data_3A46
# 
_entry.id   3A46 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3A46         
NDB   NA0056       
RCSB  RCSB028788   
WWPDB D_1000028788 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3A42 'MvNei1 apo form 1' unspecified 
PDB 3A45 'MvNei1 apo form 2' unspecified 
# 
_pdbx_database_status.entry_id                        3A46 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-01 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Imamura, K.' 1 
'Wallace, S.' 2 
'Doublie, S.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Characterization of a Viral NEIL1 Ortholog Unliganded and Bound to Abasic Site-containing DNA' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                26174 
_citation.page_last                 26183 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19625256 
_citation.pdbx_database_id_DOI      10.1074/jbc.M109.021907 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Imamura, K.'   1 
primary 'Wallace, S.S.' 2 
primary 'Doublie, S.'   3 
# 
_cell.length_a           39.513 
_cell.length_b           121.462 
_cell.length_c           80.510 
_cell.angle_alpha        90.000 
_cell.angle_beta         95.500 
_cell.angle_gamma        90.000 
_cell.entry_id           3A46 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3A46 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Formamidopyrimidine-DNA glycosylase' 33753.480 2   3.2.2.23 ? ? ? 
2 polymer     syn DNA                                   4016.623  2   ?        ? ? ? 
3 polymer     syn DNA                                   3778.451  2   ?        ? ? ? 
4 non-polymer syn GLYCEROL                              92.094    1   ?        ? ? ? 
5 water       nat water                                 18.015    417 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Fapy-DNA glycosylase, DNA-(apurinic or apyrimidinic site) lyase, AP lyase, Endonuclease VIII, MvNei1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MPEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWN
TFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVAL
LMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPN
IHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
;
;MPEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWN
TFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVAL
LMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPN
IHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
;
A,B ? 
2 polydeoxyribonucleotide no no  '(DG)(DT)(DA)(DG)(DA)(DC)(DC)(DT)(DG)(DG)(DA)(DC)(DG)' GTAGACCTGGACG C,E ? 
3 polydeoxyribonucleotide no yes '(DC)(DG)(DT)(DC)(DC)(DA)(3DR)(DG)(DT)(DC)(DT)(DA)(DC)' CGTCCANGTCTAC D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   GLU n 
1 4   GLY n 
1 5   PRO n 
1 6   GLU n 
1 7   VAL n 
1 8   ALA n 
1 9   LEU n 
1 10  THR n 
1 11  ALA n 
1 12  ASP n 
1 13  ILE n 
1 14  LEU n 
1 15  GLU n 
1 16  LYS n 
1 17  TYR n 
1 18  PHE n 
1 19  LYS n 
1 20  GLY n 
1 21  LYS n 
1 22  THR n 
1 23  LEU n 
1 24  GLU n 
1 25  TYR n 
1 26  ILE n 
1 27  ASP n 
1 28  PHE n 
1 29  ILE n 
1 30  SER n 
1 31  GLY n 
1 32  ARG n 
1 33  TYR n 
1 34  SER n 
1 35  LYS n 
1 36  SER n 
1 37  GLU n 
1 38  PRO n 
1 39  GLU n 
1 40  GLY n 
1 41  TYR n 
1 42  ASP n 
1 43  ASP n 
1 44  PHE n 
1 45  ILE n 
1 46  ALA n 
1 47  ASN n 
1 48  LEU n 
1 49  PRO n 
1 50  LEU n 
1 51  LYS n 
1 52  VAL n 
1 53  SER n 
1 54  ASN n 
1 55  VAL n 
1 56  ASP n 
1 57  THR n 
1 58  LYS n 
1 59  GLY n 
1 60  LYS n 
1 61  PHE n 
1 62  LEU n 
1 63  TRP n 
1 64  PHE n 
1 65  GLU n 
1 66  LEU n 
1 67  PHE n 
1 68  ASP n 
1 69  PRO n 
1 70  ASN n 
1 71  ASP n 
1 72  LYS n 
1 73  SER n 
1 74  ASN n 
1 75  LYS n 
1 76  TRP n 
1 77  TYR n 
1 78  ILE n 
1 79  TRP n 
1 80  ASN n 
1 81  THR n 
1 82  PHE n 
1 83  GLY n 
1 84  LEU n 
1 85  THR n 
1 86  GLY n 
1 87  MET n 
1 88  TRP n 
1 89  SER n 
1 90  LEU n 
1 91  PHE n 
1 92  GLU n 
1 93  ALA n 
1 94  LYS n 
1 95  TYR n 
1 96  THR n 
1 97  ARG n 
1 98  ALA n 
1 99  VAL n 
1 100 LEU n 
1 101 SER n 
1 102 PHE n 
1 103 ASP n 
1 104 ASN n 
1 105 GLU n 
1 106 LEU n 
1 107 MET n 
1 108 ALA n 
1 109 TYR n 
1 110 PHE n 
1 111 SER n 
1 112 ASP n 
1 113 MET n 
1 114 ARG n 
1 115 ASN n 
1 116 PHE n 
1 117 GLY n 
1 118 THR n 
1 119 PHE n 
1 120 LYS n 
1 121 PHE n 
1 122 SER n 
1 123 ASN n 
1 124 SER n 
1 125 GLU n 
1 126 LYS n 
1 127 GLU n 
1 128 LEU n 
1 129 LYS n 
1 130 ARG n 
1 131 LYS n 
1 132 LEU n 
1 133 ASN n 
1 134 GLU n 
1 135 LEU n 
1 136 GLY n 
1 137 PRO n 
1 138 ASP n 
1 139 PHE n 
1 140 LEU n 
1 141 LYS n 
1 142 ASN n 
1 143 ASP n 
1 144 ASP n 
1 145 ILE n 
1 146 ASP n 
1 147 ILE n 
1 148 SER n 
1 149 LYS n 
1 150 ILE n 
1 151 LYS n 
1 152 LYS n 
1 153 TYR n 
1 154 LYS n 
1 155 GLN n 
1 156 PRO n 
1 157 ILE n 
1 158 VAL n 
1 159 ALA n 
1 160 LEU n 
1 161 LEU n 
1 162 MET n 
1 163 ASP n 
1 164 GLN n 
1 165 LYS n 
1 166 LYS n 
1 167 ILE n 
1 168 GLY n 
1 169 SER n 
1 170 GLY n 
1 171 LEU n 
1 172 GLY n 
1 173 ASN n 
1 174 TYR n 
1 175 LEU n 
1 176 VAL n 
1 177 ALA n 
1 178 GLU n 
1 179 ILE n 
1 180 LEU n 
1 181 TYR n 
1 182 ARG n 
1 183 ALA n 
1 184 LYS n 
1 185 ILE n 
1 186 ASP n 
1 187 PRO n 
1 188 HIS n 
1 189 LYS n 
1 190 LEU n 
1 191 GLY n 
1 192 SER n 
1 193 ASN n 
1 194 LEU n 
1 195 THR n 
1 196 ASP n 
1 197 GLN n 
1 198 GLU n 
1 199 ILE n 
1 200 GLU n 
1 201 ASN n 
1 202 LEU n 
1 203 TRP n 
1 204 TYR n 
1 205 TRP n 
1 206 ILE n 
1 207 LYS n 
1 208 TYR n 
1 209 GLU n 
1 210 THR n 
1 211 LYS n 
1 212 LEU n 
1 213 ALA n 
1 214 TYR n 
1 215 ASP n 
1 216 SER n 
1 217 ASN n 
1 218 HIS n 
1 219 ILE n 
1 220 GLY n 
1 221 TYR n 
1 222 MET n 
1 223 VAL n 
1 224 ASN n 
1 225 LEU n 
1 226 GLU n 
1 227 ASN n 
1 228 GLU n 
1 229 SER n 
1 230 SER n 
1 231 LYS n 
1 232 ILE n 
1 233 GLY n 
1 234 ARG n 
1 235 LYS n 
1 236 ASN n 
1 237 TYR n 
1 238 HIS n 
1 239 PRO n 
1 240 ASN n 
1 241 ILE n 
1 242 HIS n 
1 243 PRO n 
1 244 THR n 
1 245 GLU n 
1 246 LYS n 
1 247 GLU n 
1 248 PHE n 
1 249 ASP n 
1 250 PHE n 
1 251 LEU n 
1 252 VAL n 
1 253 TYR n 
1 254 ARG n 
1 255 LYS n 
1 256 LYS n 
1 257 LYS n 
1 258 ASP n 
1 259 PRO n 
1 260 ASN n 
1 261 GLY n 
1 262 ASN n 
1 263 LYS n 
1 264 VAL n 
1 265 ILE n 
1 266 ALA n 
1 267 ASP n 
1 268 LYS n 
1 269 ILE n 
1 270 ILE n 
1 271 GLY n 
1 272 SER n 
1 273 GLY n 
1 274 LYS n 
1 275 ASN n 
1 276 LYS n 
1 277 ARG n 
1 278 THR n 
1 279 THR n 
1 280 TYR n 
1 281 TRP n 
1 282 ALA n 
1 283 PRO n 
1 284 ALA n 
1 285 ILE n 
1 286 GLN n 
1 287 LYS n 
1 288 LEU n 
1 289 GLU n 
2 1   DG  n 
2 2   DT  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DC  n 
2 7   DC  n 
2 8   DT  n 
2 9   DG  n 
2 10  DG  n 
2 11  DA  n 
2 12  DC  n 
2 13  DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DT  n 
3 4   DC  n 
3 5   DC  n 
3 6   DA  n 
3 7   3DR n 
3 8   DG  n 
3 9   DT  n 
3 10  DC  n 
3 11  DT  n 
3 12  DA  n 
3 13  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               APMV 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 L315 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Acanthamoeba polyphaga mimivirus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     212035 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta(DE3)pLys' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'Nucleotide synthesis' 
3 1 sample ? ? ? ? ? 'Nucleotide synthesis' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP FPG_MIMIV Q5UQ00 1 
;MPEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWN
TFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVAL
LMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPN
IHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQK
;
1 ? 
2 PDB 3A46      3A46   2 GTAGACCTGGACG 1 ? 
3 PDB 3A46      3A46   3 'CGTCCA(3DR)GTCTAC' 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3A46 A 1 ? 287 ? Q5UQ00 1  ? 287 ? 1  287 
2 1 3A46 B 1 ? 287 ? Q5UQ00 1  ? 287 ? 1  287 
3 2 3A46 C 1 ? 13  ? 3A46   1  ? 13  ? 1  13  
4 2 3A46 E 1 ? 13  ? 3A46   1  ? 13  ? 1  13  
5 3 3A46 D 1 ? 13  ? 3A46   14 ? 26  ? 14 26  
6 3 3A46 F 1 ? 13  ? 3A46   14 ? 26  ? 14 26  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3A46 LEU A 288 ? UNP Q5UQ00 ? ? 'EXPRESSION TAG' 288 1 
1 3A46 GLU A 289 ? UNP Q5UQ00 ? ? 'EXPRESSION TAG' 289 2 
2 3A46 LEU B 288 ? UNP Q5UQ00 ? ? 'EXPRESSION TAG' 288 3 
2 3A46 GLU B 289 ? UNP Q5UQ00 ? ? 'EXPRESSION TAG' 289 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3DR 'DNA linking'       . "1',2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE" 'ABASIC DIDEOXYRIBOSE'          'C5 H11 O6 P'     198.111 
ALA 'L-peptide linking' y ALANINE                                  ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                               'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                                 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                    ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                   ?                               'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3A46 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   46.85 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            285 
_exptl_crystal_grow.pdbx_details    
'PEG3350, 100mM bis-Tris, pH6.0-6.3, 150mM magnesium nitrate, VAPOR DIFFUSION, HANGING DROP, temperature 285K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 PEG3350             ? ? ? 
1 2 1 bis-Tris            ? ? ? 
1 3 1 'magnesium nitrate' ? ? ? 
1 4 1 HOH                 ? ? ? 
1 5 2 PEG3350             ? ? ? 
1 6 2 bis-Tris            ? ? ? 
1 7 2 'magnesium nitrate' ? ? ? 
1 8 2 HOH                 ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-11-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_wavelength_list        1.08 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
# 
_reflns.entry_id                     3A46 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             35 
_reflns.number_all                   38298 
_reflns.number_obs                   38069 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.6 
_reflns.B_iso_Wilson_estimate        32.4 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.32 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           0.652 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3A46 
_refine.ls_d_res_high                            2.200 
_refine.ls_d_res_low                             35.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    93.700 
_refine.ls_number_reflns_obs                     35872 
_refine.ls_number_reflns_all                     38229 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.213 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.261 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 9.300 
_refine.ls_number_reflns_R_free                  3574 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               31.260 
_refine.solvent_model_param_bsol                 58.124 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            2.894 
_refine.aniso_B[2][2]                            -5.739 
_refine.aniso_B[3][3]                            2.845 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            1.046 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3A45' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                79.74 
_refine.B_iso_min                                6.76 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3A46 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             0.47 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.35 
_refine_analyze.Luzzati_sigma_a_free            0.43 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4754 
_refine_hist.pdbx_number_atoms_nucleic_acid   1032 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             417 
_refine_hist.number_atoms_total               6209 
_refine_hist.d_res_high                       2.200 
_refine_hist.d_res_low                        35.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d     ? 0.006 ?     ? 'X-RAY DIFFRACTION' ? 
c_angle_deg  ? 1.242 ?     ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  ? 1.515 1.500 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  ? 2.140 2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it ? 2.518 2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it ? 3.227 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.2 
_refine_ls_shell.d_res_low                        2.3 
_refine_ls_shell.number_reflns_obs                2484 
_refine_ls_shell.number_reflns_R_free             251 
_refine_ls_shell.R_factor_R_work                  0.52 
_refine_ls_shell.R_factor_R_free                  0.578 
_refine_ls_shell.R_factor_R_free_error            0.033 
_refine_ls_shell.percent_reflns_obs               52.3 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 protein_rep.param protein.top   
'X-RAY DIFFRACTION' 2 dna-rna_rep.param dna-rna.top   
'X-RAY DIFFRACTION' 3 water_rep.param   water.top     
'X-RAY DIFFRACTION' 4 ion.param         ion.top       
'X-RAY DIFFRACTION' 5 gol_xplor_param   gol_xplor_top 
# 
_struct.entry_id                  3A46 
_struct.title                     'Crystal structure of MvNei1/THF complex' 
_struct.pdbx_descriptor           'Formamidopyrimidine-DNA glycosylase (E.C.3.2.2.23)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3A46 
_struct_keywords.text            
;helix two turns helix, zinc-less finger, HYDROLASE, THF, DNA damage, DNA repair, DNA-binding, Glycosidase, Lyase, Multifunctional enzyme
;
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 3   ? LYS A 19  ? GLU A 3   LYS A 19  1 ? 17 
HELX_P HELX_P2  2  GLY A 31  ? SER A 36  ? GLY A 31  SER A 36  1 ? 6  
HELX_P HELX_P3  3  GLY A 40  ? ASN A 47  ? GLY A 40  ASN A 47  1 ? 8  
HELX_P HELX_P4  4  SER A 124 ? ASN A 133 ? SER A 124 ASN A 133 1 ? 10 
HELX_P HELX_P5  5  ASP A 146 ? TYR A 153 ? ASP A 146 TYR A 153 5 ? 8  
HELX_P HELX_P6  6  PRO A 156 ? ASP A 163 ? PRO A 156 ASP A 163 1 ? 8  
HELX_P HELX_P7  7  GLY A 172 ? ALA A 183 ? GLY A 172 ALA A 183 1 ? 12 
HELX_P HELX_P8  8  LEU A 190 ? LEU A 194 ? LEU A 190 LEU A 194 5 ? 5  
HELX_P HELX_P9  9  THR A 195 ? SER A 216 ? THR A 195 SER A 216 1 ? 22 
HELX_P HELX_P10 10 MET A 222 ? ASN A 224 ? MET A 222 ASN A 224 5 ? 3  
HELX_P HELX_P11 11 LEU A 225 ? SER A 230 ? LEU A 225 SER A 230 1 ? 6  
HELX_P HELX_P12 12 GLU B 3   ? LYS B 19  ? GLU B 3   LYS B 19  1 ? 17 
HELX_P HELX_P13 13 GLY B 31  ? LYS B 35  ? GLY B 31  LYS B 35  5 ? 5  
HELX_P HELX_P14 14 GLY B 40  ? ASN B 47  ? GLY B 40  ASN B 47  1 ? 8  
HELX_P HELX_P15 15 SER B 124 ? ASN B 133 ? SER B 124 ASN B 133 1 ? 10 
HELX_P HELX_P16 16 ASP B 146 ? TYR B 153 ? ASP B 146 TYR B 153 5 ? 8  
HELX_P HELX_P17 17 PRO B 156 ? ASP B 163 ? PRO B 156 ASP B 163 1 ? 8  
HELX_P HELX_P18 18 GLY B 172 ? ALA B 183 ? GLY B 172 ALA B 183 1 ? 12 
HELX_P HELX_P19 19 LEU B 190 ? LEU B 194 ? LEU B 190 LEU B 194 5 ? 5  
HELX_P HELX_P20 20 THR B 195 ? SER B 216 ? THR B 195 SER B 216 1 ? 22 
HELX_P HELX_P21 21 MET B 222 ? ASN B 224 ? MET B 222 ASN B 224 5 ? 3  
HELX_P HELX_P22 22 LEU B 225 ? ILE B 232 ? LEU B 225 ILE B 232 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? D DA  6  "O3'" ? ? ? 1_555 D 3DR 7  P  ? ? D DA  19 D 3DR 20 1_555 ? ? ? ? ? ? ?            1.604 ? 
covale2  covale ? ? D 3DR 7  "O3'" ? ? ? 1_555 D DG  8  P  ? ? D 3DR 20 D DG  21 1_555 ? ? ? ? ? ? ?            1.605 ? 
covale3  covale ? ? F DA  6  "O3'" ? ? ? 1_555 F 3DR 7  P  ? ? F DA  19 F 3DR 20 1_555 ? ? ? ? ? ? ?            1.608 ? 
covale4  covale ? ? F 3DR 7  "O3'" ? ? ? 1_555 F DG  8  P  ? ? F 3DR 20 F DG  21 1_555 ? ? ? ? ? ? ?            1.595 ? 
hydrog1  hydrog ? ? C DG  1  N1    ? ? ? 1_555 D DC  13 N3 ? ? C DG  1  D DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  1  N2    ? ? ? 1_555 D DC  13 O2 ? ? C DG  1  D DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  1  O6    ? ? ? 1_555 D DC  13 N4 ? ? C DG  1  D DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DT  2  N3    ? ? ? 1_555 D DA  12 N1 ? ? C DT  2  D DA  25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DT  2  O4    ? ? ? 1_555 D DA  12 N6 ? ? C DT  2  D DA  25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DA  3  N1    ? ? ? 1_555 D DT  11 N3 ? ? C DA  3  D DT  24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DA  3  N6    ? ? ? 1_555 D DT  11 O4 ? ? C DA  3  D DT  24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DG  4  N1    ? ? ? 1_555 D DC  10 N3 ? ? C DG  4  D DC  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DG  4  N2    ? ? ? 1_555 D DC  10 O2 ? ? C DG  4  D DC  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DG  4  O6    ? ? ? 1_555 D DC  10 N4 ? ? C DG  4  D DC  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DA  5  N1    ? ? ? 1_555 D DT  9  N3 ? ? C DA  5  D DT  22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DA  5  N6    ? ? ? 1_555 D DT  9  O4 ? ? C DA  5  D DT  22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DC  6  N3    ? ? ? 1_555 D DG  8  N1 ? ? C DC  6  D DG  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DC  6  N4    ? ? ? 1_555 D DG  8  O6 ? ? C DC  6  D DG  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DC  6  O2    ? ? ? 1_555 D DG  8  N2 ? ? C DC  6  D DG  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DT  8  N3    ? ? ? 1_555 D DA  6  N1 ? ? C DT  8  D DA  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DT  8  O4    ? ? ? 1_555 D DA  6  N6 ? ? C DT  8  D DA  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  9  N1    ? ? ? 1_555 D DC  5  N3 ? ? C DG  9  D DC  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DG  9  N2    ? ? ? 1_555 D DC  5  O2 ? ? C DG  9  D DC  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DG  9  O6    ? ? ? 1_555 D DC  5  N4 ? ? C DG  9  D DC  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DG  10 N1    ? ? ? 1_555 D DC  4  N3 ? ? C DG  10 D DC  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DG  10 N2    ? ? ? 1_555 D DC  4  O2 ? ? C DG  10 D DC  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DG  10 O6    ? ? ? 1_555 D DC  4  N4 ? ? C DG  10 D DC  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DA  11 N1    ? ? ? 1_555 D DT  3  N3 ? ? C DA  11 D DT  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DA  11 N6    ? ? ? 1_555 D DT  3  O4 ? ? C DA  11 D DT  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DC  12 N3    ? ? ? 1_555 D DG  2  N1 ? ? C DC  12 D DG  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DC  12 N4    ? ? ? 1_555 D DG  2  O6 ? ? C DC  12 D DG  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DC  12 O2    ? ? ? 1_555 D DG  2  N2 ? ? C DC  12 D DG  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DG  13 N1    ? ? ? 1_555 D DC  1  N3 ? ? C DG  13 D DC  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DG  13 N2    ? ? ? 1_555 D DC  1  O2 ? ? C DG  13 D DC  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DG  13 O6    ? ? ? 1_555 D DC  1  N4 ? ? C DG  13 D DC  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? E DG  1  N1    ? ? ? 1_555 F DC  13 N3 ? ? E DG  1  F DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DG  1  N2    ? ? ? 1_555 F DC  13 O2 ? ? E DG  1  F DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DG  1  O6    ? ? ? 1_555 F DC  13 N4 ? ? E DG  1  F DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E DT  2  N3    ? ? ? 1_555 F DA  12 N1 ? ? E DT  2  F DA  25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DT  2  O4    ? ? ? 1_555 F DA  12 N6 ? ? E DT  2  F DA  25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DA  3  N1    ? ? ? 1_555 F DT  11 N3 ? ? E DA  3  F DT  24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DA  3  N6    ? ? ? 1_555 F DT  11 O4 ? ? E DA  3  F DT  24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DG  4  N1    ? ? ? 1_555 F DC  10 N3 ? ? E DG  4  F DC  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DG  4  N2    ? ? ? 1_555 F DC  10 O2 ? ? E DG  4  F DC  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DG  4  O6    ? ? ? 1_555 F DC  10 N4 ? ? E DG  4  F DC  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DA  5  N1    ? ? ? 1_555 F DT  9  N3 ? ? E DA  5  F DT  22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DA  5  N6    ? ? ? 1_555 F DT  9  O4 ? ? E DA  5  F DT  22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? E DC  6  N3    ? ? ? 1_555 F DG  8  N1 ? ? E DC  6  F DG  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? E DC  6  N4    ? ? ? 1_555 F DG  8  O6 ? ? E DC  6  F DG  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? E DC  6  O2    ? ? ? 1_555 F DG  8  N2 ? ? E DC  6  F DG  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DT  8  N3    ? ? ? 1_555 F DA  6  N1 ? ? E DT  8  F DA  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DT  8  O4    ? ? ? 1_555 F DA  6  N6 ? ? E DT  8  F DA  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E DG  9  N1    ? ? ? 1_555 F DC  5  N3 ? ? E DG  9  F DC  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? E DG  9  N2    ? ? ? 1_555 F DC  5  O2 ? ? E DG  9  F DC  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? E DG  9  O6    ? ? ? 1_555 F DC  5  N4 ? ? E DG  9  F DC  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? E DG  10 N1    ? ? ? 1_555 F DC  4  N3 ? ? E DG  10 F DC  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? E DG  10 N2    ? ? ? 1_555 F DC  4  O2 ? ? E DG  10 F DC  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? E DG  10 O6    ? ? ? 1_555 F DC  4  N4 ? ? E DG  10 F DC  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? E DA  11 N1    ? ? ? 1_555 F DT  3  N3 ? ? E DA  11 F DT  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? E DA  11 N6    ? ? ? 1_555 F DT  3  O4 ? ? E DA  11 F DT  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? E DC  12 N3    ? ? ? 1_555 F DG  2  N1 ? ? E DC  12 F DG  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? E DC  12 N4    ? ? ? 1_555 F DG  2  O6 ? ? E DC  12 F DG  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? E DC  12 O2    ? ? ? 1_555 F DG  2  N2 ? ? E DC  12 F DG  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? E DG  13 N1    ? ? ? 1_555 F DC  1  N3 ? ? E DG  13 F DC  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? E DG  13 N2    ? ? ? 1_555 F DC  1  O2 ? ? E DG  13 F DC  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? E DG  13 O6    ? ? ? 1_555 F DC  1  N4 ? ? E DG  13 F DC  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 48 A . ? LEU 48 A PRO 49 A ? PRO 49 A 1 0.11  
2 LEU 48 B . ? LEU 48 B PRO 49 B ? PRO 49 B 1 -1.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 2 ? 
C ? 8 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 86  ? SER A 89  ? GLY A 86  SER A 89  
A 2 MET A 107 ? ASP A 112 ? MET A 107 ASP A 112 
A 3 THR A 96  ? PHE A 102 ? THR A 96  PHE A 102 
A 4 THR A 22  ? PHE A 28  ? THR A 22  PHE A 28  
A 5 LEU A 50  ? LYS A 58  ? LEU A 50  LYS A 58  
A 6 PHE A 61  ? ASP A 68  ? PHE A 61  ASP A 68  
A 7 ASP A 71  ? THR A 81  ? ASP A 71  THR A 81  
A 8 THR A 118 ? SER A 122 ? THR A 118 SER A 122 
B 1 ILE A 265 ? ASP A 267 ? ILE A 265 ASP A 267 
B 2 THR A 279 ? TRP A 281 ? THR A 279 TRP A 281 
C 1 GLY B 86  ? SER B 89  ? GLY B 86  SER B 89  
C 2 MET B 107 ? ASP B 112 ? MET B 107 ASP B 112 
C 3 THR B 96  ? PHE B 102 ? THR B 96  PHE B 102 
C 4 THR B 22  ? PHE B 28  ? THR B 22  PHE B 28  
C 5 LEU B 50  ? LYS B 58  ? LEU B 50  LYS B 58  
C 6 PHE B 61  ? ASP B 68  ? PHE B 61  ASP B 68  
C 7 ASP B 71  ? THR B 81  ? ASP B 71  THR B 81  
C 8 THR B 118 ? SER B 122 ? THR B 118 SER B 122 
D 1 ILE B 265 ? ASP B 267 ? ILE B 265 ASP B 267 
D 2 THR B 279 ? TRP B 281 ? THR B 279 TRP B 281 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET A 87  ? N MET A 87  O SER A 111 ? O SER A 111 
A 2 3 O PHE A 110 ? O PHE A 110 N ARG A 97  ? N ARG A 97  
A 3 4 O SER A 101 ? O SER A 101 N TYR A 25  ? N TYR A 25  
A 4 5 N LEU A 23  ? N LEU A 23  O LEU A 50  ? O LEU A 50  
A 5 6 N ASN A 54  ? N ASN A 54  O GLU A 65  ? O GLU A 65  
A 6 7 N LEU A 66  ? N LEU A 66  O TRP A 76  ? O TRP A 76  
A 7 8 N TRP A 79  ? N TRP A 79  O LYS A 120 ? O LYS A 120 
B 1 2 N ASP A 267 ? N ASP A 267 O THR A 279 ? O THR A 279 
C 1 2 N MET B 87  ? N MET B 87  O SER B 111 ? O SER B 111 
C 2 3 O PHE B 110 ? O PHE B 110 N ARG B 97  ? N ARG B 97  
C 3 4 O VAL B 99  ? O VAL B 99  N ASP B 27  ? N ASP B 27  
C 4 5 N LEU B 23  ? N LEU B 23  O LEU B 50  ? O LEU B 50  
C 5 6 N ASN B 54  ? N ASN B 54  O GLU B 65  ? O GLU B 65  
C 6 7 N LEU B 66  ? N LEU B 66  O TRP B 76  ? O TRP B 76  
C 7 8 N TYR B 77  ? N TYR B 77  O SER B 122 ? O SER B 122 
D 1 2 N ASP B 267 ? N ASP B 267 O THR B 279 ? O THR B 279 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE GOL A 3545' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 LYS A 274 ? LYS A 274  . ? 1_555 ? 
2 AC1 6 ARG A 277 ? ARG A 277  . ? 1_555 ? 
3 AC1 6 HOH H .   ? HOH A 2017 . ? 1_555 ? 
4 AC1 6 DC  C 6   ? DC  C 6    . ? 1_555 ? 
5 AC1 6 DG  D 8   ? DG  D 21   . ? 1_555 ? 
6 AC1 6 HOH K .   ? HOH D 2070 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3A46 
_atom_sites.fract_transf_matrix[1][1]   0.025308 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002437 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008233 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012478 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . PRO A 1 2   ? 18.028  3.316   38.286  1.00 38.43 ? 2    PRO A N     1 
ATOM   2    C CA    . PRO A 1 2   ? 16.899  2.480   37.864  1.00 35.35 ? 2    PRO A CA    1 
ATOM   3    C C     . PRO A 1 2   ? 15.597  3.220   37.712  1.00 33.30 ? 2    PRO A C     1 
ATOM   4    O O     . PRO A 1 2   ? 14.774  3.231   38.630  1.00 33.30 ? 2    PRO A O     1 
ATOM   5    C CB    . PRO A 1 2   ? 16.716  1.416   38.918  1.00 37.54 ? 2    PRO A CB    1 
ATOM   6    C CG    . PRO A 1 2   ? 18.101  1.277   39.435  1.00 38.37 ? 2    PRO A CG    1 
ATOM   7    C CD    . PRO A 1 2   ? 18.597  2.741   39.514  1.00 39.18 ? 2    PRO A CD    1 
ATOM   8    N N     . GLU A 1 3   ? 15.418  3.850   36.564  1.00 29.60 ? 3    GLU A N     1 
ATOM   9    C CA    . GLU A 1 3   ? 14.180  4.525   36.273  1.00 25.52 ? 3    GLU A CA    1 
ATOM   10   C C     . GLU A 1 3   ? 13.613  3.628   35.179  1.00 23.43 ? 3    GLU A C     1 
ATOM   11   O O     . GLU A 1 3   ? 14.293  2.693   34.747  1.00 25.14 ? 3    GLU A O     1 
ATOM   12   C CB    . GLU A 1 3   ? 14.445  5.977   35.828  1.00 23.87 ? 3    GLU A CB    1 
ATOM   13   C CG    . GLU A 1 3   ? 14.687  6.878   37.058  1.00 25.73 ? 3    GLU A CG    1 
ATOM   14   C CD    . GLU A 1 3   ? 14.740  8.391   36.777  1.00 27.95 ? 3    GLU A CD    1 
ATOM   15   O OE1   . GLU A 1 3   ? 13.967  8.900   35.927  1.00 22.92 ? 3    GLU A OE1   1 
ATOM   16   O OE2   . GLU A 1 3   ? 15.548  9.069   37.455  1.00 25.64 ? 3    GLU A OE2   1 
ATOM   17   N N     . GLY A 1 4   ? 12.377  3.873   34.759  1.00 20.63 ? 4    GLY A N     1 
ATOM   18   C CA    . GLY A 1 4   ? 11.764  3.040   33.741  1.00 19.04 ? 4    GLY A CA    1 
ATOM   19   C C     . GLY A 1 4   ? 12.689  2.525   32.652  1.00 17.65 ? 4    GLY A C     1 
ATOM   20   O O     . GLY A 1 4   ? 12.840  1.316   32.487  1.00 18.80 ? 4    GLY A O     1 
ATOM   21   N N     . PRO A 1 5   ? 13.334  3.418   31.897  1.00 16.87 ? 5    PRO A N     1 
ATOM   22   C CA    . PRO A 1 5   ? 14.237  2.993   30.823  1.00 17.28 ? 5    PRO A CA    1 
ATOM   23   C C     . PRO A 1 5   ? 15.345  2.023   31.223  1.00 18.62 ? 5    PRO A C     1 
ATOM   24   O O     . PRO A 1 5   ? 15.656  1.101   30.465  1.00 19.86 ? 5    PRO A O     1 
ATOM   25   C CB    . PRO A 1 5   ? 14.769  4.316   30.278  1.00 16.61 ? 5    PRO A CB    1 
ATOM   26   C CG    . PRO A 1 5   ? 13.571  5.240   30.470  1.00 15.29 ? 5    PRO A CG    1 
ATOM   27   C CD    . PRO A 1 5   ? 13.148  4.880   31.882  1.00 16.01 ? 5    PRO A CD    1 
ATOM   28   N N     . GLU A 1 6   ? 15.946  2.215   32.396  1.00 18.86 ? 6    GLU A N     1 
ATOM   29   C CA    . GLU A 1 6   ? 17.008  1.312   32.829  1.00 18.09 ? 6    GLU A CA    1 
ATOM   30   C C     . GLU A 1 6   ? 16.450  -0.083  33.120  1.00 16.96 ? 6    GLU A C     1 
ATOM   31   O O     . GLU A 1 6   ? 17.058  -1.090  32.776  1.00 16.17 ? 6    GLU A O     1 
ATOM   32   C CB    . GLU A 1 6   ? 17.699  1.829   34.091  1.00 21.92 ? 6    GLU A CB    1 
ATOM   33   C CG    . GLU A 1 6   ? 18.733  2.911   33.886  1.00 27.97 ? 6    GLU A CG    1 
ATOM   34   C CD    . GLU A 1 6   ? 18.121  4.290   33.703  1.00 32.46 ? 6    GLU A CD    1 
ATOM   35   O OE1   . GLU A 1 6   ? 17.042  4.562   34.278  1.00 33.11 ? 6    GLU A OE1   1 
ATOM   36   O OE2   . GLU A 1 6   ? 18.736  5.111   32.997  1.00 35.50 ? 6    GLU A OE2   1 
ATOM   37   N N     . VAL A 1 7   ? 15.292  -0.131  33.767  1.00 15.84 ? 7    VAL A N     1 
ATOM   38   C CA    . VAL A 1 7   ? 14.665  -1.401  34.101  1.00 14.64 ? 7    VAL A CA    1 
ATOM   39   C C     . VAL A 1 7   ? 14.219  -2.129  32.825  1.00 14.02 ? 7    VAL A C     1 
ATOM   40   O O     . VAL A 1 7   ? 14.342  -3.349  32.723  1.00 13.45 ? 7    VAL A O     1 
ATOM   41   C CB    . VAL A 1 7   ? 13.463  -1.175  35.047  1.00 14.39 ? 7    VAL A CB    1 
ATOM   42   C CG1   . VAL A 1 7   ? 12.762  -2.483  35.344  1.00 15.40 ? 7    VAL A CG1   1 
ATOM   43   C CG2   . VAL A 1 7   ? 13.947  -0.535  36.334  1.00 13.98 ? 7    VAL A CG2   1 
ATOM   44   N N     . ALA A 1 8   ? 13.717  -1.384  31.847  1.00 11.87 ? 8    ALA A N     1 
ATOM   45   C CA    . ALA A 1 8   ? 13.285  -2.008  30.601  1.00 14.84 ? 8    ALA A CA    1 
ATOM   46   C C     . ALA A 1 8   ? 14.479  -2.602  29.847  1.00 15.21 ? 8    ALA A C     1 
ATOM   47   O O     . ALA A 1 8   ? 14.436  -3.743  29.402  1.00 17.60 ? 8    ALA A O     1 
ATOM   48   C CB    . ALA A 1 8   ? 12.545  -0.992  29.723  1.00 12.61 ? 8    ALA A CB    1 
ATOM   49   N N     . LEU A 1 9   ? 15.553  -1.837  29.715  1.00 15.52 ? 9    LEU A N     1 
ATOM   50   C CA    . LEU A 1 9   ? 16.728  -2.334  29.015  1.00 15.91 ? 9    LEU A CA    1 
ATOM   51   C C     . LEU A 1 9   ? 17.317  -3.538  29.752  1.00 16.96 ? 9    LEU A C     1 
ATOM   52   O O     . LEU A 1 9   ? 17.751  -4.509  29.129  1.00 15.37 ? 9    LEU A O     1 
ATOM   53   C CB    . LEU A 1 9   ? 17.775  -1.226  28.899  1.00 14.68 ? 9    LEU A CB    1 
ATOM   54   C CG    . LEU A 1 9   ? 19.063  -1.520  28.120  1.00 19.41 ? 9    LEU A CG    1 
ATOM   55   C CD1   . LEU A 1 9   ? 18.739  -2.072  26.719  1.00 14.83 ? 9    LEU A CD1   1 
ATOM   56   C CD2   . LEU A 1 9   ? 19.869  -0.217  28.008  1.00 18.14 ? 9    LEU A CD2   1 
ATOM   57   N N     . THR A 1 10  ? 17.351  -3.459  31.082  1.00 14.94 ? 10   THR A N     1 
ATOM   58   C CA    . THR A 1 10  ? 17.880  -4.547  31.885  1.00 12.40 ? 10   THR A CA    1 
ATOM   59   C C     . THR A 1 10  ? 17.077  -5.818  31.648  1.00 13.51 ? 10   THR A C     1 
ATOM   60   O O     . THR A 1 10  ? 17.640  -6.908  31.549  1.00 14.71 ? 10   THR A O     1 
ATOM   61   C CB    . THR A 1 10  ? 17.838  -4.206  33.380  1.00 12.07 ? 10   THR A CB    1 
ATOM   62   O OG1   . THR A 1 10  ? 18.727  -3.116  33.643  1.00 9.30  ? 10   THR A OG1   1 
ATOM   63   C CG2   . THR A 1 10  ? 18.251  -5.406  34.214  1.00 6.76  ? 10   THR A CG2   1 
ATOM   64   N N     . ALA A 1 11  ? 15.759  -5.686  31.569  1.00 14.80 ? 11   ALA A N     1 
ATOM   65   C CA    . ALA A 1 11  ? 14.919  -6.853  31.322  1.00 17.31 ? 11   ALA A CA    1 
ATOM   66   C C     . ALA A 1 11  ? 15.226  -7.440  29.937  1.00 18.63 ? 11   ALA A C     1 
ATOM   67   O O     . ALA A 1 11  ? 15.270  -8.662  29.780  1.00 20.28 ? 11   ALA A O     1 
ATOM   68   C CB    . ALA A 1 11  ? 13.438  -6.482  31.420  1.00 12.36 ? 11   ALA A CB    1 
ATOM   69   N N     . ASP A 1 12  ? 15.435  -6.574  28.942  1.00 18.73 ? 12   ASP A N     1 
ATOM   70   C CA    . ASP A 1 12  ? 15.740  -7.028  27.580  1.00 19.71 ? 12   ASP A CA    1 
ATOM   71   C C     . ASP A 1 12  ? 17.041  -7.815  27.539  1.00 17.70 ? 12   ASP A C     1 
ATOM   72   O O     . ASP A 1 12  ? 17.150  -8.811  26.837  1.00 15.84 ? 12   ASP A O     1 
ATOM   73   C CB    . ASP A 1 12  ? 15.862  -5.847  26.610  1.00 21.81 ? 12   ASP A CB    1 
ATOM   74   C CG    . ASP A 1 12  ? 14.537  -5.156  26.356  1.00 25.79 ? 12   ASP A CG    1 
ATOM   75   O OD1   . ASP A 1 12  ? 13.476  -5.822  26.450  1.00 27.99 ? 12   ASP A OD1   1 
ATOM   76   O OD2   . ASP A 1 12  ? 14.562  -3.947  26.043  1.00 24.46 ? 12   ASP A OD2   1 
ATOM   77   N N     . ILE A 1 13  ? 18.037  -7.347  28.280  1.00 16.56 ? 13   ILE A N     1 
ATOM   78   C CA    . ILE A 1 13  ? 19.318  -8.034  28.330  1.00 16.50 ? 13   ILE A CA    1 
ATOM   79   C C     . ILE A 1 13  ? 19.121  -9.381  29.046  1.00 18.99 ? 13   ILE A C     1 
ATOM   80   O O     . ILE A 1 13  ? 19.615  -10.419 28.586  1.00 19.49 ? 13   ILE A O     1 
ATOM   81   C CB    . ILE A 1 13  ? 20.362  -7.164  29.065  1.00 15.24 ? 13   ILE A CB    1 
ATOM   82   C CG1   . ILE A 1 13  ? 20.608  -5.883  28.254  1.00 16.61 ? 13   ILE A CG1   1 
ATOM   83   C CG2   . ILE A 1 13  ? 21.656  -7.931  29.263  1.00 13.53 ? 13   ILE A CG2   1 
ATOM   84   C CD1   . ILE A 1 13  ? 21.514  -4.869  28.935  1.00 15.35 ? 13   ILE A CD1   1 
ATOM   85   N N     . LEU A 1 14  ? 18.378  -9.367  30.155  1.00 18.57 ? 14   LEU A N     1 
ATOM   86   C CA    . LEU A 1 14  ? 18.115  -10.591 30.907  1.00 18.39 ? 14   LEU A CA    1 
ATOM   87   C C     . LEU A 1 14  ? 17.394  -11.597 30.023  1.00 19.89 ? 14   LEU A C     1 
ATOM   88   O O     . LEU A 1 14  ? 17.641  -12.793 30.111  1.00 19.01 ? 14   LEU A O     1 
ATOM   89   C CB    . LEU A 1 14  ? 17.273  -10.304 32.155  1.00 14.82 ? 14   LEU A CB    1 
ATOM   90   C CG    . LEU A 1 14  ? 18.010  -9.589  33.298  1.00 17.88 ? 14   LEU A CG    1 
ATOM   91   C CD1   . LEU A 1 14  ? 17.039  -9.256  34.429  1.00 10.90 ? 14   LEU A CD1   1 
ATOM   92   C CD2   . LEU A 1 14  ? 19.143  -10.471 33.807  1.00 9.90  ? 14   LEU A CD2   1 
ATOM   93   N N     . GLU A 1 15  ? 16.495  -11.113 29.175  1.00 21.83 ? 15   GLU A N     1 
ATOM   94   C CA    . GLU A 1 15  ? 15.780  -12.013 28.283  1.00 24.79 ? 15   GLU A CA    1 
ATOM   95   C C     . GLU A 1 15  ? 16.738  -12.599 27.253  1.00 24.41 ? 15   GLU A C     1 
ATOM   96   O O     . GLU A 1 15  ? 16.685  -13.790 26.946  1.00 25.93 ? 15   GLU A O     1 
ATOM   97   C CB    . GLU A 1 15  ? 14.641  -11.285 27.567  1.00 25.57 ? 15   GLU A CB    1 
ATOM   98   C CG    . GLU A 1 15  ? 13.291  -11.532 28.205  1.00 31.37 ? 15   GLU A CG    1 
ATOM   99   C CD    . GLU A 1 15  ? 12.159  -11.497 27.202  1.00 33.81 ? 15   GLU A CD    1 
ATOM   100  O OE1   . GLU A 1 15  ? 11.019  -11.837 27.589  1.00 33.03 ? 15   GLU A OE1   1 
ATOM   101  O OE2   . GLU A 1 15  ? 12.415  -11.134 26.029  1.00 34.95 ? 15   GLU A OE2   1 
ATOM   102  N N     . LYS A 1 16  ? 17.616  -11.754 26.727  1.00 22.18 ? 16   LYS A N     1 
ATOM   103  C CA    . LYS A 1 16  ? 18.589  -12.191 25.737  1.00 23.13 ? 16   LYS A CA    1 
ATOM   104  C C     . LYS A 1 16  ? 19.445  -13.334 26.256  1.00 23.43 ? 16   LYS A C     1 
ATOM   105  O O     . LYS A 1 16  ? 19.644  -14.334 25.569  1.00 24.96 ? 16   LYS A O     1 
ATOM   106  C CB    . LYS A 1 16  ? 19.503  -11.027 25.331  1.00 20.78 ? 16   LYS A CB    1 
