASN A 1 49  ? -13.776 -8.997  -4.487  1.00 48.57 ? 519 ASN A N   1 
ATOM   353  C  CA  . ASN A 1 49  ? -15.019 -9.386  -5.148  1.00 48.62 ? 519 ASN A CA  1 
ATOM   354  C  C   . ASN A 1 49  ? -15.010 -10.841 -5.605  1.00 48.43 ? 519 ASN A C   1 
ATOM   355  O  O   . ASN A 1 49  ? -15.952 -11.561 -5.350  1.00 48.68 ? 519 ASN A O   1 
ATOM   356  C  CB  . ASN A 1 49  ? -15.319 -8.456  -6.327  1.00 48.44 ? 519 ASN A CB  1 
ATOM   357  C  CG  . ASN A 1 49  ? -15.905 -7.137  -5.885  1.00 50.36 ? 519 ASN A CG  1 
ATOM   358  O  OD1 . ASN A 1 49  ? -15.771 -6.740  -4.726  1.00 51.95 ? 519 ASN A OD1 1 
ATOM   359  N  ND2 . ASN A 1 49  ? -16.566 -6.442  -6.810  1.00 52.80 ? 519 ASN A ND2 1 
ATOM   360  N  N   . CYS A 1 50  ? -13.938 -11.265 -6.267  1.00 48.23 ? 520 CYS A N   1 
ATOM   361  C  CA  . CYS A 1 50  ? -13.706 -12.686 -6.534  1.00 49.17 ? 520 CYS A CA  1 
ATOM   362  C  C   . CYS A 1 50  ? -13.892 -13.579 -5.312  1.00 48.21 ? 520 CYS A C   1 
ATOM   363  O  O   . CYS A 1 50  ? -14.643 -14.529 -5.368  1.00 48.69 ? 520 CYS A O   1 
ATOM   364  C  CB  . CYS A 1 50  ? -12.300 -12.896 -7.082  1.00 49.53 ? 520 CYS A CB  1 
ATOM   365  S  SG  . CYS A 1 50  ? -12.147 -12.310 -8.740  1.00 52.20 ? 520 CYS A SG  1 
ATOM   366  N  N   . PHE A 1 51  ? -13.189 -13.265 -4.230  1.00 47.92 ? 521 PHE A N   1 
ATOM   367  C  CA  . PHE A 1 51  ? -13.267 -14.002 -2.958  1.00 47.47 ? 521 PHE A CA  1 
ATOM   368  C  C   . PHE A 1 51  ? -14.725 -14.054 -2.511  1.00 46.88 ? 521 PHE A C   1 
ATOM   369  O  O   . PHE A 1 51  ? -15.239 -15.132 -2.219  1.00 46.62 ? 521 PHE A O   1 
ATOM   370  C  CB  . PHE A 1 51  ? -12.393 -13.308 -1.886  1.00 47.41 ? 521 PHE A CB  1 
ATOM   371  C  CG  . PHE A 1 51  ? -11.898 -14.210 -0.790  1.00 48.33 ? 521 PHE A CG  1 
ATOM   372  C  CD1 . PHE A 1 51  ? -10.580 -14.656 -0.788  1.00 49.95 ? 521 PHE A CD1 1 
ATOM   373  C  CD2 . PHE A 1 51  ? -12.728 -14.592 0.270   1.00 49.30 ? 521 PHE A CD2 1 
ATOM   374  C  CE1 . PHE A 1 51  ? -10.095 -15.478 0.240   1.00 48.79 ? 521 PHE A CE1 1 
ATOM   375  C  CE2 . PHE A 1 51  ? -12.253 -15.434 1.304   1.00 48.03 ? 521 PHE A CE2 1 
ATOM   376  C  CZ  . PHE A 1 51  ? -10.943 -15.879 1.281   1.00 48.15 ? 521 PHE A CZ  1 
ATOM   377  N  N   . LEU A 1 52  ? -15.390 -12.895 -2.490  1.00 46.15 ? 522 LEU A N   1 
ATOM   378  C  CA  . LEU A 1 52  ? -16.797 -12.825 -2.089  1.00 46.20 ? 522 LEU A CA  1 
ATOM   379  C  C   . LEU A 1 52  ? -17.707 -13.693 -2.941  1.00 46.39 ? 522 LEU A C   1 
ATOM   380  O  O   . LEU A 1 52  ? -18.557 -14.402 -2.399  1.00 46.02 ? 522 LEU A O   1 
ATOM   381  C  CB  . LEU A 1 52  ? -17.318 -11.378 -2.093  1.00 46.51 ? 522 LEU A CB  1 
ATOM   382  C  CG  . LEU A 1 52  ? -16.895 -10.507 -0.907  1.00 46.14 ? 522 LEU A CG  1 
ATOM   383  C  CD1 . LEU A 1 52  ? -17.469 -9.103  -1.026  1.00 44.94 ? 522 LEU A CD1 1 
ATOM   384  C  CD2 . LEU A 1 52  ? -17.327 -11.178 0.388   1.00 47.44 ? 522 LEU A CD2 1 
ATOM   385  N  N   . GLU A 1 53  ? -17.517 -13.630 -4.264  1.00 46.19 ? 523 GLU A N   1 
ATOM   386  C  CA  . GLU A 1 53  ? -18.323 -14.391 -5.219  1.00 46.42 ? 523 GLU A CA  1 
ATOM   387  C  C   . GLU A 1 53  ? -18.053 -15.909 -5.179  1.00 46.30 ? 523 GLU A C   1 
ATOM   388  O  O   . GLU A 1 53  ? -18.990 -16.704 -5.251  1.00 46.34 ? 523 GLU A O   1 
ATOM   389  C  CB  . GLU A 1 53  ? -18.127 -13.835 -6.647  1.00 46.44 ? 523 GLU A CB  1 
ATOM   390  C  CG  . GLU A 1 53  ? -18.698 -12.430 -6.849  1.00 45.81 ? 523 GLU A CG  1 
ATOM   391  C  CD  . GLU A 1 53  ? -18.008 -11.615 -7.963  1.00 46.33 ? 523 GLU A CD  1 
ATOM   392  O  OE1 . GLU A 1 53  ? -17.242 -12.195 -8.774  1.00 44.65 ? 523 GLU A OE1 1 
ATOM   393  O  OE2 . GLU A 1 53  ? -18.260 -10.380 -8.025  1.00 44.88 ? 523 GLU A OE2 1 
ATOM   394  N  N   . CYS A 1 54  ? -16.780 -16.287 -5.039  1.00 45.93 ? 524 CYS A N   1 
ATOM   395  C  CA  . CYS A 1 54  ? -16.301 -17.689 -5.173  1.00 45.88 ? 524 CYS A CA  1 
ATOM   396  C  C   . CYS A 1 54  ? -16.303 -18.486 -3.884  1.00 45.42 ? 524 CYS A C   1 
ATOM   397  O  O   . CYS A 1 54  ? -16.173 -19.721 -3.898  1.00 45.13 ? 524 CYS A O   1 
ATOM   398  C  CB  . CYS A 1 54  ? -14.843 -17.684 -5.608  1.00 45.30 ? 524 CYS A CB  1 
ATOM   399  S  SG  . CYS A 1 54  ? -14.591 -17.145 -7.255  1.00 47.78 ? 524 CYS A SG  1 
ATOM   400  N  N   . ALA A 1 55  ? -16.350 -17.758 -2.777  1.00 45.04 ? 525 ALA A N   1 
ATOM   401  C  CA  . ALA A 1 55  ? -16.229 -18.342 -1.458  1.00 45.10 ? 525 ALA A CA  1 
ATOM   402  C  C   . ALA A 1 55  ? -17.323 -19.359 -1.218  1.00 44.72 ? 525 ALA A C   1 
ATOM   403  O  O   . ALA A 1 55  ? -18.503 -19.076 -1.419  1.00 45.17 ? 525 ALA A O   1 
ATOM   404  C  CB  . ALA A 1 55  ? -16.295 -17.263 -0.404  1.00 45.63 ? 525 ALA A CB  1 
ATOM   405  N  N   . TYR A 1 56  ? -16.909 -20.551 -0.806  1.00 44.13 ? 526 TYR A N   1 
ATOM   406  C  CA  . TYR A 1 56  ? -17.816 -21.619 -0.429  1.00 43.03 ? 526 TYR A CA  1 
ATOM   407  C  C   . TYR A 1 56  ? -18.698 -22.138 -1.571  1.00 42.34 ? 526 TYR A C   1 
ATOM   408  O  O   . TYR A 1 56  ? -19.718 -22.766 -1.326  1.00 42.90 ? 526 TYR A O   1 
ATOM   409  C  CB  . TYR A 1 56  ? -18.652 -21.177 0.771   1.00 43.14 ? 526 TYR A CB  1 
ATOM   410  C  CG  . TYR A 1 56  ? -17.846 -20.569 1.896   1.00 43.54 ? 526 TYR A CG  1 
ATOM   411  C  CD1 . TYR A 1 56  ? -18.079 -19.253 2.312   1.00 44.08 ? 526 TYR A CD1 1 
ATOM   412  C  CD2 . TYR A 1 56  ? -16.846 -21.299 2.547   1.00 44.20 ? 526 TYR A CD2 1 
ATOM   413  C  CE1 . TYR A 1 56  ? -17.351 -18.685 3.343   1.00 43.33 ? 526 TYR A CE1 1 
ATOM   414  C  CE2 . TYR A 1 56  ? -16.116 -20.736 3.597   1.00 44.34 ? 526 TYR A CE2 1 
ATOM   415  C  CZ  . TYR A 1 56  ? -16.378 -19.430 3.986   1.00 43.71 ? 526 TYR A CZ  1 
ATOM   416  O  OH  . TYR A 1 56  ? -15.659 -18.858 5.013   1.00 45.17 ? 526 TYR A OH  1 
ATOM   417  N  N   . GLN A 1 57  ? -18.302 -21.877 -2.811  1.00 41.69 ? 527 GLN A N   1 
ATOM   418  C  CA  . GLN A 1 57  ? -18.830 -22.573 -3.973  1.00 41.33 ? 527 GLN A CA  1 
ATOM   419  C  C   . GLN A 1 57  ? -18.151 -23.950 -3.967  1.00 40.87 ? 527 GLN A C   1 
ATOM   420  O  O   . GLN A 1 57  ? -16.935 -24.023 -3.807  1.00 41.04 ? 527 GLN A O   1 
ATOM   421  C  CB  . GLN A 1 57  ? -18.420 -21.809 -5.234  1.00 41.30 ? 527 GLN A CB  1 
ATOM   422  C  CG  . GLN A 1 57  ? -19.567 -21.430 -6.164  1.00 45.39 ? 527 GLN A CG  1 
ATOM   423  C  CD  . GLN A 1 57  ? -19.321 -21.840 -7.624  1.00 47.18 ? 527 GLN A CD  1 
ATOM   424  O  OE1 . GLN A 1 57  ? -19.524 -21.044 -8.547  1.00 45.74 ? 527 GLN A OE1 1 
ATOM   425  N  NE2 . GLN A 1 57  ? -18.887 -23.094 -7.829  1.00 47.70 ? 527 GLN A NE2 1 
ATOM   426  N  N   . TYR A 1 58  ? -18.914 -25.025 -4.149  1.00 40.67 ? 528 TYR A N   1 
ATOM   427  C  CA  . TYR A 1 58  ? -18.369 -26.405 -4.167  1.00 39.94 ? 528 TYR A CA  1 
ATOM   428  C  C   . TYR A 1 58  ? -18.481 -27.128 -5.526  1.00 39.73 ? 528 TYR A C   1 
ATOM   429  O  O   . TYR A 1 58  ? -19.431 -26.907 -6.267  1.00 39.07 ? 528 TYR A O   1 
ATOM   430  C  CB  . TYR A 1 58  ? -18.990 -27.250 -3.056  1.00 40.05 ? 528 TYR A CB  1 
ATOM   431  C  CG  . TYR A 1 58  ? -18.436 -26.890 -1.693  1.00 40.89 ? 528 TYR A CG  1 
ATOM   432  C  CD1 . TYR A 1 58  ? -18.929 -25.781 -0.981  1.00 42.68 ? 528 TYR A CD1 1 
ATOM   433  C  CD2 . TYR A 1 58  ? -17.416 -27.627 -1.131  1.00 41.53 ? 528 TYR A CD2 1 
ATOM   434  C  CE1 . TYR A 1 58  ? -18.389 -25.412 0.240   1.00 42.75 ? 528 TYR A CE1 1 
ATOM   435  C  CE2 . TYR A 1 58  ? -16.867 -27.281 0.110   1.00 41.93 ? 528 TYR A CE2 1 
ATOM   436  C  CZ  . TYR A 1 58  ? -17.350 -26.176 0.780   1.00 40.87 ? 528 TYR A CZ  1 
ATOM   437  O  OH  . TYR A 1 58  ? -16.816 -25.840 1.991   1.00 40.10 ? 528 TYR A OH  1 
ATOM   438  N  N   . ASP A 1 59  ? -17.477 -27.950 -5.849  1.00 38.89 ? 529 ASP A N   1 
ATOM   439  C  CA  . ASP A 1 59  ? -17.493 -28.826 -7.016  1.00 39.41 ? 529 ASP A CA  1 
ATOM   440  C  C   . ASP A 1 59  ? -18.223 -30.119 -6.652  1.00 39.24 ? 529 ASP A C   1 
ATOM   441  O  O   . ASP A 1 59  ? -18.393 -30.403 -5.469  1.00 39.73 ? 529 ASP A O   1 
ATOM   442  C  CB  . ASP A 1 59  ? -16.062 -29.199 -7.431  1.00 38.58 ? 529 ASP A CB  1 
ATOM   443  C  CG  . ASP A 1 59  ? -15.432 -28.195 -8.393  1.00 41.12 ? 529 ASP A CG  1 
ATOM   444  O  OD1 . ASP A 1 59  ? -16.044 -27.128 -8.675  1.00 42.72 ? 529 ASP A OD1 1 
ATOM   445  O  OD2 . ASP A 1 59  ? -14.314 -28.496 -8.888  1.00 43.33 ? 529 ASP A OD2 1 
ATOM   446  N  N   . ASP A 1 60  ? -18.608 -30.904 -7.658  1.00 39.33 ? 530 ASP A N   1 
ATOM   447  C  CA  . ASP A 1 60  ? -19.301 -32.178 -7.457  1.00 39.81 ? 530 ASP A CA  1 
ATOM   448  C  C   . ASP A 1 60  ? -18.489 -33.199 -6.636  1.00 39.96 ? 530 ASP A C   1 
ATOM   449  O  O   . ASP A 1 60  ? -19.051 -34.171 -6.146  1.00 39.52 ? 530 ASP A O   1 
ATOM   450  C  CB  . ASP A 1 60  ? -19.807 -32.779 -8.788  1.00 39.91 ? 530 ASP A CB  1 
ATOM   451  C  CG  . ASP A 1 60  ? -18.683 -33.184 -9.754  1.00 42.63 ? 530 ASP A CG  1 
ATOM   452  O  OD1 . ASP A 1 60  ? -17.497 -33.273 -9.355  1.00 46.01 ? 530 ASP A OD1 1 
ATOM   453  O  OD2 . ASP A 1 60  ? -18.994 -33.442 -10.949 1.00 45.82 ? 530 ASP A OD2 1 
ATOM   454  N  N   . ASP A 1 61  ? -17.186 -32.962 -6.465  1.00 39.77 ? 531 ASP A N   1 
ATOM   455  C  CA  . ASP A 1 61  ? -16.418 -33.802 -5.561  1.00 40.61 ? 531 ASP A CA  1 
ATOM   456  C  C   . ASP A 1 61  ? -16.588 -33.471 -4.064  1.00 40.34 ? 531 ASP A C   1 
ATOM   457  O  O   . ASP A 1 61  ? -16.033 -34.153 -3.211  1.00 40.10 ? 531 ASP A O   1 
ATOM   458  C  CB  . ASP A 1 61  ? -14.935 -33.887 -5.976  1.00 40.90 ? 531 ASP A CB  1 
ATOM   459  C  CG  . ASP A 1 61  ? -14.215 -32.549 -5.916  1.00 41.79 ? 531 ASP A CG  1 
ATOM   460  O  OD1 . ASP A 1 61  ? -14.782 -31.579 -5.385  1.00 44.10 ? 531 ASP A OD1 1 
ATOM   461  O  OD2 . ASP A 1 61  ? -13.069 -32.465 -6.410  1.00 42.93 ? 531 ASP A OD2 1 
ATOM   462  N  N   . GLY A 1 62  ? -17.353 -32.430 -3.749  1.00 40.61 ? 532 GLY A N   1 
