data_3A1B
# 
_entry.id   3A1B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3A1B         
RCSB  RCSB028686   
WWPDB D_1000028686 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3A1A 
_pdbx_database_related.details        'The same protein in the free state' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3A1B 
_pdbx_database_status.recvd_initial_deposition_date   2009-03-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Otani, J.'     1 
'Arita, K.'     2 
'Ariyoshi, M.'  3 
'Shirakawa, M.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for recognition of H3K4 methylation status by the DNA methyltransferase 3A ATRX-DNMT3-DNMT3L domain' 
_citation.journal_abbrev            'Embo Rep.' 
_citation.journal_volume            10 
_citation.page_first                1235 
_citation.page_last                 1241 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1469-221X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19834512 
_citation.pdbx_database_id_DOI      10.1038/embor.2009.218 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Otani, J.'     1 
primary 'Nankumo, T.'   2 
primary 'Arita, K.'     3 
primary 'Inamoto, S.'   4 
primary 'Ariyoshi, M.'  5 
primary 'Shirakawa, M.' 6 
# 
_cell.entry_id           3A1B 
_cell.length_a           68.547 
_cell.length_b           68.547 
_cell.length_c           109.950 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3A1B 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA (cytosine-5)-methyltransferase 3A, Histone H3.1' 18072.805 1  2.1.1.37 ? 
'ADD(ATRX-DNMT3-DNMT3L) domain(residues 476-614), UNP residues 2-21(Histone H3.1)' ? 
2 non-polymer syn 'ZINC ION'                                            65.409    3  ?        ? ? ? 
3 non-polymer syn 1,2-ETHANEDIOL                                        62.068    7  ?        ? ? ? 
4 water       nat water                                                 18.015    38 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Dnmt3a, DNA methyltransferase HsaIIIA, DNA MTase HsaIIIA, M.HsaIIIA, H3/a, H3/b, H3/c, H3/d, H3/f, H3/h, H3/i, H3/j, H3/k, H3/l' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ARTKQTARKSTGGKAPRKQLRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQS
YCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ARTKQTARKSTGGKAPRKQLRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQS
YCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ARG n 
1 22  GLU n 
1 23  ARG n 
1 24  LEU n 
1 25  VAL n 
1 26  TYR n 
1 27  GLU n 
1 28  VAL n 
1 29  ARG n 
1 30  GLN n 
1 31  LYS n 
1 32  CYS n 
1 33  ARG n 
1 34  ASN n 
1 35  ILE n 
1 36  GLU n 
1 37  ASP n 
1 38  ILE n 
1 39  CYS n 
1 40  ILE n 
1 41  SER n 
1 42  CYS n 
1 43  GLY n 
1 44  SER n 
1 45  LEU n 
1 46  ASN n 
1 47  VAL n 
1 48  THR n 
1 49  LEU n 
1 50  GLU n 
1 51  HIS n 
1 52  PRO n 
1 53  LEU n 
1 54  PHE n 
1 55  VAL n 
1 56  GLY n 
1 57  GLY n 
1 58  MET n 
1 59  CYS n 
1 60  GLN n 
1 61  ASN n 
1 62  CYS n 
1 63  LYS n 
1 64  ASN n 
1 65  CYS n 
1 66  PHE n 
1 67  LEU n 
1 68  GLU n 
1 69  CYS n 
1 70  ALA n 
1 71  TYR n 
1 72  GLN n 
1 73  TYR n 
1 74  ASP n 
1 75  ASP n 
1 76  ASP n 
1 77  GLY n 
1 78  TYR n 
1 79  GLN n 
1 80  SER n 
1 81  TYR n 
1 82  CYS n 
1 83  THR n 
1 84  ILE n 
1 85  CYS n 
1 86  CYS n 
1 87  GLY n 
1 88  GLY n 
1 89  ARG n 
1 90  GLU n 
1 91  VAL n 
1 92  LEU n 
1 93  MET n 
1 94  CYS n 
1 95  GLY n 
1 96  ASN n 
1 97  ASN n 
1 98  ASN n 
1 99  CYS n 
1 100 CYS n 
1 101 ARG n 
1 102 CYS n 
1 103 PHE n 
1 104 CYS n 
1 105 VAL n 
1 106 GLU n 
1 107 CYS n 
1 108 VAL n 
1 109 ASP n 
1 110 LEU n 
1 111 LEU n 
1 112 VAL n 
1 113 GLY n 
1 114 PRO n 
1 115 GLY n 
1 116 ALA n 
1 117 ALA n 
1 118 GLN n 
1 119 ALA n 
1 120 ALA n 
1 121 ILE n 
1 122 LYS n 
1 123 GLU n 
1 124 ASP n 
1 125 PRO n 
1 126 TRP n 
1 127 ASN n 
1 128 CYS n 
1 129 TYR n 
1 130 MET n 
1 131 CYS n 
1 132 GLY n 
1 133 HIS n 
1 134 LYS n 
1 135 GLY n 
1 136 THR n 
1 137 TYR n 
1 138 GLY n 
1 139 LEU n 
1 140 LEU n 
1 141 ARG n 
1 142 ARG n 
1 143 ARG n 
1 144 GLU n 
1 145 ASP n 
1 146 TRP n 
1 147 PRO n 
1 148 SER n 
1 149 ARG n 
1 150 LEU n 
1 151 GLN n 
1 152 MET n 
1 153 PHE n 
1 154 PHE n 
1 155 ALA n 
1 156 ASN n 
1 157 ASN n 
1 158 HIS n 
1 159 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1  20  human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? 
? ? ? ? ? ? PLASMID ? ? ? pGEX ? ? 
1 2 sample ? 21 159 human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? 
? ? ? ? ? ? PLASMID ? ? ? pGEX ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H31_HUMAN   P68431 1 ARTKQTARKSTGGKAPRKQL 2   ? 
2 UNP DNM3A_HUMAN Q9Y6K1 1 
;RERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCC
RCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHD
;
476 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3A1B A 1  ? 20  ? P68431 2   ? 21  ? 456 475 
2 2 3A1B A 21 ? 159 ? Q9Y6K1 476 ? 614 ? 476 614 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                 'Zn 2'           65.409  
# 
_exptl.entry_id          3A1B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.57 
_exptl_crystal.density_percent_sol   65.58 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'10% PEG 2000 monomethyl ether, 0.1M Bis-Tris, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-06-10 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-5A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-5A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3A1B 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.d_resolution_high            2.292 
_reflns.d_resolution_low             32.721 
_reflns.number_all                   12159 
_reflns.number_obs                   12159 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            0.082 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              24.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.292 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   86.9 
_reflns_shell.Rmerge_I_obs           0.428 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        15.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3A1B 
_refine.ls_number_reflns_obs                     11534 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.72 
_refine.ls_d_res_high                            2.292 
_refine.ls_percent_reflns_obs                    98.14 
_refine.ls_R_factor_obs                          0.19344 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19198 
_refine.ls_R_factor_R_free                       0.22408 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  576 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.938 
_refine.B_iso_mean                               43.685 
_refine.aniso_B[1][1]                            2.16 
_refine.aniso_B[2][2]                            2.16 
_refine.aniso_B[3][3]                            -4.33 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3A1A' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.196 
_refine.pdbx_overall_ESU_R_Free                  0.173 
_refine.overall_SU_ML                            0.111 
_refine.overall_SU_B                             8.047 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1173 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             38 
_refine_hist.number_atoms_total               1242 
_refine_hist.d_res_high                       2.292 
_refine_hist.d_res_low                        32.72 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 1219 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.501  1.961  ? 1627 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.854  5.000  ? 150  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.229 23.443 ? 61   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.946 15.000 ? 212  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.577 15.000 ? 12   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.101  0.200  ? 168  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 927  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.207  0.200  ? 555  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.304  0.200  ? 815  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.145  0.200  ? 62   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.205  0.200  ? 34   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.173  0.200  ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.797  1.500  ? 761  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.277  2.000  ? 1177 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.282  3.000  ? 523  'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.570  4.500  ? 448  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.292 
_refine_ls_shell.d_res_low                        2.351 
_refine_ls_shell.number_reflns_R_work             695 
_refine_ls_shell.R_factor_R_work                  0.232 
_refine_ls_shell.percent_reflns_obs               82.90 
_refine_ls_shell.R_factor_R_free                  0.263 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             32 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3A1B 
_struct.title                     'Crystal structure of the DNMT3A ADD domain in complex with histone H3' 
_struct.pdbx_descriptor           'DNA (cytosine-5)-methyltransferase 3A, Histone H3.1 (E.C.2.1.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3A1B 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;Zinc-finger, Histone binding, Chromosomal protein, DNA damage, DNA repair, DNA-binding, Methylation, Nucleosome core, Nucleus, Phosphoprotein, Alternative promoter usage, Metal-binding, Methyltransferase, S-adenosyl-L-methionine, Transferase
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 17  ? GLN A 30  ? ARG A 472 GLN A 485 1 ? 14 
HELX_P HELX_P2 2 ASN A 34  ? ILE A 38  ? ASN A 489 ILE A 493 5 ? 5  
HELX_P HELX_P3 3 CYS A 59  ? ALA A 70  ? CYS A 514 ALA A 525 1 ? 12 
HELX_P HELX_P4 4 VAL A 105 ? VAL A 112 ? VAL A 560 VAL A 567 1 ? 8  
HELX_P HELX_P5 5 GLY A 115 ? LYS A 122 ? GLY A 570 LYS A 577 1 ? 8  
HELX_P HELX_P6 6 ASP A 145 ? ALA A 155 ? ASP A 600 ALA A 610 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 39  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 494 A ZN 1 1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc2  metalc ? ? A CYS 42  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 497 A ZN 1 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc3  metalc ? ? A CYS 59  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 514 A ZN 1 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc4  metalc ? ? A CYS 62  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 517 A ZN 1 1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc5  metalc ? ? A CYS 82  SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 537 A ZN 2 1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc6  metalc ? ? A CYS 85  SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 540 A ZN 2 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc7  metalc ? ? A CYS 94  SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 549 A ZN 3 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc8  metalc ? ? A CYS 99  SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 554 A ZN 3 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc9  metalc ? ? A CYS 104 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 559 A ZN 2 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc10 metalc ? ? A CYS 107 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 562 A ZN 2 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc11 metalc ? ? A CYS 128 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 583 A ZN 3 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc12 metalc ? ? A CYS 131 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 586 A ZN 3 1_555 ? ? ? ? ? ? ? 2.211 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           124 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            579 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    125 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     580 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.35 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 2   ? GLN A 5   ? ARG A 457 GLN A 460 
A 2 GLU A 90  ? MET A 93  ? GLU A 545 MET A 548 
A 3 CYS A 102 ? CYS A 104 ? CYS A 557 CYS A 559 
B 1 LEU A 49  ? GLU A 50  ? LEU A 504 GLU A 505 
B 2 GLY A 57  ? MET A 58  ? GLY A 512 MET A 513 
C 1 THR A 136 ? TYR A 137 ? THR A 591 TYR A 592 
C 2 LEU A 140 ? ARG A 141 ? LEU A 595 ARG A 596 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 2   ? N ARG A 457 O MET A 93  ? O MET A 548 
A 2 3 N LEU A 92  ? N LEU A 547 O PHE A 103 ? O PHE A 558 
B 1 2 N LEU A 49  ? N LEU A 504 O MET A 58  ? O MET A 513 
C 1 2 N TYR A 137 ? N TYR A 592 O LEU A 140 ? O LEU A 595 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1'    
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2'    
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 3'    
AC4 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE EDO A 615' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A 616' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A 617' 
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EDO A 4'   
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A 5'   
AC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A 6'   
BC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EDO A 7'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 39  ? CYS A 494 . ? 1_555 ? 
2  AC1 4 CYS A 42  ? CYS A 497 . ? 1_555 ? 
3  AC1 4 CYS A 59  ? CYS A 514 . ? 1_555 ? 
4  AC1 4 CYS A 62  ? CYS A 517 . ? 1_555 ? 
5  AC2 4 CYS A 82  ? CYS A 537 . ? 1_555 ? 
6  AC2 4 CYS A 85  ? CYS A 540 . ? 1_555 ? 
7  AC2 4 CYS A 104 ? CYS A 559 . ? 1_555 ? 
8  AC2 4 CYS A 107 ? CYS A 562 . ? 1_555 ? 
9  AC3 4 CYS A 94  ? CYS A 549 . ? 1_555 ? 
10 AC3 4 CYS A 99  ? CYS A 554 . ? 1_555 ? 
11 AC3 4 CYS A 128 ? CYS A 583 . ? 1_555 ? 
12 AC3 4 CYS A 131 ? CYS A 586 . ? 1_555 ? 
13 AC4 8 EDO K .   ? EDO A 7   . ? 1_555 ? 
14 AC4 8 HOH L .   ? HOH A 9   . ? 1_555 ? 
15 AC4 8 PHE A 66  ? PHE A 521 . ? 1_555 ? 
16 AC4 8 CYS A 69  ? CYS A 524 . ? 1_555 ? 
17 AC4 8 GLN A 79  ? GLN A 534 . ? 1_555 ? 
18 AC4 8 TYR A 81  ? TYR A 536 . ? 1_555 ? 
19 AC4 8 CYS A 82  ? CYS A 537 . ? 1_555 ? 
20 AC4 8 ARG A 101 ? ARG A 556 . ? 1_555 ? 
21 AC5 6 GLU A 36  ? GLU A 491 . ? 1_555 ? 
22 AC5 6 LEU A 49  ? LEU A 504 . ? 1_555 ? 
23 AC5 6 GLU A 50  ? GLU A 505 . ? 1_555 ? 
24 AC5 6 GLY A 56  ? GLY A 511 . ? 1_555 ? 
25 AC5 6 GLY A 57  ? GLY A 512 . ? 1_555 ? 
26 AC5 6 ARG A 143 ? ARG A 598 . ? 1_555 ? 
27 AC6 6 GLU A 22  ? GLU A 477 . ? 3_545 ? 
28 AC6 6 ALA A 70  ? ALA A 525 . ? 1_555 ? 
29 AC6 6 TYR A 71  ? TYR A 526 . ? 1_555 ? 
30 AC6 6 TYR A 73  ? TYR A 528 . ? 1_555 ? 
31 AC6 6 ASP A 109 ? ASP A 564 . ? 3_545 ? 
32 AC6 6 PRO A 114 ? PRO A 569 . ? 3_545 ? 
33 AC7 3 TRP A 126 ? TRP A 581 . ? 1_555 ? 
34 AC7 3 ASN A 127 ? ASN A 582 . ? 1_555 ? 
35 AC7 3 TYR A 137 ? TYR A 592 . ? 1_555 ? 
36 AC8 6 HOH L .   ? HOH A 21  . ? 1_555 ? 
37 AC8 6 ARG A 23  ? ARG A 478 . ? 3_545 ? 
38 AC8 6 TYR A 26  ? TYR A 481 . ? 3_545 ? 
39 AC8 6 GLU A 68  ? GLU A 523 . ? 1_555 ? 
40 AC8 6 TYR A 71  ? TYR A 526 . ? 1_555 ? 
41 AC8 6 GLN A 72  ? GLN A 527 . ? 1_555 ? 
42 AC9 6 GLY A 88  ? GLY A 543 . ? 1_555 ? 
43 AC9 6 ARG A 89  ? ARG A 544 . ? 1_555 ? 
44 AC9 6 GLU A 90  ? GLU A 545 . ? 1_555 ? 
45 AC9 6 CYS A 104 ? CYS A 559 . ? 1_555 ? 
46 AC9 6 VAL A 105 ? VAL A 560 . ? 1_555 ? 
47 AC9 6 GLU A 106 ? GLU A 561 . ? 1_555 ? 
48 BC1 7 PHE A 66  ? PHE A 521 . ? 1_555 ? 
49 BC1 7 ALA A 70  ? ALA A 525 . ? 1_555 ? 
50 BC1 7 GLN A 79  ? GLN A 534 . ? 1_555 ? 
51 BC1 7 ARG A 101 ? ARG A 556 . ? 1_555 ? 
52 BC1 7 PRO A 114 ? PRO A 569 . ? 3_545 ? 
53 BC1 7 LEU A 150 ? LEU A 605 . ? 1_555 ? 
54 BC1 7 EDO E .   ? EDO A 615 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3A1B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3A1B 
_atom_sites.fract_transf_matrix[1][1]   0.014589 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014589 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009095 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1   ? 43.370 3.593   14.090 1.00 48.77 ? 456 ALA A N   1 
ATOM   2    C  CA  . ALA A 1 1   ? 42.494 2.527   14.656 1.00 48.65 ? 456 ALA A CA  1 
ATOM   3    C  C   . ALA A 1 1   ? 42.943 1.144   14.192 1.00 48.74 ? 456 ALA A C   1 
ATOM   4    O  O   . ALA A 1 1   ? 43.296 0.962   13.031 1.00 48.75 ? 456 ALA A O   1 
ATOM   5    C  CB  . ALA A 1 1   ? 41.056 2.767   14.271 1.00 48.29 ? 456 ALA A CB  1 
ATOM   6    N  N   . ARG A 1 2   ? 42.940 0.181   15.111 1.00 48.73 ? 457 ARG A N   1 
ATOM   7    C  CA  . ARG A 1 2   ? 43.070 -1.229  14.751 1.00 49.11 ? 457 ARG A CA  1 
ATOM   8    C  C   . ARG A 1 2   ? 41.753 -1.736  14.126 1.00 48.70 ? 457 ARG A C   1 
ATOM   9    O  O   . ARG A 1 2   ? 40.676 -1.315  14.522 1.00 47.95 ? 457 ARG A O   1 
ATOM   10   C  CB  . ARG A 1 2   ? 43.407 -2.053  15.995 1.00 49.31 ? 457 ARG A CB  1 
ATOM   11   C  CG  . ARG A 1 2   ? 44.324 -3.237  15.738 1.00 51.83 ? 457 ARG A CG  1 
ATOM   12   C  CD  . ARG A 1 2   ? 44.030 -4.399  16.701 1.00 56.14 ? 457 ARG A CD  1 