ATOM   107  C CG    . LYS A 1 16  ? 20.688  -11.435 24.469  1.00 19.50 ? 16   LYS A CG    1 
ATOM   108  C CD    . LYS A 1 16  ? 21.487  -10.208 23.996  1.00 20.63 ? 16   LYS A CD    1 
ATOM   109  C CE    . LYS A 1 16  ? 22.872  -10.598 23.464  1.00 17.48 ? 16   LYS A CE    1 
ATOM   110  N NZ    . LYS A 1 16  ? 23.666  -9.412  23.000  1.00 14.76 ? 16   LYS A NZ    1 
ATOM   111  N N     . TYR A 1 17  ? 19.944  -13.185 27.474  1.00 22.79 ? 17   TYR A N     1 
ATOM   112  C CA    . TYR A 1 17  ? 20.813  -14.191 28.053  1.00 22.96 ? 17   TYR A CA    1 
ATOM   113  C C     . TYR A 1 17  ? 20.162  -15.314 28.842  1.00 24.78 ? 17   TYR A C     1 
ATOM   114  O O     . TYR A 1 17  ? 20.747  -16.392 28.960  1.00 24.15 ? 17   TYR A O     1 
ATOM   115  C CB    . TYR A 1 17  ? 21.858  -13.506 28.930  1.00 22.44 ? 17   TYR A CB    1 
ATOM   116  C CG    . TYR A 1 17  ? 22.846  -12.678 28.136  1.00 26.55 ? 17   TYR A CG    1 
ATOM   117  C CD1   . TYR A 1 17  ? 23.889  -13.286 27.437  1.00 27.11 ? 17   TYR A CD1   1 
ATOM   118  C CD2   . TYR A 1 17  ? 22.720  -11.292 28.057  1.00 26.07 ? 17   TYR A CD2   1 
ATOM   119  C CE1   . TYR A 1 17  ? 24.782  -12.536 26.680  1.00 30.26 ? 17   TYR A CE1   1 
ATOM   120  C CE2   . TYR A 1 17  ? 23.603  -10.532 27.304  1.00 28.59 ? 17   TYR A CE2   1 
ATOM   121  C CZ    . TYR A 1 17  ? 24.634  -11.160 26.616  1.00 30.59 ? 17   TYR A CZ    1 
ATOM   122  O OH    . TYR A 1 17  ? 25.509  -10.420 25.860  1.00 31.53 ? 17   TYR A OH    1 
ATOM   123  N N     . PHE A 1 18  ? 18.955  -15.096 29.361  1.00 23.41 ? 18   PHE A N     1 
ATOM   124  C CA    . PHE A 1 18  ? 18.336  -16.129 30.178  1.00 24.38 ? 18   PHE A CA    1 
ATOM   125  C C     . PHE A 1 18  ? 16.982  -16.697 29.791  1.00 25.00 ? 18   PHE A C     1 
ATOM   126  O O     . PHE A 1 18  ? 16.504  -17.632 30.441  1.00 26.65 ? 18   PHE A O     1 
ATOM   127  C CB    . PHE A 1 18  ? 18.290  -15.644 31.629  1.00 20.90 ? 18   PHE A CB    1 
ATOM   128  C CG    . PHE A 1 18  ? 19.630  -15.234 32.153  1.00 21.75 ? 18   PHE A CG    1 
ATOM   129  C CD1   . PHE A 1 18  ? 20.599  -16.189 32.437  1.00 20.67 ? 18   PHE A CD1   1 
ATOM   130  C CD2   . PHE A 1 18  ? 19.950  -13.884 32.300  1.00 20.92 ? 18   PHE A CD2   1 
ATOM   131  C CE1   . PHE A 1 18  ? 21.868  -15.811 32.854  1.00 20.40 ? 18   PHE A CE1   1 
ATOM   132  C CE2   . PHE A 1 18  ? 21.212  -13.496 32.714  1.00 20.09 ? 18   PHE A CE2   1 
ATOM   133  C CZ    . PHE A 1 18  ? 22.177  -14.463 32.994  1.00 21.68 ? 18   PHE A CZ    1 
ATOM   134  N N     . LYS A 1 19  ? 16.338  -16.159 28.766  1.00 24.48 ? 19   LYS A N     1 
ATOM   135  C CA    . LYS A 1 19  ? 15.056  -16.739 28.400  1.00 26.17 ? 19   LYS A CA    1 
ATOM   136  C C     . LYS A 1 19  ? 15.353  -18.157 27.910  1.00 25.90 ? 19   LYS A C     1 
ATOM   137  O O     . LYS A 1 19  ? 16.383  -18.388 27.280  1.00 24.96 ? 19   LYS A O     1 
ATOM   138  C CB    . LYS A 1 19  ? 14.371  -15.945 27.289  1.00 26.56 ? 19   LYS A CB    1 
ATOM   139  C CG    . LYS A 1 19  ? 13.014  -16.529 26.937  1.00 28.12 ? 19   LYS A CG    1 
ATOM   140  C CD    . LYS A 1 19  ? 12.409  -15.929 25.674  1.00 32.70 ? 19   LYS A CD    1 
ATOM   141  C CE    . LYS A 1 19  ? 11.868  -14.534 25.909  1.00 31.49 ? 19   LYS A CE    1 
ATOM   142  N NZ    . LYS A 1 19  ? 11.116  -14.068 24.715  1.00 35.62 ? 19   LYS A NZ    1 
ATOM   143  N N     . GLY A 1 20  ? 14.464  -19.102 28.210  1.00 25.65 ? 20   GLY A N     1 
ATOM   144  C CA    . GLY A 1 20  ? 14.675  -20.476 27.785  1.00 26.22 ? 20   GLY A CA    1 
ATOM   145  C C     . GLY A 1 20  ? 15.669  -21.246 28.644  1.00 27.41 ? 20   GLY A C     1 
ATOM   146  O O     . GLY A 1 20  ? 15.787  -22.470 28.525  1.00 28.77 ? 20   GLY A O     1 
ATOM   147  N N     . LYS A 1 21  ? 16.394  -20.536 29.502  1.00 26.43 ? 21   LYS A N     1 
ATOM   148  C CA    . LYS A 1 21  ? 17.368  -21.166 30.387  1.00 25.42 ? 21   LYS A CA    1 
ATOM   149  C C     . LYS A 1 21  ? 16.662  -21.739 31.605  1.00 26.33 ? 21   LYS A C     1 
ATOM   150  O O     . LYS A 1 21  ? 15.590  -21.277 31.992  1.00 25.71 ? 21   LYS A O     1 
ATOM   151  C CB    . LYS A 1 21  ? 18.406  -20.148 30.854  1.00 27.51 ? 21   LYS A CB    1 
ATOM   152  C CG    . LYS A 1 21  ? 19.753  -20.251 30.180  1.00 30.54 ? 21   LYS A CG    1 
ATOM   153  C CD    . LYS A 1 21  ? 19.659  -20.068 28.685  1.00 32.67 ? 21   LYS A CD    1 
ATOM   154  C CE    . LYS A 1 21  ? 21.041  -20.140 28.064  1.00 36.14 ? 21   LYS A CE    1 
ATOM   155  N NZ    . LYS A 1 21  ? 20.991  -19.994 26.588  1.00 36.82 ? 21   LYS A NZ    1 
ATOM   156  N N     . THR A 1 22  ? 17.271  -22.747 32.216  1.00 25.83 ? 22   THR A N     1 
ATOM   157  C CA    . THR A 1 22  ? 16.687  -23.362 33.390  1.00 25.27 ? 22   THR A CA    1 
ATOM   158  C C     . THR A 1 22  ? 17.410  -22.892 34.640  1.00 23.48 ? 22   THR A C     1 
ATOM   159  O O     . THR A 1 22  ? 18.635  -22.987 34.730  1.00 23.23 ? 22   THR A O     1 
ATOM   160  C CB    . THR A 1 22  ? 16.757  -24.896 33.300  1.00 27.54 ? 22   THR A CB    1 
ATOM   161  O OG1   . THR A 1 22  ? 15.915  -25.344 32.230  1.00 29.97 ? 22   THR A OG1   1 
ATOM   162  C CG2   . THR A 1 22  ? 16.300  -25.531 34.604  1.00 26.44 ? 22   THR A CG2   1 
ATOM   163  N N     . LEU A 1 23  ? 16.638  -22.373 35.591  1.00 20.36 ? 23   LEU A N     1 
ATOM   164  C CA    . LEU A 1 23  ? 17.176  -21.884 36.854  1.00 21.01 ? 23   LEU A CA    1 
ATOM   165  C C     . LEU A 1 23  ? 17.219  -23.050 37.828  1.00 21.34 ? 23   LEU A C     1 
ATOM   166  O O     . LEU A 1 23  ? 16.205  -23.696 38.078  1.00 22.23 ? 23   LEU A O     1 
ATOM   167  C CB    . LEU A 1 23  ? 16.284  -20.767 37.417  1.00 18.40 ? 23   LEU A CB    1 
ATOM   168  C CG    . LEU A 1 23  ? 16.663  -20.174 38.776  1.00 16.91 ? 23   LEU A CG    1 
ATOM   169  C CD1   . LEU A 1 23  ? 17.972  -19.399 38.665  1.00 14.00 ? 23   LEU A CD1   1 
ATOM   170  C CD2   . LEU A 1 23  ? 15.547  -19.263 39.258  1.00 16.57 ? 23   LEU A CD2   1 
ATOM   171  N N     . GLU A 1 24  ? 18.395  -23.310 38.381  1.00 24.01 ? 24   GLU A N     1 
ATOM   172  C CA    . GLU A 1 24  ? 18.573  -24.416 39.312  1.00 25.68 ? 24   GLU A CA    1 
ATOM   173  C C     . GLU A 1 24  ? 18.607  -23.934 40.747  1.00 26.22 ? 24   GLU A C     1 
ATOM   174  O O     . GLU A 1 24  ? 18.200  -24.652 41.659  1.00 26.65 ? 24   GLU A O     1 
ATOM   175  C CB    . GLU A 1 24  ? 19.862  -25.172 38.979  1.00 26.68 ? 24   GLU A CB    1 
ATOM   176  C CG    . GLU A 1 24  ? 19.921  -25.630 37.523  1.00 32.31 ? 24   GLU A CG    1 
ATOM   177  C CD    . GLU A 1 24  ? 21.150  -26.467 37.200  1.00 36.04 ? 24   GLU A CD    1 
ATOM   178  O OE1   . GLU A 1 24  ? 22.286  -26.026 37.503  1.00 37.32 ? 24   GLU A OE1   1 
ATOM   179  O OE2   . GLU A 1 24  ? 20.973  -27.566 36.631  1.00 38.11 ? 24   GLU A OE2   1 
ATOM   180  N N     . TYR A 1 25  ? 19.089  -22.713 40.954  1.00 27.07 ? 25   TYR A N     1 
ATOM   181  C CA    . TYR A 1 25  ? 19.142  -22.172 42.303  1.00 27.48 ? 25   TYR A CA    1 
ATOM   182  C C     . TYR A 1 25  ? 19.355  -20.672 42.385  1.00 25.32 ? 25   TYR A C     1 
ATOM   183  O O     . TYR A 1 25  ? 19.984  -20.067 41.519  1.00 24.16 ? 25   TYR A O     1 
ATOM   184  C CB    . TYR A 1 25  ? 20.240  -22.858 43.112  1.00 30.55 ? 25   TYR A CB    1 
ATOM   185  C CG    . TYR A 1 25  ? 20.053  -22.674 44.601  1.00 36.32 ? 25   TYR A CG    1 
ATOM   186  C CD1   . TYR A 1 25  ? 18.888  -23.123 45.234  1.00 37.03 ? 25   TYR A CD1   1 
ATOM   187  C CD2   . TYR A 1 25  ? 21.042  -22.081 45.385  1.00 37.77 ? 25   TYR A CD2   1 
ATOM   188  C CE1   . TYR A 1 25  ? 18.718  -22.992 46.611  1.00 38.55 ? 25   TYR A CE1   1 
ATOM   189  C CE2   . TYR A 1 25  ? 20.877  -21.946 46.767  1.00 40.10 ? 25   TYR A CE2   1 
ATOM   190  C CZ    . TYR A 1 25  ? 19.714  -22.407 47.370  1.00 38.86 ? 25   TYR A CZ    1 
ATOM   191  O OH    . TYR A 1 25  ? 19.561  -22.303 48.734  1.00 41.72 ? 25   TYR A OH    1 
ATOM   192  N N     . ILE A 1 26  ? 18.824  -20.081 43.448  1.00 22.52 ? 26   ILE A N     1 
ATOM   193  C CA    . ILE A 1 26  ? 18.969  -18.658 43.688  1.00 21.69 ? 26   ILE A CA    1 
ATOM   194  C C     . ILE A 1 26  ? 19.428  -18.502 45.136  1.00 21.78 ? 26   ILE A C     1 
ATOM   195  O O     . ILE A 1 26  ? 18.831  -19.068 46.054  1.00 22.73 ? 26   ILE A O     1 
ATOM   196  C CB    . ILE A 1 26  ? 17.639  -17.908 43.436  1.00 19.90 ? 26   ILE A CB    1 
ATOM   197  C CG1   . ILE A 1 26  ? 17.796  -16.429 43.777  1.00 20.79 ? 26   ILE A CG1   1 
ATOM   198  C CG2   . ILE A 1 26  ? 16.520  -18.528 44.249  1.00 25.13 ? 26   ILE A CG2   1 
ATOM   199  C CD1   . ILE A 1 26  ? 16.605  -15.577 43.346  1.00 20.51 ? 26   ILE A CD1   1 
ATOM   200  N N     . ASP A 1 27  ? 20.512  -17.762 45.341  1.00 21.07 ? 27   ASP A N     1 
ATOM   201  C CA    . ASP A 1 27  ? 21.034  -17.573 46.686  1.00 21.10 ? 27   ASP A CA    1 
ATOM   202  C C     . ASP A 1 27  ? 21.279  -16.117 47.056  1.00 21.63 ? 27   ASP A C     1 
ATOM   203  O O     . ASP A 1 27  ? 21.749  -15.324 46.244  1.00 21.83 ? 27   ASP A O     1 
ATOM   204  C CB    . ASP A 1 27  ? 22.331  -18.368 46.856  1.00 21.47 ? 27   ASP A CB    1 
ATOM   205  C CG    . ASP A 1 27  ? 22.944  -18.190 48.229  0.00 22.12 ? 27   ASP A CG    1 
ATOM   206  O OD1   . ASP A 1 27  ? 22.227  -18.391 49.231  0.00 22.51 ? 27   ASP A OD1   1 
ATOM   207  O OD2   . ASP A 1 27  ? 24.143  -17.852 48.305  0.00 22.50 ? 27   ASP A OD2   1 
ATOM   208  N N     . PHE A 1 28  ? 20.951  -15.773 48.296  1.00 21.76 ? 28   PHE A N     1 
ATOM   209  C CA    . PHE A 1 28  ? 21.152  -14.421 48.791  1.00 21.90 ? 28   PHE A CA    1 
ATOM   210  C C     . PHE A 1 28  ? 22.332  -14.475 49.738  1.00 22.32 ? 28   PHE A C     1 
ATOM   211  O O     . PHE A 1 28  ? 22.205  -14.878 50.891  1.00 25.06 ? 28   PHE A O     1 
ATOM   212  C CB    . PHE A 1 28  ? 19.883  -13.916 49.488  1.00 19.51 ? 28   PHE A CB    1 
ATOM   213  C CG    . PHE A 1 28  ? 18.724  -13.718 48.542  1.00 18.93 ? 28   PHE A CG    1 
ATOM   214  C CD1   . PHE A 1 28  ? 17.774  -14.718 48.356  1.00 19.02 ? 28   PHE A CD1   1 
ATOM   215  C CD2   . PHE A 1 28  ? 18.616  -12.544 47.791  1.00 18.53 ? 28   PHE A CD2   1 
ATOM   216  C CE1   . PHE A 1 28  ? 16.732  -14.554 47.437  1.00 18.43 ? 28   PHE A CE1   1 
ATOM   217  C CE2   . PHE A 1 28  ? 17.587  -12.372 46.874  1.00 16.29 ? 28   PHE A CE2   1 
ATOM   218  C CZ    . PHE A 1 28  ? 16.642  -13.375 46.694  1.00 17.01 ? 28   PHE A CZ    1 
ATOM   219  N N     . ILE A 1 29  ? 23.487  -14.072 49.222  1.00 23.58 ? 29   ILE A N     1 
ATOM   220  C CA    . ILE A 1 29  ? 24.745  -14.104 49.957  1.00 23.24 ? 29   ILE A CA    1 
ATOM   221  C C     . ILE A 1 29  ? 25.009  -12.944 50.900  1.00 24.49 ? 29   ILE A C     1 
ATOM   222  O O     . ILE A 1 29  ? 25.901  -13.029 51.747  1.00 25.51 ? 29   ILE A O     1 
ATOM   223  C CB    . ILE A 1 29  ? 25.925  -14.212 48.983  1.00 24.31 ? 29   ILE A CB    1 
ATOM   224  C CG1   . ILE A 1 29  ? 26.017  -12.946 48.129  1.00 23.66 ? 29   ILE A CG1   1 
ATOM   225  C CG2   . ILE A 1 29  ? 25.736  -15.422 48.084  1.00 24.17 ? 29   ILE A CG2   1 
ATOM   226  C CD1   . ILE A 1 29  ? 27.163  -12.974 47.144  1.00 27.77 ? 29   ILE A CD1   1 
ATOM   227  N N     . SER A 1 30  ? 24.258  -11.858 50.753  1.00 23.87 ? 30   SER A N     1 
ATOM   228  C CA    . SER A 1 30  ? 24.431  -10.704 51.632  1.00 25.38 ? 30   SER A CA    1 
ATOM   229  C C     . SER A 1 30  ? 23.260  -9.746  51.503  1.00 24.50 ? 30   SER A C     1 
ATOM   230  O O     . SER A 1 30  ? 22.384  -9.928  50.658  1.00 24.90 ? 30   SER A O     1 
ATOM   231  C CB    . SER A 1 30  ? 25.739  -9.961  51.321  1.00 26.39 ? 30   SER A CB    1 
ATOM   232  O OG    . SER A 1 30  ? 25.691  -9.305  50.066  1.00 29.27 ? 30   SER A OG    1 
ATOM   233  N N     . GLY A 1 31  ? 23.252  -8.724  52.347  1.00 24.30 ? 31   GLY A N     1 
ATOM   234  C CA    . GLY A 1 31  ? 22.176  -7.756  52.310  1.00 23.73 ? 31   GLY A CA    1 
ATOM   235  C C     . GLY A 1 31  ? 21.006  -8.216  53.150  1.00 22.81 ? 31   GLY A C     1 
ATOM   236  O O     . GLY A 1 31  ? 21.134  -9.147  53.944  1.00 21.94 ? 31   GLY A O     1 
ATOM   237  N N     . ARG A 1 32  ? 19.861  -7.573  52.956  1.00 22.34 ? 32   ARG A N     1 
ATOM   238  C CA    . ARG A 1 32  ? 18.648  -7.882  53.706  1.00 23.33 ? 32   ARG A CA    1 
ATOM   239  C C     . ARG A 1 32  ? 18.166  -9.325  53.610  1.00 22.30 ? 32   ARG A C     1 
ATOM   240  O O     . ARG A 1 32  ? 17.827  -9.930  54.619  1.00 21.15 ? 32   ARG A O     1 
ATOM   241  C CB    . ARG A 1 32  ? 17.517  -6.954  53.260  1.00 23.58 ? 32   ARG A CB    1 
ATOM   242  C CG    . ARG A 1 32  ? 17.008  -7.241  51.856  1.00 27.20 ? 32   ARG A CG    1 
ATOM   243  C CD    . ARG A 1 32  ? 16.197  -6.080  51.306  1.00 28.63 ? 32   ARG A CD    1 
ATOM   244  N NE    . ARG A 1 32  ? 14.982  -5.836  52.071  1.00 26.89 ? 32   ARG A NE    1 
ATOM   245  C CZ    . ARG A 1 32  ? 14.080  -4.913  51.756  1.00 28.25 ? 32   ARG A CZ    1 
ATOM   246  N NH1   . ARG A 1 32  ? 14.263  -4.143  50.688  1.00 28.99 ? 32   ARG A NH1   1 
ATOM   247  N NH2   . ARG A 1 32  ? 12.986  -4.774  52.494  1.00 24.72 ? 32   ARG A NH2   1 
ATOM   248  N N     . TYR A 1 33  ? 18.144  -9.879  52.404  1.00 22.84 ? 33   TYR A N     1 
ATOM   249  C CA    . TYR A 1 33  ? 17.656  -11.236 52.226  1.00 22.56 ? 33   TYR A CA    1 
ATOM   250  C C     . TYR A 1 33  ? 18.576  -12.343 52.703  1.00 23.42 ? 33   TYR A C     1 
ATOM   251  O O     . TYR A 1 33  ? 18.220  -13.518 52.647  1.00 23.15 ? 33   TYR A O     1 
ATOM   252  C CB    . TYR A 1 33  ? 17.233  -11.450 50.772  1.00 20.99 ? 33   TYR A CB    1 
ATOM   253  C CG    . TYR A 1 33  ? 16.115  -10.505 50.379  1.00 18.06 ? 33   TYR A CG    1 
ATOM   254  C CD1   . TYR A 1 33  ? 14.949  -10.411 51.146  1.00 15.08 ? 33   TYR A CD1   1 
ATOM   255  C CD2   . TYR A 1 33  ? 16.248  -9.659  49.278  1.00 17.80 ? 33   TYR A CD2   1 
ATOM   256  C CE1   . TYR A 1 33  ? 13.947  -9.490  50.825  1.00 15.86 ? 33   TYR A CE1   1 
ATOM   257  C CE2   . TYR A 1 33  ? 15.260  -8.739  48.951  1.00 17.44 ? 33   TYR A CE2   1 
ATOM   258  C CZ    . TYR A 1 33  ? 14.114  -8.657  49.724  1.00 18.56 ? 33   TYR A CZ    1 
ATOM   259  O OH    . TYR A 1 33  ? 13.149  -7.735  49.383  1.00 21.59 ? 33   TYR A OH    1 
ATOM   260  N N     . SER A 1 34  ? 19.760  -11.984 53.175  1.00 24.41 ? 34   SER A N     1 
ATOM   261  C CA    . SER A 1 34  ? 20.645  -13.001 53.719  1.00 25.97 ? 34   SER A CA    1 
ATOM   262  C C     . SER A 1 34  ? 20.314  -13.021 55.214  1.00 26.92 ? 34   SER A C     1 
ATOM   263  O O     . SER A 1 34  ? 20.493  -14.031 55.887  1.00 27.70 ? 34   SER A O     1 
ATOM   264  C CB    . SER A 1 34  ? 22.111  -12.635 53.514  1.00 24.81 ? 34   SER A CB    1 
ATOM   265  O OG    . SER A 1 34  ? 22.424  -11.456 54.222  1.00 30.39 ? 34   SER A OG    1 
ATOM   266  N N     . LYS A 1 35  ? 19.814  -11.893 55.716  1.00 26.22 ? 35   LYS A N     1 
ATOM   267  C CA    . LYS A 1 35  ? 19.444  -11.763 57.123  1.00 28.56 ? 35   LYS A CA    1 
ATOM   268  C C     . LYS A 1 35  ? 18.036  -12.290 57.364  1.00 28.55 ? 35   LYS A C     1 
ATOM   269  O O     . LYS A 1 35  ? 17.733  -12.809 58.435  1.00 28.63 ? 35   LYS A O     1 
ATOM   270  C CB    . LYS A 1 35  ? 19.531  -10.299 57.567  1.00 31.02 ? 35   LYS A CB    1 
ATOM   271  C CG    . LYS A 1 35  ? 20.959  -9.758  57.633  1.00 36.71 ? 35   LYS A CG    1 
ATOM   272  C CD    . LYS A 1 35  ? 21.816  -10.631 58.553  1.00 40.58 ? 35   LYS A CD    1 
ATOM   273  C CE    . LYS A 1 35  ? 23.250  -10.128 58.656  1.00 43.77 ? 35   LYS A CE    1 
ATOM   274  N NZ    . LYS A 1 35  ? 24.048  -10.968 59.603  1.00 45.84 ? 35   LYS A NZ    1 
ATOM   275  N N     . SER A 1 36  ? 17.183  -12.145 56.356  1.00 26.57 ? 36   SER A N     1 
ATOM   276  C CA    . SER A 1 36  ? 15.812  -12.614 56.419  1.00 26.11 ? 36   SER A CA    1 
ATOM   277  C C     . SER A 1 36  ? 15.388  -12.909 54.983  1.00 26.70 ? 36   SER A C     1 
ATOM   278  O O     . SER A 1 36  ? 15.465  -12.038 54.116  1.00 25.67 ? 36   SER A O     1 
ATOM   279  C CB    . SER A 1 36  ? 14.920  -11.544 57.034  1.00 25.53 ? 36   SER A CB    1 
ATOM   280  O OG    . SER A 1 36  ? 13.655  -12.095 57.328  1.00 28.78 ? 36   SER A OG    1 
ATOM   281  N N     . GLU A 1 37  ? 14.945  -14.135 54.730  1.00 26.38 ? 37   GLU A N     1 
ATOM   282  C CA    . GLU A 1 37  ? 14.574  -14.536 53.378  1.00 27.82 ? 37   GLU A CA    1 
ATOM   283  C C     . GLU A 1 37  ? 13.337  -13.852 52.786  1.00 24.24 ? 37   GLU A C     1 
ATOM   284  O O     . GLU A 1 37  ? 12.404  -13.478 53.501  1.00 19.98 ? 37   GLU A O     1 
ATOM   285  C CB    . GLU A 1 37  ? 14.412  -16.059 53.314  1.00 32.90 ? 37   GLU A CB    1 
ATOM   286  C CG    . GLU A 1 37  ? 15.653  -16.868 53.772  1.00 42.78 ? 37   GLU A CG    1 
ATOM   287  C CD    . GLU A 1 37  ? 16.888  -16.690 52.882  1.00 46.26 ? 37   GLU A CD    1 
ATOM   288  O OE1   . GLU A 1 37  ? 16.786  -16.906 51.659  1.00 50.21 ? 37   GLU A OE1   1 
ATOM   289  O OE2   . GLU A 1 37  ? 17.971  -16.348 53.406  1.00 47.95 ? 37   GLU A OE2   1 
ATOM   290  N N     . PRO A 1 38  ? 13.328  -13.679 51.452  1.00 20.96 ? 38   PRO A N     1 
ATOM   291  C CA    . PRO A 1 38  ? 12.216  -13.041 50.737  1.00 20.98 ? 38   PRO A CA    1 
ATOM   292  C C     . PRO A 1 38  ? 10.907  -13.797 50.914  1.00 21.90 ? 38   PRO A C     1 
ATOM   293  O O     . PRO A 1 38  ? 10.894  -14.984 51.238  1.00 21.50 ? 38   PRO A O     1 
ATOM   294  C CB    . PRO A 1 38  ? 12.676  -13.052 49.276  1.00 19.25 ? 38   PRO A CB    1 
ATOM   295  C CG    . PRO A 1 38  ? 14.181  -13.095 49.376  1.00 21.02 ? 38   PRO A CG    1 
ATOM   296  C CD    . PRO A 1 38  ? 14.405  -14.055 50.522  1.00 20.30 ? 38   PRO A CD    1 
ATOM   297  N N     . GLU A 1 39  ? 9.805   -13.094 50.690  1.00 24.13 ? 39   GLU A N     1 
ATOM   298  C CA    . GLU A 1 39  ? 8.479   -13.680 50.797  1.00 24.59 ? 39   GLU A CA    1 
ATOM   299  C C     . GLU A 1 39  ? 8.342   -14.756 49.719  1.00 22.93 ? 39   GLU A C     1 
ATOM   300  O O     . GLU A 1 39  ? 8.679   -14.518 48.559  1.00 21.55 ? 39   GLU A O     1 
ATOM   301  C CB    . GLU A 1 39  ? 7.426   -12.590 50.572  1.00 28.84 ? 39   GLU A CB    1 
ATOM   302  C CG    . GLU A 1 39  ? 6.016   -12.971 50.966  1.00 34.58 ? 39   GLU A CG    1 
ATOM   303  C CD    . GLU A 1 39  ? 4.999   -11.927 50.531  1.00 41.90 ? 39   GLU A CD    1 
ATOM   304  O OE1   . GLU A 1 39  ? 5.257   -10.712 50.718  1.00 43.67 ? 39   GLU A OE1   1 
ATOM   305  O OE2   . GLU A 1 39  ? 3.935   -12.323 50.005  1.00 44.77 ? 39   GLU A OE2   1 
ATOM   306  N N     . GLY A 1 40  ? 7.856   -15.932 50.106  1.00 21.16 ? 40   GLY A N     1 
ATOM   307  C CA    . GLY A 1 40  ? 7.674   -17.017 49.157  1.00 21.08 ? 40   GLY A CA    1 
ATOM   308  C C     . GLY A 1 40  ? 8.942   -17.721 48.693  1.00 22.86 ? 40   GLY A C     1 
ATOM   309  O O     . GLY A 1 40  ? 8.896   -18.520 47.753  1.00 21.95 ? 40   GLY A O     1 
ATOM   310  N N     . TYR A 1 41  ? 10.067  -17.445 49.351  1.00 22.35 ? 41   TYR A N     1 
ATOM   311  C CA    . TYR A 1 41  ? 11.352  -18.037 48.973  1.00 23.30 ? 41   TYR A CA    1 
ATOM   312  C C     . TYR A 1 41  ? 11.427  -19.558 49.158  1.00 25.05 ? 41   TYR A C     1 
ATOM   313  O O     . TYR A 1 41  ? 11.860  -20.284 48.260  1.00 22.23 ? 41   TYR A O     1 
ATOM   314  C CB    . TYR A 1 41  ? 12.478  -17.369 49.767  1.00 24.51 ? 41   TYR A CB    1 
ATOM   315  C CG    . TYR A 1 41  ? 13.865  -17.882 49.434  1.00 24.66 ? 41   TYR A CG    1 
ATOM   316  C CD1   . TYR A 1 41  ? 14.464  -17.591 48.211  1.00 23.00 ? 41   TYR A CD1   1 
ATOM   317  C CD2   . TYR A 1 41  ? 14.574  -18.667 50.344  1.00 24.93 ? 41   TYR A CD2   1 
ATOM   318  C CE1   . TYR A 1 41  ? 15.736  -18.069 47.900  1.00 25.65 ? 41   TYR A CE1   1 
ATOM   319  C CE2   . TYR A 1 41  ? 15.847  -19.151 50.043  1.00 25.22 ? 41   TYR A CE2   1 
ATOM   320  C CZ    . TYR A 1 41  ? 16.421  -18.849 48.820  1.00 25.85 ? 41   TYR A CZ    1 
ATOM   321  O OH    . TYR A 1 41  ? 17.673  -19.336 48.516  1.00 26.09 ? 41   TYR A OH    1 
ATOM   322  N N     . ASP A 1 42  ? 11.010  -20.036 50.325  1.00 26.31 ? 42   ASP A N     1 
ATOM   323  C CA    . ASP A 1 42  ? 11.038  -21.465 50.615  1.00 27.91 ? 42   ASP A CA    1 
ATOM   324  C C     . ASP A 1 42  ? 10.223  -22.303 49.635  1.00 26.08 ? 42   ASP A C     1 
ATOM   325  O O     . ASP A 1 42  ? 10.675  -23.363 49.213  1.00 25.77 ? 42   ASP A O     1 
ATOM   326  C CB    . ASP A 1 42  ? 10.567  -21.715 52.051  1.00 32.50 ? 42   ASP A CB    1 
ATOM   327  C CG    . ASP A 1 42  ? 11.577  -21.239 53.080  1.00 36.08 ? 42   ASP A CG    1 
ATOM   328  O OD1   . ASP A 1 42  ? 11.225  -21.150 54.279  1.00 39.08 ? 42   ASP A OD1   1 
ATOM   329  O OD2   . ASP A 1 42  ? 12.732  -20.961 52.688  1.00 37.68 ? 42   ASP A OD2   1 
ATOM   330  N N     . ASP A 1 43  ? 9.030   -21.840 49.271  1.00 24.59 ? 43   ASP A N     1 
ATOM   331  C CA    . ASP A 1 43  ? 8.206   -22.584 48.324  1.00 25.22 ? 43   ASP A CA    1 
ATOM   332  C C     . ASP A 1 43  ? 8.855   -22.599 46.955  1.00 23.64 ? 43   ASP A C     1 
ATOM   333  O O     . ASP A 1 43  ? 8.859   -23.617 46.272  1.00 23.54 ? 43   ASP A O     1 
ATOM   334  C CB    . ASP A 1 43  ? 6.804   -21.976 48.189  1.00 31.04 ? 43   ASP A CB    1 
ATOM   335  C CG    . ASP A 1 43  ? 5.910   -22.293 49.372  1.00 37.95 ? 43   ASP A CG    1 
ATOM   336  O OD1   . ASP A 1 43  ? 5.850   -23.476 49.774  1.00 42.87 ? 43   ASP A OD1   1 
ATOM   337  O OD2   . ASP A 1 43  ? 5.256   -21.365 49.893  1.00 43.07 ? 43   ASP A OD2   1 
ATOM   338  N N     . PHE A 1 44  ? 9.396   -21.456 46.552  1.00 21.54 ? 44   PHE A N     1 
ATOM   339  C CA    . PHE A 1 44  ? 10.044  -21.338 45.255  1.00 19.78 ? 44   PHE A CA    1 
ATOM   340  C C     . PHE A 1 44  ? 11.227  -22.303 45.105  1.00 18.69 ? 44   PHE A C     1 
ATOM   341  O O     . PHE A 1 44  ? 11.296  -23.054 44.137  1.00 18.06 ? 44   PHE A O     1 
ATOM   342  C CB    . PHE A 1 44  ? 10.506  -19.894 45.035  1.00 18.86 ? 44   PHE A CB    1 
ATOM   343  C CG    . PHE A 1 44  ? 11.151  -19.659 43.702  1.00 17.76 ? 44   PHE A CG    1 
ATOM   344  C CD1   . PHE A 1 44  ? 12.529  -19.516 43.598  1.00 17.43 ? 44   PHE A CD1   1 
ATOM   345  C CD2   . PHE A 1 44  ? 10.379  -19.568 42.550  1.00 16.84 ? 44   PHE A CD2   1 
ATOM   346  C CE1   . PHE A 1 44  ? 13.137  -19.278 42.358  1.00 19.01 ? 44   PHE A CE1   1 
ATOM   347  C CE2   . PHE A 1 44  ? 10.975  -19.331 41.305  1.00 19.24 ? 44   PHE A CE2   1 
ATOM   348  C CZ    . PHE A 1 44  ? 12.357  -19.185 41.210  1.00 15.98 ? 44   PHE A CZ    1 
ATOM   349  N N     . ILE A 1 45  ? 12.149  -22.282 46.061  1.00 18.26 ? 45   ILE A N     1 
ATOM   350  C CA    . ILE A 1 45  ? 13.315  -23.152 46.009  1.00 19.79 ? 45   ILE A CA    1 
ATOM   351  C C     . ILE A 1 45  ? 12.912  -24.627 45.989  1.00 20.46 ? 45   ILE A C     1 
ATOM   352  O O     . ILE A 1 45  ? 13.594  -25.466 45.395  1.00 19.39 ? 45   ILE A O     1 
ATOM   353  C CB    . ILE A 1 45  ? 14.249  -22.893 47.210  1.00 21.64 ? 45   ILE A CB    1 
ATOM   354  C CG1   . ILE A 1 45  ? 14.823  -21.478 47.115  1.00 23.29 ? 45   ILE A CG1   1 
ATOM   355  C CG2   . ILE A 1 45  ? 15.376  -23.913 47.230  1.00 24.41 ? 45   ILE A CG2   1 
ATOM   356  C CD1   . ILE A 1 45  ? 15.544  -21.203 45.817  1.00 21.28 ? 45   ILE A CD1   1 
ATOM   357  N N     . ALA A 1 46  ? 11.796  -24.929 46.639  1.00 19.32 ? 46   ALA A N     1 
ATOM   358  C CA    . ALA A 1 46  ? 11.288  -26.288 46.699  1.00 21.39 ? 46   ALA A CA    1 
ATOM   359  C C     . ALA A 1 46  ? 10.785  -26.724 45.327  1.00 22.03 ? 46   ALA A C     1 
ATOM   360  O O     . ALA A 1 46  ? 10.607  -27.913 45.079  1.00 22.48 ? 46   ALA A O     1 
ATOM   361  C CB    . ALA A 1 46  ? 10.156  -26.379 47.722  1.00 17.79 ? 46   ALA A CB    1 
ATOM   362  N N     . ASN A 1 47  ? 10.573  -25.764 44.430  1.00 20.75 ? 47   ASN A N     1 
ATOM   363  C CA    . ASN A 1 47  ? 10.067  -26.088 43.105  1.00 19.92 ? 47   ASN A CA    1 
ATOM   364  C C     . ASN A 1 47  ? 11.070  -26.018 41.975  1.00 18.03 ? 47   ASN A C     1 
ATOM   365  O O     . ASN A 1 47  ? 10.720  -26.267 40.830  1.00 18.64 ? 47   ASN A O     1 
ATOM   366  C CB    . ASN A 1 47  ? 8.860   -25.210 42.777  1.00 22.63 ? 47   ASN A CB    1 
ATOM   367  C CG    . ASN A 1 47  ? 7.596   -25.700 43.445  1.00 23.60 ? 47   ASN A CG    1 
ATOM   368  O OD1   . ASN A 1 47  ? 6.997   -26.677 43.011  1.00 25.07 ? 47   ASN A OD1   1 
ATOM   369  N ND2   . ASN A 1 47  ? 7.197   -25.036 44.518  1.00 25.56 ? 47   ASN A ND2   1 
ATOM   370  N N     . LEU A 1 48  ? 12.314  -25.683 42.282  1.00 18.20 ? 48   LEU A N     1 
ATOM   371  C CA    . LEU A 1 48  ? 13.336  -25.619 41.241  1.00 19.59 ? 48   LEU A CA    1 
ATOM   372  C C     . LEU A 1 48  ? 13.786  -27.050 40.931  1.00 20.49 ? 48   LEU A C     1 
ATOM   373  O O     . LEU A 1 48  ? 13.647  -27.939 41.778  1.00 18.99 ? 48   LEU A O     1 
ATOM   374  C CB    . LEU A 1 48  ? 14.528  -24.776 41.711  1.00 16.42 ? 48   LEU A CB    1 
ATOM   375  C CG    . LEU A 1 48  ? 14.217  -23.294 41.954  1.00 18.21 ? 48   LEU A CG    1 
ATOM   376  C CD1   . LEU A 1 48  ? 15.404  -22.595 42.613  1.00 15.87 ? 48   LEU A CD1   1 
ATOM   377  C CD2   . LEU A 1 48  ? 13.867  -22.633 40.633  1.00 15.50 ? 48   LEU A CD2   1 
ATOM   378  N N     . PRO A 1 49  ? 14.338  -27.288 39.722  1.00 20.87 ? 49   PRO A N     1 
ATOM   379  C CA    . PRO A 1 49  ? 14.558  -26.298 38.654  1.00 22.27 ? 49   PRO A CA    1 
ATOM   380  C C     . PRO A 1 49  ? 13.312  -25.838 37.897  1.00 23.37 ? 49   PRO A C     1 
ATOM   381  O O     . PRO A 1 49  ? 12.292  -26.526 37.860  1.00 24.46 ? 49   PRO A O     1 
ATOM   382  C CB    . PRO A 1 49  ? 15.556  -26.999 37.730  1.00 21.62 ? 49   PRO A CB    1 
ATOM   383  C CG    . PRO A 1 49  ? 15.179  -28.451 37.876  1.00 20.94 ? 49   PRO A CG    1 
ATOM   384  C CD    . PRO A 1 49  ? 14.977  -28.573 39.376  1.00 21.28 ? 49   PRO A CD    1 
ATOM   385  N N     . LEU A 1 50  ? 13.417  -24.661 37.292  1.00 24.29 ? 50   LEU A N     1 
ATOM   386  C CA    . LEU A 1 50  ? 12.330  -24.075 36.519  1.00 24.48 ? 50   LEU A CA    1 
ATOM   387  C C     . LEU A 1 50  ? 12.896  -23.344 35.309  1.00 24.76 ? 50   LEU A C     1 
ATOM   388  O O     . LEU A 1 50  ? 13.972  -22.743 35.374  1.00 26.63 ? 50   LEU A O     1 
ATOM   389  C CB    . LEU A 1 50  ? 11.534  -23.085 37.373  1.00 22.78 ? 50   LEU A CB    1 
ATOM   390  C CG    . LEU A 1 50  ? 10.655  -23.625 38.498  1.00 22.72 ? 50   LEU A CG    1 
ATOM   391  C CD1   . LEU A 1 50  ? 10.069  -22.440 39.276  1.00 18.88 ? 50   LEU A CD1   1 
ATOM   392  C CD2   . LEU A 1 50  ? 9.542   -24.496 37.916  1.00 19.13 ? 50   LEU A CD2   1 
ATOM   393  N N     . LYS A 1 51  ? 12.157  -23.391 34.210  1.00 25.88 ? 51   LYS A N     1 
ATOM   394  C CA    . LYS A 1 51  ? 12.567  -22.742 32.972  1.00 26.88 ? 51   LYS A CA    1 
ATOM   395  C C     . LYS A 1 51  ? 12.054  -21.302 32.906  1.00 25.07 ? 51   LYS A C     1 
ATOM   396  O O     . LYS A 1 51  ? 10.901  -21.025 33.247  1.00 25.73 ? 51   LYS A O     1 
ATOM   397  C CB    . LYS A 1 51  ? 12.032  -23.540 31.778  1.00 28.61 ? 51   LYS A CB    1 
ATOM   398  C CG    . LYS A 1 51  ? 12.408  -22.987 30.415  1.00 32.09 ? 51   LYS A CG    1 
ATOM   399  C CD    . LYS A 1 51  ? 12.108  -24.010 29.321  1.00 33.93 ? 51   LYS A CD    1 
ATOM   400  C CE    . LYS A 1 51  ? 12.633  -23.552 27.960  1.00 34.47 ? 51   LYS A CE    1 
ATOM   401  N NZ    . LYS A 1 51  ? 12.542  -24.632 26.933  1.00 33.49 ? 51   LYS A NZ    1 
ATOM   402  N N     . VAL A 1 52  ? 12.923  -20.393 32.478  1.00 23.72 ? 52   VAL A N     1 
ATOM   403  C CA    . VAL A 1 52  ? 12.566  -18.984 32.334  1.00 23.49 ? 52   VAL A CA    1 
ATOM   404  C C     . VAL A 1 52  ? 11.845  -18.811 31.004  1.00 24.71 ? 52   VAL A C     1 
ATOM   405  O O     . VAL A 1 52  ? 12.421  -19.060 29.948  1.00 24.31 ? 52   VAL A O     1 
ATOM   406  C CB    . VAL A 1 52  ? 13.814  -18.081 32.288  1.00 22.67 ? 52   VAL A CB    1 
ATOM   407  C CG1   . VAL A 1 52  ? 13.410  -16.649 31.942  1.00 23.36 ? 52   VAL A CG1   1 
ATOM   408  C CG2   . VAL A 1 52  ? 14.549  -18.128 33.616  1.00 21.72 ? 52   VAL A CG2   1 
ATOM   409  N N     . SER A 1 53  ? 10.586  -18.394 31.054  1.00 26.36 ? 53   SER A N     1 
ATOM   410  C CA    . SER A 1 53  ? 9.818   -18.169 29.841  1.00 26.62 ? 53   SER A CA    1 
ATOM   411  C C     . SER A 1 53  ? 9.909   -16.701 29.422  1.00 28.67 ? 53   SER A C     1 
ATOM   412  O O     . SER A 1 53  ? 10.032  -16.395 28.235  1.00 29.47 ? 53   SER A O     1 
ATOM   413  C CB    . SER A 1 53  ? 8.362   -18.570 30.056  1.00 27.10 ? 53   SER A CB    1 
ATOM   414  O OG    . SER A 1 53  ? 7.829   -17.967 31.222  1.00 32.60 ? 53   SER A OG    1 
ATOM   415  N N     . ASN A 1 54  ? 9.865   -15.789 30.389  1.00 29.05 ? 54   ASN A N     1 
ATOM   416  C CA    . ASN A 1 54  ? 9.945   -14.365 30.067  1.00 28.54 ? 54   ASN A CA    1 
ATOM   417  C C     . ASN A 1 54  ? 10.490  -13.511 31.209  1.00 26.55 ? 54   ASN A C     1 
ATOM   418  O O     . ASN A 1 54  ? 10.518  -13.930 32.368  1.00 24.57 ? 54   ASN A O     1 
ATOM   419  C CB    . ASN A 1 54  ? 8.558   -13.814 29.693  1.00 33.03 ? 54   ASN A CB    1 
ATOM   420  C CG    . ASN A 1 54  ? 7.796   -14.713 28.731  1.00 36.50 ? 54   ASN A CG    1 
ATOM   421  O OD1   . ASN A 1 54  ? 7.316   -15.784 29.110  1.00 40.34 ? 54   ASN A OD1   1 
ATOM   422  N ND2   . ASN A 1 54  ? 7.680   -14.280 27.479  1.00 37.62 ? 54   ASN A ND2   1 
ATOM   423  N N     . VAL A 1 55  ? 10.919  -12.304 30.856  1.00 25.02 ? 55   VAL A N     1 
ATOM   424  C CA    . VAL A 1 55  ? 11.419  -11.319 31.809  1.00 24.96 ? 55   VAL A CA    1 
ATOM   425  C C     . VAL A 1 55  ? 10.772  -10.027 31.318  1.00 26.56 ? 55   VAL A C     1 
ATOM   426  O O     . VAL A 1 55  ? 11.071  -9.560  30.219  1.00 27.64 ? 55   VAL A O     1 
ATOM   427  C CB    . VAL A 1 55  ? 12.944  -11.171 31.758  1.00 24.31 ? 55   VAL A CB    1 
ATOM   428  C CG1   . VAL A 1 55  ? 13.391  -10.145 32.786  1.00 24.37 ? 55   VAL A CG1   1 
ATOM   429  C CG2   . VAL A 1 55  ? 13.607  -12.505 32.024  1.00 23.98 ? 55   VAL A CG2   1 
ATOM   430  N N     . ASP A 1 56  ? 9.886   -9.455  32.127  1.00 25.95 ? 56   ASP A N     1 
ATOM   431  C CA    . ASP A 1 56  ? 9.164   -8.263  31.722  1.00 24.18 ? 56   ASP A CA    1 
ATOM   432  C C     . ASP A 1 56  ? 9.200   -7.122  32.733  1.00 22.58 ? 56   ASP A C     1 
ATOM   433  O O     . ASP A 1 56  ? 9.641   -7.280  33.872  1.00 21.28 ? 56   ASP A O     1 
ATOM   434  C CB    . ASP A 1 56  ? 7.708   -8.639  31.443  1.00 26.58 ? 56   ASP A CB    1 
ATOM   435  C CG    . ASP A 1 56  ? 7.111   -7.865  30.286  1.00 32.00 ? 56   ASP A CG    1 
ATOM   436  O OD1   . ASP A 1 56  ? 7.290   -6.629  30.213  1.00 32.66 ? 56   ASP A OD1   1 
ATOM   437  O OD2   . ASP A 1 56  ? 6.450   -8.504  29.444  1.00 37.01 ? 56   ASP A OD2   1 
ATOM   438  N N     . THR A 1 57  ? 8.712   -5.964  32.307  1.00 20.43 ? 57   THR A N     1 
ATOM   439  C CA    . THR A 1 57  ? 8.692   -4.805  33.178  1.00 19.09 ? 57   THR A CA    1 
ATOM   440  C C     . THR A 1 57  ? 7.475   -3.945  32.940  1.00 17.60 ? 57   THR A C     1 
ATOM   441  O O     . THR A 1 57  ? 6.828   -4.029  31.897  1.00 16.06 ? 57   THR A O     1 
ATOM   442  C CB    . THR A 1 57  ? 9.922   -3.896  32.955  1.00 18.75 ? 57   THR A CB    1 
ATOM   443  O OG1   . THR A 1 57  ? 9.829   -3.272  31.668  1.00 18.16 ? 57   THR A OG1   1 
ATOM   444  C CG2   . THR A 1 57  ? 11.212  -4.702  33.018  1.00 19.68 ? 57   THR A CG2   1 
ATOM   445  N N     . LYS A 1 58  ? 7.167   -3.139  33.946  1.00 16.29 ? 58   LYS A N     1 
ATOM   446  C CA    . LYS A 1 58  ? 6.094   -2.164  33.891  1.00 15.54 ? 58   LYS A CA    1 
ATOM   447  C C     . LYS A 1 58  ? 6.672   -1.058  34.759  1.00 13.97 ? 58   LYS A C     1 
ATOM   448  O O     . LYS A 1 58  ? 6.873   -1.235  35.966  1.00 12.01 ? 58   LYS A O     1 
ATOM   449  C CB    . LYS A 1 58  ? 4.777   -2.689  34.481  1.00 15.28 ? 58   LYS A CB    1 
ATOM   450  C CG    . LYS A 1 58  ? 3.617   -1.756  34.122  1.00 17.21 ? 58   LYS A CG    1 
ATOM   451  C CD    . LYS A 1 58  ? 2.259   -2.165  34.661  1.00 17.92 ? 58   LYS A CD    1 
ATOM   452  C CE    . LYS A 1 58  ? 1.182   -1.205  34.119  1.00 22.56 ? 58   LYS A CE    1 
ATOM   453  N NZ    . LYS A 1 58  ? -0.208  -1.475  34.597  1.00 16.74 ? 58   LYS A NZ    1 
ATOM   454  N N     . GLY A 1 59  ? 6.989   0.072   34.143  1.00 14.17 ? 59   GLY A N     1 
ATOM   455  C CA    . GLY A 1 59  ? 7.581   1.153   34.909  1.00 13.71 ? 59   GLY A CA    1 
ATOM   456  C C     . GLY A 1 59  ? 8.903   0.683   35.499  1.00 12.79 ? 59   GLY A C     1 
ATOM   457  O O     . GLY A 1 59  ? 9.764   0.166   34.790  1.00 14.62 ? 59   GLY A O     1 
ATOM   458  N N     . LYS A 1 60  ? 9.063   0.840   36.804  1.00 13.09 ? 60   LYS A N     1 
ATOM   459  C CA    . LYS A 1 60  ? 10.289  0.433   37.469  1.00 13.34 ? 60   LYS A CA    1 
ATOM   460  C C     . LYS A 1 60  ? 10.179  -0.970  38.052  1.00 13.00 ? 60   LYS A C     1 
ATOM   461  O O     . LYS A 1 60  ? 11.080  -1.416  38.755  1.00 14.75 ? 60   LYS A O     1 
ATOM   462  C CB    . LYS A 1 60  ? 10.631  1.424   38.586  1.00 12.16 ? 60   LYS A CB    1 
ATOM   463  C CG    . LYS A 1 60  ? 10.776  2.867   38.109  1.00 15.61 ? 60   LYS A CG    1 
ATOM   464  C CD    . LYS A 1 60  ? 10.710  3.843   39.283  1.00 14.49 ? 60   LYS A CD    1 
ATOM   465  C CE    . LYS A 1 60  ? 10.581  5.288   38.800  1.00 18.50 ? 60   LYS A CE    1 
ATOM   466  N NZ    . LYS A 1 60  ? 10.424  6.254   39.933  1.00 14.97 ? 60   LYS A NZ    1 
ATOM   467  N N     . PHE A 1 61  ? 9.079   -1.663  37.768  1.00 10.84 ? 61   PHE A N     1 
ATOM   468  C CA    . PHE A 1 61  ? 8.881   -3.012  38.291  1.00 11.89 ? 61   PHE A CA    1 
ATOM   469  C C     . PHE A 1 61  ? 9.294   -4.069  37.261  1.00 11.64 ? 61   PHE A C     1 
ATOM   470  O O     . PHE A 1 61  ? 8.862   -4.025  36.113  1.00 12.24 ? 61   PHE A O     1 
ATOM   471  C CB    . PHE A 1 61  ? 7.409   -3.214  38.682  1.00 12.09 ? 61   PHE A CB    1 
ATOM   472  C CG    . PHE A 1 61  ? 7.090   -4.605  39.165  1.00 14.84 ? 61   PHE A CG    1 
ATOM   473  C CD1   . PHE A 1 61  ? 7.659   -5.103  40.332  1.00 14.40 ? 61   PHE A CD1   1 
ATOM   474  C CD2   . PHE A 1 61  ? 6.227   -5.422  38.446  1.00 15.89 ? 61   PHE A CD2   1 
ATOM   475  C CE1   . PHE A 1 61  ? 7.368   -6.405  40.775  1.00 17.28 ? 61   PHE A CE1   1 
ATOM   476  C CE2   . PHE A 1 61  ? 5.933   -6.719  38.880  1.00 18.60 ? 61   PHE A CE2   1 
ATOM   477  C CZ    . PHE A 1 61  ? 6.508   -7.210  40.049  1.00 15.50 ? 61   PHE A CZ    1 
ATOM   478  N N     . LEU A 1 62  ? 10.142  -5.007  37.679  1.00 12.99 ? 62   LEU A N     1 
ATOM   479  C CA    . LEU A 1 62  ? 10.609  -6.085  36.807  1.00 13.65 ? 62   LEU A CA    1 
ATOM   480  C C     . LEU A 1 62  ? 10.190  -7.437  37.365  1.00 13.67 ? 62   LEU A C     1 
ATOM   481  O O     . LEU A 1 62  ? 10.051  -7.594  38.572  1.00 13.99 ? 62   LEU A O     1 
ATOM   482  C CB    . LEU A 1 62  ? 12.140  -6.051  36.675  1.00 11.71 ? 62   LEU A CB    1 
ATOM   483  C CG    . LEU A 1 62  ? 12.817  -7.125  35.795  1.00 14.02 ? 62   LEU A CG    1 