ATOM   463  C  CA  . GLY A 1 62  ? -17.563 -32.022 -2.350  1.00 40.29 ? 532 GLY A CA  1 
ATOM   464  C  C   . GLY A 1 62  ? -16.428 -31.175 -1.751  1.00 40.41 ? 532 GLY A C   1 
ATOM   465  O  O   . GLY A 1 62  ? -16.407 -30.898 -0.544  1.00 40.46 ? 532 GLY A O   1 
ATOM   466  N  N   . TYR A 1 63  ? -15.482 -30.755 -2.578  1.00 39.90 ? 533 TYR A N   1 
ATOM   467  C  CA  . TYR A 1 63  ? -14.435 -29.854 -2.112  1.00 40.39 ? 533 TYR A CA  1 
ATOM   468  C  C   . TYR A 1 63  ? -14.625 -28.512 -2.797  1.00 40.64 ? 533 TYR A C   1 
ATOM   469  O  O   . TYR A 1 63  ? -15.272 -28.417 -3.850  1.00 40.17 ? 533 TYR A O   1 
ATOM   470  C  CB  . TYR A 1 63  ? -13.031 -30.432 -2.369  1.00 40.57 ? 533 TYR A CB  1 
ATOM   471  C  CG  . TYR A 1 63  ? -12.740 -31.687 -1.574  1.00 39.82 ? 533 TYR A CG  1 
ATOM   472  C  CD1 . TYR A 1 63  ? -12.109 -31.630 -0.331  1.00 40.34 ? 533 TYR A CD1 1 
ATOM   473  C  CD2 . TYR A 1 63  ? -13.124 -32.921 -2.057  1.00 40.92 ? 533 TYR A CD2 1 
ATOM   474  C  CE1 . TYR A 1 63  ? -11.854 -32.810 0.415   1.00 40.45 ? 533 TYR A CE1 1 
ATOM   475  C  CE2 . TYR A 1 63  ? -12.900 -34.087 -1.334  1.00 42.78 ? 533 TYR A CE2 1 
ATOM   476  C  CZ  . TYR A 1 63  ? -12.258 -34.031 -0.100  1.00 42.34 ? 533 TYR A CZ  1 
ATOM   477  O  OH  . TYR A 1 63  ? -12.037 -35.222 0.584   1.00 42.90 ? 533 TYR A OH  1 
ATOM   478  N  N   . GLN A 1 64  ? -14.067 -27.469 -2.206  1.00 41.03 ? 534 GLN A N   1 
ATOM   479  C  CA  . GLN A 1 64  ? -14.328 -26.113 -2.705  1.00 41.05 ? 534 GLN A CA  1 
ATOM   480  C  C   . GLN A 1 64  ? -13.871 -25.967 -4.159  1.00 41.58 ? 534 GLN A C   1 
ATOM   481  O  O   . GLN A 1 64  ? -12.903 -26.638 -4.571  1.00 41.50 ? 534 GLN A O   1 
ATOM   482  C  CB  . GLN A 1 64  ? -13.670 -25.090 -1.778  1.00 41.32 ? 534 GLN A CB  1 
ATOM   483  C  CG  . GLN A 1 64  ? -14.449 -24.972 -0.471  1.00 39.36 ? 534 GLN A CG  1 
ATOM   484  C  CD  . GLN A 1 64  ? -13.838 -24.000 0.468   1.00 39.66 ? 534 GLN A CD  1 
ATOM   485  O  OE1 . GLN A 1 64  ? -12.931 -23.271 0.088   1.00 43.42 ? 534 GLN A OE1 1 
ATOM   486  N  NE2 . GLN A 1 64  ? -14.307 -23.981 1.716   1.00 37.27 ? 534 GLN A NE2 1 
ATOM   487  N  N   . SER A 1 65  ? -14.580 -25.141 -4.939  1.00 41.06 ? 535 SER A N   1 
ATOM   488  C  CA  . SER A 1 65  ? -14.289 -25.022 -6.377  1.00 41.21 ? 535 SER A CA  1 
ATOM   489  C  C   . SER A 1 65  ? -12.999 -24.265 -6.635  1.00 41.66 ? 535 SER A C   1 
ATOM   490  O  O   . SER A 1 65  ? -12.282 -24.590 -7.576  1.00 41.02 ? 535 SER A O   1 
ATOM   491  C  CB  . SER A 1 65  ? -15.411 -24.322 -7.146  1.00 40.92 ? 535 SER A CB  1 
ATOM   492  O  OG  . SER A 1 65  ? -16.619 -25.064 -7.088  1.00 40.70 ? 535 SER A OG  1 
ATOM   493  N  N   . TYR A 1 66  ? -12.723 -23.255 -5.804  1.00 41.15 ? 536 TYR A N   1 
ATOM   494  C  CA  . TYR A 1 66  ? -11.669 -22.294 -6.081  1.00 41.03 ? 536 TYR A CA  1 
ATOM   495  C  C   . TYR A 1 66  ? -10.590 -22.269 -4.997  1.00 41.69 ? 536 TYR A C   1 
ATOM   496  O  O   . TYR A 1 66  ? -10.891 -22.386 -3.801  1.00 41.99 ? 536 TYR A O   1 
ATOM   497  C  CB  . TYR A 1 66  ? -12.289 -20.901 -6.252  1.00 41.62 ? 536 TYR A CB  1 
ATOM   498  C  CG  . TYR A 1 66  ? -13.310 -20.833 -7.382  1.00 40.69 ? 536 TYR A CG  1 
ATOM   499  C  CD1 . TYR A 1 66  ? -12.895 -20.848 -8.717  1.00 40.98 ? 536 TYR A CD1 1 
ATOM   500  C  CD2 . TYR A 1 66  ? -14.673 -20.792 -7.119  1.00 39.65 ? 536 TYR A CD2 1 
ATOM   501  C  CE1 . TYR A 1 66  ? -13.801 -20.793 -9.757  1.00 41.38 ? 536 TYR A CE1 1 
ATOM   502  C  CE2 . TYR A 1 66  ? -15.617 -20.724 -8.168  1.00 41.41 ? 536 TYR A CE2 1 
ATOM   503  C  CZ  . TYR A 1 66  ? -15.160 -20.725 -9.481  1.00 41.55 ? 536 TYR A CZ  1 
ATOM   504  O  OH  . TYR A 1 66  ? -16.032 -20.653 -10.528 1.00 42.87 ? 536 TYR A OH  1 
ATOM   505  N  N   . CYS A 1 67  ? -9.337  -22.140 -5.441  1.00 41.20 ? 537 CYS A N   1 
ATOM   506  C  CA  . CYS A 1 67  ? -8.180  -21.941 -4.576  1.00 41.48 ? 537 CYS A CA  1 
ATOM   507  C  C   . CYS A 1 67  ? -8.449  -20.853 -3.548  1.00 41.79 ? 537 CYS A C   1 
ATOM   508  O  O   . CYS A 1 67  ? -8.854  -19.741 -3.892  1.00 41.17 ? 537 CYS A O   1 
ATOM   509  C  CB  . CYS A 1 67  ? -6.963  -21.536 -5.414  1.00 40.86 ? 537 CYS A CB  1 
ATOM   510  S  SG  . CYS A 1 67  ? -5.453  -21.213 -4.437  1.00 40.17 ? 537 CYS A SG  1 
ATOM   511  N  N   . THR A 1 68  ? -8.172  -21.180 -2.292  1.00 42.44 ? 538 THR A N   1 
ATOM   512  C  CA  . THR A 1 68  ? -8.369  -20.276 -1.159  1.00 43.45 ? 538 THR A CA  1 
ATOM   513  C  C   . THR A 1 68  ? -7.547  -18.974 -1.252  1.00 43.70 ? 538 THR A C   1 
ATOM   514  O  O   . THR A 1 68  ? -7.892  -17.961 -0.649  1.00 43.58 ? 538 THR A O   1 
ATOM   515  C  CB  . THR A 1 68  ? -8.083  -21.036 0.177   1.00 43.56 ? 538 THR A CB  1 
ATOM   516  O  OG1 . THR A 1 68  ? -9.202  -21.886 0.495   1.00 46.06 ? 538 THR A OG1 1 
ATOM   517  C  CG2 . THR A 1 68  ? -7.844  -20.091 1.351   1.00 43.64 ? 538 THR A CG2 1 
ATOM   518  N  N   . ILE A 1 69  ? -6.463  -18.992 -2.005  1.00 44.14 ? 539 ILE A N   1 
ATOM   519  C  CA  . ILE A 1 69  ? -5.612  -17.813 -2.076  1.00 45.40 ? 539 ILE A CA  1 
ATOM   520  C  C   . ILE A 1 69  ? -5.925  -16.928 -3.290  1.00 46.25 ? 539 ILE A C   1 
ATOM   521  O  O   . ILE A 1 69  ? -6.043  -15.701 -3.145  1.00 46.61 ? 539 ILE A O   1 
ATOM   522  C  CB  . ILE A 1 69  ? -4.117  -18.221 -2.047  1.00 45.90 ? 539 ILE A CB  1 
ATOM   523  C  CG1 . ILE A 1 69  ? -3.783  -18.862 -0.691  1.00 45.64 ? 539 ILE A CG1 1 
ATOM   524  C  CG2 . ILE A 1 69  ? -3.175  -17.022 -2.411  1.00 44.40 ? 539 ILE A CG2 1 
ATOM   525  C  CD1 . ILE A 1 69  ? -2.406  -19.534 -0.670  1.00 48.26 ? 539 ILE A CD1 1 
ATOM   526  N  N   . CYS A 1 70  ? -6.056  -17.555 -4.465  1.00 46.57 ? 540 CYS A N   1 
ATOM   527  C  CA  . CYS A 1 70  ? -6.134  -16.848 -5.742  1.00 47.05 ? 540 CYS A CA  1 
ATOM   528  C  C   . CYS A 1 70  ? -7.500  -16.896 -6.449  1.00 46.80 ? 540 CYS A C   1 
ATOM   529  O  O   . CYS A 1 70  ? -7.666  -16.214 -7.460  1.00 46.31 ? 540 CYS A O   1 
ATOM   530  C  CB  . CYS A 1 70  ? -5.042  -17.355 -6.706  1.00 46.91 ? 540 CYS A CB  1 
ATOM   531  S  SG  . CYS A 1 70  ? -5.366  -18.997 -7.510  1.00 50.78 ? 540 CYS A SG  1 
ATOM   532  N  N   . CYS A 1 71  ? -8.441  -17.704 -5.926  1.00 47.33 ? 541 CYS A N   1 
ATOM   533  C  CA  . CYS A 1 71  ? -9.793  -17.933 -6.505  1.00 48.13 ? 541 CYS A CA  1 
ATOM   534  C  C   . CYS A 1 71  ? -9.877  -18.660 -7.841  1.00 47.48 ? 541 CYS A C   1 
ATOM   535  O  O   . CYS A 1 71  ? -10.933 -18.646 -8.491  1.00 47.72 ? 541 CYS A O   1 
ATOM   536  C  CB  . CYS A 1 71  ? -10.572 -16.632 -6.660  1.00 48.48 ? 541 CYS A CB  1 
ATOM   537  S  SG  . CYS A 1 71  ? -10.841 -15.849 -5.128  1.00 54.49 ? 541 CYS A SG  1 
ATOM   538  N  N   . GLY A 1 72  ? -8.779  -19.258 -8.263  1.00 46.55 ? 542 GLY A N   1 
ATOM   539  C  CA  . GLY A 1 72  ? -8.752  -19.988 -9.517  1.00 46.66 ? 542 GLY A CA  1 
ATOM   540  C  C   . GLY A 1 72  ? -8.259  -21.387 -9.256  1.00 46.88 ? 542 GLY A C   1 
ATOM   541  O  O   . GLY A 1 72  ? -8.715  -22.024 -8.318  1.00 47.36 ? 542 GLY A O   1 
ATOM   542  N  N   . GLY A 1 73  ? -7.326  -21.849 -10.082 1.00 46.69 ? 543 GLY A N   1 
ATOM   543  C  CA  . GLY A 1 73  ? -6.680  -23.150 -9.895  1.00 46.81 ? 543 GLY A CA  1 
ATOM   544  C  C   . GLY A 1 73  ? -7.295  -24.281 -10.716 1.00 46.54 ? 543 GLY A C   1 
ATOM   545  O  O   . GLY A 1 73  ? -8.522  -24.332 -10.931 1.00 46.24 ? 543 GLY A O   1 
ATOM   546  N  N   . ARG A 1 74  ? -6.429  -25.176 -11.171 1.00 45.67 ? 544 ARG A N   1 
ATOM   547  C  CA  . ARG A 1 74  ? -6.833  -26.420 -11.817 1.00 45.78 ? 544 ARG A CA  1 
ATOM   548  C  C   . ARG A 1 74  ? -6.433  -27.590 -10.912 1.00 45.35 ? 544 ARG A C   1 
ATOM   549  O  O   . ARG A 1 74  ? -7.249  -28.062 -10.135 1.00 45.74 ? 544 ARG A O   1 
ATOM   550  C  CB  . ARG A 1 74  ? -6.187  -26.547 -13.210 1.00 45.56 ? 544 ARG A CB  1 
ATOM   551  C  CG  . ARG A 1 74  ? -6.604  -25.451 -14.210 1.00 45.09 ? 544 ARG A CG  1 
ATOM   552  C  CD  . ARG A 1 74  ? -8.030  -25.631 -14.634 1.00 41.73 ? 544 ARG A CD  1 
ATOM   553  N  NE  . ARG A 1 74  ? -8.430  -24.698 -15.692 1.00 42.77 ? 544 ARG A NE  1 
ATOM   554  C  CZ  . ARG A 1 74  ? -9.490  -24.888 -16.469 1.00 39.99 ? 544 ARG A CZ  1 
ATOM   555  N  NH1 . ARG A 1 74  ? -10.212 -26.003 -16.336 1.00 38.31 ? 544 ARG A NH1 1 
ATOM   556  N  NH2 . ARG A 1 74  ? -9.815  -23.988 -17.379 1.00 38.12 ? 544 ARG A NH2 1 
ATOM   557  N  N   . GLU A 1 75  ? -5.182  -28.036 -11.006 1.00 44.81 ? 545 GLU A N   1 
ATOM   558  C  CA  . GLU A 1 75  ? -4.613  -28.990 -10.041 1.00 44.40 ? 545 GLU A CA  1 
ATOM   559  C  C   . GLU A 1 75  ? -4.506  -28.332 -8.657  1.00 43.94 ? 545 GLU A C   1 
ATOM   560  O  O   . GLU A 1 75  ? -3.988  -27.216 -8.514  1.00 44.26 ? 545 GLU A O   1 
ATOM   561  C  CB  . GLU A 1 75  ? -3.239  -29.523 -10.496 1.00 42.80 ? 545 GLU A CB  1 
ATOM   562  C  CG  . GLU A 1 75  ? -2.709  -30.637 -9.586  1.00 43.84 ? 545 GLU A CG  1 
ATOM   563  C  CD  . GLU A 1 75  ? -1.314  -31.170 -9.947  1.00 45.79 ? 545 GLU A CD  1 
ATOM   564  O  OE1 . GLU A 1 75  ? -0.647  -30.622 -10.864 1.00 47.78 ? 545 GLU A OE1 1 
ATOM   565  O  OE2 . GLU A 1 75  ? -0.877  -32.155 -9.295  1.00 46.72 ? 545 GLU A OE2 1 
ATOM   566  N  N   . VAL A 1 76  ? -4.999  -29.017 -7.638  1.00 43.45 ? 546 VAL A N   1 
ATOM   567  C  CA  . VAL A 1 76  ? -5.045  -28.427 -6.315  1.00 43.21 ? 546 VAL A CA  1 
ATOM   568  C  C   . VAL A 1 76  ? -4.751  -29.484 -5.257  1.00 44.07 ? 546 VAL A C   1 
ATOM   569  O  O   . VAL A 1 76  ? -4.898  -30.688 -5.495  1.00 43.58 ? 546 VAL A O   1 
ATOM   570  C  CB  . VAL A 1 76  ? -6.447  -27.795 -6.019  1.00 43.99 ? 546 VAL A CB  1 
ATOM   571  C  CG1 . VAL A 1 76  ? -6.721  -26.527 -6.875  1.00 41.80 ? 546 VAL A CG1 1 
ATOM   572  C  CG2 . VAL A 1 76  ? -7.572  -28.830 -6.196  1.00 43.71 ? 546 VAL A CG2 1 
ATOM   573  N  N   . LEU A 1 77  ? -4.323  -29.017 -4.091  1.00 44.25 ? 547 LEU A N   1 