ATOM   13   N  NE  . ARG A 1 2   ? 44.383 -4.106  18.096 1.00 58.85 ? 457 ARG A NE  1 
ATOM   14   C  CZ  . ARG A 1 2   ? 44.055 -4.864  19.148 1.00 59.94 ? 457 ARG A CZ  1 
ATOM   15   N  NH1 . ARG A 1 2   ? 43.344 -5.982  18.997 1.00 60.72 ? 457 ARG A NH1 1 
ATOM   16   N  NH2 . ARG A 1 2   ? 44.435 -4.499  20.367 1.00 59.56 ? 457 ARG A NH2 1 
ATOM   17   N  N   . THR A 1 3   ? 41.860 -2.623  13.140 1.00 48.83 ? 458 THR A N   1 
ATOM   18   C  CA  . THR A 1 3   ? 40.713 -3.260  12.498 1.00 48.92 ? 458 THR A CA  1 
ATOM   19   C  C   . THR A 1 3   ? 40.725 -4.770  12.675 1.00 48.69 ? 458 THR A C   1 
ATOM   20   O  O   . THR A 1 3   ? 41.765 -5.367  12.941 1.00 48.78 ? 458 THR A O   1 
ATOM   21   C  CB  . THR A 1 3   ? 40.682 -3.012  10.975 1.00 49.25 ? 458 THR A CB  1 
ATOM   22   O  OG1 . THR A 1 3   ? 41.782 -3.694  10.343 1.00 50.15 ? 458 THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 3   ? 40.732 -1.530  10.647 1.00 49.72 ? 458 THR A CG2 1 
ATOM   24   N  N   . LYS A 1 4   ? 39.559 -5.383  12.534 1.00 48.92 ? 459 LYS A N   1 
ATOM   25   C  CA  . LYS A 1 4   ? 39.447 -6.834  12.423 1.00 49.24 ? 459 LYS A CA  1 
ATOM   26   C  C   . LYS A 1 4   ? 38.290 -7.179  11.489 1.00 50.20 ? 459 LYS A C   1 
ATOM   27   O  O   . LYS A 1 4   ? 37.359 -6.376  11.307 1.00 50.01 ? 459 LYS A O   1 
ATOM   28   C  CB  . LYS A 1 4   ? 39.264 -7.500  13.800 1.00 48.48 ? 459 LYS A CB  1 
ATOM   29   C  CG  . LYS A 1 4   ? 37.999 -7.121  14.525 1.00 47.90 ? 459 LYS A CG  1 
ATOM   30   C  CD  . LYS A 1 4   ? 37.926 -7.746  15.928 1.00 48.86 ? 459 LYS A CD  1 
ATOM   31   C  CE  . LYS A 1 4   ? 36.570 -7.515  16.615 1.00 45.89 ? 459 LYS A CE  1 
ATOM   32   N  NZ  . LYS A 1 4   ? 36.588 -8.107  17.979 1.00 46.29 ? 459 LYS A NZ  1 
ATOM   33   N  N   . GLN A 1 5   ? 38.371 -8.356  10.877 1.00 51.40 ? 460 GLN A N   1 
ATOM   34   C  CA  . GLN A 1 5   ? 37.232 -8.938  10.196 1.00 53.17 ? 460 GLN A CA  1 
ATOM   35   C  C   . GLN A 1 5   ? 36.358 -9.528  11.282 1.00 53.40 ? 460 GLN A C   1 
ATOM   36   O  O   . GLN A 1 5   ? 36.868 -10.086 12.254 1.00 53.88 ? 460 GLN A O   1 
ATOM   37   C  CB  . GLN A 1 5   ? 37.666 -10.035 9.225  1.00 53.45 ? 460 GLN A CB  1 
ATOM   38   C  CG  . GLN A 1 5   ? 38.642 -9.581  8.131  1.00 58.26 ? 460 GLN A CG  1 
ATOM   39   C  CD  . GLN A 1 5   ? 38.085 -8.467  7.244  1.00 64.75 ? 460 GLN A CD  1 
ATOM   40   O  OE1 . GLN A 1 5   ? 36.998 -8.591  6.661  1.00 67.96 ? 460 GLN A OE1 1 
ATOM   41   N  NE2 . GLN A 1 5   ? 38.836 -7.370  7.138  1.00 67.21 ? 460 GLN A NE2 1 
ATOM   42   N  N   . THR A 1 6   ? 35.044 -9.386  11.141 1.00 53.77 ? 461 THR A N   1 
ATOM   43   C  CA  . THR A 1 6   ? 34.125 -9.940  12.119 1.00 53.65 ? 461 THR A CA  1 
ATOM   44   C  C   . THR A 1 6   ? 34.017 -11.445 11.928 1.00 54.34 ? 461 THR A C   1 
ATOM   45   O  O   . THR A 1 6   ? 34.265 -11.964 10.828 1.00 54.11 ? 461 THR A O   1 
ATOM   46   C  CB  . THR A 1 6   ? 32.730 -9.290  12.049 1.00 53.75 ? 461 THR A CB  1 
ATOM   47   O  OG1 . THR A 1 6   ? 32.192 -9.441  10.731 1.00 52.76 ? 461 THR A OG1 1 
ATOM   48   C  CG2 . THR A 1 6   ? 32.815 -7.816  12.390 1.00 52.78 ? 461 THR A CG2 1 
ATOM   49   N  N   . ALA A 1 7   ? 33.679 -12.141 13.012 1.00 54.70 ? 462 ALA A N   1 
ATOM   50   C  CA  . ALA A 1 7   ? 33.428 -13.565 12.952 1.00 55.31 ? 462 ALA A CA  1 
ATOM   51   C  C   . ALA A 1 7   ? 32.155 -13.769 12.151 1.00 55.73 ? 462 ALA A C   1 
ATOM   52   O  O   . ALA A 1 7   ? 31.139 -13.123 12.417 1.00 55.76 ? 462 ALA A O   1 
ATOM   53   C  CB  . ALA A 1 7   ? 33.295 -14.152 14.354 1.00 55.39 ? 462 ALA A CB  1 
ATOM   54   N  N   . ARG A 1 8   ? 32.229 -14.643 11.151 1.00 56.39 ? 463 ARG A N   1 
ATOM   55   C  CA  . ARG A 1 8   ? 31.082 -14.976 10.316 1.00 57.20 ? 463 ARG A CA  1 
ATOM   56   C  C   . ARG A 1 8   ? 29.891 -15.330 11.207 1.00 57.73 ? 463 ARG A C   1 
ATOM   57   O  O   . ARG A 1 8   ? 30.055 -15.966 12.254 1.00 57.94 ? 463 ARG A O   1 
ATOM   58   C  CB  . ARG A 1 8   ? 31.422 -16.143 9.376  1.00 57.06 ? 463 ARG A CB  1 
ATOM   59   C  CG  . ARG A 1 8   ? 32.325 -15.873 8.484  0.00 53.37 ? 463 ARG A CG  1 
ATOM   60   C  CD  . ARG A 1 8   ? 31.897 -14.759 7.516  0.00 57.35 ? 463 ARG A CD  1 
ATOM   61   N  NE  . ARG A 1 8   ? 32.615 -14.810 6.238  0.00 63.14 ? 463 ARG A NE  1 
ATOM   62   C  CZ  . ARG A 1 8   ? 32.547 -13.865 5.298  0.00 67.72 ? 463 ARG A CZ  1 
ATOM   63   N  NH1 . ARG A 1 8   ? 31.802 -12.776 5.479  0.00 67.72 ? 463 ARG A NH1 1 
ATOM   64   N  NH2 . ARG A 1 8   ? 33.236 -14.002 4.176  0.00 73.39 ? 463 ARG A NH2 1 
ATOM   65   N  N   . LYS A 1 9   ? 28.699 -14.905 10.801 1.00 58.20 ? 464 LYS A N   1 
ATOM   66   C  CA  . LYS A 1 9   ? 27.500 -15.124 11.607 1.00 58.48 ? 464 LYS A CA  1 
ATOM   67   C  C   . LYS A 1 9   ? 26.590 -16.211 11.016 1.00 58.85 ? 464 LYS A C   1 
ATOM   68   O  O   . LYS A 1 9   ? 25.430 -15.967 10.657 1.00 59.36 ? 464 LYS A O   1 
ATOM   69   C  CB  . LYS A 1 9   ? 26.762 -13.797 11.788 1.00 58.39 ? 464 LYS A CB  1 
ATOM   70   C  CG  . LYS A 1 9   ? 25.857 -13.752 12.996 1.00 58.23 ? 464 LYS A CG  1 
ATOM   71   C  CD  . LYS A 1 9   ? 25.967 -12.417 13.701 1.00 56.99 ? 464 LYS A CD  1 
ATOM   72   C  CE  . LYS A 1 9   ? 25.859 -11.245 12.758 1.00 54.28 ? 464 LYS A CE  1 
ATOM   73   N  NZ  . LYS A 1 9   ? 25.786 -10.052 13.596 1.00 53.11 ? 464 LYS A NZ  1 
ATOM   74   N  N   . ARG A 1 17  ? 19.122 -4.249  1.621  1.00 50.01 ? 472 ARG A N   1 
ATOM   75   C  CA  . ARG A 1 17  ? 19.323 -3.583  2.904  1.00 50.41 ? 472 ARG A CA  1 
ATOM   76   C  C   . ARG A 1 17  ? 20.234 -2.358  2.774  1.00 50.17 ? 472 ARG A C   1 
ATOM   77   O  O   . ARG A 1 17  ? 19.847 -1.256  3.161  1.00 50.35 ? 472 ARG A O   1 
ATOM   78   C  CB  . ARG A 1 17  ? 19.895 -4.552  3.946  1.00 50.35 ? 472 ARG A CB  1 
ATOM   79   C  CG  . ARG A 1 17  ? 19.625 -4.148  5.413  1.00 51.86 ? 472 ARG A CG  1 
ATOM   80   C  CD  . ARG A 1 17  ? 18.236 -4.690  5.904  1.00 54.14 ? 472 ARG A CD  1 
ATOM   81   N  NE  . ARG A 1 17  ? 17.186 -3.661  5.941  1.00 54.45 ? 472 ARG A NE  1 
ATOM   82   C  CZ  . ARG A 1 17  ? 15.900 -3.878  6.221  1.00 54.49 ? 472 ARG A CZ  1 
ATOM   83   N  NH1 . ARG A 1 17  ? 15.449 -5.101  6.482  1.00 55.68 ? 472 ARG A NH1 1 
ATOM   84   N  NH2 . ARG A 1 17  ? 15.050 -2.860  6.235  1.00 54.47 ? 472 ARG A NH2 1 
ATOM   85   N  N   . LYS A 1 18  ? 21.444 -2.561  2.252  1.00 49.64 ? 473 LYS A N   1 
ATOM   86   C  CA  . LYS A 1 18  ? 22.386 -1.473  1.996  1.00 49.17 ? 473 LYS A CA  1 
ATOM   87   C  C   . LYS A 1 18  ? 21.785 -0.407  1.068  1.00 48.50 ? 473 LYS A C   1 
ATOM   88   O  O   . LYS A 1 18  ? 21.781 0.775   1.397  1.00 49.05 ? 473 LYS A O   1 
ATOM   89   C  CB  . LYS A 1 18  ? 23.672 -2.026  1.383  1.00 49.53 ? 473 LYS A CB  1 
ATOM   90   C  CG  . LYS A 1 18  ? 24.762 -0.992  1.217  1.00 49.45 ? 473 LYS A CG  1 
ATOM   91   C  CD  . LYS A 1 18  ? 26.016 -1.663  0.783  1.00 51.58 ? 473 LYS A CD  1 
ATOM   92   C  CE  . LYS A 1 18  ? 27.165 -0.701  0.801  1.00 52.82 ? 473 LYS A CE  1 
ATOM   93   N  NZ  . LYS A 1 18  ? 28.308 -1.350  0.089  1.00 52.84 ? 473 LYS A NZ  1 
ATOM   94   N  N   . GLN A 1 19  ? 21.278 -0.832  -0.082 1.00 47.11 ? 474 GLN A N   1 
ATOM   95   C  CA  . GLN A 1 19  ? 20.574 0.063   -0.997 1.00 46.81 ? 474 GLN A CA  1 
ATOM   96   C  C   . GLN A 1 19  ? 19.595 1.006   -0.271 1.00 46.23 ? 474 GLN A C   1 
ATOM   97   O  O   . GLN A 1 19  ? 19.593 2.201   -0.500 1.00 45.62 ? 474 GLN A O   1 
ATOM   98   C  CB  . GLN A 1 19  ? 19.868 -0.783  -2.049 1.00 46.48 ? 474 GLN A CB  1 
ATOM   99   C  CG  . GLN A 1 19  ? 19.123 -0.006  -3.083 1.00 49.67 ? 474 GLN A CG  1 
ATOM   100  C  CD  . GLN A 1 19  ? 18.772 -0.880  -4.261 1.00 53.00 ? 474 GLN A CD  1 
ATOM   101  O  OE1 . GLN A 1 19  ? 18.470 -2.064  -4.095 1.00 56.02 ? 474 GLN A OE1 1 
ATOM   102  N  NE2 . GLN A 1 19  ? 18.836 -0.318  -5.460 1.00 51.63 ? 474 GLN A NE2 1 
ATOM   103  N  N   . LEU A 1 20  ? 18.803 0.446   0.637  1.00 46.46 ? 475 LEU A N   1 
ATOM   104  C  CA  . LEU A 1 20  ? 17.797 1.147   1.400  1.00 46.79 ? 475 LEU A CA  1 
ATOM   105  C  C   . LEU A 1 20  ? 18.402 2.116   2.405  1.00 46.35 ? 475 LEU A C   1 
ATOM   106  O  O   . LEU A 1 20  ? 17.938 3.240   2.501  1.00 46.81 ? 475 LEU A O   1 
ATOM   107  C  CB  . LEU A 1 20  ? 16.899 0.144   2.154  1.00 47.80 ? 475 LEU A CB  1 
ATOM   108  C  CG  . LEU A 1 20  ? 15.973 0.729   3.256  1.00 49.94 ? 475 LEU A CG  1 
ATOM   109  C  CD1 . LEU A 1 20  ? 14.847 1.557   2.612  1.00 52.99 ? 475 LEU A CD1 1 
ATOM   110  C  CD2 . LEU A 1 20  ? 15.383 -0.342  4.182  1.00 48.46 ? 475 LEU A CD2 1 
ATOM   111  N  N   . ARG A 1 21  ? 19.410 1.670   3.159  1.00 45.04 ? 476 ARG A N   1 
ATOM   112  C  CA  . ARG A 1 21  ? 20.059 2.481   4.180  1.00 44.82 ? 476 ARG A CA  1 
ATOM   113  C  C   . ARG A 1 21  ? 20.715 3.652   3.516  1.00 43.81 ? 476 ARG A C   1 
ATOM   114  O  O   . ARG A 1 21  ? 20.611 4.778   3.982  1.00 43.57 ? 476 ARG A O   1 
ATOM   115  C  CB  . ARG A 1 21  ? 21.169 1.711   4.901  1.00 44.39 ? 476 ARG A CB  1 
ATOM   116  C  CG  . ARG A 1 21  ? 20.707 0.880   6.050  1.00 46.59 ? 476 ARG A CG  1 
ATOM   117  C  CD  . ARG A 1 21  ? 21.918 0.264   6.763  1.00 43.88 ? 476 ARG A CD  1 
ATOM   118  N  NE  . ARG A 1 21  ? 22.284 1.024   7.956  1.00 42.26 ? 476 ARG A NE  1 
ATOM   119  C  CZ  . ARG A 1 21  ? 23.467 0.955   8.576  1.00 42.93 ? 476 ARG A CZ  1 
ATOM   120  N  NH1 . ARG A 1 21  ? 24.444 0.233   8.051  1.00 39.29 ? 476 ARG A NH1 1 
ATOM   121  N  NH2 . ARG A 1 21  ? 23.694 1.664   9.696  1.00 40.55 ? 476 ARG A NH2 1 
ATOM   122  N  N   . GLU A 1 22  ? 21.396 3.342   2.423  1.00 42.61 ? 477 GLU A N   1 
ATOM   123  C  CA  . GLU A 1 22  ? 22.068 4.312   1.627  1.00 42.74 ? 477 GLU A CA  1 
ATOM   124  C  C   . GLU A 1 22  ? 21.119 5.408   1.098  1.00 41.46 ? 477 GLU A C   1 
ATOM   125  O  O   . GLU A 1 22  ? 21.423 6.579   1.217  1.00 40.94 ? 477 GLU A O   1 
ATOM   126  C  CB  . GLU A 1 22  ? 22.749 3.585   0.494  1.00 43.16 ? 477 GLU A CB  1 
ATOM   127  C  CG  . GLU A 1 22  ? 23.966 4.270   0.043  1.00 48.53 ? 477 GLU A CG  1 
ATOM   128  C  CD  . GLU A 1 22  ? 25.161 4.049   0.929  1.00 53.46 ? 477 GLU A CD  1 
ATOM   129  O  OE1 . GLU A 1 22  ? 25.244 3.033   1.648  1.00 53.60 ? 477 GLU A OE1 1 
ATOM   130  O  OE2 . GLU A 1 22  ? 26.050 4.915   0.868  1.00 59.77 ? 477 GLU A OE2 1 
ATOM   131  N  N   . ARG A 1 23  ? 19.974 5.016   0.547  1.00 40.65 ? 478 ARG A N   1 
ATOM   132  C  CA  . ARG A 1 23  ? 18.954 5.949   0.076  1.00 40.37 ? 478 ARG A CA  1 
ATOM   133  C  C   . ARG A 1 23  ? 18.388 6.777   1.237  1.00 40.81 ? 478 ARG A C   1 
ATOM   134  O  O   . ARG A 1 23  ? 18.244 7.980   1.120  1.00 39.76 ? 478 ARG A O   1 
ATOM   135  C  CB  . ARG A 1 23  ? 17.844 5.187   -0.636 1.00 40.20 ? 478 ARG A CB  1 
ATOM   136  C  CG  . ARG A 1 23  ? 16.624 6.013   -1.018 1.00 42.88 ? 478 ARG A CG  1 
ATOM   137  C  CD  . ARG A 1 23  ? 16.962 7.161   -1.961 1.00 43.18 ? 478 ARG A CD  1 
ATOM   138  N  NE  . ARG A 1 23  ? 15.910 8.164   -1.995 1.00 44.66 ? 478 ARG A NE  1 
ATOM   139  C  CZ  . ARG A 1 23  ? 15.828 9.151   -2.889 1.00 44.55 ? 478 ARG A CZ  1 
ATOM   140  N  NH1 . ARG A 1 23  ? 16.741 9.278   -3.859 1.00 41.75 ? 478 ARG A NH1 1 
ATOM   141  N  NH2 . ARG A 1 23  ? 14.817 10.007  -2.806 1.00 41.63 ? 478 ARG A NH2 1 
ATOM   142  N  N   . LEU A 1 24  ? 18.128 6.142   2.378  1.00 40.82 ? 479 LEU A N   1 
ATOM   143  C  CA  . LEU A 1 24  ? 17.533 6.866   3.506  1.00 41.90 ? 479 LEU A CA  1 
ATOM   144  C  C   . LEU A 1 24  ? 18.516 7.857   4.124  1.00 42.31 ? 479 LEU A C   1 
ATOM   145  O  O   . LEU A 1 24  ? 18.129 8.958   4.540  1.00 43.01 ? 479 LEU A O   1 
ATOM   146  C  CB  . LEU A 1 24  ? 17.014 5.903   4.572  1.00 41.75 ? 479 LEU A CB  1 
ATOM   147  C  CG  . LEU A 1 24  ? 15.783 5.101   4.146  1.00 43.12 ? 479 LEU A CG  1 
ATOM   148  C  CD1 . LEU A 1 24  ? 15.431 4.149   5.265  1.00 46.26 ? 479 LEU A CD1 1 
ATOM   149  C  CD2 . LEU A 1 24  ? 14.612 6.006   3.854  1.00 43.40 ? 479 LEU A CD2 1 
ATOM   150  N  N   . VAL A 1 25  ? 19.790 7.480   4.167  1.00 41.96 ? 480 VAL A N   1 
ATOM   151  C  CA  . VAL A 1 25  ? 20.810 8.389   4.687  1.00 42.14 ? 480 VAL A CA  1 
ATOM   152  C  C   . VAL A 1 25  ? 20.929 9.583   3.771  1.00 40.45 ? 480 VAL A C   1 
ATOM   153  O  O   . VAL A 1 25  ? 20.973 10.695  4.237  1.00 41.11 ? 480 VAL A O   1 
ATOM   154  C  CB  . VAL A 1 25  ? 22.168 7.681   4.937  1.00 41.62 ? 480 VAL A CB  1 
ATOM   155  C  CG1 . VAL A 1 25  ? 23.308 8.666   4.903  1.00 43.36 ? 480 VAL A CG1 1 
ATOM   156  C  CG2 . VAL A 1 25  ? 22.116 7.037   6.256  1.00 44.56 ? 480 VAL A CG2 1 
ATOM   157  N  N   . TYR A 1 26  ? 20.975 9.356   2.466  1.00 39.37 ? 481 TYR A N   1 
ATOM   158  C  CA  . TYR A 1 26  ? 20.892 10.466  1.521  1.00 37.77 ? 481 TYR A CA  1 
ATOM   159  C  C   . TYR A 1 26  ? 19.704 11.419  1.793  1.00 37.64 ? 481 TYR A C   1 
ATOM   160  O  O   . TYR A 1 26  ? 19.850 12.641  1.698  1.00 37.39 ? 481 TYR A O   1 
ATOM   161  C  CB  . TYR A 1 26  ? 20.825 9.937   0.092  1.00 35.87 ? 481 TYR A CB  1 
ATOM   162  C  CG  . TYR A 1 26  ? 20.676 11.019  -0.952 1.00 35.64 ? 481 TYR A CG  1 
ATOM   163  C  CD1 . TYR A 1 26  ? 21.773 11.787  -1.358 1.00 34.27 ? 481 TYR A CD1 1 
ATOM   164  C  CD2 . TYR A 1 26  ? 19.440 11.274  -1.547 1.00 35.29 ? 481 TYR A CD2 1 
ATOM   165  C  CE1 . TYR A 1 26  ? 21.645 12.771  -2.333 1.00 30.36 ? 481 TYR A CE1 1 
ATOM   166  C  CE2 . TYR A 1 26  ? 19.297 12.262  -2.531 1.00 33.97 ? 481 TYR A CE2 1 
ATOM   167  C  CZ  . TYR A 1 26  ? 20.412 12.996  -2.926 1.00 34.54 ? 481 TYR A CZ  1 
ATOM   168  O  OH  . TYR A 1 26  ? 20.291 13.971  -3.896 1.00 32.77 ? 481 TYR A OH  1 
ATOM   169  N  N   . GLU A 1 27  ? 18.545 10.864  2.145  1.00 37.89 ? 482 GLU A N   1 
ATOM   170  C  CA  . GLU A 1 27  ? 17.335 11.689  2.378  1.00 38.32 ? 482 GLU A CA  1 
ATOM   171  C  C   . GLU A 1 27  ? 17.427 12.503  3.666  1.00 38.39 ? 482 GLU A C   1 
ATOM   172  O  O   . GLU A 1 27  ? 16.965 13.646  3.704  1.00 37.73 ? 482 GLU A O   1 
ATOM   173  C  CB  . GLU A 1 27  ? 16.086 10.825  2.388  1.00 37.79 ? 482 GLU A CB  1 
ATOM   174  C  CG  . GLU A 1 27  ? 15.740 10.268  1.022  1.00 40.56 ? 482 GLU A CG  1 
ATOM   175  C  CD  . GLU A 1 27  ? 14.572 9.281   1.052  1.00 42.77 ? 482 GLU A CD  1 
ATOM   176  O  OE1 . GLU A 1 27  ? 13.933 9.109   2.112  1.00 46.10 ? 482 GLU A OE1 1 
ATOM   177  O  OE2 . GLU A 1 27  ? 14.288 8.678   0.005  1.00 44.53 ? 482 GLU A OE2 1 
ATOM   178  N  N   . VAL A 1 28  ? 17.992 11.888  4.715  1.00 38.90 ? 483 VAL A N   1 
ATOM   179  C  CA  . VAL A 1 28  ? 18.369 12.564  5.957  1.00 38.89 ? 483 VAL A CA  1 
ATOM   180  C  C   . VAL A 1 28  ? 19.331 13.723  5.666  1.00 39.82 ? 483 VAL A C   1 
ATOM   181  O  O   . VAL A 1 28  ? 19.039 14.874  6.049  1.00 40.57 ? 483 VAL A O   1 
ATOM   182  C  CB  . VAL A 1 28  ? 18.948 11.583  7.017  1.00 39.84 ? 483 VAL A CB  1 
ATOM   183  C  CG1 . VAL A 1 28  ? 19.404 12.354  8.282  1.00 41.37 ? 483 VAL A CG1 1 
ATOM   184  C  CG2 . VAL A 1 28  ? 17.912 10.561  7.431  1.00 36.58 ? 483 VAL A CG2 1 
ATOM   185  N  N   . ARG A 1 29  ? 20.412 13.457  4.927  1.00 39.28 ? 484 ARG A N   1 
ATOM   186  C  CA  . ARG A 1 29  ? 21.382 14.502  4.563  1.00 39.90 ? 484 ARG A CA  1 
ATOM   187  C  C   . ARG A 1 29  ? 20.751 15.599  3.758  1.00 39.75 ? 484 ARG A C   1 
ATOM   188  O  O   . ARG A 1 29  ? 21.110 16.752  3.905  1.00 40.86 ? 484 ARG A O   1 
ATOM   189  C  CB  . ARG A 1 29  ? 22.562 13.950  3.747  1.00 39.71 ? 484 ARG A CB  1 
ATOM   190  C  CG  . ARG A 1 29  ? 23.561 13.078  4.517  1.00 41.40 ? 484 ARG A CG  1 
ATOM   191  C  CD  . ARG A 1 29  ? 24.693 12.514  3.582  1.00 42.03 ? 484 ARG A CD  1 
ATOM   192  N  NE  . ARG A 1 29  ? 25.249 13.499  2.631  1.00 45.32 ? 484 ARG A NE  1 
ATOM   193  C  CZ  . ARG A 1 29  ? 26.390 14.179  2.817  1.00 45.43 ? 484 ARG A CZ  1 
ATOM   194  N  NH1 . ARG A 1 29  ? 27.112 14.003  3.909  1.00 44.87 ? 484 ARG A NH1 1 
ATOM   195  N  NH2 . ARG A 1 29  ? 26.808 15.034  1.901  1.00 48.25 ? 484 ARG A NH2 1 
ATOM   196  N  N   . GLN A 1 30  ? 19.825 15.237  2.874  1.00 39.47 ? 485 GLN A N   1 
ATOM   197  C  CA  . GLN A 1 30  ? 19.112 16.189  2.053  1.00 38.25 ? 485 GLN A CA  1 
ATOM   198  C  C   . GLN A 1 30  ? 17.926 16.865  2.787  1.00 38.21 ? 485 GLN A C   1 
ATOM   199  O  O   . GLN A 1 30  ? 17.235 17.692  2.219  1.00 37.79 ? 485 GLN A O   1 
ATOM   200  C  CB  . GLN A 1 30  ? 18.663 15.507  0.762  1.00 37.99 ? 485 GLN A CB  1 
ATOM   201  C  CG  . GLN A 1 30  ? 19.811 15.194  -0.197 1.00 39.26 ? 485 GLN A CG  1 
ATOM   202  C  CD  . GLN A 1 30  ? 20.708 16.427  -0.427 1.00 40.13 ? 485 GLN A CD  1 
ATOM   203  O  OE1 . GLN A 1 30  ? 20.356 17.326  -1.178 1.00 38.98 ? 485 GLN A OE1 1 
ATOM   204  N  NE2 . GLN A 1 30  ? 21.834 16.474  0.257  1.00 39.16 ? 485 GLN A NE2 1 
ATOM   205  N  N   . LYS A 1 31  ? 17.702 16.495  4.041  1.00 38.42 ? 486 LYS A N   1 
ATOM   206  C  CA  . LYS A 1 31  ? 16.684 17.126  4.886  1.00 39.62 ? 486 LYS A CA  1 
ATOM   207  C  C   . LYS A 1 31  ? 15.234 16.877  4.449  1.00 39.92 ? 486 LYS A C   1 
ATOM   208  O  O   . LYS A 1 31  ? 14.319 17.702  4.693  1.00 39.57 ? 486 LYS A O   1 
ATOM   209  C  CB  . LYS A 1 31  ? 17.031 18.611  5.115  1.00 39.97 ? 486 LYS A CB  1 