ATOM   484  C CD1   . LEU A 1 62  ? 14.061  -6.546  35.148  1.00 11.08 ? 62   LEU A CD1   1 
ATOM   485  C CD2   . LEU A 1 62  ? 13.184  -8.362  36.620  1.00 9.91  ? 62   LEU A CD2   1 
ATOM   486  N N     . TRP A 1 63  ? 9.983   -8.415  36.492  1.00 15.52 ? 63   TRP A N     1 
ATOM   487  C CA    . TRP A 1 63  ? 9.628   -9.751  36.964  1.00 17.37 ? 63   TRP A CA    1 
ATOM   488  C C     . TRP A 1 63  ? 9.993   -10.861 35.990  1.00 17.75 ? 63   TRP A C     1 
ATOM   489  O O     . TRP A 1 63  ? 9.993   -10.663 34.773  1.00 17.66 ? 63   TRP A O     1 
ATOM   490  C CB    . TRP A 1 63  ? 8.131   -9.838  37.305  1.00 14.73 ? 63   TRP A CB    1 
ATOM   491  C CG    . TRP A 1 63  ? 7.193   -9.945  36.133  1.00 15.53 ? 63   TRP A CG    1 
ATOM   492  C CD1   . TRP A 1 63  ? 6.715   -11.096 35.565  1.00 15.81 ? 63   TRP A CD1   1 
ATOM   493  C CD2   . TRP A 1 63  ? 6.580   -8.864  35.422  1.00 15.67 ? 63   TRP A CD2   1 
ATOM   494  N NE1   . TRP A 1 63  ? 5.838   -10.795 34.552  1.00 18.70 ? 63   TRP A NE1   1 
ATOM   495  C CE2   . TRP A 1 63  ? 5.735   -9.434  34.442  1.00 16.92 ? 63   TRP A CE2   1 
ATOM   496  C CE3   . TRP A 1 63  ? 6.656   -7.466  35.523  1.00 18.14 ? 63   TRP A CE3   1 
ATOM   497  C CZ2   . TRP A 1 63  ? 4.970   -8.655  33.564  1.00 18.25 ? 63   TRP A CZ2   1 
ATOM   498  C CZ3   . TRP A 1 63  ? 5.895   -6.688  34.650  1.00 18.66 ? 63   TRP A CZ3   1 
ATOM   499  C CH2   . TRP A 1 63  ? 5.060   -7.288  33.683  1.00 17.43 ? 63   TRP A CH2   1 
ATOM   500  N N     . PHE A 1 64  ? 10.316  -12.023 36.550  1.00 17.85 ? 64   PHE A N     1 
ATOM   501  C CA    . PHE A 1 64  ? 10.654  -13.206 35.767  1.00 18.55 ? 64   PHE A CA    1 
ATOM   502  C C     . PHE A 1 64  ? 9.443   -14.126 35.820  1.00 20.16 ? 64   PHE A C     1 
ATOM   503  O O     . PHE A 1 64  ? 8.818   -14.293 36.875  1.00 17.89 ? 64   PHE A O     1 
ATOM   504  C CB    . PHE A 1 64  ? 11.825  -13.997 36.369  1.00 18.02 ? 64   PHE A CB    1 
ATOM   505  C CG    . PHE A 1 64  ? 13.167  -13.332 36.248  1.00 18.41 ? 64   PHE A CG    1 
ATOM   506  C CD1   . PHE A 1 64  ? 13.501  -12.239 37.047  1.00 18.88 ? 64   PHE A CD1   1 
ATOM   507  C CD2   . PHE A 1 64  ? 14.123  -13.842 35.379  1.00 16.13 ? 64   PHE A CD2   1 
ATOM   508  C CE1   . PHE A 1 64  ? 14.775  -11.669 36.987  1.00 19.68 ? 64   PHE A CE1   1 
ATOM   509  C CE2   . PHE A 1 64  ? 15.398  -13.282 35.305  1.00 19.61 ? 64   PHE A CE2   1 
ATOM   510  C CZ    . PHE A 1 64  ? 15.725  -12.191 36.114  1.00 19.56 ? 64   PHE A CZ    1 
ATOM   511  N N     . GLU A 1 65  ? 9.112   -14.720 34.685  1.00 20.61 ? 65   GLU A N     1 
ATOM   512  C CA    . GLU A 1 65  ? 8.014   -15.659 34.632  1.00 23.60 ? 65   GLU A CA    1 
ATOM   513  C C     . GLU A 1 65  ? 8.689   -16.994 34.321  1.00 24.48 ? 65   GLU A C     1 
ATOM   514  O O     . GLU A 1 65  ? 9.450   -17.088 33.360  1.00 23.22 ? 65   GLU A O     1 
ATOM   515  C CB    . GLU A 1 65  ? 7.035   -15.282 33.523  1.00 26.11 ? 65   GLU A CB    1 
ATOM   516  C CG    . GLU A 1 65  ? 5.722   -16.050 33.577  1.00 33.10 ? 65   GLU A CG    1 
ATOM   517  C CD    . GLU A 1 65  ? 4.728   -15.570 32.533  1.00 38.26 ? 65   GLU A CD    1 
ATOM   518  O OE1   . GLU A 1 65  ? 4.482   -14.341 32.468  1.00 40.99 ? 65   GLU A OE1   1 
ATOM   519  O OE2   . GLU A 1 65  ? 4.194   -16.419 31.784  1.00 39.16 ? 65   GLU A OE2   1 
ATOM   520  N N     . LEU A 1 66  ? 8.438   -18.004 35.151  1.00 24.91 ? 66   LEU A N     1 
ATOM   521  C CA    . LEU A 1 66  ? 9.026   -19.328 34.957  1.00 25.44 ? 66   LEU A CA    1 
ATOM   522  C C     . LEU A 1 66  ? 7.965   -20.422 35.025  1.00 26.82 ? 66   LEU A C     1 
ATOM   523  O O     . LEU A 1 66  ? 6.856   -20.197 35.519  1.00 26.40 ? 66   LEU A O     1 
ATOM   524  C CB    . LEU A 1 66  ? 10.082  -19.619 36.024  1.00 23.99 ? 66   LEU A CB    1 
ATOM   525  C CG    . LEU A 1 66  ? 11.232  -18.644 36.243  1.00 22.53 ? 66   LEU A CG    1 
ATOM   526  C CD1   . LEU A 1 66  ? 10.808  -17.563 37.225  1.00 21.96 ? 66   LEU A CD1   1 
ATOM   527  C CD2   . LEU A 1 66  ? 12.423  -19.402 36.793  1.00 20.55 ? 66   LEU A CD2   1 
ATOM   528  N N     . PHE A 1 67  ? 8.319   -21.608 34.539  1.00 28.69 ? 67   PHE A N     1 
ATOM   529  C CA    . PHE A 1 67  ? 7.407   -22.746 34.548  1.00 30.73 ? 67   PHE A CA    1 
ATOM   530  C C     . PHE A 1 67  ? 8.169   -24.065 34.497  1.00 33.21 ? 67   PHE A C     1 
ATOM   531  O O     . PHE A 1 67  ? 9.329   -24.109 34.092  1.00 32.58 ? 67   PHE A O     1 
ATOM   532  C CB    . PHE A 1 67  ? 6.449   -22.681 33.351  1.00 29.08 ? 67   PHE A CB    1 
ATOM   533  C CG    . PHE A 1 67  ? 7.111   -22.947 32.026  1.00 31.15 ? 67   PHE A CG    1 
ATOM   534  C CD1   . PHE A 1 67  ? 7.899   -21.974 31.414  1.00 29.38 ? 67   PHE A CD1   1 
ATOM   535  C CD2   . PHE A 1 67  ? 6.964   -24.183 31.398  1.00 29.65 ? 67   PHE A CD2   1 
ATOM   536  C CE1   . PHE A 1 67  ? 8.528   -22.226 30.194  1.00 31.61 ? 67   PHE A CE1   1 
ATOM   537  C CE2   . PHE A 1 67  ? 7.588   -24.448 30.179  1.00 30.53 ? 67   PHE A CE2   1 
ATOM   538  C CZ    . PHE A 1 67  ? 8.374   -23.470 29.573  1.00 29.64 ? 67   PHE A CZ    1 
ATOM   539  N N     . ASP A 1 68  ? 7.509   -25.138 34.921  1.00 38.57 ? 68   ASP A N     1 
ATOM   540  C CA    . ASP A 1 68  ? 8.112   -26.464 34.900  1.00 43.17 ? 68   ASP A CA    1 
ATOM   541  C C     . ASP A 1 68  ? 7.793   -27.039 33.527  1.00 45.23 ? 68   ASP A C     1 
ATOM   542  O O     . ASP A 1 68  ? 6.632   -27.241 33.189  1.00 44.64 ? 68   ASP A O     1 
ATOM   543  C CB    . ASP A 1 68  ? 7.509   -27.338 36.004  1.00 45.07 ? 68   ASP A CB    1 
ATOM   544  C CG    . ASP A 1 68  ? 8.235   -28.668 36.165  1.00 47.04 ? 68   ASP A CG    1 
ATOM   545  O OD1   . ASP A 1 68  ? 8.102   -29.278 37.245  1.00 50.08 ? 68   ASP A OD1   1 
ATOM   546  O OD2   . ASP A 1 68  ? 8.927   -29.109 35.223  1.00 47.89 ? 68   ASP A OD2   1 
ATOM   547  N N     . PRO A 1 69  ? 8.824   -27.291 32.709  1.00 49.03 ? 69   PRO A N     1 
ATOM   548  C CA    . PRO A 1 69  ? 8.625   -27.840 31.364  1.00 52.63 ? 69   PRO A CA    1 
ATOM   549  C C     . PRO A 1 69  ? 7.602   -28.972 31.291  1.00 55.11 ? 69   PRO A C     1 
ATOM   550  O O     . PRO A 1 69  ? 6.735   -28.976 30.417  1.00 54.94 ? 69   PRO A O     1 
ATOM   551  C CB    . PRO A 1 69  ? 10.030  -28.286 30.968  1.00 51.68 ? 69   PRO A CB    1 
ATOM   552  C CG    . PRO A 1 69  ? 10.881  -27.243 31.609  1.00 51.21 ? 69   PRO A CG    1 
ATOM   553  C CD    . PRO A 1 69  ? 10.259  -27.112 32.992  1.00 49.70 ? 69   PRO A CD    1 
ATOM   554  N N     . ASN A 1 70  ? 7.692   -29.923 32.215  1.00 58.47 ? 70   ASN A N     1 
ATOM   555  C CA    . ASN A 1 70  ? 6.765   -31.051 32.221  1.00 62.41 ? 70   ASN A CA    1 
ATOM   556  C C     . ASN A 1 70  ? 5.400   -30.719 32.818  1.00 63.55 ? 70   ASN A C     1 
ATOM   557  O O     . ASN A 1 70  ? 4.451   -31.486 32.673  1.00 64.59 ? 70   ASN A O     1 
ATOM   558  C CB    . ASN A 1 70  ? 7.385   -32.240 32.955  1.00 62.77 ? 70   ASN A CB    1 
ATOM   559  C CG    . ASN A 1 70  ? 8.685   -32.697 32.318  1.00 64.93 ? 70   ASN A CG    1 
ATOM   560  O OD1   . ASN A 1 70  ? 9.755   -32.145 32.589  1.00 65.10 ? 70   ASN A OD1   1 
ATOM   561  N ND2   . ASN A 1 70  ? 8.595   -33.697 31.447  1.00 65.47 ? 70   ASN A ND2   1 
ATOM   562  N N     . ASP A 1 71  ? 5.303   -29.576 33.487  1.00 65.09 ? 71   ASP A N     1 
ATOM   563  C CA    . ASP A 1 71  ? 4.042   -29.140 34.079  1.00 66.54 ? 71   ASP A CA    1 
ATOM   564  C C     . ASP A 1 71  ? 3.820   -27.661 33.757  1.00 66.86 ? 71   ASP A C     1 
ATOM   565  O O     . ASP A 1 71  ? 3.975   -26.792 34.616  1.00 67.16 ? 71   ASP A O     1 
ATOM   566  C CB    . ASP A 1 71  ? 4.061   -29.351 35.596  1.00 67.74 ? 71   ASP A CB    1 
ATOM   567  C CG    . ASP A 1 71  ? 2.753   -28.950 36.258  1.00 69.44 ? 71   ASP A CG    1 
ATOM   568  O OD1   . ASP A 1 71  ? 2.646   -29.089 37.496  1.00 69.10 ? 71   ASP A OD1   1 
ATOM   569  O OD2   . ASP A 1 71  ? 1.830   -28.496 35.544  1.00 70.65 ? 71   ASP A OD2   1 
ATOM   570  N N     . LYS A 1 72  ? 3.451   -27.388 32.510  1.00 67.00 ? 72   LYS A N     1 
ATOM   571  C CA    . LYS A 1 72  ? 3.223   -26.025 32.044  1.00 66.66 ? 72   LYS A CA    1 
ATOM   572  C C     . LYS A 1 72  ? 2.168   -25.242 32.820  1.00 66.30 ? 72   LYS A C     1 
ATOM   573  O O     . LYS A 1 72  ? 1.980   -24.048 32.583  1.00 66.50 ? 72   LYS A O     1 
ATOM   574  C CB    . LYS A 1 72  ? 2.869   -26.049 30.558  1.00 67.32 ? 72   LYS A CB    1 
ATOM   575  C CG    . LYS A 1 72  ? 4.046   -26.418 29.668  1.00 68.26 ? 72   LYS A CG    1 
ATOM   576  C CD    . LYS A 1 72  ? 3.589   -26.829 28.278  1.00 69.24 ? 72   LYS A CD    1 
ATOM   577  C CE    . LYS A 1 72  ? 2.793   -28.131 28.329  1.00 69.13 ? 72   LYS A CE    1 
ATOM   578  N NZ    . LYS A 1 72  ? 2.342   -28.592 26.983  1.00 67.54 ? 72   LYS A NZ    1 
ATOM   579  N N     . SER A 1 73  ? 1.480   -25.906 33.743  1.00 65.48 ? 73   SER A N     1 
ATOM   580  C CA    . SER A 1 73  ? 0.461   -25.236 34.549  1.00 64.05 ? 73   SER A CA    1 
ATOM   581  C C     . SER A 1 73  ? 1.140   -24.558 35.734  1.00 61.84 ? 73   SER A C     1 
ATOM   582  O O     . SER A 1 73  ? 0.729   -23.486 36.176  1.00 61.45 ? 73   SER A O     1 
ATOM   583  C CB    . SER A 1 73  ? -0.573  -26.245 35.060  1.00 64.81 ? 73   SER A CB    1 
ATOM   584  O OG    . SER A 1 73  ? -1.585  -25.595 35.814  1.00 64.62 ? 73   SER A OG    1 
ATOM   585  N N     . ASN A 1 74  ? 2.188   -25.202 36.236  1.00 59.63 ? 74   ASN A N     1 
ATOM   586  C CA    . ASN A 1 74  ? 2.958   -24.696 37.365  1.00 56.97 ? 74   ASN A CA    1 
ATOM   587  C C     . ASN A 1 74  ? 3.777   -23.487 36.914  1.00 53.64 ? 74   ASN A C     1 
ATOM   588  O O     . ASN A 1 74  ? 4.860   -23.641 36.352  1.00 52.77 ? 74   ASN A O     1 
ATOM   589  C CB    . ASN A 1 74  ? 3.891   -25.799 37.883  1.00 58.69 ? 74   ASN A CB    1 
ATOM   590  C CG    . ASN A 1 74  ? 4.598   -25.419 39.173  1.00 60.09 ? 74   ASN A CG    1 
ATOM   591  O OD1   . ASN A 1 74  ? 5.472   -26.147 39.652  1.00 60.54 ? 74   ASN A OD1   1 
ATOM   592  N ND2   . ASN A 1 74  ? 4.220   -24.282 39.746  1.00 60.81 ? 74   ASN A ND2   1 
ATOM   593  N N     . LYS A 1 75  ? 3.248   -22.289 37.152  1.00 50.06 ? 75   LYS A N     1 
ATOM   594  C CA    . LYS A 1 75  ? 3.934   -21.059 36.769  1.00 46.17 ? 75   LYS A CA    1 
ATOM   595  C C     . LYS A 1 75  ? 4.378   -20.244 37.974  1.00 42.01 ? 75   LYS A C     1 
ATOM   596  O O     . LYS A 1 75  ? 3.593   -19.970 38.883  1.00 40.59 ? 75   LYS A O     1 
ATOM   597  C CB    . LYS A 1 75  ? 3.039   -20.199 35.874  1.00 48.10 ? 75   LYS A CB    1 
ATOM   598  C CG    . LYS A 1 75  ? 2.750   -20.833 34.525  1.00 51.57 ? 75   LYS A CG    1 
ATOM   599  C CD    . LYS A 1 75  ? 2.204   -19.832 33.521  1.00 52.31 ? 75   LYS A CD    1 
ATOM   600  C CE    . LYS A 1 75  ? 2.039   -20.489 32.154  1.00 54.93 ? 75   LYS A CE    1 
ATOM   601  N NZ    . LYS A 1 75  ? 1.670   -19.516 31.084  1.00 55.26 ? 75   LYS A NZ    1 
ATOM   602  N N     . TRP A 1 76  ? 5.651   -19.865 37.971  1.00 36.97 ? 76   TRP A N     1 
ATOM   603  C CA    . TRP A 1 76  ? 6.215   -19.079 39.054  1.00 32.07 ? 76   TRP A CA    1 
ATOM   604  C C     . TRP A 1 76  ? 6.700   -17.704 38.606  1.00 29.34 ? 76   TRP A C     1 
ATOM   605  O O     . TRP A 1 76  ? 7.048   -17.489 37.445  1.00 26.56 ? 76   TRP A O     1 
ATOM   606  C CB    . TRP A 1 76  ? 7.357   -19.843 39.725  1.00 29.83 ? 76   TRP A CB    1 
ATOM   607  C CG    . TRP A 1 76  ? 6.866   -20.945 40.590  1.00 29.90 ? 76   TRP A CG    1 
ATOM   608  C CD1   . TRP A 1 76  ? 6.465   -22.185 40.192  1.00 28.79 ? 76   TRP A CD1   1 
ATOM   609  C CD2   . TRP A 1 76  ? 6.662   -20.889 42.007  1.00 29.74 ? 76   TRP A CD2   1 
ATOM   610  N NE1   . TRP A 1 76  ? 6.021   -22.907 41.273  1.00 30.18 ? 76   TRP A NE1   1 
ATOM   611  C CE2   . TRP A 1 76  ? 6.133   -22.137 42.399  1.00 29.44 ? 76   TRP A CE2   1 
ATOM   612  C CE3   . TRP A 1 76  ? 6.876   -19.904 42.983  1.00 31.11 ? 76   TRP A CE3   1 
ATOM   613  C CZ2   . TRP A 1 76  ? 5.811   -22.430 43.728  1.00 29.75 ? 76   TRP A CZ2   1 
ATOM   614  C CZ3   . TRP A 1 76  ? 6.554   -20.194 44.308  1.00 31.72 ? 76   TRP A CZ3   1 
ATOM   615  C CH2   . TRP A 1 76  ? 6.028   -21.451 44.666  1.00 31.15 ? 76   TRP A CH2   1 
ATOM   616  N N     . TYR A 1 77  ? 6.720   -16.775 39.550  1.00 26.72 ? 77   TYR A N     1 
ATOM   617  C CA    . TYR A 1 77  ? 7.148   -15.418 39.265  1.00 25.26 ? 77   TYR A CA    1 
ATOM   618  C C     . TYR A 1 77  ? 8.161   -14.942 40.284  1.00 23.32 ? 77   TYR A C     1 
ATOM   619  O O     . TYR A 1 77  ? 8.111   -15.324 41.458  1.00 23.88 ? 77   TYR A O     1 
ATOM   620  C CB    . TYR A 1 77  ? 5.947   -14.466 39.278  1.00 23.15 ? 77   TYR A CB    1 
ATOM   621  C CG    . TYR A 1 77  ? 4.843   -14.875 38.331  1.00 24.69 ? 77   TYR A CG    1 
ATOM   622  C CD1   . TYR A 1 77  ? 3.854   -15.775 38.729  1.00 26.23 ? 77   TYR A CD1   1 
ATOM   623  C CD2   . TYR A 1 77  ? 4.817   -14.405 37.020  1.00 24.41 ? 77   TYR A CD2   1 
ATOM   624  C CE1   . TYR A 1 77  ? 2.868   -16.198 37.843  1.00 27.55 ? 77   TYR A CE1   1 
ATOM   625  C CE2   . TYR A 1 77  ? 3.839   -14.820 36.128  1.00 26.48 ? 77   TYR A CE2   1 
ATOM   626  C CZ    . TYR A 1 77  ? 2.866   -15.718 36.543  1.00 27.84 ? 77   TYR A CZ    1 
ATOM   627  O OH    . TYR A 1 77  ? 1.890   -16.131 35.659  1.00 30.17 ? 77   TYR A OH    1 
ATOM   628  N N     . ILE A 1 78  ? 9.101   -14.133 39.819  1.00 19.47 ? 78   ILE A N     1 
ATOM   629  C CA    . ILE A 1 78  ? 10.092  -13.546 40.699  1.00 16.91 ? 78   ILE A CA    1 
ATOM   630  C C     . ILE A 1 78  ? 9.867   -12.053 40.515  1.00 15.77 ? 78   ILE A C     1 
ATOM   631  O O     . ILE A 1 78  ? 10.076  -11.528 39.425  1.00 13.51 ? 78   ILE A O     1 
ATOM   632  C CB    . ILE A 1 78  ? 11.528  -13.870 40.279  1.00 17.17 ? 78   ILE A CB    1 
ATOM   633  C CG1   . ILE A 1 78  ? 11.761  -15.382 40.302  1.00 17.32 ? 78   ILE A CG1   1 
ATOM   634  C CG2   . ILE A 1 78  ? 12.497  -13.146 41.212  1.00 14.27 ? 78   ILE A CG2   1 
ATOM   635  C CD1   . ILE A 1 78  ? 13.104  -15.790 39.700  1.00 17.21 ? 78   ILE A CD1   1 
ATOM   636  N N     . TRP A 1 79  ? 9.404   -11.394 41.574  1.00 15.78 ? 79   TRP A N     1 
ATOM   637  C CA    . TRP A 1 79  ? 9.138   -9.954  41.563  1.00 14.66 ? 79   TRP A CA    1 
ATOM   638  C C     . TRP A 1 79  ? 10.422  -9.257  41.945  1.00 15.54 ? 79   TRP A C     1 
ATOM   639  O O     . TRP A 1 79  ? 11.066  -9.658  42.900  1.00 16.08 ? 79   TRP A O     1 
ATOM   640  C CB    . TRP A 1 79  ? 8.087   -9.590  42.608  1.00 13.40 ? 79   TRP A CB    1 
ATOM   641  C CG    . TRP A 1 79  ? 6.742   -10.158 42.370  1.00 14.71 ? 79   TRP A CG    1 
ATOM   642  C CD1   . TRP A 1 79  ? 6.436   -11.295 41.674  1.00 17.11 ? 79   TRP A CD1   1 
ATOM   643  C CD2   . TRP A 1 79  ? 5.512   -9.668  42.900  1.00 16.02 ? 79   TRP A CD2   1 
ATOM   644  N NE1   . TRP A 1 79  ? 5.089   -11.544 41.747  1.00 19.86 ? 79   TRP A NE1   1 
ATOM   645  C CE2   . TRP A 1 79  ? 4.497   -10.560 42.499  1.00 18.16 ? 79   TRP A CE2   1 
ATOM   646  C CE3   . TRP A 1 79  ? 5.167   -8.562  43.689  1.00 15.71 ? 79   TRP A CE3   1 
ATOM   647  C CZ2   . TRP A 1 79  ? 3.158   -10.378 42.850  1.00 19.95 ? 79   TRP A CZ2   1 
ATOM   648  C CZ3   . TRP A 1 79  ? 3.835   -8.382  44.039  1.00 17.36 ? 79   TRP A CZ3   1 
ATOM   649  C CH2   . TRP A 1 79  ? 2.848   -9.285  43.623  1.00 17.90 ? 79   TRP A CH2   1 
ATOM   650  N N     . ASN A 1 80  ? 10.802  -8.210  41.226  1.00 14.66 ? 80   ASN A N     1 
ATOM   651  C CA    . ASN A 1 80  ? 12.030  -7.524  41.586  1.00 15.78 ? 80   ASN A CA    1 
ATOM   652  C C     . ASN A 1 80  ? 11.923  -6.005  41.463  1.00 15.93 ? 80   ASN A C     1 
ATOM   653  O O     . ASN A 1 80  ? 11.371  -5.467  40.495  1.00 15.56 ? 80   ASN A O     1 
ATOM   654  C CB    . ASN A 1 80  ? 13.185  -8.080  40.744  1.00 16.91 ? 80   ASN A CB    1 
ATOM   655  C CG    . ASN A 1 80  ? 14.487  -7.333  40.961  1.00 17.64 ? 80   ASN A CG    1 
ATOM   656  O OD1   . ASN A 1 80  ? 15.072  -6.815  40.004  1.00 22.70 ? 80   ASN A OD1   1 
ATOM   657  N ND2   . ASN A 1 80  ? 14.949  -7.260  42.220  1.00 14.90 ? 80   ASN A ND2   1 
ATOM   658  N N     . THR A 1 81  ? 12.438  -5.324  42.477  1.00 17.03 ? 81   THR A N     1 
ATOM   659  C CA    . THR A 1 81  ? 12.442  -3.875  42.525  1.00 18.62 ? 81   THR A CA    1 
ATOM   660  C C     . THR A 1 81  ? 13.900  -3.490  42.688  1.00 19.70 ? 81   THR A C     1 
ATOM   661  O O     . THR A 1 81  ? 14.625  -4.128  43.449  1.00 21.20 ? 81   THR A O     1 
ATOM   662  C CB    . THR A 1 81  ? 11.586  -3.384  43.701  1.00 20.29 ? 81   THR A CB    1 
ATOM   663  O OG1   . THR A 1 81  ? 10.536  -2.552  43.195  1.00 25.13 ? 81   THR A OG1   1 
ATOM   664  C CG2   . THR A 1 81  ? 12.411  -2.635  44.721  1.00 22.46 ? 81   THR A CG2   1 
ATOM   665  N N     . PHE A 1 82  ? 14.325  -2.454  41.970  1.00 19.07 ? 82   PHE A N     1 
ATOM   666  C CA    . PHE A 1 82  ? 15.712  -2.003  41.992  1.00 19.44 ? 82   PHE A CA    1 
ATOM   667  C C     . PHE A 1 82  ? 16.080  -1.027  43.091  1.00 18.54 ? 82   PHE A C     1 
ATOM   668  O O     . PHE A 1 82  ? 17.240  -0.957  43.486  1.00 18.92 ? 82   PHE A O     1 
ATOM   669  C CB    . PHE A 1 82  ? 16.076  -1.343  40.654  1.00 21.15 ? 82   PHE A CB    1 
ATOM   670  C CG    . PHE A 1 82  ? 16.187  -2.298  39.498  1.00 19.69 ? 82   PHE A CG    1 
ATOM   671  C CD1   . PHE A 1 82  ? 15.349  -3.396  39.396  1.00 20.39 ? 82   PHE A CD1   1 
ATOM   672  C CD2   . PHE A 1 82  ? 17.087  -2.048  38.471  1.00 20.97 ? 82   PHE A CD2   1 
ATOM   673  C CE1   . PHE A 1 82  ? 15.401  -4.231  38.285  1.00 20.57 ? 82   PHE A CE1   1 
ATOM   674  C CE2   . PHE A 1 82  ? 17.144  -2.876  37.356  1.00 20.95 ? 82   PHE A CE2   1 
ATOM   675  C CZ    . PHE A 1 82  ? 16.296  -3.971  37.267  1.00 20.72 ? 82   PHE A CZ    1 
ATOM   676  N N     . GLY A 1 83  ? 15.114  -0.253  43.568  1.00 17.30 ? 83   GLY A N     1 
ATOM   677  C CA    . GLY A 1 83  ? 15.425  0.725   44.592  1.00 16.22 ? 83   GLY A CA    1 
ATOM   678  C C     . GLY A 1 83  ? 16.242  1.837   43.955  1.00 18.16 ? 83   GLY A C     1 
ATOM   679  O O     . GLY A 1 83  ? 16.012  2.195   42.805  1.00 17.05 ? 83   GLY A O     1 
ATOM   680  N N     . LEU A 1 84  ? 17.215  2.367   44.688  1.00 19.49 ? 84   LEU A N     1 
ATOM   681  C CA    . LEU A 1 84  ? 18.053  3.450   44.186  1.00 19.37 ? 84   LEU A CA    1 
ATOM   682  C C     . LEU A 1 84  ? 19.370  3.007   43.560  1.00 20.00 ? 84   LEU A C     1 
ATOM   683  O O     . LEU A 1 84  ? 19.927  3.725   42.733  1.00 20.43 ? 84   LEU A O     1 
ATOM   684  C CB    . LEU A 1 84  ? 18.368  4.429   45.319  1.00 17.78 ? 84   LEU A CB    1 
ATOM   685  C CG    . LEU A 1 84  ? 17.243  5.328   45.828  1.00 18.43 ? 84   LEU A CG    1 
ATOM   686  C CD1   . LEU A 1 84  ? 17.703  6.095   47.059  1.00 14.10 ? 84   LEU A CD1   1 
ATOM   687  C CD2   . LEU A 1 84  ? 16.830  6.294   44.714  1.00 20.96 ? 84   LEU A CD2   1 
ATOM   688  N N     . THR A 1 85  ? 19.863  1.829   43.937  1.00 19.15 ? 85   THR A N     1 
ATOM   689  C CA    . THR A 1 85  ? 21.154  1.375   43.432  1.00 16.87 ? 85   THR A CA    1 
ATOM   690  C C     . THR A 1 85  ? 21.190  -0.055  42.912  1.00 18.34 ? 85   THR A C     1 
ATOM   691  O O     . THR A 1 85  ? 22.266  -0.598  42.660  1.00 17.66 ? 85   THR A O     1 
ATOM   692  C CB    . THR A 1 85  ? 22.225  1.508   44.538  1.00 17.83 ? 85   THR A CB    1 
ATOM   693  O OG1   . THR A 1 85  ? 21.780  0.817   45.718  1.00 13.09 ? 85   THR A OG1   1 
ATOM   694  C CG2   . THR A 1 85  ? 22.467  2.980   44.875  1.00 13.94 ? 85   THR A CG2   1 
ATOM   695  N N     . GLY A 1 86  ? 20.024  -0.665  42.752  1.00 17.76 ? 86   GLY A N     1 
ATOM   696  C CA    . GLY A 1 86  ? 19.986  -2.031  42.269  1.00 18.32 ? 86   GLY A CA    1 
ATOM   697  C C     . GLY A 1 86  ? 20.500  -2.166  40.855  1.00 19.15 ? 86   GLY A C     1 
ATOM   698  O O     . GLY A 1 86  ? 20.240  -1.304  40.011  1.00 18.70 ? 86   GLY A O     1 
ATOM   699  N N     . MET A 1 87  ? 21.224  -3.255  40.599  1.00 20.74 ? 87   MET A N     1 
ATOM   700  C CA    . MET A 1 87  ? 21.793  -3.533  39.279  1.00 22.33 ? 87   MET A CA    1 
ATOM   701  C C     . MET A 1 87  ? 21.929  -5.024  39.025  1.00 19.41 ? 87   MET A C     1 
ATOM   702  O O     . MET A 1 87  ? 22.262  -5.790  39.924  1.00 20.04 ? 87   MET A O     1 
ATOM   703  C CB    . MET A 1 87  ? 23.199  -2.932  39.133  1.00 24.58 ? 87   MET A CB    1 
ATOM   704  C CG    . MET A 1 87  ? 23.310  -1.440  39.313  1.00 31.97 ? 87   MET A CG    1 
ATOM   705  S SD    . MET A 1 87  ? 24.994  -0.889  38.928  1.00 36.71 ? 87   MET A SD    1 
ATOM   706  C CE    . MET A 1 87  ? 25.847  -1.305  40.453  1.00 34.69 ? 87   MET A CE    1 
ATOM   707  N N     . TRP A 1 88  ? 21.677  -5.432  37.792  1.00 17.98 ? 88   TRP A N     1 
ATOM   708  C CA    . TRP A 1 88  ? 21.838  -6.825  37.422  1.00 17.94 ? 88   TRP A CA    1 
ATOM   709  C C     . TRP A 1 88  ? 23.131  -6.869  36.618  1.00 19.09 ? 88   TRP A C     1 
ATOM   710  O O     . TRP A 1 88  ? 23.562  -5.847  36.063  1.00 18.09 ? 88   TRP A O     1 
ATOM   711  C CB    . TRP A 1 88  ? 20.673  -7.320  36.559  1.00 16.62 ? 88   TRP A CB    1 
ATOM   712  C CG    . TRP A 1 88  ? 19.449  -7.674  37.347  1.00 16.98 ? 88   TRP A CG    1 
ATOM   713  C CD1   . TRP A 1 88  ? 18.408  -6.849  37.661  1.00 15.29 ? 88   TRP A CD1   1 
ATOM   714  C CD2   . TRP A 1 88  ? 19.144  -8.945  37.933  1.00 13.61 ? 88   TRP A CD2   1 
ATOM   715  N NE1   . TRP A 1 88  ? 17.474  -7.527  38.400  1.00 15.00 ? 88   TRP A NE1   1 
ATOM   716  C CE2   . TRP A 1 88  ? 17.900  -8.817  38.586  1.00 14.68 ? 88   TRP A CE2   1 
ATOM   717  C CE3   . TRP A 1 88  ? 19.805  -10.183 37.974  1.00 15.12 ? 88   TRP A CE3   1 
ATOM   718  C CZ2   . TRP A 1 88  ? 17.297  -9.877  39.273  1.00 13.05 ? 88   TRP A CZ2   1 
ATOM   719  C CZ3   . TRP A 1 88  ? 19.205  -11.240 38.657  1.00 13.14 ? 88   TRP A CZ3   1 
ATOM   720  C CH2   . TRP A 1 88  ? 17.964  -11.078 39.297  1.00 13.76 ? 88   TRP A CH2   1 
ATOM   721  N N     . SER A 1 89  ? 23.758  -8.038  36.571  1.00 17.45 ? 89   SER A N     1 
ATOM   722  C CA    . SER A 1 89  ? 24.997  -8.186  35.834  1.00 20.26 ? 89   SER A CA    1 
ATOM   723  C C     . SER A 1 89  ? 25.292  -9.633  35.528  1.00 22.90 ? 89   SER A C     1 
ATOM   724  O O     . SER A 1 89  ? 24.718  -10.547 36.133  1.00 21.15 ? 89   SER A O     1 
ATOM   725  C CB    . SER A 1 89  ? 26.164  -7.596  36.622  1.00 22.87 ? 89   SER A CB    1 
ATOM   726  O OG    . SER A 1 89  ? 26.273  -8.203  37.897  1.00 28.73 ? 89   SER A OG    1 
ATOM   727  N N     . LEU A 1 90  ? 26.199  -9.829  34.577  1.00 22.86 ? 90   LEU A N     1 
ATOM   728  C CA    . LEU A 1 90  ? 26.603  -11.155 34.172  1.00 23.46 ? 90   LEU A CA    1 
ATOM   729  C C     . LEU A 1 90  ? 27.800  -11.615 34.989  1.00 23.66 ? 90   LEU A C     1 
ATOM   730  O O     . LEU A 1 90  ? 28.213  -12.769 34.890  1.00 24.79 ? 90   LEU A O     1 
ATOM   731  C CB    . LEU A 1 90  ? 26.926  -11.164 32.682  1.00 23.99 ? 90   LEU A CB    1 
ATOM   732  C CG    . LEU A 1 90  ? 25.705  -10.890 31.799  1.00 23.96 ? 90   LEU A CG    1 
ATOM   733  C CD1   . LEU A 1 90  ? 26.123  -10.940 30.339  1.00 24.12 ? 90   LEU A CD1   1 
ATOM   734  C CD2   . LEU A 1 90  ? 24.616  -11.921 32.071  1.00 22.06 ? 90   LEU A CD2   1 
ATOM   735  N N     . PHE A 1 91  ? 28.344  -10.715 35.808  1.00 22.37 ? 91   PHE A N     1 
ATOM   736  C CA    . PHE A 1 91  ? 29.478  -11.055 36.660  1.00 23.89 ? 91   PHE A CA    1 
ATOM   737  C C     . PHE A 1 91  ? 29.198  -10.671 38.113  1.00 24.69 ? 91   PHE A C     1 
ATOM   738  O O     . PHE A 1 91  ? 28.390  -9.783  38.386  1.00 23.44 ? 91   PHE A O     1 
ATOM   739  C CB    . PHE A 1 91  ? 30.755  -10.356 36.174  1.00 24.64 ? 91   PHE A CB    1 
ATOM   740  C CG    . PHE A 1 91  ? 30.776  -8.877  36.429  1.00 26.82 ? 91   PHE A CG    1 
ATOM   741  C CD1   . PHE A 1 91  ? 30.092  -8.001  35.594  1.00 27.44 ? 91   PHE A CD1   1 
ATOM   742  C CD2   . PHE A 1 91  ? 31.479  -8.360  37.515  1.00 26.02 ? 91   PHE A CD2   1 
ATOM   743  C CE1   . PHE A 1 91  ? 30.110  -6.626  35.840  1.00 27.21 ? 91   PHE A CE1   1 
ATOM   744  C CE2   . PHE A 1 91  ? 31.501  -6.994  37.767  1.00 26.84 ? 91   PHE A CE2   1 
ATOM   745  C CZ    . PHE A 1 91  ? 30.816  -6.124  36.929  1.00 25.51 ? 91   PHE A CZ    1 
ATOM   746  N N     . GLU A 1 92  ? 29.870  -11.338 39.047  1.00 26.03 ? 92   GLU A N     1 
ATOM   747  C CA    . GLU A 1 92  ? 29.668  -11.062 40.465  1.00 26.28 ? 92   GLU A CA    1 
ATOM   748  C C     . GLU A 1 92  ? 30.337  -9.759  40.876  1.00 25.12 ? 92   GLU A C     1 
ATOM   749  O O     . GLU A 1 92  ? 31.430  -9.757  41.440  1.00 24.45 ? 92   GLU A O     1 
ATOM   750  C CB    . GLU A 1 92  ? 30.206  -12.214 41.318  1.00 28.57 ? 92   GLU A CB    1 
ATOM   751  C CG    . GLU A 1 92  ? 29.920  -12.063 42.813  1.00 32.55 ? 92   GLU A CG    1 
ATOM   752  C CD    . GLU A 1 92  ? 30.493  -13.204 43.640  1.00 36.79 ? 92   GLU A CD    1 
ATOM   753  O OE1   . GLU A 1 92  ? 31.733  -13.387 43.649  1.00 39.80 ? 92   GLU A OE1   1 
ATOM   754  O OE2   . GLU A 1 92  ? 29.702  -13.923 44.281  1.00 39.25 ? 92   GLU A OE2   1 
ATOM   755  N N     . ALA A 1 93  ? 29.660  -8.652  40.596  1.00 23.23 ? 93   ALA A N     1 
ATOM   756  C CA    . ALA A 1 93  ? 30.170  -7.330  40.918  1.00 22.68 ? 93   ALA A CA    1 
ATOM   757  C C     . ALA A 1 93  ? 30.216  -7.106  42.418  1.00 22.51 ? 93   ALA A C     1 
ATOM   758  O O     . ALA A 1 93  ? 29.894  -7.988  43.205  1.00 23.55 ? 93   ALA A O     1 
ATOM   759  C CB    . ALA A 1 93  ? 29.290  -6.267  40.269  1.00 21.10 ? 93   ALA A CB    1 
ATOM   760  N N     . LYS A 1 94  ? 30.623  -5.906  42.803  1.00 23.43 ? 94   LYS A N     1 
ATOM   761  C CA    . LYS A 1 94  ? 30.695  -5.528  44.204  1.00 23.82 ? 94   LYS A CA    1 
ATOM   762  C C     . LYS A 1 94  ? 29.247  -5.331  44.660  1.00 22.39 ? 94   LYS A C     1 
ATOM   763  O O     . LYS A 1 94  ? 28.383  -4.995  43.854  1.00 22.41 ? 94   LYS A O     1 
ATOM   764  C CB    . LYS A 1 94  ? 31.481  -4.223  44.337  1.00 24.24 ? 94   LYS A CB    1 
ATOM   765  C CG    . LYS A 1 94  ? 31.804  -3.825  45.764  1.00 29.31 ? 94   LYS A CG    1 
ATOM   766  C CD    . LYS A 1 94  ? 32.510  -2.475  45.805  1.00 30.46 ? 94   LYS A CD    1 
ATOM   767  C CE    . LYS A 1 94  ? 32.807  -2.044  47.230  1.00 30.86 ? 94   LYS A CE    1 
ATOM   768  N NZ    . LYS A 1 94  ? 33.353  -0.658  47.265  1.00 32.33 ? 94   LYS A NZ    1 
ATOM   769  N N     . TYR A 1 95  ? 28.977  -5.543  45.939  1.00 20.06 ? 95   TYR A N     1 
ATOM   770  C CA    . TYR A 1 95  ? 27.618  -5.384  46.460  1.00 19.74 ? 95   TYR A CA    1 
ATOM   771  C C     . TYR A 1 95  ? 26.652  -6.438  45.914  1.00 18.78 ? 95   TYR A C     1 
ATOM   772  O O     . TYR A 1 95  ? 25.443  -6.223  45.897  1.00 18.42 ? 95   TYR A O     1 
ATOM   773  C CB    . TYR A 1 95  ? 27.071  -3.985  46.142  1.00 19.86 ? 95   TYR A CB    1 
ATOM   774  C CG    . TYR A 1 95  ? 27.908  -2.855  46.693  1.00 21.12 ? 95   TYR A CG    1 
ATOM   775  C CD1   . TYR A 1 95  ? 28.283  -1.781  45.887  1.00 22.74 ? 95   TYR A CD1   1 
ATOM   776  C CD2   . TYR A 1 95  ? 28.338  -2.865  48.022  1.00 23.90 ? 95   TYR A CD2   1 
ATOM   777  C CE1   . TYR A 1 95  ? 29.073  -0.740  46.393  1.00 24.37 ? 95   TYR A CE1   1 
ATOM   778  C CE2   . TYR A 1 95  ? 29.125  -1.838  48.535  1.00 23.65 ? 95   TYR A CE2   1 
ATOM   779  C CZ    . TYR A 1 95  ? 29.487  -0.782  47.717  1.00 25.92 ? 95   TYR A CZ    1 
ATOM   780  O OH    . TYR A 1 95  ? 30.260  0.228   48.231  1.00 28.55 ? 95   TYR A OH    1 
ATOM   781  N N     . THR A 1 96  ? 27.177  -7.572  45.461  1.00 17.63 ? 96   THR A N     1 
ATOM   782  C CA    . THR A 1 96  ? 26.306  -8.619  44.958  1.00 17.49 ? 96   THR A CA    1 
ATOM   783  C C     . THR A 1 96  ? 25.458  -9.125  46.115  1.00 16.44 ? 96   THR A C     1 
ATOM   784  O O     . THR A 1 96  ? 25.977  -9.443  47.184  1.00 17.11 ? 96   THR A O     1 
ATOM   785  C CB    . THR A 1 96  ? 27.101  -9.790  44.366  1.00 16.67 ? 96   THR A CB    1 
ATOM   786  O OG1   . THR A 1 96  ? 27.663  -9.396  43.107  1.00 19.51 ? 96   THR A OG1   1 
ATOM   787  C CG2   . THR A 1 96  ? 26.192  -10.993 44.153  1.00 16.91 ? 96   THR A CG2   1 
ATOM   788  N N     . ARG A 1 97  ? 24.151  -9.190  45.903  1.00 14.45 ? 97   ARG A N     1 
ATOM   789  C CA    . ARG A 1 97  ? 23.246  -9.649  46.943  1.00 15.15 ? 97   ARG A CA    1 
ATOM   790  C C     . ARG A 1 97  ? 22.623  -10.974 46.574  1.00 14.70 ? 97   ARG A C     1 
ATOM   791  O O     . ARG A 1 97  ? 22.469  -11.856 47.417  1.00 15.38 ? 97   ARG A O     1 
ATOM   792  C CB    . ARG A 1 97  ? 22.129  -8.628  47.175  1.00 15.45 ? 97   ARG A CB    1 
ATOM   793  C CG    . ARG A 1 97  ? 22.612  -7.209  47.401  1.00 15.48 ? 97   ARG A CG    1 
ATOM   794  C CD    . ARG A 1 97  ? 23.654  -7.149  48.480  1.00 15.45 ? 97   ARG A CD    1 
ATOM   795  N NE    . ARG A 1 97  ? 23.962  -5.771  48.837  1.00 20.72 ? 97   ARG A NE    1 
ATOM   796  C CZ    . ARG A 1 97  ? 24.923  -5.418  49.685  1.00 21.74 ? 97   ARG A CZ    1 
ATOM   797  N NH1   . ARG A 1 97  ? 25.671  -6.346  50.262  1.00 20.33 ? 97   ARG A NH1   1 
ATOM   798  N NH2   . ARG A 1 97  ? 25.129  -4.134  49.960  1.00 22.52 ? 97   ARG A NH2   1 
ATOM   799  N N     . ALA A 1 98  ? 22.252  -11.114 45.309  1.00 15.44 ? 98   ALA A N     1 
ATOM   800  C CA    . ALA A 1 98  ? 21.624  -12.341 44.861  1.00 14.88 ? 98   ALA A CA    1 
ATOM   801  C C     . ALA A 1 98  ? 22.386  -12.992 43.718  1.00 17.73 ? 98   ALA A C     1 
ATOM   802  O O     . ALA A 1 98  ? 22.841  -12.314 42.794  1.00 18.67 ? 98   ALA A O     1 
ATOM   803  C CB    . ALA A 1 98  ? 20.196  -12.058 44.441  1.00 12.95 ? 98   ALA A CB    1 
ATOM   804  N N     . VAL A 1 99  ? 22.515  -14.315 43.795  1.00 18.78 ? 99   VAL A N     1 
ATOM   805  C CA    . VAL A 1 99  ? 23.205  -15.102 42.777  1.00 19.06 ? 99   VAL A CA    1 
ATOM   806  C C     . VAL A 1 99  ? 22.247  -16.151 42.214  1.00 19.89 ? 99   VAL A C     1 
ATOM   807  O O     . VAL A 1 99  ? 21.788  -17.028 42.947  1.00 19.94 ? 99   VAL A O     1 
ATOM   808  C CB    . VAL A 1 99  ? 24.432  -15.833 43.370  1.00 19.45 ? 99   VAL A CB    1 
ATOM   809  C CG1   . VAL A 1 99  ? 25.143  -16.638 42.285  1.00 18.32 ? 99   VAL A CG1   1 
ATOM   810  C CG2   . VAL A 1 99  ? 25.382  -14.829 43.998  1.00 18.59 ? 99   VAL A CG2   1 
ATOM   811  N N     . LEU A 1 100 ? 21.934  -16.045 40.925  1.00 19.69 ? 100  LEU A N     1 
ATOM   812  C CA    . LEU A 1 100 ? 21.047  -16.994 40.257  1.00 21.13 ? 100  LEU A CA    1 
ATOM   813  C C     . LEU A 1 100 ? 21.890  -17.976 39.440  1.00 23.63 ? 100  LEU A C     1 
ATOM   814  O O     . LEU A 1 100 ? 22.653  -17.573 38.550  1.00 23.16 ? 100  LEU A O     1 
ATOM   815  C CB    . LEU A 1 100 ? 20.057  -16.268 39.334  1.00 18.83 ? 100  LEU A CB    1 
ATOM   816  C CG    . LEU A 1 100 ? 18.901  -15.510 40.005  1.00 20.69 ? 100  LEU A CG    1 
ATOM   817  C CD1   . LEU A 1 100 ? 19.469  -14.327 40.773  1.00 16.69 ? 100  LEU A CD1   1 
ATOM   818  C CD2   . LEU A 1 100 ? 17.884  -15.028 38.965  1.00 17.60 ? 100  LEU A CD2   1 
ATOM   819  N N     . SER A 1 101 ? 21.752  -19.262 39.755  1.00 22.99 ? 101  SER A N     1 
ATOM   820  C CA    . SER A 1 101 ? 22.499  -20.313 39.079  1.00 24.36 ? 101  SER A CA    1 
ATOM   821  C C     . SER A 1 101 ? 21.645  -21.043 38.060  1.00 24.99 ? 101  SER A C     1 
ATOM   822  O O     . SER A 1 101 ? 20.662  -21.706 38.412  1.00 24.46 ? 101  SER A O     1 
ATOM   823  C CB    . SER A 1 101 ? 23.029  -21.334 40.091  1.00 24.78 ? 101  SER A CB    1 
ATOM   824  O OG    . SER A 1 101 ? 23.940  -20.745 41.003  1.00 26.41 ? 101  SER A OG    1 
ATOM   825  N N     . PHE A 1 102 ? 22.020  -20.920 36.795  1.00 23.33 ? 102  PHE A N     1 
ATOM   826  C CA    . PHE A 1 102 ? 21.295  -21.595 35.743  1.00 25.71 ? 102  PHE A CA    1 
ATOM   827  C C     . PHE A 1 102 ? 22.086  -22.841 35.354  1.00 29.71 ? 102  PHE A C     1 
ATOM   828  O O     . PHE A 1 102 ? 23.208  -23.047 35.822  1.00 27.13 ? 102  PHE A O     1 
ATOM   829  C CB    . PHE A 1 102 ? 21.097  -20.666 34.540  1.00 22.88 ? 102  PHE A CB    1 
ATOM   830  C CG    . PHE A 1 102 ? 20.150  -19.514 34.808  1.00 20.77 ? 102  PHE A CG    1 
ATOM   831  C CD1   . PHE A 1 102 ? 20.595  -18.353 35.441  1.00 17.96 ? 102  PHE A CD1   1 
ATOM   832  C CD2   . PHE A 1 102 ? 18.809  -19.606 34.448  1.00 17.79 ? 102  PHE A CD2   1 
ATOM   833  C CE1   . PHE A 1 102 ? 19.713  -17.300 35.714  1.00 19.17 ? 102  PHE A CE1   1 
ATOM   834  C CE2   . PHE A 1 102 ? 17.920  -18.564 34.714  1.00 17.84 ? 102  PHE A CE2   1 
ATOM   835  C CZ    . PHE A 1 102 ? 18.371  -17.404 35.350  1.00 16.77 ? 102  PHE A CZ    1 
ATOM   836  N N     . ASP A 1 103 ? 21.495  -23.680 34.512  1.00 34.27 ? 103  ASP A N     1 
ATOM   837  C CA    . ASP A 1 103 ? 22.159  -24.901 34.087  1.00 38.35 ? 103  ASP A CA    1 
ATOM   838  C C     . ASP A 1 103 ? 23.343  -24.547 33.198  1.00 39.86 ? 103  ASP A C     1 
ATOM   839  O O     . ASP A 1 103 ? 23.364  -23.482 32.570  1.00 40.62 ? 103  ASP A O     1 
ATOM   840  C CB    . ASP A 1 103 ? 21.167  -25.798 33.338  1.00 41.26 ? 103  ASP A CB    1 
ATOM   841  C CG    . ASP A 1 103 ? 21.729  -27.179 33.044  1.00 46.31 ? 103  ASP A CG    1 
ATOM   842  O OD1   . ASP A 1 103 ? 22.605  -27.300 32.157  1.00 48.30 ? 103  ASP A OD1   1 
ATOM   843  O OD2   . ASP A 1 103 ? 21.298  -28.148 33.707  1.00 47.98 ? 103  ASP A OD2   1 
ATOM   844  N N     . ASN A 1 104 ? 24.334  -25.432 33.161  1.00 41.44 ? 104  ASN A N     1 
ATOM   845  C CA    . ASN A 1 104 ? 25.527  -25.221 32.343  1.00 43.03 ? 104  ASN A CA    1 
ATOM   846  C C     . ASN A 1 104 ? 26.419  -24.102 32.877  1.00 42.14 ? 104  ASN A C     1 
ATOM   847  O O     . ASN A 1 104 ? 27.058  -23.391 32.106  1.00 41.41 ? 104  ASN A O     1 
ATOM   848  C CB    . ASN A 1 104 ? 25.137  -24.900 30.893  1.00 45.65 ? 104  ASN A CB    1 
ATOM   849  C CG    . ASN A 1 104 ? 24.211  -25.937 30.293  1.00 48.56 ? 104  ASN A CG    1 
ATOM   850  O OD1   . ASN A 1 104 ? 24.530  -27.129 30.258  1.00 50.51 ? 104  ASN A OD1   1 
ATOM   851  N ND2   . ASN A 1 104 ? 23.055  -25.489 29.814  1.00 49.53 ? 104  ASN A ND2   1 
ATOM   852  N N     . GLU A 1 105 ? 26.442  -23.930 34.194  1.00 42.14 ? 105  GLU A N     1 
ATOM   853  C CA    . GLU A 1 105 ? 27.287  -22.912 34.811  1.00 42.73 ? 105  GLU A CA    1 
ATOM   854  C C     . GLU A 1 105 ? 26.881  -21.456 34.538  1.00 41.01 ? 105  GLU A C     1 
ATOM   855  O O     . GLU A 1 105 ? 27.587  -20.534 34.941  1.00 40.67 ? 105  GLU A O     1 
ATOM   856  C CB    . GLU A 1 105 ? 28.737  -23.129 34.368  1.00 46.17 ? 105  GLU A CB    1 
ATOM   857  C CG    . GLU A 1 105 ? 29.757  -22.261 35.078  1.00 50.71 ? 105  GLU A CG    1 
ATOM   858  C CD    . GLU A 1 105 ? 31.136  -22.391 34.470  1.00 54.16 ? 105  GLU A CD    1 
ATOM   859  O OE1   . GLU A 1 105 ? 31.610  -23.542 34.324  1.00 57.50 ? 105  GLU A OE1   1 
ATOM   860  O OE2   . GLU A 1 105 ? 31.745  -21.348 34.141  1.00 54.17 ? 105  GLU A OE2   1 
ATOM   861  N N     . LEU A 1 106 ? 25.760  -21.244 33.855  1.00 39.27 ? 106  LEU A N     1 