ATOM   574  C  CA  . LEU A 1 77  ? -4.250  -29.836 -2.905  1.00 44.58 ? 547 LEU A CA  1 
ATOM   575  C  C   . LEU A 1 77  ? -5.575  -29.630 -2.202  1.00 44.87 ? 547 LEU A C   1 
ATOM   576  O  O   . LEU A 1 77  ? -6.062  -28.504 -2.141  1.00 45.01 ? 547 LEU A O   1 
ATOM   577  C  CB  . LEU A 1 77  ? -3.099  -29.338 -2.023  1.00 44.68 ? 547 LEU A CB  1 
ATOM   578  C  CG  . LEU A 1 77  ? -1.708  -29.156 -2.649  1.00 45.11 ? 547 LEU A CG  1 
ATOM   579  C  CD1 . LEU A 1 77  ? -0.732  -28.527 -1.657  1.00 44.18 ? 547 LEU A CD1 1 
ATOM   580  C  CD2 . LEU A 1 77  ? -1.156  -30.470 -3.116  1.00 46.68 ? 547 LEU A CD2 1 
ATOM   581  N  N   . MET A 1 78  ? -6.152  -30.703 -1.666  1.00 45.05 ? 548 MET A N   1 
ATOM   582  C  CA  . MET A 1 78  ? -7.480  -30.663 -1.020  1.00 45.35 ? 548 MET A CA  1 
ATOM   583  C  C   . MET A 1 78  ? -7.400  -31.052 0.469   1.00 45.41 ? 548 MET A C   1 
ATOM   584  O  O   . MET A 1 78  ? -6.764  -32.049 0.795   1.00 44.85 ? 548 MET A O   1 
ATOM   585  C  CB  . MET A 1 78  ? -8.441  -31.580 -1.779  1.00 45.31 ? 548 MET A CB  1 
ATOM   586  C  CG  . MET A 1 78  ? -8.758  -31.060 -3.195  1.00 46.07 ? 548 MET A CG  1 
ATOM   587  S  SD  . MET A 1 78  ? -9.607  -32.169 -4.332  1.00 46.42 ? 548 MET A SD  1 
ATOM   588  C  CE  . MET A 1 78  ? -8.209  -32.970 -5.098  1.00 47.94 ? 548 MET A CE  1 
ATOM   589  N  N   . CYS A 1 79  ? -8.010  -30.251 1.354   1.00 45.21 ? 549 CYS A N   1 
ATOM   590  C  CA  . CYS A 1 79  ? -7.961  -30.489 2.818   1.00 46.22 ? 549 CYS A CA  1 
ATOM   591  C  C   . CYS A 1 79  ? -8.793  -31.686 3.173   1.00 46.88 ? 549 CYS A C   1 
ATOM   592  O  O   . CYS A 1 79  ? -9.954  -31.764 2.779   1.00 47.97 ? 549 CYS A O   1 
ATOM   593  C  CB  . CYS A 1 79  ? -8.498  -29.284 3.639   1.00 46.08 ? 549 CYS A CB  1 
ATOM   594  S  SG  . CYS A 1 79  ? -8.177  -29.346 5.490   1.00 44.24 ? 549 CYS A SG  1 
ATOM   595  N  N   . GLY A 1 80  ? -8.219  -32.595 3.947   1.00 47.33 ? 550 GLY A N   1 
ATOM   596  C  CA  . GLY A 1 80  ? -8.970  -33.716 4.514   1.00 47.08 ? 550 GLY A CA  1 
ATOM   597  C  C   . GLY A 1 80  ? -9.769  -33.442 5.788   1.00 47.25 ? 550 GLY A C   1 
ATOM   598  O  O   . GLY A 1 80  ? -10.345 -34.379 6.362   1.00 47.10 ? 550 GLY A O   1 
ATOM   599  N  N   . ASN A 1 81  ? -9.817  -32.181 6.242   1.00 47.07 ? 551 ASN A N   1 
ATOM   600  C  CA  . ASN A 1 81  ? -10.709 -31.794 7.360   1.00 46.60 ? 551 ASN A CA  1 
ATOM   601  C  C   . ASN A 1 81  ? -12.084 -31.530 6.764   1.00 46.46 ? 551 ASN A C   1 
ATOM   602  O  O   . ASN A 1 81  ? -12.281 -30.565 6.015   1.00 45.78 ? 551 ASN A O   1 
ATOM   603  C  CB  . ASN A 1 81  ? -10.172 -30.555 8.112   1.00 46.42 ? 551 ASN A CB  1 
ATOM   604  C  CG  . ASN A 1 81  ? -11.117 -30.046 9.242   1.00 47.17 ? 551 ASN A CG  1 
ATOM   605  O  OD1 . ASN A 1 81  ? -12.241 -30.530 9.437   1.00 47.08 ? 551 ASN A OD1 1 
ATOM   606  N  ND2 . ASN A 1 81  ? -10.637 -29.049 9.986   1.00 47.49 ? 551 ASN A ND2 1 
ATOM   607  N  N   . ASN A 1 82  ? -13.031 -32.405 7.075   1.00 46.82 ? 552 ASN A N   1 
ATOM   608  C  CA  . ASN A 1 82  ? -14.359 -32.313 6.494   1.00 47.27 ? 552 ASN A CA  1 
ATOM   609  C  C   . ASN A 1 82  ? -15.162 -31.119 6.991   1.00 47.27 ? 552 ASN A C   1 
ATOM   610  O  O   . ASN A 1 82  ? -16.218 -30.807 6.447   1.00 47.48 ? 552 ASN A O   1 
ATOM   611  C  CB  . ASN A 1 82  ? -15.123 -33.626 6.684   1.00 48.39 ? 552 ASN A CB  1 
ATOM   612  C  CG  . ASN A 1 82  ? -14.894 -34.598 5.539   1.00 49.80 ? 552 ASN A CG  1 
ATOM   613  O  OD1 . ASN A 1 82  ? -15.837 -34.967 4.838   1.00 52.25 ? 552 ASN A OD1 1 
ATOM   614  N  ND2 . ASN A 1 82  ? -13.639 -35.000 5.331   1.00 50.71 ? 552 ASN A ND2 1 
ATOM   615  N  N   . ASN A 1 83  ? -14.663 -30.453 8.026   1.00 47.27 ? 553 ASN A N   1 
ATOM   616  C  CA  . ASN A 1 83  ? -15.251 -29.191 8.452   1.00 47.78 ? 553 ASN A CA  1 
ATOM   617  C  C   . ASN A 1 83  ? -14.716 -28.028 7.615   1.00 47.45 ? 553 ASN A C   1 
ATOM   618  O  O   . ASN A 1 83  ? -15.170 -26.888 7.742   1.00 47.18 ? 553 ASN A O   1 
ATOM   619  C  CB  . ASN A 1 83  ? -15.001 -28.951 9.940   1.00 47.97 ? 553 ASN A CB  1 
ATOM   620  C  CG  . ASN A 1 83  ? -16.035 -29.617 10.812  1.00 49.50 ? 553 ASN A CG  1 
ATOM   621  O  OD1 . ASN A 1 83  ? -15.748 -30.607 11.493  1.00 50.16 ? 553 ASN A OD1 1 
ATOM   622  N  ND2 . ASN A 1 83  ? -17.258 -29.083 10.794  1.00 50.97 ? 553 ASN A ND2 1 
ATOM   623  N  N   . CYS A 1 84  ? -13.765 -28.333 6.742   1.00 47.16 ? 554 CYS A N   1 
ATOM   624  C  CA  . CYS A 1 84  ? -13.046 -27.306 6.025   1.00 46.58 ? 554 CYS A CA  1 
ATOM   625  C  C   . CYS A 1 84  ? -13.223 -27.417 4.508   1.00 45.96 ? 554 CYS A C   1 
ATOM   626  O  O   . CYS A 1 84  ? -13.823 -26.517 3.887   1.00 46.01 ? 554 CYS A O   1 
ATOM   627  C  CB  . CYS A 1 84  ? -11.566 -27.358 6.413   1.00 46.47 ? 554 CYS A CB  1 
ATOM   628  S  SG  . CYS A 1 84  ? -10.537 -26.294 5.404   1.00 48.65 ? 554 CYS A SG  1 
ATOM   629  N  N   . CYS A 1 85  ? -12.690 -28.497 3.912   1.00 44.82 ? 555 CYS A N   1 
ATOM   630  C  CA  . CYS A 1 85  ? -12.892 -28.796 2.478   1.00 44.17 ? 555 CYS A CA  1 
ATOM   631  C  C   . CYS A 1 85  ? -12.276 -27.789 1.484   1.00 43.38 ? 555 CYS A C   1 
ATOM   632  O  O   . CYS A 1 85  ? -12.701 -27.711 0.311   1.00 43.38 ? 555 CYS A O   1 
ATOM   633  C  CB  . CYS A 1 85  ? -14.392 -28.951 2.192   1.00 43.79 ? 555 CYS A CB  1 
ATOM   634  S  SG  . CYS A 1 85  ? -15.170 -30.349 3.067   1.00 46.23 ? 555 CYS A SG  1 
ATOM   635  N  N   . ARG A 1 86  ? -11.311 -27.009 1.964   1.00 42.79 ? 556 ARG A N   1 
ATOM   636  C  CA  . ARG A 1 86  ? -10.600 -26.004 1.153   1.00 42.93 ? 556 ARG A CA  1 
ATOM   637  C  C   . ARG A 1 86  ? -9.636  -26.636 0.157   1.00 43.42 ? 556 ARG A C   1 
ATOM   638  O  O   . ARG A 1 86  ? -9.163  -27.760 0.366   1.00 43.69 ? 556 ARG A O   1 
ATOM   639  C  CB  . ARG A 1 86  ? -9.826  -25.023 2.044   1.00 42.28 ? 556 ARG A CB  1 
ATOM   640  C  CG  . ARG A 1 86  ? -10.734 -24.035 2.785   1.00 42.00 ? 556 ARG A CG  1 
ATOM   641  C  CD  . ARG A 1 86  ? -9.960  -23.035 3.638   1.00 42.25 ? 556 ARG A CD  1 
ATOM   642  N  NE  . ARG A 1 86  ? -10.875 -22.112 4.307   1.00 42.04 ? 556 ARG A NE  1 
ATOM   643  C  CZ  . ARG A 1 86  ? -11.354 -20.991 3.764   1.00 43.11 ? 556 ARG A CZ  1 
ATOM   644  N  NH1 . ARG A 1 86  ? -12.203 -20.238 4.462   1.00 41.78 ? 556 ARG A NH1 1 
ATOM   645  N  NH2 . ARG A 1 86  ? -11.004 -20.627 2.519   1.00 41.24 ? 556 ARG A NH2 1 
ATOM   646  N  N   A CYS A 1 87  ? -9.357  -25.901 -0.920  0.50 43.04 ? 557 CYS A N   1 
ATOM   647  N  N   B CYS A 1 87  ? -9.352  -25.923 -0.926  0.50 43.68 ? 557 CYS A N   1 
ATOM   648  C  CA  A CYS A 1 87  ? -8.338  -26.276 -1.897  0.50 42.66 ? 557 CYS A CA  1 
ATOM   649  C  CA  B CYS A 1 87  ? -8.271  -26.326 -1.806  0.50 44.03 ? 557 CYS A CA  1 
ATOM   650  C  C   A CYS A 1 87  ? -7.313  -25.162 -2.074  0.50 42.91 ? 557 CYS A C   1 
ATOM   651  C  C   B CYS A 1 87  ? -7.310  -25.181 -2.061  0.50 43.62 ? 557 CYS A C   1 
ATOM   652  O  O   A CYS A 1 87  ? -7.664  -23.972 -2.003  0.50 42.91 ? 557 CYS A O   1 
ATOM   653  O  O   B CYS A 1 87  ? -7.699  -24.001 -2.035  0.50 43.60 ? 557 CYS A O   1 
ATOM   654  C  CB  A CYS A 1 87  ? -8.974  -26.610 -3.249  0.50 42.58 ? 557 CYS A CB  1 
ATOM   655  C  CB  B CYS A 1 87  ? -8.794  -26.891 -3.125  0.50 44.28 ? 557 CYS A CB  1 
ATOM   656  S  SG  A CYS A 1 87  ? -10.128 -28.014 -3.208  0.50 41.03 ? 557 CYS A SG  1 
ATOM   657  S  SG  B CYS A 1 87  ? -9.559  -25.689 -4.177  0.50 47.71 ? 557 CYS A SG  1 
ATOM   658  N  N   . PHE A 1 88  ? -6.055  -25.559 -2.287  1.00 42.65 ? 558 PHE A N   1 
ATOM   659  C  CA  . PHE A 1 88  ? -4.965  -24.636 -2.603  1.00 42.93 ? 558 PHE A CA  1 
ATOM   660  C  C   . PHE A 1 88  ? -4.303  -25.077 -3.908  1.00 42.28 ? 558 PHE A C   1 
ATOM   661  O  O   . PHE A 1 88  ? -3.739  -26.196 -3.993  1.00 42.69 ? 558 PHE A O   1 
ATOM   662  C  CB  . PHE A 1 88  ? -3.923  -24.666 -1.463  1.00 41.74 ? 558 PHE A CB  1 
ATOM   663  C  CG  . PHE A 1 88  ? -4.425  -24.043 -0.201  1.00 43.20 ? 558 PHE A CG  1 
ATOM   664  C  CD1 . PHE A 1 88  ? -5.268  -24.749 0.659   1.00 41.58 ? 558 PHE A CD1 1 
ATOM   665  C  CD2 . PHE A 1 88  ? -4.093  -22.722 0.110   1.00 44.29 ? 558 PHE A CD2 1 
ATOM   666  C  CE1 . PHE A 1 88  ? -5.764  -24.161 1.813   1.00 41.21 ? 558 PHE A CE1 1 
ATOM   667  C  CE2 . PHE A 1 88  ? -4.578  -22.120 1.271   1.00 45.28 ? 558 PHE A CE2 1 
ATOM   668  C  CZ  . PHE A 1 88  ? -5.424  -22.835 2.123   1.00 42.95 ? 558 PHE A CZ  1 
ATOM   669  N  N   . CYS A 1 89  ? -4.295  -24.208 -4.899  1.00 41.42 ? 559 CYS A N   1 
ATOM   670  C  CA  . CYS A 1 89  ? -3.701  -24.597 -6.182  1.00 41.74 ? 559 CYS A CA  1 
ATOM   671  C  C   . CYS A 1 89  ? -2.183  -24.801 -6.091  1.00 41.49 ? 559 CYS A C   1 
ATOM   672  O  O   . CYS A 1 89  ? -1.526  -24.301 -5.168  1.00 41.54 ? 559 CYS A O   1 
ATOM   673  C  CB  . CYS A 1 89  ? -4.128  -23.668 -7.329  1.00 42.09 ? 559 CYS A CB  1 
ATOM   674  S  SG  . CYS A 1 89  ? -3.282  -22.092 -7.428  1.00 42.87 ? 559 CYS A SG  1 
ATOM   675  N  N   . VAL A 1 90  ? -1.612  -25.563 -7.014  1.00 41.34 ? 560 VAL A N   1 
ATOM   676  C  CA  . VAL A 1 90  ? -0.193  -25.903 -6.863  1.00 41.06 ? 560 VAL A CA  1 
ATOM   677  C  C   . VAL A 1 90  ? 0.697   -24.694 -7.138  1.00 41.29 ? 560 VAL A C   1 
ATOM   678  O  O   . VAL A 1 90  ? 1.768   -24.570 -6.558  1.00 41.42 ? 560 VAL A O   1 
ATOM   679  C  CB  . VAL A 1 90  ? 0.217   -27.149 -7.692  1.00 41.08 ? 560 VAL A CB  1 
ATOM   680  C  CG1 . VAL A 1 90  ? -0.585  -28.356 -7.227  1.00 40.13 ? 560 VAL A CG1 1 
ATOM   681  C  CG2 . VAL A 1 90  ? 0.018   -26.912 -9.201  1.00 41.53 ? 560 VAL A CG2 1 
ATOM   682  N  N   . GLU A 1 91  ? 0.238   -23.794 -8.003  1.00 41.99 ? 561 GLU A N   1 
ATOM   683  C  CA  . GLU A 1 91  ? 1.016   -22.600 -8.361  1.00 42.89 ? 561 GLU A CA  1 
ATOM   684  C  C   . GLU A 1 91  ? 1.154   -21.640 -7.170  1.00 43.18 ? 561 GLU A C   1 
ATOM   685  O  O   . GLU A 1 91  ? 2.220   -21.081 -6.937  1.00 43.13 ? 561 GLU A O   1 