ATOM   210  C  CG  . LYS A 1 31  ? 18.272 18.728  6.031  1.00 43.76 ? 486 LYS A CG  1 
ATOM   211  C  CD  . LYS A 1 31  ? 18.641 20.159  6.265  1.00 52.12 ? 486 LYS A CD  1 
ATOM   212  C  CE  . LYS A 1 31  ? 19.436 20.284  7.574  1.00 55.76 ? 486 LYS A CE  1 
ATOM   213  N  NZ  . LYS A 1 31  ? 19.365 21.733  8.057  1.00 57.49 ? 486 LYS A NZ  1 
ATOM   214  N  N   . CYS A 1 32  ? 15.047 15.706  3.834  1.00 39.34 ? 487 CYS A N   1 
ATOM   215  C  CA  . CYS A 1 32  ? 13.751 15.205  3.405  1.00 39.82 ? 487 CYS A CA  1 
ATOM   216  C  C   . CYS A 1 32  ? 13.235 14.075  4.304  1.00 39.92 ? 487 CYS A C   1 
ATOM   217  O  O   . CYS A 1 32  ? 12.140 13.563  4.108  1.00 39.78 ? 487 CYS A O   1 
ATOM   218  C  CB  . CYS A 1 32  ? 13.842 14.725  1.952  1.00 39.67 ? 487 CYS A CB  1 
ATOM   219  S  SG  . CYS A 1 32  ? 13.901 16.151  0.850  1.00 42.86 ? 487 CYS A SG  1 
ATOM   220  N  N   . ARG A 1 33  ? 14.039 13.690  5.283  1.00 40.34 ? 488 ARG A N   1 
ATOM   221  C  CA  . ARG A 1 33  ? 13.641 12.697  6.254  1.00 41.22 ? 488 ARG A CA  1 
ATOM   222  C  C   . ARG A 1 33  ? 14.372 12.969  7.552  1.00 40.72 ? 488 ARG A C   1 
ATOM   223  O  O   . ARG A 1 33  ? 15.522 13.396  7.519  1.00 40.51 ? 488 ARG A O   1 
ATOM   224  C  CB  . ARG A 1 33  ? 14.000 11.291  5.760  1.00 41.73 ? 488 ARG A CB  1 
ATOM   225  C  CG  . ARG A 1 33  ? 13.114 10.238  6.399  1.00 44.47 ? 488 ARG A CG  1 
ATOM   226  C  CD  . ARG A 1 33  ? 13.264 8.899   5.779  1.00 46.74 ? 488 ARG A CD  1 
ATOM   227  N  NE  . ARG A 1 33  ? 12.728 8.760   4.419  1.00 44.10 ? 488 ARG A NE  1 
ATOM   228  C  CZ  . ARG A 1 33  ? 11.505 8.335   4.134  1.00 44.57 ? 488 ARG A CZ  1 
ATOM   229  N  NH1 . ARG A 1 33  ? 10.619 8.084   5.095  1.00 45.90 ? 488 ARG A NH1 1 
ATOM   230  N  NH2 . ARG A 1 33  ? 11.159 8.207   2.875  1.00 45.61 ? 488 ARG A NH2 1 
ATOM   231  N  N   . ASN A 1 34  ? 13.710 12.726  8.682  1.00 40.45 ? 489 ASN A N   1 
ATOM   232  C  CA  . ASN A 1 34  ? 14.351 12.833  10.004 1.00 41.06 ? 489 ASN A CA  1 
ATOM   233  C  C   . ASN A 1 34  ? 15.050 11.562  10.422 1.00 40.45 ? 489 ASN A C   1 
ATOM   234  O  O   . ASN A 1 34  ? 14.500 10.488  10.229 1.00 39.56 ? 489 ASN A O   1 
ATOM   235  C  CB  . ASN A 1 34  ? 13.320 13.175  11.057 1.00 41.60 ? 489 ASN A CB  1 
ATOM   236  C  CG  . ASN A 1 34  ? 12.730 14.523  10.835 1.00 44.86 ? 489 ASN A CG  1 
ATOM   237  O  OD1 . ASN A 1 34  ? 13.363 15.384  10.205 1.00 47.54 ? 489 ASN A OD1 1 
ATOM   238  N  ND2 . ASN A 1 34  ? 11.502 14.728  11.311 1.00 46.46 ? 489 ASN A ND2 1 
ATOM   239  N  N   . ILE A 1 35  ? 16.245 11.678  11.004 1.00 40.03 ? 490 ILE A N   1 
ATOM   240  C  CA  . ILE A 1 35  ? 16.992 10.474  11.412 1.00 40.11 ? 490 ILE A CA  1 
ATOM   241  C  C   . ILE A 1 35  ? 16.257 9.697   12.525 1.00 40.19 ? 490 ILE A C   1 
ATOM   242  O  O   . ILE A 1 35  ? 16.405 8.467   12.640 1.00 39.61 ? 490 ILE A O   1 
ATOM   243  C  CB  . ILE A 1 35  ? 18.476 10.784  11.775 1.00 40.12 ? 490 ILE A CB  1 
ATOM   244  C  CG1 . ILE A 1 35  ? 19.319 9.524   11.708 1.00 40.47 ? 490 ILE A CG1 1 
ATOM   245  C  CG2 . ILE A 1 35  ? 18.597 11.501  13.145 1.00 41.65 ? 490 ILE A CG2 1 
ATOM   246  C  CD1 . ILE A 1 35  ? 20.843 9.720   11.895 1.00 41.11 ? 490 ILE A CD1 1 
ATOM   247  N  N   . GLU A 1 36  ? 15.461 10.422  13.318 1.00 39.70 ? 491 GLU A N   1 
ATOM   248  C  CA  . GLU A 1 36  ? 14.629 9.846   14.363 1.00 41.06 ? 491 GLU A CA  1 
ATOM   249  C  C   . GLU A 1 36  ? 13.572 8.913   13.800 1.00 41.51 ? 491 GLU A C   1 
ATOM   250  O  O   . GLU A 1 36  ? 13.051 8.072   14.531 1.00 41.86 ? 491 GLU A O   1 
ATOM   251  C  CB  . GLU A 1 36  ? 13.899 10.937  15.182 1.00 41.04 ? 491 GLU A CB  1 
ATOM   252  C  CG  . GLU A 1 36  ? 14.827 11.899  15.914 1.00 43.16 ? 491 GLU A CG  1 
ATOM   253  C  CD  . GLU A 1 36  ? 15.310 13.103  15.056 1.00 47.67 ? 491 GLU A CD  1 
ATOM   254  O  OE1 . GLU A 1 36  ? 15.039 13.201  13.816 1.00 44.99 ? 491 GLU A OE1 1 
ATOM   255  O  OE2 . GLU A 1 36  ? 15.957 13.984  15.668 1.00 50.38 ? 491 GLU A OE2 1 
ATOM   256  N  N   . ASP A 1 37  ? 13.236 9.084   12.521 1.00 41.02 ? 492 ASP A N   1 
ATOM   257  C  CA  . ASP A 1 37  ? 12.171 8.306   11.895 1.00 41.58 ? 492 ASP A CA  1 
ATOM   258  C  C   . ASP A 1 37  ? 12.658 7.074   11.113 1.00 41.09 ? 492 ASP A C   1 
ATOM   259  O  O   . ASP A 1 37  ? 11.872 6.421   10.439 1.00 40.84 ? 492 ASP A O   1 
ATOM   260  C  CB  . ASP A 1 37  ? 11.332 9.219   10.972 1.00 42.66 ? 492 ASP A CB  1 
ATOM   261  C  CG  . ASP A 1 37  ? 10.588 10.310  11.743 1.00 44.69 ? 492 ASP A CG  1 
ATOM   262  O  OD1 . ASP A 1 37  ? 10.154 10.070  12.886 1.00 46.22 ? 492 ASP A OD1 1 
ATOM   263  O  OD2 . ASP A 1 37  ? 10.441 11.415  11.206 1.00 50.74 ? 492 ASP A OD2 1 
ATOM   264  N  N   . ILE A 1 38  ? 13.944 6.753   11.194 1.00 40.51 ? 493 ILE A N   1 
ATOM   265  C  CA  . ILE A 1 38  ? 14.449 5.554   10.549 1.00 40.81 ? 493 ILE A CA  1 
ATOM   266  C  C   . ILE A 1 38  ? 15.210 4.747   11.582 1.00 40.64 ? 493 ILE A C   1 
ATOM   267  O  O   . ILE A 1 38  ? 15.728 5.307   12.555 1.00 40.86 ? 493 ILE A O   1 
ATOM   268  C  CB  . ILE A 1 38  ? 15.385 5.887   9.335  1.00 40.81 ? 493 ILE A CB  1 
ATOM   269  C  CG1 . ILE A 1 38  ? 16.739 6.408   9.803  1.00 42.08 ? 493 ILE A CG1 1 
ATOM   270  C  CG2 . ILE A 1 38  ? 14.764 6.962   8.429  1.00 39.87 ? 493 ILE A CG2 1 
ATOM   271  C  CD1 . ILE A 1 38  ? 17.831 6.549   8.661  1.00 43.25 ? 493 ILE A CD1 1 
ATOM   272  N  N   . CYS A 1 39  ? 15.287 3.433   11.375 1.00 39.94 ? 494 CYS A N   1 
ATOM   273  C  CA  . CYS A 1 39  ? 16.154 2.593   12.156 1.00 39.13 ? 494 CYS A CA  1 
ATOM   274  C  C   . CYS A 1 39  ? 17.593 2.840   11.688 1.00 39.73 ? 494 CYS A C   1 
ATOM   275  O  O   . CYS A 1 39  ? 17.957 2.495   10.567 1.00 38.95 ? 494 CYS A O   1 
ATOM   276  C  CB  . CYS A 1 39  ? 15.762 1.123   12.022 1.00 38.32 ? 494 CYS A CB  1 
ATOM   277  S  SG  . CYS A 1 39  ? 16.812 0.036   13.015 1.00 38.72 ? 494 CYS A SG  1 
ATOM   278  N  N   . ILE A 1 40  ? 18.421 3.446   12.551 1.00 41.01 ? 495 ILE A N   1 
ATOM   279  C  CA  . ILE A 1 40  ? 19.781 3.785   12.136 1.00 41.74 ? 495 ILE A CA  1 
ATOM   280  C  C   . ILE A 1 40  ? 20.647 2.525   11.990 1.00 41.61 ? 495 ILE A C   1 
ATOM   281  O  O   . ILE A 1 40  ? 21.757 2.567   11.408 1.00 41.55 ? 495 ILE A O   1 
ATOM   282  C  CB  . ILE A 1 40  ? 20.456 4.828   13.079 1.00 42.79 ? 495 ILE A CB  1 
ATOM   283  C  CG1 . ILE A 1 40  ? 20.460 4.351   14.534 1.00 45.00 ? 495 ILE A CG1 1 
ATOM   284  C  CG2 . ILE A 1 40  ? 19.747 6.168   12.958 1.00 42.84 ? 495 ILE A CG2 1 
ATOM   285  C  CD1 . ILE A 1 40  ? 21.543 5.043   15.372 1.00 48.38 ? 495 ILE A CD1 1 
ATOM   286  N  N   . SER A 1 41  ? 20.113 1.407   12.479 1.00 40.75 ? 496 SER A N   1 
ATOM   287  C  CA  A SER A 1 41  ? 20.818 0.145   12.398 0.70 41.49 ? 496 SER A CA  1 
ATOM   288  C  CA  B SER A 1 41  ? 20.790 0.117   12.422 0.30 40.93 ? 496 SER A CA  1 
ATOM   289  C  C   . SER A 1 41  ? 20.550 -0.575  11.076 1.00 41.48 ? 496 SER A C   1 
ATOM   290  O  O   . SER A 1 41  ? 21.477 -1.020  10.447 1.00 42.28 ? 496 SER A O   1 
ATOM   291  C  CB  A SER A 1 41  ? 20.459 -0.753  13.586 0.70 41.78 ? 496 SER A CB  1 
ATOM   292  C  CB  B SER A 1 41  ? 20.334 -0.793  13.580 0.30 40.87 ? 496 SER A CB  1 
ATOM   293  O  OG  A SER A 1 41  ? 20.815 -2.085  13.283 0.70 44.20 ? 496 SER A OG  1 
ATOM   294  O  OG  B SER A 1 41  ? 20.649 -0.255  14.855 0.30 39.02 ? 496 SER A OG  1 
ATOM   295  N  N   . CYS A 1 42  ? 19.285 -0.691  10.636 1.00 41.21 ? 497 CYS A N   1 
ATOM   296  C  CA  . CYS A 1 42  ? 19.028 -1.415  9.378  1.00 40.70 ? 497 CYS A CA  1 
ATOM   297  C  C   . CYS A 1 42  ? 18.288 -0.609  8.303  1.00 41.24 ? 497 CYS A C   1 
ATOM   298  O  O   . CYS A 1 42  ? 18.161 -1.077  7.177  1.00 41.58 ? 497 CYS A O   1 
ATOM   299  C  CB  . CYS A 1 42  ? 18.239 -2.700  9.654  1.00 41.12 ? 497 CYS A CB  1 
ATOM   300  S  SG  . CYS A 1 42  ? 16.487 -2.372  10.054 1.00 39.17 ? 497 CYS A SG  1 
ATOM   301  N  N   . GLY A 1 43  ? 17.785 0.579   8.644  1.00 41.27 ? 498 GLY A N   1 
ATOM   302  C  CA  . GLY A 1 43  ? 17.046 1.407   7.683  1.00 40.63 ? 498 GLY A CA  1 
ATOM   303  C  C   . GLY A 1 43  ? 15.547 1.201   7.646  1.00 40.94 ? 498 GLY A C   1 
ATOM   304  O  O   . GLY A 1 43  ? 14.847 1.863   6.891  1.00 41.97 ? 498 GLY A O   1 
ATOM   305  N  N   . SER A 1 44  ? 15.029 0.288   8.451  1.00 40.90 ? 499 SER A N   1 
ATOM   306  C  CA  . SER A 1 44  ? 13.588 0.073   8.508  1.00 40.53 ? 499 SER A CA  1 
ATOM   307  C  C   . SER A 1 44  ? 12.931 1.370   8.907  1.00 40.87 ? 499 SER A C   1 
ATOM   308  O  O   . SER A 1 44  ? 13.503 2.146   9.706  1.00 39.65 ? 499 SER A O   1 
ATOM   309  C  CB  . SER A 1 44  ? 13.246 -0.987  9.552  1.00 40.92 ? 499 SER A CB  1 
ATOM   310  O  OG  . SER A 1 44  ? 11.855 -1.033  9.795  1.00 41.23 ? 499 SER A OG  1 
ATOM   311  N  N   . LEU A 1 45  ? 11.728 1.585   8.358  1.00 40.62 ? 500 LEU A N   1 
ATOM   312  C  CA  . LEU A 1 45  ? 10.876 2.698   8.719  1.00 40.91 ? 500 LEU A CA  1 
ATOM   313  C  C   . LEU A 1 45  ? 9.903  2.317   9.820  1.00 41.31 ? 500 LEU A C   1 
ATOM   314  O  O   . LEU A 1 45  ? 9.139  3.178   10.301 1.00 41.16 ? 500 LEU A O   1 
ATOM   315  C  CB  . LEU A 1 45  ? 10.102 3.238   7.492  1.00 41.27 ? 500 LEU A CB  1 
ATOM   316  C  CG  . LEU A 1 45  ? 10.932 3.860   6.365  1.00 41.21 ? 500 LEU A CG  1 
ATOM   317  C  CD1 . LEU A 1 45  ? 10.049 4.353   5.196  1.00 40.61 ? 500 LEU A CD1 1 
ATOM   318  C  CD2 . LEU A 1 45  ? 11.851 4.978   6.852  1.00 41.62 ? 500 LEU A CD2 1 
ATOM   319  N  N   . ASN A 1 46  ? 9.906  1.042   10.212 1.00 41.67 ? 501 ASN A N   1 
ATOM   320  C  CA  . ASN A 1 46  ? 9.050  0.597   11.319 1.00 42.74 ? 501 ASN A CA  1 
ATOM   321  C  C   . ASN A 1 46  ? 9.747  0.850   12.659 1.00 42.79 ? 501 ASN A C   1 
ATOM   322  O  O   . ASN A 1 46  ? 10.107 -0.076  13.373 1.00 42.28 ? 501 ASN A O   1 
ATOM   323  C  CB  . ASN A 1 46  ? 8.624  -0.873  11.191 1.00 43.31 ? 501 ASN A CB  1 
ATOM   324  C  CG  . ASN A 1 46  ? 7.510  -1.254  12.188 1.00 45.95 ? 501 ASN A CG  1 
ATOM   325  O  OD1 . ASN A 1 46  ? 6.674  -0.421  12.565 1.00 48.43 ? 501 ASN A OD1 1 
ATOM   326  N  ND2 . ASN A 1 46  ? 7.496  -2.514  12.612 1.00 48.51 ? 501 ASN A ND2 1 
ATOM   327  N  N   . VAL A 1 47  ? 9.936  2.133   12.961 1.00 42.88 ? 502 VAL A N   1 
ATOM   328  C  CA  . VAL A 1 47  ? 10.586 2.589   14.163 1.00 42.64 ? 502 VAL A CA  1 
ATOM   329  C  C   . VAL A 1 47  ? 9.609  2.521   15.328 1.00 42.85 ? 502 VAL A C   1 
ATOM   330  O  O   . VAL A 1 47  ? 8.513  3.092   15.269 1.00 43.25 ? 502 VAL A O   1 
ATOM   331  C  CB  . VAL A 1 47  ? 11.161 4.000   13.950 1.00 42.54 ? 502 VAL A CB  1 
ATOM   332  C  CG1 . VAL A 1 47  ? 11.524 4.670   15.267 1.00 42.02 ? 502 VAL A CG1 1 
ATOM   333  C  CG2 . VAL A 1 47  ? 12.368 3.903   13.073 1.00 42.72 ? 502 VAL A CG2 1 
ATOM   334  N  N   . THR A 1 48  ? 10.005 1.784   16.367 1.00 42.81 ? 503 THR A N   1 
ATOM   335  C  CA  . THR A 1 48  ? 9.174  1.606   17.552 1.00 43.25 ? 503 THR A CA  1 
ATOM   336  C  C   . THR A 1 48  ? 9.901  2.047   18.807 1.00 43.51 ? 503 THR A C   1 
ATOM   337  O  O   . THR A 1 48  ? 9.337  1.969   19.891 1.00 43.83 ? 503 THR A O   1 
ATOM   338  C  CB  . THR A 1 48  ? 8.720  0.139   17.746 1.00 43.40 ? 503 THR A CB  1 
ATOM   339  O  OG1 . THR A 1 48  ? 9.845  -0.747  17.607 1.00 42.95 ? 503 THR A OG1 1 
ATOM   340  C  CG2 . THR A 1 48  ? 7.610  -0.225  16.740 1.00 43.59 ? 503 THR A CG2 1 
ATOM   341  N  N   . LEU A 1 49  ? 11.149 2.491   18.662 1.00 43.12 ? 504 LEU A N   1 
ATOM   342  C  CA  . LEU A 1 49  ? 11.887 3.033   19.799 1.00 43.33 ? 504 LEU A CA  1 
ATOM   343  C  C   . LEU A 1 49  ? 13.048 3.933   19.403 1.00 42.58 ? 504 LEU A C   1 
ATOM   344  O  O   . LEU A 1 49  ? 13.385 4.062   18.244 1.00 42.91 ? 504 LEU A O   1 
ATOM   345  C  CB  . LEU A 1 49  ? 12.294 1.936   20.820 1.00 44.38 ? 504 LEU A CB  1 
ATOM   346  C  CG  . LEU A 1 49  ? 13.105 0.626   20.629 1.00 45.79 ? 504 LEU A CG  1 
ATOM   347  C  CD1 . LEU A 1 49  ? 12.679 -0.273  19.479 1.00 45.39 ? 504 LEU A CD1 1 
ATOM   348  C  CD2 . LEU A 1 49  ? 14.578 0.912   20.543 1.00 48.02 ? 504 LEU A CD2 1 
ATOM   349  N  N   . GLU A 1 50  ? 13.609 4.612   20.383 1.00 42.26 ? 505 GLU A N   1 
ATOM   350  C  CA  . GLU A 1 50  ? 14.751 5.481   20.175 1.00 41.93 ? 505 GLU A CA  1 
ATOM   351  C  C   . GLU A 1 50  ? 16.048 4.701   20.419 1.00 40.77 ? 505 GLU A C   1 
ATOM   352  O  O   . GLU A 1 50  ? 16.170 4.008   21.417 1.00 40.37 ? 505 GLU A O   1 
ATOM   353  C  CB  . GLU A 1 50  ? 14.643 6.665   21.132 1.00 42.19 ? 505 GLU A CB  1 
ATOM   354  C  CG  . GLU A 1 50  ? 13.438 7.551   20.778 1.00 45.25 ? 505 GLU A CG  1 
ATOM   355  C  CD  . GLU A 1 50  ? 13.294 8.727   21.696 1.00 50.03 ? 505 GLU A CD  1 
ATOM   356  O  OE1 . GLU A 1 50  ? 14.151 8.879   22.593 1.00 53.28 ? 505 GLU A OE1 1 
ATOM   357  O  OE2 . GLU A 1 50  ? 12.319 9.496   21.543 1.00 52.88 ? 505 GLU A OE2 1 
ATOM   358  N  N   . HIS A 1 51  ? 17.002 4.805   19.502 1.00 39.43 ? 506 HIS A N   1 
ATOM   359  C  CA  . HIS A 1 51  ? 18.295 4.189   19.704 1.00 38.44 ? 506 HIS A CA  1 
ATOM   360  C  C   . HIS A 1 51  ? 18.876 4.787   20.975 1.00 37.96 ? 506 HIS A C   1 
ATOM   361  O  O   . HIS A 1 51  ? 18.830 6.026   21.128 1.00 38.16 ? 506 HIS A O   1 
ATOM   362  C  CB  . HIS A 1 51  ? 19.220 4.486   18.520 1.00 38.50 ? 506 HIS A CB  1 
ATOM   363  C  CG  . HIS A 1 51  ? 20.431 3.613   18.487 1.00 37.66 ? 506 HIS A CG  1 
ATOM   364  N  ND1 . HIS A 1 51  ? 21.515 3.818   19.312 1.00 39.69 ? 506 HIS A ND1 1 
ATOM   365  C  CD2 . HIS A 1 51  ? 20.722 2.513   17.751 1.00 39.32 ? 506 HIS A CD2 1 
ATOM   366  C  CE1 . HIS A 1 51  ? 22.433 2.894   19.070 1.00 39.74 ? 506 HIS A CE1 1 
ATOM   367  N  NE2 . HIS A 1 51  ? 21.973 2.085   18.132 1.00 39.19 ? 506 HIS A NE2 1 
ATOM   368  N  N   . PRO A 1 52  ? 19.411 3.939   21.896 1.00 36.76 ? 507 PRO A N   1 
ATOM   369  C  CA  . PRO A 1 52  ? 19.870 4.482   23.195 1.00 35.90 ? 507 PRO A CA  1 
ATOM   370  C  C   . PRO A 1 52  ? 21.221 5.240   23.178 1.00 35.49 ? 507 PRO A C   1 
ATOM   371  O  O   . PRO A 1 52  ? 21.510 5.986   24.102 1.00 34.54 ? 507 PRO A O   1 
ATOM   372  C  CB  . PRO A 1 52  ? 19.975 3.228   24.075 1.00 35.41 ? 507 PRO A CB  1 
ATOM   373  C  CG  . PRO A 1 52  ? 20.392 2.155   23.116 1.00 34.82 ? 507 PRO A CG  1 
ATOM   374  C  CD  . PRO A 1 52  ? 19.642 2.482   21.812 1.00 36.40 ? 507 PRO A CD  1 
ATOM   375  N  N   . LEU A 1 53  ? 22.027 5.080   22.134 1.00 35.12 ? 508 LEU A N   1 
ATOM   376  C  CA  . LEU A 1 53  ? 23.361 5.687   22.136 1.00 35.19 ? 508 LEU A CA  1 
ATOM   377  C  C   . LEU A 1 53  ? 23.441 6.920   21.256 1.00 36.02 ? 508 LEU A C   1 
ATOM   378  O  O   . LEU A 1 53  ? 24.151 7.873   21.591 1.00 35.65 ? 508 LEU A O   1 
ATOM   379  C  CB  . LEU A 1 53  ? 24.406 4.692   21.626 1.00 35.22 ? 508 LEU A CB  1 
ATOM   380  C  CG  . LEU A 1 53  ? 24.680 3.447   22.462 1.00 35.09 ? 508 LEU A CG  1 
ATOM   381  C  CD1 . LEU A 1 53  ? 25.850 2.643   21.844 1.00 33.20 ? 508 LEU A CD1 1 
ATOM   382  C  CD2 . LEU A 1 53  ? 24.960 3.859   23.873 1.00 30.60 ? 508 LEU A CD2 1 
ATOM   383  N  N   . PHE A 1 54  ? 22.748 6.861   20.115 1.00 35.82 ? 509 PHE A N   1 
ATOM   384  C  CA  . PHE A 1 54  ? 22.802 7.893   19.108 1.00 37.19 ? 509 PHE A CA  1 
ATOM   385  C  C   . PHE A 1 54  ? 21.410 8.354   18.751 1.00 37.45 ? 509 PHE A C   1 
ATOM   386  O  O   . PHE A 1 54  ? 20.452 7.577   18.807 1.00 38.05 ? 509 PHE A O   1 
ATOM   387  C  CB  . PHE A 1 54  ? 23.507 7.377   17.840 1.00 37.26 ? 509 PHE A CB  1 
ATOM   388  C  CG  . PHE A 1 54  ? 24.913 6.955   18.077 1.00 37.33 ? 509 PHE A CG  1 
ATOM   389  C  CD1 . PHE A 1 54  ? 25.901 7.910   18.306 1.00 38.71 ? 509 PHE A CD1 1 
ATOM   390  C  CD2 . PHE A 1 54  ? 25.256 5.616   18.083 1.00 37.37 ? 509 PHE A CD2 1 
ATOM   391  C  CE1 . PHE A 1 54  ? 27.217 7.531   18.548 1.00 39.35 ? 509 PHE A CE1 1 
ATOM   392  C  CE2 . PHE A 1 54  ? 26.566 5.215   18.343 1.00 37.06 ? 509 PHE A CE2 1 
ATOM   393  C  CZ  . PHE A 1 54  ? 27.548 6.172   18.572 1.00 38.46 ? 509 PHE A CZ  1 
ATOM   394  N  N   . VAL A 1 55  ? 21.305 9.624   18.379 1.00 38.02 ? 510 VAL A N   1 
ATOM   395  C  CA  . VAL A 1 55  ? 20.057 10.171  17.903 1.00 37.91 ? 510 VAL A CA  1 
ATOM   396  C  C   . VAL A 1 55  ? 19.665 9.369   16.651 1.00 38.33 ? 510 VAL A C   1 
ATOM   397  O  O   . VAL A 1 55  ? 20.482 9.170   15.720 1.00 38.68 ? 510 VAL A O   1 
ATOM   398  C  CB  . VAL A 1 55  ? 20.153 11.688  17.648 1.00 38.57 ? 510 VAL A CB  1 
ATOM   399  C  CG1 . VAL A 1 55  ? 18.796 12.257  17.206 1.00 39.23 ? 510 VAL A CG1 1 
ATOM   400  C  CG2 . VAL A 1 55  ? 20.590 12.420  18.924 1.00 37.77 ? 510 VAL A CG2 1 
ATOM   401  N  N   . GLY A 1 56  ? 18.431 8.874   16.657 1.00 37.40 ? 511 GLY A N   1 
ATOM   402  C  CA  . GLY A 1 56  ? 17.905 8.102   15.554 1.00 37.85 ? 511 GLY A CA  1 
ATOM   403  C  C   . GLY A 1 56  ? 16.952 7.069   16.097 1.00 38.29 ? 511 GLY A C   1 
ATOM   404  O  O   . GLY A 1 56  ? 16.912 6.833   17.320 1.00 38.38 ? 511 GLY A O   1 
ATOM   405  N  N   . GLY A 1 57  ? 16.178 6.458   15.208 1.00 38.15 ? 512 GLY A N   1 
ATOM   406  C  CA  . GLY A 1 57  ? 15.224 5.446   15.618 1.00 38.54 ? 512 GLY A CA  1 