ATOM   862  C CA    . LEU A 1 106 ? 25.295  -19.885 33.572  1.00 37.27 ? 106  LEU A CA    1 
ATOM   863  C C     . LEU A 1 106 ? 24.993  -19.146 34.880  1.00 35.87 ? 106  LEU A C     1 
ATOM   864  O O     . LEU A 1 106 ? 24.401  -19.719 35.795  1.00 35.72 ? 106  LEU A O     1 
ATOM   865  C CB    . LEU A 1 106 ? 24.033  -19.923 32.712  1.00 38.44 ? 106  LEU A CB    1 
ATOM   866  C CG    . LEU A 1 106 ? 24.150  -19.251 31.346  1.00 39.91 ? 106  LEU A CG    1 
ATOM   867  C CD1   . LEU A 1 106 ? 24.543  -17.781 31.511  1.00 39.45 ? 106  LEU A CD1   1 
ATOM   868  C CD2   . LEU A 1 106 ? 25.199  -19.992 30.524  1.00 43.05 ? 106  LEU A CD2   1 
ATOM   869  N N     . MET A 1 107 ? 25.392  -17.879 34.969  1.00 32.01 ? 107  MET A N     1 
ATOM   870  C CA    . MET A 1 107 ? 25.154  -17.105 36.188  1.00 29.90 ? 107  MET A CA    1 
ATOM   871  C C     . MET A 1 107 ? 24.594  -15.713 35.923  1.00 27.70 ? 107  MET A C     1 
ATOM   872  O O     . MET A 1 107 ? 24.890  -15.089 34.906  1.00 28.59 ? 107  MET A O     1 
ATOM   873  C CB    . MET A 1 107 ? 26.453  -16.945 36.988  1.00 32.39 ? 107  MET A CB    1 
ATOM   874  C CG    . MET A 1 107 ? 27.244  -18.221 37.218  1.00 33.44 ? 107  MET A CG    1 
ATOM   875  S SD    . MET A 1 107 ? 26.396  -19.367 38.305  1.00 38.09 ? 107  MET A SD    1 
ATOM   876  C CE    . MET A 1 107 ? 26.769  -18.647 39.921  1.00 34.08 ? 107  MET A CE    1 
ATOM   877  N N     . ALA A 1 108 ? 23.784  -15.236 36.860  1.00 25.72 ? 108  ALA A N     1 
ATOM   878  C CA    . ALA A 1 108 ? 23.192  -13.908 36.795  1.00 23.72 ? 108  ALA A CA    1 
ATOM   879  C C     . ALA A 1 108 ? 23.344  -13.346 38.200  1.00 23.39 ? 108  ALA A C     1 
ATOM   880  O O     . ALA A 1 108 ? 23.142  -14.060 39.179  1.00 24.30 ? 108  ALA A O     1 
ATOM   881  C CB    . ALA A 1 108 ? 21.726  -13.990 36.412  1.00 24.28 ? 108  ALA A CB    1 
ATOM   882  N N     . TYR A 1 109 ? 23.711  -12.075 38.301  1.00 21.72 ? 109  TYR A N     1 
ATOM   883  C CA    . TYR A 1 109 ? 23.915  -11.454 39.595  1.00 19.33 ? 109  TYR A CA    1 
ATOM   884  C C     . TYR A 1 109 ? 23.174  -10.138 39.730  1.00 19.65 ? 109  TYR A C     1 
ATOM   885  O O     . TYR A 1 109 ? 23.047  -9.380  38.765  1.00 19.46 ? 109  TYR A O     1 
ATOM   886  C CB    . TYR A 1 109 ? 25.403  -11.193 39.831  1.00 20.20 ? 109  TYR A CB    1 
ATOM   887  C CG    . TYR A 1 109 ? 26.298  -12.390 39.613  1.00 23.99 ? 109  TYR A CG    1 
ATOM   888  C CD1   . TYR A 1 109 ? 26.724  -12.749 38.330  1.00 22.55 ? 109  TYR A CD1   1 
ATOM   889  C CD2   . TYR A 1 109 ? 26.740  -13.153 40.695  1.00 23.90 ? 109  TYR A CD2   1 
ATOM   890  C CE1   . TYR A 1 109 ? 27.575  -13.837 38.137  1.00 25.20 ? 109  TYR A CE1   1 
ATOM   891  C CE2   . TYR A 1 109 ? 27.586  -14.241 40.512  1.00 25.22 ? 109  TYR A CE2   1 
ATOM   892  C CZ    . TYR A 1 109 ? 28.003  -14.577 39.236  1.00 25.67 ? 109  TYR A CZ    1 
ATOM   893  O OH    . TYR A 1 109 ? 28.860  -15.642 39.074  1.00 28.56 ? 109  TYR A OH    1 
ATOM   894  N N     . PHE A 1 110 ? 22.703  -9.878  40.945  1.00 17.21 ? 110  PHE A N     1 
ATOM   895  C CA    . PHE A 1 110 ? 21.987  -8.655  41.274  1.00 15.81 ? 110  PHE A CA    1 
ATOM   896  C C     . PHE A 1 110 ? 22.772  -8.055  42.426  1.00 16.11 ? 110  PHE A C     1 
ATOM   897  O O     . PHE A 1 110 ? 22.953  -8.701  43.459  1.00 16.54 ? 110  PHE A O     1 
ATOM   898  C CB    . PHE A 1 110 ? 20.559  -8.966  41.740  1.00 15.00 ? 110  PHE A CB    1 
ATOM   899  C CG    . PHE A 1 110 ? 19.805  -7.760  42.238  1.00 14.10 ? 110  PHE A CG    1 
ATOM   900  C CD1   . PHE A 1 110 ? 19.146  -6.908  41.346  1.00 12.54 ? 110  PHE A CD1   1 
ATOM   901  C CD2   . PHE A 1 110 ? 19.793  -7.448  43.596  1.00 12.09 ? 110  PHE A CD2   1 
ATOM   902  C CE1   . PHE A 1 110 ? 18.486  -5.759  41.802  1.00 14.65 ? 110  PHE A CE1   1 
ATOM   903  C CE2   . PHE A 1 110 ? 19.136  -6.300  44.066  1.00 12.69 ? 110  PHE A CE2   1 
ATOM   904  C CZ    . PHE A 1 110 ? 18.482  -5.454  43.168  1.00 12.06 ? 110  PHE A CZ    1 
ATOM   905  N N     . SER A 1 111 ? 23.253  -6.831  42.241  1.00 15.20 ? 111  SER A N     1 
ATOM   906  C CA    . SER A 1 111 ? 24.012  -6.150  43.277  1.00 16.49 ? 111  SER A CA    1 
ATOM   907  C C     . SER A 1 111 ? 23.206  -4.928  43.659  1.00 15.60 ? 111  SER A C     1 
ATOM   908  O O     . SER A 1 111 ? 22.450  -4.403  42.843  1.00 16.81 ? 111  SER A O     1 
ATOM   909  C CB    . SER A 1 111 ? 25.401  -5.745  42.768  1.00 16.09 ? 111  SER A CB    1 
ATOM   910  O OG    . SER A 1 111 ? 25.303  -4.792  41.727  1.00 20.33 ? 111  SER A OG    1 
ATOM   911  N N     . ASP A 1 112 ? 23.361  -4.476  44.894  1.00 14.36 ? 112  ASP A N     1 
ATOM   912  C CA    . ASP A 1 112 ? 22.598  -3.339  45.379  1.00 16.30 ? 112  ASP A CA    1 
ATOM   913  C C     . ASP A 1 112 ? 23.295  -2.761  46.603  1.00 17.57 ? 112  ASP A C     1 
ATOM   914  O O     . ASP A 1 112 ? 23.139  -3.269  47.715  1.00 19.32 ? 112  ASP A O     1 
ATOM   915  C CB    . ASP A 1 112 ? 21.184  -3.820  45.720  1.00 14.18 ? 112  ASP A CB    1 
ATOM   916  C CG    . ASP A 1 112 ? 20.283  -2.712  46.222  1.00 17.18 ? 112  ASP A CG    1 
ATOM   917  O OD1   . ASP A 1 112 ? 20.649  -1.522  46.119  1.00 19.39 ? 112  ASP A OD1   1 
ATOM   918  O OD2   . ASP A 1 112 ? 19.189  -3.039  46.720  1.00 18.97 ? 112  ASP A OD2   1 
ATOM   919  N N     . MET A 1 113 ? 24.072  -1.703  46.392  1.00 17.97 ? 113  MET A N     1 
ATOM   920  C CA    . MET A 1 113 ? 24.815  -1.084  47.480  1.00 19.58 ? 113  MET A CA    1 
ATOM   921  C C     . MET A 1 113 ? 23.985  -0.734  48.705  1.00 20.33 ? 113  MET A C     1 
ATOM   922  O O     . MET A 1 113 ? 24.310  -1.145  49.810  1.00 22.28 ? 113  MET A O     1 
ATOM   923  C CB    . MET A 1 113 ? 25.530  0.176   46.989  1.00 23.69 ? 113  MET A CB    1 
ATOM   924  C CG    . MET A 1 113 ? 26.285  0.933   48.078  1.00 24.85 ? 113  MET A CG    1 
ATOM   925  S SD    . MET A 1 113 ? 27.017  2.486   47.487  1.00 30.83 ? 113  MET A SD    1 
ATOM   926  C CE    . MET A 1 113 ? 25.606  3.596   47.607  1.00 28.28 ? 113  MET A CE    1 
ATOM   927  N N     . ARG A 1 114 ? 22.911  0.020   48.520  1.00 20.18 ? 114  ARG A N     1 
ATOM   928  C CA    . ARG A 1 114 ? 22.098  0.422   49.659  1.00 19.78 ? 114  ARG A CA    1 
ATOM   929  C C     . ARG A 1 114 ? 21.059  -0.598  50.107  1.00 20.94 ? 114  ARG A C     1 
ATOM   930  O O     . ARG A 1 114 ? 20.435  -0.420  51.151  1.00 20.92 ? 114  ARG A O     1 
ATOM   931  C CB    . ARG A 1 114 ? 21.432  1.763   49.362  1.00 19.70 ? 114  ARG A CB    1 
ATOM   932  C CG    . ARG A 1 114 ? 22.440  2.829   48.961  1.00 18.00 ? 114  ARG A CG    1 
ATOM   933  C CD    . ARG A 1 114 ? 21.776  4.161   48.721  1.00 19.18 ? 114  ARG A CD    1 
ATOM   934  N NE    . ARG A 1 114 ? 21.197  4.718   49.935  1.00 17.85 ? 114  ARG A NE    1 
ATOM   935  C CZ    . ARG A 1 114 ? 20.566  5.885   49.976  1.00 19.87 ? 114  ARG A CZ    1 
ATOM   936  N NH1   . ARG A 1 114 ? 20.439  6.604   48.866  1.00 20.05 ? 114  ARG A NH1   1 
ATOM   937  N NH2   . ARG A 1 114 ? 20.061  6.333   51.119  1.00 19.32 ? 114  ARG A NH2   1 
ATOM   938  N N     . ASN A 1 115 ? 20.892  -1.674  49.343  1.00 20.45 ? 115  ASN A N     1 
ATOM   939  C CA    . ASN A 1 115 ? 19.923  -2.715  49.691  1.00 21.76 ? 115  ASN A CA    1 
ATOM   940  C C     . ASN A 1 115 ? 18.472  -2.223  49.734  1.00 20.89 ? 115  ASN A C     1 
ATOM   941  O O     . ASN A 1 115 ? 17.709  -2.660  50.591  1.00 19.97 ? 115  ASN A O     1 
ATOM   942  C CB    . ASN A 1 115 ? 20.241  -3.334  51.061  1.00 22.93 ? 115  ASN A CB    1 
ATOM   943  C CG    . ASN A 1 115 ? 21.537  -4.112  51.073  1.00 25.91 ? 115  ASN A CG    1 
ATOM   944  O OD1   . ASN A 1 115 ? 21.724  -5.042  50.291  1.00 28.59 ? 115  ASN A OD1   1 
ATOM   945  N ND2   . ASN A 1 115 ? 22.440  -3.741  51.975  1.00 26.12 ? 115  ASN A ND2   1 
ATOM   946  N N     . PHE A 1 116 ? 18.083  -1.321  48.838  1.00 18.69 ? 116  PHE A N     1 
ATOM   947  C CA    . PHE A 1 116 ? 16.703  -0.856  48.850  1.00 18.67 ? 116  PHE A CA    1 
ATOM   948  C C     . PHE A 1 116 ? 15.862  -1.687  47.875  1.00 18.27 ? 116  PHE A C     1 
ATOM   949  O O     . PHE A 1 116 ? 14.627  -1.624  47.885  1.00 15.93 ? 116  PHE A O     1 
ATOM   950  C CB    . PHE A 1 116 ? 16.612  0.632   48.490  1.00 17.90 ? 116  PHE A CB    1 
ATOM   951  C CG    . PHE A 1 116 ? 17.089  1.559   49.583  1.00 19.01 ? 116  PHE A CG    1 
ATOM   952  C CD1   . PHE A 1 116 ? 17.228  1.108   50.895  1.00 18.91 ? 116  PHE A CD1   1 
ATOM   953  C CD2   . PHE A 1 116 ? 17.369  2.898   49.304  1.00 17.44 ? 116  PHE A CD2   1 
ATOM   954  C CE1   . PHE A 1 116 ? 17.637  1.976   51.908  1.00 19.57 ? 116  PHE A CE1   1 
ATOM   955  C CE2   . PHE A 1 116 ? 17.776  3.770   50.307  1.00 17.24 ? 116  PHE A CE2   1 
ATOM   956  C CZ    . PHE A 1 116 ? 17.911  3.308   51.615  1.00 16.64 ? 116  PHE A CZ    1 
ATOM   957  N N     . GLY A 1 117 ? 16.544  -2.463  47.039  1.00 14.55 ? 117  GLY A N     1 
ATOM   958  C CA    . GLY A 1 117 ? 15.856  -3.308  46.080  1.00 16.81 ? 117  GLY A CA    1 
ATOM   959  C C     . GLY A 1 117 ? 15.092  -4.410  46.790  1.00 16.48 ? 117  GLY A C     1 
ATOM   960  O O     . GLY A 1 117 ? 15.390  -4.727  47.941  1.00 17.17 ? 117  GLY A O     1 
ATOM   961  N N     . THR A 1 118 ? 14.107  -4.995  46.117  1.00 15.23 ? 118  THR A N     1 
ATOM   962  C CA    . THR A 1 118 ? 13.311  -6.050  46.727  1.00 15.16 ? 118  THR A CA    1 
ATOM   963  C C     . THR A 1 118 ? 13.098  -7.256  45.816  1.00 14.77 ? 118  THR A C     1 
ATOM   964  O O     . THR A 1 118 ? 13.183  -7.154  44.586  1.00 12.75 ? 118  THR A O     1 
ATOM   965  C CB    . THR A 1 118 ? 11.921  -5.532  47.155  1.00 16.58 ? 118  THR A CB    1 
ATOM   966  O OG1   . THR A 1 118 ? 11.190  -5.126  45.994  1.00 21.08 ? 118  THR A OG1   1 
ATOM   967  C CG2   . THR A 1 118 ? 12.054  -4.336  48.104  1.00 18.34 ? 118  THR A CG2   1 
ATOM   968  N N     . PHE A 1 119 ? 12.828  -8.395  46.450  1.00 12.33 ? 119  PHE A N     1 
ATOM   969  C CA    . PHE A 1 119 ? 12.566  -9.658  45.771  1.00 12.76 ? 119  PHE A CA    1 
ATOM   970  C C     . PHE A 1 119 ? 11.354  -10.327 46.403  1.00 13.99 ? 119  PHE A C     1 
ATOM   971  O O     . PHE A 1 119 ? 11.192  -10.320 47.620  1.00 13.40 ? 119  PHE A O     1 
ATOM   972  C CB    . PHE A 1 119 ? 13.738  -10.625 45.926  1.00 11.94 ? 119  PHE A CB    1 
ATOM   973  C CG    . PHE A 1 119 ? 14.873  -10.358 45.006  1.00 13.48 ? 119  PHE A CG    1 
ATOM   974  C CD1   . PHE A 1 119 ? 15.939  -9.558  45.408  1.00 11.72 ? 119  PHE A CD1   1 
ATOM   975  C CD2   . PHE A 1 119 ? 14.891  -10.923 43.733  1.00 10.78 ? 119  PHE A CD2   1 
ATOM   976  C CE1   . PHE A 1 119 ? 17.013  -9.327  44.550  1.00 14.04 ? 119  PHE A CE1   1 
ATOM   977  C CE2   . PHE A 1 119 ? 15.957  -10.698 42.870  1.00 12.51 ? 119  PHE A CE2   1 
ATOM   978  C CZ    . PHE A 1 119 ? 17.021  -9.901  43.278  1.00 11.41 ? 119  PHE A CZ    1 
ATOM   979  N N     . LYS A 1 120 ? 10.508  -10.915 45.576  1.00 16.29 ? 120  LYS A N     1 
ATOM   980  C CA    . LYS A 1 120 ? 9.347   -11.630 46.078  1.00 18.47 ? 120  LYS A CA    1 
ATOM   981  C C     . LYS A 1 120 ? 9.105   -12.775 45.112  1.00 18.68 ? 120  LYS A C     1 
ATOM   982  O O     . LYS A 1 120 ? 9.298   -12.623 43.907  1.00 19.59 ? 120  LYS A O     1 
ATOM   983  C CB    . LYS A 1 120 ? 8.125   -10.711 46.145  1.00 19.91 ? 120  LYS A CB    1 
ATOM   984  C CG    . LYS A 1 120 ? 6.839   -11.401 46.575  1.00 19.30 ? 120  LYS A CG    1 
ATOM   985  C CD    . LYS A 1 120 ? 5.725   -10.370 46.690  1.00 24.27 ? 120  LYS A CD    1 
ATOM   986  C CE    . LYS A 1 120 ? 4.336   -10.960 46.462  1.00 22.79 ? 120  LYS A CE    1 
ATOM   987  N NZ    . LYS A 1 120 ? 3.919   -11.884 47.542  1.00 26.36 ? 120  LYS A NZ    1 
ATOM   988  N N     . PHE A 1 121 ? 8.697   -13.921 45.643  1.00 17.59 ? 121  PHE A N     1 
ATOM   989  C CA    . PHE A 1 121 ? 8.445   -15.100 44.826  1.00 17.84 ? 121  PHE A CA    1 
ATOM   990  C C     . PHE A 1 121 ? 6.990   -15.492 44.988  1.00 19.46 ? 121  PHE A C     1 
ATOM   991  O O     . PHE A 1 121 ? 6.473   -15.557 46.095  1.00 19.02 ? 121  PHE A O     1 
ATOM   992  C CB    . PHE A 1 121 ? 9.367   -16.241 45.263  1.00 17.42 ? 121  PHE A CB    1 
ATOM   993  C CG    . PHE A 1 121 ? 10.828  -15.905 45.161  1.00 14.85 ? 121  PHE A CG    1 
ATOM   994  C CD1   . PHE A 1 121 ? 11.520  -16.087 43.962  1.00 15.86 ? 121  PHE A CD1   1 
ATOM   995  C CD2   . PHE A 1 121 ? 11.505  -15.376 46.251  1.00 14.22 ? 121  PHE A CD2   1 
ATOM   996  C CE1   . PHE A 1 121 ? 12.875  -15.743 43.848  1.00 14.47 ? 121  PHE A CE1   1 
ATOM   997  C CE2   . PHE A 1 121 ? 12.859  -15.027 46.155  1.00 16.55 ? 121  PHE A CE2   1 
ATOM   998  C CZ    . PHE A 1 121 ? 13.548  -15.213 44.947  1.00 15.01 ? 121  PHE A CZ    1 
ATOM   999  N N     . SER A 1 122 ? 6.331   -15.755 43.873  1.00 21.07 ? 122  SER A N     1 
ATOM   1000 C CA    . SER A 1 122 ? 4.928   -16.098 43.908  1.00 23.50 ? 122  SER A CA    1 
ATOM   1001 C C     . SER A 1 122 ? 4.569   -17.030 42.767  1.00 25.07 ? 122  SER A C     1 
ATOM   1002 O O     . SER A 1 122 ? 5.221   -17.044 41.716  1.00 24.46 ? 122  SER A O     1 
ATOM   1003 C CB    . SER A 1 122 ? 4.097   -14.809 43.813  1.00 25.39 ? 122  SER A CB    1 
ATOM   1004 O OG    . SER A 1 122 ? 2.703   -15.066 43.764  1.00 27.93 ? 122  SER A OG    1 
ATOM   1005 N N     . ASN A 1 123 ? 3.539   -17.834 42.978  1.00 25.49 ? 123  ASN A N     1 
ATOM   1006 C CA    . ASN A 1 123 ? 3.101   -18.721 41.924  1.00 28.94 ? 123  ASN A CA    1 
ATOM   1007 C C     . ASN A 1 123 ? 1.627   -18.401 41.717  1.00 29.40 ? 123  ASN A C     1 
ATOM   1008 O O     . ASN A 1 123 ? 0.817   -19.257 41.367  1.00 31.40 ? 123  ASN A O     1 
ATOM   1009 C CB    . ASN A 1 123 ? 3.335   -20.183 42.314  1.00 31.18 ? 123  ASN A CB    1 
ATOM   1010 C CG    . ASN A 1 123 ? 2.322   -20.694 43.292  1.00 32.58 ? 123  ASN A CG    1 
ATOM   1011 O OD1   . ASN A 1 123 ? 1.875   -19.968 44.183  1.00 33.65 ? 123  ASN A OD1   1 
ATOM   1012 N ND2   . ASN A 1 123 ? 1.958   -21.966 43.145  1.00 33.71 ? 123  ASN A ND2   1 
ATOM   1013 N N     . SER A 1 124 ? 1.303   -17.133 41.944  1.00 29.43 ? 124  SER A N     1 
ATOM   1014 C CA    . SER A 1 124 ? -0.051  -16.626 41.785  1.00 31.29 ? 124  SER A CA    1 
ATOM   1015 C C     . SER A 1 124 ? -0.087  -15.544 40.715  1.00 31.08 ? 124  SER A C     1 
ATOM   1016 O O     . SER A 1 124 ? 0.405   -14.434 40.929  1.00 30.97 ? 124  SER A O     1 
ATOM   1017 C CB    . SER A 1 124 ? -0.555  -16.041 43.104  1.00 30.23 ? 124  SER A CB    1 
ATOM   1018 O OG    . SER A 1 124 ? -1.751  -15.308 42.902  1.00 31.45 ? 124  SER A OG    1 
ATOM   1019 N N     . GLU A 1 125 ? -0.662  -15.863 39.564  1.00 31.48 ? 125  GLU A N     1 
ATOM   1020 C CA    . GLU A 1 125 ? -0.753  -14.881 38.497  1.00 33.79 ? 125  GLU A CA    1 
ATOM   1021 C C     . GLU A 1 125 ? -1.759  -13.806 38.900  1.00 32.66 ? 125  GLU A C     1 
ATOM   1022 O O     . GLU A 1 125 ? -1.657  -12.660 38.477  1.00 31.40 ? 125  GLU A O     1 
ATOM   1023 C CB    . GLU A 1 125 ? -1.203  -15.524 37.187  1.00 36.41 ? 125  GLU A CB    1 
ATOM   1024 C CG    . GLU A 1 125 ? -1.143  -14.541 36.026  1.00 44.26 ? 125  GLU A CG    1 
ATOM   1025 C CD    . GLU A 1 125 ? -1.974  -14.964 34.837  1.00 47.96 ? 125  GLU A CD    1 
ATOM   1026 O OE1   . GLU A 1 125 ? -3.213  -15.078 34.987  1.00 51.85 ? 125  GLU A OE1   1 
ATOM   1027 O OE2   . GLU A 1 125 ? -1.387  -15.174 33.753  1.00 50.05 ? 125  GLU A OE2   1 
ATOM   1028 N N     . LYS A 1 126 ? -2.732  -14.192 39.716  1.00 32.32 ? 126  LYS A N     1 
ATOM   1029 C CA    . LYS A 1 126 ? -3.753  -13.269 40.185  1.00 31.80 ? 126  LYS A CA    1 
ATOM   1030 C C     . LYS A 1 126 ? -3.091  -12.128 40.955  1.00 31.40 ? 126  LYS A C     1 
ATOM   1031 O O     . LYS A 1 126 ? -3.413  -10.953 40.756  1.00 28.80 ? 126  LYS A O     1 
ATOM   1032 C CB    . LYS A 1 126 ? -4.727  -13.984 41.121  1.00 34.43 ? 126  LYS A CB    1 
ATOM   1033 C CG    . LYS A 1 126 ? -5.369  -15.250 40.566  1.00 38.59 ? 126  LYS A CG    1 
ATOM   1034 C CD    . LYS A 1 126 ? -6.611  -14.939 39.760  1.00 41.39 ? 126  LYS A CD    1 
ATOM   1035 C CE    . LYS A 1 126 ? -7.474  -16.181 39.553  1.00 44.47 ? 126  LYS A CE    1 
ATOM   1036 N NZ    . LYS A 1 126 ? -6.800  -17.244 38.750  1.00 46.63 ? 126  LYS A NZ    1 
ATOM   1037 N N     . GLU A 1 127 ? -2.165  -12.481 41.841  1.00 29.76 ? 127  GLU A N     1 
ATOM   1038 C CA    . GLU A 1 127 ? -1.482  -11.480 42.645  1.00 31.53 ? 127  GLU A CA    1 
ATOM   1039 C C     . GLU A 1 127 ? -0.590  -10.566 41.807  1.00 29.13 ? 127  GLU A C     1 
ATOM   1040 O O     . GLU A 1 127 ? -0.514  -9.363  42.053  1.00 29.87 ? 127  GLU A O     1 
ATOM   1041 C CB    . GLU A 1 127 ? -0.654  -12.154 43.737  1.00 34.70 ? 127  GLU A CB    1 
ATOM   1042 C CG    . GLU A 1 127 ? -0.343  -11.235 44.899  1.00 39.81 ? 127  GLU A CG    1 
ATOM   1043 C CD    . GLU A 1 127 ? 0.360   -11.950 46.033  1.00 45.42 ? 127  GLU A CD    1 
ATOM   1044 O OE1   . GLU A 1 127 ? -0.125  -13.024 46.457  1.00 47.62 ? 127  GLU A OE1   1 
ATOM   1045 O OE2   . GLU A 1 127 ? 1.394   -11.432 46.507  1.00 48.07 ? 127  GLU A OE2   1 
ATOM   1046 N N     . LEU A 1 128 ? 0.081   -11.136 40.817  1.00 27.57 ? 128  LEU A N     1 
ATOM   1047 C CA    . LEU A 1 128 ? 0.948   -10.350 39.951  1.00 26.72 ? 128  LEU A CA    1 
ATOM   1048 C C     . LEU A 1 128 ? 0.127   -9.320  39.184  1.00 25.41 ? 128  LEU A C     1 
ATOM   1049 O O     . LEU A 1 128 ? 0.535   -8.172  39.046  1.00 22.66 ? 128  LEU A O     1 
ATOM   1050 C CB    . LEU A 1 128 ? 1.680   -11.257 38.963  1.00 25.12 ? 128  LEU A CB    1 
ATOM   1051 C CG    . LEU A 1 128 ? 2.492   -10.534 37.892  1.00 24.87 ? 128  LEU A CG    1 
ATOM   1052 C CD1   . LEU A 1 128 ? 3.543   -9.642  38.539  1.00 23.28 ? 128  LEU A CD1   1 
ATOM   1053 C CD2   . LEU A 1 128 ? 3.132   -11.554 36.988  1.00 25.61 ? 128  LEU A CD2   1 
ATOM   1054 N N     . LYS A 1 129 ? -1.037  -9.744  38.701  1.00 26.26 ? 129  LYS A N     1 
ATOM   1055 C CA    . LYS A 1 129 ? -1.927  -8.872  37.942  1.00 26.07 ? 129  LYS A CA    1 
ATOM   1056 C C     . LYS A 1 129 ? -2.393  -7.677  38.784  1.00 25.07 ? 129  LYS A C     1 
ATOM   1057 O O     . LYS A 1 129 ? -2.370  -6.538  38.318  1.00 23.64 ? 129  LYS A O     1 
ATOM   1058 C CB    . LYS A 1 129 ? -3.128  -9.675  37.435  1.00 28.29 ? 129  LYS A CB    1 
ATOM   1059 C CG    . LYS A 1 129 ? -3.633  -9.244  36.064  1.00 33.62 ? 129  LYS A CG    1 
ATOM   1060 C CD    . LYS A 1 129 ? -4.742  -10.171 35.569  1.00 39.18 ? 129  LYS A CD    1 
ATOM   1061 C CE    . LYS A 1 129 ? -5.165  -9.838  34.143  1.00 40.89 ? 129  LYS A CE    1 
ATOM   1062 N NZ    . LYS A 1 129 ? -4.020  -9.994  33.195  1.00 43.83 ? 129  LYS A NZ    1 
ATOM   1063 N N     . ARG A 1 130 ? -2.812  -7.931  40.021  1.00 24.08 ? 130  ARG A N     1 
ATOM   1064 C CA    . ARG A 1 130 ? -3.247  -6.844  40.892  1.00 24.78 ? 130  ARG A CA    1 
ATOM   1065 C C     . ARG A 1 130 ? -2.084  -5.894  41.146  1.00 24.99 ? 130  ARG A C     1 
ATOM   1066 O O     . ARG A 1 130 ? -2.274  -4.679  41.253  1.00 24.27 ? 130  ARG A O     1 
ATOM   1067 C CB    . ARG A 1 130 ? -3.774  -7.382  42.226  1.00 23.34 ? 130  ARG A CB    1 
ATOM   1068 C CG    . ARG A 1 130 ? -5.178  -7.974  42.143  1.00 25.53 ? 130  ARG A CG    1 
ATOM   1069 C CD    . ARG A 1 130 ? -5.756  -8.240  43.530  1.00 25.64 ? 130  ARG A CD    1 
ATOM   1070 N NE    . ARG A 1 130 ? -5.056  -9.309  44.241  1.00 28.01 ? 130  ARG A NE    1 
ATOM   1071 C CZ    . ARG A 1 130 ? -5.272  -10.613 44.062  1.00 30.90 ? 130  ARG A CZ    1 
ATOM   1072 N NH1   . ARG A 1 130 ? -6.182  -11.039 43.188  1.00 28.23 ? 130  ARG A NH1   1 
ATOM   1073 N NH2   . ARG A 1 130 ? -4.572  -11.498 44.767  1.00 29.82 ? 130  ARG A NH2   1 
ATOM   1074 N N     . LYS A 1 131 ? -0.882  -6.459  41.238  1.00 25.34 ? 131  LYS A N     1 
ATOM   1075 C CA    . LYS A 1 131 ? 0.329   -5.681  41.466  1.00 25.40 ? 131  LYS A CA    1 
ATOM   1076 C C     . LYS A 1 131 ? 0.561   -4.727  40.295  1.00 25.27 ? 131  LYS A C     1 
ATOM   1077 O O     . LYS A 1 131 ? 0.871   -3.553  40.488  1.00 23.94 ? 131  LYS A O     1 
ATOM   1078 C CB    . LYS A 1 131 ? 1.529   -6.618  41.619  1.00 28.01 ? 131  LYS A CB    1 
ATOM   1079 C CG    . LYS A 1 131 ? 2.888   -5.930  41.527  1.00 29.11 ? 131  LYS A CG    1 
ATOM   1080 C CD    . LYS A 1 131 ? 3.084   -4.853  42.588  1.00 30.85 ? 131  LYS A CD    1 
ATOM   1081 C CE    . LYS A 1 131 ? 4.360   -4.059  42.306  1.00 32.07 ? 131  LYS A CE    1 
ATOM   1082 N NZ    . LYS A 1 131 ? 4.555   -2.900  43.223  1.00 35.11 ? 131  LYS A NZ    1 
ATOM   1083 N N     . LEU A 1 132 ? 0.403   -5.244  39.082  1.00 23.97 ? 132  LEU A N     1 
ATOM   1084 C CA    . LEU A 1 132 ? 0.583   -4.443  37.880  1.00 24.51 ? 132  LEU A CA    1 
ATOM   1085 C C     . LEU A 1 132 ? -0.489  -3.353  37.774  1.00 24.71 ? 132  LEU A C     1 
ATOM   1086 O O     . LEU A 1 132 ? -0.227  -2.279  37.231  1.00 21.25 ? 132  LEU A O     1 
ATOM   1087 C CB    . LEU A 1 132 ? 0.565   -5.345  36.632  1.00 23.26 ? 132  LEU A CB    1 
ATOM   1088 C CG    . LEU A 1 132 ? 1.741   -6.328  36.486  1.00 23.64 ? 132  LEU A CG    1 
ATOM   1089 C CD1   . LEU A 1 132 ? 1.598   -7.141  35.209  1.00 23.74 ? 132  LEU A CD1   1 
ATOM   1090 C CD2   . LEU A 1 132 ? 3.044   -5.561  36.450  1.00 22.56 ? 132  LEU A CD2   1 
ATOM   1091 N N     . ASN A 1 133 ? -1.688  -3.626  38.297  1.00 25.58 ? 133  ASN A N     1 
ATOM   1092 C CA    . ASN A 1 133 ? -2.780  -2.650  38.265  1.00 26.55 ? 133  ASN A CA    1 
ATOM   1093 C C     . ASN A 1 133 ? -2.569  -1.509  39.261  1.00 25.51 ? 133  ASN A C     1 
ATOM   1094 O O     . ASN A 1 133 ? -3.302  -0.529  39.248  1.00 26.26 ? 133  ASN A O     1 
ATOM   1095 C CB    . ASN A 1 133 ? -4.132  -3.314  38.557  1.00 29.66 ? 133  ASN A CB    1 
ATOM   1096 C CG    . ASN A 1 133 ? -4.637  -4.155  37.401  1.00 34.45 ? 133  ASN A CG    1 
ATOM   1097 O OD1   . ASN A 1 133 ? -4.489  -3.786  36.236  1.00 36.20 ? 133  ASN A OD1   1 
ATOM   1098 N ND2   . ASN A 1 133 ? -5.254  -5.291  37.721  1.00 37.38 ? 133  ASN A ND2   1 
ATOM   1099 N N     . GLU A 1 134 ? -1.584  -1.644  40.139  1.00 24.62 ? 134  GLU A N     1 
ATOM   1100 C CA    . GLU A 1 134 ? -1.294  -0.589  41.101  1.00 25.97 ? 134  GLU A CA    1 
ATOM   1101 C C     . GLU A 1 134 ? -0.386  0.443   40.431  1.00 24.12 ? 134  GLU A C     1 
ATOM   1102 O O     . GLU A 1 134 ? -0.190  1.534   40.947  1.00 24.81 ? 134  GLU A O     1 
ATOM   1103 C CB    . GLU A 1 134 ? -0.597  -1.164  42.334  1.00 28.89 ? 134  GLU A CB    1 
ATOM   1104 C CG    . GLU A 1 134 ? -1.480  -2.049  43.194  1.00 36.76 ? 134  GLU A CG    1 
ATOM   1105 C CD    . GLU A 1 134 ? -0.683  -2.822  44.238  1.00 42.88 ? 134  GLU A CD    1 
ATOM   1106 O OE1   . GLU A 1 134 ? -1.301  -3.589  45.011  1.00 46.83 ? 134  GLU A OE1   1 
ATOM   1107 O OE2   . GLU A 1 134 ? 0.560   -2.670  44.285  1.00 44.19 ? 134  GLU A OE2   1 
ATOM   1108 N N     . LEU A 1 135 ? 0.151   0.079   39.269  1.00 22.01 ? 135  LEU A N     1 
ATOM   1109 C CA    . LEU A 1 135 ? 1.039   0.942   38.499  1.00 20.15 ? 135  LEU A CA    1 
ATOM   1110 C C     . LEU A 1 135 ? 0.339   1.499   37.271  1.00 18.69 ? 135  LEU A C     1 
ATOM   1111 O O     . LEU A 1 135 ? -0.365  0.778   36.572  1.00 19.66 ? 135  LEU A O     1 
ATOM   1112 C CB    . LEU A 1 135 ? 2.272   0.154   38.048  1.00 19.73 ? 135  LEU A CB    1 
ATOM   1113 C CG    . LEU A 1 135 ? 3.115   -0.471  39.163  1.00 17.94 ? 135  LEU A CG    1 
ATOM   1114 C CD1   . LEU A 1 135 ? 4.102   -1.479  38.578  1.00 19.64 ? 135  LEU A CD1   1 
ATOM   1115 C CD2   . LEU A 1 135 ? 3.828   0.629   39.908  1.00 16.41 ? 135  LEU A CD2   1 
ATOM   1116 N N     . GLY A 1 136 ? 0.542   2.784   37.006  1.00 17.96 ? 136  GLY A N     1 
ATOM   1117 C CA    . GLY A 1 136 ? -0.073  3.396   35.844  1.00 17.71 ? 136  GLY A CA    1 
ATOM   1118 C C     . GLY A 1 136 ? 0.597   2.942   34.561  1.00 19.14 ? 136  GLY A C     1 
ATOM   1119 O O     . GLY A 1 136 ? 1.602   2.235   34.608  1.00 17.72 ? 136  GLY A O     1 
ATOM   1120 N N     . PRO A 1 137 ? 0.065   3.338   33.392  1.00 19.98 ? 137  PRO A N     1 
ATOM   1121 C CA    . PRO A 1 137 ? 0.630   2.958   32.093  1.00 20.01 ? 137  PRO A CA    1 
ATOM   1122 C C     . PRO A 1 137 ? 2.127   3.276   32.021  1.00 20.03 ? 137  PRO A C     1 
ATOM   1123 O O     . PRO A 1 137 ? 2.573   4.326   32.480  1.00 18.95 ? 137  PRO A O     1 
ATOM   1124 C CB    . PRO A 1 137 ? -0.179  3.800   31.102  1.00 21.44 ? 137  PRO A CB    1 
ATOM   1125 C CG    . PRO A 1 137 ? -1.476  4.033   31.814  1.00 21.39 ? 137  PRO A CG    1 
ATOM   1126 C CD    . PRO A 1 137 ? -1.021  4.319   33.217  1.00 20.83 ? 137  PRO A CD    1 
ATOM   1127 N N     . ASP A 1 138 ? 2.894   2.361   31.443  1.00 19.92 ? 138  ASP A N     1 
ATOM   1128 C CA    . ASP A 1 138 ? 4.333   2.525   31.308  1.00 19.80 ? 138  ASP A CA    1 
ATOM   1129 C C     . ASP A 1 138 ? 4.611   3.640   30.294  1.00 20.82 ? 138  ASP A C     1 
ATOM   1130 O O     . ASP A 1 138 ? 4.341   3.491   29.094  1.00 20.38 ? 138  ASP A O     1 
ATOM   1131 C CB    . ASP A 1 138 ? 4.942   1.201   30.838  1.00 20.55 ? 138  ASP A CB    1 
ATOM   1132 C CG    . ASP A 1 138 ? 6.448   1.208   30.855  1.00 20.62 ? 138  ASP A CG    1 
ATOM   1133 O OD1   . ASP A 1 138 ? 7.054   2.165   30.332  1.00 24.74 ? 138  ASP A OD1   1 
ATOM   1134 O OD2   . ASP A 1 138 ? 7.034   0.243   31.381  1.00 26.10 ? 138  ASP A OD2   1 
ATOM   1135 N N     . PHE A 1 139 ? 5.147   4.754   30.782  1.00 20.28 ? 139  PHE A N     1 
ATOM   1136 C CA    . PHE A 1 139 ? 5.452   5.912   29.935  1.00 20.60 ? 139  PHE A CA    1 
ATOM   1137 C C     . PHE A 1 139 ? 6.334   5.600   28.732  1.00 21.18 ? 139  PHE A C     1 
ATOM   1138 O O     . PHE A 1 139 ? 6.212   6.238   27.684  1.00 23.30 ? 139  PHE A O     1 
ATOM   1139 C CB    . PHE A 1 139 ? 6.116   7.017   30.760  1.00 17.26 ? 139  PHE A CB    1 
ATOM   1140 C CG    . PHE A 1 139 ? 5.144   7.921   31.473  1.00 17.83 ? 139  PHE A CG    1 
ATOM   1141 C CD1   . PHE A 1 139 ? 5.220   8.098   32.849  1.00 17.16 ? 139  PHE A CD1   1 
ATOM   1142 C CD2   . PHE A 1 139 ? 4.197   8.650   30.758  1.00 17.35 ? 139  PHE A CD2   1 
ATOM   1143 C CE1   . PHE A 1 139 ? 4.369   8.996   33.503  1.00 18.33 ? 139  PHE A CE1   1 
ATOM   1144 C CE2   . PHE A 1 139 ? 3.341   9.549   31.400  1.00 17.18 ? 139  PHE A CE2   1 
ATOM   1145 C CZ    . PHE A 1 139 ? 3.431   9.722   32.779  1.00 17.77 ? 139  PHE A CZ    1 
ATOM   1146 N N     . LEU A 1 140 ? 7.225   4.628   28.872  1.00 21.43 ? 140  LEU A N     1 
ATOM   1147 C CA    . LEU A 1 140 ? 8.113   4.273   27.773  1.00 22.18 ? 140  LEU A CA    1 
ATOM   1148 C C     . LEU A 1 140 ? 7.490   3.319   26.763  1.00 23.50 ? 140  LEU A C     1 
ATOM   1149 O O     . LEU A 1 140 ? 7.574   3.532   25.559  1.00 23.38 ? 140  LEU A O     1 
ATOM   1150 C CB    . LEU A 1 140 ? 9.400   3.631   28.305  1.00 20.40 ? 140  LEU A CB    1 
ATOM   1151 C CG    . LEU A 1 140 ? 10.266  2.981   27.213  1.00 21.12 ? 140  LEU A CG    1 
ATOM   1152 C CD1   . LEU A 1 140 ? 10.822  4.057   26.291  1.00 18.52 ? 140  LEU A CD1   1 
ATOM   1153 C CD2   . LEU A 1 140 ? 11.395  2.175   27.846  1.00 18.15 ? 140  LEU A CD2   1 
ATOM   1154 N N     . LYS A 1 141 ? 6.859   2.271   27.269  1.00 26.62 ? 141  LYS A N     1 
ATOM   1155 C CA    . LYS A 1 141 ? 6.284   1.231   26.431  1.00 29.20 ? 141  LYS A CA    1 
ATOM   1156 C C     . LYS A 1 141 ? 4.870   1.432   25.904  1.00 31.65 ? 141  LYS A C     1 
ATOM   1157 O O     . LYS A 1 141 ? 4.474   0.783   24.939  1.00 31.24 ? 141  LYS A O     1 
ATOM   1158 C CB    . LYS A 1 141 ? 6.385   -0.087  27.189  1.00 28.66 ? 141  LYS A CB    1 
ATOM   1159 C CG    . LYS A 1 141 ? 7.824   -0.382  27.614  1.00 31.09 ? 141  LYS A CG    1 
ATOM   1160 C CD    . LYS A 1 141 ? 7.925   -1.438  28.703  1.00 30.71 ? 141  LYS A CD    1 
ATOM   1161 C CE    . LYS A 1 141 ? 7.418   -2.775  28.239  1.00 29.65 ? 141  LYS A CE    1 
ATOM   1162 N NZ    . LYS A 1 141 ? 7.658   -3.815  29.276  1.00 31.39 ? 141  LYS A NZ    1 
ATOM   1163 N N     . ASN A 1 142 ? 4.115   2.331   26.518  1.00 34.55 ? 142  ASN A N     1 
ATOM   1164 C CA    . ASN A 1 142 ? 2.749   2.571   26.085  1.00 39.37 ? 142  ASN A CA    1 
ATOM   1165 C C     . ASN A 1 142 ? 2.678   3.878   25.302  1.00 43.23 ? 142  ASN A C     1 
ATOM   1166 O O     . ASN A 1 142 ? 2.883   4.961   25.854  1.00 44.56 ? 142  ASN A O     1 
ATOM   1167 C CB    . ASN A 1 142 ? 1.834   2.624   27.304  1.00 41.66 ? 142  ASN A CB    1 
ATOM   1168 C CG    . ASN A 1 142 ? 0.376   2.601   26.932  1.00 44.02 ? 142  ASN A CG    1 
ATOM   1169 O OD1   . ASN A 1 142 ? -0.079  3.405   26.120  1.00 45.93 ? 142  ASN A OD1   1 
ATOM   1170 N ND2   . ASN A 1 142 ? -0.373  1.680   27.530  1.00 44.91 ? 142  ASN A ND2   1 
ATOM   1171 N N     . ASP A 1 143 ? 2.371   3.776   24.013  1.00 45.80 ? 143  ASP A N     1 
ATOM   1172 C CA    . ASP A 1 143 ? 2.316   4.949   23.150  1.00 48.81 ? 143  ASP A CA    1 
ATOM   1173 C C     . ASP A 1 143 ? 0.992   5.715   23.141  1.00 49.26 ? 143  ASP A C     1 
ATOM   1174 O O     . ASP A 1 143 ? 0.887   6.770   22.516  1.00 48.83 ? 143  ASP A O     1 
ATOM   1175 C CB    . ASP A 1 143 ? 2.678   4.543   21.720  1.00 51.47 ? 143  ASP A CB    1 
ATOM   1176 C CG    . ASP A 1 143 ? 3.034   5.731   20.854  1.00 55.02 ? 143  ASP A CG    1 
ATOM   1177 O OD1   . ASP A 1 143 ? 4.022   6.428   21.181  1.00 54.95 ? 143  ASP A OD1   1 
ATOM   1178 O OD2   . ASP A 1 143 ? 2.326   5.970   19.851  1.00 57.83 ? 143  ASP A OD2   1 
ATOM   1179 N N     . ASP A 1 144 ? -0.015  5.201   23.835  1.00 50.01 ? 144  ASP A N     1 
ATOM   1180 C CA    . ASP A 1 144 ? -1.309  5.870   23.860  1.00 51.51 ? 144  ASP A CA    1 
ATOM   1181 C C     . ASP A 1 144 ? -1.842  6.106   25.269  1.00 50.56 ? 144  ASP A C     1 
ATOM   1182 O O     . ASP A 1 144 ? -2.901  5.598   25.644  1.00 51.14 ? 144  ASP A O     1 
ATOM   1183 C CB    . ASP A 1 144 ? -2.326  5.063   23.054  1.00 55.03 ? 144  ASP A CB    1 
ATOM   1184 C CG    . ASP A 1 144 ? -2.371  3.612   23.472  1.00 58.08 ? 144  ASP A CG    1 
ATOM   1185 O OD1   . ASP A 1 144 ? -1.364  2.904   23.251  1.00 61.20 ? 144  ASP A OD1   1 
ATOM   1186 O OD2   . ASP A 1 144 ? -3.407  3.180   24.029  1.00 60.88 ? 144  ASP A OD2   1 
ATOM   1187 N N     . ILE A 1 145 ? -1.098  6.881   26.048  1.00 49.09 ? 145  ILE A N     1 
ATOM   1188 C CA    . ILE A 1 145 ? -1.500  7.206   27.407  1.00 46.50 ? 145  ILE A CA    1 
ATOM   1189 C C     . ILE A 1 145 ? -2.307  8.498   27.357  1.00 46.76 ? 145  ILE A C     1 
ATOM   1190 O O     . ILE A 1 145 ? -2.048  9.369   26.523  1.00 44.80 ? 145  ILE A O     1 
ATOM   1191 C CB    . ILE A 1 145 ? -0.275  7.433   28.315  1.00 45.75 ? 145  ILE A CB    1 
ATOM   1192 C CG1   . ILE A 1 145 ? 0.568   6.159   28.388  1.00 44.91 ? 145  ILE A CG1   1 
ATOM   1193 C CG2   . ILE A 1 145 ? -0.726  7.874   29.699  1.00 44.13 ? 145  ILE A CG2   1 
ATOM   1194 C CD1   . ILE A 1 145 ? 1.881   6.343   29.131  1.00 42.94 ? 145  ILE A CD1   1 
ATOM   1195 N N     . ASP A 1 146 ? -3.289  8.615   28.244  1.00 47.34 ? 146  ASP A N     1 
ATOM   1196 C CA    . ASP A 1 146 ? -4.111  9.815   28.303  1.00 48.11 ? 146  ASP A CA    1 
ATOM   1197 C C     . ASP A 1 146 ? -3.563  10.694  29.412  1.00 46.93 ? 146  ASP A C     1 
ATOM   1198 O O     . ASP A 1 146 ? -3.969  10.582  30.567  1.00 46.88 ? 146  ASP A O     1 
ATOM   1199 C CB    . ASP A 1 146 ? -5.570  9.462   28.599  1.00 50.64 ? 146  ASP A CB    1 
ATOM   1200 C CG    . ASP A 1 146 ? -6.463  10.689  28.650  1.00 54.18 ? 146  ASP A CG    1 
ATOM   1201 O OD1   . ASP A 1 146 ? -6.488  11.450  27.654  1.00 53.81 ? 146  ASP A OD1   1 
ATOM   1202 O OD2   . ASP A 1 146 ? -7.139  10.892  29.684  1.00 55.86 ? 146  ASP A OD2   1 
ATOM   1203 N N     . ILE A 1 147 ? -2.633  11.572  29.067  1.00 45.42 ? 147  ILE A N     1 
ATOM   1204 C CA    . ILE A 1 147 ? -2.056  12.420  30.084  1.00 45.04 ? 147  ILE A CA    1 
ATOM   1205 C C     . ILE A 1 147 ? -2.937  13.619  30.378  1.00 44.48 ? 147  ILE A C     1 
ATOM   1206 O O     . ILE A 1 147 ? -2.642  14.386  31.288  1.00 45.63 ? 147  ILE A O     1 
ATOM   1207 C CB    . ILE A 1 147 ? -0.643  12.898  29.693  1.00 45.38 ? 147  ILE A CB    1 
ATOM   1208 C CG1   . ILE A 1 147 ? -0.723  13.939  28.584  1.00 46.04 ? 147  ILE A CG1   1 
ATOM   1209 C CG2   . ILE A 1 147 ? 0.193   11.713  29.224  1.00 44.94 ? 147  ILE A CG2   1 
ATOM   1210 C CD1   . ILE A 1 147 ? 0.584   14.643  28.360  1.00 47.47 ? 147  ILE A CD1   1 
ATOM   1211 N N     . SER A 1 148 ? -4.020  13.782  29.621  1.00 42.98 ? 148  SER A N     1 
ATOM   1212 C CA    . SER A 1 148 ? -4.920  14.907  29.856  1.00 42.75 ? 148  SER A CA    1 
ATOM   1213 C C     . SER A 1 148 ? -5.480  14.807  31.276  1.00 41.98 ? 148  SER A C     1 
ATOM   1214 O O     . SER A 1 148 ? -6.029  15.769  31.809  1.00 41.22 ? 148  SER A O     1 
ATOM   1215 C CB    . SER A 1 148 ? -6.068  14.913  28.842  1.00 43.26 ? 148  SER A CB    1 
ATOM   1216 O OG    . SER A 1 148 ? -6.974  13.851  29.079  1.00 45.86 ? 148  SER A OG    1 
ATOM   1217 N N     . LYS A 1 149 ? -5.324  13.633  31.881  1.00 41.01 ? 149  LYS A N     1 
ATOM   1218 C CA    . LYS A 1 149 ? -5.787  13.392  33.244  1.00 41.33 ? 149  LYS A CA    1 
ATOM   1219 C C     . LYS A 1 149 ? -5.027  14.297  34.217  1.00 39.68 ? 149  LYS A C     1 
ATOM   1220 O O     . LYS A 1 149 ? -5.420  14.466  35.369  1.00 38.64 ? 149  LYS A O     1 
ATOM   1221 C CB    . LYS A 1 149 ? -5.566  11.923  33.612  1.00 43.90 ? 149  LYS A CB    1 
ATOM   1222 C CG    . LYS A 1 149 ? -6.112  11.526  34.970  1.00 46.75 ? 149  LYS A CG    1 
ATOM   1223 C CD    . LYS A 1 149 ? -5.832  10.054  35.263  1.00 50.35 ? 149  LYS A CD    1 
ATOM   1224 C CE    . LYS A 1 149 ? -6.333  9.659   36.649  1.00 51.90 ? 149  LYS A CE    1 
ATOM   1225 N NZ    . LYS A 1 149 ? -6.013  8.242   36.986  1.00 54.09 ? 149  LYS A NZ    1 
ATOM   1226 N N     . ILE A 1 150 ? -3.930  14.872  33.737  1.00 38.56 ? 150  ILE A N     1 
ATOM   1227 C CA    . ILE A 1 150 ? -3.111  15.777  34.534  1.00 37.85 ? 150  ILE A CA    1 
ATOM   1228 C C     . ILE A 1 150 ? -3.954  16.928  35.086  1.00 37.73 ? 150  ILE A C     1 
ATOM   1229 O O     . ILE A 1 150 ? -3.786  17.351  36.233  1.00 35.47 ? 150  ILE A O     1 
ATOM   1230 C CB    . ILE A 1 150 ? -1.977  16.387  33.676  1.00 37.60 ? 150  ILE A CB    1 
ATOM   1231 C CG1   . ILE A 1 150 ? -0.923  15.324  33.364  1.00 39.42 ? 150  ILE A CG1   1 
ATOM   1232 C CG2   . ILE A 1 150 ? -1.352  17.566  34.397  1.00 36.47 ? 150  ILE A CG2   1 
ATOM   1233 C CD1   . ILE A 1 150 ? -0.216  14.801  34.585  1.00 41.43 ? 150  ILE A CD1   1 
ATOM   1234 N N     . LYS A 1 151 ? -4.859  17.423  34.251  1.00 37.53 ? 151  LYS A N     1 
ATOM   1235 C CA    . LYS A 1 151 ? -5.714  18.546  34.602  1.00 39.33 ? 151  LYS A CA    1 
ATOM   1236 C C     . LYS A 1 151 ? -6.600  18.314  35.826  1.00 39.84 ? 151  LYS A C     1 
ATOM   1237 O O     . LYS A 1 151 ? -7.018  19.270  36.481  1.00 39.20 ? 151  LYS A O     1 
ATOM   1238 C CB    . LYS A 1 151 ? -6.564  18.923  33.386  1.00 40.26 ? 151  LYS A CB    1 