ATOM   686  C  CB  . GLU A 1 91  ? 0.413   -21.885 -9.577  1.00 42.47 ? 561 GLU A CB  1 
ATOM   687  C  CG  . GLU A 1 91  ? 0.672   -22.605 -10.898 1.00 43.61 ? 561 GLU A CG  1 
ATOM   688  C  CD  . GLU A 1 91  ? -0.470  -23.541 -11.333 1.00 44.57 ? 561 GLU A CD  1 
ATOM   689  O  OE1 . GLU A 1 91  ? -1.445  -23.715 -10.562 1.00 45.15 ? 561 GLU A OE1 1 
ATOM   690  O  OE2 . GLU A 1 91  ? -0.388  -24.102 -12.455 1.00 44.25 ? 561 GLU A OE2 1 
ATOM   691  N  N   . CYS A 1 92  ? 0.069   -21.487 -6.414  1.00 44.07 ? 562 CYS A N   1 
ATOM   692  C  CA  . CYS A 1 92  ? 0.049   -20.641 -5.227  1.00 44.87 ? 562 CYS A CA  1 
ATOM   693  C  C   . CYS A 1 92  ? 0.976   -21.205 -4.164  1.00 44.84 ? 562 CYS A C   1 
ATOM   694  O  O   . CYS A 1 92  ? 1.720   -20.452 -3.519  1.00 44.69 ? 562 CYS A O   1 
ATOM   695  C  CB  . CYS A 1 92  ? -1.379  -20.508 -4.669  1.00 44.41 ? 562 CYS A CB  1 
ATOM   696  S  SG  . CYS A 1 92  ? -2.345  -19.173 -5.439  1.00 46.48 ? 562 CYS A SG  1 
ATOM   697  N  N   . VAL A 1 93  ? 0.930   -22.528 -3.993  1.00 44.59 ? 563 VAL A N   1 
ATOM   698  C  CA  . VAL A 1 93  ? 1.766   -23.206 -2.999  1.00 44.89 ? 563 VAL A CA  1 
ATOM   699  C  C   . VAL A 1 93  ? 3.264   -23.067 -3.322  1.00 46.13 ? 563 VAL A C   1 
ATOM   700  O  O   . VAL A 1 93  ? 4.055   -22.635 -2.471  1.00 46.78 ? 563 VAL A O   1 
ATOM   701  C  CB  . VAL A 1 93  ? 1.327   -24.689 -2.830  1.00 45.02 ? 563 VAL A CB  1 
ATOM   702  C  CG1 . VAL A 1 93  ? 2.343   -25.508 -2.064  1.00 42.50 ? 563 VAL A CG1 1 
ATOM   703  C  CG2 . VAL A 1 93  ? -0.029  -24.732 -2.105  1.00 43.31 ? 563 VAL A CG2 1 
ATOM   704  N  N   . ASP A 1 94  ? 3.641   -23.391 -4.557  1.00 45.96 ? 564 ASP A N   1 
ATOM   705  C  CA  . ASP A 1 94  ? 5.002   -23.215 -5.009  1.00 46.75 ? 564 ASP A CA  1 
ATOM   706  C  C   . ASP A 1 94  ? 5.472   -21.744 -4.959  1.00 46.42 ? 564 ASP A C   1 
ATOM   707  O  O   . ASP A 1 94  ? 6.637   -21.462 -4.736  1.00 46.75 ? 564 ASP A O   1 
ATOM   708  C  CB  . ASP A 1 94  ? 5.160   -23.812 -6.405  1.00 47.08 ? 564 ASP A CB  1 
ATOM   709  C  CG  . ASP A 1 94  ? 5.184   -25.345 -6.390  1.00 51.39 ? 564 ASP A CG  1 
ATOM   710  O  OD1 . ASP A 1 94  ? 5.443   -25.940 -5.320  1.00 54.20 ? 564 ASP A OD1 1 
ATOM   711  O  OD2 . ASP A 1 94  ? 4.959   -25.974 -7.459  1.00 56.11 ? 564 ASP A OD2 1 
ATOM   712  N  N   . LEU A 1 95  ? 4.567   -20.797 -5.134  1.00 46.45 ? 565 LEU A N   1 
ATOM   713  C  CA  . LEU A 1 95  ? 4.983   -19.406 -5.102  1.00 46.26 ? 565 LEU A CA  1 
ATOM   714  C  C   . LEU A 1 95  ? 5.173   -18.918 -3.666  1.00 46.08 ? 565 LEU A C   1 
ATOM   715  O  O   . LEU A 1 95  ? 6.216   -18.377 -3.319  1.00 46.18 ? 565 LEU A O   1 
ATOM   716  C  CB  . LEU A 1 95  ? 3.969   -18.530 -5.846  1.00 46.20 ? 565 LEU A CB  1 
ATOM   717  C  CG  . LEU A 1 95  ? 4.380   -17.076 -6.102  1.00 46.89 ? 565 LEU A CG  1 
ATOM   718  C  CD1 . LEU A 1 95  ? 5.630   -16.990 -6.968  1.00 44.60 ? 565 LEU A CD1 1 
ATOM   719  C  CD2 . LEU A 1 95  ? 3.199   -16.309 -6.740  1.00 47.18 ? 565 LEU A CD2 1 
ATOM   720  N  N   . LEU A 1 96  ? 4.171   -19.159 -2.824  1.00 46.22 ? 566 LEU A N   1 
ATOM   721  C  CA  . LEU A 1 96  ? 4.063   -18.510 -1.511  1.00 45.62 ? 566 LEU A CA  1 
ATOM   722  C  C   . LEU A 1 96  ? 4.731   -19.312 -0.395  1.00 45.91 ? 566 LEU A C   1 
ATOM   723  O  O   . LEU A 1 96  ? 5.267   -18.732 0.554   1.00 45.81 ? 566 LEU A O   1 
ATOM   724  C  CB  . LEU A 1 96  ? 2.595   -18.189 -1.182  1.00 44.37 ? 566 LEU A CB  1 
ATOM   725  C  CG  . LEU A 1 96  ? 2.018   -17.032 -2.013  1.00 45.01 ? 566 LEU A CG  1 
ATOM   726  C  CD1 . LEU A 1 96  ? 0.512   -16.872 -1.790  1.00 41.19 ? 566 LEU A CD1 1 
ATOM   727  C  CD2 . LEU A 1 96  ? 2.776   -15.689 -1.763  1.00 41.32 ? 566 LEU A CD2 1 
ATOM   728  N  N   . VAL A 1 97  ? 4.697   -20.637 -0.507  1.00 45.57 ? 567 VAL A N   1 
ATOM   729  C  CA  . VAL A 1 97  ? 5.402   -21.488 0.448   1.00 45.15 ? 567 VAL A CA  1 
ATOM   730  C  C   . VAL A 1 97  ? 6.846   -21.651 -0.011  1.00 45.81 ? 567 VAL A C   1 
ATOM   731  O  O   . VAL A 1 97  ? 7.777   -21.350 0.740   1.00 46.15 ? 567 VAL A O   1 
ATOM   732  C  CB  . VAL A 1 97  ? 4.677   -22.817 0.639   1.00 44.99 ? 567 VAL A CB  1 
ATOM   733  C  CG1 . VAL A 1 97  ? 5.422   -23.760 1.618   1.00 44.17 ? 567 VAL A CG1 1 
ATOM   734  C  CG2 . VAL A 1 97  ? 3.266   -22.549 1.126   1.00 44.89 ? 567 VAL A CG2 1 
ATOM   735  N  N   . GLY A 1 98  ? 7.041   -22.083 -1.255  1.00 46.31 ? 568 GLY A N   1 
ATOM   736  C  CA  . GLY A 1 98  ? 8.376   -22.063 -1.862  1.00 46.76 ? 568 GLY A CA  1 
ATOM   737  C  C   . GLY A 1 98  ? 8.486   -23.130 -2.921  1.00 47.07 ? 568 GLY A C   1 
ATOM   738  O  O   . GLY A 1 98  ? 7.645   -24.047 -2.956  1.00 47.83 ? 568 GLY A O   1 
ATOM   739  N  N   . PRO A 1 99  ? 9.490   -23.016 -3.810  1.00 47.05 ? 569 PRO A N   1 
ATOM   740  C  CA  . PRO A 1 99  ? 9.534   -23.980 -4.921  1.00 47.42 ? 569 PRO A CA  1 
ATOM   741  C  C   . PRO A 1 99  ? 9.672   -25.410 -4.421  1.00 47.49 ? 569 PRO A C   1 
ATOM   742  O  O   . PRO A 1 99  ? 10.531  -25.694 -3.564  1.00 47.91 ? 569 PRO A O   1 
ATOM   743  C  CB  . PRO A 1 99  ? 10.784  -23.571 -5.726  1.00 47.43 ? 569 PRO A CB  1 
ATOM   744  C  CG  . PRO A 1 99  ? 11.232  -22.258 -5.180  1.00 46.55 ? 569 PRO A CG  1 
ATOM   745  C  CD  . PRO A 1 99  ? 10.602  -22.042 -3.855  1.00 47.19 ? 569 PRO A CD  1 
ATOM   746  N  N   . GLY A 1 100 ? 8.827   -26.288 -4.948  1.00 46.93 ? 570 GLY A N   1 
ATOM   747  C  CA  . GLY A 1 100 ? 8.879   -27.708 -4.642  1.00 47.09 ? 570 GLY A CA  1 
ATOM   748  C  C   . GLY A 1 100 ? 7.859   -28.110 -3.599  1.00 47.93 ? 570 GLY A C   1 
ATOM   749  O  O   . GLY A 1 100 ? 7.644   -29.299 -3.369  1.00 47.82 ? 570 GLY A O   1 
ATOM   750  N  N   . ALA A 1 101 ? 7.218   -27.124 -2.974  1.00 47.93 ? 571 ALA A N   1 
ATOM   751  C  CA  . ALA A 1 101 ? 6.379   -27.384 -1.811  1.00 48.92 ? 571 ALA A CA  1 
ATOM   752  C  C   . ALA A 1 101 ? 5.055   -28.058 -2.179  1.00 48.57 ? 571 ALA A C   1 
ATOM   753  O  O   . ALA A 1 101 ? 4.477   -28.759 -1.367  1.00 49.46 ? 571 ALA A O   1 
ATOM   754  C  CB  . ALA A 1 101 ? 6.132   -26.074 -0.976  1.00 48.49 ? 571 ALA A CB  1 
ATOM   755  N  N   . ALA A 1 102 ? 4.581   -27.853 -3.397  1.00 48.43 ? 572 ALA A N   1 
ATOM   756  C  CA  . ALA A 1 102 ? 3.341   -28.485 -3.831  1.00 48.47 ? 572 ALA A CA  1 
ATOM   757  C  C   . ALA A 1 102 ? 3.484   -29.998 -3.939  1.00 48.56 ? 572 ALA A C   1 
ATOM   758  O  O   . ALA A 1 102 ? 2.655   -30.730 -3.403  1.00 47.97 ? 572 ALA A O   1 
ATOM   759  C  CB  . ALA A 1 102 ? 2.851   -27.886 -5.142  1.00 48.61 ? 572 ALA A CB  1 
ATOM   760  N  N   . GLN A 1 103 ? 4.538   -30.473 -4.605  1.00 48.86 ? 573 GLN A N   1 
ATOM   761  C  CA  . GLN A 1 103 ? 4.668   -31.922 -4.798  1.00 49.12 ? 573 GLN A CA  1 
ATOM   762  C  C   . GLN A 1 103 ? 5.067   -32.648 -3.499  1.00 49.09 ? 573 GLN A C   1 
ATOM   763  O  O   . GLN A 1 103 ? 4.826   -33.856 -3.362  1.00 49.12 ? 573 GLN A O   1 
ATOM   764  C  CB  . GLN A 1 103 ? 5.567   -32.301 -5.998  1.00 49.47 ? 573 GLN A CB  1 
ATOM   765  C  CG  . GLN A 1 103 ? 5.054   -31.850 -7.393  1.00 49.39 ? 573 GLN A CG  1 
ATOM   766  C  CD  . GLN A 1 103 ? 3.758   -32.536 -7.856  1.00 51.15 ? 573 GLN A CD  1 
ATOM   767  O  OE1 . GLN A 1 103 ? 3.711   -33.761 -8.064  1.00 49.85 ? 573 GLN A OE1 1 
ATOM   768  N  NE2 . GLN A 1 103 ? 2.709   -31.733 -8.055  1.00 50.79 ? 573 GLN A NE2 1 
ATOM   769  N  N   . ALA A 1 104 ? 5.639   -31.918 -2.541  1.00 48.66 ? 574 ALA A N   1 
ATOM   770  C  CA  . ALA A 1 104 ? 5.869   -32.499 -1.213  1.00 48.71 ? 574 ALA A CA  1 
ATOM   771  C  C   . ALA A 1 104 ? 4.559   -32.643 -0.425  1.00 48.63 ? 574 ALA A C   1 
ATOM   772  O  O   . ALA A 1 104 ? 4.339   -33.664 0.226   1.00 48.61 ? 574 ALA A O   1 
ATOM   773  C  CB  . ALA A 1 104 ? 6.903   -31.703 -0.419  1.00 48.47 ? 574 ALA A CB  1 
ATOM   774  N  N   . ALA A 1 105 ? 3.700   -31.623 -0.489  1.00 48.47 ? 575 ALA A N   1 
ATOM   775  C  CA  . ALA A 1 105 ? 2.374   -31.684 0.140   1.00 48.67 ? 575 ALA A CA  1 
ATOM   776  C  C   . ALA A 1 105 ? 1.570   -32.898 -0.354  1.00 48.71 ? 575 ALA A C   1 
ATOM   777  O  O   . ALA A 1 105 ? 0.860   -33.538 0.423   1.00 48.75 ? 575 ALA A O   1 
ATOM   778  C  CB  . ALA A 1 105 ? 1.600   -30.379 -0.074  1.00 47.98 ? 575 ALA A CB  1 
ATOM   779  N  N   . ILE A 1 106 ? 1.730   -33.233 -1.633  1.00 49.01 ? 576 ILE A N   1 
ATOM   780  C  CA  . ILE A 1 106 ? 1.081   -34.396 -2.238  1.00 49.23 ? 576 ILE A CA  1 
ATOM   781  C  C   . ILE A 1 106 ? 1.760   -35.696 -1.812  1.00 49.17 ? 576 ILE A C   1 
ATOM   782  O  O   . ILE A 1 106 ? 1.097   -36.647 -1.400  1.00 49.20 ? 576 ILE A O   1 
ATOM   783  C  CB  . ILE A 1 106 ? 1.103   -34.292 -3.767  1.00 49.60 ? 576 ILE A CB  1 
ATOM   784  C  CG1 . ILE A 1 106 ? 0.477   -32.964 -4.204  1.00 49.62 ? 576 ILE A CG1 1 
ATOM   785  C  CG2 . ILE A 1 106 ? 0.383   -35.500 -4.409  1.00 49.51 ? 576 ILE A CG2 1 
ATOM   786  C  CD1 . ILE A 1 106 ? 0.780   -32.569 -5.636  1.00 51.40 ? 576 ILE A CD1 1 
ATOM   787  N  N   . TRP A 1 111 ? -3.965  -35.165 4.409   1.00 43.11 ? 581 TRP A N   1 
ATOM   788  C  CA  . TRP A 1 111 ? -3.440  -33.798 4.388   1.00 43.45 ? 581 TRP A CA  1 
ATOM   789  C  C   . TRP A 1 111 ? -4.375  -32.768 5.010   1.00 43.60 ? 581 TRP A C   1 
ATOM   790  O  O   . TRP A 1 111 ? -5.494  -32.565 4.545   1.00 43.58 ? 581 TRP A O   1 
ATOM   791  C  CB  . TRP A 1 111 ? -3.077  -33.363 2.964   1.00 43.48 ? 581 TRP A CB  1 
ATOM   792  C  CG  . TRP A 1 111 ? -2.301  -32.056 2.903   1.00 43.46 ? 581 TRP A CG  1 
ATOM   793  C  CD1 . TRP A 1 111 ? -1.030  -31.844 3.330   1.00 43.93 ? 581 TRP A CD1 1 
ATOM   794  C  CD2 . TRP A 1 111 ? -2.767  -30.790 2.389   1.00 43.71 ? 581 TRP A CD2 1 
ATOM   795  N  NE1 . TRP A 1 111 ? -0.670  -30.524 3.124   1.00 44.48 ? 581 TRP A NE1 1 
ATOM   796  C  CE2 . TRP A 1 111 ? -1.719  -29.863 2.545   1.00 43.85 ? 581 TRP A CE2 1 