ATOM   407  C  C   . GLY A 1 57  ? 15.813 4.046   15.647 1.00 39.16 ? 512 GLY A C   1 
ATOM   408  O  O   . GLY A 1 57  ? 16.959 3.833   15.278 1.00 39.04 ? 512 GLY A O   1 
ATOM   409  N  N   . MET A 1 58  ? 15.016 3.087   16.095 1.00 39.38 ? 513 MET A N   1 
ATOM   410  C  CA  . MET A 1 58  ? 15.439 1.715   16.088 1.00 40.75 ? 513 MET A CA  1 
ATOM   411  C  C   . MET A 1 58  ? 14.199 0.857   15.919 1.00 38.78 ? 513 MET A C   1 
ATOM   412  O  O   . MET A 1 58  ? 13.165 1.186   16.483 1.00 38.35 ? 513 MET A O   1 
ATOM   413  C  CB  . MET A 1 58  ? 16.142 1.392   17.411 1.00 40.51 ? 513 MET A CB  1 
ATOM   414  C  CG  . MET A 1 58  ? 16.888 0.068   17.403 1.00 41.98 ? 513 MET A CG  1 
ATOM   415  S  SD  . MET A 1 58  ? 17.929 -0.119  18.886 1.00 46.22 ? 513 MET A SD  1 
ATOM   416  C  CE  . MET A 1 58  ? 19.293 -0.992  18.137 1.00 43.49 ? 513 MET A CE  1 
ATOM   417  N  N   . CYS A 1 59  ? 14.280 -0.207  15.124 1.00 37.62 ? 514 CYS A N   1 
ATOM   418  C  CA  . CYS A 1 59  ? 13.159 -1.167  15.053 1.00 38.02 ? 514 CYS A CA  1 
ATOM   419  C  C   . CYS A 1 59  ? 13.305 -2.244  16.122 1.00 38.32 ? 514 CYS A C   1 
ATOM   420  O  O   . CYS A 1 59  ? 14.396 -2.427  16.688 1.00 37.16 ? 514 CYS A O   1 
ATOM   421  C  CB  . CYS A 1 59  ? 13.038 -1.808  13.664 1.00 37.57 ? 514 CYS A CB  1 
ATOM   422  S  SG  . CYS A 1 59  ? 14.410 -2.933  13.216 1.00 40.09 ? 514 CYS A SG  1 
ATOM   423  N  N   . GLN A 1 60  ? 12.200 -2.933  16.419 1.00 39.80 ? 515 GLN A N   1 
ATOM   424  C  CA  . GLN A 1 60  ? 12.208 -4.033  17.397 1.00 41.20 ? 515 GLN A CA  1 
ATOM   425  C  C   . GLN A 1 60  ? 13.239 -5.124  17.079 1.00 41.07 ? 515 GLN A C   1 
ATOM   426  O  O   . GLN A 1 60  ? 13.951 -5.539  17.973 1.00 42.59 ? 515 GLN A O   1 
ATOM   427  C  CB  . GLN A 1 60  ? 10.801 -4.640  17.596 1.00 41.56 ? 515 GLN A CB  1 
ATOM   428  C  CG  . GLN A 1 60  ? 10.686 -5.580  18.815 1.00 43.94 ? 515 GLN A CG  1 
ATOM   429  C  CD  . GLN A 1 60  ? 11.041 -4.887  20.131 1.00 48.46 ? 515 GLN A CD  1 
ATOM   430  O  OE1 . GLN A 1 60  ? 10.455 -3.851  20.468 1.00 51.19 ? 515 GLN A OE1 1 
ATOM   431  N  NE2 . GLN A 1 60  ? 12.024 -5.441  20.869 1.00 48.25 ? 515 GLN A NE2 1 
ATOM   432  N  N   . ASN A 1 61  ? 13.328 -5.561  15.822 1.00 41.10 ? 516 ASN A N   1 
ATOM   433  C  CA  A ASN A 1 61  ? 14.291 -6.595  15.422 0.70 41.21 ? 516 ASN A CA  1 
ATOM   434  C  CA  B ASN A 1 61  ? 14.273 -6.597  15.408 0.30 40.70 ? 516 ASN A CA  1 
ATOM   435  C  C   . ASN A 1 61  ? 15.720 -6.193  15.681 1.00 40.96 ? 516 ASN A C   1 
ATOM   436  O  O   . ASN A 1 61  ? 16.541 -7.017  16.086 1.00 41.70 ? 516 ASN A O   1 
ATOM   437  C  CB  A ASN A 1 61  ? 14.181 -6.927  13.936 0.70 41.88 ? 516 ASN A CB  1 
ATOM   438  C  CB  B ASN A 1 61  ? 14.084 -6.933  13.918 0.30 40.58 ? 516 ASN A CB  1 
ATOM   439  C  CG  A ASN A 1 61  ? 15.365 -7.762  13.444 0.70 44.36 ? 516 ASN A CG  1 
ATOM   440  C  CG  B ASN A 1 61  ? 12.807 -7.739  13.637 0.30 39.87 ? 516 ASN A CG  1 
ATOM   441  O  OD1 A ASN A 1 61  ? 15.521 -8.935  13.835 0.70 46.70 ? 516 ASN A OD1 1 
ATOM   442  O  OD1 B ASN A 1 61  ? 12.307 -8.467  14.499 0.30 38.30 ? 516 ASN A OD1 1 
ATOM   443  N  ND2 A ASN A 1 61  ? 16.225 -7.151  12.613 0.70 44.36 ? 516 ASN A ND2 1 
ATOM   444  N  ND2 B ASN A 1 61  ? 12.288 -7.615  12.418 0.30 37.65 ? 516 ASN A ND2 1 
ATOM   445  N  N   . CYS A 1 62  ? 16.039 -4.929  15.428 1.00 40.73 ? 517 CYS A N   1 
ATOM   446  C  CA  . CYS A 1 62  ? 17.373 -4.447  15.716 1.00 40.30 ? 517 CYS A CA  1 
ATOM   447  C  C   . CYS A 1 62  ? 17.594 -4.344  17.197 1.00 40.20 ? 517 CYS A C   1 
ATOM   448  O  O   . CYS A 1 62  ? 18.678 -4.692  17.681 1.00 40.20 ? 517 CYS A O   1 
ATOM   449  C  CB  . CYS A 1 62  ? 17.665 -3.145  15.011 1.00 39.31 ? 517 CYS A CB  1 
ATOM   450  S  SG  . CYS A 1 62  ? 18.030 -3.499  13.283 1.00 40.95 ? 517 CYS A SG  1 
ATOM   451  N  N   . LYS A 1 63  ? 16.570 -3.923  17.930 1.00 40.57 ? 518 LYS A N   1 
ATOM   452  C  CA  . LYS A 1 63  ? 16.694 -3.903  19.386 1.00 41.70 ? 518 LYS A CA  1 
ATOM   453  C  C   . LYS A 1 63  ? 17.077 -5.307  19.874 1.00 41.87 ? 518 LYS A C   1 
ATOM   454  O  O   . LYS A 1 63  ? 18.038 -5.462  20.624 1.00 41.86 ? 518 LYS A O   1 
ATOM   455  C  CB  . LYS A 1 63  ? 15.435 -3.395  20.096 1.00 40.92 ? 518 LYS A CB  1 
ATOM   456  C  CG  . LYS A 1 63  ? 15.478 -3.694  21.609 1.00 42.48 ? 518 LYS A CG  1 
ATOM   457  C  CD  . LYS A 1 63  ? 14.402 -2.993  22.407 1.00 42.38 ? 518 LYS A CD  1 
ATOM   458  C  CE  . LYS A 1 63  ? 14.554 -3.379  23.886 1.00 45.77 ? 518 LYS A CE  1 
ATOM   459  N  NZ  . LYS A 1 63  ? 13.807 -2.487  24.798 1.00 47.16 ? 518 LYS A NZ  1 
ATOM   460  N  N   . ASN A 1 64  ? 16.355 -6.324  19.402 1.00 42.40 ? 519 ASN A N   1 
ATOM   461  C  CA  . ASN A 1 64  ? 16.666 -7.710  19.763 1.00 42.77 ? 519 ASN A CA  1 
ATOM   462  C  C   . ASN A 1 64  ? 18.102 -8.123  19.465 1.00 43.08 ? 519 ASN A C   1 
ATOM   463  O  O   . ASN A 1 64  ? 18.717 -8.780  20.298 1.00 42.74 ? 519 ASN A O   1 
ATOM   464  C  CB  . ASN A 1 64  ? 15.689 -8.683  19.113 1.00 42.80 ? 519 ASN A CB  1 
ATOM   465  C  CG  . ASN A 1 64  ? 14.267 -8.535  19.653 1.00 44.14 ? 519 ASN A CG  1 
ATOM   466  O  OD1 . ASN A 1 64  ? 13.286 -8.873  18.976 1.00 43.22 ? 519 ASN A OD1 1 
ATOM   467  N  ND2 . ASN A 1 64  ? 14.152 -8.011  20.867 1.00 42.73 ? 519 ASN A ND2 1 
ATOM   468  N  N   . CYS A 1 65  ? 18.631 -7.765  18.287 1.00 43.47 ? 520 CYS A N   1 
ATOM   469  C  CA  . CYS A 1 65  ? 20.047 -8.052  17.972 1.00 44.79 ? 520 CYS A CA  1 
ATOM   470  C  C   . CYS A 1 65  ? 21.001 -7.357  18.922 1.00 44.32 ? 520 CYS A C   1 
ATOM   471  O  O   . CYS A 1 65  ? 21.972 -7.956  19.364 1.00 43.97 ? 520 CYS A O   1 
ATOM   472  C  CB  . CYS A 1 65  ? 20.410 -7.637  16.545 1.00 44.81 ? 520 CYS A CB  1 
ATOM   473  S  SG  . CYS A 1 65  ? 19.582 -8.683  15.396 1.00 51.24 ? 520 CYS A SG  1 
ATOM   474  N  N   . PHE A 1 66  ? 20.733 -6.081  19.192 1.00 44.91 ? 521 PHE A N   1 
ATOM   475  C  CA  . PHE A 1 66  ? 21.575 -5.258  20.057 1.00 45.48 ? 521 PHE A CA  1 
ATOM   476  C  C   . PHE A 1 66  ? 21.717 -5.908  21.434 1.00 45.20 ? 521 PHE A C   1 
ATOM   477  O  O   . PHE A 1 66  ? 22.823 -5.995  21.975 1.00 44.77 ? 521 PHE A O   1 
ATOM   478  C  CB  . PHE A 1 66  ? 20.965 -3.859  20.184 1.00 46.59 ? 521 PHE A CB  1 
ATOM   479  C  CG  . PHE A 1 66  ? 21.912 -2.793  20.735 1.00 48.50 ? 521 PHE A CG  1 
ATOM   480  C  CD1 . PHE A 1 66  ? 22.798 -2.109  19.890 1.00 50.79 ? 521 PHE A CD1 1 
ATOM   481  C  CD2 . PHE A 1 66  ? 21.880 -2.440  22.075 1.00 50.85 ? 521 PHE A CD2 1 
ATOM   482  C  CE1 . PHE A 1 66  ? 23.642 -1.104  20.379 1.00 51.81 ? 521 PHE A CE1 1 
ATOM   483  C  CE2 . PHE A 1 66  ? 22.731 -1.433  22.580 1.00 52.69 ? 521 PHE A CE2 1 
ATOM   484  C  CZ  . PHE A 1 66  ? 23.603 -0.764  21.732 1.00 51.99 ? 521 PHE A CZ  1 
ATOM   485  N  N   . LEU A 1 67  ? 20.595 -6.371  21.987 1.00 44.84 ? 522 LEU A N   1 
ATOM   486  C  CA  . LEU A 1 67  ? 20.590 -7.033  23.290 1.00 44.68 ? 522 LEU A CA  1 
ATOM   487  C  C   . LEU A 1 67  ? 21.494 -8.270  23.303 1.00 44.94 ? 522 LEU A C   1 
ATOM   488  O  O   . LEU A 1 67  ? 22.167 -8.527  24.290 1.00 44.98 ? 522 LEU A O   1 
ATOM   489  C  CB  . LEU A 1 67  ? 19.168 -7.416  23.686 1.00 44.50 ? 522 LEU A CB  1 
ATOM   490  C  CG  . LEU A 1 67  ? 18.181 -6.288  24.017 1.00 45.23 ? 522 LEU A CG  1 
ATOM   491  C  CD1 . LEU A 1 67  ? 16.792 -6.853  24.156 1.00 44.91 ? 522 LEU A CD1 1 
ATOM   492  C  CD2 . LEU A 1 67  ? 18.571 -5.536  25.292 1.00 46.16 ? 522 LEU A CD2 1 
ATOM   493  N  N   . GLU A 1 68  ? 21.495 -9.033  22.212 1.00 45.11 ? 523 GLU A N   1 
ATOM   494  C  CA  . GLU A 1 68  ? 22.335 -10.223 22.090 1.00 45.14 ? 523 GLU A CA  1 
ATOM   495  C  C   . GLU A 1 68  ? 23.782 -9.833  21.855 1.00 43.85 ? 523 GLU A C   1 
ATOM   496  O  O   . GLU A 1 68  ? 24.663 -10.296 22.557 1.00 41.95 ? 523 GLU A O   1 
ATOM   497  C  CB  . GLU A 1 68  ? 21.829 -11.123 20.970 1.00 45.59 ? 523 GLU A CB  1 
ATOM   498  C  CG  . GLU A 1 68  ? 20.392 -11.551 21.211 1.00 51.41 ? 523 GLU A CG  1 
ATOM   499  C  CD  . GLU A 1 68  ? 19.772 -12.319 20.052 1.00 58.44 ? 523 GLU A CD  1 
ATOM   500  O  OE1 . GLU A 1 68  ? 20.532 -12.954 19.293 1.00 62.45 ? 523 GLU A OE1 1 
ATOM   501  O  OE2 . GLU A 1 68  ? 18.522 -12.307 19.920 1.00 61.24 ? 523 GLU A OE2 1 
ATOM   502  N  N   . CYS A 1 69  ? 24.010 -8.949  20.884 1.00 44.00 ? 524 CYS A N   1 
ATOM   503  C  CA  . CYS A 1 69  ? 25.360 -8.544  20.515 1.00 44.53 ? 524 CYS A CA  1 
ATOM   504  C  C   . CYS A 1 69  ? 26.132 -7.878  21.626 1.00 42.93 ? 524 CYS A C   1 
ATOM   505  O  O   . CYS A 1 69  ? 27.336 -7.959  21.632 1.00 42.96 ? 524 CYS A O   1 
ATOM   506  C  CB  . CYS A 1 69  ? 25.358 -7.663  19.264 1.00 44.66 ? 524 CYS A CB  1 
ATOM   507  S  SG  . CYS A 1 69  ? 24.996 -8.742  17.849 1.00 54.29 ? 524 CYS A SG  1 
ATOM   508  N  N   . ALA A 1 70  ? 25.438 -7.233  22.559 1.00 41.47 ? 525 ALA A N   1 
ATOM   509  C  CA  . ALA A 1 70  ? 26.107 -6.594  23.676 1.00 41.10 ? 525 ALA A CA  1 
ATOM   510  C  C   . ALA A 1 70  ? 26.969 -7.587  24.470 1.00 40.31 ? 525 ALA A C   1 
ATOM   511  O  O   . ALA A 1 70  ? 27.922 -7.168  25.113 1.00 40.79 ? 525 ALA A O   1 
ATOM   512  C  CB  . ALA A 1 70  ? 25.072 -5.914  24.603 1.00 40.87 ? 525 ALA A CB  1 
ATOM   513  N  N   . TYR A 1 71  ? 26.605 -8.880  24.451 1.00 38.77 ? 526 TYR A N   1 
ATOM   514  C  CA  . TYR A 1 71  ? 27.264 -9.915  25.265 1.00 37.53 ? 526 TYR A CA  1 
ATOM   515  C  C   . TYR A 1 71  ? 28.192 -10.787 24.435 1.00 37.22 ? 526 TYR A C   1 
ATOM   516  O  O   . TYR A 1 71  ? 28.736 -11.755 24.942 1.00 36.23 ? 526 TYR A O   1 
ATOM   517  C  CB  . TYR A 1 71  ? 26.235 -10.763 26.035 1.00 37.04 ? 526 TYR A CB  1 
ATOM   518  C  CG  . TYR A 1 71  ? 25.459 -9.899  26.980 1.00 36.51 ? 526 TYR A CG  1 
ATOM   519  C  CD1 . TYR A 1 71  ? 24.269 -9.325  26.583 1.00 34.82 ? 526 TYR A CD1 1 
ATOM   520  C  CD2 . TYR A 1 71  ? 25.958 -9.596  28.252 1.00 35.47 ? 526 TYR A CD2 1 
ATOM   521  C  CE1 . TYR A 1 71  ? 23.567 -8.480  27.418 1.00 34.94 ? 526 TYR A CE1 1 
ATOM   522  C  CE2 . TYR A 1 71  ? 25.283 -8.736  29.092 1.00 35.48 ? 526 TYR A CE2 1 
ATOM   523  C  CZ  . TYR A 1 71  ? 24.082 -8.183  28.665 1.00 36.76 ? 526 TYR A CZ  1 
ATOM   524  O  OH  . TYR A 1 71  ? 23.379 -7.331  29.484 1.00 36.74 ? 526 TYR A OH  1 
ATOM   525  N  N   . GLN A 1 72  ? 28.384 -10.412 23.168 1.00 37.38 ? 527 GLN A N   1 
ATOM   526  C  CA  . GLN A 1 72  ? 29.230 -11.179 22.253 1.00 38.87 ? 527 GLN A CA  1 
ATOM   527  C  C   . GLN A 1 72  ? 30.579 -10.501 22.095 1.00 38.56 ? 527 GLN A C   1 
ATOM   528  O  O   . GLN A 1 72  ? 30.697 -9.435  21.445 1.00 38.57 ? 527 GLN A O   1 
ATOM   529  C  CB  . GLN A 1 72  ? 28.572 -11.338 20.870 1.00 37.88 ? 527 GLN A CB  1 
ATOM   530  C  CG  . GLN A 1 72  ? 27.320 -12.157 20.858 1.00 40.00 ? 527 GLN A CG  1 
ATOM   531  C  CD  . GLN A 1 72  ? 26.763 -12.377 19.446 1.00 42.91 ? 527 GLN A CD  1 
ATOM   532  O  OE1 . GLN A 1 72  ? 26.660 -11.449 18.641 1.00 50.38 ? 527 GLN A OE1 1 
ATOM   533  N  NE2 . GLN A 1 72  ? 26.394 -13.615 19.149 1.00 48.72 ? 527 GLN A NE2 1 
ATOM   534  N  N   . TYR A 1 73  ? 31.591 -11.131 22.670 1.00 38.64 ? 528 TYR A N   1 
ATOM   535  C  CA  . TYR A 1 73  ? 32.963 -10.635 22.615 1.00 39.35 ? 528 TYR A CA  1 
ATOM   536  C  C   . TYR A 1 73  ? 33.875 -11.626 21.925 1.00 40.13 ? 528 TYR A C   1 
ATOM   537  O  O   . TYR A 1 73  ? 33.641 -12.829 21.991 1.00 39.49 ? 528 TYR A O   1 
ATOM   538  C  CB  . TYR A 1 73  ? 33.470 -10.384 24.033 1.00 39.45 ? 528 TYR A CB  1 
ATOM   539  C  CG  . TYR A 1 73  ? 32.911 -9.121  24.597 1.00 38.89 ? 528 TYR A CG  1 
ATOM   540  C  CD1 . TYR A 1 73  ? 31.605 -9.059  25.072 1.00 37.76 ? 528 TYR A CD1 1 
ATOM   541  C  CD2 . TYR A 1 73  ? 33.678 -7.977  24.635 1.00 39.73 ? 528 TYR A CD2 1 
ATOM   542  C  CE1 . TYR A 1 73  ? 31.083 -7.871  25.575 1.00 40.32 ? 528 TYR A CE1 1 
ATOM   543  C  CE2 . TYR A 1 73  ? 33.166 -6.781  25.116 1.00 41.00 ? 528 TYR A CE2 1 
ATOM   544  C  CZ  . TYR A 1 73  ? 31.886 -6.738  25.595 1.00 40.83 ? 528 TYR A CZ  1 
ATOM   545  O  OH  . TYR A 1 73  ? 31.426 -5.548  26.089 1.00 43.08 ? 528 TYR A OH  1 
ATOM   546  N  N   . ASP A 1 74  ? 34.916 -11.118 21.269 1.00 41.07 ? 529 ASP A N   1 
ATOM   547  C  CA  . ASP A 1 74  ? 35.957 -11.974 20.681 1.00 41.83 ? 529 ASP A CA  1 
ATOM   548  C  C   . ASP A 1 74  ? 37.071 -12.245 21.697 1.00 42.24 ? 529 ASP A C   1 
ATOM   549  O  O   . ASP A 1 74  ? 37.091 -11.653 22.773 1.00 41.59 ? 529 ASP A O   1 
ATOM   550  C  CB  . ASP A 1 74  ? 36.521 -11.328 19.408 1.00 42.00 ? 529 ASP A CB  1 
ATOM   551  C  CG  . ASP A 1 74  ? 35.518 -11.323 18.255 1.00 43.56 ? 529 ASP A CG  1 
ATOM   552  O  OD1 . ASP A 1 74  ? 34.569 -12.154 18.245 1.00 45.36 ? 529 ASP A OD1 1 
ATOM   553  O  OD2 . ASP A 1 74  ? 35.676 -10.483 17.350 1.00 43.62 ? 529 ASP A OD2 1 
ATOM   554  N  N   . ASP A 1 75  ? 37.998 -13.143 21.373 1.00 43.46 ? 530 ASP A N   1 
ATOM   555  C  CA  . ASP A 1 75  ? 39.035 -13.488 22.355 1.00 44.63 ? 530 ASP A CA  1 
ATOM   556  C  C   . ASP A 1 75  ? 40.051 -12.347 22.554 1.00 44.26 ? 530 ASP A C   1 
ATOM   557  O  O   . ASP A 1 75  ? 40.855 -12.379 23.482 1.00 43.77 ? 530 ASP A O   1 
ATOM   558  C  CB  . ASP A 1 75  ? 39.692 -14.849 22.067 1.00 45.13 ? 530 ASP A CB  1 
ATOM   559  C  CG  . ASP A 1 75  ? 40.396 -14.899 20.724 1.00 48.17 ? 530 ASP A CG  1 
ATOM   560  O  OD1 . ASP A 1 75  ? 40.481 -13.865 20.020 1.00 51.61 ? 530 ASP A OD1 1 
ATOM   561  O  OD2 . ASP A 1 75  ? 40.883 -15.995 20.366 1.00 52.61 ? 530 ASP A OD2 1 
ATOM   562  N  N   . ASP A 1 76  ? 39.954 -11.317 21.711 1.00 43.87 ? 531 ASP A N   1 
ATOM   563  C  CA  . ASP A 1 76  ? 40.735 -10.098 21.882 1.00 43.46 ? 531 ASP A CA  1 
ATOM   564  C  C   . ASP A 1 76  ? 40.177 -9.151  22.963 1.00 43.20 ? 531 ASP A C   1 
ATOM   565  O  O   . ASP A 1 76  ? 40.732 -8.071  23.177 1.00 43.69 ? 531 ASP A O   1 
ATOM   566  C  CB  . ASP A 1 76  ? 40.875 -9.363  20.546 1.00 43.44 ? 531 ASP A CB  1 
ATOM   567  C  CG  . ASP A 1 76  ? 39.534 -8.864  19.987 1.00 44.67 ? 531 ASP A CG  1 
ATOM   568  O  OD1 . ASP A 1 76  ? 38.489 -8.950  20.675 1.00 46.84 ? 531 ASP A OD1 1 
ATOM   569  O  OD2 . ASP A 1 76  ? 39.524 -8.377  18.838 1.00 46.01 ? 531 ASP A OD2 1 
ATOM   570  N  N   . GLY A 1 77  ? 39.086 -9.544  23.627 1.00 42.51 ? 532 GLY A N   1 
ATOM   571  C  CA  . GLY A 1 77  ? 38.449 -8.709  24.659 1.00 41.84 ? 532 GLY A CA  1 
ATOM   572  C  C   . GLY A 1 77  ? 37.503 -7.626  24.128 1.00 41.92 ? 532 GLY A C   1 
ATOM   573  O  O   . GLY A 1 77  ? 36.843 -6.932  24.919 1.00 41.54 ? 532 GLY A O   1 
ATOM   574  N  N   . TYR A 1 78  ? 37.426 -7.494  22.797 1.00 41.23 ? 533 TYR A N   1 
ATOM   575  C  CA  . TYR A 1 78  ? 36.553 -6.511  22.129 1.00 40.96 ? 533 TYR A CA  1 
ATOM   576  C  C   . TYR A 1 78  ? 35.226 -7.121  21.667 1.00 40.55 ? 533 TYR A C   1 
ATOM   577  O  O   . TYR A 1 78  ? 35.122 -8.332  21.457 1.00 41.30 ? 533 TYR A O   1 
ATOM   578  C  CB  . TYR A 1 78  ? 37.285 -5.856  20.932 1.00 41.18 ? 533 TYR A CB  1 
ATOM   579  C  CG  . TYR A 1 78  ? 38.194 -4.706  21.330 1.00 41.54 ? 533 TYR A CG  1 
ATOM   580  C  CD1 . TYR A 1 78  ? 37.834 -3.391  21.059 1.00 42.98 ? 533 TYR A CD1 1 
ATOM   581  C  CD2 . TYR A 1 78  ? 39.397 -4.937  21.999 1.00 43.72 ? 533 TYR A CD2 1 
ATOM   582  C  CE1 . TYR A 1 78  ? 38.642 -2.332  21.434 1.00 42.66 ? 533 TYR A CE1 1 
ATOM   583  C  CE2 . TYR A 1 78  ? 40.224 -3.883  22.384 1.00 44.23 ? 533 TYR A CE2 1 
ATOM   584  C  CZ  . TYR A 1 78  ? 39.831 -2.585  22.101 1.00 43.97 ? 533 TYR A CZ  1 
ATOM   585  O  OH  . TYR A 1 78  ? 40.634 -1.534  22.478 1.00 44.83 ? 533 TYR A OH  1 
ATOM   586  N  N   . GLN A 1 79  ? 34.216 -6.277  21.515 1.00 40.06 ? 534 GLN A N   1 
ATOM   587  C  CA  . GLN A 1 79  ? 32.916 -6.688  21.001 1.00 40.40 ? 534 GLN A CA  1 
ATOM   588  C  C   . GLN A 1 79  ? 33.034 -7.307  19.622 1.00 39.84 ? 534 GLN A C   1 
ATOM   589  O  O   . GLN A 1 79  ? 33.868 -6.874  18.791 1.00 38.45 ? 534 GLN A O   1 
ATOM   590  C  CB  . GLN A 1 79  ? 31.921 -5.506  21.000 1.00 39.84 ? 534 GLN A CB  1 
ATOM   591  C  CG  . GLN A 1 79  ? 31.310 -5.357  22.419 1.00 41.90 ? 534 GLN A CG  1 
ATOM   592  C  CD  . GLN A 1 79  ? 30.113 -4.454  22.549 1.00 43.81 ? 534 GLN A CD  1 
ATOM   593  O  OE1 . GLN A 1 79  ? 29.493 -4.399  23.633 1.00 51.45 ? 534 GLN A OE1 1 
ATOM   594  N  NE2 . GLN A 1 79  ? 29.761 -3.739  21.479 1.00 44.95 ? 534 GLN A NE2 1 
ATOM   595  N  N   . SER A 1 80  ? 32.202 -8.317  19.380 1.00 38.86 ? 535 SER A N   1 
ATOM   596  C  CA  . SER A 1 80  ? 32.324 -9.078  18.160 1.00 38.83 ? 535 SER A CA  1 
ATOM   597  C  C   . SER A 1 80  ? 31.856 -8.252  16.975 1.00 39.73 ? 535 SER A C   1 
ATOM   598  O  O   . SER A 1 80  ? 32.415 -8.375  15.889 1.00 39.59 ? 535 SER A O   1 
ATOM   599  C  CB  . SER A 1 80  ? 31.557 -10.376 18.267 1.00 38.74 ? 535 SER A CB  1 
ATOM   600  O  OG  . SER A 1 80  ? 32.164 -11.221 19.256 1.00 39.98 ? 535 SER A OG  1 
ATOM   601  N  N   . TYR A 1 81  ? 30.862 -7.384  17.197 1.00 39.37 ? 536 TYR A N   1 
ATOM   602  C  CA  . TYR A 1 81  ? 30.197 -6.705  16.101 1.00 39.52 ? 536 TYR A CA  1 
ATOM   603  C  C   . TYR A 1 81  ? 30.061 -5.203  16.295 1.00 38.81 ? 536 TYR A C   1 
ATOM   604  O  O   . TYR A 1 81  ? 30.287 -4.674  17.394 1.00 37.55 ? 536 TYR A O   1 