ATOM   1239 C CG    . LYS A 1 151 ? -5.736  19.100  32.112  1.00 42.78 ? 151  LYS A CG    1 
ATOM   1240 C CD    . LYS A 1 151 ? -6.605  19.317  30.880  1.00 46.06 ? 151  LYS A CD    1 
ATOM   1241 C CE    . LYS A 1 151 ? -7.230  20.711  30.864  1.00 48.42 ? 151  LYS A CE    1 
ATOM   1242 N NZ    . LYS A 1 151 ? -6.215  21.791  30.673  1.00 49.17 ? 151  LYS A NZ    1 
ATOM   1243 N N     . LYS A 1 152 ? -6.869  17.053  36.147  1.00 39.50 ? 152  LYS A N     1 
ATOM   1244 C CA    . LYS A 1 152 ? -7.716  16.728  37.293  1.00 41.06 ? 152  LYS A CA    1 
ATOM   1245 C C     . LYS A 1 152 ? -7.048  16.885  38.650  1.00 40.23 ? 152  LYS A C     1 
ATOM   1246 O O     . LYS A 1 152 ? -7.720  16.866  39.680  1.00 41.27 ? 152  LYS A O     1 
ATOM   1247 C CB    . LYS A 1 152 ? -8.254  15.297  37.170  1.00 43.42 ? 152  LYS A CB    1 
ATOM   1248 C CG    . LYS A 1 152 ? -9.616  15.217  36.506  1.00 47.53 ? 152  LYS A CG    1 
ATOM   1249 C CD    . LYS A 1 152 ? -10.624 16.028  37.309  1.00 51.64 ? 152  LYS A CD    1 
ATOM   1250 C CE    . LYS A 1 152 ? -11.947 16.201  36.581  1.00 53.46 ? 152  LYS A CE    1 
ATOM   1251 N NZ    . LYS A 1 152 ? -12.866 17.063  37.380  1.00 53.55 ? 152  LYS A NZ    1 
ATOM   1252 N N     . TYR A 1 153 ? -5.733  17.055  38.655  1.00 38.66 ? 153  TYR A N     1 
ATOM   1253 C CA    . TYR A 1 153 ? -4.996  17.176  39.906  1.00 37.04 ? 153  TYR A CA    1 
ATOM   1254 C C     . TYR A 1 153 ? -4.480  18.565  40.240  1.00 36.12 ? 153  TYR A C     1 
ATOM   1255 O O     . TYR A 1 153 ? -3.760  19.178  39.456  1.00 37.00 ? 153  TYR A O     1 
ATOM   1256 C CB    . TYR A 1 153 ? -3.832  16.188  39.898  1.00 35.61 ? 153  TYR A CB    1 
ATOM   1257 C CG    . TYR A 1 153 ? -4.291  14.753  39.908  1.00 35.14 ? 153  TYR A CG    1 
ATOM   1258 C CD1   . TYR A 1 153 ? -4.808  14.177  41.072  1.00 34.42 ? 153  TYR A CD1   1 
ATOM   1259 C CD2   . TYR A 1 153 ? -4.251  13.981  38.751  1.00 34.79 ? 153  TYR A CD2   1 
ATOM   1260 C CE1   . TYR A 1 153 ? -5.272  12.869  41.083  1.00 32.92 ? 153  TYR A CE1   1 
ATOM   1261 C CE2   . TYR A 1 153 ? -4.717  12.667  38.750  1.00 36.24 ? 153  TYR A CE2   1 
ATOM   1262 C CZ    . TYR A 1 153 ? -5.225  12.120  39.923  1.00 34.83 ? 153  TYR A CZ    1 
ATOM   1263 O OH    . TYR A 1 153 ? -5.682  10.823  39.935  1.00 35.95 ? 153  TYR A OH    1 
ATOM   1264 N N     . LYS A 1 154 ? -4.852  19.049  41.419  1.00 35.29 ? 154  LYS A N     1 
ATOM   1265 C CA    . LYS A 1 154 ? -4.415  20.351  41.887  1.00 35.25 ? 154  LYS A CA    1 
ATOM   1266 C C     . LYS A 1 154 ? -3.080  20.150  42.584  1.00 33.99 ? 154  LYS A C     1 
ATOM   1267 O O     . LYS A 1 154 ? -2.930  20.481  43.759  1.00 34.46 ? 154  LYS A O     1 
ATOM   1268 C CB    . LYS A 1 154 ? -5.426  20.937  42.879  1.00 39.41 ? 154  LYS A CB    1 
ATOM   1269 C CG    . LYS A 1 154 ? -6.740  21.426  42.261  1.00 44.54 ? 154  LYS A CG    1 
ATOM   1270 C CD    . LYS A 1 154 ? -7.557  20.286  41.657  1.00 48.10 ? 154  LYS A CD    1 
ATOM   1271 C CE    . LYS A 1 154 ? -8.856  20.791  41.027  1.00 49.48 ? 154  LYS A CE    1 
ATOM   1272 N NZ    . LYS A 1 154 ? -9.771  21.403  42.035  1.00 51.21 ? 154  LYS A NZ    1 
ATOM   1273 N N     . GLN A 1 155 ? -2.112  19.596  41.862  1.00 30.94 ? 155  GLN A N     1 
ATOM   1274 C CA    . GLN A 1 155 ? -0.798  19.347  42.436  1.00 28.16 ? 155  GLN A CA    1 
ATOM   1275 C C     . GLN A 1 155 ? 0.326   19.709  41.489  1.00 25.64 ? 155  GLN A C     1 
ATOM   1276 O O     . GLN A 1 155 ? 0.142   19.765  40.275  1.00 25.09 ? 155  GLN A O     1 
ATOM   1277 C CB    . GLN A 1 155 ? -0.680  17.880  42.847  1.00 31.62 ? 155  GLN A CB    1 
ATOM   1278 C CG    . GLN A 1 155 ? -1.613  17.524  43.982  1.00 39.07 ? 155  GLN A CG    1 
ATOM   1279 C CD    . GLN A 1 155 ? -1.557  16.068  44.361  1.00 43.64 ? 155  GLN A CD    1 
ATOM   1280 O OE1   . GLN A 1 155 ? -1.891  15.192  43.563  1.00 48.88 ? 155  GLN A OE1   1 
ATOM   1281 N NE2   . GLN A 1 155 ? -1.139  15.796  45.590  1.00 47.32 ? 155  GLN A NE2   1 
ATOM   1282 N N     . PRO A 1 156 ? 1.513   19.983  42.040  1.00 23.24 ? 156  PRO A N     1 
ATOM   1283 C CA    . PRO A 1 156 ? 2.660   20.338  41.208  1.00 22.53 ? 156  PRO A CA    1 
ATOM   1284 C C     . PRO A 1 156 ? 2.914   19.254  40.164  1.00 22.62 ? 156  PRO A C     1 
ATOM   1285 O O     . PRO A 1 156 ? 2.984   18.064  40.485  1.00 22.91 ? 156  PRO A O     1 
ATOM   1286 C CB    . PRO A 1 156 ? 3.795   20.452  42.223  1.00 22.10 ? 156  PRO A CB    1 
ATOM   1287 C CG    . PRO A 1 156 ? 3.079   20.933  43.456  1.00 22.21 ? 156  PRO A CG    1 
ATOM   1288 C CD    . PRO A 1 156 ? 1.855   20.059  43.471  1.00 21.50 ? 156  PRO A CD    1 
ATOM   1289 N N     . ILE A 1 157 ? 3.038   19.678  38.913  1.00 22.72 ? 157  ILE A N     1 
ATOM   1290 C CA    . ILE A 1 157 ? 3.278   18.771  37.802  1.00 22.52 ? 157  ILE A CA    1 
ATOM   1291 C C     . ILE A 1 157 ? 4.424   17.803  38.092  1.00 21.95 ? 157  ILE A C     1 
ATOM   1292 O O     . ILE A 1 157 ? 4.361   16.642  37.712  1.00 22.50 ? 157  ILE A O     1 
ATOM   1293 C CB    . ILE A 1 157 ? 3.595   19.562  36.506  1.00 22.58 ? 157  ILE A CB    1 
ATOM   1294 C CG1   . ILE A 1 157 ? 3.660   18.610  35.314  1.00 22.19 ? 157  ILE A CG1   1 
ATOM   1295 C CG2   . ILE A 1 157 ? 4.907   20.313  36.665  1.00 22.57 ? 157  ILE A CG2   1 
ATOM   1296 C CD1   . ILE A 1 157 ? 2.371   17.835  35.087  1.00 23.90 ? 157  ILE A CD1   1 
ATOM   1297 N N     . VAL A 1 158 ? 5.468   18.272  38.768  1.00 21.55 ? 158  VAL A N     1 
ATOM   1298 C CA    . VAL A 1 158 ? 6.587   17.397  39.074  1.00 20.02 ? 158  VAL A CA    1 
ATOM   1299 C C     . VAL A 1 158 ? 6.149   16.258  40.005  1.00 21.34 ? 158  VAL A C     1 
ATOM   1300 O O     . VAL A 1 158 ? 6.648   15.139  39.906  1.00 22.36 ? 158  VAL A O     1 
ATOM   1301 C CB    . VAL A 1 158 ? 7.772   18.187  39.697  1.00 19.15 ? 158  VAL A CB    1 
ATOM   1302 C CG1   . VAL A 1 158 ? 7.414   18.690  41.094  1.00 17.94 ? 158  VAL A CG1   1 
ATOM   1303 C CG2   . VAL A 1 158 ? 9.016   17.310  39.728  1.00 14.84 ? 158  VAL A CG2   1 
ATOM   1304 N N     . ALA A 1 159 ? 5.202   16.532  40.896  1.00 21.78 ? 159  ALA A N     1 
ATOM   1305 C CA    . ALA A 1 159 ? 4.712   15.499  41.808  1.00 21.32 ? 159  ALA A CA    1 
ATOM   1306 C C     . ALA A 1 159 ? 3.897   14.457  41.045  1.00 20.27 ? 159  ALA A C     1 
ATOM   1307 O O     . ALA A 1 159 ? 4.073   13.260  41.241  1.00 21.06 ? 159  ALA A O     1 
ATOM   1308 C CB    . ALA A 1 159 ? 3.852   16.125  42.909  1.00 20.29 ? 159  ALA A CB    1 
ATOM   1309 N N     . LEU A 1 160 ? 3.008   14.921  40.173  1.00 20.33 ? 160  LEU A N     1 
ATOM   1310 C CA    . LEU A 1 160 ? 2.157   14.029  39.393  1.00 21.03 ? 160  LEU A CA    1 
ATOM   1311 C C     . LEU A 1 160 ? 2.959   13.089  38.505  1.00 21.80 ? 160  LEU A C     1 
ATOM   1312 O O     . LEU A 1 160 ? 2.575   11.935  38.306  1.00 22.32 ? 160  LEU A O     1 
ATOM   1313 C CB    . LEU A 1 160 ? 1.190   14.843  38.531  1.00 21.10 ? 160  LEU A CB    1 
ATOM   1314 C CG    . LEU A 1 160 ? 0.227   15.721  39.332  1.00 24.17 ? 160  LEU A CG    1 
ATOM   1315 C CD1   . LEU A 1 160 ? -0.529  16.650  38.396  1.00 25.10 ? 160  LEU A CD1   1 
ATOM   1316 C CD2   . LEU A 1 160 ? -0.731  14.834  40.123  1.00 24.87 ? 160  LEU A CD2   1 
ATOM   1317 N N     . LEU A 1 161 ? 4.074   13.583  37.976  1.00 20.13 ? 161  LEU A N     1 
ATOM   1318 C CA    . LEU A 1 161 ? 4.918   12.784  37.106  1.00 19.91 ? 161  LEU A CA    1 
ATOM   1319 C C     . LEU A 1 161 ? 5.814   11.826  37.891  1.00 19.72 ? 161  LEU A C     1 
ATOM   1320 O O     . LEU A 1 161 ? 6.194   10.773  37.388  1.00 18.29 ? 161  LEU A O     1 
ATOM   1321 C CB    . LEU A 1 161 ? 5.765   13.701  36.219  1.00 19.23 ? 161  LEU A CB    1 
ATOM   1322 C CG    . LEU A 1 161 ? 4.963   14.534  35.217  1.00 19.69 ? 161  LEU A CG    1 
ATOM   1323 C CD1   . LEU A 1 161 ? 5.905   15.367  34.366  1.00 21.13 ? 161  LEU A CD1   1 
ATOM   1324 C CD2   . LEU A 1 161 ? 4.137   13.607  34.331  1.00 17.03 ? 161  LEU A CD2   1 
ATOM   1325 N N     . MET A 1 162 ? 6.155   12.191  39.122  1.00 19.94 ? 162  MET A N     1 
ATOM   1326 C CA    . MET A 1 162 ? 6.985   11.326  39.945  1.00 20.58 ? 162  MET A CA    1 
ATOM   1327 C C     . MET A 1 162 ? 6.134   10.164  40.490  1.00 21.27 ? 162  MET A C     1 
ATOM   1328 O O     . MET A 1 162 ? 6.652   9.095   40.798  1.00 22.11 ? 162  MET A O     1 
ATOM   1329 C CB    . MET A 1 162 ? 7.606   12.124  41.089  1.00 20.91 ? 162  MET A CB    1 
ATOM   1330 C CG    . MET A 1 162 ? 8.731   13.062  40.662  1.00 25.97 ? 162  MET A CG    1 
ATOM   1331 S SD    . MET A 1 162 ? 10.230  12.185  40.162  1.00 32.30 ? 162  MET A SD    1 
ATOM   1332 C CE    . MET A 1 162 ? 10.990  11.867  41.790  1.00 29.14 ? 162  MET A CE    1 
ATOM   1333 N N     . ASP A 1 163 ? 4.826   10.391  40.598  1.00 20.73 ? 163  ASP A N     1 
ATOM   1334 C CA    . ASP A 1 163 ? 3.878   9.386   41.076  1.00 18.94 ? 163  ASP A CA    1 
ATOM   1335 C C     . ASP A 1 163 ? 3.902   8.234   40.072  1.00 19.63 ? 163  ASP A C     1 
ATOM   1336 O O     . ASP A 1 163 ? 3.980   8.459   38.865  1.00 21.04 ? 163  ASP A O     1 
ATOM   1337 C CB    . ASP A 1 163 ? 2.470   10.001  41.142  1.00 18.17 ? 163  ASP A CB    1 
ATOM   1338 C CG    . ASP A 1 163 ? 1.463   9.120   41.893  1.00 23.15 ? 163  ASP A CG    1 
ATOM   1339 O OD1   . ASP A 1 163 ? 0.988   8.106   41.330  1.00 21.97 ? 163  ASP A OD1   1 
ATOM   1340 O OD2   . ASP A 1 163 ? 1.145   9.447   43.060  1.00 24.37 ? 163  ASP A OD2   1 
ATOM   1341 N N     . GLN A 1 164 ? 3.824   7.003   40.559  1.00 19.31 ? 164  GLN A N     1 
ATOM   1342 C CA    . GLN A 1 164 ? 3.859   5.847   39.667  1.00 19.02 ? 164  GLN A CA    1 
ATOM   1343 C C     . GLN A 1 164 ? 2.484   5.291   39.296  1.00 20.76 ? 164  GLN A C     1 
ATOM   1344 O O     . GLN A 1 164 ? 2.382   4.284   38.590  1.00 21.09 ? 164  GLN A O     1 
ATOM   1345 C CB    . GLN A 1 164 ? 4.709   4.743   40.296  1.00 16.35 ? 164  GLN A CB    1 
ATOM   1346 C CG    . GLN A 1 164 ? 6.148   5.160   40.561  1.00 15.51 ? 164  GLN A CG    1 
ATOM   1347 C CD    . GLN A 1 164 ? 6.866   5.625   39.296  1.00 15.23 ? 164  GLN A CD    1 
ATOM   1348 O OE1   . GLN A 1 164 ? 7.107   4.838   38.371  1.00 10.89 ? 164  GLN A OE1   1 
ATOM   1349 N NE2   . GLN A 1 164 ? 7.202   6.911   39.249  1.00 13.34 ? 164  GLN A NE2   1 
ATOM   1350 N N     . LYS A 1 165 ? 1.427   5.958   39.743  1.00 23.21 ? 165  LYS A N     1 
ATOM   1351 C CA    . LYS A 1 165 ? 0.082   5.490   39.460  1.00 25.21 ? 165  LYS A CA    1 
ATOM   1352 C C     . LYS A 1 165 ? -0.862  6.496   38.801  1.00 26.16 ? 165  LYS A C     1 
ATOM   1353 O O     . LYS A 1 165 ? -1.548  6.157   37.832  1.00 26.98 ? 165  LYS A O     1 
ATOM   1354 C CB    . LYS A 1 165 ? -0.550  4.969   40.752  1.00 27.88 ? 165  LYS A CB    1 
ATOM   1355 C CG    . LYS A 1 165 ? -2.027  4.593   40.621  1.00 33.58 ? 165  LYS A CG    1 
ATOM   1356 C CD    . LYS A 1 165 ? -2.233  3.541   39.546  1.00 36.00 ? 165  LYS A CD    1 
ATOM   1357 C CE    . LYS A 1 165 ? -3.703  3.200   39.374  1.00 37.63 ? 165  LYS A CE    1 
ATOM   1358 N NZ    . LYS A 1 165 ? -3.893  2.219   38.269  1.00 39.96 ? 165  LYS A NZ    1 
ATOM   1359 N N     . LYS A 1 166 ? -0.896  7.725   39.312  1.00 25.89 ? 166  LYS A N     1 
ATOM   1360 C CA    . LYS A 1 166 ? -1.800  8.749   38.787  1.00 24.95 ? 166  LYS A CA    1 
ATOM   1361 C C     . LYS A 1 166 ? -1.835  8.946   37.275  1.00 25.06 ? 166  LYS A C     1 
ATOM   1362 O O     . LYS A 1 166 ? -2.906  8.868   36.672  1.00 25.82 ? 166  LYS A O     1 
ATOM   1363 C CB    . LYS A 1 166 ? -1.532  10.100  39.454  1.00 27.31 ? 166  LYS A CB    1 
ATOM   1364 C CG    . LYS A 1 166 ? -2.024  10.203  40.892  1.00 28.16 ? 166  LYS A CG    1 
ATOM   1365 C CD    . LYS A 1 166 ? -1.948  11.640  41.375  1.00 31.92 ? 166  LYS A CD    1 
ATOM   1366 C CE    . LYS A 1 166 ? -2.433  11.786  42.803  1.00 32.47 ? 166  LYS A CE    1 
ATOM   1367 N NZ    . LYS A 1 166 ? -1.525  11.086  43.751  1.00 36.47 ? 166  LYS A NZ    1 
ATOM   1368 N N     . ILE A 1 167 ? -0.683  9.201   36.659  1.00 22.68 ? 167  ILE A N     1 
ATOM   1369 C CA    . ILE A 1 167 ? -0.642  9.425   35.215  1.00 21.51 ? 167  ILE A CA    1 
ATOM   1370 C C     . ILE A 1 167 ? 0.023   8.286   34.447  1.00 20.82 ? 167  ILE A C     1 
ATOM   1371 O O     . ILE A 1 167 ? -0.511  7.788   33.459  1.00 21.65 ? 167  ILE A O     1 
ATOM   1372 C CB    . ILE A 1 167 ? 0.119   10.724  34.873  1.00 21.39 ? 167  ILE A CB    1 
ATOM   1373 C CG1   . ILE A 1 167 ? -0.276  11.845  35.842  1.00 21.02 ? 167  ILE A CG1   1 
ATOM   1374 C CG2   . ILE A 1 167 ? -0.153  11.113  33.433  1.00 19.57 ? 167  ILE A CG2   1 
ATOM   1375 C CD1   . ILE A 1 167 ? -1.754  12.155  35.887  1.00 23.70 ? 167  ILE A CD1   1 
ATOM   1376 N N     . GLY A 1 168 ? 1.206   7.898   34.898  1.00 20.60 ? 168  GLY A N     1 
ATOM   1377 C CA    . GLY A 1 168 ? 1.939   6.826   34.254  1.00 17.82 ? 168  GLY A CA    1 
ATOM   1378 C C     . GLY A 1 168 ? 3.057   6.372   35.172  1.00 18.39 ? 168  GLY A C     1 
ATOM   1379 O O     . GLY A 1 168 ? 3.305   6.998   36.207  1.00 17.70 ? 168  GLY A O     1 
ATOM   1380 N N     . SER A 1 169 ? 3.735   5.291   34.801  1.00 15.85 ? 169  SER A N     1 
ATOM   1381 C CA    . SER A 1 169 ? 4.822   4.775   35.615  1.00 14.58 ? 169  SER A CA    1 
ATOM   1382 C C     . SER A 1 169 ? 6.145   4.806   34.863  1.00 15.23 ? 169  SER A C     1 
ATOM   1383 O O     . SER A 1 169 ? 6.168   4.847   33.628  1.00 16.07 ? 169  SER A O     1 
ATOM   1384 C CB    . SER A 1 169 ? 4.509   3.339   36.044  1.00 15.46 ? 169  SER A CB    1 
ATOM   1385 O OG    . SER A 1 169 ? 4.253   2.517   34.914  1.00 15.65 ? 169  SER A OG    1 
ATOM   1386 N N     . GLY A 1 170 ? 7.242   4.790   35.611  1.00 12.55 ? 170  GLY A N     1 
ATOM   1387 C CA    . GLY A 1 170 ? 8.551   4.767   34.990  1.00 12.53 ? 170  GLY A CA    1 
ATOM   1388 C C     . GLY A 1 170 ? 9.441   5.984   35.178  1.00 12.93 ? 170  GLY A C     1 
ATOM   1389 O O     . GLY A 1 170 ? 10.668  5.863   35.138  1.00 9.95  ? 170  GLY A O     1 
ATOM   1390 N N     . LEU A 1 171 ? 8.844   7.152   35.387  1.00 12.10 ? 171  LEU A N     1 
ATOM   1391 C CA    . LEU A 1 171 ? 9.636   8.365   35.552  1.00 11.87 ? 171  LEU A CA    1 
ATOM   1392 C C     . LEU A 1 171 ? 10.187  8.525   36.966  1.00 14.57 ? 171  LEU A C     1 
ATOM   1393 O O     . LEU A 1 171 ? 9.487   8.298   37.948  1.00 18.09 ? 171  LEU A O     1 
ATOM   1394 C CB    . LEU A 1 171 ? 8.799   9.587   35.189  1.00 10.15 ? 171  LEU A CB    1 
ATOM   1395 C CG    . LEU A 1 171 ? 8.096   9.522   33.828  1.00 10.15 ? 171  LEU A CG    1 
ATOM   1396 C CD1   . LEU A 1 171 ? 7.312   10.811  33.593  1.00 9.08  ? 171  LEU A CD1   1 
ATOM   1397 C CD2   . LEU A 1 171 ? 9.118   9.294   32.729  1.00 10.36 ? 171  LEU A CD2   1 
ATOM   1398 N N     . GLY A 1 172 ? 11.451  8.913   37.054  1.00 14.77 ? 172  GLY A N     1 
ATOM   1399 C CA    . GLY A 1 172 ? 12.085  9.123   38.334  1.00 16.50 ? 172  GLY A CA    1 
ATOM   1400 C C     . GLY A 1 172 ? 12.646  10.537  38.422  1.00 21.17 ? 172  GLY A C     1 
ATOM   1401 O O     . GLY A 1 172 ? 12.412  11.378  37.539  1.00 19.35 ? 172  GLY A O     1 
ATOM   1402 N N     . ASN A 1 173 ? 13.423  10.789  39.470  1.00 19.42 ? 173  ASN A N     1 
ATOM   1403 C CA    . ASN A 1 173 ? 13.970  12.113  39.698  1.00 19.50 ? 173  ASN A CA    1 
ATOM   1404 C C     . ASN A 1 173 ? 14.756  12.758  38.563  1.00 18.95 ? 173  ASN A C     1 
ATOM   1405 O O     . ASN A 1 173 ? 14.604  13.958  38.328  1.00 18.07 ? 173  ASN A O     1 
ATOM   1406 C CB    . ASN A 1 173 ? 14.804  12.123  40.974  1.00 17.82 ? 173  ASN A CB    1 
ATOM   1407 C CG    . ASN A 1 173 ? 14.788  13.477  41.655  1.00 18.86 ? 173  ASN A CG    1 
ATOM   1408 O OD1   . ASN A 1 173 ? 13.749  14.131  41.708  1.00 17.73 ? 173  ASN A OD1   1 
ATOM   1409 N ND2   . ASN A 1 173 ? 15.930  13.897  42.191  1.00 16.32 ? 173  ASN A ND2   1 
ATOM   1410 N N     . TYR A 1 174 ? 15.592  12.008  37.852  1.00 17.45 ? 174  TYR A N     1 
ATOM   1411 C CA    . TYR A 1 174 ? 16.321  12.670  36.786  1.00 19.15 ? 174  TYR A CA    1 
ATOM   1412 C C     . TYR A 1 174 ? 15.473  12.860  35.524  1.00 18.43 ? 174  TYR A C     1 
ATOM   1413 O O     . TYR A 1 174 ? 15.559  13.908  34.882  1.00 17.09 ? 174  TYR A O     1 
ATOM   1414 C CB    . TYR A 1 174 ? 17.665  11.968  36.490  1.00 22.60 ? 174  TYR A CB    1 
ATOM   1415 C CG    . TYR A 1 174 ? 17.636  10.740  35.610  1.00 24.22 ? 174  TYR A CG    1 
ATOM   1416 C CD1   . TYR A 1 174 ? 17.939  9.484   36.128  1.00 25.82 ? 174  TYR A CD1   1 
ATOM   1417 C CD2   . TYR A 1 174 ? 17.340  10.841  34.252  1.00 25.30 ? 174  TYR A CD2   1 
ATOM   1418 C CE1   . TYR A 1 174 ? 17.946  8.354   35.317  1.00 29.86 ? 174  TYR A CE1   1 
ATOM   1419 C CE2   . TYR A 1 174 ? 17.345  9.725   33.433  1.00 29.88 ? 174  TYR A CE2   1 
ATOM   1420 C CZ    . TYR A 1 174 ? 17.645  8.482   33.968  1.00 30.36 ? 174  TYR A CZ    1 
ATOM   1421 O OH    . TYR A 1 174 ? 17.611  7.372   33.158  1.00 32.24 ? 174  TYR A OH    1 
ATOM   1422 N N     . LEU A 1 175 ? 14.629  11.884  35.189  1.00 14.53 ? 175  LEU A N     1 
ATOM   1423 C CA    . LEU A 1 175 ? 13.784  12.019  34.003  1.00 15.70 ? 175  LEU A CA    1 
ATOM   1424 C C     . LEU A 1 175 ? 12.773  13.159  34.079  1.00 15.18 ? 175  LEU A C     1 
ATOM   1425 O O     . LEU A 1 175 ? 12.579  13.874  33.105  1.00 16.68 ? 175  LEU A O     1 
ATOM   1426 C CB    . LEU A 1 175 ? 13.036  10.720  33.699  1.00 15.42 ? 175  LEU A CB    1 
ATOM   1427 C CG    . LEU A 1 175 ? 13.853  9.620   33.025  1.00 18.19 ? 175  LEU A CG    1 
ATOM   1428 C CD1   . LEU A 1 175 ? 13.045  8.325   32.977  1.00 14.41 ? 175  LEU A CD1   1 
ATOM   1429 C CD2   . LEU A 1 175 ? 14.251  10.085  31.632  1.00 18.26 ? 175  LEU A CD2   1 
ATOM   1430 N N     . VAL A 1 176 ? 12.126  13.342  35.221  1.00 14.87 ? 176  VAL A N     1 
ATOM   1431 C CA    . VAL A 1 176 ? 11.145  14.405  35.314  1.00 16.97 ? 176  VAL A CA    1 
ATOM   1432 C C     . VAL A 1 176 ? 11.779  15.790  35.204  1.00 17.64 ? 176  VAL A C     1 
ATOM   1433 O O     . VAL A 1 176 ? 11.217  16.672  34.567  1.00 18.74 ? 176  VAL A O     1 
ATOM   1434 C CB    . VAL A 1 176 ? 10.331  14.317  36.613  1.00 17.44 ? 176  VAL A CB    1 
ATOM   1435 C CG1   . VAL A 1 176 ? 9.408   15.518  36.725  1.00 19.57 ? 176  VAL A CG1   1 
ATOM   1436 C CG2   . VAL A 1 176 ? 9.501   13.048  36.609  1.00 20.90 ? 176  VAL A CG2   1 
ATOM   1437 N N     . ALA A 1 177 ? 12.945  15.975  35.816  1.00 17.10 ? 177  ALA A N     1 
ATOM   1438 C CA    . ALA A 1 177 ? 13.636  17.260  35.756  1.00 16.44 ? 177  ALA A CA    1 
ATOM   1439 C C     . ALA A 1 177 ? 13.986  17.603  34.313  1.00 16.17 ? 177  ALA A C     1 
ATOM   1440 O O     . ALA A 1 177 ? 13.805  18.735  33.876  1.00 16.23 ? 177  ALA A O     1 
ATOM   1441 C CB    . ALA A 1 177 ? 14.910  17.216  36.600  1.00 15.62 ? 177  ALA A CB    1 
ATOM   1442 N N     . GLU A 1 178 ? 14.488  16.615  33.578  1.00 14.56 ? 178  GLU A N     1 
ATOM   1443 C CA    . GLU A 1 178 ? 14.868  16.815  32.188  1.00 14.37 ? 178  GLU A CA    1 
ATOM   1444 C C     . GLU A 1 178 ? 13.665  17.048  31.288  1.00 14.87 ? 178  GLU A C     1 
ATOM   1445 O O     . GLU A 1 178 ? 13.711  17.880  30.384  1.00 13.72 ? 178  GLU A O     1 
ATOM   1446 C CB    . GLU A 1 178 ? 15.669  15.616  31.686  1.00 15.31 ? 178  GLU A CB    1 
ATOM   1447 C CG    . GLU A 1 178 ? 17.022  15.462  32.369  1.00 15.05 ? 178  GLU A CG    1 
ATOM   1448 C CD    . GLU A 1 178 ? 17.943  16.629  32.070  1.00 20.66 ? 178  GLU A CD    1 
ATOM   1449 O OE1   . GLU A 1 178 ? 18.069  16.959  30.872  1.00 19.24 ? 178  GLU A OE1   1 
ATOM   1450 O OE2   . GLU A 1 178 ? 18.539  17.207  33.017  1.00 17.28 ? 178  GLU A OE2   1 
ATOM   1451 N N     . ILE A 1 179 ? 12.584  16.321  31.542  1.00 14.63 ? 179  ILE A N     1 
ATOM   1452 C CA    . ILE A 1 179 ? 11.371  16.465  30.750  1.00 13.50 ? 179  ILE A CA    1 
ATOM   1453 C C     . ILE A 1 179 ? 10.706  17.835  30.930  1.00 15.55 ? 179  ILE A C     1 
ATOM   1454 O O     . ILE A 1 179 ? 10.260  18.449  29.956  1.00 16.36 ? 179  ILE A O     1 
ATOM   1455 C CB    . ILE A 1 179 ? 10.364  15.353  31.101  1.00 13.12 ? 179  ILE A CB    1 
ATOM   1456 C CG1   . ILE A 1 179 ? 10.887  14.011  30.569  1.00 14.34 ? 179  ILE A CG1   1 
ATOM   1457 C CG2   . ILE A 1 179 ? 8.998   15.678  30.529  1.00 13.82 ? 179  ILE A CG2   1 
ATOM   1458 C CD1   . ILE A 1 179 ? 10.115  12.797  31.058  1.00 13.62 ? 179  ILE A CD1   1 
ATOM   1459 N N     . LEU A 1 180 ? 10.647  18.325  32.163  1.00 15.41 ? 180  LEU A N     1 
ATOM   1460 C CA    . LEU A 1 180 ? 10.015  19.615  32.407  1.00 16.61 ? 180  LEU A CA    1 
ATOM   1461 C C     . LEU A 1 180 ? 10.840  20.770  31.838  1.00 19.79 ? 180  LEU A C     1 
ATOM   1462 O O     . LEU A 1 180 ? 10.279  21.779  31.417  1.00 20.81 ? 180  LEU A O     1 
ATOM   1463 C CB    . LEU A 1 180 ? 9.771   19.811  33.901  1.00 15.77 ? 180  LEU A CB    1 
ATOM   1464 C CG    . LEU A 1 180 ? 8.767   18.815  34.503  1.00 15.68 ? 180  LEU A CG    1 
ATOM   1465 C CD1   . LEU A 1 180 ? 8.707   19.006  35.996  1.00 11.59 ? 180  LEU A CD1   1 
ATOM   1466 C CD2   . LEU A 1 180 ? 7.377   19.013  33.875  1.00 12.93 ? 180  LEU A CD2   1 
ATOM   1467 N N     . TYR A 1 181 ? 12.164  20.618  31.814  1.00 19.00 ? 181  TYR A N     1 
ATOM   1468 C CA    . TYR A 1 181 ? 13.034  21.654  31.273  1.00 18.04 ? 181  TYR A CA    1 
ATOM   1469 C C     . TYR A 1 181 ? 12.819  21.723  29.758  1.00 20.35 ? 181  TYR A C     1 
ATOM   1470 O O     . TYR A 1 181 ? 12.695  22.809  29.180  1.00 20.27 ? 181  TYR A O     1 
ATOM   1471 C CB    . TYR A 1 181 ? 14.498  21.329  31.590  1.00 17.18 ? 181  TYR A CB    1 
ATOM   1472 C CG    . TYR A 1 181 ? 15.501  22.214  30.880  1.00 18.58 ? 181  TYR A CG    1 
ATOM   1473 C CD1   . TYR A 1 181 ? 15.691  23.549  31.261  1.00 18.97 ? 181  TYR A CD1   1 
ATOM   1474 C CD2   . TYR A 1 181 ? 16.232  21.728  29.798  1.00 17.77 ? 181  TYR A CD2   1 
ATOM   1475 C CE1   . TYR A 1 181 ? 16.581  24.373  30.578  1.00 18.17 ? 181  TYR A CE1   1 
ATOM   1476 C CE2   . TYR A 1 181 ? 17.120  22.540  29.105  1.00 19.43 ? 181  TYR A CE2   1 
ATOM   1477 C CZ    . TYR A 1 181 ? 17.291  23.860  29.499  1.00 21.11 ? 181  TYR A CZ    1 
ATOM   1478 O OH    . TYR A 1 181 ? 18.176  24.647  28.812  1.00 21.35 ? 181  TYR A OH    1 
ATOM   1479 N N     . ARG A 1 182 ? 12.776  20.556  29.122  1.00 20.06 ? 182  ARG A N     1 
ATOM   1480 C CA    . ARG A 1 182 ? 12.565  20.459  27.680  1.00 21.49 ? 182  ARG A CA    1 
ATOM   1481 C C     . ARG A 1 182 ? 11.205  21.014  27.300  1.00 21.40 ? 182  ARG A C     1 
ATOM   1482 O O     . ARG A 1 182 ? 11.057  21.667  26.265  1.00 22.79 ? 182  ARG A O     1 
ATOM   1483 C CB    . ARG A 1 182 ? 12.617  19.006  27.227  1.00 22.18 ? 182  ARG A CB    1 
ATOM   1484 C CG    . ARG A 1 182 ? 13.945  18.332  27.399  1.00 26.97 ? 182  ARG A CG    1 
ATOM   1485 C CD    . ARG A 1 182 ? 14.830  18.525  26.197  1.00 30.12 ? 182  ARG A CD    1 
ATOM   1486 N NE    . ARG A 1 182 ? 15.899  17.535  26.206  1.00 34.71 ? 182  ARG A NE    1 
ATOM   1487 C CZ    . ARG A 1 182 ? 16.688  17.270  25.173  1.00 34.88 ? 182  ARG A CZ    1 
ATOM   1488 N NH1   . ARG A 1 182 ? 16.534  17.923  24.027  1.00 34.61 ? 182  ARG A NH1   1 
ATOM   1489 N NH2   . ARG A 1 182 ? 17.632  16.348  25.291  1.00 37.05 ? 182  ARG A NH2   1 
ATOM   1490 N N     . ALA A 1 183 ? 10.207  20.723  28.128  1.00 20.50 ? 183  ALA A N     1 
ATOM   1491 C CA    . ALA A 1 183 ? 8.853   21.190  27.870  1.00 21.53 ? 183  ALA A CA    1 
ATOM   1492 C C     . ALA A 1 183 ? 8.705   22.640  28.307  1.00 20.98 ? 183  ALA A C     1 
ATOM   1493 O O     . ALA A 1 183 ? 7.688   23.266  28.038  1.00 21.35 ? 183  ALA A O     1 
ATOM   1494 C CB    . ALA A 1 183 ? 7.847   20.319  28.610  1.00 19.66 ? 183  ALA A CB    1 
ATOM   1495 N N     . LYS A 1 184 ? 9.725   23.155  28.989  1.00 20.46 ? 184  LYS A N     1 
ATOM   1496 C CA    . LYS A 1 184 ? 9.734   24.536  29.473  1.00 22.98 ? 184  LYS A CA    1 
ATOM   1497 C C     . LYS A 1 184 ? 8.614   24.810  30.470  1.00 23.19 ? 184  LYS A C     1 
ATOM   1498 O O     . LYS A 1 184 ? 7.992   25.868  30.441  1.00 23.04 ? 184  LYS A O     1 
ATOM   1499 C CB    . LYS A 1 184 ? 9.620   25.508  28.292  1.00 21.85 ? 184  LYS A CB    1 
ATOM   1500 C CG    . LYS A 1 184 ? 10.792  25.452  27.332  1.00 20.08 ? 184  LYS A CG    1 
ATOM   1501 C CD    . LYS A 1 184 ? 10.579  26.404  26.169  1.00 24.75 ? 184  LYS A CD    1 
ATOM   1502 C CE    . LYS A 1 184 ? 11.868  26.648  25.388  1.00 26.29 ? 184  LYS A CE    1 
ATOM   1503 N NZ    . LYS A 1 184 ? 12.461  25.386  24.874  1.00 30.21 ? 184  LYS A NZ    1 
ATOM   1504 N N     . ILE A 1 185 ? 8.373   23.859  31.366  1.00 23.15 ? 185  ILE A N     1 
ATOM   1505 C CA    . ILE A 1 185 ? 7.316   24.004  32.356  1.00 22.94 ? 185  ILE A CA    1 
ATOM   1506 C C     . ILE A 1 185 ? 7.862   24.094  33.773  1.00 22.84 ? 185  ILE A C     1 
ATOM   1507 O O     . ILE A 1 185 ? 8.684   23.274  34.186  1.00 24.78 ? 185  ILE A O     1 
ATOM   1508 C CB    . ILE A 1 185 ? 6.336   22.810  32.278  1.00 24.18 ? 185  ILE A CB    1 
ATOM   1509 C CG1   . ILE A 1 185 ? 5.798   22.676  30.851  1.00 25.59 ? 185  ILE A CG1   1 
ATOM   1510 C CG2   . ILE A 1 185 ? 5.191   23.003  33.255  1.00 25.65 ? 185  ILE A CG2   1 
ATOM   1511 C CD1   . ILE A 1 185 ? 4.888   21.464  30.643  1.00 27.22 ? 185  ILE A CD1   1 
ATOM   1512 N N     . ASP A 1 186 ? 7.406   25.098  34.512  1.00 23.16 ? 186  ASP A N     1 
ATOM   1513 C CA    . ASP A 1 186 ? 7.817   25.288  35.900  1.00 24.62 ? 186  ASP A CA    1 
ATOM   1514 C C     . ASP A 1 186 ? 7.351   24.046  36.661  1.00 24.88 ? 186  ASP A C     1 
ATOM   1515 O O     . ASP A 1 186 ? 6.208   23.615  36.509  1.00 24.53 ? 186  ASP A O     1 
ATOM   1516 C CB    . ASP A 1 186 ? 7.141   26.539  36.486  1.00 23.57 ? 186  ASP A CB    1 
ATOM   1517 C CG    . ASP A 1 186 ? 7.629   26.873  37.891  1.00 23.95 ? 186  ASP A CG    1 
ATOM   1518 O OD1   . ASP A 1 186 ? 7.746   25.953  38.724  1.00 22.65 ? 186  ASP A OD1   1 
ATOM   1519 O OD2   . ASP A 1 186 ? 7.888   28.064  38.169  1.00 24.82 ? 186  ASP A OD2   1 
ATOM   1520 N N     . PRO A 1 187 ? 8.236   23.447  37.471  1.00 26.37 ? 187  PRO A N     1 
ATOM   1521 C CA    . PRO A 1 187 ? 7.927   22.248  38.262  1.00 27.20 ? 187  PRO A CA    1 
ATOM   1522 C C     . PRO A 1 187 ? 6.752   22.466  39.219  1.00 26.68 ? 187  PRO A C     1 
ATOM   1523 O O     . PRO A 1 187 ? 5.958   21.558  39.452  1.00 26.42 ? 187  PRO A O     1 
ATOM   1524 C CB    . PRO A 1 187 ? 9.231   21.986  39.013  1.00 27.54 ? 187  PRO A CB    1 
ATOM   1525 C CG    . PRO A 1 187 ? 10.260  22.536  38.087  1.00 29.95 ? 187  PRO A CG    1 
ATOM   1526 C CD    . PRO A 1 187 ? 9.648   23.825  37.631  1.00 26.53 ? 187  PRO A CD    1 
ATOM   1527 N N     . HIS A 1 188 ? 6.660   23.677  39.766  1.00 26.23 ? 188  HIS A N     1 
ATOM   1528 C CA    . HIS A 1 188 ? 5.595   24.042  40.696  1.00 26.48 ? 188  HIS A CA    1 
ATOM   1529 C C     . HIS A 1 188 ? 4.222   24.128  40.045  1.00 26.41 ? 188  HIS A C     1 
ATOM   1530 O O     . HIS A 1 188 ? 3.214   24.044  40.734  1.00 28.47 ? 188  HIS A O     1 
ATOM   1531 C CB    . HIS A 1 188 ? 5.876   25.401  41.350  1.00 26.80 ? 188  HIS A CB    1 
ATOM   1532 C CG    . HIS A 1 188 ? 7.172   25.470  42.099  1.00 28.99 ? 188  HIS A CG    1 
ATOM   1533 N ND1   . HIS A 1 188 ? 8.379   25.711  41.479  1.00 28.16 ? 188  HIS A ND1   1 
ATOM   1534 C CD2   . HIS A 1 188 ? 7.446   25.335  43.419  1.00 27.56 ? 188  HIS A CD2   1 
ATOM   1535 C CE1   . HIS A 1 188 ? 9.342   25.721  42.384  1.00 28.41 ? 188  HIS A CE1   1 
ATOM   1536 N NE2   . HIS A 1 188 ? 8.802   25.496  43.570  1.00 27.88 ? 188  HIS A NE2   1 
ATOM   1537 N N     . LYS A 1 189 ? 4.167   24.299  38.728  1.00 28.65 ? 189  LYS A N     1 
ATOM   1538 C CA    . LYS A 1 189 ? 2.872   24.427  38.061  1.00 30.38 ? 189  LYS A CA    1 
ATOM   1539 C C     . LYS A 1 189 ? 1.906   23.266  38.282  1.00 30.95 ? 189  LYS A C     1 
ATOM   1540 O O     . LYS A 1 189 ? 2.208   22.117  37.967  1.00 31.42 ? 189  LYS A O     1 
ATOM   1541 C CB    . LYS A 1 189 ? 3.047   24.655  36.560  1.00 31.43 ? 189  LYS A CB    1 
ATOM   1542 C CG    . LYS A 1 189 ? 1.734   25.061  35.889  1.00 35.12 ? 189  LYS A CG    1 
ATOM   1543 C CD    . LYS A 1 189 ? 1.948   25.689  34.529  1.00 36.86 ? 189  LYS A CD    1 
ATOM   1544 C CE    . LYS A 1 189 ? 0.688   26.412  34.081  1.00 39.11 ? 189  LYS A CE    1 
ATOM   1545 N NZ    . LYS A 1 189 ? 0.916   27.232  32.858  1.00 40.91 ? 189  LYS A NZ    1 
ATOM   1546 N N     . LEU A 1 190 ? 0.733   23.587  38.817  1.00 31.07 ? 190  LEU A N     1 
ATOM   1547 C CA    . LEU A 1 190 ? -0.297  22.593  39.091  1.00 30.49 ? 190  LEU A CA    1 
ATOM   1548 C C     . LEU A 1 190 ? -0.830  21.982  37.806  1.00 30.37 ? 190  LEU A C     1 
ATOM   1549 O O     . LEU A 1 190 ? -1.003  22.675  36.804  1.00 30.20 ? 190  LEU A O     1 
ATOM   1550 C CB    . LEU A 1 190 ? -1.447  23.235  39.871  1.00 30.84 ? 190  LEU A CB    1 
ATOM   1551 C CG    . LEU A 1 190 ? -1.318  23.404  41.390  1.00 32.51 ? 190  LEU A CG    1 
ATOM   1552 C CD1   . LEU A 1 190 ? 0.121   23.611  41.795  1.00 33.20 ? 190  LEU A CD1   1 
ATOM   1553 C CD2   . LEU A 1 190 ? -2.168  24.581  41.825  1.00 32.77 ? 190  LEU A CD2   1 
ATOM   1554 N N     . GLY A 1 191 ? -1.090  20.678  37.841  1.00 30.29 ? 191  GLY A N     1 
ATOM   1555 C CA    . GLY A 1 191 ? -1.616  20.004  36.669  1.00 29.67 ? 191  GLY A CA    1 
ATOM   1556 C C     . GLY A 1 191 ? -2.947  20.592  36.234  1.00 30.13 ? 191  GLY A C     1 
ATOM   1557 O O     . GLY A 1 191 ? -3.254  20.651  35.044  1.00 28.92 ? 191  GLY A O     1 
ATOM   1558 N N     . SER A 1 192 ? -3.742  21.039  37.198  1.00 30.46 ? 192  SER A N     1 
ATOM   1559 C CA    . SER A 1 192 ? -5.041  21.622  36.884  1.00 32.84 ? 192  SER A CA    1 
ATOM   1560 C C     . SER A 1 192 ? -4.933  22.966  36.160  1.00 34.24 ? 192  SER A C     1 
ATOM   1561 O O     . SER A 1 192 ? -5.913  23.445  35.590  1.00 33.91 ? 192  SER A O     1 
ATOM   1562 C CB    . SER A 1 192 ? -5.877  21.777  38.160  1.00 32.02 ? 192  SER A CB    1 
ATOM   1563 O OG    . SER A 1 192 ? -5.177  22.481  39.169  1.00 31.61 ? 192  SER A OG    1 
ATOM   1564 N N     . ASN A 1 193 ? -3.745  23.568  36.170  1.00 36.01 ? 193  ASN A N     1 
ATOM   1565 C CA    . ASN A 1 193 ? -3.551  24.853  35.506  1.00 37.55 ? 193  ASN A CA    1 
ATOM   1566 C C     . ASN A 1 193 ? -2.857  24.739  34.160  1.00 39.89 ? 193  ASN A C     1 
ATOM   1567 O O     . ASN A 1 193 ? -2.625  25.750  33.492  1.00 41.15 ? 193  ASN A O     1 
ATOM   1568 C CB    . ASN A 1 193 ? -2.749  25.807  36.391  1.00 37.90 ? 193  ASN A CB    1 
ATOM   1569 C CG    . ASN A 1 193 ? -3.493  26.198  37.650  1.00 39.30 ? 193  ASN A CG    1 
ATOM   1570 O OD1   . ASN A 1 193 ? -4.725  26.232  37.671  1.00 39.00 ? 193  ASN A OD1   1 
ATOM   1571 N ND2   . ASN A 1 193 ? -2.746  26.517  38.706  1.00 37.83 ? 193  ASN A ND2   1 
ATOM   1572 N N     . LEU A 1 194 ? -2.521  23.517  33.761  1.00 40.64 ? 194  LEU A N     1 
ATOM   1573 C CA    . LEU A 1 194 ? -1.849  23.298  32.486  1.00 41.07 ? 194  LEU A CA    1 
ATOM   1574 C C     . LEU A 1 194 ? -2.824  23.390  31.317  1.00 43.15 ? 194  LEU A C     1 
ATOM   1575 O O     . LEU A 1 194 ? -3.918  22.836  31.365  1.00 43.28 ? 194  LEU A O     1 
ATOM   1576 C CB    . LEU A 1 194 ? -1.161  21.929  32.480  1.00 39.44 ? 194  LEU A CB    1 
ATOM   1577 C CG    . LEU A 1 194 ? 0.044   21.771  33.410  1.00 37.71 ? 194  LEU A CG    1 
ATOM   1578 C CD1   . LEU A 1 194 ? 0.515   20.325  33.405  1.00 35.75 ? 194  LEU A CD1   1 
ATOM   1579 C CD2   . LEU A 1 194 ? 1.156   22.698  32.954  1.00 36.60 ? 194  LEU A CD2   1 
ATOM   1580 N N     . THR A 1 195 ? -2.419  24.095  30.266  1.00 45.49 ? 195  THR A N     1 
ATOM   1581 C CA    . THR A 1 195 ? -3.257  24.252  29.084  1.00 47.89 ? 195  THR A CA    1 
ATOM   1582 C C     . THR A 1 195 ? -3.203  22.968  28.267  1.00 50.36 ? 195  THR A C     1 
ATOM   1583 O O     . THR A 1 195 ? -2.322  22.134  28.473  1.00 51.28 ? 195  THR A O     1 
ATOM   1584 C CB    . THR A 1 195 ? -2.763  25.409  28.193  1.00 47.79 ? 195  THR A CB    1 
ATOM   1585 O OG1   . THR A 1 195 ? -1.505  25.054  27.604  1.00 47.28 ? 195  THR A OG1   1 
ATOM   1586 C CG2   . THR A 1 195 ? -2.597  26.683  29.014  1.00 45.45 ? 195  THR A CG2   1 
ATOM   1587 N N     . ASP A 1 196 ? -4.142  22.806  27.341  1.00 51.56 ? 196  ASP A N     1 
ATOM   1588 C CA    . ASP A 1 196 ? -4.159  21.615  26.506  1.00 52.76 ? 196  ASP A CA    1 
ATOM   1589 C C     . ASP A 1 196 ? -2.947  21.650  25.594  1.00 52.13 ? 196  ASP A C     1 
ATOM   1590 O O     . ASP A 1 196 ? -2.451  20.614  25.157  1.00 52.78 ? 196  ASP A O     1 
ATOM   1591 C CB    . ASP A 1 196 ? -5.440  21.566  25.672  1.00 54.71 ? 196  ASP A CB    1 
ATOM   1592 C CG    . ASP A 1 196 ? -6.682  21.519  26.531  1.00 57.17 ? 196  ASP A CG    1 
ATOM   1593 O OD1   . ASP A 1 196 ? -6.767  20.618  27.393  1.00 57.26 ? 196  ASP A OD1   1 
ATOM   1594 O OD2   . ASP A 1 196 ? -7.571  22.380  26.347  1.00 59.27 ? 196  ASP A OD2   1 
ATOM   1595 N N     . GLN A 1 197 ? -2.471  22.857  25.320  1.00 52.01 ? 197  GLN A N     1 
ATOM   1596 C CA    . GLN A 1 197 ? -1.311  23.044  24.465  1.00 51.74 ? 197  GLN A CA    1 
ATOM   1597 C C     . GLN A 1 197 ? -0.077  22.551  25.213  1.00 49.82 ? 197  GLN A C     1 
ATOM   1598 O O     . GLN A 1 197 ? 0.796   21.897  24.636  1.00 48.60 ? 197  GLN A O     1 
ATOM   1599 C CB    . GLN A 1 197 ? -1.150  24.523  24.118  1.00 54.31 ? 197  GLN A CB    1 
ATOM   1600 C CG    . GLN A 1 197 ? -0.703  24.776  22.693  1.00 58.14 ? 197  GLN A CG    1 
ATOM   1601 C CD    . GLN A 1 197 ? 0.576   24.049  22.349  1.00 60.54 ? 197  GLN A CD    1 
ATOM   1602 O OE1   . GLN A 1 197 ? 1.610   24.260  22.981  1.00 62.12 ? 197  GLN A OE1   1 
ATOM   1603 N NE2   . GLN A 1 197 ? 0.515   23.184  21.341  1.00 62.52 ? 197  GLN A NE2   1 
ATOM   1604 N N     . GLU A 1 198 ? -0.012  22.871  26.502  1.00 47.37 ? 198  GLU A N     1 
ATOM   1605 C CA    . GLU A 1 198 ? 1.110   22.450  27.330  1.00 46.66 ? 198  GLU A CA    1 
ATOM   1606 C C     . GLU A 1 198 ? 1.078   20.938  27.521  1.00 44.72 ? 198  GLU A C     1 
ATOM   1607 O O     . GLU A 1 198 ? 2.119   20.282  27.527  1.00 43.32 ? 198  GLU A O     1 
ATOM   1608 C CB    . GLU A 1 198 ? 1.056   23.139  28.695  1.00 47.87 ? 198  GLU A CB    1 
ATOM   1609 C CG    . GLU A 1 198 ? 1.249   24.644  28.641  1.00 51.62 ? 198  GLU A CG    1 
ATOM   1610 C CD    . GLU A 1 198 ? 1.257   25.278  30.020  1.00 53.48 ? 198  GLU A CD    1 
ATOM   1611 O OE1   . GLU A 1 198 ? 0.233   25.182  30.729  1.00 54.15 ? 198  GLU A OE1   1 
ATOM   1612 O OE2   . GLU A 1 198 ? 2.291   25.869  30.396  1.00 55.16 ? 198  GLU A OE2   1 
ATOM   1613 N N     . ILE A 1 199 ? -0.126  20.396  27.672  1.00 43.66 ? 199  ILE A N     1 
ATOM   1614 C CA    . ILE A 1 199 ? -0.307  18.965  27.867  1.00 42.72 ? 199  ILE A CA    1 
ATOM   1615 C C     . ILE A 1 199 ? 0.254   18.169  26.701  1.00 42.20 ? 199  ILE A C     1 
ATOM   1616 O O     . ILE A 1 199 ? 1.047   17.255  26.901  1.00 41.94 ? 199  ILE A O     1 