ATOM   797  C  CE3 . TRP A 1 111 ? -3.969  -30.356 1.817   1.00 43.06 ? 581 TRP A CE3 1 
ATOM   798  C  CZ2 . TRP A 1 111 ? -1.828  -28.535 2.133   1.00 44.49 ? 581 TRP A CZ2 1 
ATOM   799  C  CZ3 . TRP A 1 111 ? -4.077  -29.046 1.419   1.00 43.19 ? 581 TRP A CZ3 1 
ATOM   800  C  CH2 . TRP A 1 111 ? -3.015  -28.149 1.568   1.00 43.39 ? 581 TRP A CH2 1 
ATOM   801  N  N   . ASN A 1 112 ? -3.897  -32.112 6.064   1.00 44.09 ? 582 ASN A N   1 
ATOM   802  C  CA  . ASN A 1 112 ? -4.590  -30.963 6.640   1.00 44.20 ? 582 ASN A CA  1 
ATOM   803  C  C   . ASN A 1 112 ? -4.044  -29.693 6.000   1.00 43.89 ? 582 ASN A C   1 
ATOM   804  O  O   . ASN A 1 112 ? -2.830  -29.519 5.899   1.00 44.33 ? 582 ASN A O   1 
ATOM   805  C  CB  . ASN A 1 112 ? -4.424  -30.936 8.161   1.00 43.98 ? 582 ASN A CB  1 
ATOM   806  C  CG  . ASN A 1 112 ? -5.208  -32.052 8.857   1.00 45.69 ? 582 ASN A CG  1 
ATOM   807  O  OD1 . ASN A 1 112 ? -6.240  -32.530 8.360   1.00 47.31 ? 582 ASN A OD1 1 
ATOM   808  N  ND2 . ASN A 1 112 ? -4.720  -32.467 10.022  1.00 45.75 ? 582 ASN A ND2 1 
ATOM   809  N  N   . CYS A 1 113 ? -4.928  -28.813 5.549   1.00 43.35 ? 583 CYS A N   1 
ATOM   810  C  CA  . CYS A 1 113 ? -4.484  -27.641 4.802   1.00 42.90 ? 583 CYS A CA  1 
ATOM   811  C  C   . CYS A 1 113 ? -3.807  -26.590 5.674   1.00 42.47 ? 583 CYS A C   1 
ATOM   812  O  O   . CYS A 1 113 ? -3.606  -26.775 6.892   1.00 41.63 ? 583 CYS A O   1 
ATOM   813  C  CB  . CYS A 1 113 ? -5.631  -27.030 3.997   1.00 43.06 ? 583 CYS A CB  1 
ATOM   814  S  SG  . CYS A 1 113 ? -6.766  -26.004 4.958   1.00 44.51 ? 583 CYS A SG  1 
ATOM   815  N  N   . TYR A 1 114 ? -3.454  -25.477 5.040   1.00 42.15 ? 584 TYR A N   1 
ATOM   816  C  CA  . TYR A 1 114 ? -2.751  -24.409 5.748   1.00 42.53 ? 584 TYR A CA  1 
ATOM   817  C  C   . TYR A 1 114 ? -3.561  -23.736 6.836   1.00 42.29 ? 584 TYR A C   1 
ATOM   818  O  O   . TYR A 1 114 ? -2.976  -23.266 7.784   1.00 43.10 ? 584 TYR A O   1 
ATOM   819  C  CB  . TYR A 1 114 ? -2.156  -23.409 4.759   1.00 42.73 ? 584 TYR A CB  1 
ATOM   820  C  CG  . TYR A 1 114 ? -1.255  -24.111 3.765   1.00 42.43 ? 584 TYR A CG  1 
ATOM   821  C  CD1 . TYR A 1 114 ? -1.654  -24.280 2.439   1.00 43.18 ? 584 TYR A CD1 1 
ATOM   822  C  CD2 . TYR A 1 114 ? -0.040  -24.660 4.162   1.00 42.30 ? 584 TYR A CD2 1 
ATOM   823  C  CE1 . TYR A 1 114 ? -0.826  -24.940 1.503   1.00 42.21 ? 584 TYR A CE1 1 
ATOM   824  C  CE2 . TYR A 1 114 ? 0.796   -25.340 3.232   1.00 43.20 ? 584 TYR A CE2 1 
ATOM   825  C  CZ  . TYR A 1 114 ? 0.377   -25.470 1.906   1.00 41.55 ? 584 TYR A CZ  1 
ATOM   826  O  OH  . TYR A 1 114 ? 1.144   -26.120 0.971   1.00 43.06 ? 584 TYR A OH  1 
ATOM   827  N  N   . MET A 1 115 ? -4.890  -23.727 6.705   1.00 42.96 ? 585 MET A N   1 
ATOM   828  C  CA  . MET A 1 115 ? -5.811  -23.199 7.726   1.00 43.12 ? 585 MET A CA  1 
ATOM   829  C  C   . MET A 1 115 ? -6.025  -24.134 8.911   1.00 43.64 ? 585 MET A C   1 
ATOM   830  O  O   . MET A 1 115 ? -6.376  -23.682 9.999   1.00 44.50 ? 585 MET A O   1 
ATOM   831  C  CB  . MET A 1 115 ? -7.190  -22.898 7.130   1.00 43.01 ? 585 MET A CB  1 
ATOM   832  C  CG  . MET A 1 115 ? -7.242  -21.848 6.043   1.00 43.13 ? 585 MET A CG  1 
ATOM   833  S  SD  . MET A 1 115 ? -6.142  -20.452 6.330   1.00 45.13 ? 585 MET A SD  1 
ATOM   834  C  CE  . MET A 1 115 ? -7.048  -19.463 7.497   1.00 41.50 ? 585 MET A CE  1 
ATOM   835  N  N   . CYS A 1 116 ? -5.864  -25.436 8.688   1.00 43.56 ? 586 CYS A N   1 
ATOM   836  C  CA  . CYS A 1 116 ? -6.114  -26.446 9.706   1.00 42.79 ? 586 CYS A CA  1 
ATOM   837  C  C   . CYS A 1 116 ? -4.850  -26.932 10.435  1.00 42.98 ? 586 CYS A C   1 
ATOM   838  O  O   . CYS A 1 116 ? -4.919  -27.424 11.568  1.00 43.10 ? 586 CYS A O   1 
ATOM   839  C  CB  . CYS A 1 116 ? -6.832  -27.646 9.070   1.00 42.74 ? 586 CYS A CB  1 
ATOM   840  S  SG  . CYS A 1 116 ? -8.429  -27.265 8.384   1.00 39.68 ? 586 CYS A SG  1 
ATOM   841  N  N   . GLY A 1 117 ? -3.699  -26.816 9.783   1.00 42.95 ? 587 GLY A N   1 
ATOM   842  C  CA  . GLY A 1 117 ? -2.435  -27.300 10.365  1.00 42.72 ? 587 GLY A CA  1 
ATOM   843  C  C   . GLY A 1 117 ? -2.138  -26.720 11.733  1.00 42.87 ? 587 GLY A C   1 
ATOM   844  O  O   . GLY A 1 117 ? -2.637  -25.649 12.061  1.00 42.75 ? 587 GLY A O   1 
ATOM   845  N  N   . HIS A 1 118 ? -1.329  -27.420 12.536  1.00 42.98 ? 588 HIS A N   1 
ATOM   846  C  CA  . HIS A 1 118 ? -0.920  -26.895 13.839  1.00 43.40 ? 588 HIS A CA  1 
ATOM   847  C  C   . HIS A 1 118 ? -0.090  -25.623 13.673  1.00 43.26 ? 588 HIS A C   1 
ATOM   848  O  O   . HIS A 1 118 ? -0.369  -24.620 14.329  1.00 43.02 ? 588 HIS A O   1 
ATOM   849  C  CB  . HIS A 1 118 ? -0.160  -27.938 14.668  1.00 43.54 ? 588 HIS A CB  1 
ATOM   850  C  CG  . HIS A 1 118 ? 0.234   -27.453 16.031  1.00 44.72 ? 588 HIS A CG  1 
ATOM   851  N  ND1 . HIS A 1 118 ? 1.528   -27.107 16.357  1.00 46.22 ? 588 HIS A ND1 1 
ATOM   852  C  CD2 . HIS A 1 118 ? -0.498  -27.256 17.154  1.00 46.42 ? 588 HIS A CD2 1 
ATOM   853  C  CE1 . HIS A 1 118 ? 1.578   -26.719 17.619  1.00 45.72 ? 588 HIS A CE1 1 
ATOM   854  N  NE2 . HIS A 1 118 ? 0.361   -26.800 18.125  1.00 46.08 ? 588 HIS A NE2 1 
ATOM   855  N  N   . LYS A 1 119 ? 0.917   -25.669 12.797  1.00 43.49 ? 589 LYS A N   1 
ATOM   856  C  CA  . LYS A 1 119 ? 1.737   -24.488 12.504  1.00 44.03 ? 589 LYS A CA  1 
ATOM   857  C  C   . LYS A 1 119 ? 0.909   -23.487 11.730  1.00 43.47 ? 589 LYS A C   1 
ATOM   858  O  O   . LYS A 1 119 ? 0.011   -23.868 10.997  1.00 43.96 ? 589 LYS A O   1 
ATOM   859  C  CB  . LYS A 1 119 ? 2.974   -24.841 11.672  1.00 44.21 ? 589 LYS A CB  1 
ATOM   860  C  CG  . LYS A 1 119 ? 4.111   -25.415 12.459  1.00 47.46 ? 589 LYS A CG  1 
ATOM   861  C  CD  . LYS A 1 119 ? 5.448   -24.974 11.881  1.00 51.32 ? 589 LYS A CD  1 
ATOM   862  C  CE  . LYS A 1 119 ? 6.599   -25.267 12.869  1.00 52.66 ? 589 LYS A CE  1 
ATOM   863  N  NZ  . LYS A 1 119 ? 6.271   -24.864 14.271  1.00 52.17 ? 589 LYS A NZ  1 
ATOM   864  N  N   . GLY A 1 120 ? 1.215   -22.210 11.887  1.00 43.39 ? 590 GLY A N   1 
ATOM   865  C  CA  . GLY A 1 120 ? 0.574   -21.175 11.084  1.00 43.65 ? 590 GLY A CA  1 
ATOM   866  C  C   . GLY A 1 120 ? 1.474   -20.544 10.030  1.00 44.11 ? 590 GLY A C   1 
ATOM   867  O  O   . GLY A 1 120 ? 1.005   -19.720 9.243   1.00 43.64 ? 590 GLY A O   1 
ATOM   868  N  N   . THR A 1 121 ? 2.757   -20.927 10.016  1.00 44.03 ? 591 THR A N   1 
ATOM   869  C  CA  . THR A 1 121 ? 3.737   -20.341 9.100   1.00 45.01 ? 591 THR A CA  1 
ATOM   870  C  C   . THR A 1 121 ? 4.320   -21.383 8.139   1.00 45.10 ? 591 THR A C   1 
ATOM   871  O  O   . THR A 1 121 ? 4.911   -22.376 8.555   1.00 45.06 ? 591 THR A O   1 
ATOM   872  C  CB  . THR A 1 121 ? 4.897   -19.619 9.869   1.00 45.59 ? 591 THR A CB  1 
ATOM   873  O  OG1 . THR A 1 121 ? 4.369   -18.515 10.615  1.00 46.03 ? 591 THR A OG1 1 
ATOM   874  C  CG2 . THR A 1 121 ? 5.954   -19.087 8.903   1.00 46.31 ? 591 THR A CG2 1 
ATOM   875  N  N   . TYR A 1 122 ? 4.174   -21.115 6.848   1.00 45.35 ? 592 TYR A N   1 
ATOM   876  C  CA  . TYR A 1 122 ? 4.667   -21.994 5.800   1.00 45.47 ? 592 TYR A CA  1 
ATOM   877  C  C   . TYR A 1 122 ? 5.327   -21.149 4.738   1.00 44.85 ? 592 TYR A C   1 
ATOM   878  O  O   . TYR A 1 122 ? 4.645   -20.624 3.852   1.00 45.65 ? 592 TYR A O   1 
ATOM   879  C  CB  . TYR A 1 122 ? 3.504   -22.753 5.161   1.00 46.01 ? 592 TYR A CB  1 
ATOM   880  C  CG  . TYR A 1 122 ? 2.716   -23.573 6.125   1.00 47.06 ? 592 TYR A CG  1 
ATOM   881  C  CD1 . TYR A 1 122 ? 3.046   -24.910 6.367   1.00 47.87 ? 592 TYR A CD1 1 
ATOM   882  C  CD2 . TYR A 1 122 ? 1.641   -23.019 6.808   1.00 48.37 ? 592 TYR A CD2 1 
ATOM   883  C  CE1 . TYR A 1 122 ? 2.319   -25.662 7.264   1.00 47.76 ? 592 TYR A CE1 1 
ATOM   884  C  CE2 . TYR A 1 122 ? 0.913   -23.753 7.709   1.00 47.82 ? 592 TYR A CE2 1 
ATOM   885  C  CZ  . TYR A 1 122 ? 1.250   -25.074 7.924   1.00 48.66 ? 592 TYR A CZ  1 
ATOM   886  O  OH  . TYR A 1 122 ? 0.504   -25.799 8.814   1.00 50.47 ? 592 TYR A OH  1 
ATOM   887  N  N   . GLY A 1 123 ? 6.644   -21.033 4.798   1.00 43.62 ? 593 GLY A N   1 
ATOM   888  C  CA  . GLY A 1 123 ? 7.339   -20.141 3.892   1.00 42.82 ? 593 GLY A CA  1 
ATOM   889  C  C   . GLY A 1 123 ? 6.886   -18.714 4.142   1.00 42.29 ? 593 GLY A C   1 
ATOM   890  O  O   . GLY A 1 123 ? 6.871   -18.258 5.291   1.00 41.81 ? 593 GLY A O   1 
ATOM   891  N  N   . LEU A 1 124 ? 6.499   -18.031 3.068   1.00 41.11 ? 594 LEU A N   1 
ATOM   892  C  CA  . LEU A 1 124 ? 5.995   -16.668 3.156   1.00 41.35 ? 594 LEU A CA  1 
ATOM   893  C  C   . LEU A 1 124 ? 4.506   -16.621 3.477   1.00 41.82 ? 594 LEU A C   1 
ATOM   894  O  O   . LEU A 1 124 ? 3.952   -15.551 3.711   1.00 41.74 ? 594 LEU A O   1 
ATOM   895  C  CB  . LEU A 1 124 ? 6.277   -15.901 1.858   1.00 41.21 ? 594 LEU A CB  1 
ATOM   896  C  CG  . LEU A 1 124 ? 7.743   -15.790 1.429   1.00 39.83 ? 594 LEU A CG  1 
ATOM   897  C  CD1 . LEU A 1 124 ? 7.840   -14.987 0.135   1.00 39.11 ? 594 LEU A CD1 1 
ATOM   898  C  CD2 . LEU A 1 124 ? 8.568   -15.169 2.537   1.00 38.42 ? 594 LEU A CD2 1 
ATOM   899  N  N   . LEU A 1 125 ? 3.880   -17.790 3.505   1.00 42.05 ? 595 LEU A N   1 
ATOM   900  C  CA  . LEU A 1 125 ? 2.484   -17.912 3.833   1.00 43.28 ? 595 LEU A CA  1 
ATOM   901  C  C   . LEU A 1 125 ? 2.306   -17.966 5.352   1.00 43.96 ? 595 LEU A C   1 
ATOM   902  O  O   . LEU A 1 125 ? 2.789   -18.892 6.017   1.00 43.62 ? 595 LEU A O   1 
ATOM   903  C  CB  . LEU A 1 125 ? 1.899   -19.158 3.157   1.00 43.26 ? 595 LEU A CB  1 
ATOM   904  C  CG  . LEU A 1 125 ? 0.390   -19.276 3.121   1.00 44.44 ? 595 LEU A CG  1 
ATOM   905  C  CD1 . LEU A 1 125 ? -0.163  -18.286 2.125   1.00 47.58 ? 595 LEU A CD1 1 
ATOM   906  C  CD2 . LEU A 1 125 ? -0.019  -20.667 2.751   1.00 46.07 ? 595 LEU A CD2 1 
ATOM   907  N  N   . ARG A 1 126 ? 1.639   -16.955 5.906   1.00 44.77 ? 596 ARG A N   1 