ATOM   605  C  CB  . TYR A 1 81  ? 28.817 -7.340  15.837 1.00 40.62 ? 536 TYR A CB  1 
ATOM   606  C  CG  . TYR A 1 81  ? 28.926 -8.795  15.493 1.00 41.55 ? 536 TYR A CG  1 
ATOM   607  C  CD1 . TYR A 1 81  ? 29.439 -9.194  14.259 1.00 42.45 ? 536 TYR A CD1 1 
ATOM   608  C  CD2 . TYR A 1 81  ? 28.558 -9.773  16.404 1.00 41.61 ? 536 TYR A CD2 1 
ATOM   609  C  CE1 . TYR A 1 81  ? 29.569 -10.510 13.934 1.00 41.37 ? 536 TYR A CE1 1 
ATOM   610  C  CE2 . TYR A 1 81  ? 28.689 -11.109 16.095 1.00 42.72 ? 536 TYR A CE2 1 
ATOM   611  C  CZ  . TYR A 1 81  ? 29.189 -11.470 14.852 1.00 43.33 ? 536 TYR A CZ  1 
ATOM   612  O  OH  . TYR A 1 81  ? 29.325 -12.808 14.526 1.00 45.18 ? 536 TYR A OH  1 
ATOM   613  N  N   . CYS A 1 82  ? 29.698 -4.543  15.199 1.00 38.32 ? 537 CYS A N   1 
ATOM   614  C  CA  . CYS A 1 82  ? 29.446 -3.118  15.153 1.00 38.53 ? 537 CYS A CA  1 
ATOM   615  C  C   . CYS A 1 82  ? 28.416 -2.693  16.190 1.00 38.99 ? 537 CYS A C   1 
ATOM   616  O  O   . CYS A 1 82  ? 27.357 -3.304  16.344 1.00 38.27 ? 537 CYS A O   1 
ATOM   617  C  CB  . CYS A 1 82  ? 28.983 -2.699  13.739 1.00 38.07 ? 537 CYS A CB  1 
ATOM   618  S  SG  . CYS A 1 82  ? 28.594 -0.903  13.534 1.00 39.44 ? 537 CYS A SG  1 
ATOM   619  N  N   . THR A 1 83  ? 28.766 -1.627  16.890 1.00 39.75 ? 538 THR A N   1 
ATOM   620  C  CA  . THR A 1 83  ? 27.921 -0.960  17.874 1.00 41.09 ? 538 THR A CA  1 
ATOM   621  C  C   . THR A 1 83  ? 26.637 -0.420  17.234 1.00 42.50 ? 538 THR A C   1 
ATOM   622  O  O   . THR A 1 83  ? 25.580 -0.435  17.860 1.00 44.30 ? 538 THR A O   1 
ATOM   623  C  CB  . THR A 1 83  ? 28.746 0.169   18.573 1.00 40.42 ? 538 THR A CB  1 
ATOM   624  O  OG1 . THR A 1 83  ? 29.512 -0.414  19.626 1.00 43.15 ? 538 THR A OG1 1 
ATOM   625  C  CG2 . THR A 1 83  ? 27.879 1.241   19.154 1.00 39.01 ? 538 THR A CG2 1 
ATOM   626  N  N   . ILE A 1 84  ? 26.700 0.030   15.986 1.00 42.85 ? 539 ILE A N   1 
ATOM   627  C  CA  . ILE A 1 84  ? 25.509 0.595   15.347 1.00 43.60 ? 539 ILE A CA  1 
ATOM   628  C  C   . ILE A 1 84  ? 24.582 -0.435  14.703 1.00 43.94 ? 539 ILE A C   1 
ATOM   629  O  O   . ILE A 1 84  ? 23.396 -0.384  14.910 1.00 45.50 ? 539 ILE A O   1 
ATOM   630  C  CB  . ILE A 1 84  ? 25.865 1.690   14.298 1.00 43.81 ? 539 ILE A CB  1 
ATOM   631  C  CG1 . ILE A 1 84  ? 26.505 2.895   14.979 1.00 44.09 ? 539 ILE A CG1 1 
ATOM   632  C  CG2 . ILE A 1 84  ? 24.616 2.146   13.533 1.00 42.53 ? 539 ILE A CG2 1 
ATOM   633  C  CD1 . ILE A 1 84  ? 27.444 3.650   14.039 1.00 47.53 ? 539 ILE A CD1 1 
ATOM   634  N  N   . CYS A 1 85  ? 25.112 -1.353  13.916 1.00 44.92 ? 540 CYS A N   1 
ATOM   635  C  CA  . CYS A 1 85  ? 24.277 -2.244  13.120 1.00 44.92 ? 540 CYS A CA  1 
ATOM   636  C  C   . CYS A 1 85  ? 24.299 -3.684  13.600 1.00 45.82 ? 540 CYS A C   1 
ATOM   637  O  O   . CYS A 1 85  ? 23.681 -4.555  12.971 1.00 45.29 ? 540 CYS A O   1 
ATOM   638  C  CB  . CYS A 1 85  ? 24.753 -2.205  11.673 1.00 44.47 ? 540 CYS A CB  1 
ATOM   639  S  SG  . CYS A 1 85  ? 26.353 -3.039  11.326 1.00 44.10 ? 540 CYS A SG  1 
ATOM   640  N  N   . CYS A 1 86  ? 25.053 -3.943  14.679 1.00 45.89 ? 541 CYS A N   1 
ATOM   641  C  CA  . CYS A 1 86  ? 25.229 -5.290  15.229 1.00 46.61 ? 541 CYS A CA  1 
ATOM   642  C  C   . CYS A 1 86  ? 25.737 -6.319  14.260 1.00 45.73 ? 541 CYS A C   1 
ATOM   643  O  O   . CYS A 1 86  ? 25.540 -7.501  14.480 1.00 46.01 ? 541 CYS A O   1 
ATOM   644  C  CB  . CYS A 1 86  ? 23.932 -5.811  15.837 1.00 47.11 ? 541 CYS A CB  1 
ATOM   645  S  SG  . CYS A 1 86  ? 23.183 -4.608  16.879 1.00 52.17 ? 541 CYS A SG  1 
ATOM   646  N  N   . GLY A 1 87  ? 26.393 -5.882  13.198 1.00 45.60 ? 542 GLY A N   1 
ATOM   647  C  CA  . GLY A 1 87  ? 27.031 -6.809  12.272 1.00 44.82 ? 542 GLY A CA  1 
ATOM   648  C  C   . GLY A 1 87  ? 28.302 -6.185  11.762 1.00 44.67 ? 542 GLY A C   1 
ATOM   649  O  O   . GLY A 1 87  ? 29.175 -5.818  12.558 1.00 45.17 ? 542 GLY A O   1 
ATOM   650  N  N   . GLY A 1 88  ? 28.393 -6.044  10.438 1.00 44.30 ? 543 GLY A N   1 
ATOM   651  C  CA  . GLY A 1 88  ? 29.575 -5.537  9.769  1.00 43.51 ? 543 GLY A CA  1 
ATOM   652  C  C   . GLY A 1 88  ? 30.532 -6.628  9.328  1.00 43.73 ? 543 GLY A C   1 
ATOM   653  O  O   . GLY A 1 88  ? 30.542 -7.727  9.895  1.00 44.33 ? 543 GLY A O   1 
ATOM   654  N  N   . ARG A 1 89  ? 31.356 -6.327  8.330  1.00 43.22 ? 544 ARG A N   1 
ATOM   655  C  CA  . ARG A 1 89  ? 32.367 -7.264  7.852  1.00 43.52 ? 544 ARG A CA  1 
ATOM   656  C  C   . ARG A 1 89  ? 33.730 -6.952  8.438  1.00 42.38 ? 544 ARG A C   1 
ATOM   657  O  O   . ARG A 1 89  ? 34.428 -7.827  8.935  1.00 42.40 ? 544 ARG A O   1 
ATOM   658  C  CB  . ARG A 1 89  ? 32.469 -7.194  6.336  1.00 44.16 ? 544 ARG A CB  1 
ATOM   659  C  CG  . ARG A 1 89  ? 31.410 -7.961  5.608  1.00 47.87 ? 544 ARG A CG  1 
ATOM   660  C  CD  . ARG A 1 89  ? 31.981 -8.371  4.253  1.00 54.87 ? 544 ARG A CD  1 
ATOM   661  N  NE  . ARG A 1 89  ? 31.008 -8.274  3.168  1.00 59.19 ? 544 ARG A NE  1 
ATOM   662  C  CZ  . ARG A 1 89  ? 30.276 -7.192  2.904  1.00 62.14 ? 544 ARG A CZ  1 
ATOM   663  N  NH1 . ARG A 1 89  ? 30.368 -6.096  3.666  1.00 62.62 ? 544 ARG A NH1 1 
ATOM   664  N  NH2 . ARG A 1 89  ? 29.432 -7.214  1.877  1.00 64.26 ? 544 ARG A NH2 1 
ATOM   665  N  N   . GLU A 1 90  ? 34.106 -5.689  8.326  1.00 41.66 ? 545 GLU A N   1 
ATOM   666  C  CA  . GLU A 1 90  ? 35.342 -5.168  8.864  1.00 40.78 ? 545 GLU A CA  1 
ATOM   667  C  C   . GLU A 1 90  ? 35.006 -4.069  9.864  1.00 39.54 ? 545 GLU A C   1 
ATOM   668  O  O   . GLU A 1 90  ? 34.222 -3.165  9.561  1.00 38.80 ? 545 GLU A O   1 
ATOM   669  C  CB  . GLU A 1 90  ? 36.208 -4.599  7.734  1.00 40.69 ? 545 GLU A CB  1 
ATOM   670  C  CG  . GLU A 1 90  ? 37.403 -3.803  8.242  1.00 43.36 ? 545 GLU A CG  1 
ATOM   671  C  CD  . GLU A 1 90  ? 38.455 -3.555  7.184  1.00 46.03 ? 545 GLU A CD  1 
ATOM   672  O  OE1 . GLU A 1 90  ? 39.111 -4.525  6.741  1.00 48.10 ? 545 GLU A OE1 1 
ATOM   673  O  OE2 . GLU A 1 90  ? 38.626 -2.381  6.793  1.00 47.36 ? 545 GLU A OE2 1 
ATOM   674  N  N   . VAL A 1 91  ? 35.605 -4.145  11.044 1.00 38.52 ? 546 VAL A N   1 
ATOM   675  C  CA  . VAL A 1 91  ? 35.297 -3.185  12.091 1.00 37.90 ? 546 VAL A CA  1 
ATOM   676  C  C   . VAL A 1 91  ? 36.509 -2.443  12.624 1.00 37.71 ? 546 VAL A C   1 
ATOM   677  O  O   . VAL A 1 91  ? 37.575 -3.025  12.800 1.00 37.35 ? 546 VAL A O   1 
ATOM   678  C  CB  . VAL A 1 91  ? 34.507 -3.838  13.283 1.00 37.94 ? 546 VAL A CB  1 
ATOM   679  C  CG1 . VAL A 1 91  ? 33.150 -4.356  12.819 1.00 36.70 ? 546 VAL A CG1 1 
ATOM   680  C  CG2 . VAL A 1 91  ? 35.316 -4.936  13.979 1.00 36.82 ? 546 VAL A CG2 1 
ATOM   681  N  N   . LEU A 1 92  ? 36.329 -1.154  12.889 1.00 37.90 ? 547 LEU A N   1 
ATOM   682  C  CA  . LEU A 1 92  ? 37.332 -0.374  13.618 1.00 38.37 ? 547 LEU A CA  1 
ATOM   683  C  C   . LEU A 1 92  ? 37.156 -0.581  15.116 1.00 38.18 ? 547 LEU A C   1 
ATOM   684  O  O   . LEU A 1 92  ? 36.035 -0.546  15.632 1.00 38.21 ? 547 LEU A O   1 
ATOM   685  C  CB  . LEU A 1 92  ? 37.232 1.119   13.287 1.00 38.64 ? 547 LEU A CB  1 
ATOM   686  C  CG  . LEU A 1 92  ? 36.902 1.558   11.853 1.00 39.81 ? 547 LEU A CG  1 
ATOM   687  C  CD1 . LEU A 1 92  ? 36.939 3.075   11.748 1.00 40.58 ? 547 LEU A CD1 1 
ATOM   688  C  CD2 . LEU A 1 92  ? 37.814 0.933   10.854 1.00 38.00 ? 547 LEU A CD2 1 
ATOM   689  N  N   . MET A 1 93  ? 38.266 -0.786  15.806 1.00 38.04 ? 548 MET A N   1 
ATOM   690  C  CA  . MET A 1 93  ? 38.262 -1.000  17.242 1.00 38.59 ? 548 MET A CA  1 
ATOM   691  C  C   . MET A 1 93  ? 38.711 0.254   17.975 1.00 38.20 ? 548 MET A C   1 
ATOM   692  O  O   . MET A 1 93  ? 39.717 0.856   17.604 1.00 37.79 ? 548 MET A O   1 
ATOM   693  C  CB  . MET A 1 93  ? 39.210 -2.138  17.581 1.00 38.26 ? 548 MET A CB  1 
ATOM   694  C  CG  . MET A 1 93  ? 38.731 -3.479  17.130 1.00 38.51 ? 548 MET A CG  1 
ATOM   695  S  SD  . MET A 1 93  ? 40.046 -4.682  17.303 1.00 41.29 ? 548 MET A SD  1 
ATOM   696  C  CE  . MET A 1 93  ? 40.527 -4.802  15.631 1.00 39.62 ? 548 MET A CE  1 
ATOM   697  N  N   . CYS A 1 94  ? 37.958 0.640   19.002 1.00 38.06 ? 549 CYS A N   1 
ATOM   698  C  CA  . CYS A 1 94  ? 38.291 1.778   19.856 1.00 39.51 ? 549 CYS A CA  1 
ATOM   699  C  C   . CYS A 1 94  ? 39.644 1.571   20.517 1.00 40.94 ? 549 CYS A C   1 
ATOM   700  O  O   . CYS A 1 94  ? 39.976 0.465   20.954 1.00 41.74 ? 549 CYS A O   1 
ATOM   701  C  CB  . CYS A 1 94  ? 37.199 2.002   20.904 1.00 39.80 ? 549 CYS A CB  1 
ATOM   702  S  SG  . CYS A 1 94  ? 37.358 3.492   21.897 1.00 37.20 ? 549 CYS A SG  1 
ATOM   703  N  N   . GLY A 1 95  ? 40.443 2.633   20.558 1.00 42.53 ? 550 GLY A N   1 
ATOM   704  C  CA  . GLY A 1 95  ? 41.814 2.556   21.049 1.00 43.87 ? 550 GLY A CA  1 
ATOM   705  C  C   . GLY A 1 95  ? 41.924 2.513   22.556 1.00 45.58 ? 550 GLY A C   1 
ATOM   706  O  O   . GLY A 1 95  ? 43.022 2.313   23.097 1.00 45.93 ? 550 GLY A O   1 
ATOM   707  N  N   . ASN A 1 96  ? 40.810 2.701   23.256 1.00 47.18 ? 551 ASN A N   1 
ATOM   708  C  CA  . ASN A 1 96  ? 40.851 2.584   24.709 1.00 49.21 ? 551 ASN A CA  1 
ATOM   709  C  C   . ASN A 1 96  ? 40.114 1.387   25.332 1.00 49.87 ? 551 ASN A C   1 
ATOM   710  O  O   . ASN A 1 96  ? 39.068 0.913   24.848 1.00 49.91 ? 551 ASN A O   1 
ATOM   711  C  CB  . ASN A 1 96  ? 40.549 3.923   25.413 1.00 49.66 ? 551 ASN A CB  1 
ATOM   712  C  CG  . ASN A 1 96  ? 39.079 4.109   25.731 1.00 51.31 ? 551 ASN A CG  1 
ATOM   713  O  OD1 . ASN A 1 96  ? 38.632 3.856   26.864 1.00 53.18 ? 551 ASN A OD1 1 
ATOM   714  N  ND2 . ASN A 1 96  ? 38.316 4.550   24.740 1.00 52.96 ? 551 ASN A ND2 1 
ATOM   715  N  N   . ASN A 1 97  ? 40.701 0.915   26.426 1.00 50.89 ? 552 ASN A N   1 
ATOM   716  C  CA  . ASN A 1 97  ? 40.448 -0.412  26.952 1.00 51.49 ? 552 ASN A CA  1 
ATOM   717  C  C   . ASN A 1 97  ? 39.184 -0.553  27.790 1.00 51.50 ? 552 ASN A C   1 
ATOM   718  O  O   . ASN A 1 97  ? 38.722 -1.670  28.013 1.00 51.99 ? 552 ASN A O   1 
ATOM   719  C  CB  . ASN A 1 97  ? 41.664 -0.879  27.754 1.00 52.00 ? 552 ASN A CB  1 
ATOM   720  C  CG  . ASN A 1 97  ? 42.116 -2.277  27.367 1.00 53.38 ? 552 ASN A CG  1 
ATOM   721  O  OD1 . ASN A 1 97  ? 43.208 -2.716  27.747 1.00 53.21 ? 552 ASN A OD1 1 
ATOM   722  N  ND2 . ASN A 1 97  ? 41.280 -2.984  26.590 1.00 55.53 ? 552 ASN A ND2 1 
ATOM   723  N  N   . ASN A 1 98  ? 38.636 0.570   28.254 1.00 51.20 ? 553 ASN A N   1 
ATOM   724  C  CA  . ASN A 1 98  ? 37.423 0.567   29.073 1.00 50.49 ? 553 ASN A CA  1 
ATOM   725  C  C   . ASN A 1 98  ? 36.238 0.624   28.159 1.00 49.89 ? 553 ASN A C   1 
ATOM   726  O  O   . ASN A 1 98  ? 35.077 0.744   28.599 1.00 50.64 ? 553 ASN A O   1 
ATOM   727  C  CB  . ASN A 1 98  ? 37.372 1.792   29.982 1.00 51.14 ? 553 ASN A CB  1 
ATOM   728  C  CG  . ASN A 1 98  ? 38.735 2.183   30.519 1.00 52.65 ? 553 ASN A CG  1 
ATOM   729  O  OD1 . ASN A 1 98  ? 39.211 1.639   31.525 1.00 52.87 ? 553 ASN A OD1 1 
ATOM   730  N  ND2 . ASN A 1 98  ? 39.373 3.145   29.846 1.00 54.99 ? 553 ASN A ND2 1 
ATOM   731  N  N   . CYS A 1 99  ? 36.521 0.583   26.865 1.00 47.60 ? 554 CYS A N   1 
ATOM   732  C  CA  . CYS A 1 99  ? 35.460 0.773   25.914 1.00 46.15 ? 554 CYS A CA  1 
ATOM   733  C  C   . CYS A 1 99  ? 35.072 -0.544  25.245 1.00 44.91 ? 554 CYS A C   1 
ATOM   734  O  O   . CYS A 1 99  ? 33.906 -0.964  25.330 1.00 44.93 ? 554 CYS A O   1 
ATOM   735  C  CB  . CYS A 1 99  ? 35.845 1.833   24.887 1.00 45.60 ? 554 CYS A CB  1 
ATOM   736  S  SG  . CYS A 1 99  ? 34.498 2.127   23.770 1.00 45.84 ? 554 CYS A SG  1 
ATOM   737  N  N   . CYS A 1 100 ? 36.051 -1.165  24.579 1.00 42.83 ? 555 CYS A N   1 
ATOM   738  C  CA  . CYS A 1 100 ? 35.859 -2.412  23.834 1.00 40.97 ? 555 CYS A CA  1 
ATOM   739  C  C   . CYS A 1 100 ? 34.870 -2.393  22.647 1.00 40.22 ? 555 CYS A C   1 
ATOM   740  O  O   . CYS A 1 100 ? 34.530 -3.459  22.116 1.00 39.61 ? 555 CYS A O   1 
ATOM   741  C  CB  . CYS A 1 100 ? 35.533 -3.533  24.801 1.00 40.70 ? 555 CYS A CB  1 
ATOM   742  S  SG  . CYS A 1 100 ? 36.791 -3.599  26.087 1.00 40.44 ? 555 CYS A SG  1 
ATOM   743  N  N   . ARG A 1 101 ? 34.451 -1.208  22.211 1.00 38.73 ? 556 ARG A N   1 
ATOM   744  C  CA  . ARG A 1 101 ? 33.528 -1.093  21.076 1.00 39.00 ? 556 ARG A CA  1 
ATOM   745  C  C   . ARG A 1 101 ? 34.159 -1.144  19.692 1.00 38.53 ? 556 ARG A C   1 
ATOM   746  O  O   . ARG A 1 101 ? 35.315 -0.793  19.515 1.00 38.41 ? 556 ARG A O   1 
ATOM   747  C  CB  . ARG A 1 101 ? 32.688 0.179   21.164 1.00 38.86 ? 556 ARG A CB  1 
ATOM   748  C  CG  . ARG A 1 101 ? 31.749 0.164   22.337 1.00 41.71 ? 556 ARG A CG  1 
ATOM   749  C  CD  . ARG A 1 101 ? 30.728 1.285   22.282 1.00 44.17 ? 556 ARG A CD  1 
ATOM   750  N  NE  . ARG A 1 101 ? 29.837 1.141   23.425 1.00 46.83 ? 556 ARG A NE  1 
ATOM   751  C  CZ  . ARG A 1 101 ? 28.726 0.398   23.448 1.00 49.46 ? 556 ARG A CZ  1 
ATOM   752  N  NH1 . ARG A 1 101 ? 28.026 0.373   24.575 1.00 51.35 ? 556 ARG A NH1 1 
ATOM   753  N  NH2 . ARG A 1 101 ? 28.290 -0.293  22.368 1.00 45.92 ? 556 ARG A NH2 1 
ATOM   754  N  N   . CYS A 1 102 ? 33.346 -1.536  18.714 1.00 37.84 ? 557 CYS A N   1 
ATOM   755  C  CA  . CYS A 1 102 ? 33.734 -1.637  17.329 1.00 36.81 ? 557 CYS A CA  1 
ATOM   756  C  C   . CYS A 1 102 ? 32.673 -0.955  16.502 1.00 36.70 ? 557 CYS A C   1 
ATOM   757  O  O   . CYS A 1 102 ? 31.507 -0.900  16.920 1.00 36.30 ? 557 CYS A O   1 
ATOM   758  C  CB  . CYS A 1 102 ? 33.851 -3.099  16.918 1.00 36.16 ? 557 CYS A CB  1 
ATOM   759  S  SG  . CYS A 1 102 ? 35.106 -3.964  17.881 1.00 39.06 ? 557 CYS A SG  1 
ATOM   760  N  N   . PHE A 1 103 ? 33.099 -0.420  15.352 1.00 35.87 ? 558 PHE A N   1 
ATOM   761  C  CA  . PHE A 1 103 ? 32.251 0.249   14.392 1.00 36.59 ? 558 PHE A CA  1 
ATOM   762  C  C   . PHE A 1 103 ? 32.667 -0.199  13.009 1.00 37.26 ? 558 PHE A C   1 
ATOM   763  O  O   . PHE A 1 103 ? 33.857 -0.090  12.662 1.00 37.61 ? 558 PHE A O   1 
ATOM   764  C  CB  . PHE A 1 103 ? 32.426 1.772   14.497 1.00 36.38 ? 558 PHE A CB  1 
ATOM   765  C  CG  . PHE A 1 103 ? 31.812 2.371   15.746 1.00 36.84 ? 558 PHE A CG  1 
ATOM   766  C  CD1 . PHE A 1 103 ? 32.490 2.334   16.956 1.00 36.57 ? 558 PHE A CD1 1 
ATOM   767  C  CD2 . PHE A 1 103 ? 30.554 2.962   15.703 1.00 37.89 ? 558 PHE A CD2 1 
ATOM   768  C  CE1 . PHE A 1 103 ? 31.935 2.867   18.115 1.00 36.71 ? 558 PHE A CE1 1 
ATOM   769  C  CE2 . PHE A 1 103 ? 29.983 3.521   16.871 1.00 37.86 ? 558 PHE A CE2 1 
ATOM   770  C  CZ  . PHE A 1 103 ? 30.683 3.467   18.066 1.00 37.20 ? 558 PHE A CZ  1 
ATOM   771  N  N   . CYS A 1 104 ? 31.722 -0.704  12.211 1.00 36.71 ? 559 CYS A N   1 
ATOM   772  C  CA  . CYS A 1 104 ? 32.097 -1.284  10.924 1.00 37.01 ? 559 CYS A CA  1 
ATOM   773  C  C   . CYS A 1 104 ? 32.304 -0.168  9.903  1.00 37.13 ? 559 CYS A C   1 
ATOM   774  O  O   . CYS A 1 104 ? 31.779 0.956   10.082 1.00 36.28 ? 559 CYS A O   1 
ATOM   775  C  CB  . CYS A 1 104 ? 31.079 -2.321  10.426 1.00 35.76 ? 559 CYS A CB  1 
ATOM   776  S  SG  . CYS A 1 104 ? 29.543 -1.565  9.796  1.00 39.29 ? 559 CYS A SG  1 
ATOM   777  N  N   . VAL A 1 105 ? 33.058 -0.474  8.841  1.00 37.03 ? 560 VAL A N   1 
ATOM   778  C  CA  . VAL A 1 105 ? 33.364 0.551   7.844  1.00 38.54 ? 560 VAL A CA  1 
ATOM   779  C  C   . VAL A 1 105 ? 32.130 1.051   7.095  1.00 39.25 ? 560 VAL A C   1 
ATOM   780  O  O   . VAL A 1 105 ? 32.082 2.213   6.679  1.00 38.94 ? 560 VAL A O   1 
ATOM   781  C  CB  . VAL A 1 105 ? 34.587 0.202   6.901  1.00 38.20 ? 560 VAL A CB  1 
ATOM   782  C  CG1 . VAL A 1 105 ? 35.125 -1.158  7.156  1.00 39.28 ? 560 VAL A CG1 1 
ATOM   783  C  CG2 . VAL A 1 105 ? 34.266 0.413   5.422  1.00 39.29 ? 560 VAL A CG2 1 
ATOM   784  N  N   . GLU A 1 106 ? 31.127 0.180   6.956  1.00 41.01 ? 561 GLU A N   1 
ATOM   785  C  CA  . GLU A 1 106 ? 29.897 0.556   6.276  1.00 43.10 ? 561 GLU A CA  1 
ATOM   786  C  C   . GLU A 1 106 ? 29.158 1.657   7.040  1.00 41.96 ? 561 GLU A C   1 
ATOM   787  O  O   . GLU A 1 106 ? 28.836 2.681   6.454  1.00 42.17 ? 561 GLU A O   1 
ATOM   788  C  CB  . GLU A 1 106 ? 28.983 -0.640  5.960  1.00 43.06 ? 561 GLU A CB  1 
ATOM   789  C  CG  . GLU A 1 106 ? 27.642 -0.186  5.285  1.00 47.20 ? 561 GLU A CG  1 
ATOM   790  C  CD  . GLU A 1 106 ? 26.634 -1.320  4.996  1.00 48.09 ? 561 GLU A CD  1 
ATOM   791  O  OE1 . GLU A 1 106 ? 27.035 -2.370  4.419  1.00 53.41 ? 561 GLU A OE1 1 
ATOM   792  O  OE2 . GLU A 1 106 ? 25.429 -1.141  5.337  1.00 54.16 ? 561 GLU A OE2 1 
ATOM   793  N  N   . CYS A 1 107 ? 28.931 1.473   8.340  1.00 41.59 ? 562 CYS A N   1 
ATOM   794  C  CA  . CYS A 1 107 ? 28.223 2.484   9.130  1.00 41.19 ? 562 CYS A CA  1 
ATOM   795  C  C   . CYS A 1 107 ? 29.033 3.754   9.261  1.00 41.11 ? 562 CYS A C   1 
ATOM   796  O  O   . CYS A 1 107 ? 28.482 4.855   9.245  1.00 41.56 ? 562 CYS A O   1 
ATOM   797  C  CB  . CYS A 1 107 ? 27.873 1.946   10.530 1.00 41.44 ? 562 CYS A CB  1 
ATOM   798  S  SG  . CYS A 1 107 ? 26.598 0.676   10.451 1.00 42.88 ? 562 CYS A SG  1 
ATOM   799  N  N   . VAL A 1 108 ? 30.346 3.621   9.384  1.00 40.34 ? 563 VAL A N   1 
ATOM   800  C  CA  . VAL A 1 108 ? 31.193 4.820   9.466  1.00 40.05 ? 563 VAL A CA  1 
ATOM   801  C  C   . VAL A 1 108 ? 31.127 5.656   8.178  1.00 39.90 ? 563 VAL A C   1 