ATOM   1617 C CB    . ILE A 1 199 ? -1.798  18.600  28.038  1.00 43.35 ? 199  ILE A CB    1 
ATOM   1618 C CG1   . ILE A 1 199 ? -2.376  19.310  29.263  1.00 43.31 ? 199  ILE A CG1   1 
ATOM   1619 C CG2   . ILE A 1 199 ? -1.952  17.097  28.207  1.00 42.43 ? 199  ILE A CG2   1 
ATOM   1620 C CD1   . ILE A 1 199 ? -1.748  18.889  30.563  1.00 44.58 ? 199  ILE A CD1   1 
ATOM   1621 N N     . GLU A 1 200 ? -0.150  18.511  25.482  1.00 41.64 ? 200  GLU A N     1 
ATOM   1622 C CA    . GLU A 1 200 ? 0.343   17.783  24.319  1.00 41.99 ? 200  GLU A CA    1 
ATOM   1623 C C     . GLU A 1 200 ? 1.846   17.979  24.153  1.00 39.74 ? 200  GLU A C     1 
ATOM   1624 O O     . GLU A 1 200 ? 2.539   17.118  23.610  1.00 39.15 ? 200  GLU A O     1 
ATOM   1625 C CB    . GLU A 1 200 ? -0.396  18.217  23.046  1.00 43.10 ? 200  GLU A CB    1 
ATOM   1626 C CG    . GLU A 1 200 ? -0.206  19.668  22.657  1.00 50.85 ? 200  GLU A CG    1 
ATOM   1627 C CD    . GLU A 1 200 ? -1.013  20.051  21.420  1.00 54.24 ? 200  GLU A CD    1 
ATOM   1628 O OE1   . GLU A 1 200 ? -2.258  19.919  21.454  1.00 55.11 ? 200  GLU A OE1   1 
ATOM   1629 O OE2   . GLU A 1 200 ? -0.403  20.484  20.415  1.00 55.75 ? 200  GLU A OE2   1 
ATOM   1630 N N     . ASN A 1 201 ? 2.351   19.110  24.635  1.00 37.98 ? 201  ASN A N     1 
ATOM   1631 C CA    . ASN A 1 201 ? 3.777   19.400  24.539  1.00 35.89 ? 201  ASN A CA    1 
ATOM   1632 C C     . ASN A 1 201 ? 4.529   18.516  25.528  1.00 31.79 ? 201  ASN A C     1 
ATOM   1633 O O     . ASN A 1 201 ? 5.560   17.931  25.201  1.00 29.35 ? 201  ASN A O     1 
ATOM   1634 C CB    . ASN A 1 201 ? 4.041   20.875  24.852  1.00 39.68 ? 201  ASN A CB    1 
ATOM   1635 C CG    . ASN A 1 201 ? 5.470   21.287  24.552  1.00 43.61 ? 201  ASN A CG    1 
ATOM   1636 O OD1   . ASN A 1 201 ? 5.929   21.192  23.413  1.00 47.66 ? 201  ASN A OD1   1 
ATOM   1637 N ND2   . ASN A 1 201 ? 6.181   21.752  25.574  1.00 46.86 ? 201  ASN A ND2   1 
ATOM   1638 N N     . LEU A 1 202 ? 3.995   18.424  26.741  1.00 28.41 ? 202  LEU A N     1 
ATOM   1639 C CA    . LEU A 1 202 ? 4.593   17.607  27.784  1.00 25.89 ? 202  LEU A CA    1 
ATOM   1640 C C     . LEU A 1 202 ? 4.639   16.140  27.337  1.00 23.09 ? 202  LEU A C     1 
ATOM   1641 O O     . LEU A 1 202 ? 5.662   15.471  27.468  1.00 20.64 ? 202  LEU A O     1 
ATOM   1642 C CB    . LEU A 1 202 ? 3.782   17.753  29.073  1.00 26.50 ? 202  LEU A CB    1 
ATOM   1643 C CG    . LEU A 1 202 ? 4.190   16.918  30.288  1.00 26.88 ? 202  LEU A CG    1 
ATOM   1644 C CD1   . LEU A 1 202 ? 5.621   17.238  30.679  1.00 27.53 ? 202  LEU A CD1   1 
ATOM   1645 C CD2   . LEU A 1 202 ? 3.240   17.214  31.435  1.00 25.17 ? 202  LEU A CD2   1 
ATOM   1646 N N     . TRP A 1 203 ? 3.532   15.657  26.789  1.00 21.76 ? 203  TRP A N     1 
ATOM   1647 C CA    . TRP A 1 203 ? 3.449   14.279  26.323  1.00 23.50 ? 203  TRP A CA    1 
ATOM   1648 C C     . TRP A 1 203 ? 4.554   14.039  25.306  1.00 23.12 ? 203  TRP A C     1 
ATOM   1649 O O     . TRP A 1 203 ? 5.230   13.011  25.335  1.00 23.14 ? 203  TRP A O     1 
ATOM   1650 C CB    . TRP A 1 203 ? 2.079   14.021  25.685  1.00 23.99 ? 203  TRP A CB    1 
ATOM   1651 C CG    . TRP A 1 203 ? 1.906   12.656  25.087  1.00 27.29 ? 203  TRP A CG    1 
ATOM   1652 C CD1   . TRP A 1 203 ? 1.318   12.362  23.894  1.00 27.70 ? 203  TRP A CD1   1 
ATOM   1653 C CD2   . TRP A 1 203 ? 2.293   11.397  25.664  1.00 29.19 ? 203  TRP A CD2   1 
ATOM   1654 N NE1   . TRP A 1 203 ? 1.314   11.005  23.688  1.00 29.69 ? 203  TRP A NE1   1 
ATOM   1655 C CE2   . TRP A 1 203 ? 1.905   10.389  24.757  1.00 29.33 ? 203  TRP A CE2   1 
ATOM   1656 C CE3   . TRP A 1 203 ? 2.929   11.026  26.855  1.00 28.63 ? 203  TRP A CE3   1 
ATOM   1657 C CZ2   . TRP A 1 203 ? 2.129   9.033   25.006  1.00 30.02 ? 203  TRP A CZ2   1 
ATOM   1658 C CZ3   . TRP A 1 203 ? 3.151   9.682   27.100  1.00 28.64 ? 203  TRP A CZ3   1 
ATOM   1659 C CH2   . TRP A 1 203 ? 2.753   8.701   26.179  1.00 29.76 ? 203  TRP A CH2   1 
ATOM   1660 N N     . TYR A 1 204 ? 4.742   14.998  24.406  1.00 22.00 ? 204  TYR A N     1 
ATOM   1661 C CA    . TYR A 1 204 ? 5.781   14.871  23.398  1.00 21.68 ? 204  TYR A CA    1 
ATOM   1662 C C     . TYR A 1 204 ? 7.139   14.634  24.045  1.00 21.24 ? 204  TYR A C     1 
ATOM   1663 O O     . TYR A 1 204 ? 7.882   13.731  23.656  1.00 23.09 ? 204  TYR A O     1 
ATOM   1664 C CB    . TYR A 1 204 ? 5.878   16.135  22.535  1.00 21.42 ? 204  TYR A CB    1 
ATOM   1665 C CG    . TYR A 1 204 ? 7.036   16.064  21.558  1.00 22.71 ? 204  TYR A CG    1 
ATOM   1666 C CD1   . TYR A 1 204 ? 6.946   15.297  20.401  1.00 21.22 ? 204  TYR A CD1   1 
ATOM   1667 C CD2   . TYR A 1 204 ? 8.249   16.698  21.833  1.00 22.13 ? 204  TYR A CD2   1 
ATOM   1668 C CE1   . TYR A 1 204 ? 8.025   15.155  19.548  1.00 23.60 ? 204  TYR A CE1   1 
ATOM   1669 C CE2   . TYR A 1 204 ? 9.345   16.560  20.980  1.00 21.89 ? 204  TYR A CE2   1 
ATOM   1670 C CZ    . TYR A 1 204 ? 9.224   15.786  19.841  1.00 23.28 ? 204  TYR A CZ    1 
ATOM   1671 O OH    . TYR A 1 204 ? 10.297  15.622  18.993  1.00 24.51 ? 204  TYR A OH    1 
ATOM   1672 N N     . TRP A 1 205 ? 7.467   15.452  25.035  1.00 20.06 ? 205  TRP A N     1 
ATOM   1673 C CA    . TRP A 1 205 ? 8.760   15.333  25.688  1.00 20.13 ? 205  TRP A CA    1 
ATOM   1674 C C     . TRP A 1 205 ? 8.942   14.117  26.581  1.00 18.99 ? 205  TRP A C     1 
ATOM   1675 O O     . TRP A 1 205 ? 10.063  13.624  26.745  1.00 19.29 ? 205  TRP A O     1 
ATOM   1676 C CB    . TRP A 1 205 ? 9.068   16.626  26.428  1.00 18.63 ? 205  TRP A CB    1 
ATOM   1677 C CG    . TRP A 1 205 ? 9.357   17.719  25.454  1.00 21.83 ? 205  TRP A CG    1 
ATOM   1678 C CD1   . TRP A 1 205 ? 8.606   18.832  25.218  1.00 22.30 ? 205  TRP A CD1   1 
ATOM   1679 C CD2   . TRP A 1 205 ? 10.482  17.794  24.565  1.00 21.67 ? 205  TRP A CD2   1 
ATOM   1680 N NE1   . TRP A 1 205 ? 9.195   19.600  24.242  1.00 25.00 ? 205  TRP A NE1   1 
ATOM   1681 C CE2   . TRP A 1 205 ? 10.346  18.987  23.823  1.00 22.23 ? 205  TRP A CE2   1 
ATOM   1682 C CE3   . TRP A 1 205 ? 11.593  16.968  24.328  1.00 21.09 ? 205  TRP A CE3   1 
ATOM   1683 C CZ2   . TRP A 1 205 ? 11.284  19.382  22.856  1.00 23.92 ? 205  TRP A CZ2   1 
ATOM   1684 C CZ3   . TRP A 1 205 ? 12.529  17.359  23.366  1.00 22.70 ? 205  TRP A CZ3   1 
ATOM   1685 C CH2   . TRP A 1 205 ? 12.366  18.558  22.641  1.00 22.63 ? 205  TRP A CH2   1 
ATOM   1686 N N     . ILE A 1 206 ? 7.851   13.625  27.154  1.00 19.17 ? 206  ILE A N     1 
ATOM   1687 C CA    . ILE A 1 206 ? 7.929   12.433  27.991  1.00 19.03 ? 206  ILE A CA    1 
ATOM   1688 C C     . ILE A 1 206 ? 8.428   11.300  27.094  1.00 18.50 ? 206  ILE A C     1 
ATOM   1689 O O     . ILE A 1 206 ? 9.355   10.573  27.445  1.00 18.20 ? 206  ILE A O     1 
ATOM   1690 C CB    . ILE A 1 206 ? 6.545   12.075  28.568  1.00 16.77 ? 206  ILE A CB    1 
ATOM   1691 C CG1   . ILE A 1 206 ? 6.168   13.092  29.641  1.00 16.10 ? 206  ILE A CG1   1 
ATOM   1692 C CG2   . ILE A 1 206 ? 6.554   10.662  29.137  1.00 15.78 ? 206  ILE A CG2   1 
ATOM   1693 C CD1   . ILE A 1 206 ? 4.739   13.004  30.086  1.00 18.90 ? 206  ILE A CD1   1 
ATOM   1694 N N     . LYS A 1 207 ? 7.817   11.185  25.920  1.00 19.80 ? 207  LYS A N     1 
ATOM   1695 C CA    . LYS A 1 207 ? 8.173   10.161  24.949  1.00 20.06 ? 207  LYS A CA    1 
ATOM   1696 C C     . LYS A 1 207 ? 9.598   10.333  24.446  1.00 20.16 ? 207  LYS A C     1 
ATOM   1697 O O     . LYS A 1 207 ? 10.368  9.370   24.372  1.00 19.18 ? 207  LYS A O     1 
ATOM   1698 C CB    . LYS A 1 207 ? 7.198   10.209  23.775  1.00 22.63 ? 207  LYS A CB    1 
ATOM   1699 C CG    . LYS A 1 207 ? 5.780   9.818   24.150  1.00 27.47 ? 207  LYS A CG    1 
ATOM   1700 C CD    . LYS A 1 207 ? 4.863   9.767   22.943  1.00 28.81 ? 207  LYS A CD    1 
ATOM   1701 C CE    . LYS A 1 207 ? 4.585   11.156  22.389  1.00 32.67 ? 207  LYS A CE    1 
ATOM   1702 N NZ    . LYS A 1 207 ? 3.708   11.083  21.180  1.00 34.34 ? 207  LYS A NZ    1 
ATOM   1703 N N     . TYR A 1 208 ? 9.944   11.569  24.098  1.00 19.71 ? 208  TYR A N     1 
ATOM   1704 C CA    . TYR A 1 208 ? 11.279  11.891  23.604  1.00 18.17 ? 208  TYR A CA    1 
ATOM   1705 C C     . TYR A 1 208 ? 12.363  11.521  24.620  1.00 18.40 ? 208  TYR A C     1 
ATOM   1706 O O     . TYR A 1 208 ? 13.353  10.864  24.285  1.00 17.59 ? 208  TYR A O     1 
ATOM   1707 C CB    . TYR A 1 208 ? 11.367  13.387  23.317  1.00 20.29 ? 208  TYR A CB    1 
ATOM   1708 C CG    . TYR A 1 208 ? 12.628  13.813  22.617  1.00 22.82 ? 208  TYR A CG    1 
ATOM   1709 C CD1   . TYR A 1 208 ? 12.652  13.980  21.234  1.00 25.86 ? 208  TYR A CD1   1 
ATOM   1710 C CD2   . TYR A 1 208 ? 13.795  14.066  23.334  1.00 25.33 ? 208  TYR A CD2   1 
ATOM   1711 C CE1   . TYR A 1 208 ? 13.808  14.398  20.580  1.00 27.57 ? 208  TYR A CE1   1 
ATOM   1712 C CE2   . TYR A 1 208 ? 14.959  14.483  22.690  1.00 25.97 ? 208  TYR A CE2   1 
ATOM   1713 C CZ    . TYR A 1 208 ? 14.956  14.649  21.314  1.00 27.22 ? 208  TYR A CZ    1 
ATOM   1714 O OH    . TYR A 1 208 ? 16.092  15.076  20.666  1.00 29.42 ? 208  TYR A OH    1 
ATOM   1715 N N     . GLU A 1 209 ? 12.180  11.961  25.862  1.00 17.86 ? 209  GLU A N     1 
ATOM   1716 C CA    . GLU A 1 209 ? 13.156  11.696  26.914  1.00 17.71 ? 209  GLU A CA    1 
ATOM   1717 C C     . GLU A 1 209 ? 13.259  10.234  27.331  1.00 16.91 ? 209  GLU A C     1 
ATOM   1718 O O     . GLU A 1 209 ? 14.366  9.730   27.528  1.00 14.79 ? 209  GLU A O     1 
ATOM   1719 C CB    . GLU A 1 209 ? 12.870  12.568  28.137  1.00 19.25 ? 209  GLU A CB    1 
ATOM   1720 C CG    . GLU A 1 209 ? 13.247  14.030  27.961  1.00 23.05 ? 209  GLU A CG    1 
ATOM   1721 C CD    . GLU A 1 209 ? 14.722  14.218  27.632  1.00 26.43 ? 209  GLU A CD    1 
ATOM   1722 O OE1   . GLU A 1 209 ? 15.046  14.407  26.444  1.00 29.80 ? 209  GLU A OE1   1 
ATOM   1723 O OE2   . GLU A 1 209 ? 15.562  14.167  28.555  1.00 26.50 ? 209  GLU A OE2   1 
ATOM   1724 N N     . THR A 1 210 ? 12.125  9.546   27.461  1.00 15.16 ? 210  THR A N     1 
ATOM   1725 C CA    . THR A 1 210 ? 12.171  8.135   27.848  1.00 16.40 ? 210  THR A CA    1 
ATOM   1726 C C     . THR A 1 210 ? 12.838  7.305   26.755  1.00 17.98 ? 210  THR A C     1 
ATOM   1727 O O     . THR A 1 210 ? 13.657  6.422   27.039  1.00 17.90 ? 210  THR A O     1 
ATOM   1728 C CB    . THR A 1 210 ? 10.753  7.555   28.139  1.00 17.12 ? 210  THR A CB    1 
ATOM   1729 O OG1   . THR A 1 210 ? 9.871   7.831   27.045  1.00 17.11 ? 210  THR A OG1   1 
ATOM   1730 C CG2   . THR A 1 210 ? 10.180  8.169   29.409  1.00 18.66 ? 210  THR A CG2   1 
ATOM   1731 N N     . LYS A 1 211 ? 12.506  7.607   25.504  1.00 17.88 ? 211  LYS A N     1 
ATOM   1732 C CA    . LYS A 1 211 ? 13.077  6.880   24.380  1.00 19.74 ? 211  LYS A CA    1 
ATOM   1733 C C     . LYS A 1 211 ? 14.570  7.157   24.242  1.00 19.69 ? 211  LYS A C     1 
ATOM   1734 O O     . LYS A 1 211 ? 15.347  6.264   23.918  1.00 19.50 ? 211  LYS A O     1 
ATOM   1735 C CB    . LYS A 1 211 ? 12.355  7.245   23.078  1.00 19.08 ? 211  LYS A CB    1 
ATOM   1736 C CG    . LYS A 1 211 ? 12.910  6.510   21.866  1.00 22.91 ? 211  LYS A CG    1 
ATOM   1737 C CD    . LYS A 1 211 ? 11.982  6.614   20.669  1.00 25.65 ? 211  LYS A CD    1 
ATOM   1738 C CE    . LYS A 1 211 ? 12.505  5.795   19.495  1.00 23.58 ? 211  LYS A CE    1 
ATOM   1739 N NZ    . LYS A 1 211 ? 11.465  5.663   18.445  1.00 25.73 ? 211  LYS A NZ    1 
ATOM   1740 N N     . LEU A 1 212 ? 14.975  8.396   24.484  1.00 19.30 ? 212  LEU A N     1 
ATOM   1741 C CA    . LEU A 1 212 ? 16.387  8.734   24.391  1.00 19.48 ? 212  LEU A CA    1 
ATOM   1742 C C     . LEU A 1 212 ? 17.148  8.001   25.496  1.00 20.76 ? 212  LEU A C     1 
ATOM   1743 O O     . LEU A 1 212 ? 18.237  7.476   25.274  1.00 21.08 ? 212  LEU A O     1 
ATOM   1744 C CB    . LEU A 1 212 ? 16.587  10.239  24.558  1.00 19.26 ? 212  LEU A CB    1 
ATOM   1745 C CG    . LEU A 1 212 ? 18.053  10.672  24.609  1.00 19.68 ? 212  LEU A CG    1 
ATOM   1746 C CD1   . LEU A 1 212 ? 18.683  10.492  23.230  1.00 20.08 ? 212  LEU A CD1   1 
ATOM   1747 C CD2   . LEU A 1 212 ? 18.146  12.126  25.061  1.00 20.19 ? 212  LEU A CD2   1 
ATOM   1748 N N     . ALA A 1 213 ? 16.563  7.981   26.691  1.00 19.22 ? 213  ALA A N     1 
ATOM   1749 C CA    . ALA A 1 213 ? 17.171  7.327   27.838  1.00 18.43 ? 213  ALA A CA    1 
ATOM   1750 C C     . ALA A 1 213 ? 17.304  5.833   27.580  1.00 17.25 ? 213  ALA A C     1 
ATOM   1751 O O     . ALA A 1 213 ? 18.339  5.235   27.846  1.00 16.50 ? 213  ALA A O     1 
ATOM   1752 C CB    . ALA A 1 213 ? 16.326  7.566   29.081  1.00 18.56 ? 213  ALA A CB    1 
ATOM   1753 N N     . TYR A 1 214 ? 16.244  5.241   27.055  1.00 18.99 ? 214  TYR A N     1 
ATOM   1754 C CA    . TYR A 1 214 ? 16.231  3.815   26.764  1.00 19.20 ? 214  TYR A CA    1 
ATOM   1755 C C     . TYR A 1 214 ? 17.301  3.482   25.733  1.00 19.67 ? 214  TYR A C     1 
ATOM   1756 O O     . TYR A 1 214 ? 18.012  2.495   25.886  1.00 18.26 ? 214  TYR A O     1 
ATOM   1757 C CB    . TYR A 1 214 ? 14.839  3.408   26.264  1.00 17.01 ? 214  TYR A CB    1 
ATOM   1758 C CG    . TYR A 1 214 ? 14.714  1.983   25.774  1.00 17.18 ? 214  TYR A CG    1 
ATOM   1759 C CD1   . TYR A 1 214 ? 14.820  0.898   26.646  1.00 15.67 ? 214  TYR A CD1   1 
ATOM   1760 C CD2   . TYR A 1 214 ? 14.462  1.722   24.429  1.00 15.46 ? 214  TYR A CD2   1 
ATOM   1761 C CE1   . TYR A 1 214 ? 14.672  -0.413  26.184  1.00 14.32 ? 214  TYR A CE1   1 
ATOM   1762 C CE2   . TYR A 1 214 ? 14.317  0.434   23.966  1.00 16.98 ? 214  TYR A CE2   1 
ATOM   1763 C CZ    . TYR A 1 214 ? 14.419  -0.629  24.837  1.00 16.02 ? 214  TYR A CZ    1 
ATOM   1764 O OH    . TYR A 1 214 ? 14.250  -1.896  24.335  1.00 17.88 ? 214  TYR A OH    1 
ATOM   1765 N N     . ASP A 1 215 ? 17.434  4.314   24.699  1.00 21.26 ? 215  ASP A N     1 
ATOM   1766 C CA    . ASP A 1 215 ? 18.437  4.064   23.660  1.00 22.89 ? 215  ASP A CA    1 
ATOM   1767 C C     . ASP A 1 215 ? 19.881  4.290   24.098  1.00 23.64 ? 215  ASP A C     1 
ATOM   1768 O O     . ASP A 1 215 ? 20.810  3.862   23.415  1.00 22.81 ? 215  ASP A O     1 
ATOM   1769 C CB    . ASP A 1 215 ? 18.171  4.918   22.417  1.00 24.41 ? 215  ASP A CB    1 
ATOM   1770 C CG    . ASP A 1 215 ? 16.876  4.552   21.725  1.00 25.15 ? 215  ASP A CG    1 
ATOM   1771 O OD1   . ASP A 1 215 ? 16.420  3.397   21.883  1.00 26.45 ? 215  ASP A OD1   1 
ATOM   1772 O OD2   . ASP A 1 215 ? 16.325  5.418   21.014  1.00 27.16 ? 215  ASP A OD2   1 
ATOM   1773 N N     . SER A 1 216 ? 20.078  4.943   25.236  1.00 23.45 ? 216  SER A N     1 
ATOM   1774 C CA    . SER A 1 216 ? 21.427  5.209   25.713  1.00 26.04 ? 216  SER A CA    1 
ATOM   1775 C C     . SER A 1 216 ? 22.189  3.973   26.174  1.00 28.20 ? 216  SER A C     1 
ATOM   1776 O O     . SER A 1 216 ? 21.596  2.950   26.522  1.00 27.17 ? 216  SER A O     1 
ATOM   1777 C CB    . SER A 1 216 ? 21.381  6.248   26.827  1.00 25.71 ? 216  SER A CB    1 
ATOM   1778 O OG    . SER A 1 216 ? 20.899  7.467   26.300  1.00 26.12 ? 216  SER A OG    1 
ATOM   1779 N N     . ASN A 1 217 ? 23.515  4.077   26.171  1.00 31.20 ? 217  ASN A N     1 
ATOM   1780 C CA    . ASN A 1 217 ? 24.370  2.969   26.571  1.00 34.55 ? 217  ASN A CA    1 
ATOM   1781 C C     . ASN A 1 217 ? 25.087  3.208   27.887  1.00 36.95 ? 217  ASN A C     1 
ATOM   1782 O O     . ASN A 1 217 ? 25.631  2.276   28.479  1.00 38.05 ? 217  ASN A O     1 
ATOM   1783 C CB    . ASN A 1 217 ? 25.407  2.679   25.481  1.00 34.73 ? 217  ASN A CB    1 
ATOM   1784 C CG    . ASN A 1 217 ? 24.799  2.021   24.263  1.00 37.34 ? 217  ASN A CG    1 
ATOM   1785 O OD1   . ASN A 1 217 ? 24.185  0.960   24.363  1.00 37.53 ? 217  ASN A OD1   1 
ATOM   1786 N ND2   . ASN A 1 217 ? 24.965  2.647   23.104  1.00 39.17 ? 217  ASN A ND2   1 
ATOM   1787 N N     . HIS A 1 218 ? 25.097  4.447   28.360  1.00 38.20 ? 218  HIS A N     1 
ATOM   1788 C CA    . HIS A 1 218 ? 25.791  4.711   29.608  1.00 40.02 ? 218  HIS A CA    1 
ATOM   1789 C C     . HIS A 1 218 ? 25.375  5.977   30.333  1.00 39.54 ? 218  HIS A C     1 
ATOM   1790 O O     . HIS A 1 218 ? 26.176  6.895   30.503  1.00 39.00 ? 218  HIS A O     1 
ATOM   1791 C CB    . HIS A 1 218 ? 27.306  4.715   29.361  1.00 42.38 ? 218  HIS A CB    1 
ATOM   1792 C CG    . HIS A 1 218 ? 27.710  5.422   28.104  1.00 43.90 ? 218  HIS A CG    1 
ATOM   1793 N ND1   . HIS A 1 218 ? 27.558  6.781   27.931  1.00 44.88 ? 218  HIS A ND1   1 
ATOM   1794 C CD2   . HIS A 1 218 ? 28.226  4.950   26.945  1.00 43.47 ? 218  HIS A CD2   1 
ATOM   1795 C CE1   . HIS A 1 218 ? 27.961  7.116   26.718  1.00 44.62 ? 218  HIS A CE1   1 
ATOM   1796 N NE2   . HIS A 1 218 ? 28.370  6.023   26.099  1.00 45.18 ? 218  HIS A NE2   1 
ATOM   1797 N N     . ILE A 1 219 ? 24.118  6.019   30.767  1.00 38.72 ? 219  ILE A N     1 
ATOM   1798 C CA    . ILE A 1 219 ? 23.618  7.172   31.504  1.00 37.85 ? 219  ILE A CA    1 
ATOM   1799 C C     . ILE A 1 219 ? 24.262  7.121   32.886  1.00 36.32 ? 219  ILE A C     1 
ATOM   1800 O O     . ILE A 1 219 ? 24.480  8.155   33.514  1.00 35.29 ? 219  ILE A O     1 
ATOM   1801 C CB    . ILE A 1 219 ? 22.078  7.134   31.658  1.00 39.03 ? 219  ILE A CB    1 
ATOM   1802 C CG1   . ILE A 1 219 ? 21.412  7.267   30.286  1.00 39.55 ? 219  ILE A CG1   1 
ATOM   1803 C CG2   . ILE A 1 219 ? 21.617  8.261   32.572  1.00 39.01 ? 219  ILE A CG2   1 
ATOM   1804 C CD1   . ILE A 1 219 ? 19.900  7.246   30.342  1.00 40.14 ? 219  ILE A CD1   1 
ATOM   1805 N N     . GLY A 1 220 ? 24.557  5.909   33.357  1.00 34.12 ? 220  GLY A N     1 
ATOM   1806 C CA    . GLY A 1 220 ? 25.201  5.767   34.650  1.00 33.80 ? 220  GLY A CA    1 
ATOM   1807 C C     . GLY A 1 220 ? 24.509  4.985   35.758  1.00 33.02 ? 220  GLY A C     1 
ATOM   1808 O O     . GLY A 1 220 ? 25.094  4.802   36.821  1.00 33.40 ? 220  GLY A O     1 
ATOM   1809 N N     . TYR A 1 221 ? 23.290  4.507   35.538  1.00 32.16 ? 221  TYR A N     1 
ATOM   1810 C CA    . TYR A 1 221 ? 22.603  3.774   36.596  1.00 31.52 ? 221  TYR A CA    1 
ATOM   1811 C C     . TYR A 1 221 ? 22.493  2.262   36.393  1.00 31.29 ? 221  TYR A C     1 
ATOM   1812 O O     . TYR A 1 221 ? 21.727  1.585   37.078  1.00 32.19 ? 221  TYR A O     1 
ATOM   1813 C CB    . TYR A 1 221 ? 21.230  4.403   36.843  1.00 31.53 ? 221  TYR A CB    1 
ATOM   1814 C CG    . TYR A 1 221 ? 21.351  5.869   37.201  1.00 33.98 ? 221  TYR A CG    1 
ATOM   1815 C CD1   . TYR A 1 221 ? 21.155  6.861   36.239  1.00 32.95 ? 221  TYR A CD1   1 
ATOM   1816 C CD2   . TYR A 1 221 ? 21.730  6.264   38.490  1.00 33.51 ? 221  TYR A CD2   1 
ATOM   1817 C CE1   . TYR A 1 221 ? 21.332  8.209   36.549  1.00 36.91 ? 221  TYR A CE1   1 
ATOM   1818 C CE2   . TYR A 1 221 ? 21.910  7.609   38.809  1.00 35.67 ? 221  TYR A CE2   1 
ATOM   1819 C CZ    . TYR A 1 221 ? 21.708  8.574   37.836  1.00 36.90 ? 221  TYR A CZ    1 
ATOM   1820 O OH    . TYR A 1 221 ? 21.858  9.904   38.151  1.00 40.03 ? 221  TYR A OH    1 
ATOM   1821 N N     . MET A 1 222 ? 23.266  1.743   35.446  1.00 30.08 ? 222  MET A N     1 
ATOM   1822 C CA    . MET A 1 222 ? 23.314  0.312   35.178  1.00 29.65 ? 222  MET A CA    1 
ATOM   1823 C C     . MET A 1 222 ? 24.685  0.060   34.577  1.00 29.23 ? 222  MET A C     1 
ATOM   1824 O O     . MET A 1 222 ? 24.826  -0.504  33.496  1.00 28.95 ? 222  MET A O     1 
ATOM   1825 C CB    . MET A 1 222 ? 22.185  -0.124  34.234  1.00 29.14 ? 222  MET A CB    1 
ATOM   1826 C CG    . MET A 1 222 ? 22.186  0.477   32.845  1.00 29.91 ? 222  MET A CG    1 
ATOM   1827 S SD    . MET A 1 222 ? 20.642  0.062   31.957  1.00 32.43 ? 222  MET A SD    1 
ATOM   1828 C CE    . MET A 1 222 ? 21.016  -1.628  31.411  1.00 24.63 ? 222  MET A CE    1 
ATOM   1829 N N     . VAL A 1 223 ? 25.698  0.496   35.316  1.00 29.20 ? 223  VAL A N     1 
ATOM   1830 C CA    . VAL A 1 223 ? 27.081  0.378   34.900  1.00 31.20 ? 223  VAL A CA    1 
ATOM   1831 C C     . VAL A 1 223 ? 27.559  -1.062  34.760  1.00 31.33 ? 223  VAL A C     1 
ATOM   1832 O O     . VAL A 1 223 ? 28.429  -1.349  33.939  1.00 31.86 ? 223  VAL A O     1 
ATOM   1833 C CB    . VAL A 1 223 ? 28.006  1.131   35.882  1.00 33.80 ? 223  VAL A CB    1 
ATOM   1834 C CG1   . VAL A 1 223 ? 27.959  0.468   37.257  1.00 33.71 ? 223  VAL A CG1   1 
ATOM   1835 C CG2   . VAL A 1 223 ? 29.433  1.166   35.334  1.00 34.42 ? 223  VAL A CG2   1 
ATOM   1836 N N     . ASN A 1 224 ? 26.985  -1.968  35.545  1.00 31.61 ? 224  ASN A N     1 
ATOM   1837 C CA    . ASN A 1 224 ? 27.378  -3.373  35.487  1.00 30.86 ? 224  ASN A CA    1 
ATOM   1838 C C     . ASN A 1 224 ? 26.975  -4.079  34.191  1.00 31.59 ? 224  ASN A C     1 
ATOM   1839 O O     . ASN A 1 224 ? 27.390  -5.217  33.951  1.00 31.80 ? 224  ASN A O     1 
ATOM   1840 C CB    . ASN A 1 224 ? 26.805  -4.133  36.689  1.00 31.80 ? 224  ASN A CB    1 
ATOM   1841 C CG    . ASN A 1 224 ? 27.554  -3.840  37.986  1.00 31.62 ? 224  ASN A CG    1 
ATOM   1842 O OD1   . ASN A 1 224 ? 27.083  -4.172  39.071  1.00 30.98 ? 224  ASN A OD1   1 
ATOM   1843 N ND2   . ASN A 1 224 ? 28.729  -3.225  37.873  1.00 29.77 ? 224  ASN A ND2   1 
ATOM   1844 N N     . LEU A 1 225 ? 26.176  -3.413  33.358  1.00 29.97 ? 225  LEU A N     1 
ATOM   1845 C CA    . LEU A 1 225 ? 25.735  -3.996  32.087  1.00 30.69 ? 225  LEU A CA    1 
ATOM   1846 C C     . LEU A 1 225 ? 25.997  -3.072  30.890  1.00 32.89 ? 225  LEU A C     1 
ATOM   1847 O O     . LEU A 1 225 ? 25.427  -3.257  29.811  1.00 31.77 ? 225  LEU A O     1 
ATOM   1848 C CB    . LEU A 1 225 ? 24.242  -4.333  32.144  1.00 25.08 ? 225  LEU A CB    1 
ATOM   1849 C CG    . LEU A 1 225 ? 23.830  -5.458  33.094  1.00 25.13 ? 225  LEU A CG    1 
ATOM   1850 C CD1   . LEU A 1 225 ? 22.332  -5.401  33.308  1.00 22.73 ? 225  LEU A CD1   1 
ATOM   1851 C CD2   . LEU A 1 225 ? 24.260  -6.815  32.529  1.00 22.29 ? 225  LEU A CD2   1 
ATOM   1852 N N     . GLU A 1 226 ? 26.860  -2.080  31.078  1.00 34.93 ? 226  GLU A N     1 
ATOM   1853 C CA    . GLU A 1 226 ? 27.158  -1.158  29.994  1.00 37.52 ? 226  GLU A CA    1 
ATOM   1854 C C     . GLU A 1 226 ? 27.772  -1.846  28.781  1.00 37.08 ? 226  GLU A C     1 
ATOM   1855 O O     . GLU A 1 226 ? 27.513  -1.454  27.647  1.00 37.89 ? 226  GLU A O     1 
ATOM   1856 C CB    . GLU A 1 226 ? 28.058  -0.028  30.489  1.00 38.75 ? 226  GLU A CB    1 
ATOM   1857 C CG    . GLU A 1 226 ? 27.270  1.218   30.832  1.00 41.93 ? 226  GLU A CG    1 
ATOM   1858 C CD    . GLU A 1 226 ? 28.125  2.299   31.441  1.00 44.96 ? 226  GLU A CD    1 
ATOM   1859 O OE1   . GLU A 1 226 ? 29.268  2.485   30.968  1.00 46.49 ? 226  GLU A OE1   1 
ATOM   1860 O OE2   . GLU A 1 226 ? 27.649  2.969   32.384  1.00 46.69 ? 226  GLU A OE2   1 
ATOM   1861 N N     . ASN A 1 227 ? 28.581  -2.873  29.002  1.00 37.02 ? 227  ASN A N     1 
ATOM   1862 C CA    . ASN A 1 227 ? 29.156  -3.568  27.864  1.00 36.36 ? 227  ASN A CA    1 
ATOM   1863 C C     . ASN A 1 227 ? 28.042  -4.272  27.107  1.00 34.50 ? 227  ASN A C     1 
ATOM   1864 O O     . ASN A 1 227 ? 28.014  -4.249  25.878  1.00 33.91 ? 227  ASN A O     1 
ATOM   1865 C CB    . ASN A 1 227 ? 30.220  -4.575  28.304  1.00 39.07 ? 227  ASN A CB    1 
ATOM   1866 C CG    . ASN A 1 227 ? 31.505  -3.900  28.756  1.00 43.20 ? 227  ASN A CG    1 
ATOM   1867 O OD1   . ASN A 1 227 ? 32.011  -2.993  28.088  1.00 45.71 ? 227  ASN A OD1   1 
ATOM   1868 N ND2   . ASN A 1 227 ? 32.042  -4.342  29.888  1.00 45.55 ? 227  ASN A ND2   1 
ATOM   1869 N N     . GLU A 1 228 ? 27.113  -4.878  27.845  1.00 32.61 ? 228  GLU A N     1 
ATOM   1870 C CA    . GLU A 1 228 ? 25.990  -5.585  27.230  1.00 31.43 ? 228  GLU A CA    1 
ATOM   1871 C C     . GLU A 1 228 ? 25.026  -4.631  26.530  1.00 29.44 ? 228  GLU A C     1 
ATOM   1872 O O     . GLU A 1 228 ? 24.447  -4.979  25.506  1.00 28.14 ? 228  GLU A O     1 
ATOM   1873 C CB    . GLU A 1 228 ? 25.222  -6.402  28.278  1.00 33.97 ? 228  GLU A CB    1 
ATOM   1874 C CG    . GLU A 1 228 ? 26.064  -7.437  29.021  1.00 37.96 ? 228  GLU A CG    1 
ATOM   1875 C CD    . GLU A 1 228 ? 26.909  -8.282  28.088  1.00 41.23 ? 228  GLU A CD    1 
ATOM   1876 O OE1   . GLU A 1 228 ? 26.410  -8.652  27.003  1.00 43.37 ? 228  GLU A OE1   1 
ATOM   1877 O OE2   . GLU A 1 228 ? 28.070  -8.586  28.439  1.00 43.67 ? 228  GLU A OE2   1 
ATOM   1878 N N     . SER A 1 229 ? 24.855  -3.436  27.094  1.00 28.70 ? 229  SER A N     1 
ATOM   1879 C CA    . SER A 1 229 ? 23.967  -2.415  26.532  1.00 29.32 ? 229  SER A CA    1 
ATOM   1880 C C     . SER A 1 229 ? 24.265  -2.117  25.071  1.00 28.68 ? 229  SER A C     1 
ATOM   1881 O O     . SER A 1 229 ? 23.354  -1.964  24.259  1.00 28.49 ? 229  SER A O     1 
ATOM   1882 C CB    . SER A 1 229 ? 24.087  -1.100  27.310  1.00 28.93 ? 229  SER A CB    1 
ATOM   1883 O OG    . SER A 1 229 ? 23.580  -1.219  28.622  1.00 35.65 ? 229  SER A OG    1 
ATOM   1884 N N     . SER A 1 230 ? 25.548  -2.016  24.752  1.00 29.00 ? 230  SER A N     1 
ATOM   1885 C CA    . SER A 1 230 ? 25.981  -1.705  23.397  1.00 32.44 ? 230  SER A CA    1 
ATOM   1886 C C     . SER A 1 230 ? 26.019  -2.914  22.474  1.00 32.35 ? 230  SER A C     1 
ATOM   1887 O O     . SER A 1 230 ? 26.326  -2.786  21.295  1.00 34.48 ? 230  SER A O     1 
ATOM   1888 C CB    . SER A 1 230 ? 27.364  -1.048  23.437  1.00 32.43 ? 230  SER A CB    1 
ATOM   1889 O OG    . SER A 1 230 ? 28.289  -1.859  24.149  1.00 35.21 ? 230  SER A OG    1 
ATOM   1890 N N     . LYS A 1 231 ? 25.715  -4.090  23.007  1.00 32.40 ? 231  LYS A N     1 
ATOM   1891 C CA    . LYS A 1 231 ? 25.725  -5.293  22.189  1.00 31.71 ? 231  LYS A CA    1 
ATOM   1892 C C     . LYS A 1 231 ? 24.320  -5.812  21.956  1.00 30.04 ? 231  LYS A C     1 
ATOM   1893 O O     . LYS A 1 231 ? 24.132  -6.916  21.459  1.00 30.79 ? 231  LYS A O     1 
ATOM   1894 C CB    . LYS A 1 231 ? 26.583  -6.383  22.836  1.00 34.38 ? 231  LYS A CB    1 
ATOM   1895 C CG    . LYS A 1 231 ? 28.058  -6.022  22.948  1.00 37.40 ? 231  LYS A CG    1 
ATOM   1896 C CD    . LYS A 1 231 ? 28.914  -7.242  23.292  1.00 41.14 ? 231  LYS A CD    1 
ATOM   1897 C CE    . LYS A 1 231 ? 28.485  -7.891  24.604  1.00 43.58 ? 231  LYS A CE    1 
ATOM   1898 N NZ    . LYS A 1 231 ? 28.607  -6.958  25.760  1.00 45.11 ? 231  LYS A NZ    1 
ATOM   1899 N N     . ILE A 1 232 ? 23.326  -5.020  22.335  1.00 28.71 ? 232  ILE A N     1 
ATOM   1900 C CA    . ILE A 1 232 ? 21.941  -5.412  22.120  1.00 26.39 ? 232  ILE A CA    1 
ATOM   1901 C C     . ILE A 1 232 ? 21.211  -4.232  21.496  1.00 25.21 ? 232  ILE A C     1 
ATOM   1902 O O     . ILE A 1 232 ? 21.567  -3.078  21.733  1.00 24.13 ? 232  ILE A O     1 
ATOM   1903 C CB    . ILE A 1 232 ? 21.238  -5.818  23.445  1.00 26.18 ? 232  ILE A CB    1 
ATOM   1904 C CG1   . ILE A 1 232 ? 19.862  -6.418  23.136  1.00 24.73 ? 232  ILE A CG1   1 
ATOM   1905 C CG2   . ILE A 1 232 ? 21.089  -4.609  24.360  1.00 25.23 ? 232  ILE A CG2   1 
ATOM   1906 C CD1   . ILE A 1 232 ? 19.171  -7.026  24.338  1.00 22.39 ? 232  ILE A CD1   1 
ATOM   1907 N N     . GLY A 1 233 ? 20.198  -4.523  20.692  1.00 25.01 ? 233  GLY A N     1 
ATOM   1908 C CA    . GLY A 1 233 ? 19.447  -3.457  20.056  1.00 27.14 ? 233  GLY A CA    1 
ATOM   1909 C C     . GLY A 1 233 ? 18.453  -2.815  21.009  1.00 26.57 ? 233  GLY A C     1 
ATOM   1910 O O     . GLY A 1 233 ? 18.584  -2.930  22.226  1.00 27.04 ? 233  GLY A O     1 
ATOM   1911 N N     . ARG A 1 234 ? 17.461  -2.131  20.453  1.00 23.91 ? 234  ARG A N     1 
ATOM   1912 C CA    . ARG A 1 234 ? 16.436  -1.481  21.257  1.00 24.31 ? 234  ARG A CA    1 
ATOM   1913 C C     . ARG A 1 234 ? 15.083  -1.660  20.587  1.00 24.63 ? 234  ARG A C     1 
ATOM   1914 O O     . ARG A 1 234 ? 14.971  -1.520  19.371  1.00 25.02 ? 234  ARG A O     1 
ATOM   1915 C CB    . ARG A 1 234 ? 16.728  0.019   21.393  1.00 24.10 ? 234  ARG A CB    1 
ATOM   1916 C CG    . ARG A 1 234 ? 18.048  0.364   22.065  1.00 21.01 ? 234  ARG A CG    1 
ATOM   1917 C CD    . ARG A 1 234 ? 18.090  -0.133  23.493  1.00 18.50 ? 234  ARG A CD    1 
ATOM   1918 N NE    . ARG A 1 234 ? 19.204  0.453   24.229  1.00 17.72 ? 234  ARG A NE    1 
ATOM   1919 C CZ    . ARG A 1 234 ? 20.449  -0.014  24.233  1.00 17.11 ? 234  ARG A CZ    1 
ATOM   1920 N NH1   . ARG A 1 234 ? 20.775  -1.097  23.539  1.00 13.86 ? 234  ARG A NH1   1 
ATOM   1921 N NH2   . ARG A 1 234 ? 21.372  0.611   24.945  1.00 18.16 ? 234  ARG A NH2   1 
ATOM   1922 N N     . LYS A 1 235 ? 14.058  -1.992  21.367  1.00 26.04 ? 235  LYS A N     1 
ATOM   1923 C CA    . LYS A 1 235 ? 12.728  -2.142  20.803  1.00 26.05 ? 235  LYS A CA    1 
ATOM   1924 C C     . LYS A 1 235 ? 12.348  -0.737  20.367  1.00 27.40 ? 235  LYS A C     1 
ATOM   1925 O O     . LYS A 1 235 ? 12.741  0.244   21.005  1.00 27.07 ? 235  LYS A O     1 
ATOM   1926 C CB    . LYS A 1 235 ? 11.738  -2.642  21.852  1.00 28.96 ? 235  LYS A CB    1 
ATOM   1927 C CG    . LYS A 1 235 ? 12.093  -3.988  22.467  1.00 34.65 ? 235  LYS A CG    1 
ATOM   1928 C CD    . LYS A 1 235 ? 12.173  -5.086  21.419  1.00 38.49 ? 235  LYS A CD    1 
ATOM   1929 C CE    . LYS A 1 235 ? 12.532  -6.429  22.053  1.00 42.12 ? 235  LYS A CE    1 
ATOM   1930 N NZ    . LYS A 1 235 ? 12.758  -7.499  21.036  1.00 42.35 ? 235  LYS A NZ    1 
ATOM   1931 N N     . ASN A 1 236 ? 11.585  -0.635  19.288  1.00 28.49 ? 236  ASN A N     1 
ATOM   1932 C CA    . ASN A 1 236 ? 11.188  0.663   18.766  1.00 28.46 ? 236  ASN A CA    1 
ATOM   1933 C C     . ASN A 1 236 ? 9.955   1.234   19.459  1.00 26.48 ? 236  ASN A C     1 
ATOM   1934 O O     . ASN A 1 236 ? 8.873   1.276   18.884  1.00 28.33 ? 236  ASN A O     1 
ATOM   1935 C CB    . ASN A 1 236 ? 10.957  0.551   17.255  1.00 31.93 ? 236  ASN A CB    1 
ATOM   1936 C CG    . ASN A 1 236 ? 10.941  1.898   16.567  1.00 35.89 ? 236  ASN A CG    1 
ATOM   1937 O OD1   . ASN A 1 236 ? 11.693  2.808   16.929  1.00 37.43 ? 236  ASN A OD1   1 
ATOM   1938 N ND2   . ASN A 1 236 ? 10.093  2.032   15.556  1.00 40.02 ? 236  ASN A ND2   1 
ATOM   1939 N N     . TYR A 1 237 ? 10.127  1.661   20.707  1.00 25.52 ? 237  TYR A N     1 
ATOM   1940 C CA    . TYR A 1 237 ? 9.037   2.251   21.478  1.00 23.45 ? 237  TYR A CA    1 
ATOM   1941 C C     . TYR A 1 237 ? 8.839   3.670   20.950  1.00 24.14 ? 237  TYR A C     1 
ATOM   1942 O O     . TYR A 1 237 ? 9.786   4.282   20.450  1.00 21.18 ? 237  TYR A O     1 
ATOM   1943 C CB    . TYR A 1 237 ? 9.384   2.283   22.974  1.00 23.13 ? 237  TYR A CB    1 
ATOM   1944 C CG    . TYR A 1 237 ? 9.474   0.919   23.618  1.00 22.64 ? 237  TYR A CG    1 
ATOM   1945 C CD1   . TYR A 1 237 ? 8.365   0.063   23.655  1.00 21.88 ? 237  TYR A CD1   1 
ATOM   1946 C CD2   . TYR A 1 237 ? 10.668  0.479   24.190  1.00 22.88 ? 237  TYR A CD2   1 
ATOM   1947 C CE1   . TYR A 1 237 ? 8.445   -1.196  24.244  1.00 23.54 ? 237  TYR A CE1   1 
ATOM   1948 C CE2   . TYR A 1 237 ? 10.761  -0.777  24.784  1.00 23.29 ? 237  TYR A CE2   1 
ATOM   1949 C CZ    . TYR A 1 237 ? 9.648   -1.611  24.808  1.00 25.49 ? 237  TYR A CZ    1 
ATOM   1950 O OH    . TYR A 1 237 ? 9.737   -2.860  25.389  1.00 26.55 ? 237  TYR A OH    1 
ATOM   1951 N N     . HIS A 1 238 ? 7.619   4.191   21.065  1.00 23.87 ? 238  HIS A N     1 
ATOM   1952 C CA    . HIS A 1 238 ? 7.319   5.521   20.549  1.00 25.02 ? 238  HIS A CA    1 
ATOM   1953 C C     . HIS A 1 238 ? 7.979   5.603   19.174  1.00 27.13 ? 238  HIS A C     1 
ATOM   1954 O O     . HIS A 1 238 ? 8.887   6.409   18.946  1.00 26.04 ? 238  HIS A O     1 
ATOM   1955 C CB    . HIS A 1 238 ? 7.897   6.604   21.456  1.00 22.51 ? 238  HIS A CB    1 
ATOM   1956 C CG    . HIS A 1 238 ? 7.432   6.524   22.873  1.00 18.84 ? 238  HIS A CG    1 
ATOM   1957 N ND1   . HIS A 1 238 ? 6.118   6.291   23.215  1.00 17.04 ? 238  HIS A ND1   1 
ATOM   1958 C CD2   . HIS A 1 238 ? 8.101   6.686   24.036  1.00 17.11 ? 238  HIS A CD2   1 
ATOM   1959 C CE1   . HIS A 1 238 ? 5.997   6.315   24.530  1.00 16.61 ? 238  HIS A CE1   1 
ATOM   1960 N NE2   . HIS A 1 238 ? 7.186   6.554   25.053  1.00 17.78 ? 238  HIS A NE2   1 
ATOM   1961 N N     . PRO A 1 239 ? 7.524   4.753   18.240  1.00 29.87 ? 239  PRO A N     1 
ATOM   1962 C CA    . PRO A 1 239 ? 8.014   4.648   16.859  1.00 32.54 ? 239  PRO A CA    1 
ATOM   1963 C C     . PRO A 1 239 ? 8.158   5.961   16.097  1.00 33.72 ? 239  PRO A C     1 
ATOM   1964 O O     . PRO A 1 239 ? 9.108   6.135   15.339  1.00 35.26 ? 239  PRO A O     1 
ATOM   1965 C CB    . PRO A 1 239 ? 6.980   3.744   16.192  1.00 32.30 ? 239  PRO A CB    1 
ATOM   1966 C CG    . PRO A 1 239 ? 6.498   2.883   17.312  1.00 32.29 ? 239  PRO A CG    1 
ATOM   1967 C CD    . PRO A 1 239 ? 6.357   3.874   18.441  1.00 31.04 ? 239  PRO A CD    1 
ATOM   1968 N N     . ASN A 1 240 ? 7.211   6.872   16.302  1.00 34.91 ? 240  ASN A N     1 
ATOM   1969 C CA    . ASN A 1 240 ? 7.185   8.154   15.601  1.00 38.31 ? 240  ASN A CA    1 
ATOM   1970 C C     . ASN A 1 240 ? 8.088   9.239   16.165  1.00 38.31 ? 240  ASN A C     1 
ATOM   1971 O O     . ASN A 1 240 ? 8.192   10.310  15.578  1.00 38.60 ? 240  ASN A O     1 
ATOM   1972 C CB    . ASN A 1 240 ? 5.744   8.689   15.554  1.00 39.14 ? 240  ASN A CB    1 
ATOM   1973 C CG    . ASN A 1 240 ? 4.783   7.727   14.875  1.00 41.42 ? 240  ASN A CG    1 
ATOM   1974 O OD1   . ASN A 1 240 ? 3.596   7.686   15.206  1.00 44.64 ? 240  ASN A OD1   1 
ATOM   1975 N ND2   . ASN A 1 240 ? 5.286   6.957   13.917  1.00 38.74 ? 240  ASN A ND2   1 
ATOM   1976 N N     . ILE A 1 241 ? 8.732   8.973   17.296  1.00 38.93 ? 241  ILE A N     1 
ATOM   1977 C CA    . ILE A 1 241 ? 9.611   9.960   17.919  1.00 38.42 ? 241  ILE A CA    1 
ATOM   1978 C C     . ILE A 1 241 ? 11.076  9.659   17.626  1.00 39.51 ? 241  ILE A C     1 
ATOM   1979 O O     . ILE A 1 241 ? 11.537  8.536   17.820  1.00 39.23 ? 241  ILE A O     1 
ATOM   1980 C CB    . ILE A 1 241 ? 9.407   9.995   19.449  1.00 38.72 ? 241  ILE A CB    1 
ATOM   1981 C CG1   . ILE A 1 241 ? 7.947   10.323  19.776  1.00 37.77 ? 241  ILE A CG1   1 
ATOM   1982 C CG2   . ILE A 1 241 ? 10.332  11.029  20.074  1.00 39.21 ? 241  ILE A CG2   1 
ATOM   1983 C CD1   . ILE A 1 241 ? 7.495   11.679  19.285  1.00 36.48 ? 241  ILE A CD1   1 
ATOM   1984 N N     . HIS A 1 242 ? 11.811  10.670  17.171  1.00 40.04 ? 242  HIS A N     1 
ATOM   1985 C CA    . HIS A 1 242 ? 13.217  10.480  16.839  1.00 41.92 ? 242  HIS A CA    1 
ATOM   1986 C C     . HIS A 1 242 ? 14.154  11.495  17.497  1.00 42.05 ? 242  HIS A C     1 
ATOM   1987 O O     . HIS A 1 242 ? 14.274  12.631  17.045  1.00 42.98 ? 242  HIS A O     1 
ATOM   1988 C CB    . HIS A 1 242 ? 13.389  10.527  15.320  1.00 43.33 ? 242  HIS A CB    1 
ATOM   1989 C CG    . HIS A 1 242 ? 12.451  9.622   14.585  1.00 45.62 ? 242  HIS A CG    1 
ATOM   1990 N ND1   . HIS A 1 242 ? 12.557  8.248   14.626  1.00 46.93 ? 242  HIS A ND1   1 
ATOM   1991 C CD2   . HIS A 1 242 ? 11.360  9.892   13.830  1.00 46.37 ? 242  HIS A CD2   1 
ATOM   1992 C CE1   . HIS A 1 242 ? 11.570  7.711   13.930  1.00 46.89 ? 242  HIS A CE1   1 
ATOM   1993 N NE2   . HIS A 1 242 ? 10.829  8.687   13.437  1.00 47.21 ? 242  HIS A NE2   1 