ATOM   908  C  CA  . ARG A 1 126 ? 1.432   -16.896 7.364   1.00 45.86 ? 596 ARG A CA  1 
ATOM   909  C  C   . ARG A 1 126 ? -0.025  -16.698 7.678   1.00 45.60 ? 596 ARG A C   1 
ATOM   910  O  O   . ARG A 1 126 ? -0.648  -15.724 7.253   1.00 46.26 ? 596 ARG A O   1 
ATOM   911  C  CB  . ARG A 1 126 ? 2.359   -15.873 8.094   1.00 46.16 ? 596 ARG A CB  1 
ATOM   912  C  CG  . ARG A 1 126 ? 2.983   -14.795 7.202   1.00 47.41 ? 596 ARG A CG  1 
ATOM   913  C  CD  . ARG A 1 126 ? 4.067   -13.947 7.881   1.00 47.80 ? 596 ARG A CD  1 
ATOM   914  N  NE  . ARG A 1 126 ? 5.420   -14.533 7.680   1.00 51.30 ? 596 ARG A NE  1 
ATOM   915  C  CZ  . ARG A 1 126 ? 6.144   -14.451 6.524   1.00 50.49 ? 596 ARG A CZ  1 
ATOM   916  N  NH1 . ARG A 1 126 ? 5.596   -13.798 5.394   1.00 49.14 ? 596 ARG A NH1 1 
ATOM   917  N  NH2 . ARG A 1 126 ? 7.362   -15.038 6.494   1.00 49.69 ? 596 ARG A NH2 1 
ATOM   918  N  N   . ARG A 1 127 ? -0.579  -17.682 8.371   1.00 45.67 ? 597 ARG A N   1 
ATOM   919  C  CA  . ARG A 1 127 ? -1.989  -17.692 8.748   1.00 44.97 ? 597 ARG A CA  1 
ATOM   920  C  C   . ARG A 1 127 ? -2.224  -16.602 9.790   1.00 45.32 ? 597 ARG A C   1 
ATOM   921  O  O   . ARG A 1 127 ? -1.390  -16.395 10.690  1.00 45.20 ? 597 ARG A O   1 
ATOM   922  C  CB  . ARG A 1 127 ? -2.344  -19.080 9.290   1.00 44.87 ? 597 ARG A CB  1 
ATOM   923  C  CG  . ARG A 1 127 ? -3.823  -19.348 9.551   1.00 43.47 ? 597 ARG A CG  1 
ATOM   924  C  CD  . ARG A 1 127 ? -4.013  -20.799 9.933   1.00 42.03 ? 597 ARG A CD  1 
ATOM   925  N  NE  . ARG A 1 127 ? -3.417  -21.158 11.230  1.00 42.21 ? 597 ARG A NE  1 
ATOM   926  C  CZ  . ARG A 1 127 ? -2.973  -22.381 11.538  1.00 41.69 ? 597 ARG A CZ  1 
ATOM   927  N  NH1 . ARG A 1 127 ? -3.022  -23.353 10.639  1.00 41.72 ? 597 ARG A NH1 1 
ATOM   928  N  NH2 . ARG A 1 127 ? -2.467  -22.640 12.731  1.00 39.56 ? 597 ARG A NH2 1 
ATOM   929  N  N   . ARG A 1 128 ? -3.331  -15.877 9.643   1.00 44.87 ? 598 ARG A N   1 
ATOM   930  C  CA  . ARG A 1 128 ? -3.684  -14.826 10.584  1.00 44.67 ? 598 ARG A CA  1 
ATOM   931  C  C   . ARG A 1 128 ? -4.408  -15.431 11.789  1.00 44.69 ? 598 ARG A C   1 
ATOM   932  O  O   . ARG A 1 128 ? -5.322  -16.239 11.628  1.00 44.65 ? 598 ARG A O   1 
ATOM   933  C  CB  . ARG A 1 128 ? -4.542  -13.749 9.904   1.00 44.65 ? 598 ARG A CB  1 
ATOM   934  C  CG  . ARG A 1 128 ? -3.761  -12.843 8.954   1.00 44.16 ? 598 ARG A CG  1 
ATOM   935  C  CD  . ARG A 1 128 ? -4.543  -11.569 8.637   1.00 42.73 ? 598 ARG A CD  1 
ATOM   936  N  NE  . ARG A 1 128 ? -4.128  -10.930 7.382   1.00 41.50 ? 598 ARG A NE  1 
ATOM   937  C  CZ  . ARG A 1 128 ? -3.457  -9.781  7.289   1.00 40.16 ? 598 ARG A CZ  1 
ATOM   938  N  NH1 . ARG A 1 128 ? -3.106  -9.115  8.380   1.00 38.63 ? 598 ARG A NH1 1 
ATOM   939  N  NH2 . ARG A 1 128 ? -3.134  -9.292  6.096   1.00 38.85 ? 598 ARG A NH2 1 
ATOM   940  N  N   . GLU A 1 129 ? -4.000  -15.018 12.989  1.00 44.47 ? 599 GLU A N   1 
ATOM   941  C  CA  . GLU A 1 129 ? -4.483  -15.584 14.255  1.00 44.83 ? 599 GLU A CA  1 
ATOM   942  C  C   . GLU A 1 129 ? -5.997  -15.420 14.502  1.00 44.70 ? 599 GLU A C   1 
ATOM   943  O  O   . GLU A 1 129 ? -6.660  -16.291 15.115  1.00 44.51 ? 599 GLU A O   1 
ATOM   944  C  CB  . GLU A 1 129 ? -3.705  -14.945 15.419  1.00 45.28 ? 599 GLU A CB  1 
ATOM   945  C  CG  . GLU A 1 129 ? -4.168  -13.522 15.793  1.00 46.44 ? 599 GLU A CG  1 
ATOM   946  C  CD  . GLU A 1 129 ? -5.217  -13.499 16.906  1.00 49.11 ? 599 GLU A CD  1 
ATOM   947  O  OE1 . GLU A 1 129 ? -5.218  -14.436 17.771  1.00 50.21 ? 599 GLU A OE1 1 
ATOM   948  O  OE2 . GLU A 1 129 ? -6.033  -12.527 16.932  1.00 50.22 ? 599 GLU A OE2 1 
ATOM   949  N  N   . ASP A 1 130 ? -6.524  -14.283 14.049  1.00 43.97 ? 600 ASP A N   1 
ATOM   950  C  CA  . ASP A 1 130 ? -7.934  -13.968 14.157  1.00 44.00 ? 600 ASP A CA  1 
ATOM   951  C  C   . ASP A 1 130 ? -8.643  -14.229 12.837  1.00 43.57 ? 600 ASP A C   1 
ATOM   952  O  O   . ASP A 1 130 ? -9.625  -13.554 12.544  1.00 43.31 ? 600 ASP A O   1 
ATOM   953  C  CB  . ASP A 1 130 ? -8.113  -12.480 14.522  1.00 44.13 ? 600 ASP A CB  1 
ATOM   954  C  CG  . ASP A 1 130 ? -7.200  -11.557 13.680  1.00 45.03 ? 600 ASP A CG  1 
ATOM   955  O  OD1 . ASP A 1 130 ? -6.418  -12.060 12.822  1.00 45.22 ? 600 ASP A OD1 1 
ATOM   956  O  OD2 . ASP A 1 130 ? -7.256  -10.327 13.892  1.00 44.68 ? 600 ASP A OD2 1 
ATOM   957  N  N   . TRP A 1 131 ? -8.170  -15.194 12.040  1.00 43.21 ? 601 TRP A N   1 
ATOM   958  C  CA  . TRP A 1 131 ? -8.801  -15.406 10.736  1.00 42.85 ? 601 TRP A CA  1 
ATOM   959  C  C   . TRP A 1 131 ? -10.325 -15.615 10.814  1.00 42.94 ? 601 TRP A C   1 
ATOM   960  O  O   . TRP A 1 131 ? -11.048 -14.987 10.036  1.00 42.95 ? 601 TRP A O   1 
ATOM   961  C  CB  . TRP A 1 131 ? -8.077  -16.430 9.836   1.00 42.41 ? 601 TRP A CB  1 
ATOM   962  C  CG  . TRP A 1 131 ? -8.244  -17.868 10.219  1.00 42.24 ? 601 TRP A CG  1 
ATOM   963  C  CD1 . TRP A 1 131 ? -7.380  -18.621 10.959  1.00 41.98 ? 601 TRP A CD1 1 
ATOM   964  C  CD2 . TRP A 1 131 ? -9.333  -18.730 9.868   1.00 41.91 ? 601 TRP A CD2 1 
ATOM   965  N  NE1 . TRP A 1 131 ? -7.862  -19.900 11.091  1.00 42.86 ? 601 TRP A NE1 1 
ATOM   966  C  CE2 . TRP A 1 131 ? -9.060  -19.996 10.432  1.00 42.36 ? 601 TRP A CE2 1 
ATOM   967  C  CE3 . TRP A 1 131 ? -10.519 -18.556 9.132   1.00 42.39 ? 601 TRP A CE3 1 
ATOM   968  C  CZ2 . TRP A 1 131 ? -9.930  -21.086 10.290  1.00 42.65 ? 601 TRP A CZ2 1 
ATOM   969  C  CZ3 . TRP A 1 131 ? -11.384 -19.640 8.988   1.00 42.27 ? 601 TRP A CZ3 1 
ATOM   970  C  CH2 . TRP A 1 131 ? -11.086 -20.888 9.567   1.00 42.24 ? 601 TRP A CH2 1 
ATOM   971  N  N   . PRO A 1 132 ? -10.822 -16.456 11.768  1.00 43.07 ? 602 PRO A N   1 
ATOM   972  C  CA  . PRO A 1 132 ? -12.278 -16.695 11.796  1.00 43.06 ? 602 PRO A CA  1 
ATOM   973  C  C   . PRO A 1 132 ? -13.086 -15.413 11.931  1.00 43.10 ? 602 PRO A C   1 
ATOM   974  O  O   . PRO A 1 132 ? -14.047 -15.223 11.195  1.00 43.53 ? 602 PRO A O   1 
ATOM   975  C  CB  . PRO A 1 132 ? -12.475 -17.585 13.029  1.00 42.81 ? 602 PRO A CB  1 
ATOM   976  C  CG  . PRO A 1 132 ? -11.166 -18.232 13.245  1.00 42.82 ? 602 PRO A CG  1 
ATOM   977  C  CD  . PRO A 1 132 ? -10.141 -17.215 12.838  1.00 43.08 ? 602 PRO A CD  1 
ATOM   978  N  N   . SER A 1 133 ? -12.687 -14.533 12.844  1.00 42.90 ? 603 SER A N   1 
ATOM   979  C  CA  . SER A 1 133 ? -13.384 -13.267 13.023  1.00 43.01 ? 603 SER A CA  1 
ATOM   980  C  C   . SER A 1 133 ? -13.081 -12.242 11.921  1.00 43.13 ? 603 SER A C   1 
ATOM   981  O  O   . SER A 1 133 ? -13.845 -11.299 11.736  1.00 42.91 ? 603 SER A O   1 
ATOM   982  C  CB  . SER A 1 133 ? -13.122 -12.687 14.418  1.00 43.05 ? 603 SER A CB  1 
ATOM   983  O  OG  . SER A 1 133 ? -11.762 -12.361 14.588  1.00 42.81 ? 603 SER A OG  1 
ATOM   984  N  N   . ARG A 1 134 ? -11.980 -12.425 11.190  1.00 43.37 ? 604 ARG A N   1 
ATOM   985  C  CA  . ARG A 1 134 ? -11.669 -11.549 10.051  1.00 43.55 ? 604 ARG A CA  1 
ATOM   986  C  C   . ARG A 1 134 ? -12.580 -11.802 8.862   1.00 43.66 ? 604 ARG A C   1 
ATOM   987  O  O   . ARG A 1 134 ? -12.980 -10.865 8.177   1.00 43.71 ? 604 ARG A O   1 
ATOM   988  C  CB  . ARG A 1 134 ? -10.211 -11.668 9.617   1.00 43.54 ? 604 ARG A CB  1 
ATOM   989  C  CG  . ARG A 1 134 ? -9.239  -11.036 10.581  1.00 43.68 ? 604 ARG A CG  1 
ATOM   990  C  CD  . ARG A 1 134 ? -7.870  -10.975 9.977   1.00 44.11 ? 604 ARG A CD  1 
ATOM   991  N  NE  . ARG A 1 134 ? -7.647  -9.687  9.336   1.00 44.25 ? 604 ARG A NE  1 
ATOM   992  C  CZ  . ARG A 1 134 ? -6.759  -8.790  9.748   1.00 44.24 ? 604 ARG A CZ  1 
ATOM   993  N  NH1 . ARG A 1 134 ? -5.980  -9.042  10.794  1.00 43.46 ? 604 ARG A NH1 1 
ATOM   994  N  NH2 . ARG A 1 134 ? -6.642  -7.641  9.100   1.00 45.15 ? 604 ARG A NH2 1 
ATOM   995  N  N   . LEU A 1 135 ? -12.899 -13.069 8.623   1.00 43.80 ? 605 LEU A N   1 
ATOM   996  C  CA  . LEU A 1 135 ? -13.842 -13.435 7.582   1.00 44.28 ? 605 LEU A CA  1 
ATOM   997  C  C   . LEU A 1 135 ? -15.205 -12.832 7.854   1.00 44.72 ? 605 LEU A C   1 
ATOM   998  O  O   . LEU A 1 135 ? -15.872 -12.341 6.928   1.00 45.18 ? 605 LEU A O   1 
ATOM   999  C  CB  . LEU A 1 135 ? -13.975 -14.952 7.496   1.00 44.51 ? 605 LEU A CB  1 
ATOM   1000 C  CG  . LEU A 1 135 ? -12.911 -15.750 6.760   1.00 44.07 ? 605 LEU A CG  1 
ATOM   1001 C  CD1 . LEU A 1 135 ? -13.250 -17.222 6.860   1.00 44.39 ? 605 LEU A CD1 1 
ATOM   1002 C  CD2 . LEU A 1 135 ? -12.820 -15.314 5.300   1.00 43.27 ? 605 LEU A CD2 1 
ATOM   1003 N  N   . GLN A 1 136 ? -15.620 -12.875 9.121   1.00 45.06 ? 606 GLN A N   1 
ATOM   1004 C  CA  . GLN A 1 136 ? -16.870 -12.244 9.560   1.00 45.15 ? 606 GLN A CA  1 
ATOM   1005 C  C   . GLN A 1 136 ? -16.904 -10.761 9.178   1.00 45.25 ? 606 GLN A C   1 
ATOM   1006 O  O   . GLN A 1 136 ? -17.895 -10.276 8.617   1.00 44.67 ? 606 GLN A O   1 
ATOM   1007 C  CB  . GLN A 1 136 ? -17.067 -12.412 11.074  1.00 45.49 ? 606 GLN A CB  1 
ATOM   1008 C  CG  . GLN A 1 136 ? -17.289 -13.846 11.552  1.00 45.84 ? 606 GLN A CG  1 
ATOM   1009 C  CD  . GLN A 1 136 ? -18.639 -14.421 11.143  1.00 46.95 ? 606 GLN A CD  1 
ATOM   1010 O  OE1 . GLN A 1 136 ? -18.879 -14.704 9.964   1.00 47.94 ? 606 GLN A OE1 1 
ATOM   1011 N  NE2 . GLN A 1 136 ? -19.518 -14.620 12.123  1.00 46.73 ? 606 GLN A NE2 1 
ATOM   1012 N  N   . MET A 1 137 ? -15.808 -10.061 9.475   1.00 45.77 ? 607 MET A N   1 
ATOM   1013 C  CA  . MET A 1 137 ? -15.615 -8.660  9.083   1.00 46.42 ? 607 MET A CA  1 
ATOM   1014 C  C   . MET A 1 137 ? -15.600 -8.513  7.557   1.00 46.57 ? 607 MET A C   1 
ATOM   1015 O  O   . MET A 1 137 ? -16.343 -7.702  7.013   1.00 46.60 ? 607 MET A O   1 
ATOM   1016 C  CB  . MET A 1 137 ? -14.329 -8.109  9.714   1.00 46.31 ? 607 MET A CB  1 
ATOM   1017 C  CG  . MET A 1 137 ? -13.968 -6.691  9.326   1.00 46.65 ? 607 MET A CG  1 
ATOM   1018 S  SD  . MET A 1 137 ? -12.909 -5.865  10.543  1.00 47.29 ? 607 MET A SD  1 