ATOM   802  O  O   . VAL A 1 108 ? 30.787 6.838   8.224  1.00 39.16 ? 563 VAL A O   1 
ATOM   803  C  CB  . VAL A 1 108 ? 32.633 4.463   9.876  1.00 40.39 ? 563 VAL A CB  1 
ATOM   804  C  CG1 . VAL A 1 108 ? 33.554 5.686   9.824  1.00 40.11 ? 563 VAL A CG1 1 
ATOM   805  C  CG2 . VAL A 1 108 ? 32.619 3.800   11.263 1.00 38.38 ? 563 VAL A CG2 1 
ATOM   806  N  N   . ASP A 1 109 ? 31.397 5.037   7.034  1.00 40.16 ? 564 ASP A N   1 
ATOM   807  C  CA  . ASP A 1 109 ? 31.301 5.753   5.767  1.00 40.94 ? 564 ASP A CA  1 
ATOM   808  C  C   . ASP A 1 109 ? 29.910 6.301   5.525  1.00 40.62 ? 564 ASP A C   1 
ATOM   809  O  O   . ASP A 1 109 ? 29.769 7.399   5.015  1.00 40.40 ? 564 ASP A O   1 
ATOM   810  C  CB  . ASP A 1 109 ? 31.719 4.880   4.601  1.00 41.58 ? 564 ASP A CB  1 
ATOM   811  C  CG  . ASP A 1 109 ? 33.235 4.643   4.561  1.00 45.22 ? 564 ASP A CG  1 
ATOM   812  O  OD1 . ASP A 1 109 ? 34.024 5.467   5.109  1.00 45.79 ? 564 ASP A OD1 1 
ATOM   813  O  OD2 . ASP A 1 109 ? 33.627 3.609   3.976  1.00 50.03 ? 564 ASP A OD2 1 
ATOM   814  N  N   . LEU A 1 110 ? 28.897 5.537   5.934  1.00 40.46 ? 565 LEU A N   1 
ATOM   815  C  CA  . LEU A 1 110 ? 27.491 5.914   5.763  1.00 39.74 ? 565 LEU A CA  1 
ATOM   816  C  C   . LEU A 1 110 ? 27.035 7.063   6.673  1.00 38.98 ? 565 LEU A C   1 
ATOM   817  O  O   . LEU A 1 110 ? 26.430 8.009   6.197  1.00 38.31 ? 565 LEU A O   1 
ATOM   818  C  CB  . LEU A 1 110 ? 26.613 4.679   6.001  1.00 39.81 ? 565 LEU A CB  1 
ATOM   819  C  CG  . LEU A 1 110 ? 25.108 4.726   5.773  1.00 40.51 ? 565 LEU A CG  1 
ATOM   820  C  CD1 . LEU A 1 110 ? 24.811 5.007   4.307  1.00 39.74 ? 565 LEU A CD1 1 
ATOM   821  C  CD2 . LEU A 1 110 ? 24.523 3.400   6.195  1.00 41.04 ? 565 LEU A CD2 1 
ATOM   822  N  N   . LEU A 1 111 ? 27.297 6.953   7.977  1.00 38.06 ? 566 LEU A N   1 
ATOM   823  C  CA  . LEU A 1 111 ? 26.806 7.916   8.967  1.00 38.03 ? 566 LEU A CA  1 
ATOM   824  C  C   . LEU A 1 111 ? 27.761 9.061   9.325  1.00 38.10 ? 566 LEU A C   1 
ATOM   825  O  O   . LEU A 1 111 ? 27.323 10.196  9.574  1.00 38.48 ? 566 LEU A O   1 
ATOM   826  C  CB  . LEU A 1 111 ? 26.410 7.177   10.251 1.00 37.81 ? 566 LEU A CB  1 
ATOM   827  C  CG  . LEU A 1 111 ? 25.171 6.270   10.062 1.00 37.31 ? 566 LEU A CG  1 
ATOM   828  C  CD1 . LEU A 1 111 ? 24.952 5.468   11.294 1.00 40.45 ? 566 LEU A CD1 1 
ATOM   829  C  CD2 . LEU A 1 111 ? 23.931 7.099   9.806  1.00 35.08 ? 566 LEU A CD2 1 
ATOM   830  N  N   . VAL A 1 112 ? 29.056 8.781   9.369  1.00 37.44 ? 567 VAL A N   1 
ATOM   831  C  CA  . VAL A 1 112 ? 30.023 9.848   9.594  1.00 36.73 ? 567 VAL A CA  1 
ATOM   832  C  C   . VAL A 1 112 ? 30.361 10.539  8.276  1.00 37.13 ? 567 VAL A C   1 
ATOM   833  O  O   . VAL A 1 112 ? 30.318 11.777  8.183  1.00 37.13 ? 567 VAL A O   1 
ATOM   834  C  CB  . VAL A 1 112 ? 31.286 9.347   10.330 1.00 36.85 ? 567 VAL A CB  1 
ATOM   835  C  CG1 . VAL A 1 112 ? 32.240 10.509  10.557 1.00 35.49 ? 567 VAL A CG1 1 
ATOM   836  C  CG2 . VAL A 1 112 ? 30.885 8.665   11.657 1.00 33.57 ? 567 VAL A CG2 1 
ATOM   837  N  N   . GLY A 1 113 ? 30.665 9.741   7.254  1.00 36.89 ? 568 GLY A N   1 
ATOM   838  C  CA  . GLY A 1 113 ? 30.815 10.269  5.909  1.00 36.51 ? 568 GLY A CA  1 
ATOM   839  C  C   . GLY A 1 113 ? 31.835 9.498   5.095  1.00 36.22 ? 568 GLY A C   1 
ATOM   840  O  O   . GLY A 1 113 ? 32.686 8.793   5.660  1.00 36.43 ? 568 GLY A O   1 
ATOM   841  N  N   . PRO A 1 114 ? 31.760 9.623   3.755  1.00 35.86 ? 569 PRO A N   1 
ATOM   842  C  CA  . PRO A 1 114 ? 32.750 8.960   2.915  1.00 35.51 ? 569 PRO A CA  1 
ATOM   843  C  C   . PRO A 1 114 ? 34.147 9.462   3.278  1.00 35.45 ? 569 PRO A C   1 
ATOM   844  O  O   . PRO A 1 114 ? 34.354 10.681  3.431  1.00 35.64 ? 569 PRO A O   1 
ATOM   845  C  CB  . PRO A 1 114 ? 32.363 9.399   1.494  1.00 35.40 ? 569 PRO A CB  1 
ATOM   846  C  CG  . PRO A 1 114 ? 30.965 9.850   1.596  1.00 35.77 ? 569 PRO A CG  1 
ATOM   847  C  CD  . PRO A 1 114 ? 30.774 10.384  2.965  1.00 35.27 ? 569 PRO A CD  1 
ATOM   848  N  N   . GLY A 1 115 ? 35.088 8.532   3.421  1.00 34.96 ? 570 GLY A N   1 
ATOM   849  C  CA  . GLY A 1 115 ? 36.459 8.876   3.806  1.00 34.51 ? 570 GLY A CA  1 
ATOM   850  C  C   . GLY A 1 115 ? 36.736 8.658   5.281  1.00 34.39 ? 570 GLY A C   1 
ATOM   851  O  O   . GLY A 1 115 ? 37.863 8.382   5.667  1.00 33.98 ? 570 GLY A O   1 
ATOM   852  N  N   . ALA A 1 116 ? 35.684 8.749   6.100  1.00 34.76 ? 571 ALA A N   1 
ATOM   853  C  CA  . ALA A 1 116 ? 35.787 8.710   7.555  1.00 34.41 ? 571 ALA A CA  1 
ATOM   854  C  C   . ALA A 1 116 ? 36.404 7.432   8.104  1.00 34.85 ? 571 ALA A C   1 
ATOM   855  O  O   . ALA A 1 116 ? 37.140 7.488   9.101  1.00 35.36 ? 571 ALA A O   1 
ATOM   856  C  CB  . ALA A 1 116 ? 34.435 8.943   8.189  1.00 34.05 ? 571 ALA A CB  1 
ATOM   857  N  N   . ALA A 1 117 ? 36.104 6.290   7.485  1.00 34.14 ? 572 ALA A N   1 
ATOM   858  C  CA  . ALA A 1 117 ? 36.636 5.018   7.980  1.00 33.93 ? 572 ALA A CA  1 
ATOM   859  C  C   . ALA A 1 117 ? 38.137 4.989   7.760  1.00 34.08 ? 572 ALA A C   1 
ATOM   860  O  O   . ALA A 1 117 ? 38.917 4.723   8.683  1.00 34.72 ? 572 ALA A O   1 
ATOM   861  C  CB  . ALA A 1 117 ? 35.958 3.838   7.284  1.00 33.65 ? 572 ALA A CB  1 
ATOM   862  N  N   . GLN A 1 118 ? 38.540 5.302   6.535  1.00 33.38 ? 573 GLN A N   1 
ATOM   863  C  CA  . GLN A 1 118 ? 39.939 5.256   6.166  1.00 33.26 ? 573 GLN A CA  1 
ATOM   864  C  C   . GLN A 1 118 ? 40.749 6.257   6.998  1.00 32.72 ? 573 GLN A C   1 
ATOM   865  O  O   . GLN A 1 118 ? 41.860 5.953   7.424  1.00 32.31 ? 573 GLN A O   1 
ATOM   866  C  CB  . GLN A 1 118 ? 40.100 5.467   4.656  1.00 32.94 ? 573 GLN A CB  1 
ATOM   867  C  CG  . GLN A 1 118 ? 41.509 5.216   4.132  1.00 35.16 ? 573 GLN A CG  1 
ATOM   868  C  CD  . GLN A 1 118 ? 42.029 3.810   4.423  1.00 36.54 ? 573 GLN A CD  1 
ATOM   869  O  OE1 . GLN A 1 118 ? 41.266 2.842   4.473  1.00 37.87 ? 573 GLN A OE1 1 
ATOM   870  N  NE2 . GLN A 1 118 ? 43.334 3.699   4.625  1.00 36.29 ? 573 GLN A NE2 1 
ATOM   871  N  N   . ALA A 1 119 ? 40.162 7.421   7.262  1.00 32.63 ? 574 ALA A N   1 
ATOM   872  C  CA  . ALA A 1 119 ? 40.770 8.421   8.142  1.00 33.05 ? 574 ALA A CA  1 
ATOM   873  C  C   . ALA A 1 119 ? 40.950 7.903   9.568  1.00 33.44 ? 574 ALA A C   1 
ATOM   874  O  O   . ALA A 1 119 ? 41.981 8.143   10.175 1.00 33.38 ? 574 ALA A O   1 
ATOM   875  C  CB  . ALA A 1 119 ? 39.962 9.711   8.141  1.00 32.76 ? 574 ALA A CB  1 
ATOM   876  N  N   . ALA A 1 120 ? 39.947 7.189   10.092 1.00 34.45 ? 575 ALA A N   1 
ATOM   877  C  CA  . ALA A 1 120 ? 40.039 6.564   11.423 1.00 34.96 ? 575 ALA A CA  1 
ATOM   878  C  C   . ALA A 1 120 ? 41.086 5.452   11.446 1.00 35.60 ? 575 ALA A C   1 
ATOM   879  O  O   . ALA A 1 120 ? 41.935 5.405   12.347 1.00 35.83 ? 575 ALA A O   1 
ATOM   880  C  CB  . ALA A 1 120 ? 38.694 6.047   11.859 1.00 35.13 ? 575 ALA A CB  1 
ATOM   881  N  N   . ILE A 1 121 ? 41.050 4.576   10.441 1.00 36.25 ? 576 ILE A N   1 
ATOM   882  C  CA  . ILE A 1 121 ? 42.072 3.527   10.297 1.00 36.73 ? 576 ILE A CA  1 
ATOM   883  C  C   . ILE A 1 121 ? 43.490 4.100   10.388 1.00 37.30 ? 576 ILE A C   1 
ATOM   884  O  O   . ILE A 1 121 ? 44.357 3.508   11.043 1.00 37.34 ? 576 ILE A O   1 
ATOM   885  C  CB  . ILE A 1 121 ? 41.901 2.701   8.985  1.00 36.73 ? 576 ILE A CB  1 
ATOM   886  C  CG1 . ILE A 1 121 ? 40.540 1.999   8.957  1.00 36.67 ? 576 ILE A CG1 1 
ATOM   887  C  CG2 . ILE A 1 121 ? 43.045 1.689   8.806  1.00 36.98 ? 576 ILE A CG2 1 
ATOM   888  C  CD1 . ILE A 1 121 ? 40.144 1.409   7.595  1.00 36.62 ? 576 ILE A CD1 1 
ATOM   889  N  N   . LYS A 1 122 ? 43.732 5.247   9.754  1.00 38.00 ? 577 LYS A N   1 
ATOM   890  C  CA  . LYS A 1 122 ? 45.077 5.846   9.803  1.00 38.84 ? 577 LYS A CA  1 
ATOM   891  C  C   . LYS A 1 122 ? 45.289 6.926   10.877 1.00 39.37 ? 577 LYS A C   1 
ATOM   892  O  O   . LYS A 1 122 ? 46.295 7.631   10.869 1.00 39.52 ? 577 LYS A O   1 
ATOM   893  C  CB  . LYS A 1 122 ? 45.586 6.278   8.410  1.00 38.93 ? 577 LYS A CB  1 
ATOM   894  C  CG  . LYS A 1 122 ? 44.768 7.318   7.641  1.00 38.92 ? 577 LYS A CG  1 
ATOM   895  C  CD  . LYS A 1 122 ? 45.317 7.428   6.208  1.00 39.12 ? 577 LYS A CD  1 
ATOM   896  C  CE  . LYS A 1 122 ? 44.822 8.659   5.470  1.00 38.87 ? 577 LYS A CE  1 
ATOM   897  N  NZ  . LYS A 1 122 ? 45.603 8.859   4.202  1.00 38.85 ? 577 LYS A NZ  1 
ATOM   898  N  N   . GLU A 1 123 ? 44.344 7.040   11.805 1.00 40.15 ? 578 GLU A N   1 
ATOM   899  C  CA  . GLU A 1 123 ? 44.540 7.855   13.001 1.00 41.11 ? 578 GLU A CA  1 
ATOM   900  C  C   . GLU A 1 123 ? 44.977 6.953   14.154 1.00 40.84 ? 578 GLU A C   1 
ATOM   901  O  O   . GLU A 1 123 ? 44.340 5.930   14.421 1.00 41.04 ? 578 GLU A O   1 
ATOM   902  C  CB  . GLU A 1 123 ? 43.253 8.586   13.360 1.00 40.87 ? 578 GLU A CB  1 
ATOM   903  C  CG  . GLU A 1 123 ? 43.408 9.622   14.456 1.00 42.19 ? 578 GLU A CG  1 
ATOM   904  C  CD  . GLU A 1 123 ? 42.088 10.314  14.824 1.00 43.43 ? 578 GLU A CD  1 
ATOM   905  O  OE1 . GLU A 1 123 ? 40.989 9.910   14.356 1.00 43.70 ? 578 GLU A OE1 1 
ATOM   906  O  OE2 . GLU A 1 123 ? 42.166 11.294  15.601 1.00 48.90 ? 578 GLU A OE2 1 
ATOM   907  N  N   . ASP A 1 124 ? 46.050 7.336   14.841 1.00 40.47 ? 579 ASP A N   1 
ATOM   908  C  CA  . ASP A 1 124 ? 46.584 6.524   15.931 1.00 40.51 ? 579 ASP A CA  1 
ATOM   909  C  C   . ASP A 1 124 ? 47.184 7.347   17.071 1.00 40.25 ? 579 ASP A C   1 
ATOM   910  O  O   . ASP A 1 124 ? 48.143 8.080   16.843 1.00 39.98 ? 579 ASP A O   1 
ATOM   911  C  CB  . ASP A 1 124 ? 47.660 5.576   15.402 1.00 40.76 ? 579 ASP A CB  1 
ATOM   912  C  CG  . ASP A 1 124 ? 48.033 4.520   16.411 1.00 41.38 ? 579 ASP A CG  1 
ATOM   913  O  OD1 . ASP A 1 124 ? 47.098 3.964   17.043 1.00 43.06 ? 579 ASP A OD1 1 
ATOM   914  O  OD2 . ASP A 1 124 ? 49.241 4.240   16.569 1.00 39.88 ? 579 ASP A OD2 1 
ATOM   915  N  N   . PRO A 1 125 ? 46.653 7.208   18.306 1.00 40.04 ? 580 PRO A N   1 
ATOM   916  C  CA  . PRO A 1 125 ? 45.515 6.396   18.757 1.00 39.94 ? 580 PRO A CA  1 
ATOM   917  C  C   . PRO A 1 125 ? 44.164 6.948   18.314 1.00 39.58 ? 580 PRO A C   1 
ATOM   918  O  O   . PRO A 1 125 ? 44.034 8.153   18.084 1.00 39.87 ? 580 PRO A O   1 
ATOM   919  C  CB  . PRO A 1 125 ? 45.615 6.468   20.283 1.00 39.95 ? 580 PRO A CB  1 
ATOM   920  C  CG  . PRO A 1 125 ? 46.302 7.756   20.547 1.00 40.41 ? 580 PRO A CG  1 
ATOM   921  C  CD  . PRO A 1 125 ? 47.285 7.925   19.431 1.00 40.07 ? 580 PRO A CD  1 
ATOM   922  N  N   . TRP A 1 126 ? 43.177 6.066   18.202 1.00 38.74 ? 581 TRP A N   1 
ATOM   923  C  CA  . TRP A 1 126 ? 41.840 6.453   17.760 1.00 38.09 ? 581 TRP A CA  1 
ATOM   924  C  C   . TRP A 1 126 ? 40.815 6.157   18.847 1.00 38.19 ? 581 TRP A C   1 
ATOM   925  O  O   . TRP A 1 126 ? 40.809 5.065   19.401 1.00 38.34 ? 581 TRP A O   1 
ATOM   926  C  CB  . TRP A 1 126 ? 41.459 5.720   16.473 1.00 37.21 ? 581 TRP A CB  1 
ATOM   927  C  CG  . TRP A 1 126 ? 40.076 6.079   15.964 1.00 37.09 ? 581 TRP A CG  1 
ATOM   928  C  CD1 . TRP A 1 126 ? 39.711 7.239   15.342 1.00 36.03 ? 581 TRP A CD1 1 
ATOM   929  C  CD2 . TRP A 1 126 ? 38.885 5.272   16.037 1.00 35.86 ? 581 TRP A CD2 1 
ATOM   930  N  NE1 . TRP A 1 126 ? 38.375 7.207   15.018 1.00 35.52 ? 581 TRP A NE1 1 
ATOM   931  C  CE2 . TRP A 1 126 ? 37.841 6.015   15.432 1.00 36.09 ? 581 TRP A CE2 1 
ATOM   932  C  CE3 . TRP A 1 126 ? 38.598 3.999   16.559 1.00 34.83 ? 581 TRP A CE3 1 
ATOM   933  C  CZ2 . TRP A 1 126 ? 36.522 5.526   15.330 1.00 36.87 ? 581 TRP A CZ2 1 
ATOM   934  C  CZ3 . TRP A 1 126 ? 37.290 3.505   16.455 1.00 35.55 ? 581 TRP A CZ3 1 
ATOM   935  C  CH2 . TRP A 1 126 ? 36.266 4.274   15.848 1.00 36.73 ? 581 TRP A CH2 1 
ATOM   936  N  N   . ASN A 1 127 ? 39.966 7.137   19.157 1.00 38.07 ? 582 ASN A N   1 
ATOM   937  C  CA  . ASN A 1 127 ? 38.885 6.954   20.114 1.00 38.02 ? 582 ASN A CA  1 
ATOM   938  C  C   . ASN A 1 127 ? 37.592 6.906   19.362 1.00 37.92 ? 582 ASN A C   1 
ATOM   939  O  O   . ASN A 1 127 ? 37.351 7.762   18.522 1.00 37.54 ? 582 ASN A O   1 
ATOM   940  C  CB  . ASN A 1 127 ? 38.819 8.111   21.097 1.00 38.10 ? 582 ASN A CB  1 
ATOM   941  C  CG  . ASN A 1 127 ? 39.988 8.141   22.029 1.00 39.65 ? 582 ASN A CG  1 
ATOM   942  O  OD1 . ASN A 1 127 ? 40.332 7.131   22.645 1.00 42.22 ? 582 ASN A OD1 1 
ATOM   943  N  ND2 . ASN A 1 127 ? 40.615 9.304   22.148 1.00 38.80 ? 582 ASN A ND2 1 
ATOM   944  N  N   . CYS A 1 128 ? 36.750 5.924   19.675 1.00 37.99 ? 583 CYS A N   1 
ATOM   945  C  CA  . CYS A 1 128 ? 35.524 5.715   18.915 1.00 38.32 ? 583 CYS A CA  1 
ATOM   946  C  C   . CYS A 1 128 ? 34.522 6.844   19.175 1.00 37.82 ? 583 CYS A C   1 
ATOM   947  O  O   . CYS A 1 128 ? 34.768 7.765   19.960 1.00 37.83 ? 583 CYS A O   1 
ATOM   948  C  CB  . CYS A 1 128 ? 34.920 4.356   19.253 1.00 38.62 ? 583 CYS A CB  1 
ATOM   949  S  SG  . CYS A 1 128 ? 33.878 4.369   20.751 1.00 39.95 ? 583 CYS A SG  1 
ATOM   950  N  N   . TYR A 1 129 ? 33.385 6.756   18.529 1.00 38.07 ? 584 TYR A N   1 
ATOM   951  C  CA  . TYR A 1 129 ? 32.376 7.815   18.574 1.00 38.60 ? 584 TYR A CA  1 
ATOM   952  C  C   . TYR A 1 129 ? 31.664 7.877   19.928 1.00 39.31 ? 584 TYR A C   1 
ATOM   953  O  O   . TYR A 1 129 ? 31.007 8.879   20.234 1.00 39.64 ? 584 TYR A O   1 
ATOM   954  C  CB  . TYR A 1 129 ? 31.394 7.633   17.418 1.00 37.52 ? 584 TYR A CB  1 
ATOM   955  C  CG  . TYR A 1 129 ? 32.152 7.496   16.112 1.00 38.89 ? 584 TYR A CG  1 
ATOM   956  C  CD1 . TYR A 1 129 ? 32.292 6.250   15.479 1.00 38.56 ? 584 TYR A CD1 1 
ATOM   957  C  CD2 . TYR A 1 129 ? 32.795 8.605   15.544 1.00 38.56 ? 584 TYR A CD2 1 
ATOM   958  C  CE1 . TYR A 1 129 ? 33.028 6.125   14.307 1.00 39.21 ? 584 TYR A CE1 1 
ATOM   959  C  CE2 . TYR A 1 129 ? 33.525 8.492   14.377 1.00 38.53 ? 584 TYR A CE2 1 
ATOM   960  C  CZ  . TYR A 1 129 ? 33.642 7.255   13.761 1.00 39.15 ? 584 TYR A CZ  1 
ATOM   961  O  OH  . TYR A 1 129 ? 34.382 7.165   12.601 1.00 39.44 ? 584 TYR A OH  1 
ATOM   962  N  N   . MET A 1 130 ? 31.814 6.822   20.734 1.00 39.61 ? 585 MET A N   1 
ATOM   963  C  CA  . MET A 1 130 ? 31.306 6.840   22.093 1.00 40.69 ? 585 MET A CA  1 
ATOM   964  C  C   . MET A 1 130 ? 32.288 7.509   23.048 1.00 41.79 ? 585 MET A C   1 
ATOM   965  O  O   . MET A 1 130 ? 31.874 8.068   24.061 1.00 42.83 ? 585 MET A O   1 
ATOM   966  C  CB  . MET A 1 130 ? 30.952 5.420   22.573 1.00 40.81 ? 585 MET A CB  1 
ATOM   967  C  CG  . MET A 1 130 ? 29.663 4.853   21.918 1.00 39.98 ? 585 MET A CG  1 
ATOM   968  S  SD  . MET A 1 130 ? 28.261 5.970   22.196 1.00 44.64 ? 585 MET A SD  1 
ATOM   969  C  CE  . MET A 1 130 ? 28.125 5.859   23.971 1.00 40.33 ? 585 MET A CE  1 
ATOM   970  N  N   . CYS A 1 131 ? 33.586 7.458   22.736 1.00 42.15 ? 586 CYS A N   1 
ATOM   971  C  CA  . CYS A 1 131 ? 34.608 8.032   23.621 1.00 42.34 ? 586 CYS A CA  1 
ATOM   972  C  C   . CYS A 1 131 ? 35.014 9.473   23.299 1.00 42.52 ? 586 CYS A C   1 
ATOM   973  O  O   . CYS A 1 131 ? 35.354 10.228  24.201 1.00 42.52 ? 586 CYS A O   1 
ATOM   974  C  CB  . CYS A 1 131 ? 35.853 7.147   23.647 1.00 42.42 ? 586 CYS A CB  1 
ATOM   975  S  SG  . CYS A 1 131 ? 35.529 5.458   24.163 1.00 41.85 ? 586 CYS A SG  1 
ATOM   976  N  N   . GLY A 1 132 ? 34.990 9.847   22.025 1.00 43.00 ? 587 GLY A N   1 
ATOM   977  C  CA  . GLY A 1 132 ? 35.465 11.174  21.592 1.00 43.44 ? 587 GLY A CA  1 
ATOM   978  C  C   . GLY A 1 132 ? 34.756 12.335  22.274 1.00 43.80 ? 587 GLY A C   1 
ATOM   979  O  O   . GLY A 1 132 ? 33.545 12.276  22.516 1.00 43.62 ? 587 GLY A O   1 
ATOM   980  N  N   . HIS A 1 133 ? 35.506 13.395  22.580 1.00 44.10 ? 588 HIS A N   1 
ATOM   981  C  CA  . HIS A 1 133 ? 34.954 14.519  23.346 1.00 44.55 ? 588 HIS A CA  1 
ATOM   982  C  C   . HIS A 1 133 ? 33.869 15.329  22.610 1.00 44.25 ? 588 HIS A C   1 
ATOM   983  O  O   . HIS A 1 133 ? 32.961 15.863  23.243 1.00 44.17 ? 588 HIS A O   1 
ATOM   984  C  CB  . HIS A 1 133 ? 36.067 15.402  23.986 1.00 44.84 ? 588 HIS A CB  1 
ATOM   985  C  CG  . HIS A 1 133 ? 36.600 16.499  23.106 1.00 46.53 ? 588 HIS A CG  1 
ATOM   986  N  ND1 . HIS A 1 133 ? 36.797 16.356  21.747 1.00 48.11 ? 588 HIS A ND1 1 
ATOM   987  C  CD2 . HIS A 1 133 ? 37.033 17.748  23.414 1.00 48.50 ? 588 HIS A CD2 1 
ATOM   988  C  CE1 . HIS A 1 133 ? 37.293 17.477  21.250 1.00 47.84 ? 588 HIS A CE1 1 
ATOM   989  N  NE2 . HIS A 1 133 ? 37.451 18.336  22.242 1.00 49.04 ? 588 HIS A NE2 1 
ATOM   990  N  N   . LYS A 1 134 ? 33.936 15.385  21.284 1.00 44.12 ? 589 LYS A N   1 
ATOM   991  C  CA  . LYS A 1 134 ? 33.004 16.230  20.532 1.00 44.11 ? 589 LYS A CA  1 
ATOM   992  C  C   . LYS A 1 134 ? 31.528 15.776  20.569 1.00 43.51 ? 589 LYS A C   1 
ATOM   993  O  O   . LYS A 1 134 ? 30.617 16.609  20.591 1.00 43.92 ? 589 LYS A O   1 
ATOM   994  C  CB  . LYS A 1 134 ? 33.457 16.433  19.081 1.00 44.27 ? 589 LYS A CB  1 
ATOM   995  C  CG  . LYS A 1 134 ? 33.079 17.802  18.570 1.00 45.50 ? 589 LYS A CG  1 
ATOM   996  C  CD  . LYS A 1 134 ? 32.300 17.747  17.277 1.00 47.36 ? 589 LYS A CD  1 
ATOM   997  C  CE  . LYS A 1 134 ? 33.090 18.342  16.127 1.00 47.30 ? 589 LYS A CE  1 
ATOM   998  N  NZ  . LYS A 1 134 ? 32.169 18.718  15.035 1.00 47.27 ? 589 LYS A NZ  1 