ATOM   1994 N N     . PRO A 1 243 ? 14.819  11.095  18.589  1.00 41.44 ? 243  PRO A N     1 
ATOM   1995 C CA    . PRO A 1 243 ? 15.748  11.985  19.290  1.00 41.48 ? 243  PRO A CA    1 
ATOM   1996 C C     . PRO A 1 243 ? 16.977  12.273  18.437  1.00 41.89 ? 243  PRO A C     1 
ATOM   1997 O O     . PRO A 1 243 ? 17.534  11.369  17.816  1.00 41.61 ? 243  PRO A O     1 
ATOM   1998 C CB    . PRO A 1 243 ? 16.096  11.197  20.547  1.00 40.50 ? 243  PRO A CB    1 
ATOM   1999 C CG    . PRO A 1 243 ? 14.836  10.424  20.805  1.00 41.28 ? 243  PRO A CG    1 
ATOM   2000 C CD    . PRO A 1 243 ? 14.488  9.928   19.423  1.00 41.56 ? 243  PRO A CD    1 
ATOM   2001 N N     . THR A 1 244 ? 17.402  13.531  18.414  1.00 42.80 ? 244  THR A N     1 
ATOM   2002 C CA    . THR A 1 244 ? 18.564  13.919  17.625  1.00 43.77 ? 244  THR A CA    1 
ATOM   2003 C C     . THR A 1 244 ? 19.871  13.428  18.246  1.00 44.27 ? 244  THR A C     1 
ATOM   2004 O O     . THR A 1 244 ? 20.743  12.919  17.540  1.00 44.59 ? 244  THR A O     1 
ATOM   2005 C CB    . THR A 1 244 ? 18.648  15.448  17.466  1.00 43.90 ? 244  THR A CB    1 
ATOM   2006 O OG1   . THR A 1 244 ? 19.086  16.034  18.697  1.00 44.08 ? 244  THR A OG1   1 
ATOM   2007 C CG2   . THR A 1 244 ? 17.285  16.016  17.102  1.00 44.39 ? 244  THR A CG2   1 
ATOM   2008 N N     . GLU A 1 245 ? 20.013  13.580  19.561  1.00 43.90 ? 245  GLU A N     1 
ATOM   2009 C CA    . GLU A 1 245 ? 21.234  13.142  20.220  1.00 44.57 ? 245  GLU A CA    1 
ATOM   2010 C C     . GLU A 1 245 ? 21.363  11.624  20.243  1.00 45.22 ? 245  GLU A C     1 
ATOM   2011 O O     . GLU A 1 245 ? 20.371  10.896  20.314  1.00 44.32 ? 245  GLU A O     1 
ATOM   2012 C CB    . GLU A 1 245 ? 21.335  13.716  21.641  1.00 44.74 ? 245  GLU A CB    1 
ATOM   2013 C CG    . GLU A 1 245 ? 20.074  13.670  22.484  1.00 46.84 ? 245  GLU A CG    1 
ATOM   2014 C CD    . GLU A 1 245 ? 19.077  14.764  22.130  1.00 47.60 ? 245  GLU A CD    1 
ATOM   2015 O OE1   . GLU A 1 245 ? 18.249  14.549  21.227  1.00 46.55 ? 245  GLU A OE1   1 
ATOM   2016 O OE2   . GLU A 1 245 ? 19.123  15.846  22.754  1.00 49.49 ? 245  GLU A OE2   1 
ATOM   2017 N N     . LYS A 1 246 ? 22.602  11.155  20.169  1.00 45.29 ? 246  LYS A N     1 
ATOM   2018 C CA    . LYS A 1 246 ? 22.884  9.729   20.156  1.00 47.17 ? 246  LYS A CA    1 
ATOM   2019 C C     . LYS A 1 246 ? 23.066  9.153   21.553  1.00 46.59 ? 246  LYS A C     1 
ATOM   2020 O O     . LYS A 1 246 ? 23.122  7.934   21.726  1.00 46.95 ? 246  LYS A O     1 
ATOM   2021 C CB    . LYS A 1 246 ? 24.131  9.461   19.307  1.00 49.01 ? 246  LYS A CB    1 
ATOM   2022 C CG    . LYS A 1 246 ? 25.358  10.270  19.720  1.00 50.73 ? 246  LYS A CG    1 
ATOM   2023 C CD    . LYS A 1 246 ? 26.396  10.331  18.593  1.00 54.02 ? 246  LYS A CD    1 
ATOM   2024 C CE    . LYS A 1 246 ? 26.831  8.941   18.125  1.00 53.82 ? 246  LYS A CE    1 
ATOM   2025 N NZ    . LYS A 1 246 ? 27.802  9.016   17.004  1.00 53.41 ? 246  LYS A NZ    1 
ATOM   2026 N N     . GLU A 1 247 ? 23.157  10.031  22.547  1.00 44.99 ? 247  GLU A N     1 
ATOM   2027 C CA    . GLU A 1 247 ? 23.330  9.599   23.928  1.00 44.19 ? 247  GLU A CA    1 
ATOM   2028 C C     . GLU A 1 247 ? 22.657  10.594  24.862  1.00 42.88 ? 247  GLU A C     1 
ATOM   2029 O O     . GLU A 1 247 ? 22.783  11.807  24.686  1.00 41.63 ? 247  GLU A O     1 
ATOM   2030 C CB    . GLU A 1 247 ? 24.818  9.495   24.262  1.00 45.71 ? 247  GLU A CB    1 
ATOM   2031 C CG    . GLU A 1 247 ? 25.135  8.859   25.608  1.00 48.26 ? 247  GLU A CG    1 
ATOM   2032 C CD    . GLU A 1 247 ? 24.711  7.394   25.703  1.00 50.61 ? 247  GLU A CD    1 
ATOM   2033 O OE1   . GLU A 1 247 ? 24.730  6.689   24.669  1.00 50.06 ? 247  GLU A OE1   1 
ATOM   2034 O OE2   . GLU A 1 247 ? 24.379  6.945   26.824  1.00 49.79 ? 247  GLU A OE2   1 
ATOM   2035 N N     . PHE A 1 248 ? 21.936  10.074  25.849  1.00 40.26 ? 248  PHE A N     1 
ATOM   2036 C CA    . PHE A 1 248 ? 21.241  10.912  26.815  1.00 38.94 ? 248  PHE A CA    1 
ATOM   2037 C C     . PHE A 1 248 ? 22.245  11.800  27.549  1.00 38.99 ? 248  PHE A C     1 
ATOM   2038 O O     . PHE A 1 248 ? 23.344  11.363  27.883  1.00 39.64 ? 248  PHE A O     1 
ATOM   2039 C CB    . PHE A 1 248 ? 20.498  10.039  27.829  1.00 36.33 ? 248  PHE A CB    1 
ATOM   2040 C CG    . PHE A 1 248 ? 19.521  10.792  28.684  1.00 33.74 ? 248  PHE A CG    1 
ATOM   2041 C CD1   . PHE A 1 248 ? 18.191  10.928  28.289  1.00 32.44 ? 248  PHE A CD1   1 
ATOM   2042 C CD2   . PHE A 1 248 ? 19.925  11.363  29.884  1.00 31.72 ? 248  PHE A CD2   1 
ATOM   2043 C CE1   . PHE A 1 248 ? 17.274  11.615  29.079  1.00 31.90 ? 248  PHE A CE1   1 
ATOM   2044 C CE2   . PHE A 1 248 ? 19.017  12.055  30.686  1.00 33.09 ? 248  PHE A CE2   1 
ATOM   2045 C CZ    . PHE A 1 248 ? 17.687  12.183  30.283  1.00 31.85 ? 248  PHE A CZ    1 
ATOM   2046 N N     . ASP A 1 249 ? 21.859  13.046  27.791  1.00 39.09 ? 249  ASP A N     1 
ATOM   2047 C CA    . ASP A 1 249 ? 22.708  14.000  28.494  1.00 40.53 ? 249  ASP A CA    1 
ATOM   2048 C C     . ASP A 1 249 ? 21.867  14.843  29.448  1.00 39.14 ? 249  ASP A C     1 
ATOM   2049 O O     . ASP A 1 249 ? 20.749  15.240  29.120  1.00 41.23 ? 249  ASP A O     1 
ATOM   2050 C CB    . ASP A 1 249 ? 23.426  14.911  27.494  1.00 44.52 ? 249  ASP A CB    1 
ATOM   2051 C CG    . ASP A 1 249 ? 24.754  14.335  27.022  1.00 48.86 ? 249  ASP A CG    1 
ATOM   2052 O OD1   . ASP A 1 249 ? 25.227  14.746  25.936  1.00 51.13 ? 249  ASP A OD1   1 
ATOM   2053 O OD2   . ASP A 1 249 ? 25.332  13.484  27.739  1.00 50.30 ? 249  ASP A OD2   1 
ATOM   2054 N N     . PHE A 1 250 ? 22.406  15.109  30.631  1.00 36.08 ? 250  PHE A N     1 
ATOM   2055 C CA    . PHE A 1 250 ? 21.695  15.899  31.620  1.00 31.95 ? 250  PHE A CA    1 
ATOM   2056 C C     . PHE A 1 250 ? 21.805  17.383  31.300  1.00 30.29 ? 250  PHE A C     1 
ATOM   2057 O O     . PHE A 1 250 ? 22.878  17.973  31.351  1.00 29.44 ? 250  PHE A O     1 
ATOM   2058 C CB    . PHE A 1 250 ? 22.246  15.614  33.017  1.00 32.07 ? 250  PHE A CB    1 
ATOM   2059 C CG    . PHE A 1 250 ? 22.005  14.203  33.490  1.00 32.84 ? 250  PHE A CG    1 
ATOM   2060 C CD1   . PHE A 1 250 ? 20.714  13.679  33.533  1.00 31.92 ? 250  PHE A CD1   1 
ATOM   2061 C CD2   . PHE A 1 250 ? 23.066  13.404  33.912  1.00 31.94 ? 250  PHE A CD2   1 
ATOM   2062 C CE1   . PHE A 1 250 ? 20.484  12.381  33.992  1.00 29.74 ? 250  PHE A CE1   1 
ATOM   2063 C CE2   . PHE A 1 250 ? 22.843  12.107  34.371  1.00 31.88 ? 250  PHE A CE2   1 
ATOM   2064 C CZ    . PHE A 1 250 ? 21.548  11.597  34.412  1.00 30.92 ? 250  PHE A CZ    1 
ATOM   2065 N N     . LEU A 1 251 ? 20.673  17.975  30.955  1.00 28.47 ? 251  LEU A N     1 
ATOM   2066 C CA    . LEU A 1 251 ? 20.613  19.383  30.622  1.00 25.84 ? 251  LEU A CA    1 
ATOM   2067 C C     . LEU A 1 251 ? 20.500  20.225  31.881  1.00 24.56 ? 251  LEU A C     1 
ATOM   2068 O O     . LEU A 1 251 ? 21.024  21.342  31.943  1.00 24.39 ? 251  LEU A O     1 
ATOM   2069 C CB    . LEU A 1 251 ? 19.415  19.633  29.707  1.00 27.21 ? 251  LEU A CB    1 
ATOM   2070 C CG    . LEU A 1 251 ? 19.642  19.686  28.187  1.00 30.07 ? 251  LEU A CG    1 
ATOM   2071 C CD1   . LEU A 1 251 ? 20.790  18.790  27.742  1.00 27.84 ? 251  LEU A CD1   1 
ATOM   2072 C CD2   . LEU A 1 251 ? 18.346  19.299  27.514  1.00 30.04 ? 251  LEU A CD2   1 
ATOM   2073 N N     . VAL A 1 252 ? 19.837  19.680  32.895  1.00 21.70 ? 252  VAL A N     1 
ATOM   2074 C CA    . VAL A 1 252 ? 19.654  20.404  34.143  1.00 21.31 ? 252  VAL A CA    1 
ATOM   2075 C C     . VAL A 1 252 ? 19.930  19.604  35.405  1.00 20.15 ? 252  VAL A C     1 
ATOM   2076 O O     . VAL A 1 252 ? 20.425  20.154  36.394  1.00 18.26 ? 252  VAL A O     1 
ATOM   2077 C CB    . VAL A 1 252 ? 18.215  20.976  34.250  1.00 22.55 ? 252  VAL A CB    1 
ATOM   2078 C CG1   . VAL A 1 252 ? 17.191  19.859  34.189  1.00 20.53 ? 252  VAL A CG1   1 
ATOM   2079 C CG2   . VAL A 1 252 ? 18.057  21.727  35.551  1.00 28.40 ? 252  VAL A CG2   1 
ATOM   2080 N N     . TYR A 1 253 ? 19.618  18.311  35.378  1.00 20.21 ? 253  TYR A N     1 
ATOM   2081 C CA    . TYR A 1 253 ? 19.797  17.475  36.557  1.00 21.16 ? 253  TYR A CA    1 
ATOM   2082 C C     . TYR A 1 253 ? 21.202  17.479  37.132  1.00 21.41 ? 253  TYR A C     1 
ATOM   2083 O O     . TYR A 1 253 ? 22.165  17.087  36.475  1.00 21.58 ? 253  TYR A O     1 
ATOM   2084 C CB    . TYR A 1 253 ? 19.346  16.032  36.275  1.00 19.95 ? 253  TYR A CB    1 
ATOM   2085 C CG    . TYR A 1 253 ? 19.553  15.078  37.441  1.00 18.73 ? 253  TYR A CG    1 
ATOM   2086 C CD1   . TYR A 1 253 ? 20.668  14.240  37.488  1.00 17.72 ? 253  TYR A CD1   1 
ATOM   2087 C CD2   . TYR A 1 253 ? 18.627  15.000  38.484  1.00 18.94 ? 253  TYR A CD2   1 
ATOM   2088 C CE1   . TYR A 1 253 ? 20.854  13.343  38.533  1.00 18.03 ? 253  TYR A CE1   1 
ATOM   2089 C CE2   . TYR A 1 253 ? 18.803  14.103  39.546  1.00 17.65 ? 253  TYR A CE2   1 
ATOM   2090 C CZ    . TYR A 1 253 ? 19.922  13.273  39.558  1.00 19.54 ? 253  TYR A CZ    1 
ATOM   2091 O OH    . TYR A 1 253 ? 20.112  12.359  40.571  1.00 16.36 ? 253  TYR A OH    1 
ATOM   2092 N N     . ARG A 1 254 ? 21.302  17.944  38.371  1.00 22.91 ? 254  ARG A N     1 
ATOM   2093 C CA    . ARG A 1 254 ? 22.575  18.002  39.062  1.00 26.80 ? 254  ARG A CA    1 
ATOM   2094 C C     . ARG A 1 254 ? 23.544  18.954  38.360  1.00 28.14 ? 254  ARG A C     1 
ATOM   2095 O O     . ARG A 1 254 ? 24.758  18.747  38.384  1.00 27.96 ? 254  ARG A O     1 
ATOM   2096 C CB    . ARG A 1 254 ? 23.176  16.598  39.128  1.00 27.74 ? 254  ARG A CB    1 
ATOM   2097 C CG    . ARG A 1 254 ? 23.740  16.259  40.475  1.00 34.46 ? 254  ARG A CG    1 
ATOM   2098 C CD    . ARG A 1 254 ? 23.138  14.983  41.033  1.00 35.06 ? 254  ARG A CD    1 
ATOM   2099 N NE    . ARG A 1 254 ? 23.419  14.870  42.459  1.00 39.23 ? 254  ARG A NE    1 
ATOM   2100 C CZ    . ARG A 1 254 ? 24.641  14.815  42.978  1.00 39.37 ? 254  ARG A CZ    1 
ATOM   2101 N NH1   . ARG A 1 254 ? 25.700  14.857  42.187  1.00 40.73 ? 254  ARG A NH1   1 
ATOM   2102 N NH2   . ARG A 1 254 ? 24.804  14.730  44.289  1.00 41.42 ? 254  ARG A NH2   1 
ATOM   2103 N N     . LYS A 1 255 ? 22.998  19.994  37.732  1.00 29.14 ? 255  LYS A N     1 
ATOM   2104 C CA    . LYS A 1 255 ? 23.809  20.986  37.030  1.00 29.34 ? 255  LYS A CA    1 
ATOM   2105 C C     . LYS A 1 255 ? 23.726  22.341  37.721  1.00 29.12 ? 255  LYS A C     1 
ATOM   2106 O O     . LYS A 1 255 ? 22.731  22.664  38.367  1.00 26.78 ? 255  LYS A O     1 
ATOM   2107 C CB    . LYS A 1 255 ? 23.333  21.148  35.583  1.00 29.38 ? 255  LYS A CB    1 
ATOM   2108 C CG    . LYS A 1 255 ? 23.419  19.898  34.736  1.00 29.57 ? 255  LYS A CG    1 
ATOM   2109 C CD    . LYS A 1 255 ? 24.854  19.552  34.404  1.00 31.94 ? 255  LYS A CD    1 
ATOM   2110 C CE    . LYS A 1 255 ? 24.903  18.419  33.402  1.00 31.47 ? 255  LYS A CE    1 
ATOM   2111 N NZ    . LYS A 1 255 ? 26.263  18.239  32.831  1.00 34.61 ? 255  LYS A NZ    1 
ATOM   2112 N N     . LYS A 1 256 ? 24.786  23.127  37.579  1.00 31.54 ? 256  LYS A N     1 
ATOM   2113 C CA    . LYS A 1 256 ? 24.847  24.461  38.161  1.00 32.26 ? 256  LYS A CA    1 
ATOM   2114 C C     . LYS A 1 256 ? 24.113  25.424  37.231  1.00 31.63 ? 256  LYS A C     1 
ATOM   2115 O O     . LYS A 1 256 ? 23.541  26.418  37.674  1.00 31.60 ? 256  LYS A O     1 
ATOM   2116 C CB    . LYS A 1 256 ? 26.309  24.893  38.319  1.00 35.06 ? 256  LYS A CB    1 
ATOM   2117 C CG    . LYS A 1 256 ? 26.712  25.204  39.755  1.00 38.83 ? 256  LYS A CG    1 
ATOM   2118 C CD    . LYS A 1 256 ? 26.372  24.054  40.682  1.00 39.48 ? 256  LYS A CD    1 
ATOM   2119 C CE    . LYS A 1 256 ? 26.638  24.416  42.127  1.00 42.70 ? 256  LYS A CE    1 
ATOM   2120 N NZ    . LYS A 1 256 ? 26.162  23.346  43.053  1.00 45.67 ? 256  LYS A NZ    1 
ATOM   2121 N N     . LYS A 1 257 ? 24.140  25.114  35.937  1.00 30.56 ? 257  LYS A N     1 
ATOM   2122 C CA    . LYS A 1 257 ? 23.476  25.925  34.926  1.00 31.53 ? 257  LYS A CA    1 
ATOM   2123 C C     . LYS A 1 257 ? 23.157  25.093  33.687  1.00 30.77 ? 257  LYS A C     1 
ATOM   2124 O O     . LYS A 1 257 ? 23.841  24.109  33.396  1.00 30.51 ? 257  LYS A O     1 
ATOM   2125 C CB    . LYS A 1 257 ? 24.348  27.121  34.549  1.00 32.47 ? 257  LYS A CB    1 
ATOM   2126 C CG    . LYS A 1 257 ? 25.761  26.769  34.154  1.00 36.50 ? 257  LYS A CG    1 
ATOM   2127 C CD    . LYS A 1 257 ? 26.590  28.030  33.940  1.00 39.41 ? 257  LYS A CD    1 
ATOM   2128 C CE    . LYS A 1 257 ? 26.567  28.932  35.170  1.00 41.69 ? 257  LYS A CE    1 
ATOM   2129 N NZ    . LYS A 1 257 ? 27.423  30.142  34.987  1.00 45.42 ? 257  LYS A NZ    1 
ATOM   2130 N N     . ASP A 1 258 ? 22.109  25.479  32.964  1.00 29.69 ? 258  ASP A N     1 
ATOM   2131 C CA    . ASP A 1 258 ? 21.719  24.739  31.774  1.00 29.47 ? 258  ASP A CA    1 
ATOM   2132 C C     . ASP A 1 258 ? 22.759  24.963  30.669  1.00 30.56 ? 258  ASP A C     1 
ATOM   2133 O O     . ASP A 1 258 ? 23.692  25.749  30.839  1.00 29.40 ? 258  ASP A O     1 
ATOM   2134 C CB    . ASP A 1 258 ? 20.298  25.143  31.330  1.00 26.54 ? 258  ASP A CB    1 
ATOM   2135 C CG    . ASP A 1 258 ? 20.248  26.489  30.617  1.00 27.63 ? 258  ASP A CG    1 
ATOM   2136 O OD1   . ASP A 1 258 ? 21.291  27.171  30.540  1.00 26.71 ? 258  ASP A OD1   1 
ATOM   2137 O OD2   . ASP A 1 258 ? 19.151  26.863  30.130  1.00 24.76 ? 258  ASP A OD2   1 
ATOM   2138 N N     . PRO A 1 259 ? 22.619  24.269  29.527  1.00 31.04 ? 259  PRO A N     1 
ATOM   2139 C CA    . PRO A 1 259 ? 23.589  24.433  28.438  1.00 31.42 ? 259  PRO A CA    1 
ATOM   2140 C C     . PRO A 1 259 ? 23.860  25.865  27.983  1.00 31.33 ? 259  PRO A C     1 
ATOM   2141 O O     . PRO A 1 259 ? 24.880  26.130  27.356  1.00 30.92 ? 259  PRO A O     1 
ATOM   2142 C CB    . PRO A 1 259 ? 23.001  23.575  27.322  1.00 31.87 ? 259  PRO A CB    1 
ATOM   2143 C CG    . PRO A 1 259 ? 22.302  22.480  28.082  1.00 32.17 ? 259  PRO A CG    1 
ATOM   2144 C CD    . PRO A 1 259 ? 21.605  23.259  29.175  1.00 30.83 ? 259  PRO A CD    1 
ATOM   2145 N N     . ASN A 1 260 ? 22.970  26.793  28.308  1.00 31.98 ? 260  ASN A N     1 
ATOM   2146 C CA    . ASN A 1 260 ? 23.172  28.170  27.873  1.00 31.66 ? 260  ASN A CA    1 
ATOM   2147 C C     . ASN A 1 260 ? 23.573  29.158  28.959  1.00 29.60 ? 260  ASN A C     1 
ATOM   2148 O O     . ASN A 1 260 ? 23.468  30.368  28.764  1.00 31.53 ? 260  ASN A O     1 
ATOM   2149 C CB    . ASN A 1 260 ? 21.918  28.661  27.162  1.00 34.69 ? 260  ASN A CB    1 
ATOM   2150 C CG    . ASN A 1 260 ? 21.432  27.680  26.119  1.00 39.77 ? 260  ASN A CG    1 
ATOM   2151 O OD1   . ASN A 1 260 ? 22.185  27.280  25.226  1.00 41.80 ? 260  ASN A OD1   1 
ATOM   2152 N ND2   . ASN A 1 260 ? 20.169  27.280  26.226  1.00 42.96 ? 260  ASN A ND2   1 
ATOM   2153 N N     . GLY A 1 261 ? 24.025  28.650  30.101  1.00 28.19 ? 261  GLY A N     1 
ATOM   2154 C CA    . GLY A 1 261 ? 24.447  29.529  31.178  1.00 26.80 ? 261  GLY A CA    1 
ATOM   2155 C C     . GLY A 1 261 ? 23.374  30.009  32.143  1.00 25.44 ? 261  GLY A C     1 
ATOM   2156 O O     . GLY A 1 261 ? 23.666  30.772  33.064  1.00 26.93 ? 261  GLY A O     1 
ATOM   2157 N N     . ASN A 1 262 ? 22.133  29.579  31.954  1.00 24.36 ? 262  ASN A N     1 
ATOM   2158 C CA    . ASN A 1 262 ? 21.071  30.001  32.860  1.00 23.99 ? 262  ASN A CA    1 
ATOM   2159 C C     . ASN A 1 262 ? 21.187  29.242  34.177  1.00 23.48 ? 262  ASN A C     1 
ATOM   2160 O O     . ASN A 1 262 ? 21.453  28.039  34.195  1.00 21.51 ? 262  ASN A O     1 
ATOM   2161 C CB    . ASN A 1 262 ? 19.701  29.765  32.230  1.00 24.45 ? 262  ASN A CB    1 
ATOM   2162 C CG    . ASN A 1 262 ? 19.552  30.465  30.897  1.00 25.86 ? 262  ASN A CG    1 
ATOM   2163 O OD1   . ASN A 1 262 ? 19.504  29.821  29.846  1.00 27.08 ? 262  ASN A OD1   1 
ATOM   2164 N ND2   . ASN A 1 262 ? 19.493  31.792  30.929  1.00 22.46 ? 262  ASN A ND2   1 
ATOM   2165 N N     . LYS A 1 263 ? 21.002  29.963  35.276  1.00 22.09 ? 263  LYS A N     1 
ATOM   2166 C CA    . LYS A 1 263 ? 21.097  29.393  36.613  1.00 21.90 ? 263  LYS A CA    1 
ATOM   2167 C C     . LYS A 1 263 ? 20.123  28.243  36.836  1.00 21.15 ? 263  LYS A C     1 
ATOM   2168 O O     . LYS A 1 263 ? 18.941  28.354  36.529  1.00 19.23 ? 263  LYS A O     1 
ATOM   2169 C CB    . LYS A 1 263 ? 20.823  30.475  37.658  1.00 23.90 ? 263  LYS A CB    1 
ATOM   2170 C CG    . LYS A 1 263 ? 20.723  29.957  39.084  1.00 24.22 ? 263  LYS A CG    1 
ATOM   2171 C CD    . LYS A 1 263 ? 22.040  30.087  39.807  1.00 29.85 ? 263  LYS A CD    1 
ATOM   2172 C CE    . LYS A 1 263 ? 22.295  31.527  40.237  1.00 31.27 ? 263  LYS A CE    1 
ATOM   2173 N NZ    . LYS A 1 263 ? 21.280  31.978  41.230  1.00 32.36 ? 263  LYS A NZ    1 
ATOM   2174 N N     . VAL A 1 264 ? 20.632  27.146  37.384  1.00 21.48 ? 264  VAL A N     1 
ATOM   2175 C CA    . VAL A 1 264 ? 19.815  25.981  37.685  1.00 20.43 ? 264  VAL A CA    1 
ATOM   2176 C C     . VAL A 1 264 ? 19.573  25.904  39.185  1.00 21.90 ? 264  VAL A C     1 
ATOM   2177 O O     . VAL A 1 264 ? 20.518  25.864  39.970  1.00 22.66 ? 264  VAL A O     1 
ATOM   2178 C CB    . VAL A 1 264 ? 20.509  24.689  37.237  1.00 22.15 ? 264  VAL A CB    1 
ATOM   2179 C CG1   . VAL A 1 264 ? 19.747  23.476  37.780  1.00 20.88 ? 264  VAL A CG1   1 
ATOM   2180 C CG2   . VAL A 1 264 ? 20.585  24.650  35.708  1.00 20.42 ? 264  VAL A CG2   1 
ATOM   2181 N N     . ILE A 1 265 ? 18.304  25.877  39.578  1.00 22.71 ? 265  ILE A N     1 
ATOM   2182 C CA    . ILE A 1 265 ? 17.936  25.802  40.982  1.00 24.28 ? 265  ILE A CA    1 
ATOM   2183 C C     . ILE A 1 265 ? 17.725  24.353  41.416  1.00 24.81 ? 265  ILE A C     1 
ATOM   2184 O O     . ILE A 1 265 ? 17.122  23.564  40.690  1.00 24.39 ? 265  ILE A O     1 
ATOM   2185 C CB    . ILE A 1 265 ? 16.623  26.584  41.267  1.00 26.37 ? 265  ILE A CB    1 
ATOM   2186 C CG1   . ILE A 1 265 ? 16.859  28.086  41.131  1.00 28.46 ? 265  ILE A CG1   1 
ATOM   2187 C CG2   . ILE A 1 265 ? 16.126  26.285  42.673  1.00 27.17 ? 265  ILE A CG2   1 
ATOM   2188 C CD1   . ILE A 1 265 ? 15.604  28.915  41.371  1.00 31.51 ? 265  ILE A CD1   1 
ATOM   2189 N N     . ALA A 1 266 ? 18.244  24.015  42.592  1.00 25.23 ? 266  ALA A N     1 
ATOM   2190 C CA    . ALA A 1 266 ? 18.096  22.681  43.167  1.00 28.49 ? 266  ALA A CA    1 
ATOM   2191 C C     . ALA A 1 266 ? 17.011  22.864  44.220  1.00 29.00 ? 266  ALA A C     1 
ATOM   2192 O O     . ALA A 1 266 ? 17.294  23.104  45.392  1.00 29.84 ? 266  ALA A O     1 
ATOM   2193 C CB    . ALA A 1 266 ? 19.399  22.235  43.814  1.00 28.00 ? 266  ALA A CB    1 
ATOM   2194 N N     . ASP A 1 267 ? 15.766  22.753  43.778  1.00 31.08 ? 267  ASP A N     1 
ATOM   2195 C CA    . ASP A 1 267 ? 14.602  22.963  44.627  1.00 32.21 ? 267  ASP A CA    1 
ATOM   2196 C C     . ASP A 1 267 ? 14.082  21.740  45.365  1.00 32.56 ? 267  ASP A C     1 
ATOM   2197 O O     . ASP A 1 267 ? 14.172  20.617  44.876  1.00 33.84 ? 267  ASP A O     1 
ATOM   2198 C CB    . ASP A 1 267 ? 13.477  23.556  43.767  1.00 33.65 ? 267  ASP A CB    1 
ATOM   2199 C CG    . ASP A 1 267 ? 12.902  24.825  44.351  1.00 32.83 ? 267  ASP A CG    1 
ATOM   2200 O OD1   . ASP A 1 267 ? 12.245  25.576  43.605  1.00 33.94 ? 267  ASP A OD1   1 
ATOM   2201 O OD2   . ASP A 1 267 ? 13.101  25.070  45.554  1.00 33.75 ? 267  ASP A OD2   1 
ATOM   2202 N N     . LYS A 1 268 ? 13.535  21.973  46.554  1.00 34.69 ? 268  LYS A N     1 
ATOM   2203 C CA    . LYS A 1 268 ? 12.952  20.907  47.364  1.00 35.84 ? 268  LYS A CA    1 
ATOM   2204 C C     . LYS A 1 268 ? 11.445  21.119  47.293  1.00 36.12 ? 268  LYS A C     1 
ATOM   2205 O O     . LYS A 1 268 ? 10.855  21.765  48.158  1.00 37.43 ? 268  LYS A O     1 
ATOM   2206 C CB    . LYS A 1 268 ? 13.419  20.999  48.822  1.00 37.51 ? 268  LYS A CB    1 
ATOM   2207 C CG    . LYS A 1 268 ? 14.910  20.758  49.039  1.00 39.26 ? 268  LYS A CG    1 
ATOM   2208 C CD    . LYS A 1 268 ? 15.314  19.358  48.599  1.00 41.65 ? 268  LYS A CD    1 
ATOM   2209 C CE    . LYS A 1 268 ? 16.808  19.105  48.801  1.00 43.43 ? 268  LYS A CE    1 
ATOM   2210 N NZ    . LYS A 1 268 ? 17.191  18.996  50.246  1.00 44.36 ? 268  LYS A NZ    1 
ATOM   2211 N N     . ILE A 1 269 ? 10.826  20.587  46.247  1.00 34.77 ? 269  ILE A N     1 
ATOM   2212 C CA    . ILE A 1 269 ? 9.395   20.741  46.059  1.00 33.05 ? 269  ILE A CA    1 
ATOM   2213 C C     . ILE A 1 269 ? 8.617   19.561  46.617  1.00 33.92 ? 269  ILE A C     1 
ATOM   2214 O O     . ILE A 1 269 ? 7.629   19.736  47.329  1.00 33.28 ? 269  ILE A O     1 
ATOM   2215 C CB    . ILE A 1 269 ? 9.043   20.877  44.558  1.00 31.82 ? 269  ILE A CB    1 
ATOM   2216 C CG1   . ILE A 1 269 ? 9.796   22.061  43.951  1.00 31.77 ? 269  ILE A CG1   1 
ATOM   2217 C CG2   . ILE A 1 269 ? 7.533   21.055  44.386  1.00 29.93 ? 269  ILE A CG2   1 
ATOM   2218 C CD1   . ILE A 1 269 ? 9.542   22.257  42.472  1.00 30.57 ? 269  ILE A CD1   1 
ATOM   2219 N N     . ILE A 1 270 ? 9.087   18.360  46.296  1.00 33.32 ? 270  ILE A N     1 
ATOM   2220 C CA    . ILE A 1 270 ? 8.431   17.126  46.701  1.00 34.28 ? 270  ILE A CA    1 
ATOM   2221 C C     . ILE A 1 270 ? 8.877   16.546  48.039  1.00 32.97 ? 270  ILE A C     1 
ATOM   2222 O O     . ILE A 1 270 ? 9.975   16.816  48.518  1.00 32.87 ? 270  ILE A O     1 
ATOM   2223 C CB    . ILE A 1 270 ? 8.639   16.041  45.617  1.00 36.28 ? 270  ILE A CB    1 
ATOM   2224 C CG1   . ILE A 1 270 ? 8.232   16.591  44.250  1.00 37.71 ? 270  ILE A CG1   1 
ATOM   2225 C CG2   . ILE A 1 270 ? 7.822   14.803  45.945  1.00 37.54 ? 270  ILE A CG2   1 
ATOM   2226 C CD1   . ILE A 1 270 ? 8.481   15.632  43.099  1.00 41.27 ? 270  ILE A CD1   1 
ATOM   2227 N N     . GLY A 1 271 ? 7.999   15.740  48.627  1.00 32.95 ? 271  GLY A N     1 
ATOM   2228 C CA    . GLY A 1 271 ? 8.297   15.079  49.880  1.00 30.17 ? 271  GLY A CA    1 
ATOM   2229 C C     . GLY A 1 271 ? 8.374   15.971  51.093  1.00 31.65 ? 271  GLY A C     1 
ATOM   2230 O O     . GLY A 1 271 ? 8.262   17.193  51.004  1.00 29.53 ? 271  GLY A O     1 
ATOM   2231 N N     . SER A 1 272 ? 8.566   15.328  52.238  1.00 32.21 ? 272  SER A N     1 
ATOM   2232 C CA    . SER A 1 272 ? 8.674   15.997  53.523  1.00 31.96 ? 272  SER A CA    1 
ATOM   2233 C C     . SER A 1 272 ? 9.642   15.150  54.348  1.00 32.56 ? 272  SER A C     1 
ATOM   2234 O O     . SER A 1 272 ? 10.261  14.225  53.818  1.00 33.30 ? 272  SER A O     1 
ATOM   2235 C CB    . SER A 1 272 ? 7.306   16.038  54.199  1.00 32.42 ? 272  SER A CB    1 
ATOM   2236 O OG    . SER A 1 272 ? 6.855   14.722  54.481  1.00 33.77 ? 272  SER A OG    1 
ATOM   2237 N N     . GLY A 1 273 ? 9.775   15.467  55.631  1.00 32.79 ? 273  GLY A N     1 
ATOM   2238 C CA    . GLY A 1 273 ? 10.665  14.715  56.505  1.00 32.52 ? 273  GLY A CA    1 
ATOM   2239 C C     . GLY A 1 273 ? 11.949  14.222  55.857  1.00 32.99 ? 273  GLY A C     1 
ATOM   2240 O O     . GLY A 1 273 ? 12.763  15.022  55.389  1.00 34.34 ? 273  GLY A O     1 
ATOM   2241 N N     . LYS A 1 274 ? 12.131  12.903  55.829  1.00 31.02 ? 274  LYS A N     1 
ATOM   2242 C CA    . LYS A 1 274 ? 13.322  12.297  55.238  1.00 31.00 ? 274  LYS A CA    1 
ATOM   2243 C C     . LYS A 1 274 ? 13.126  11.715  53.840  1.00 30.28 ? 274  LYS A C     1 
ATOM   2244 O O     . LYS A 1 274 ? 13.887  10.846  53.420  1.00 30.58 ? 274  LYS A O     1 
ATOM   2245 C CB    . LYS A 1 274 ? 13.860  11.191  56.153  1.00 32.56 ? 274  LYS A CB    1 
ATOM   2246 C CG    . LYS A 1 274 ? 14.962  11.639  57.091  1.00 34.62 ? 274  LYS A CG    1 
ATOM   2247 C CD    . LYS A 1 274 ? 14.489  12.697  58.061  1.00 34.85 ? 274  LYS A CD    1 
ATOM   2248 C CE    . LYS A 1 274 ? 15.637  13.170  58.930  1.00 36.34 ? 274  LYS A CE    1 
ATOM   2249 N NZ    . LYS A 1 274 ? 16.321  12.027  59.597  1.00 36.05 ? 274  LYS A NZ    1 
ATOM   2250 N N     . ASN A 1 275 ? 12.110  12.170  53.117  1.00 29.82 ? 275  ASN A N     1 
ATOM   2251 C CA    . ASN A 1 275 ? 11.886  11.654  51.774  1.00 28.83 ? 275  ASN A CA    1 
ATOM   2252 C C     . ASN A 1 275 ? 11.847  12.793  50.763  1.00 28.66 ? 275  ASN A C     1 
ATOM   2253 O O     . ASN A 1 275 ? 11.346  12.640  49.655  1.00 31.63 ? 275  ASN A O     1 
ATOM   2254 C CB    . ASN A 1 275 ? 10.585  10.841  51.720  1.00 28.80 ? 275  ASN A CB    1 
ATOM   2255 C CG    . ASN A 1 275 ? 9.348   11.682  51.996  1.00 27.89 ? 275  ASN A CG    1 
ATOM   2256 O OD1   . ASN A 1 275 ? 9.009   12.579  51.228  1.00 28.40 ? 275  ASN A OD1   1 
ATOM   2257 N ND2   . ASN A 1 275 ? 8.667   11.387  53.095  1.00 30.48 ? 275  ASN A ND2   1 
ATOM   2258 N N     . LYS A 1 276 ? 12.392  13.934  51.155  1.00 29.04 ? 276  LYS A N     1 
ATOM   2259 C CA    . LYS A 1 276 ? 12.429  15.111  50.294  1.00 30.50 ? 276  LYS A CA    1 
ATOM   2260 C C     . LYS A 1 276 ? 13.358  14.891  49.100  1.00 29.06 ? 276  LYS A C     1 
ATOM   2261 O O     . LYS A 1 276 ? 14.516  14.512  49.273  1.00 29.75 ? 276  LYS A O     1 
ATOM   2262 C CB    . LYS A 1 276 ? 12.910  16.316  51.106  1.00 33.09 ? 276  LYS A CB    1 
ATOM   2263 C CG    . LYS A 1 276 ? 12.047  17.554  50.958  1.00 37.11 ? 276  LYS A CG    1 
ATOM   2264 C CD    . LYS A 1 276 ? 11.442  17.970  52.288  1.00 39.01 ? 276  LYS A CD    1 
ATOM   2265 C CE    . LYS A 1 276 ? 12.520  18.265  53.321  1.00 40.33 ? 276  LYS A CE    1 
ATOM   2266 N NZ    . LYS A 1 276 ? 11.941  18.725  54.620  1.00 40.69 ? 276  LYS A NZ    1 
ATOM   2267 N N     . ARG A 1 277 ? 12.851  15.124  47.892  1.00 27.57 ? 277  ARG A N     1 
ATOM   2268 C CA    . ARG A 1 277 ? 13.650  14.954  46.676  1.00 26.25 ? 277  ARG A CA    1 
ATOM   2269 C C     . ARG A 1 277 ? 14.075  16.319  46.115  1.00 25.41 ? 277  ARG A C     1 
ATOM   2270 O O     . ARG A 1 277 ? 13.403  17.322  46.337  1.00 24.10 ? 277  ARG A O     1 
ATOM   2271 C CB    . ARG A 1 277 ? 12.844  14.199  45.606  1.00 27.49 ? 277  ARG A CB    1 
ATOM   2272 C CG    . ARG A 1 277 ? 12.188  12.894  46.075  1.00 28.40 ? 277  ARG A CG    1 
ATOM   2273 C CD    . ARG A 1 277 ? 13.199  11.900  46.630  1.00 28.07 ? 277  ARG A CD    1 
ATOM   2274 N NE    . ARG A 1 277 ? 14.057  11.307  45.604  1.00 29.70 ? 277  ARG A NE    1 
ATOM   2275 C CZ    . ARG A 1 277 ? 13.626  10.469  44.662  1.00 30.62 ? 277  ARG A CZ    1 
ATOM   2276 N NH1   . ARG A 1 277 ? 12.344  10.125  44.610  1.00 29.95 ? 277  ARG A NH1   1 
ATOM   2277 N NH2   . ARG A 1 277 ? 14.476  9.964   43.780  1.00 29.99 ? 277  ARG A NH2   1 
ATOM   2278 N N     . THR A 1 278 ? 15.190  16.348  45.387  1.00 23.96 ? 278  THR A N     1 
ATOM   2279 C CA    . THR A 1 278 ? 15.695  17.580  44.788  1.00 22.82 ? 278  THR A CA    1 
ATOM   2280 C C     . THR A 1 278 ? 15.230  17.707  43.336  1.00 22.55 ? 278  THR A C     1 
ATOM   2281 O O     . THR A 1 278 ? 15.473  16.814  42.518  1.00 21.84 ? 278  THR A O     1 
ATOM   2282 C CB    . THR A 1 278 ? 17.238  17.615  44.787  1.00 22.30 ? 278  THR A CB    1 
ATOM   2283 O OG1   . THR A 1 278 ? 17.724  17.560  46.129  1.00 24.84 ? 278  THR A OG1   1 
ATOM   2284 C CG2   . THR A 1 278 ? 17.745  18.898  44.135  1.00 23.53 ? 278  THR A CG2   1 
ATOM   2285 N N     . THR A 1 279 ? 14.565  18.812  43.016  1.00 20.26 ? 279  THR A N     1 
ATOM   2286 C CA    . THR A 1 279 ? 14.097  19.037  41.652  1.00 20.67 ? 279  THR A CA    1 
ATOM   2287 C C     . THR A 1 279 ? 14.955  20.116  41.006  1.00 20.95 ? 279  THR A C     1 
ATOM   2288 O O     . THR A 1 279 ? 14.986  21.260  41.469  1.00 21.63 ? 279  THR A O     1 
ATOM   2289 C CB    . THR A 1 279 ? 12.626  19.512  41.605  1.00 21.43 ? 279  THR A CB    1 
ATOM   2290 O OG1   . THR A 1 279 ? 11.772  18.515  42.176  1.00 22.20 ? 279  THR A OG1   1 
ATOM   2291 C CG2   . THR A 1 279 ? 12.197  19.758  40.157  1.00 22.59 ? 279  THR A CG2   1 
ATOM   2292 N N     . TYR A 1 280 ? 15.653  19.756  39.937  1.00 18.64 ? 280  TYR A N     1 
ATOM   2293 C CA    . TYR A 1 280 ? 16.503  20.714  39.248  1.00 16.45 ? 280  TYR A CA    1 
ATOM   2294 C C     . TYR A 1 280 ? 15.762  21.351  38.094  1.00 17.53 ? 280  TYR A C     1 
ATOM   2295 O O     . TYR A 1 280 ? 15.210  20.651  37.249  1.00 17.03 ? 280  TYR A O     1 
ATOM   2296 C CB    . TYR A 1 280 ? 17.755  20.021  38.724  1.00 16.43 ? 280  TYR A CB    1 
ATOM   2297 C CG    . TYR A 1 280 ? 18.665  19.513  39.818  1.00 15.40 ? 280  TYR A CG    1 
ATOM   2298 C CD1   . TYR A 1 280 ? 19.656  20.326  40.355  1.00 12.99 ? 280  TYR A CD1   1 
ATOM   2299 C CD2   . TYR A 1 280 ? 18.518  18.219  40.328  1.00 14.77 ? 280  TYR A CD2   1 
ATOM   2300 C CE1   . TYR A 1 280 ? 20.486  19.868  41.371  1.00 14.45 ? 280  TYR A CE1   1 
ATOM   2301 C CE2   . TYR A 1 280 ? 19.335  17.752  41.347  1.00 13.81 ? 280  TYR A CE2   1 
ATOM   2302 C CZ    . TYR A 1 280 ? 20.318  18.580  41.864  1.00 15.64 ? 280  TYR A CZ    1 
ATOM   2303 O OH    . TYR A 1 280 ? 21.120  18.126  42.882  1.00 17.94 ? 280  TYR A OH    1 
ATOM   2304 N N     . TRP A 1 281 ? 15.749  22.681  38.055  1.00 15.88 ? 281  TRP A N     1 
ATOM   2305 C CA    . TRP A 1 281 ? 15.076  23.384  36.975  1.00 15.79 ? 281  TRP A CA    1 
ATOM   2306 C C     . TRP A 1 281 ? 15.702  24.763  36.731  1.00 16.44 ? 281  TRP A C     1 
ATOM   2307 O O     . TRP A 1 281 ? 16.381  25.309  37.601  1.00 17.41 ? 281  TRP A O     1 
ATOM   2308 C CB    . TRP A 1 281 ? 13.567  23.498  37.272  1.00 14.00 ? 281  TRP A CB    1 
ATOM   2309 C CG    . TRP A 1 281 ? 13.202  24.399  38.416  1.00 15.78 ? 281  TRP A CG    1 
ATOM   2310 C CD1   . TRP A 1 281 ? 13.534  24.238  39.732  1.00 13.32 ? 281  TRP A CD1   1 
ATOM   2311 C CD2   . TRP A 1 281 ? 12.430  25.611  38.342  1.00 15.11 ? 281  TRP A CD2   1 
ATOM   2312 N NE1   . TRP A 1 281 ? 13.018  25.271  40.480  1.00 14.02 ? 281  TRP A NE1   1 
ATOM   2313 C CE2   . TRP A 1 281 ? 12.338  26.129  39.654  1.00 14.05 ? 281  TRP A CE2   1 
ATOM   2314 C CE3   . TRP A 1 281 ? 11.809  26.308  37.292  1.00 14.06 ? 281  TRP A CE3   1 
ATOM   2315 C CZ2   . TRP A 1 281 ? 11.647  27.317  39.951  1.00 15.95 ? 281  TRP A CZ2   1 
ATOM   2316 C CZ3   . TRP A 1 281 ? 11.118  27.494  37.584  1.00 16.40 ? 281  TRP A CZ3   1 
ATOM   2317 C CH2   . TRP A 1 281 ? 11.045  27.984  38.908  1.00 15.12 ? 281  TRP A CH2   1 
ATOM   2318 N N     . ALA A 1 282 ? 15.489  25.304  35.534  1.00 15.63 ? 282  ALA A N     1 
ATOM   2319 C CA    . ALA A 1 282 ? 16.032  26.607  35.153  1.00 16.29 ? 282  ALA A CA    1 
ATOM   2320 C C     . ALA A 1 282 ? 14.907  27.639  34.992  1.00 15.76 ? 282  ALA A C     1 
ATOM   2321 O O     . ALA A 1 282 ? 14.191  27.650  33.987  1.00 12.06 ? 282  ALA A O     1 
ATOM   2322 C CB    . ALA A 1 282 ? 16.825  26.477  33.850  1.00 16.60 ? 282  ALA A CB    1 
ATOM   2323 N N     . PRO A 1 283 ? 14.735  28.508  35.999  1.00 16.73 ? 283  PRO A N     1 
ATOM   2324 C CA    . PRO A 1 283 ? 13.714  29.564  36.034  1.00 19.87 ? 283  PRO A CA    1 
ATOM   2325 C C     . PRO A 1 283 ? 13.668  30.438  34.784  1.00 22.29 ? 283  PRO A C     1 
ATOM   2326 O O     . PRO A 1 283 ? 12.601  30.896  34.382  1.00 22.71 ? 283  PRO A O     1 
ATOM   2327 C CB    . PRO A 1 283 ? 14.089  30.371  37.277  1.00 17.59 ? 283  PRO A CB    1 
ATOM   2328 C CG    . PRO A 1 283 ? 14.656  29.340  38.178  1.00 17.50 ? 283  PRO A CG    1 
ATOM   2329 C CD    . PRO A 1 283 ? 15.525  28.507  37.245  1.00 15.39 ? 283  PRO A CD    1 
ATOM   2330 N N     . ALA A 1 284 ? 14.821  30.675  34.171  1.00 23.04 ? 284  ALA A N     1 
ATOM   2331 C CA    . ALA A 1 284 ? 14.853  31.507  32.976  1.00 26.23 ? 284  ALA A CA    1 
ATOM   2332 C C     . ALA A 1 284 ? 14.131  30.834  31.812  1.00 27.63 ? 284  ALA A C     1 
ATOM   2333 O O     . ALA A 1 284 ? 13.564  31.513  30.956  1.00 29.07 ? 284  ALA A O     1 
ATOM   2334 C CB    . ALA A 1 284 ? 16.303  31.829  32.588  1.00 26.12 ? 284  ALA A CB    1 
ATOM   2335 N N     . ILE A 1 285 ? 14.151  29.503  31.783  1.00 27.42 ? 285  ILE A N     1 
ATOM   2336 C CA    . ILE A 1 285 ? 13.504  28.748  30.712  1.00 28.72 ? 285  ILE A CA    1 
ATOM   2337 C C     . ILE A 1 285 ? 12.117  28.203  31.073  1.00 29.47 ? 285  ILE A C     1 
ATOM   2338 O O     . ILE A 1 285 ? 11.174  28.300  30.280  1.00 26.86 ? 285  ILE A O     1 
ATOM   2339 C CB    . ILE A 1 285 ? 14.385  27.554  30.254  1.00 29.96 ? 285  ILE A CB    1 
ATOM   2340 C CG1   . ILE A 1 285 ? 15.543  28.046  29.379  1.00 32.74 ? 285  ILE A CG1   1 
ATOM   2341 C CG2   . ILE A 1 285 ? 13.549  26.562  29.462  1.00 28.36 ? 285  ILE A CG2   1 
ATOM   2342 C CD1   . ILE A 1 285 ? 16.534  28.931  30.089  1.00 36.35 ? 285  ILE A CD1   1 
ATOM   2343 N N     . GLN A 1 286 ? 11.997  27.618  32.259  1.00 29.05 ? 286  GLN A N     1 
ATOM   2344 C CA    . GLN A 1 286 ? 10.726  27.050  32.693  1.00 31.40 ? 286  GLN A CA    1 
ATOM   2345 C C     . GLN A 1 286 ? 9.854   28.077  33.419  1.00 34.61 ? 286  GLN A C     1 
ATOM   2346 O O     . GLN A 1 286 ? 10.235  28.597  34.464  1.00 34.98 ? 286  GLN A O     1 
ATOM   2347 C CB    . GLN A 1 286 ? 11.000  25.838  33.585  1.00 28.20 ? 286  GLN A CB    1 
ATOM   2348 C CG    . GLN A 1 286 ? 11.695  24.697  32.846  1.00 25.61 ? 286  GLN A CG    1 
ATOM   2349 C CD    . GLN A 1 286 ? 12.376  23.720  33.784  1.00 25.67 ? 286  GLN A CD    1 
ATOM   2350 O OE1   . GLN A 1 286 ? 13.581  23.810  34.035  1.00 25.10 ? 286  GLN A OE1   1 
ATOM   2351 N NE2   . GLN A 1 286 ? 11.605  22.787  34.318  1.00 23.27 ? 286  GLN A NE2   1 
ATOM   2352 N N     . LYS A 1 287 ? 8.681   28.357  32.856  1.00 39.44 ? 287  LYS A N     1 
ATOM   2353 C CA    . LYS A 1 287 ? 7.756   29.334  33.429  1.00 44.56 ? 287  LYS A CA    1 
ATOM   2354 C C     . LYS A 1 287 ? 6.349   28.774  33.598  1.00 47.07 ? 287  LYS A C     1 
ATOM   2355 O O     . LYS A 1 287 ? 6.085   27.621  33.242  1.00 48.22 ? 287  LYS A O     1 
ATOM   2356 C CB    . LYS A 1 287 ? 7.703   30.591  32.548  1.00 45.61 ? 287  LYS A CB    1 
ATOM   2357 C CG    . LYS A 1 287 ? 9.010   31.389  32.470  1.00 46.59 ? 287  LYS A CG    1 
ATOM   2358 C CD    . LYS A 1 287 ? 9.448   31.880  33.844  1.00 48.24 ? 287  LYS A CD    1 
ATOM   2359 C CE    . LYS A 1 287 ? 9.871   33.348  33.821  1.00 49.12 ? 287  LYS A CE    1 
ATOM   2360 N NZ    . LYS A 1 287 ? 8.706   34.272  33.639  1.00 49.85 ? 287  LYS A NZ    1 
ATOM   2361 N N     . LEU A 1 288 ? 5.452   29.588  34.154  1.00 49.85 ? 288  LEU A N     1 
ATOM   2362 C CA    . LEU A 1 288 ? 4.067   29.169  34.366  1.00 52.87 ? 288  LEU A CA    1 
ATOM   2363 C C     . LEU A 1 288 ? 3.208   29.678  33.208  1.00 55.34 ? 288  LEU A C     1 
ATOM   2364 O O     . LEU A 1 288 ? 2.334   30.522  33.347  1.00 56.21 ? 288  LEU A O     1 
ATOM   2365 C CB    . LEU A 1 288 ? 3.547   29.693  35.712  1.00 52.68 ? 288  LEU A CB    1 
ATOM   2366 C CG    . LEU A 1 288 ? 4.161   29.085  36.982  1.00 52.33 ? 288  LEU A CG    1 
ATOM   2367 C CD1   . LEU A 1 288 ? 5.598   29.529  37.140  1.00 52.34 ? 288  LEU A CD1   1 
ATOM   2368 C CD2   . LEU A 1 288 ? 3.361   29.519  38.197  1.00 52.86 ? 288  LEU A CD2   1 
ATOM   2369 N N     . GLU A 1 289 ? 3.505   29.144  32.040  1.00 58.94 ? 289  GLU A N     1 
ATOM   2370 C CA    . GLU A 1 289 ? 2.813   29.493  30.825  1.00 61.65 ? 289  GLU A CA    1 
ATOM   2371 C C     . GLU A 1 289 ? 3.218   28.487  29.775  1.00 61.92 ? 289  GLU A C     1 