ATOM   1019 C  CE  . MET A 1 137 ? -12.327 -4.438  9.621   1.00 46.70 ? 607 MET A CE  1 
ATOM   1020 N  N   . PHE A 1 138 ? -14.781 -9.320  6.882   1.00 46.93 ? 608 PHE A N   1 
ATOM   1021 C  CA  . PHE A 1 138 ? -14.732 -9.385  5.405   1.00 47.79 ? 608 PHE A CA  1 
ATOM   1022 C  C   . PHE A 1 138 ? -16.121 -9.494  4.731   1.00 48.32 ? 608 PHE A C   1 
ATOM   1023 O  O   . PHE A 1 138 ? -16.510 -8.616  3.938   1.00 48.16 ? 608 PHE A O   1 
ATOM   1024 C  CB  . PHE A 1 138 ? -13.833 -10.544 4.963   1.00 47.96 ? 608 PHE A CB  1 
ATOM   1025 C  CG  . PHE A 1 138 ? -13.439 -10.503 3.509   1.00 48.10 ? 608 PHE A CG  1 
ATOM   1026 C  CD1 . PHE A 1 138 ? -12.380 -9.713  3.084   1.00 47.82 ? 608 PHE A CD1 1 
ATOM   1027 C  CD2 . PHE A 1 138 ? -14.109 -11.282 2.571   1.00 47.86 ? 608 PHE A CD2 1 
ATOM   1028 C  CE1 . PHE A 1 138 ? -12.011 -9.691  1.750   1.00 48.42 ? 608 PHE A CE1 1 
ATOM   1029 C  CE2 . PHE A 1 138 ? -13.748 -11.259 1.233   1.00 47.75 ? 608 PHE A CE2 1 
ATOM   1030 C  CZ  . PHE A 1 138 ? -12.694 -10.469 0.823   1.00 48.29 ? 608 PHE A CZ  1 
ATOM   1031 N  N   . PHE A 1 139 ? -16.850 -10.565 5.058   1.00 48.52 ? 609 PHE A N   1 
ATOM   1032 C  CA  . PHE A 1 139 ? -18.215 -10.779 4.568   1.00 48.52 ? 609 PHE A CA  1 
ATOM   1033 C  C   . PHE A 1 139 ? -19.202 -9.739  5.123   1.00 49.12 ? 609 PHE A C   1 
ATOM   1034 O  O   . PHE A 1 139 ? -18.893 -8.986  6.058   1.00 49.41 ? 609 PHE A O   1 
ATOM   1035 C  CB  . PHE A 1 139 ? -18.682 -12.200 4.912   1.00 48.44 ? 609 PHE A CB  1 
ATOM   1036 C  CG  . PHE A 1 139 ? -18.055 -13.278 4.055   1.00 48.00 ? 609 PHE A CG  1 
ATOM   1037 C  CD1 . PHE A 1 139 ? -18.706 -13.746 2.915   1.00 48.58 ? 609 PHE A CD1 1 
ATOM   1038 C  CD2 . PHE A 1 139 ? -16.819 -13.825 4.385   1.00 48.08 ? 609 PHE A CD2 1 
ATOM   1039 C  CE1 . PHE A 1 139 ? -18.132 -14.745 2.114   1.00 48.33 ? 609 PHE A CE1 1 
ATOM   1040 C  CE2 . PHE A 1 139 ? -16.234 -14.822 3.589   1.00 46.85 ? 609 PHE A CE2 1 
ATOM   1041 C  CZ  . PHE A 1 139 ? -16.892 -15.278 2.459   1.00 47.80 ? 609 PHE A CZ  1 
HETATM 1042 ZN ZN  . ZN  B 2 .   ? -5.620  -8.932  -6.510  1.00 49.25 ? 1   ZN  A ZN  1 
HETATM 1043 ZN ZN  . ZN  C 2 .   ? -4.115  -20.334 -6.130  1.00 33.34 ? 2   ZN  A ZN  1 
HETATM 1044 ZN ZN  . ZN  D 2 .   ? -8.352  -27.179 5.994   1.00 44.05 ? 3   ZN  A ZN  1 
HETATM 1045 C  C1  . EDO E 3 .   ? -11.671 -17.953 -2.442  1.00 57.74 ? 4   EDO A C1  1 
HETATM 1046 O  O1  . EDO E 3 .   ? -12.762 -17.212 -1.865  1.00 59.32 ? 4   EDO A O1  1 
HETATM 1047 C  C2  . EDO E 3 .   ? -11.842 -19.434 -2.122  1.00 56.08 ? 4   EDO A C2  1 
HETATM 1048 O  O2  . EDO E 3 .   ? -12.900 -19.984 -2.911  1.00 55.11 ? 4   EDO A O2  1 
HETATM 1049 O  O   . HOH F 4 .   ? 1.401   -14.760 4.216   1.00 34.66 ? 5   HOH A O   1 
HETATM 1050 O  O   . HOH F 4 .   ? -10.683 -23.207 -1.190  1.00 24.92 ? 7   HOH A O   1 
HETATM 1051 O  O   . HOH F 4 .   ? -9.600  -27.191 -9.220  1.00 32.27 ? 8   HOH A O   1 
HETATM 1052 O  O   . HOH F 4 .   ? 6.087   -28.353 -6.377  1.00 37.54 ? 9   HOH A O   1 
HETATM 1053 O  O   . HOH F 4 .   ? 4.010   -21.073 -8.867  1.00 37.95 ? 10  HOH A O   1 
HETATM 1054 O  O   . HOH F 4 .   ? 9.317   -19.209 0.163   1.00 44.35 ? 11  HOH A O   1 
HETATM 1055 O  O   . HOH F 4 .   ? 13.599  -13.305 3.393   1.00 39.97 ? 12  HOH A O   1 
HETATM 1056 O  O   . HOH F 4 .   ? -3.535  -4.018  -11.208 1.00 50.12 ? 13  HOH A O   1 
HETATM 1057 O  O   . HOH F 4 .   ? -14.521 -22.309 -3.797  1.00 28.75 ? 14  HOH A O   1 
HETATM 1058 O  O   . HOH F 4 .   ? -21.780 -24.699 -4.682  1.00 35.66 ? 15  HOH A O   1 
HETATM 1059 O  O   . HOH F 4 .   ? -3.737  -25.125 -10.327 1.00 29.91 ? 16  HOH A O   1 
HETATM 1060 O  O   . HOH F 4 .   ? -2.923  -27.241 -13.017 1.00 45.35 ? 17  HOH A O   1 
HETATM 1061 O  O   . HOH F 4 .   ? -0.680  -28.708 -12.651 1.00 44.84 ? 18  HOH A O   1 
HETATM 1062 O  O   . HOH F 4 .   ? -6.084  -31.747 -7.993  1.00 32.57 ? 19  HOH A O   1 
HETATM 1063 O  O   . HOH F 4 .   ? -3.058  -33.918 -7.935  1.00 48.68 ? 20  HOH A O   1 
HETATM 1064 O  O   . HOH F 4 .   ? -11.094 -23.437 6.686   1.00 45.28 ? 21  HOH A O   1 
HETATM 1065 O  O   . HOH F 4 .   ? 0.715   -1.121  -2.381  1.00 53.74 ? 615 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   471 ?   ?   ?   A . n 
A 1 2   PRO 2   472 ?   ?   ?   A . n 
A 1 3   LEU 3   473 ?   ?   ?   A . n 
A 1 4   GLY 4   474 474 GLY GLY A . n 
A 1 5   SER 5   475 475 SER SER A . n 
A 1 6   ARG 6   476 476 ARG ARG A . n 
A 1 7   GLU 7   477 477 GLU GLU A . n 
A 1 8   ARG 8   478 478 ARG ARG A . n 
A 1 9   LEU 9   479 479 LEU LEU A . n 
A 1 10  VAL 10  480 480 VAL VAL A . n 
A 1 11  TYR 11  481 481 TYR TYR A . n 
A 1 12  GLU 12  482 482 GLU GLU A . n 
A 1 13  VAL 13  483 483 VAL VAL A . n 
A 1 14  ARG 14  484 484 ARG ARG A . n 
A 1 15  GLN 15  485 485 GLN GLN A . n 
A 1 16  LYS 16  486 486 LYS LYS A . n 
A 1 17  CYS 17  487 487 CYS CYS A . n 
A 1 18  ARG 18  488 488 ARG ARG A . n 
A 1 19  ASN 19  489 489 ASN ASN A . n 
A 1 20  ILE 20  490 490 ILE ILE A . n 
A 1 21  GLU 21  491 491 GLU GLU A . n 
A 1 22  ASP 22  492 492 ASP ASP A . n 
A 1 23  ILE 23  493 493 ILE ILE A . n 
A 1 24  CYS 24  494 494 CYS CYS A . n 
A 1 25  ILE 25  495 495 ILE ILE A . n 
A 1 26  SER 26  496 496 SER SER A . n 
A 1 27  CYS 27  497 497 CYS CYS A . n 
A 1 28  GLY 28  498 498 GLY GLY A . n 
A 1 29  SER 29  499 499 SER SER A . n 
A 1 30  LEU 30  500 500 LEU LEU A . n 
A 1 31  ASN 31  501 501 ASN ASN A . n 
A 1 32  VAL 32  502 502 VAL VAL A . n 
A 1 33  THR 33  503 503 THR THR A . n 
A 1 34  LEU 34  504 504 LEU LEU A . n 
A 1 35  GLU 35  505 505 GLU GLU A . n 
A 1 36  HIS 36  506 506 HIS HIS A . n 
A 1 37  PRO 37  507 507 PRO PRO A . n 
A 1 38  LEU 38  508 508 LEU LEU A . n 
A 1 39  PHE 39  509 509 PHE PHE A . n 
A 1 40  VAL 40  510 510 VAL VAL A . n 
A 1 41  GLY 41  511 511 GLY GLY A . n 
A 1 42  GLY 42  512 512 GLY GLY A . n 
A 1 43  MET 43  513 513 MET MET A . n 
A 1 44  CYS 44  514 514 CYS CYS A . n 
A 1 45  GLN 45  515 515 GLN GLN A . n 
A 1 46  ASN 46  516 516 ASN ASN A . n 
A 1 47  CYS 47  517 517 CYS CYS A . n 
A 1 48  LYS 48  518 518 LYS LYS A . n 
A 1 49  ASN 49  519 519 ASN ASN A . n 
A 1 50  CYS 50  520 520 CYS CYS A . n 
A 1 51  PHE 51  521 521 PHE PHE A . n 
A 1 52  LEU 52  522 522 LEU LEU A . n 
A 1 53  GLU 53  523 523 GLU GLU A . n 
A 1 54  CYS 54  524 524 CYS CYS A . n 
A 1 55  ALA 55  525 525 ALA ALA A . n 
A 1 56  TYR 56  526 526 TYR TYR A . n 
A 1 57  GLN 57  527 527 GLN GLN A . n 
A 1 58  TYR 58  528 528 TYR TYR A . n 
A 1 59  ASP 59  529 529 ASP ASP A . n 
A 1 60  ASP 60  530 530 ASP ASP A . n 
A 1 61  ASP 61  531 531 ASP ASP A . n 
A 1 62  GLY 62  532 532 GLY GLY A . n 
A 1 63  TYR 63  533 533 TYR TYR A . n 
A 1 64  GLN 64  534 534 GLN GLN A . n 
A 1 65  SER 65  535 535 SER SER A . n 
A 1 66  TYR 66  536 536 TYR TYR A . n 
A 1 67  CYS 67  537 537 CYS CYS A . n 
A 1 68  THR 68  538 538 THR THR A . n 
A 1 69  ILE 69  539 539 ILE ILE A . n 
A 1 70  CYS 70  540 540 CYS CYS A . n 
A 1 71  CYS 71  541 541 CYS CYS A . n 
A 1 72  GLY 72  542 542 GLY GLY A . n 
A 1 73  GLY 73  543 543 GLY GLY A . n 
A 1 74  ARG 74  544 544 ARG ARG A . n 
A 1 75  GLU 75  545 545 GLU GLU A . n 
A 1 76  VAL 76  546 546 VAL VAL A . n 
A 1 77  LEU 77  547 547 LEU LEU A . n 
A 1 78  MET 78  548 548 MET MET A . n 
A 1 79  CYS 79  549 549 CYS CYS A . n 
A 1 80  GLY 80  550 550 GLY GLY A . n 
A 1 81  ASN 81  551 551 ASN ASN A . n 
A 1 82  ASN 82  552 552 ASN ASN A . n 
A 1 83  ASN 83  553 553 ASN ASN A . n 
A 1 84  CYS 84  554 554 CYS CYS A . n 
A 1 85  CYS 85  555 555 CYS CYS A . n 
A 1 86  ARG 86  556 556 ARG ARG A . n 
A 1 87  CYS 87  557 557 CYS CYS A . n 
A 1 88  PHE 88  558 558 PHE PHE A . n 
A 1 89  CYS 89  559 559 CYS CYS A . n 
A 1 90  VAL 90  560 560 VAL VAL A . n 
A 1 91  GLU 91  561 561 GLU GLU A . n 
A 1 92  CYS 92  562 562 CYS CYS A . n 
A 1 93  VAL 93  563 563 VAL VAL A . n 
A 1 94  ASP 94  564 564 ASP ASP A . n 
A 1 95  LEU 95  565 565 LEU LEU A . n 
A 1 96  LEU 96  566 566 LEU LEU A . n 
A 1 97  VAL 97  567 567 VAL VAL A . n 
A 1 98  GLY 98  568 568 GLY GLY A . n 
A 1 99  PRO 99  569 569 PRO PRO A . n 
A 1 100 GLY 100 570 570 GLY GLY A . n 
A 1 101 ALA 101 571 571 ALA ALA A . n 
A 1 102 ALA 102 572 572 ALA ALA A . n 
A 1 103 GLN 103 573 573 GLN GLN A . n 
A 1 104 ALA 104 574 574 ALA ALA A . n 
A 1 105 ALA 105 575 575 ALA ALA A . n 
A 1 106 ILE 106 576 576 ILE ILE A . n 
A 1 107 LYS 107 577 ?   ?   ?   A . n 
A 1 108 GLU 108 578 ?   ?   ?   A . n 
A 1 109 ASP 109 579 ?   ?   ?   A . n 
A 1 110 PRO 110 580 ?   ?   ?   A . n 
A 1 111 TRP 111 581 581 TRP TRP A . n 
A 1 112 ASN 112 582 582 ASN ASN A . n 
A 1 113 CYS 113 583 583 CYS CYS A . n 
A 1 114 TYR 114 584 584 TYR TYR A . n 
A 1 115 MET 115 585 585 MET MET A . n 
A 1 116 CYS 116 586 586 CYS CYS A . n 
A 1 117 GLY 117 587 587 GLY GLY A . n 
A 1 118 HIS 118 588 588 HIS HIS A . n 
A 1 119 LYS 119 589 589 LYS LYS A . n 
A 1 120 GLY 120 590 590 GLY GLY A . n 
A 1 121 THR 121 591 591 THR THR A . n 
A 1 122 TYR 122 592 592 TYR TYR A . n 
A 1 123 GLY 123 593 593 GLY GLY A . n 
A 1 124 LEU 124 594 594 LEU LEU A . n 
A 1 125 LEU 125 595 595 LEU LEU A . n 
A 1 126 ARG 126 596 596 ARG ARG A . n 
A 1 127 ARG 127 597 597 ARG ARG A . n 
A 1 128 ARG 128 598 598 ARG ARG A . n 
A 1 129 GLU 129 599 599 GLU GLU A . n 
A 1 130 ASP 130 600 600 ASP ASP A . n 
A 1 131 TRP 131 601 601 TRP TRP A . n 
A 1 132 PRO 132 602 602 PRO PRO A . n 
A 1 133 SER 133 603 603 SER SER A . n 
A 1 134 ARG 134 604 604 ARG ARG A . n 
A 1 135 LEU 135 605 605 LEU LEU A . n 
A 1 136 GLN 136 606 606 GLN GLN A . n 
A 1 137 MET 137 607 607 MET MET A . n 
A 1 138 PHE 138 608 608 PHE PHE A . n 
A 1 139 PHE 139 609 609 PHE PHE A . n 
A 1 140 ALA 140 610 ?   ?   ?   A . n 
A 1 141 ASN 141 611 ?   ?   ?   A . n 
A 1 142 ASN 142 612 ?   ?   ?   A . n 
A 1 143 HIS 143 613 ?   ?   ?   A . n 
A 1 144 ASP 144 614 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1  1   1  ZN  ZN  A . 