ATOM   999  N  N   . GLY A 1 135 ? 31.277 14.475  20.554 1.00 42.15 ? 590 GLY A N   1 
ATOM   1000 C  CA  . GLY A 1 135 ? 29.893 14.018  20.566 1.00 41.33 ? 590 GLY A CA  1 
ATOM   1001 C  C   . GLY A 1 135 ? 29.138 13.949  19.236 1.00 40.70 ? 590 GLY A C   1 
ATOM   1002 O  O   . GLY A 1 135 ? 28.213 13.155  19.120 1.00 40.97 ? 590 GLY A O   1 
ATOM   1003 N  N   . THR A 1 136 ? 29.530 14.746  18.241 1.00 39.57 ? 591 THR A N   1 
ATOM   1004 C  CA  . THR A 1 136 ? 28.879 14.765  16.928 1.00 39.65 ? 591 THR A CA  1 
ATOM   1005 C  C   . THR A 1 136 ? 29.885 14.505  15.816 1.00 39.63 ? 591 THR A C   1 
ATOM   1006 O  O   . THR A 1 136 ? 30.911 15.174  15.735 1.00 40.38 ? 591 THR A O   1 
ATOM   1007 C  CB  . THR A 1 136 ? 28.167 16.118  16.644 1.00 39.50 ? 591 THR A CB  1 
ATOM   1008 O  OG1 . THR A 1 136 ? 27.127 16.305  17.594 1.00 40.63 ? 591 THR A OG1 1 
ATOM   1009 C  CG2 . THR A 1 136 ? 27.538 16.157  15.236 1.00 38.75 ? 591 THR A CG2 1 
ATOM   1010 N  N   . TYR A 1 137 ? 29.579 13.536  14.963 1.00 39.44 ? 592 TYR A N   1 
ATOM   1011 C  CA  . TYR A 1 137 ? 30.405 13.191  13.806 1.00 39.76 ? 592 TYR A CA  1 
ATOM   1012 C  C   . TYR A 1 137 ? 29.492 12.802  12.627 1.00 39.94 ? 592 TYR A C   1 
ATOM   1013 O  O   . TYR A 1 137 ? 28.937 11.691  12.571 1.00 39.88 ? 592 TYR A O   1 
ATOM   1014 C  CB  . TYR A 1 137 ? 31.371 12.047  14.155 1.00 39.72 ? 592 TYR A CB  1 
ATOM   1015 C  CG  . TYR A 1 137 ? 31.979 12.186  15.527 1.00 40.94 ? 592 TYR A CG  1 
ATOM   1016 C  CD1 . TYR A 1 137 ? 33.110 12.987  15.741 1.00 40.81 ? 592 TYR A CD1 1 
ATOM   1017 C  CD2 . TYR A 1 137 ? 31.416 11.532  16.626 1.00 41.50 ? 592 TYR A CD2 1 
ATOM   1018 C  CE1 . TYR A 1 137 ? 33.662 13.125  17.014 1.00 39.84 ? 592 TYR A CE1 1 
ATOM   1019 C  CE2 . TYR A 1 137 ? 31.960 11.672  17.898 1.00 41.75 ? 592 TYR A CE2 1 
ATOM   1020 C  CZ  . TYR A 1 137 ? 33.076 12.464  18.079 1.00 41.13 ? 592 TYR A CZ  1 
ATOM   1021 O  OH  . TYR A 1 137 ? 33.597 12.579  19.346 1.00 42.77 ? 592 TYR A OH  1 
ATOM   1022 N  N   . GLY A 1 138 ? 29.302 13.739  11.712 1.00 40.34 ? 593 GLY A N   1 
ATOM   1023 C  CA  . GLY A 1 138 ? 28.420 13.531  10.557 1.00 40.37 ? 593 GLY A CA  1 
ATOM   1024 C  C   . GLY A 1 138 ? 26.976 13.467  11.007 1.00 39.80 ? 593 GLY A C   1 
ATOM   1025 O  O   . GLY A 1 138 ? 26.474 14.405  11.610 1.00 40.57 ? 593 GLY A O   1 
ATOM   1026 N  N   . LEU A 1 139 ? 26.310 12.359  10.722 1.00 39.36 ? 594 LEU A N   1 
ATOM   1027 C  CA  . LEU A 1 139 ? 24.952 12.164  11.198 1.00 39.03 ? 594 LEU A CA  1 
ATOM   1028 C  C   . LEU A 1 139 ? 24.961 11.538  12.584 1.00 40.09 ? 594 LEU A C   1 
ATOM   1029 O  O   . LEU A 1 139 ? 23.936 11.515  13.261 1.00 40.79 ? 594 LEU A O   1 
ATOM   1030 C  CB  . LEU A 1 139 ? 24.136 11.314  10.205 1.00 38.54 ? 594 LEU A CB  1 
ATOM   1031 C  CG  . LEU A 1 139 ? 23.909 11.911  8.810  1.00 36.98 ? 594 LEU A CG  1 
ATOM   1032 C  CD1 . LEU A 1 139 ? 23.187 10.904  7.913  1.00 34.62 ? 594 LEU A CD1 1 
ATOM   1033 C  CD2 . LEU A 1 139 ? 23.160 13.216  8.920  1.00 32.39 ? 594 LEU A CD2 1 
ATOM   1034 N  N   . LEU A 1 140 ? 26.120 11.048  13.012 1.00 40.56 ? 595 LEU A N   1 
ATOM   1035 C  CA  . LEU A 1 140 ? 26.263 10.429  14.331 1.00 42.51 ? 595 LEU A CA  1 
ATOM   1036 C  C   . LEU A 1 140 ? 26.286 11.462  15.467 1.00 42.07 ? 595 LEU A C   1 
ATOM   1037 O  O   . LEU A 1 140 ? 27.238 12.244  15.590 1.00 42.95 ? 595 LEU A O   1 
ATOM   1038 C  CB  . LEU A 1 140 ? 27.543 9.589   14.354 1.00 42.15 ? 595 LEU A CB  1 
ATOM   1039 C  CG  . LEU A 1 140 ? 27.487 8.148   14.790 1.00 45.89 ? 595 LEU A CG  1 
ATOM   1040 C  CD1 . LEU A 1 140 ? 26.281 7.440   14.177 1.00 44.93 ? 595 LEU A CD1 1 
ATOM   1041 C  CD2 . LEU A 1 140 ? 28.805 7.415   14.465 1.00 44.45 ? 595 LEU A CD2 1 
ATOM   1042 N  N   . ARG A 1 141 ? 25.235 11.478  16.280 1.00 42.02 ? 596 ARG A N   1 
ATOM   1043 C  CA  . ARG A 1 141 ? 25.097 12.434  17.378 1.00 43.04 ? 596 ARG A CA  1 
ATOM   1044 C  C   . ARG A 1 141 ? 24.824 11.640  18.646 1.00 42.17 ? 596 ARG A C   1 
ATOM   1045 O  O   . ARG A 1 141 ? 23.714 11.133  18.839 1.00 42.10 ? 596 ARG A O   1 
ATOM   1046 C  CB  . ARG A 1 141 ? 23.982 13.448  17.066 1.00 42.97 ? 596 ARG A CB  1 
ATOM   1047 C  CG  . ARG A 1 141 ? 23.662 14.488  18.151 1.00 45.89 ? 596 ARG A CG  1 
ATOM   1048 C  CD  . ARG A 1 141 ? 23.169 15.838  17.553 1.00 47.49 ? 596 ARG A CD  1 
ATOM   1049 N  NE  . ARG A 1 141 ? 21.793 15.847  17.011 1.00 57.16 ? 596 ARG A NE  1 
ATOM   1050 C  CZ  . ARG A 1 141 ? 21.428 15.366  15.811 1.00 60.00 ? 596 ARG A CZ  1 
ATOM   1051 N  NH1 . ARG A 1 141 ? 22.325 14.805  15.010 1.00 61.50 ? 596 ARG A NH1 1 
ATOM   1052 N  NH2 . ARG A 1 141 ? 20.155 15.432  15.408 1.00 60.57 ? 596 ARG A NH2 1 
ATOM   1053 N  N   . ARG A 1 142 ? 25.871 11.487  19.465 1.00 41.22 ? 597 ARG A N   1 
ATOM   1054 C  CA  . ARG A 1 142 ? 25.810 10.791  20.741 1.00 40.42 ? 597 ARG A CA  1 
ATOM   1055 C  C   . ARG A 1 142 ? 24.825 11.493  21.678 1.00 40.08 ? 597 ARG A C   1 
ATOM   1056 O  O   . ARG A 1 142 ? 24.836 12.717  21.777 1.00 39.51 ? 597 ARG A O   1 
ATOM   1057 C  CB  . ARG A 1 142 ? 27.196 10.733  21.379 1.00 40.47 ? 597 ARG A CB  1 
ATOM   1058 C  CG  . ARG A 1 142 ? 27.235 9.909   22.654 1.00 40.00 ? 597 ARG A CG  1 
ATOM   1059 C  CD  . ARG A 1 142 ? 28.632 9.657   23.170 1.00 37.65 ? 597 ARG A CD  1 
ATOM   1060 N  NE  . ARG A 1 142 ? 29.276 10.858  23.699 1.00 39.02 ? 597 ARG A NE  1 
ATOM   1061 C  CZ  . ARG A 1 142 ? 30.430 11.353  23.247 1.00 38.71 ? 597 ARG A CZ  1 
ATOM   1062 N  NH1 . ARG A 1 142 ? 31.082 10.761  22.250 1.00 37.75 ? 597 ARG A NH1 1 
ATOM   1063 N  NH2 . ARG A 1 142 ? 30.944 12.437  23.801 1.00 38.72 ? 597 ARG A NH2 1 
ATOM   1064 N  N   . ARG A 1 143 ? 23.954 10.714  22.319 1.00 39.35 ? 598 ARG A N   1 
ATOM   1065 C  CA  . ARG A 1 143 ? 22.989 11.241  23.286 1.00 39.42 ? 598 ARG A CA  1 
ATOM   1066 C  C   . ARG A 1 143 ? 23.707 11.742  24.547 1.00 39.82 ? 598 ARG A C   1 
ATOM   1067 O  O   . ARG A 1 143 ? 24.632 11.082  25.050 1.00 39.00 ? 598 ARG A O   1 
ATOM   1068 C  CB  . ARG A 1 143 ? 22.011 10.146  23.720 1.00 39.47 ? 598 ARG A CB  1 
ATOM   1069 C  CG  . ARG A 1 143 ? 21.343 9.351   22.612 1.00 38.35 ? 598 ARG A CG  1 
ATOM   1070 C  CD  . ARG A 1 143 ? 19.949 9.800   22.424 1.00 36.79 ? 598 ARG A CD  1 
ATOM   1071 N  NE  . ARG A 1 143 ? 19.209 8.948   21.513 1.00 36.08 ? 598 ARG A NE  1 
ATOM   1072 C  CZ  . ARG A 1 143 ? 18.096 9.320   20.903 1.00 34.68 ? 598 ARG A CZ  1 
ATOM   1073 N  NH1 . ARG A 1 143 ? 17.595 10.519  21.135 1.00 33.95 ? 598 ARG A NH1 1 
ATOM   1074 N  NH2 . ARG A 1 143 ? 17.484 8.492   20.059 1.00 35.15 ? 598 ARG A NH2 1 
ATOM   1075 N  N   . GLU A 1 144 ? 23.261 12.892  25.062 1.00 40.31 ? 599 GLU A N   1 
ATOM   1076 C  CA  . GLU A 1 144 ? 23.770 13.429  26.309 1.00 41.14 ? 599 GLU A CA  1 
ATOM   1077 C  C   . GLU A 1 144 ? 23.528 12.397  27.425 1.00 40.68 ? 599 GLU A C   1 
ATOM   1078 O  O   . GLU A 1 144 ? 24.356 12.234  28.309 1.00 40.95 ? 599 GLU A O   1 
ATOM   1079 C  CB  . GLU A 1 144 ? 23.132 14.810  26.634 1.00 41.46 ? 599 GLU A CB  1 
ATOM   1080 C  CG  . GLU A 1 144 ? 23.727 16.023  25.840 1.00 42.95 ? 599 GLU A CG  1 
ATOM   1081 C  CD  . GLU A 1 144 ? 22.964 17.388  26.028 1.00 43.67 ? 599 GLU A CD  1 
ATOM   1082 O  OE1 . GLU A 1 144 ? 22.896 17.937  27.163 1.00 45.52 ? 599 GLU A OE1 1 
ATOM   1083 O  OE2 . GLU A 1 144 ? 22.452 17.936  25.017 1.00 46.04 ? 599 GLU A OE2 1 
ATOM   1084 N  N   . ASP A 1 145 ? 22.416 11.671  27.340 1.00 40.18 ? 600 ASP A N   1 
ATOM   1085 C  CA  . ASP A 1 145 ? 21.973 10.770  28.408 1.00 39.69 ? 600 ASP A CA  1 
ATOM   1086 C  C   . ASP A 1 145 ? 22.018 9.277   28.015 1.00 39.30 ? 600 ASP A C   1 
ATOM   1087 O  O   . ASP A 1 145 ? 21.179 8.489   28.462 1.00 39.47 ? 600 ASP A O   1 
ATOM   1088 C  CB  . ASP A 1 145 ? 20.555 11.155  28.865 1.00 39.54 ? 600 ASP A CB  1 
ATOM   1089 C  CG  . ASP A 1 145 ? 19.528 11.113  27.714 1.00 39.77 ? 600 ASP A CG  1 
ATOM   1090 O  OD1 . ASP A 1 145 ? 19.937 10.943  26.544 1.00 36.53 ? 600 ASP A OD1 1 
ATOM   1091 O  OD2 . ASP A 1 145 ? 18.310 11.254  27.987 1.00 39.46 ? 600 ASP A OD2 1 
ATOM   1092 N  N   . TRP A 1 146 ? 23.007 8.878   27.219 1.00 38.36 ? 601 TRP A N   1 
ATOM   1093 C  CA  . TRP A 1 146 ? 23.090 7.488   26.797 1.00 37.97 ? 601 TRP A CA  1 
ATOM   1094 C  C   . TRP A 1 146 ? 23.179 6.481   27.972 1.00 37.72 ? 601 TRP A C   1 
ATOM   1095 O  O   . TRP A 1 146 ? 22.638 5.383   27.850 1.00 36.90 ? 601 TRP A O   1 
ATOM   1096 C  CB  . TRP A 1 146 ? 24.190 7.250   25.741 1.00 37.93 ? 601 TRP A CB  1 
ATOM   1097 C  CG  . TRP A 1 146 ? 25.593 7.450   26.237 1.00 39.69 ? 601 TRP A CG  1 
ATOM   1098 C  CD1 . TRP A 1 146 ? 26.339 8.599   26.167 1.00 38.65 ? 601 TRP A CD1 1 
ATOM   1099 C  CD2 . TRP A 1 146 ? 26.420 6.472   26.914 1.00 39.49 ? 601 TRP A CD2 1 
ATOM   1100 N  NE1 . TRP A 1 146 ? 27.569 8.395   26.752 1.00 39.68 ? 601 TRP A NE1 1 
ATOM   1101 C  CE2 . TRP A 1 146 ? 27.648 7.104   27.215 1.00 40.02 ? 601 TRP A CE2 1 
ATOM   1102 C  CE3 . TRP A 1 146 ? 26.232 5.132   27.293 1.00 38.51 ? 601 TRP A CE3 1 
ATOM   1103 C  CZ2 . TRP A 1 146 ? 28.695 6.440   27.884 1.00 40.87 ? 601 TRP A CZ2 1 
ATOM   1104 C  CZ3 . TRP A 1 146 ? 27.274 4.461   27.948 1.00 39.89 ? 601 TRP A CZ3 1 
ATOM   1105 C  CH2 . TRP A 1 146 ? 28.488 5.121   28.250 1.00 39.80 ? 601 TRP A CH2 1 
ATOM   1106 N  N   . PRO A 1 147 ? 23.837 6.848   29.107 1.00 37.35 ? 602 PRO A N   1 
ATOM   1107 C  CA  . PRO A 1 147 ? 23.930 5.839   30.164 1.00 37.30 ? 602 PRO A CA  1 
ATOM   1108 C  C   . PRO A 1 147 ? 22.577 5.450   30.761 1.00 37.40 ? 602 PRO A C   1 
ATOM   1109 O  O   . PRO A 1 147 ? 22.337 4.259   30.946 1.00 37.34 ? 602 PRO A O   1 
ATOM   1110 C  CB  . PRO A 1 147 ? 24.835 6.499   31.225 1.00 37.09 ? 602 PRO A CB  1 
ATOM   1111 C  CG  . PRO A 1 147 ? 25.520 7.598   30.509 1.00 37.34 ? 602 PRO A CG  1 
ATOM   1112 C  CD  . PRO A 1 147 ? 24.525 8.089   29.504 1.00 37.22 ? 602 PRO A CD  1 
ATOM   1113 N  N   . SER A 1 148 ? 21.706 6.420   31.052 1.00 36.89 ? 603 SER A N   1 
ATOM   1114 C  CA  . SER A 1 148 ? 20.353 6.081   31.531 1.00 37.65 ? 603 SER A CA  1 
ATOM   1115 C  C   . SER A 1 148 ? 19.479 5.427   30.439 1.00 37.72 ? 603 SER A C   1 
ATOM   1116 O  O   . SER A 1 148 ? 18.721 4.495   30.723 1.00 37.92 ? 603 SER A O   1 
ATOM   1117 C  CB  . SER A 1 148 ? 19.635 7.281   32.189 1.00 37.29 ? 603 SER A CB  1 
ATOM   1118 O  OG  . SER A 1 148 ? 19.864 8.459   31.439 1.00 38.41 ? 603 SER A OG  1 
ATOM   1119 N  N   . ARG A 1 149 ? 19.592 5.895   29.203 1.00 37.43 ? 604 ARG A N   1 
ATOM   1120 C  CA  . ARG A 1 149 ? 18.906 5.236   28.093 1.00 37.93 ? 604 ARG A CA  1 
ATOM   1121 C  C   . ARG A 1 149 ? 19.346 3.783   27.959 1.00 38.67 ? 604 ARG A C   1 
ATOM   1122 O  O   . ARG A 1 149 ? 18.510 2.895   27.836 1.00 38.53 ? 604 ARG A O   1 
ATOM   1123 C  CB  . ARG A 1 149 ? 19.155 5.972   26.781 1.00 37.89 ? 604 ARG A CB  1 
ATOM   1124 C  CG  . ARG A 1 149 ? 18.265 7.208   26.612 1.00 38.26 ? 604 ARG A CG  1 
ATOM   1125 C  CD  . ARG A 1 149 ? 18.731 8.016   25.419 1.00 38.11 ? 604 ARG A CD  1 
ATOM   1126 N  NE  . ARG A 1 149 ? 17.857 9.159   25.214 1.00 37.81 ? 604 ARG A NE  1 
ATOM   1127 C  CZ  . ARG A 1 149 ? 16.705 9.104   24.556 1.00 37.27 ? 604 ARG A CZ  1 
ATOM   1128 N  NH1 . ARG A 1 149 ? 16.283 7.956   24.028 1.00 38.02 ? 604 ARG A NH1 1 
ATOM   1129 N  NH2 . ARG A 1 149 ? 15.964 10.189  24.450 1.00 34.57 ? 604 ARG A NH2 1 
ATOM   1130 N  N   . LEU A 1 150 ? 20.657 3.551   28.013 1.00 39.12 ? 605 LEU A N   1 
ATOM   1131 C  CA  . LEU A 1 150 ? 21.224 2.220   27.864 1.00 40.45 ? 605 LEU A CA  1 
ATOM   1132 C  C   . LEU A 1 150 ? 20.739 1.321   29.017 1.00 41.09 ? 605 LEU A C   1 
ATOM   1133 O  O   . LEU A 1 150 ? 20.297 0.195   28.796 1.00 41.14 ? 605 LEU A O   1 
ATOM   1134 C  CB  . LEU A 1 150 ? 22.757 2.319   27.778 1.00 40.30 ? 605 LEU A CB  1 
ATOM   1135 C  CG  . LEU A 1 150 ? 23.565 1.234   27.072 1.00 42.29 ? 605 LEU A CG  1 
ATOM   1136 C  CD1 . LEU A 1 150 ? 23.241 1.158   25.586 1.00 41.42 ? 605 LEU A CD1 1 
ATOM   1137 C  CD2 . LEU A 1 150 ? 25.063 1.415   27.322 1.00 40.64 ? 605 LEU A CD2 1 
ATOM   1138 N  N   . GLN A 1 151 ? 20.738 1.848   30.237 1.00 41.68 ? 606 GLN A N   1 
ATOM   1139 C  CA  . GLN A 1 151 ? 20.234 1.106   31.367 1.00 42.75 ? 606 GLN A CA  1 
ATOM   1140 C  C   . GLN A 1 151 ? 18.756 0.714   31.211 1.00 42.95 ? 606 GLN A C   1 
ATOM   1141 O  O   . GLN A 1 151 ? 18.390 -0.434  31.496 1.00 43.40 ? 606 GLN A O   1 
ATOM   1142 C  CB  . GLN A 1 151 ? 20.430 1.898   32.671 1.00 43.21 ? 606 GLN A CB  1 
ATOM   1143 C  CG  . GLN A 1 151 ? 21.816 1.764   33.290 1.00 45.65 ? 606 GLN A CG  1 
ATOM   1144 C  CD  . GLN A 1 151 ? 21.764 1.804   34.799 1.00 49.92 ? 606 GLN A CD  1 
ATOM   1145 O  OE1 . GLN A 1 151 ? 21.916 0.772   35.472 1.00 51.30 ? 606 GLN A OE1 1 
ATOM   1146 N  NE2 . GLN A 1 151 ? 21.502 2.991   35.351 1.00 51.45 ? 606 GLN A NE2 1 
ATOM   1147 N  N   . MET A 1 152 ? 17.915 1.665   30.791 1.00 42.40 ? 607 MET A N   1 
ATOM   1148 C  CA  . MET A 1 152 ? 16.492 1.406   30.546 1.00 42.80 ? 607 MET A CA  1 
ATOM   1149 C  C   . MET A 1 152 ? 16.325 0.333   29.464 1.00 41.37 ? 607 MET A C   1 
ATOM   1150 O  O   . MET A 1 152 ? 15.542 -0.602  29.611 1.00 41.25 ? 607 MET A O   1 
ATOM   1151 C  CB  . MET A 1 152 ? 15.743 2.698   30.156 1.00 42.25 ? 607 MET A CB  1 
ATOM   1152 C  CG  . MET A 1 152 ? 15.526 3.718   31.315 1.00 44.30 ? 607 MET A CG  1 
ATOM   1153 S  SD  . MET A 1 152 ? 14.394 5.124   30.924 1.00 47.63 ? 607 MET A SD  1 
ATOM   1154 C  CE  . MET A 1 152 ? 15.144 5.874   29.425 1.00 44.83 ? 607 MET A CE  1 
ATOM   1155 N  N   . PHE A 1 153 ? 17.113 0.461   28.403 1.00 40.38 ? 608 PHE A N   1 
ATOM   1156 C  CA  . PHE A 1 153 ? 17.099 -0.435  27.257 1.00 39.85 ? 608 PHE A CA  1 
ATOM   1157 C  C   . PHE A 1 153 ? 17.350 -1.894  27.637 1.00 39.62 ? 608 PHE A C   1 
ATOM   1158 O  O   . PHE A 1 153 ? 16.740 -2.791  27.066 1.00 38.91 ? 608 PHE A O   1 
ATOM   1159 C  CB  . PHE A 1 153 ? 18.177 0.042   26.295 1.00 40.43 ? 608 PHE A CB  1 
ATOM   1160 C  CG  . PHE A 1 153 ? 18.095 -0.533  24.933 1.00 40.43 ? 608 PHE A CG  1 
ATOM   1161 C  CD1 . PHE A 1 153 ? 17.323 0.090   23.947 1.00 41.28 ? 608 PHE A CD1 1 
ATOM   1162 C  CD2 . PHE A 1 153 ? 18.834 -1.660  24.602 1.00 42.04 ? 608 PHE A CD2 1 
ATOM   1163 C  CE1 . PHE A 1 153 ? 17.271 -0.419  22.652 1.00 40.94 ? 608 PHE A CE1 1 
ATOM   1164 C  CE2 . PHE A 1 153 ? 18.794 -2.186  23.291 1.00 43.87 ? 608 PHE A CE2 1 
ATOM   1165 C  CZ  . PHE A 1 153 ? 18.003 -1.559  22.313 1.00 40.67 ? 608 PHE A CZ  1 
ATOM   1166 N  N   . PHE A 1 154 ? 18.236 -2.125  28.607 1.00 39.99 ? 609 PHE A N   1 
ATOM   1167 C  CA  . PHE A 1 154 ? 18.610 -3.486  29.003 1.00 40.20 ? 609 PHE A CA  1 
ATOM   1168 C  C   . PHE A 1 154 ? 17.788 -4.048  30.131 1.00 41.29 ? 609 PHE A C   1 
ATOM   1169 O  O   . PHE A 1 154 ? 17.862 -5.240  30.421 1.00 42.47 ? 609 PHE A O   1 
ATOM   1170 C  CB  . PHE A 1 154 ? 20.106 -3.573  29.315 1.00 39.43 ? 609 PHE A CB  1 
ATOM   1171 C  CG  . PHE A 1 154 ? 20.942 -3.705  28.089 1.00 38.96 ? 609 PHE A CG  1 
ATOM   1172 C  CD1 . PHE A 1 154 ? 21.332 -4.957  27.636 1.00 37.58 ? 609 PHE A CD1 1 
ATOM   1173 C  CD2 . PHE A 1 154 ? 21.294 -2.588  27.358 1.00 36.24 ? 609 PHE A CD2 1 
ATOM   1174 C  CE1 . PHE A 1 154 ? 22.076 -5.092  26.475 1.00 36.49 ? 609 PHE A CE1 1 
ATOM   1175 C  CE2 . PHE A 1 154 ? 22.037 -2.705  26.195 1.00 39.36 ? 609 PHE A CE2 1 
ATOM   1176 C  CZ  . PHE A 1 154 ? 22.446 -3.955  25.755 1.00 38.84 ? 609 PHE A CZ  1 
ATOM   1177 N  N   . ALA A 1 155 ? 17.004 -3.193  30.771 1.00 42.10 ? 610 ALA A N   1 
ATOM   1178 C  CA  . ALA A 1 155 ? 16.166 -3.602  31.898 1.00 43.16 ? 610 ALA A CA  1 
ATOM   1179 C  C   . ALA A 1 155 ? 14.797 -4.159  31.471 1.00 43.81 ? 610 ALA A C   1 
ATOM   1180 O  O   . ALA A 1 155 ? 14.156 -4.909  32.229 1.00 44.26 ? 610 ALA A O   1 
ATOM   1181 C  CB  . ALA A 1 155 ? 15.974 -2.423  32.856 1.00 43.06 ? 610 ALA A CB  1 
HETATM 1182 ZN ZN  . ZN  B 2 .   ? 16.369 -2.087  12.331 1.00 53.55 ? 1   ZN  A ZN  1 
HETATM 1183 ZN ZN  . ZN  C 2 .   ? 27.787 -1.190  11.297 1.00 54.05 ? 2   ZN  A ZN  1 
HETATM 1184 ZN ZN  . ZN  D 2 .   ? 35.362 3.943   22.562 1.00 64.59 ? 3   ZN  A ZN  1 
HETATM 1185 C  C1  . EDO E 3 .   ? 25.976 -3.947  20.708 1.00 68.83 ? 615 EDO A C1  1 
HETATM 1186 O  O1  . EDO E 3 .   ? 26.949 -3.077  21.275 1.00 69.77 ? 615 EDO A O1  1 
HETATM 1187 C  C2  . EDO E 3 .   ? 26.283 -4.030  19.227 1.00 69.05 ? 615 EDO A C2  1 
HETATM 1188 O  O2  . EDO E 3 .   ? 27.355 -4.952  19.020 1.00 68.70 ? 615 EDO A O2  1 
HETATM 1189 C  C1  . EDO F 3 .   ? 15.071 8.761   17.871 1.00 66.30 ? 616 EDO A C1  1 
HETATM 1190 O  O1  . EDO F 3 .   ? 15.701 9.883   18.495 1.00 65.12 ? 616 EDO A O1  1 
HETATM 1191 C  C2  . EDO F 3 .   ? 13.546 8.763   17.771 1.00 66.64 ? 616 EDO A C2  1 
HETATM 1192 O  O2  . EDO F 3 .   ? 13.139 7.522   17.158 1.00 63.97 ? 616 EDO A O2  1 
HETATM 1193 C  C1  . EDO G 3 .   ? 27.557 -5.590  29.384 1.00 79.44 ? 617 EDO A C1  1 
HETATM 1194 O  O1  . EDO G 3 .   ? 28.960 -5.821  29.179 1.00 79.22 ? 617 EDO A O1  1 
HETATM 1195 C  C2  . EDO G 3 .   ? 26.890 -5.701  28.026 1.00 80.57 ? 617 EDO A C2  1 
HETATM 1196 O  O2  . EDO G 3 .   ? 27.911 -5.816  27.027 1.00 81.78 ? 617 EDO A O2  1 