C 2 ZN  1  2   2  ZN  ZN  A . 
D 2 ZN  1  3   3  ZN  ZN  A . 
E 3 EDO 1  4   4  EDO EDO A . 
F 4 HOH 1  5   5  HOH HOH A . 
F 4 HOH 2  7   7  HOH HOH A . 
F 4 HOH 3  8   8  HOH HOH A . 
F 4 HOH 4  9   9  HOH HOH A . 
F 4 HOH 5  10  10 HOH HOH A . 
F 4 HOH 6  11  11 HOH HOH A . 
F 4 HOH 7  12  12 HOH HOH A . 
F 4 HOH 8  13  13 HOH HOH A . 
F 4 HOH 9  14  14 HOH HOH A . 
F 4 HOH 10 15  15 HOH HOH A . 
F 4 HOH 11 16  16 HOH HOH A . 
F 4 HOH 12 17  17 HOH HOH A . 
F 4 HOH 13 18  18 HOH HOH A . 
F 4 HOH 14 19  19 HOH HOH A . 
F 4 HOH 15 20  20 HOH HOH A . 
F 4 HOH 16 21  21 HOH HOH A . 
F 4 HOH 17 615 4  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 24  ? A CYS 494 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 27  ? A CYS 497 ? 1_555 111.7 ? 
2  SG ? A CYS 24  ? A CYS 494 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 44  ? A CYS 514 ? 1_555 116.4 ? 
3  SG ? A CYS 27  ? A CYS 497 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 44  ? A CYS 514 ? 1_555 111.3 ? 
4  SG ? A CYS 24  ? A CYS 494 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 47  ? A CYS 517 ? 1_555 105.9 ? 
5  SG ? A CYS 27  ? A CYS 497 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 47  ? A CYS 517 ? 1_555 110.3 ? 
6  SG ? A CYS 44  ? A CYS 514 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 47  ? A CYS 517 ? 1_555 100.4 ? 
7  SG ? A CYS 67  ? A CYS 537 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 70  ? A CYS 540 ? 1_555 110.1 ? 
8  SG ? A CYS 67  ? A CYS 537 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 89  ? A CYS 559 ? 1_555 108.9 ? 
9  SG ? A CYS 70  ? A CYS 540 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 89  ? A CYS 559 ? 1_555 107.4 ? 
10 SG ? A CYS 67  ? A CYS 537 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 92  ? A CYS 562 ? 1_555 115.3 ? 
11 SG ? A CYS 70  ? A CYS 540 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 92  ? A CYS 562 ? 1_555 108.4 ? 
12 SG ? A CYS 89  ? A CYS 559 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 92  ? A CYS 562 ? 1_555 106.3 ? 
13 SG ? A CYS 79  ? A CYS 549 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 84  ? A CYS 554 ? 1_555 111.7 ? 
14 SG ? A CYS 79  ? A CYS 549 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 113 ? A CYS 583 ? 1_555 110.6 ? 
15 SG ? A CYS 84  ? A CYS 554 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 113 ? A CYS 583 ? 1_555 109.6 ? 
16 SG ? A CYS 79  ? A CYS 549 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 116 ? A CYS 586 ? 1_555 101.1 ? 
17 SG ? A CYS 84  ? A CYS 554 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 116 ? A CYS 586 ? 1_555 103.1 ? 
18 SG ? A CYS 113 ? A CYS 583 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 116 ? A CYS 586 ? 1_555 120.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-11-10 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 5.1170   -11.8890 -9.7720 0.0588  -0.0279 -0.0966 -0.1224 -0.0403 0.0467  45.6780 70.4567 28.1323 
51.6719  -21.2478 -18.8900 -0.2593 0.9760  2.2213  -1.4689 0.8221  1.0591  -1.1515 1.6617  -0.5628 
'X-RAY DIFFRACTION' 2  ? refined 10.3820  -11.5190 -3.5660 -0.0925 -0.0340 0.0675  -0.2326 -0.0332 0.0962  16.7445 14.2136 39.3216 
-1.2715  19.6860  -0.8021  -0.3907 0.6833  0.3986  -1.2620 0.1364  -0.9931 -0.2946 2.1059  0.2542  
'X-RAY DIFFRACTION' 3  ? refined 7.4240   -6.5340  1.3270  0.1691  -0.1532 0.0700  -0.0806 -0.2384 0.0706  37.7359 41.0738 20.0360 
7.4609   -2.1044  -0.1688  0.2192  -0.5604 0.4215  1.2903  -1.0859 -1.4237 -1.3230 1.3916  0.8668  
'X-RAY DIFFRACTION' 4  ? refined -0.9940  -7.1820  -4.5710 0.0729  -0.1593 0.0449  -0.1195 -0.0918 0.0260  3.7674  8.3233  26.1100 
-5.1887  -2.7187  -1.5867  -0.3868 0.1945  0.6521  -0.3082 0.1933  -0.6197 -2.2577 0.8329  0.1936  
'X-RAY DIFFRACTION' 5  ? refined -6.6160  -7.1490  2.4080  0.1236  -0.0474 0.3159  0.0215  -0.2213 -0.0741 22.9289 26.3051 16.9865 
19.3983  -16.0905 -6.1065  -1.1824 -1.2383 2.7917  0.2351  -0.3324 1.1083  -1.4829 0.8932  1.5148  
'X-RAY DIFFRACTION' 6  ? refined -5.5120  -10.6430 1.3700  -0.0523 -0.0781 0.0231  0.0391  -0.0371 -0.0180 0.1116  0.0072  10.4382 
0.0284   -1.0792  -0.2749  -0.2143 -0.1504 0.2973  -0.2279 0.3345  0.1834  -0.6344 -0.4493 -0.1202 
'X-RAY DIFFRACTION' 7  ? refined -12.5920 -10.2540 -4.4310 -0.0495 -0.1555 -0.1292 0.2031  -0.0690 -0.0076 44.4305 34.0496 9.8528 
33.3674  10.7563  9.9674   -0.0402 -0.0246 0.6894  -0.0186 -0.5273 0.0600  -0.4410 -0.9739 0.5675  
'X-RAY DIFFRACTION' 8  ? refined -17.2850 -16.5590 -2.2610 0.0058  -0.1328 -0.0540 -0.0445 -0.0050 -0.0365 9.5553  46.1639 6.6872 
-7.4411  -0.5763  -15.9389 0.0692  0.1020  0.3050  -0.0510 -0.0596 0.1754  -1.2471 -0.9355 -0.0096 
'X-RAY DIFFRACTION' 9  ? refined -17.6320 -28.3380 -5.3970 -0.2195 -0.0256 -0.0938 0.0912  -0.0057 0.0425  18.1343 23.5881 7.4448 
6.6494   -1.7234  4.9630   0.0216  0.6343  0.0630  -1.3580 0.1858  0.2133  0.0725  -0.3145 -0.2074 
'X-RAY DIFFRACTION' 10 ? refined -13.1470 -25.8010 -3.9750 -0.2714 -0.0892 -0.1216 0.0913  -0.0046 -0.0503 19.2007 0.5989  4.3448 
2.7541   0.2322   0.9742   0.0522  -0.0794 -0.1014 0.1533  0.0790  -0.1964 -0.0873 -0.2206 -0.1312 
'X-RAY DIFFRACTION' 11 ? refined -6.2140  -23.6500 -6.8790 -0.3756 -0.1180 -0.1110 0.0093  0.0596  -0.0155 2.9680  6.9984  16.5356 
3.3129   5.6564   1.9552   0.3021  0.0621  0.3215  -0.1603 -0.3344 0.1151  -0.0960 0.3951  0.0323  
'X-RAY DIFFRACTION' 12 ? refined -11.7990 -30.4770 4.7740  -0.1605 0.0549  -0.0710 -0.0423 0.0347  0.0906  30.3516 22.2521 4.9113 
-13.7175 -7.4494  10.4016  -0.8100 -1.6769 -1.4980 1.0825  0.2668  0.8619  1.0835  -0.3184 0.5432  
'X-RAY DIFFRACTION' 13 ? refined -5.7930  -24.7110 -2.0920 -0.2903 -0.0462 -0.1573 0.0740  -0.0570 0.0385  9.4551  11.5237 14.5997 
7.7649   -2.6052  6.3132   0.4981  -0.4029 -0.0453 0.3336  -0.7848 0.1208  -0.1372 0.2558  0.2867  
'X-RAY DIFFRACTION' 14 ? refined 3.0540   -21.2720 -4.3200 -0.2553 -0.1451 -0.1121 0.0437  0.0122  -0.0346 18.7500 8.5882  5.9347 
-0.2231  5.3093   -4.9125  -0.4321 0.9218  -0.0110 -0.4502 0.1049  -0.1270 0.0387  0.8264  0.3271  
'X-RAY DIFFRACTION' 15 ? refined 5.8600   -28.6550 -3.2540 -0.2857 -0.0478 0.0156  0.1066  -0.0886 -0.0572 42.9717 15.5909 23.9369 
20.2410  -20.6473 -9.1752  -0.9301 1.2095  -2.8243 -0.4812 0.7757  -0.8388 1.8286  0.6452  0.1544  
'X-RAY DIFFRACTION' 16 ? refined -2.4010  -29.7330 3.4350  -0.0393 0.0376  0.0141  -0.1335 -0.0997 -0.0165 24.5883 8.2969  6.1942 
-2.9001  -6.2475  -2.7551  -0.0596 -0.3038 -1.5740 0.6297  0.1243  -0.1768 1.5414  -0.6073 -0.0647 
'X-RAY DIFFRACTION' 17 ? refined 1.0810   -22.9020 9.0370  -0.1723 0.0554  -0.0810 -0.0030 -0.1149 0.0013  34.6994 4.5919  6.4519 
10.8738  -9.3734  -0.7827  0.2640  -1.0494 -0.2207 0.5501  0.2116  0.1992  0.1993  -0.1814 -0.4756 
'X-RAY DIFFRACTION' 18 ? refined -1.3490  -16.0530 9.0950  -0.2495 0.1147  0.0271  0.0438  -0.0665 -0.1737 7.9024  14.7635 46.4181 
-9.9638  16.2364  -15.1113 -0.5932 -0.9615 1.0880  1.6388  0.1844  -0.6004 -1.6432 -1.1137 0.4088  
'X-RAY DIFFRACTION' 19 ? refined -10.5400 -14.4270 10.7280 0.0848  0.2903  -0.0725 0.1588  0.0345  -0.1123 42.5546 4.4603  23.1366 
-12.1821 -3.7882  5.7944   -1.0290 -0.8646 0.1735  0.8344  1.3196  0.5831  -0.3596 -0.9537 -0.2906 
'X-RAY DIFFRACTION' 20 ? refined -15.9620 -10.8140 6.4840  0.2125  -0.1128 0.1234  0.2237  -0.0113 -0.0200 28.8279 71.7392 
102.8674 -20.5423 6.5062   31.2482  0.8280  0.4924  1.3273  0.8859  -0.1988 0.7856  2.7132  0.3025  -0.6292 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 474 ? ? A 478 ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 479 ? ? A 485 ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 486 ? ? A 491 ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 492 ? ? A 501 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 502 ? ? A 507 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 508 ? ? A 515 ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 516 ? ? A 521 ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 522 ? ? A 526 ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 527 ? ? A 531 ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 A 532 ? ? A 537 ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 A 538 ? ? A 547 ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 A 548 ? ? A 555 ? ? ? ? 
'X-RAY DIFFRACTION' 13 13 A 556 ? ? A 560 ? ? ? ? 
'X-RAY DIFFRACTION' 14 14 A 561 ? ? A 567 ? ? ? ? 
'X-RAY DIFFRACTION' 15 15 A 568 ? ? A 575 ? ? ? ? 
'X-RAY DIFFRACTION' 16 16 A 576 ? ? A 584 ? ? ? ? 
'X-RAY DIFFRACTION' 17 17 A 585 ? ? A 594 ? ? ? ? 
'X-RAY DIFFRACTION' 18 18 A 595 ? ? A 599 ? ? ? ? 
'X-RAY DIFFRACTION' 19 19 A 600 ? ? A 605 ? ? ? ? 
'X-RAY DIFFRACTION' 20 20 A 606 ? ? A 609 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
ADSC     'data collection' Quantum  ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
SOLVE    phasing           .        ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CZ 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             596 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            NH1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             596 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.415 
_pdbx_validate_rmsd_bond.bond_target_value         1.326 
_pdbx_validate_rmsd_bond.bond_deviation            0.089 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.013 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ARG 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     544 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -112.96 
_pdbx_validate_torsion.psi             -83.93 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 471 ? A GLY 1   
2  1 Y 1 A PRO 472 ? A PRO 2   
3  1 Y 1 A LEU 473 ? A LEU 3   
4  1 Y 1 A LYS 577 ? A LYS 107 
5  1 Y 1 A GLU 578 ? A GLU 108 
6  1 Y 1 A ASP 579 ? A ASP 109 
7  1 Y 1 A PRO 580 ? A PRO 110 
8  1 Y 1 A ALA 610 ? A ALA 140 
9  1 Y 1 A ASN 611 ? A ASN 141 
10 1 Y 1 A ASN 612 ? A ASN 142 
11 1 Y 1 A HIS 613 ? A HIS 143 
12 1 Y 1 A ASP 614 ? A ASP 144 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'     ZN  
3 1,2-ETHANEDIOL EDO 
4 water          HOH 
#