HETATM 1197 C  C1  . EDO H 3 .   ? 36.269 10.838  15.850 1.00 83.85 ? 4   EDO A C1  1 
HETATM 1198 O  O1  . EDO H 3 .   ? 36.975 9.808   15.151 1.00 85.71 ? 4   EDO A O1  1 
HETATM 1199 C  C2  . EDO H 3 .   ? 35.931 10.361  17.253 1.00 83.64 ? 4   EDO A C2  1 
HETATM 1200 O  O2  . EDO H 3 .   ? 37.139 10.291  18.012 1.00 84.23 ? 4   EDO A O2  1 
HETATM 1201 C  C1  . EDO I 3 .   ? 26.445 -14.016 23.931 1.00 70.10 ? 5   EDO A C1  1 
HETATM 1202 O  O1  . EDO I 3 .   ? 26.668 -15.188 23.143 1.00 68.47 ? 5   EDO A O1  1 
HETATM 1203 C  C2  . EDO I 3 .   ? 25.126 -13.354 23.501 1.00 70.21 ? 5   EDO A C2  1 
HETATM 1204 O  O2  . EDO I 3 .   ? 24.648 -13.938 22.275 1.00 70.86 ? 5   EDO A O2  1 
HETATM 1205 C  C1  . EDO J 3 .   ? 31.193 -3.824  6.370  1.00 73.14 ? 6   EDO A C1  1 
HETATM 1206 O  O1  . EDO J 3 .   ? 32.126 -3.285  7.306  1.00 66.25 ? 6   EDO A O1  1 
HETATM 1207 C  C2  . EDO J 3 .   ? 29.783 -3.943  6.949  1.00 76.69 ? 6   EDO A C2  1 
HETATM 1208 O  O2  . EDO J 3 .   ? 28.989 -4.811  6.117  1.00 80.11 ? 6   EDO A O2  1 
HETATM 1209 C  C1  . EDO K 3 .   ? 26.507 -2.593  25.690 1.00 85.91 ? 7   EDO A C1  1 
HETATM 1210 O  O1  . EDO K 3 .   ? 26.385 -1.193  25.930 1.00 85.94 ? 7   EDO A O1  1 
HETATM 1211 C  C2  . EDO K 3 .   ? 26.611 -2.763  24.192 1.00 85.14 ? 7   EDO A C2  1 
HETATM 1212 O  O2  . EDO K 3 .   ? 26.063 -1.587  23.611 1.00 84.82 ? 7   EDO A O2  1 
HETATM 1213 O  O   . HOH L 4 .   ? 9.357  5.694   10.425 1.00 58.19 ? 8   HOH A O   1 
HETATM 1214 O  O   . HOH L 4 .   ? 29.072 -7.271  19.609 1.00 54.77 ? 9   HOH A O   1 
HETATM 1215 O  O   . HOH L 4 .   ? 16.731 5.413   24.238 1.00 56.07 ? 10  HOH A O   1 
HETATM 1216 O  O   . HOH L 4 .   ? 10.953 11.589  8.598  1.00 53.12 ? 11  HOH A O   1 
HETATM 1217 O  O   . HOH L 4 .   ? 17.813 14.233  10.742 1.00 55.09 ? 12  HOH A O   1 
HETATM 1218 O  O   . HOH L 4 .   ? 26.602 11.676  6.157  1.00 74.38 ? 15  HOH A O   1 
HETATM 1219 O  O   . HOH L 4 .   ? 10.828 -0.335  6.152  1.00 69.24 ? 16  HOH A O   1 
HETATM 1220 O  O   . HOH L 4 .   ? 9.860  -1.960  15.242 1.00 62.74 ? 17  HOH A O   1 
HETATM 1221 O  O   . HOH L 4 .   ? 20.209 -2.195  32.823 1.00 67.09 ? 18  HOH A O   1 
HETATM 1222 O  O   . HOH L 4 .   ? 15.053 17.522  8.292  1.00 78.85 ? 19  HOH A O   1 
HETATM 1223 O  O   . HOH L 4 .   ? 20.237 3.345   8.491  1.00 67.29 ? 20  HOH A O   1 
HETATM 1224 O  O   . HOH L 4 .   ? 23.111 -15.144 21.023 1.00 72.63 ? 21  HOH A O   1 
HETATM 1225 O  O   . HOH L 4 .   ? 16.477 11.384  -6.252 1.00 65.01 ? 22  HOH A O   1 
HETATM 1226 O  O   . HOH L 4 .   ? 12.419 4.726   23.288 1.00 62.88 ? 23  HOH A O   1 
HETATM 1227 O  O   . HOH L 4 .   ? 12.485 -2.155  5.447  1.00 78.23 ? 24  HOH A O   1 
HETATM 1228 O  O   . HOH L 4 .   ? 33.836 -10.519 15.283 1.00 66.06 ? 29  HOH A O   1 
HETATM 1229 O  O   . HOH L 4 .   ? 31.425 2.945   25.208 1.00 68.07 ? 31  HOH A O   1 
HETATM 1230 O  O   . HOH L 4 .   ? 18.914 4.407   -4.444 1.00 73.13 ? 36  HOH A O   1 
HETATM 1231 O  O   . HOH L 4 .   ? 9.926  9.505   7.679  1.00 71.25 ? 38  HOH A O   1 
HETATM 1232 O  O   . HOH L 4 .   ? 20.481 14.275  11.112 1.00 61.35 ? 39  HOH A O   1 
HETATM 1233 O  O   . HOH L 4 .   ? 21.390 16.719  7.809  1.00 71.48 ? 40  HOH A O   1 
HETATM 1234 O  O   . HOH L 4 .   ? 26.487 -3.425  8.100  1.00 73.88 ? 43  HOH A O   1 
HETATM 1235 O  O   . HOH L 4 .   ? 8.258  7.037   12.341 1.00 74.58 ? 44  HOH A O   1 
HETATM 1236 O  O   . HOH L 4 .   ? 17.842 -11.800 17.312 1.00 87.55 ? 45  HOH A O   1 
HETATM 1237 O  O   . HOH L 4 .   ? 12.763 6.501   0.197  1.00 76.07 ? 46  HOH A O   1 
HETATM 1238 O  O   . HOH L 4 .   ? 20.083 3.445   -7.568 1.00 76.41 ? 47  HOH A O   1 
HETATM 1239 O  O   . HOH L 4 .   ? 33.439 -4.382  27.909 1.00 73.72 ? 48  HOH A O   1 
HETATM 1240 O  O   . HOH L 4 .   ? 40.703 10.117  18.337 1.00 87.33 ? 50  HOH A O   1 
HETATM 1241 O  O   . HOH L 4 .   ? 24.958 -11.966 16.662 1.00 88.87 ? 51  HOH A O   1 
HETATM 1242 O  O   . HOH L 4 .   ? 22.223 13.412  13.031 1.00 66.64 ? 52  HOH A O   1 
HETATM 1243 O  O   . HOH L 4 .   ? 42.368 1.094   17.740 1.00 71.79 ? 53  HOH A O   1 
HETATM 1244 O  O   . HOH L 4 .   ? 17.437 15.333  8.293  1.00 52.49 ? 618 HOH A O   1 
HETATM 1245 O  O   . HOH L 4 .   ? 24.270 14.318  -0.243 1.00 66.53 ? 619 HOH A O   1 
HETATM 1246 O  O   . HOH L 4 .   ? 22.899 10.063  15.396 1.00 48.61 ? 620 HOH A O   1 
HETATM 1247 O  O   . HOH L 4 .   ? 30.796 -2.696  19.265 1.00 46.49 ? 621 HOH A O   1 
HETATM 1248 O  O   . HOH L 4 .   ? 22.726 -0.382  17.255 1.00 62.13 ? 622 HOH A O   1 
HETATM 1249 O  O   . HOH L 4 .   ? 22.627 9.645   31.834 1.00 52.51 ? 623 HOH A O   1 
HETATM 1250 O  O   . HOH L 4 .   ? 21.129 3.194   -2.859 1.00 47.10 ? 624 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   456 456 ALA ALA A . n 
A 1 2   ARG 2   457 457 ARG ARG A . n 
A 1 3   THR 3   458 458 THR THR A . n 
A 1 4   LYS 4   459 459 LYS LYS A . n 
A 1 5   GLN 5   460 460 GLN GLN A . n 
A 1 6   THR 6   461 461 THR THR A . n 
A 1 7   ALA 7   462 462 ALA ALA A . n 
A 1 8   ARG 8   463 463 ARG ARG A . n 
A 1 9   LYS 9   464 464 LYS LYS A . n 
A 1 10  SER 10  465 ?   ?   ?   A . n 
A 1 11  THR 11  466 ?   ?   ?   A . n 
A 1 12  GLY 12  467 ?   ?   ?   A . n 
A 1 13  GLY 13  468 ?   ?   ?   A . n 
A 1 14  LYS 14  469 ?   ?   ?   A . n 
A 1 15  ALA 15  470 ?   ?   ?   A . n 
A 1 16  PRO 16  471 ?   ?   ?   A . n 
A 1 17  ARG 17  472 472 ARG ARG A . n 
A 1 18  LYS 18  473 473 LYS LYS A . n 
A 1 19  GLN 19  474 474 GLN GLN A . n 
A 1 20  LEU 20  475 475 LEU LEU A . n 
A 1 21  ARG 21  476 476 ARG ARG A . n 
A 1 22  GLU 22  477 477 GLU GLU A . n 
A 1 23  ARG 23  478 478 ARG ARG A . n 
A 1 24  LEU 24  479 479 LEU LEU A . n 
A 1 25  VAL 25  480 480 VAL VAL A . n 
A 1 26  TYR 26  481 481 TYR TYR A . n 
A 1 27  GLU 27  482 482 GLU GLU A . n 
A 1 28  VAL 28  483 483 VAL VAL A . n 
A 1 29  ARG 29  484 484 ARG ARG A . n 
A 1 30  GLN 30  485 485 GLN GLN A . n 
A 1 31  LYS 31  486 486 LYS LYS A . n 
A 1 32  CYS 32  487 487 CYS CYS A . n 
A 1 33  ARG 33  488 488 ARG ARG A . n 
A 1 34  ASN 34  489 489 ASN ASN A . n 
A 1 35  ILE 35  490 490 ILE ILE A . n 
A 1 36  GLU 36  491 491 GLU GLU A . n 
A 1 37  ASP 37  492 492 ASP ASP A . n 
A 1 38  ILE 38  493 493 ILE ILE A . n 
A 1 39  CYS 39  494 494 CYS CYS A . n 
A 1 40  ILE 40  495 495 ILE ILE A . n 
A 1 41  SER 41  496 496 SER SER A . n 
A 1 42  CYS 42  497 497 CYS CYS A . n 
A 1 43  GLY 43  498 498 GLY GLY A . n 
A 1 44  SER 44  499 499 SER SER A . n 
A 1 45  LEU 45  500 500 LEU LEU A . n 
A 1 46  ASN 46  501 501 ASN ASN A . n 
A 1 47  VAL 47  502 502 VAL VAL A . n 
A 1 48  THR 48  503 503 THR THR A . n 
A 1 49  LEU 49  504 504 LEU LEU A . n 
A 1 50  GLU 50  505 505 GLU GLU A . n 
A 1 51  HIS 51  506 506 HIS HIS A . n 
A 1 52  PRO 52  507 507 PRO PRO A . n 
A 1 53  LEU 53  508 508 LEU LEU A . n 
A 1 54  PHE 54  509 509 PHE PHE A . n 
A 1 55  VAL 55  510 510 VAL VAL A . n 
A 1 56  GLY 56  511 511 GLY GLY A . n 
A 1 57  GLY 57  512 512 GLY GLY A . n 
A 1 58  MET 58  513 513 MET MET A . n 
A 1 59  CYS 59  514 514 CYS CYS A . n 
A 1 60  GLN 60  515 515 GLN GLN A . n 
A 1 61  ASN 61  516 516 ASN ASN A . n 
A 1 62  CYS 62  517 517 CYS CYS A . n 
A 1 63  LYS 63  518 518 LYS LYS A . n 
A 1 64  ASN 64  519 519 ASN ASN A . n 
A 1 65  CYS 65  520 520 CYS CYS A . n 
A 1 66  PHE 66  521 521 PHE PHE A . n 
A 1 67  LEU 67  522 522 LEU LEU A . n 
A 1 68  GLU 68  523 523 GLU GLU A . n 
A 1 69  CYS 69  524 524 CYS CYS A . n 
A 1 70  ALA 70  525 525 ALA ALA A . n 
A 1 71  TYR 71  526 526 TYR TYR A . n 
A 1 72  GLN 72  527 527 GLN GLN A . n 
A 1 73  TYR 73  528 528 TYR TYR A . n 
A 1 74  ASP 74  529 529 ASP ASP A . n 
A 1 75  ASP 75  530 530 ASP ASP A . n 
A 1 76  ASP 76  531 531 ASP ASP A . n 
A 1 77  GLY 77  532 532 GLY GLY A . n 
A 1 78  TYR 78  533 533 TYR TYR A . n 
A 1 79  GLN 79  534 534 GLN GLN A . n 
A 1 80  SER 80  535 535 SER SER A . n 
A 1 81  TYR 81  536 536 TYR TYR A . n 
A 1 82  CYS 82  537 537 CYS CYS A . n 
A 1 83  THR 83  538 538 THR THR A . n 
A 1 84  ILE 84  539 539 ILE ILE A . n 
A 1 85  CYS 85  540 540 CYS CYS A . n 
A 1 86  CYS 86  541 541 CYS CYS A . n 
A 1 87  GLY 87  542 542 GLY GLY A . n 
A 1 88  GLY 88  543 543 GLY GLY A . n 
A 1 89  ARG 89  544 544 ARG ARG A . n 
A 1 90  GLU 90  545 545 GLU GLU A . n 
A 1 91  VAL 91  546 546 VAL VAL A . n 
A 1 92  LEU 92  547 547 LEU LEU A . n 
A 1 93  MET 93  548 548 MET MET A . n 
A 1 94  CYS 94  549 549 CYS CYS A . n 
A 1 95  GLY 95  550 550 GLY GLY A . n 
A 1 96  ASN 96  551 551 ASN ASN A . n 
A 1 97  ASN 97  552 552 ASN ASN A . n 
A 1 98  ASN 98  553 553 ASN ASN A . n 
A 1 99  CYS 99  554 554 CYS CYS A . n 
A 1 100 CYS 100 555 555 CYS CYS A . n 
A 1 101 ARG 101 556 556 ARG ARG A . n 
A 1 102 CYS 102 557 557 CYS CYS A . n 
A 1 103 PHE 103 558 558 PHE PHE A . n 
A 1 104 CYS 104 559 559 CYS CYS A . n 
A 1 105 VAL 105 560 560 VAL VAL A . n 
A 1 106 GLU 106 561 561 GLU GLU A . n 
A 1 107 CYS 107 562 562 CYS CYS A . n 
A 1 108 VAL 108 563 563 VAL VAL A . n 
A 1 109 ASP 109 564 564 ASP ASP A . n 
A 1 110 LEU 110 565 565 LEU LEU A . n 
A 1 111 LEU 111 566 566 LEU LEU A . n 
A 1 112 VAL 112 567 567 VAL VAL A . n 
A 1 113 GLY 113 568 568 GLY GLY A . n 
A 1 114 PRO 114 569 569 PRO PRO A . n 
A 1 115 GLY 115 570 570 GLY GLY A . n 
A 1 116 ALA 116 571 571 ALA ALA A . n 
A 1 117 ALA 117 572 572 ALA ALA A . n 
A 1 118 GLN 118 573 573 GLN GLN A . n 
A 1 119 ALA 119 574 574 ALA ALA A . n 
A 1 120 ALA 120 575 575 ALA ALA A . n 
A 1 121 ILE 121 576 576 ILE ILE A . n 
A 1 122 LYS 122 577 577 LYS LYS A . n 
A 1 123 GLU 123 578 578 GLU GLU A . n 
A 1 124 ASP 124 579 579 ASP ASP A . n 
A 1 125 PRO 125 580 580 PRO PRO A . n 
A 1 126 TRP 126 581 581 TRP TRP A . n 
A 1 127 ASN 127 582 582 ASN ASN A . n 
A 1 128 CYS 128 583 583 CYS CYS A . n 
A 1 129 TYR 129 584 584 TYR TYR A . n 
A 1 130 MET 130 585 585 MET MET A . n 
A 1 131 CYS 131 586 586 CYS CYS A . n 
A 1 132 GLY 132 587 587 GLY GLY A . n 
A 1 133 HIS 133 588 588 HIS HIS A . n 
A 1 134 LYS 134 589 589 LYS LYS A . n 
A 1 135 GLY 135 590 590 GLY GLY A . n 
A 1 136 THR 136 591 591 THR THR A . n 
A 1 137 TYR 137 592 592 TYR TYR A . n 
A 1 138 GLY 138 593 593 GLY GLY A . n 
A 1 139 LEU 139 594 594 LEU LEU A . n 
A 1 140 LEU 140 595 595 LEU LEU A . n 
A 1 141 ARG 141 596 596 ARG ARG A . n 
A 1 142 ARG 142 597 597 ARG ARG A . n 
A 1 143 ARG 143 598 598 ARG ARG A . n 
A 1 144 GLU 144 599 599 GLU GLU A . n 
A 1 145 ASP 145 600 600 ASP ASP A . n 
A 1 146 TRP 146 601 601 TRP TRP A . n 
A 1 147 PRO 147 602 602 PRO PRO A . n 
A 1 148 SER 148 603 603 SER SER A . n 
A 1 149 ARG 149 604 604 ARG ARG A . n 
A 1 150 LEU 150 605 605 LEU LEU A . n 
A 1 151 GLN 151 606 606 GLN GLN A . n 
A 1 152 MET 152 607 607 MET MET A . n 
A 1 153 PHE 153 608 608 PHE PHE A . n 
A 1 154 PHE 154 609 609 PHE PHE A . n 
A 1 155 ALA 155 610 610 ALA ALA A . n 
A 1 156 ASN 156 611 ?   ?   ?   A . n 
A 1 157 ASN 157 612 ?   ?   ?   A . n 
A 1 158 HIS 158 613 ?   ?   ?   A . n 
A 1 159 ASP 159 614 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1  1   1  ZN  ZN  A . 
C 2 ZN  1  2   2  ZN  ZN  A . 
D 2 ZN  1  3   3  ZN  ZN  A . 
E 3 EDO 1  615 1  EDO EDO A . 
F 3 EDO 1  616 2  EDO EDO A . 
G 3 EDO 1  617 3  EDO EDO A . 
H 3 EDO 1  4   4  EDO EDO A . 
I 3 EDO 1  5   5  EDO EDO A . 
J 3 EDO 1  6   6  EDO EDO A . 
K 3 EDO 1  7   7  EDO EDO A . 
L 4 HOH 1  8   8  HOH HOH A . 
L 4 HOH 2  9   9  HOH HOH A . 
L 4 HOH 3  10  10 HOH HOH A . 
L 4 HOH 4  11  11 HOH HOH A . 
L 4 HOH 5  12  12 HOH HOH A . 
L 4 HOH 6  15  15 HOH HOH A . 
L 4 HOH 7  16  16 HOH HOH A . 
L 4 HOH 8  17  17 HOH HOH A . 
L 4 HOH 9  18  18 HOH HOH A . 
L 4 HOH 10 19  19 HOH HOH A . 
L 4 HOH 11 20  20 HOH HOH A . 
L 4 HOH 12 21  21 HOH HOH A . 
L 4 HOH 13 22  22 HOH HOH A . 
L 4 HOH 14 23  23 HOH HOH A . 
L 4 HOH 15 24  24 HOH HOH A . 
L 4 HOH 16 29  29 HOH HOH A . 
L 4 HOH 17 31  31 HOH HOH A . 
L 4 HOH 18 36  36 HOH HOH A . 
L 4 HOH 19 38  38 HOH HOH A . 
L 4 HOH 20 39  39 HOH HOH A . 
L 4 HOH 21 40  40 HOH HOH A . 
L 4 HOH 22 43  43 HOH HOH A . 
L 4 HOH 23 44  44 HOH HOH A . 
L 4 HOH 24 45  45 HOH HOH A . 
L 4 HOH 25 46  46 HOH HOH A . 
L 4 HOH 26 47  47 HOH HOH A . 
L 4 HOH 27 48  48 HOH HOH A . 
L 4 HOH 28 50  50 HOH HOH A . 
L 4 HOH 29 51  51 HOH HOH A . 
L 4 HOH 30 52  52 HOH HOH A . 
L 4 HOH 31 53  53 HOH HOH A . 
L 4 HOH 32 618 1  HOH HOH A . 
L 4 HOH 33 619 2  HOH HOH A . 
L 4 HOH 34 620 3  HOH HOH A . 
L 4 HOH 35 621 4  HOH HOH A . 
L 4 HOH 36 622 5  HOH HOH A . 
L 4 HOH 37 623 6  HOH HOH A . 
L 4 HOH 38 624 7  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 39  ? A CYS 494 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 42  ? A CYS 497 ? 1_555 113.8 ? 
2  SG ? A CYS 39  ? A CYS 494 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 59  ? A CYS 514 ? 1_555 113.1 ? 
3  SG ? A CYS 42  ? A CYS 497 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 59  ? A CYS 514 ? 1_555 112.2 ? 
4  SG ? A CYS 39  ? A CYS 494 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 62  ? A CYS 517 ? 1_555 107.3 ? 
5  SG ? A CYS 42  ? A CYS 497 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 62  ? A CYS 517 ? 1_555 106.7 ? 
6  SG ? A CYS 59  ? A CYS 514 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 62  ? A CYS 517 ? 1_555 102.8 ? 
7  SG ? A CYS 82  ? A CYS 537 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 85  ? A CYS 540 ? 1_555 106.8 ? 
8  SG ? A CYS 82  ? A CYS 537 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 104 ? A CYS 559 ? 1_555 111.4 ? 
9  SG ? A CYS 85  ? A CYS 540 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 104 ? A CYS 559 ? 1_555 109.9 ? 
10 SG ? A CYS 82  ? A CYS 537 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 107 ? A CYS 562 ? 1_555 114.1 ? 
11 SG ? A CYS 85  ? A CYS 540 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 107 ? A CYS 562 ? 1_555 108.6 ? 
12 SG ? A CYS 104 ? A CYS 559 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 107 ? A CYS 562 ? 1_555 105.9 ? 
13 SG ? A CYS 94  ? A CYS 549 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 99  ? A CYS 554 ? 1_555 109.8 ? 
14 SG ? A CYS 94  ? A CYS 549 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 128 ? A CYS 583 ? 1_555 112.4 ? 
15 SG ? A CYS 99  ? A CYS 554 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 128 ? A CYS 583 ? 1_555 107.5 ? 
16 SG ? A CYS 94  ? A CYS 549 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 131 ? A CYS 586 ? 1_555 107.3 ? 
17 SG ? A CYS 99  ? A CYS 554 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 131 ? A CYS 586 ? 1_555 100.7 ? 
18 SG ? A CYS 128 ? A CYS 583 ? 1_555 ZN ? D ZN . ? A ZN 3 ? 1_555 SG ? A CYS 131 ? A CYS 586 ? 1_555 118.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-11-10 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-08-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' Advisory                    
4 3 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen               
2 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 34.0369 -7.2752 11.6380 0.2326 0.3778 0.0742 0.1587 0.2666  -0.0053 14.2058 15.1387 5.0194  
-3.4410 -1.0867 -8.1400 0.7017  0.1273  -1.8014 -0.6157 -1.0545 -0.9225 1.3654  0.5934  0.3528  
'X-RAY DIFFRACTION' 2 ? refined 21.0966 0.9313  13.6057 0.0650 0.1246 0.0677 0.0302 0.0089  0.0220  1.9657  5.4161  7.3528  
-1.7626 2.5345  -4.7795 -0.0322 -0.2025 -0.1149 -0.1092 0.0666  0.0596  0.2174  -0.3244 -0.0344 
'X-RAY DIFFRACTION' 3 ? refined 31.3545 5.3412  17.7805 0.1528 0.2145 0.1827 0.0030 -0.1075 0.0970  4.2940  7.3807  10.8445 
-0.4647 -1.5597 -2.5319 -0.2171 -0.2279 0.3439  0.2288  -0.1787 -0.8617 -0.6085 1.0876  0.3957  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 456 ? ? A 472 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 473 ? ? A 543 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 544 ? ? A 610 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
ADSC     'data collection' Quantum  ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
MOLREP   phasing           .        ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             463 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             463 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.298 
_pdbx_validate_rmsd_bond.bond_target_value         1.521 
_pdbx_validate_rmsd_bond.bond_deviation            -0.223 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.027 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              504 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              504 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              504 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.70 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            15.40 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 465 ? A SER 10  
2  1 Y 1 A THR 466 ? A THR 11  
3  1 Y 1 A GLY 467 ? A GLY 12  
4  1 Y 1 A GLY 468 ? A GLY 13  
5  1 Y 1 A LYS 469 ? A LYS 14  
6  1 Y 1 A ALA 470 ? A ALA 15  
7  1 Y 1 A PRO 471 ? A PRO 16  
8  1 Y 1 A ASN 611 ? A ASN 156 
9  1 Y 1 A ASN 612 ? A ASN 157 
10 1 Y 1 A HIS 613 ? A HIS 158 
11 1 Y 1 A ASP 614 ? A ASP 159 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'     ZN  
3 1,2-ETHANEDIOL EDO 
4 water          HOH 
#