ATOM   2372 C CB    . GLU A 1 289 ? 3.191   30.917  30.410  1.00 63.41 ? 289  GLU A CB    1 
ATOM   2373 C CG    . GLU A 1 289 ? 3.404   31.175  28.912  1.00 66.35 ? 289  GLU A CG    1 
ATOM   2374 C CD    . GLU A 1 289 ? 4.274   32.392  28.687  1.00 68.38 ? 289  GLU A CD    1 
ATOM   2375 O OE1   . GLU A 1 289 ? 5.506   32.275  28.868  1.00 68.52 ? 289  GLU A OE1   1 
ATOM   2376 O OE2   . GLU A 1 289 ? 3.730   33.471  28.364  1.00 68.88 ? 289  GLU A OE2   1 
ATOM   2377 O OXT   . GLU A 1 289 ? 2.754   28.641  28.637  1.00 63.50 ? 289  GLU A OXT   1 
ATOM   2378 N N     . PRO B 1 2   ? 10.714  -18.175 79.873  1.00 32.95 ? 2    PRO B N     1 
ATOM   2379 C CA    . PRO B 1 2   ? 11.029  -18.643 78.517  1.00 31.10 ? 2    PRO B CA    1 
ATOM   2380 C C     . PRO B 1 2   ? 12.478  -18.958 78.197  1.00 28.94 ? 2    PRO B C     1 
ATOM   2381 O O     . PRO B 1 2   ? 13.396  -18.693 78.978  1.00 29.78 ? 2    PRO B O     1 
ATOM   2382 C CB    . PRO B 1 2   ? 10.457  -17.604 77.578  1.00 31.43 ? 2    PRO B CB    1 
ATOM   2383 C CG    . PRO B 1 2   ? 9.163   -17.314 78.289  1.00 33.23 ? 2    PRO B CG    1 
ATOM   2384 C CD    . PRO B 1 2   ? 9.528   -17.298 79.812  1.00 33.50 ? 2    PRO B CD    1 
ATOM   2385 N N     . GLU B 1 3   ? 12.660  -19.546 77.024  1.00 26.04 ? 3    GLU B N     1 
ATOM   2386 C CA    . GLU B 1 3   ? 13.965  -19.963 76.563  1.00 22.07 ? 3    GLU B CA    1 
ATOM   2387 C C     . GLU B 1 3   ? 14.466  -19.116 75.397  1.00 19.45 ? 3    GLU B C     1 
ATOM   2388 O O     . GLU B 1 3   ? 13.757  -18.234 74.912  1.00 18.47 ? 3    GLU B O     1 
ATOM   2389 C CB    . GLU B 1 3   ? 13.883  -21.449 76.208  1.00 19.80 ? 3    GLU B CB    1 
ATOM   2390 C CG    . GLU B 1 3   ? 13.463  -22.274 77.421  1.00 21.62 ? 3    GLU B CG    1 
ATOM   2391 C CD    . GLU B 1 3   ? 13.310  -23.763 77.145  1.00 21.69 ? 3    GLU B CD    1 
ATOM   2392 O OE1   . GLU B 1 3   ? 14.036  -24.294 76.284  1.00 22.70 ? 3    GLU B OE1   1 
ATOM   2393 O OE2   . GLU B 1 3   ? 12.478  -24.405 77.818  1.00 21.43 ? 3    GLU B OE2   1 
ATOM   2394 N N     . GLY B 1 4   ? 15.693  -19.383 74.966  1.00 18.67 ? 4    GLY B N     1 
ATOM   2395 C CA    . GLY B 1 4   ? 16.290  -18.631 73.873  1.00 18.53 ? 4    GLY B CA    1 
ATOM   2396 C C     . GLY B 1 4   ? 15.370  -18.201 72.745  1.00 18.40 ? 4    GLY B C     1 
ATOM   2397 O O     . GLY B 1 4   ? 15.276  -17.005 72.451  1.00 19.77 ? 4    GLY B O     1 
ATOM   2398 N N     . PRO B 1 5   ? 14.685  -19.142 72.079  1.00 18.89 ? 5    PRO B N     1 
ATOM   2399 C CA    . PRO B 1 5   ? 13.782  -18.784 70.977  1.00 19.66 ? 5    PRO B CA    1 
ATOM   2400 C C     . PRO B 1 5   ? 12.716  -17.747 71.340  1.00 20.81 ? 5    PRO B C     1 
ATOM   2401 O O     . PRO B 1 5   ? 12.521  -16.787 70.599  1.00 21.04 ? 5    PRO B O     1 
ATOM   2402 C CB    . PRO B 1 5   ? 13.192  -20.129 70.570  1.00 19.51 ? 5    PRO B CB    1 
ATOM   2403 C CG    . PRO B 1 5   ? 14.360  -21.060 70.793  1.00 19.74 ? 5    PRO B CG    1 
ATOM   2404 C CD    . PRO B 1 5   ? 14.848  -20.604 72.168  1.00 20.36 ? 5    PRO B CD    1 
ATOM   2405 N N     . GLU B 1 6   ? 12.033  -17.932 72.470  1.00 19.90 ? 6    GLU B N     1 
ATOM   2406 C CA    . GLU B 1 6   ? 11.015  -16.975 72.897  1.00 21.24 ? 6    GLU B CA    1 
ATOM   2407 C C     . GLU B 1 6   ? 11.607  -15.580 73.110  1.00 19.25 ? 6    GLU B C     1 
ATOM   2408 O O     . GLU B 1 6   ? 11.076  -14.583 72.614  1.00 19.03 ? 6    GLU B O     1 
ATOM   2409 C CB    . GLU B 1 6   ? 10.363  -17.400 74.216  1.00 23.77 ? 6    GLU B CB    1 
ATOM   2410 C CG    . GLU B 1 6   ? 9.264   -18.433 74.111  1.00 32.43 ? 6    GLU B CG    1 
ATOM   2411 C CD    . GLU B 1 6   ? 9.798   -19.828 73.871  1.00 36.07 ? 6    GLU B CD    1 
ATOM   2412 O OE1   . GLU B 1 6   ? 10.894  -20.143 74.388  1.00 37.79 ? 6    GLU B OE1   1 
ATOM   2413 O OE2   . GLU B 1 6   ? 9.112   -20.610 73.182  1.00 38.78 ? 6    GLU B OE2   1 
ATOM   2414 N N     . VAL B 1 7   ? 12.683  -15.521 73.887  1.00 16.63 ? 7    VAL B N     1 
ATOM   2415 C CA    . VAL B 1 7   ? 13.352  -14.263 74.180  1.00 16.34 ? 7    VAL B CA    1 
ATOM   2416 C C     . VAL B 1 7   ? 13.764  -13.566 72.880  1.00 15.31 ? 7    VAL B C     1 
ATOM   2417 O O     . VAL B 1 7   ? 13.490  -12.384 72.706  1.00 14.11 ? 7    VAL B O     1 
ATOM   2418 C CB    . VAL B 1 7   ? 14.599  -14.498 75.059  1.00 16.72 ? 7    VAL B CB    1 
ATOM   2419 C CG1   . VAL B 1 7   ? 15.365  -13.177 75.259  1.00 16.24 ? 7    VAL B CG1   1 
ATOM   2420 C CG2   . VAL B 1 7   ? 14.174  -15.075 76.400  1.00 13.42 ? 7    VAL B CG2   1 
ATOM   2421 N N     . ALA B 1 8   ? 14.397  -14.309 71.969  1.00 14.15 ? 8    ALA B N     1 
ATOM   2422 C CA    . ALA B 1 8   ? 14.835  -13.762 70.680  1.00 15.09 ? 8    ALA B CA    1 
ATOM   2423 C C     . ALA B 1 8   ? 13.660  -13.174 69.893  1.00 15.22 ? 8    ALA B C     1 
ATOM   2424 O O     . ALA B 1 8   ? 13.699  -12.017 69.463  1.00 13.99 ? 8    ALA B O     1 
ATOM   2425 C CB    . ALA B 1 8   ? 15.517  -14.843 69.852  1.00 13.28 ? 8    ALA B CB    1 
ATOM   2426 N N     . LEU B 1 9   ? 12.619  -13.976 69.702  1.00 13.13 ? 9    LEU B N     1 
ATOM   2427 C CA    . LEU B 1 9   ? 11.444  -13.511 68.981  1.00 14.14 ? 9    LEU B CA    1 
ATOM   2428 C C     . LEU B 1 9   ? 10.839  -12.276 69.665  1.00 15.03 ? 9    LEU B C     1 
ATOM   2429 O O     . LEU B 1 9   ? 10.422  -11.333 68.996  1.00 16.90 ? 9    LEU B O     1 
ATOM   2430 C CB    . LEU B 1 9   ? 10.405  -14.626 68.899  1.00 14.17 ? 9    LEU B CB    1 
ATOM   2431 C CG    . LEU B 1 9   ? 9.137   -14.320 68.096  1.00 17.17 ? 9    LEU B CG    1 
ATOM   2432 C CD1   . LEU B 1 9   ? 9.513   -13.923 66.662  1.00 16.93 ? 9    LEU B CD1   1 
ATOM   2433 C CD2   . LEU B 1 9   ? 8.237   -15.553 68.086  1.00 16.94 ? 9    LEU B CD2   1 
ATOM   2434 N N     . THR B 1 10  ? 10.794  -12.277 70.995  1.00 13.87 ? 10   THR B N     1 
ATOM   2435 C CA    . THR B 1 10  ? 10.237  -11.140 71.725  1.00 14.56 ? 10   THR B CA    1 
ATOM   2436 C C     . THR B 1 10  ? 11.037  -9.882  71.405  1.00 13.86 ? 10   THR B C     1 
ATOM   2437 O O     . THR B 1 10  ? 10.470  -8.819  71.191  1.00 15.05 ? 10   THR B O     1 
ATOM   2438 C CB    . THR B 1 10  ? 10.244  -11.390 73.258  1.00 14.48 ? 10   THR B CB    1 
ATOM   2439 O OG1   . THR B 1 10  ? 9.409   -12.516 73.554  1.00 14.70 ? 10   THR B OG1   1 
ATOM   2440 C CG2   . THR B 1 10  ? 9.717   -10.166 74.019  1.00 12.32 ? 10   THR B CG2   1 
ATOM   2441 N N     . ALA B 1 11  ? 12.358  -10.007 71.356  1.00 16.22 ? 11   ALA B N     1 
ATOM   2442 C CA    . ALA B 1 11  ? 13.214  -8.863  71.045  1.00 15.87 ? 11   ALA B CA    1 
ATOM   2443 C C     . ALA B 1 11  ? 12.907  -8.299  69.664  1.00 16.86 ? 11   ALA B C     1 
ATOM   2444 O O     . ALA B 1 11  ? 12.817  -7.071  69.490  1.00 16.35 ? 11   ALA B O     1 
ATOM   2445 C CB    . ALA B 1 11  ? 14.684  -9.259  71.133  1.00 15.58 ? 11   ALA B CB    1 
ATOM   2446 N N     . ASP B 1 12  ? 12.750  -9.187  68.681  1.00 16.79 ? 12   ASP B N     1 
ATOM   2447 C CA    . ASP B 1 12  ? 12.444  -8.753  67.315  1.00 18.61 ? 12   ASP B CA    1 
ATOM   2448 C C     . ASP B 1 12  ? 11.142  -7.964  67.286  1.00 17.99 ? 12   ASP B C     1 
ATOM   2449 O O     . ASP B 1 12  ? 11.025  -6.960  66.579  1.00 17.51 ? 12   ASP B O     1 
ATOM   2450 C CB    . ASP B 1 12  ? 12.318  -9.949  66.368  1.00 19.08 ? 12   ASP B CB    1 
ATOM   2451 C CG    . ASP B 1 12  ? 13.590  -10.767 66.292  1.00 24.23 ? 12   ASP B CG    1 
ATOM   2452 O OD1   . ASP B 1 12  ? 14.661  -10.230 66.636  1.00 30.78 ? 12   ASP B OD1   1 
ATOM   2453 O OD2   . ASP B 1 12  ? 13.527  -11.941 65.879  1.00 26.29 ? 12   ASP B OD2   1 
ATOM   2454 N N     . ILE B 1 13  ? 10.163  -8.436  68.051  1.00 16.94 ? 13   ILE B N     1 
ATOM   2455 C CA    . ILE B 1 13  ? 8.875   -7.783  68.121  1.00 16.92 ? 13   ILE B CA    1 
ATOM   2456 C C     . ILE B 1 13  ? 8.996   -6.441  68.844  1.00 18.71 ? 13   ILE B C     1 
ATOM   2457 O O     . ILE B 1 13  ? 8.397   -5.452  68.427  1.00 18.86 ? 13   ILE B O     1 
ATOM   2458 C CB    . ILE B 1 13  ? 7.853   -8.686  68.827  1.00 17.90 ? 13   ILE B CB    1 
ATOM   2459 C CG1   . ILE B 1 13  ? 7.565   -9.909  67.946  1.00 16.95 ? 13   ILE B CG1   1 
ATOM   2460 C CG2   . ILE B 1 13  ? 6.581   -7.911  69.127  1.00 16.24 ? 13   ILE B CG2   1 
ATOM   2461 C CD1   . ILE B 1 13  ? 6.645   -10.935 68.579  1.00 17.75 ? 13   ILE B CD1   1 
ATOM   2462 N N     . LEU B 1 14  ? 9.780   -6.401  69.917  1.00 19.31 ? 14   LEU B N     1 
ATOM   2463 C CA    . LEU B 1 14  ? 9.961   -5.155  70.654  1.00 20.45 ? 14   LEU B CA    1 
ATOM   2464 C C     . LEU B 1 14  ? 10.687  -4.150  69.761  1.00 21.77 ? 14   LEU B C     1 
ATOM   2465 O O     . LEU B 1 14  ? 10.396  -2.955  69.788  1.00 21.35 ? 14   LEU B O     1 
ATOM   2466 C CB    . LEU B 1 14  ? 10.756  -5.405  71.942  1.00 19.40 ? 14   LEU B CB    1 
ATOM   2467 C CG    . LEU B 1 14  ? 10.051  -6.182  73.066  1.00 19.04 ? 14   LEU B CG    1 
ATOM   2468 C CD1   . LEU B 1 14  ? 11.068  -6.572  74.139  1.00 16.76 ? 14   LEU B CD1   1 
ATOM   2469 C CD2   . LEU B 1 14  ? 8.941   -5.328  73.673  1.00 16.19 ? 14   LEU B CD2   1 
ATOM   2470 N N     . GLU B 1 15  ? 11.631  -4.643  68.966  1.00 23.62 ? 15   GLU B N     1 
ATOM   2471 C CA    . GLU B 1 15  ? 12.383  -3.793  68.046  1.00 26.11 ? 15   GLU B CA    1 
ATOM   2472 C C     . GLU B 1 15  ? 11.464  -3.200  66.988  1.00 26.98 ? 15   GLU B C     1 
ATOM   2473 O O     . GLU B 1 15  ? 11.577  -2.034  66.634  1.00 27.24 ? 15   GLU B O     1 
ATOM   2474 C CB    . GLU B 1 15  ? 13.459  -4.597  67.325  1.00 27.96 ? 15   GLU B CB    1 
ATOM   2475 C CG    . GLU B 1 15  ? 14.759  -4.746  68.062  1.00 33.50 ? 15   GLU B CG    1 
ATOM   2476 C CD    . GLU B 1 15  ? 15.912  -4.160  67.280  1.00 35.58 ? 15   GLU B CD    1 
ATOM   2477 O OE1   . GLU B 1 15  ? 15.923  -4.325  66.042  1.00 36.75 ? 15   GLU B OE1   1 
ATOM   2478 O OE2   . GLU B 1 15  ? 16.808  -3.547  67.897  1.00 37.20 ? 15   GLU B OE2   1 
ATOM   2479 N N     . LYS B 1 16  ? 10.561  -4.025  66.476  1.00 27.83 ? 16   LYS B N     1 
ATOM   2480 C CA    . LYS B 1 16  ? 9.631   -3.594  65.442  1.00 28.14 ? 16   LYS B CA    1 
ATOM   2481 C C     . LYS B 1 16  ? 8.688   -2.476  65.886  1.00 27.57 ? 16   LYS B C     1 
ATOM   2482 O O     . LYS B 1 16  ? 8.355   -1.590  65.107  1.00 27.90 ? 16   LYS B O     1 
ATOM   2483 C CB    . LYS B 1 16  ? 8.811   -4.791  64.955  1.00 26.04 ? 16   LYS B CB    1 
ATOM   2484 C CG    . LYS B 1 16  ? 7.706   -4.430  63.986  1.00 27.48 ? 16   LYS B CG    1 
ATOM   2485 C CD    . LYS B 1 16  ? 6.903   -5.658  63.615  1.00 30.61 ? 16   LYS B CD    1 
ATOM   2486 C CE    . LYS B 1 16  ? 5.604   -5.278  62.931  1.00 30.86 ? 16   LYS B CE    1 
ATOM   2487 N NZ    . LYS B 1 16  ? 4.796   -6.482  62.596  1.00 32.88 ? 16   LYS B NZ    1 
ATOM   2488 N N     . TYR B 1 17  ? 8.257   -2.511  67.135  1.00 27.28 ? 17   TYR B N     1 
ATOM   2489 C CA    . TYR B 1 17  ? 7.337   -1.493  67.613  1.00 28.00 ? 17   TYR B CA    1 
ATOM   2490 C C     . TYR B 1 17  ? 7.996   -0.358  68.380  1.00 27.49 ? 17   TYR B C     1 
ATOM   2491 O O     . TYR B 1 17  ? 7.412   0.721   68.513  1.00 28.06 ? 17   TYR B O     1 
ATOM   2492 C CB    . TYR B 1 17  ? 6.264   -2.134  68.492  1.00 28.27 ? 17   TYR B CB    1 
ATOM   2493 C CG    . TYR B 1 17  ? 5.318   -3.039  67.736  1.00 31.88 ? 17   TYR B CG    1 
ATOM   2494 C CD1   . TYR B 1 17  ? 4.319   -2.511  66.923  1.00 32.06 ? 17   TYR B CD1   1 
ATOM   2495 C CD2   . TYR B 1 17  ? 5.425   -4.427  67.828  1.00 31.64 ? 17   TYR B CD2   1 
ATOM   2496 C CE1   . TYR B 1 17  ? 3.447   -3.342  66.220  1.00 33.78 ? 17   TYR B CE1   1 
ATOM   2497 C CE2   . TYR B 1 17  ? 4.561   -5.264  67.130  1.00 32.31 ? 17   TYR B CE2   1 
ATOM   2498 C CZ    . TYR B 1 17  ? 3.575   -4.714  66.330  1.00 34.15 ? 17   TYR B CZ    1 
ATOM   2499 O OH    . TYR B 1 17  ? 2.714   -5.537  65.644  1.00 37.78 ? 17   TYR B OH    1 
ATOM   2500 N N     . PHE B 1 18  ? 9.218   -0.569  68.857  1.00 24.22 ? 18   PHE B N     1 
ATOM   2501 C CA    . PHE B 1 18  ? 9.845   0.469   69.651  1.00 23.19 ? 18   PHE B CA    1 
ATOM   2502 C C     . PHE B 1 18  ? 11.180  1.035   69.206  1.00 23.87 ? 18   PHE B C     1 
ATOM   2503 O O     . PHE B 1 18  ? 11.583  2.101   69.675  1.00 23.52 ? 18   PHE B O     1 
ATOM   2504 C CB    . PHE B 1 18  ? 9.908   -0.016  71.099  1.00 20.56 ? 18   PHE B CB    1 
ATOM   2505 C CG    . PHE B 1 18  ? 8.553   -0.301  71.676  1.00 21.39 ? 18   PHE B CG    1 
ATOM   2506 C CD1   . PHE B 1 18  ? 7.686   0.739   71.985  1.00 20.66 ? 18   PHE B CD1   1 
ATOM   2507 C CD2   . PHE B 1 18  ? 8.108   -1.610  71.842  1.00 21.39 ? 18   PHE B CD2   1 
ATOM   2508 C CE1   . PHE B 1 18  ? 6.393   0.487   72.446  1.00 20.01 ? 18   PHE B CE1   1 
ATOM   2509 C CE2   . PHE B 1 18  ? 6.820   -1.870  72.304  1.00 22.55 ? 18   PHE B CE2   1 
ATOM   2510 C CZ    . PHE B 1 18  ? 5.960   -0.814  72.606  1.00 21.46 ? 18   PHE B CZ    1 
ATOM   2511 N N     . LYS B 1 19  ? 11.874  0.343   68.312  1.00 24.14 ? 19   LYS B N     1 
ATOM   2512 C CA    . LYS B 1 19  ? 13.149  0.860   67.835  1.00 26.15 ? 19   LYS B CA    1 
ATOM   2513 C C     . LYS B 1 19  ? 12.884  2.252   67.254  1.00 24.89 ? 19   LYS B C     1 
ATOM   2514 O O     . LYS B 1 19  ? 11.963  2.428   66.458  1.00 24.02 ? 19   LYS B O     1 
ATOM   2515 C CB    . LYS B 1 19  ? 13.724  -0.051  66.753  1.00 28.04 ? 19   LYS B CB    1 
ATOM   2516 C CG    . LYS B 1 19  ? 15.025  0.451   66.134  1.00 30.82 ? 19   LYS B CG    1 
ATOM   2517 C CD    . LYS B 1 19  ? 15.528  -0.538  65.095  1.00 33.70 ? 19   LYS B CD    1 
ATOM   2518 C CE    . LYS B 1 19  ? 16.728  0.007   64.344  1.00 36.54 ? 19   LYS B CE    1 
ATOM   2519 N NZ    . LYS B 1 19  ? 17.847  0.331   65.263  1.00 37.26 ? 19   LYS B NZ    1 
ATOM   2520 N N     . GLY B 1 20  ? 13.675  3.235   67.675  1.00 24.43 ? 20   GLY B N     1 
ATOM   2521 C CA    . GLY B 1 20  ? 13.504  4.591   67.186  1.00 24.24 ? 20   GLY B CA    1 
ATOM   2522 C C     . GLY B 1 20  ? 12.537  5.444   67.992  1.00 27.69 ? 20   GLY B C     1 
ATOM   2523 O O     . GLY B 1 20  ? 12.522  6.669   67.839  1.00 29.17 ? 20   GLY B O     1 
ATOM   2524 N N     . LYS B 1 21  ? 11.731  4.816   68.848  1.00 26.20 ? 21   LYS B N     1 
ATOM   2525 C CA    . LYS B 1 21  ? 10.766  5.551   69.658  1.00 26.13 ? 21   LYS B CA    1 
ATOM   2526 C C     . LYS B 1 21  ? 11.415  6.160   70.888  1.00 27.06 ? 21   LYS B C     1 
ATOM   2527 O O     . LYS B 1 21  ? 12.488  5.733   71.319  1.00 26.41 ? 21   LYS B O     1 
ATOM   2528 C CB    . LYS B 1 21  ? 9.614   4.639   70.093  1.00 28.76 ? 21   LYS B CB    1 
ATOM   2529 C CG    . LYS B 1 21  ? 8.905   3.935   68.937  1.00 32.26 ? 21   LYS B CG    1 
ATOM   2530 C CD    . LYS B 1 21  ? 8.550   4.917   67.834  1.00 34.49 ? 21   LYS B CD    1 
ATOM   2531 C CE    . LYS B 1 21  ? 7.905   4.225   66.640  1.00 38.73 ? 21   LYS B CE    1 
ATOM   2532 N NZ    . LYS B 1 21  ? 6.543   3.721   66.966  1.00 40.60 ? 21   LYS B NZ    1 
ATOM   2533 N N     . THR B 1 22  ? 10.761  7.166   71.457  1.00 26.14 ? 22   THR B N     1 
ATOM   2534 C CA    . THR B 1 22  ? 11.298  7.826   72.633  1.00 26.57 ? 22   THR B CA    1 
ATOM   2535 C C     . THR B 1 22  ? 10.625  7.327   73.902  1.00 25.13 ? 22   THR B C     1 
ATOM   2536 O O     . THR B 1 22  ? 9.415   7.432   74.049  1.00 25.58 ? 22   THR B O     1 
ATOM   2537 C CB    . THR B 1 22  ? 11.120  9.357   72.546  1.00 28.26 ? 22   THR B CB    1 
ATOM   2538 O OG1   . THR B 1 22  ? 11.785  9.846   71.378  1.00 26.21 ? 22   THR B OG1   1 
ATOM   2539 C CG2   . THR B 1 22  ? 11.715  10.032  73.773  1.00 26.92 ? 22   THR B CG2   1 
ATOM   2540 N N     . LEU B 1 23  ? 11.421  6.770   74.808  1.00 23.67 ? 23   LEU B N     1 
ATOM   2541 C CA    . LEU B 1 23  ? 10.905  6.276   76.073  1.00 22.72 ? 23   LEU B CA    1 
ATOM   2542 C C     . LEU B 1 23  ? 10.864  7.460   77.025  1.00 23.98 ? 23   LEU B C     1 
ATOM   2543 O O     . LEU B 1 23  ? 11.878  8.126   77.241  1.00 25.06 ? 23   LEU B O     1 
ATOM   2544 C CB    . LEU B 1 23  ? 11.823  5.196   76.637  1.00 19.24 ? 23   LEU B CB    1 
ATOM   2545 C CG    . LEU B 1 23  ? 11.470  4.664   78.030  1.00 19.90 ? 23   LEU B CG    1 
ATOM   2546 C CD1   . LEU B 1 23  ? 10.131  3.922   78.004  1.00 14.00 ? 23   LEU B CD1   1 
ATOM   2547 C CD2   . LEU B 1 23  ? 12.592  3.749   78.499  1.00 18.10 ? 23   LEU B CD2   1 
ATOM   2548 N N     . GLU B 1 24  ? 9.697   7.732   77.589  1.00 24.59 ? 24   GLU B N     1 
ATOM   2549 C CA    . GLU B 1 24  ? 9.560   8.858   78.501  1.00 27.70 ? 24   GLU B CA    1 
ATOM   2550 C C     . GLU B 1 24  ? 9.566   8.445   79.967  1.00 27.58 ? 24   GLU B C     1 
ATOM   2551 O O     . GLU B 1 24  ? 10.086  9.170   80.809  1.00 28.52 ? 24   GLU B O     1 
ATOM   2552 C CB    . GLU B 1 24  ? 8.289   9.644   78.161  1.00 28.45 ? 24   GLU B CB    1 
ATOM   2553 C CG    . GLU B 1 24  ? 8.404   10.402  76.835  1.00 32.64 ? 24   GLU B CG    1 
ATOM   2554 C CD    . GLU B 1 24  ? 7.062   10.895  76.299  1.00 36.09 ? 24   GLU B CD    1 
ATOM   2555 O OE1   . GLU B 1 24  ? 7.048   11.511  75.208  1.00 34.33 ? 24   GLU B OE1   1 
ATOM   2556 O OE2   . GLU B 1 24  ? 6.024   10.661  76.964  1.00 37.60 ? 24   GLU B OE2   1 
ATOM   2557 N N     . TYR B 1 25  ? 9.012   7.276   80.273  1.00 28.13 ? 25   TYR B N     1 
ATOM   2558 C CA    . TYR B 1 25  ? 8.988   6.810   81.652  1.00 29.66 ? 25   TYR B CA    1 
ATOM   2559 C C     . TYR B 1 25  ? 8.852   5.293   81.797  1.00 27.68 ? 25   TYR B C     1 
ATOM   2560 O O     . TYR B 1 25  ? 8.387   4.614   80.884  1.00 26.72 ? 25   TYR B O     1 
ATOM   2561 C CB    . TYR B 1 25  ? 7.834   7.479   82.408  1.00 33.50 ? 25   TYR B CB    1 
ATOM   2562 C CG    . TYR B 1 25  ? 7.961   7.363   83.911  1.00 39.47 ? 25   TYR B CG    1 
ATOM   2563 C CD1   . TYR B 1 25  ? 6.830   7.249   84.720  1.00 41.72 ? 25   TYR B CD1   1 
ATOM   2564 C CD2   . TYR B 1 25  ? 9.216   7.399   84.532  1.00 39.09 ? 25   TYR B CD2   1 
ATOM   2565 C CE1   . TYR B 1 25  ? 6.942   7.175   86.109  1.00 43.44 ? 25   TYR B CE1   1 
ATOM   2566 C CE2   . TYR B 1 25  ? 9.337   7.327   85.916  1.00 41.20 ? 25   TYR B CE2   1 
ATOM   2567 C CZ    . TYR B 1 25  ? 8.197   7.216   86.700  1.00 43.49 ? 25   TYR B CZ    1 
ATOM   2568 O OH    . TYR B 1 25  ? 8.310   7.155   88.071  1.00 44.94 ? 25   TYR B OH    1 
ATOM   2569 N N     . ILE B 1 26  ? 9.272   4.776   82.951  1.00 26.83 ? 26   ILE B N     1 
ATOM   2570 C CA    . ILE B 1 26  ? 9.162   3.352   83.266  1.00 27.40 ? 26   ILE B CA    1 
ATOM   2571 C C     . ILE B 1 26  ? 8.538   3.293   84.649  1.00 26.96 ? 26   ILE B C     1 
ATOM   2572 O O     . ILE B 1 26  ? 8.997   3.969   85.567  1.00 27.17 ? 26   ILE B O     1 
ATOM   2573 C CB    . ILE B 1 26  ? 10.520  2.623   83.367  1.00 28.49 ? 26   ILE B CB    1 
ATOM   2574 C CG1   . ILE B 1 26  ? 11.584  3.344   82.549  1.00 31.08 ? 26   ILE B CG1   1 
ATOM   2575 C CG2   . ILE B 1 26  ? 10.366  1.185   82.917  1.00 27.71 ? 26   ILE B CG2   1 
ATOM   2576 C CD1   . ILE B 1 26  ? 12.297  4.407   83.342  1.00 33.33 ? 26   ILE B CD1   1 
ATOM   2577 N N     . ASP B 1 27  ? 7.502   2.480   84.796  1.00 26.47 ? 27   ASP B N     1 
ATOM   2578 C CA    . ASP B 1 27  ? 6.806   2.344   86.065  1.00 27.14 ? 27   ASP B CA    1 
ATOM   2579 C C     . ASP B 1 27  ? 6.624   0.891   86.478  1.00 26.29 ? 27   ASP B C     1 
ATOM   2580 O O     . ASP B 1 27  ? 6.083   0.081   85.724  1.00 25.62 ? 27   ASP B O     1 
ATOM   2581 C CB    . ASP B 1 27  ? 5.427   3.000   85.974  1.00 32.15 ? 27   ASP B CB    1 
ATOM   2582 C CG    . ASP B 1 27  ? 5.354   4.315   86.718  1.00 38.88 ? 27   ASP B CG    1 
ATOM   2583 O OD1   . ASP B 1 27  ? 4.291   4.967   86.660  1.00 43.18 ? 27   ASP B OD1   1 
ATOM   2584 O OD2   . ASP B 1 27  ? 6.351   4.699   87.366  1.00 45.53 ? 27   ASP B OD2   1 
ATOM   2585 N N     . PHE B 1 28  ? 7.082   0.560   87.679  1.00 24.88 ? 28   PHE B N     1 
ATOM   2586 C CA    . PHE B 1 28  ? 6.917   -0.788  88.184  1.00 24.87 ? 28   PHE B CA    1 
ATOM   2587 C C     . PHE B 1 28  ? 5.703   -0.738  89.091  1.00 24.42 ? 28   PHE B C     1 
ATOM   2588 O O     . PHE B 1 28  ? 5.813   -0.461  90.283  1.00 24.89 ? 28   PHE B O     1 
ATOM   2589 C CB    . PHE B 1 28  ? 8.175   -1.233  88.925  1.00 21.61 ? 28   PHE B CB    1 
ATOM   2590 C CG    . PHE B 1 28  ? 9.362   -1.397  88.022  1.00 21.37 ? 28   PHE B CG    1 
ATOM   2591 C CD1   . PHE B 1 28  ? 10.247  -0.342  87.807  1.00 20.26 ? 28   PHE B CD1   1 
ATOM   2592 C CD2   . PHE B 1 28  ? 9.566   -2.596  87.335  1.00 19.29 ? 28   PHE B CD2   1 
ATOM   2593 C CE1   . PHE B 1 28  ? 11.319  -0.482  86.916  1.00 21.03 ? 28   PHE B CE1   1 
ATOM   2594 C CE2   . PHE B 1 28  ? 10.630  -2.747  86.444  1.00 18.31 ? 28   PHE B CE2   1 
ATOM   2595 C CZ    . PHE B 1 28  ? 11.509  -1.689  86.232  1.00 20.91 ? 28   PHE B CZ    1 
ATOM   2596 N N     . ILE B 1 29  ? 4.542   -0.984  88.487  1.00 24.19 ? 29   ILE B N     1 
ATOM   2597 C CA    . ILE B 1 29  ? 3.248   -0.942  89.170  1.00 23.77 ? 29   ILE B CA    1 
ATOM   2598 C C     . ILE B 1 29  ? 2.983   -2.041  90.195  1.00 24.55 ? 29   ILE B C     1 
ATOM   2599 O O     . ILE B 1 29  ? 2.102   -1.897  91.039  1.00 24.33 ? 29   ILE B O     1 
ATOM   2600 C CB    . ILE B 1 29  ? 2.088   -0.965  88.152  1.00 23.99 ? 29   ILE B CB    1 
ATOM   2601 C CG1   . ILE B 1 29  ? 2.118   -2.278  87.369  1.00 23.02 ? 29   ILE B CG1   1 
ATOM   2602 C CG2   . ILE B 1 29  ? 2.198   0.223   87.204  1.00 22.33 ? 29   ILE B CG2   1 
ATOM   2603 C CD1   . ILE B 1 29  ? 0.982   -2.415  86.403  1.00 27.83 ? 29   ILE B CD1   1 
ATOM   2604 N N     . SER B 1 30  ? 3.711   -3.148  90.111  1.00 22.84 ? 30   SER B N     1 
ATOM   2605 C CA    . SER B 1 30  ? 3.530   -4.227  91.075  1.00 22.33 ? 30   SER B CA    1 
ATOM   2606 C C     . SER B 1 30  ? 4.722   -5.165  91.046  1.00 21.79 ? 30   SER B C     1 
ATOM   2607 O O     . SER B 1 30  ? 5.681   -4.947  90.307  1.00 21.25 ? 30   SER B O     1 
ATOM   2608 C CB    . SER B 1 30  ? 2.241   -5.011  90.794  1.00 22.14 ? 30   SER B CB    1 
ATOM   2609 O OG    . SER B 1 30  ? 2.311   -5.730  89.574  1.00 24.33 ? 30   SER B OG    1 
ATOM   2610 N N     . GLY B 1 31  ? 4.663   -6.207  91.863  1.00 21.99 ? 31   GLY B N     1 
ATOM   2611 C CA    . GLY B 1 31  ? 5.753   -7.156  91.906  1.00 21.90 ? 31   GLY B CA    1 
ATOM   2612 C C     . GLY B 1 31  ? 6.916   -6.662  92.738  1.00 22.30 ? 31   GLY B C     1 
ATOM   2613 O O     . GLY B 1 31  ? 6.814   -5.643  93.426  1.00 21.95 ? 31   GLY B O     1 
ATOM   2614 N N     . ARG B 1 32  ? 8.029   -7.385  92.645  1.00 20.74 ? 32   ARG B N     1 
ATOM   2615 C CA    . ARG B 1 32  ? 9.241   -7.088  93.393  1.00 20.76 ? 32   ARG B CA    1 
ATOM   2616 C C     . ARG B 1 32  ? 9.765   -5.671  93.253  1.00 19.85 ? 32   ARG B C     1 
ATOM   2617 O O     . ARG B 1 32  ? 10.282  -5.106  94.213  1.00 21.09 ? 32   ARG B O     1 
ATOM   2618 C CB    . ARG B 1 32  ? 10.356  -8.059  92.989  1.00 20.76 ? 32   ARG B CB    1 
ATOM   2619 C CG    . ARG B 1 32  ? 10.975  -7.748  91.638  1.00 23.88 ? 32   ARG B CG    1 
ATOM   2620 C CD    . ARG B 1 32  ? 11.837  -8.891  91.134  1.00 25.54 ? 32   ARG B CD    1 
ATOM   2621 N NE    . ARG B 1 32  ? 12.990  -9.163  91.987  1.00 27.23 ? 32   ARG B NE    1 
ATOM   2622 C CZ    . ARG B 1 32  ? 13.845  -10.162 91.775  1.00 28.81 ? 32   ARG B CZ    1 
ATOM   2623 N NH1   . ARG B 1 32  ? 13.670  -10.978 90.741  1.00 27.58 ? 32   ARG B NH1   1 
ATOM   2624 N NH2   . ARG B 1 32  ? 14.877  -10.343 92.587  1.00 28.52 ? 32   ARG B NH2   1 
ATOM   2625 N N     . TYR B 1 33  ? 9.630   -5.082  92.074  1.00 18.21 ? 33   TYR B N     1 
ATOM   2626 C CA    . TYR B 1 33  ? 10.174  -3.747  91.878  1.00 17.63 ? 33   TYR B CA    1 
ATOM   2627 C C     . TYR B 1 33  ? 9.292   -2.594  92.318  1.00 18.18 ? 33   TYR B C     1 
ATOM   2628 O O     . TYR B 1 33  ? 9.715   -1.442  92.291  1.00 19.51 ? 33   TYR B O     1 
ATOM   2629 C CB    . TYR B 1 33  ? 10.639  -3.587  90.425  1.00 17.34 ? 33   TYR B CB    1 
ATOM   2630 C CG    . TYR B 1 33  ? 11.790  -4.523  90.103  1.00 17.03 ? 33   TYR B CG    1 
ATOM   2631 C CD1   . TYR B 1 33  ? 12.905  -4.587  90.941  1.00 17.70 ? 33   TYR B CD1   1 
ATOM   2632 C CD2   . TYR B 1 33  ? 11.752  -5.367  88.990  1.00 15.18 ? 33   TYR B CD2   1 
ATOM   2633 C CE1   . TYR B 1 33  ? 13.959  -5.468  90.689  1.00 16.10 ? 33   TYR B CE1   1 
ATOM   2634 C CE2   . TYR B 1 33  ? 12.803  -6.258  88.728  1.00 14.80 ? 33   TYR B CE2   1 
ATOM   2635 C CZ    . TYR B 1 33  ? 13.901  -6.304  89.583  1.00 16.53 ? 33   TYR B CZ    1 
ATOM   2636 O OH    . TYR B 1 33  ? 14.927  -7.197  89.357  1.00 13.45 ? 33   TYR B OH    1 
ATOM   2637 N N     . SER B 1 34  ? 8.072   -2.898  92.742  1.00 19.20 ? 34   SER B N     1 
ATOM   2638 C CA    . SER B 1 34  ? 7.183   -1.856  93.230  1.00 22.16 ? 34   SER B CA    1 
ATOM   2639 C C     . SER B 1 34  ? 7.508   -1.661  94.719  1.00 23.96 ? 34   SER B C     1 
ATOM   2640 O O     . SER B 1 34  ? 7.060   -0.704  95.340  1.00 25.13 ? 34   SER B O     1 
ATOM   2641 C CB    . SER B 1 34  ? 5.718   -2.272  93.062  1.00 21.05 ? 34   SER B CB    1 
ATOM   2642 O OG    . SER B 1 34  ? 5.416   -3.407  93.856  1.00 21.79 ? 34   SER B OG    1 
ATOM   2643 N N     . LYS B 1 35  ? 8.303   -2.577  95.272  1.00 25.40 ? 35   LYS B N     1 
ATOM   2644 C CA    . LYS B 1 35  ? 8.697   -2.537  96.682  1.00 27.72 ? 35   LYS B CA    1 
ATOM   2645 C C     . LYS B 1 35  ? 10.151  -2.122  96.862  1.00 27.65 ? 35   LYS B C     1 
ATOM   2646 O O     . LYS B 1 35  ? 10.519  -1.575  97.893  1.00 27.86 ? 35   LYS B O     1 
ATOM   2647 C CB    . LYS B 1 35  ? 8.485   -3.910  97.328  1.00 29.08 ? 35   LYS B CB    1 
ATOM   2648 C CG    . LYS B 1 35  ? 7.054   -4.395  97.275  1.00 33.52 ? 35   LYS B CG    1 
ATOM   2649 C CD    . LYS B 1 35  ? 6.945   -5.844  97.704  1.00 36.66 ? 35   LYS B CD    1 
ATOM   2650 C CE    . LYS B 1 35  ? 5.536   -6.372  97.476  1.00 41.11 ? 35   LYS B CE    1 
ATOM   2651 N NZ    . LYS B 1 35  ? 5.402   -7.815  97.845  1.00 43.90 ? 35   LYS B NZ    1 
ATOM   2652 N N     . SER B 1 36  ? 10.978  -2.405  95.862  1.00 28.95 ? 36   SER B N     1 
ATOM   2653 C CA    . SER B 1 36  ? 12.393  -2.044  95.896  1.00 29.47 ? 36   SER B CA    1 
ATOM   2654 C C     . SER B 1 36  ? 12.864  -1.760  94.474  1.00 29.68 ? 36   SER B C     1 
ATOM   2655 O O     . SER B 1 36  ? 12.673  -2.579  93.570  1.00 30.82 ? 36   SER B O     1 
ATOM   2656 C CB    . SER B 1 36  ? 13.219  -3.173  96.520  1.00 31.86 ? 36   SER B CB    1 
ATOM   2657 O OG    . SER B 1 36  ? 12.788  -4.442  96.060  1.00 35.50 ? 36   SER B OG    1 
ATOM   2658 N N     . GLU B 1 37  ? 13.480  -0.598  94.286  1.00 27.33 ? 37   GLU B N     1 
ATOM   2659 C CA    . GLU B 1 37  ? 13.957  -0.170  92.977  1.00 27.46 ? 37   GLU B CA    1 
ATOM   2660 C C     . GLU B 1 37  ? 15.028  -1.063  92.355  1.00 24.13 ? 37   GLU B C     1 
ATOM   2661 O O     . GLU B 1 37  ? 15.931  -1.545  93.032  1.00 22.29 ? 37   GLU B O     1 
ATOM   2662 C CB    . GLU B 1 37  ? 14.504  1.263   93.053  1.00 31.12 ? 37   GLU B CB    1 
ATOM   2663 C CG    . GLU B 1 37  ? 13.573  2.269   93.717  1.00 36.14 ? 37   GLU B CG    1 
ATOM   2664 C CD    . GLU B 1 37  ? 14.043  3.704   93.536  1.00 38.84 ? 37   GLU B CD    1 
ATOM   2665 O OE1   . GLU B 1 37  ? 15.251  3.967   93.740  1.00 39.95 ? 37   GLU B OE1   1 
ATOM   2666 O OE2   . GLU B 1 37  ? 13.202  4.570   93.195  1.00 40.36 ? 37   GLU B OE2   1 
ATOM   2667 N N     . PRO B 1 38  ? 14.932  -1.293  91.040  1.00 23.42 ? 38   PRO B N     1 
ATOM   2668 C CA    . PRO B 1 38  ? 15.928  -2.130  90.369  1.00 22.43 ? 38   PRO B CA    1 
ATOM   2669 C C     . PRO B 1 38  ? 17.267  -1.409  90.446  1.00 22.25 ? 38   PRO B C     1 
ATOM   2670 O O     . PRO B 1 38  ? 17.314  -0.197  90.649  1.00 22.35 ? 38   PRO B O     1 
ATOM   2671 C CB    . PRO B 1 38  ? 15.407  -2.206  88.939  1.00 20.69 ? 38   PRO B CB    1 
ATOM   2672 C CG    . PRO B 1 38  ? 13.928  -2.044  89.101  1.00 23.49 ? 38   PRO B CG    1 
ATOM   2673 C CD    . PRO B 1 38  ? 13.834  -0.943  90.123  1.00 23.08 ? 38   PRO B CD    1 
ATOM   2674 N N     . GLU B 1 39  ? 18.358  -2.142  90.290  1.00 22.78 ? 39   GLU B N     1 
ATOM   2675 C CA    . GLU B 1 39  ? 19.672  -1.516  90.336  1.00 24.43 ? 39   GLU B CA    1 
ATOM   2676 C C     . GLU B 1 39  ? 19.809  -0.455  89.223  1.00 23.24 ? 39   GLU B C     1 
ATOM   2677 O O     . GLU B 1 39  ? 19.476  -0.713  88.062  1.00 22.78 ? 39   GLU B O     1 
ATOM   2678 C CB    . GLU B 1 39  ? 20.752  -2.593  90.193  1.00 27.88 ? 39   GLU B CB    1 
ATOM   2679 C CG    . GLU B 1 39  ? 22.171  -2.067  90.192  1.00 35.50 ? 39   GLU B CG    1 
ATOM   2680 C CD    . GLU B 1 39  ? 23.196  -3.171  90.007  1.00 40.89 ? 39   GLU B CD    1 
ATOM   2681 O OE1   . GLU B 1 39  ? 24.388  -2.843  89.817  1.00 44.07 ? 39   GLU B OE1   1 
ATOM   2682 O OE2   . GLU B 1 39  ? 22.815  -4.365  90.056  1.00 42.38 ? 39   GLU B OE2   1 
ATOM   2683 N N     . GLY B 1 40  ? 20.275  0.737   89.595  1.00 22.42 ? 40   GLY B N     1 
ATOM   2684 C CA    . GLY B 1 40  ? 20.463  1.825   88.642  1.00 20.68 ? 40   GLY B CA    1 
ATOM   2685 C C     . GLY B 1 40  ? 19.224  2.603   88.208  1.00 20.84 ? 40   GLY B C     1 
ATOM   2686 O O     . GLY B 1 40  ? 19.318  3.539   87.406  1.00 21.76 ? 40   GLY B O     1 
ATOM   2687 N N     . TYR B 1 41  ? 18.068  2.242   88.749  1.00 18.53 ? 41   TYR B N     1 
ATOM   2688 C CA    . TYR B 1 41  ? 16.802  2.879   88.389  1.00 18.62 ? 41   TYR B CA    1 
ATOM   2689 C C     . TYR B 1 41  ? 16.700  4.408   88.538  1.00 21.30 ? 41   TYR B C     1 
ATOM   2690 O O     . TYR B 1 41  ? 16.193  5.087   87.646  1.00 19.10 ? 41   TYR B O     1 
ATOM   2691 C CB    . TYR B 1 41  ? 15.684  2.229   89.187  1.00 18.44 ? 41   TYR B CB    1 
ATOM   2692 C CG    . TYR B 1 41  ? 14.308  2.755   88.879  1.00 19.25 ? 41   TYR B CG    1 
ATOM   2693 C CD1   . TYR B 1 41  ? 13.679  2.462   87.667  1.00 19.02 ? 41   TYR B CD1   1 
ATOM   2694 C CD2   . TYR B 1 41  ? 13.607  3.494   89.825  1.00 19.53 ? 41   TYR B CD2   1 
ATOM   2695 C CE1   . TYR B 1 41  ? 12.382  2.886   87.413  1.00 19.15 ? 41   TYR B CE1   1 
ATOM   2696 C CE2   . TYR B 1 41  ? 12.307  3.924   89.583  1.00 22.25 ? 41   TYR B CE2   1 
ATOM   2697 C CZ    . TYR B 1 41  ? 11.699  3.617   88.379  1.00 22.77 ? 41   TYR B CZ    1 
ATOM   2698 O OH    . TYR B 1 41  ? 10.408  4.054   88.152  1.00 24.94 ? 41   TYR B OH    1 
ATOM   2699 N N     . ASP B 1 42  ? 17.157  4.943   89.667  1.00 22.93 ? 42   ASP B N     1 
ATOM   2700 C CA    . ASP B 1 42  ? 17.089  6.381   89.911  1.00 25.38 ? 42   ASP B CA    1 
ATOM   2701 C C     . ASP B 1 42  ? 17.891  7.167   88.876  1.00 25.01 ? 42   ASP B C     1 
ATOM   2702 O O     . ASP B 1 42  ? 17.452  8.212   88.398  1.00 25.07 ? 42   ASP B O     1 
ATOM   2703 C CB    . ASP B 1 42  ? 17.587  6.686   91.326  1.00 29.44 ? 42   ASP B CB    1 
ATOM   2704 C CG    . ASP B 1 42  ? 16.649  6.147   92.400  1.00 34.74 ? 42   ASP B CG    1 
ATOM   2705 O OD1   . ASP B 1 42  ? 17.084  5.993   93.565  1.00 39.06 ? 42   ASP B OD1   1 
ATOM   2706 O OD2   . ASP B 1 42  ? 15.468  5.887   92.080  1.00 35.57 ? 42   ASP B OD2   1 
ATOM   2707 N N     . ASP B 1 43  ? 19.062  6.653   88.528  1.00 24.19 ? 43   ASP B N     1 
ATOM   2708 C CA    . ASP B 1 43  ? 19.909  7.292   87.536  1.00 23.62 ? 43   ASP B CA    1 
ATOM   2709 C C     . ASP B 1 43  ? 19.249  7.285   86.171  1.00 22.95 ? 43   ASP B C     1 
ATOM   2710 O O     . ASP B 1 43  ? 19.253  8.292   85.460  1.00 20.51 ? 43   ASP B O     1 
ATOM   2711 C CB    . ASP B 1 43  ? 21.230  6.553   87.427  1.00 28.67 ? 43   ASP B CB    1 
ATOM   2712 C CG    . ASP B 1 43  ? 22.255  7.079   88.368  1.00 34.21 ? 43   ASP B CG    1 
ATOM   2713 O OD1   . ASP B 1 43  ? 21.905  7.328   89.542  1.00 37.82 ? 43   ASP B OD1   1 
ATOM   2714 O OD2   . ASP B 1 43  ? 23.413  7.238   87.930  1.00 39.30 ? 43   ASP B OD2   1 
ATOM   2715 N N     . PHE B 1 44  ? 18.698  6.132   85.803  1.00 21.46 ? 44   PHE B N     1 
ATOM   2716 C CA    . PHE B 1 44  ? 18.047  5.982   84.512  1.00 21.26 ? 44   PHE B CA    1 
ATOM   2717 C C     . PHE B 1 44  ? 16.892  6.962   84.322  1.00 21.34 ? 44   PHE B C     1 
ATOM   2718 O O     . PHE B 1 44  ? 16.773  7.577   83.265  1.00 20.52 ? 44   PHE B O     1 
ATOM   2719 C CB    . PHE B 1 44  ? 17.529  4.552   84.335  1.00 19.75 ? 44   PHE B CB    1 
ATOM   2720 C CG    . PHE B 1 44  ? 16.949  4.289   82.978  1.00 16.93 ? 44   PHE B CG    1 
ATOM   2721 C CD1   . PHE B 1 44  ? 15.578  4.186   82.800  1.00 15.64 ? 44   PHE B CD1   1 
ATOM   2722 C CD2   . PHE B 1 44  ? 17.781  4.144   81.874  1.00 15.95 ? 44   PHE B CD2   1 
ATOM   2723 C CE1   . PHE B 1 44  ? 15.036  3.940   81.539  1.00 14.91 ? 44   PHE B CE1   1 
ATOM   2724 C CE2   . PHE B 1 44  ? 17.254  3.898   80.606  1.00 16.74 ? 44   PHE B CE2   1 
ATOM   2725 C CZ    . PHE B 1 44  ? 15.874  3.795   80.440  1.00 16.17 ? 44   PHE B CZ    1 
ATOM   2726 N N     . ILE B 1 45  ? 16.048  7.089   85.344  1.00 21.23 ? 45   ILE B N     1 
ATOM   2727 C CA    . ILE B 1 45  ? 14.894  7.978   85.288  1.00 22.87 ? 45   ILE B CA    1 
ATOM   2728 C C     . ILE B 1 45  ? 15.286  9.444   85.215  1.00 22.05 ? 45   ILE B C     1 
ATOM   2729 O O     . ILE B 1 45  ? 14.590  10.248  84.597  1.00 21.12 ? 45   ILE B O     1 
ATOM   2730 C CB    . ILE B 1 45  ? 13.970  7.782   86.506  1.00 24.79 ? 45   ILE B CB    1 
ATOM   2731 C CG1   . ILE B 1 45  ? 13.226  6.457   86.375  1.00 27.18 ? 45   ILE B CG1   1 
ATOM   2732 C CG2   . ILE B 1 45  ? 12.952  8.913   86.589  1.00 28.48 ? 45   ILE B CG2   1 
ATOM   2733 C CD1   . ILE B 1 45  ? 12.059  6.367   87.315  1.00 32.90 ? 45   ILE B CD1   1 
ATOM   2734 N N     . ALA B 1 46  ? 16.400  9.784   85.847  1.00 20.63 ? 46   ALA B N     1 
ATOM   2735 C CA    . ALA B 1 46  ? 16.877  11.153  85.837  1.00 22.05 ? 46   ALA B CA    1 
ATOM   2736 C C     . ALA B 1 46  ? 17.414  11.497  84.457  1.00 21.98 ? 46   ALA B C     1 
ATOM   2737 O O     . ALA B 1 46  ? 17.674  12.657  84.161  1.00 22.02 ? 46   ALA B O     1 
ATOM   2738 C CB    . ALA B 1 46  ? 17.965  11.331  86.881  1.00 21.88 ? 46   ALA B CB    1 
ATOM   2739 N N     . ASN B 1 47  ? 17.576  10.493  83.604  1.00 21.39 ? 47   ASN B N     1 
ATOM   2740 C CA    . ASN B 1 47  ? 18.098  10.752  82.268  1.00 21.05 ? 47   ASN B CA    1 
ATOM   2741 C C     . ASN B 1 47  ? 17.090  10.574  81.140  1.00 19.56 ? 47   ASN B C     1 
ATOM   2742 O O     . ASN B 1 47  ? 17.425  10.723  79.969  1.00 21.64 ? 47   ASN B O     1 
ATOM   2743 C CB    . ASN B 1 47  ? 19.346  9.905   82.028  1.00 22.81 ? 47   ASN B CB    1 
ATOM   2744 C CG    . ASN B 1 47  ? 20.572  10.488  82.700  1.00 24.67 ? 47   ASN B CG    1 
ATOM   2745 O OD1   . ASN B 1 47  ? 21.201  11.402  82.173  1.00 26.85 ? 47   ASN B OD1   1 
ATOM   2746 N ND2   . ASN B 1 47  ? 20.904  9.978   83.879  1.00 25.69 ? 47   ASN B ND2   1 
ATOM   2747 N N     . LEU B 1 48  ? 15.848  10.261  81.484  1.00 19.54 ? 48   LEU B N     1 
ATOM   2748 C CA    . LEU B 1 48  ? 14.807  10.126  80.458  1.00 20.05 ? 48   LEU B CA    1 
ATOM   2749 C C     . LEU B 1 48  ? 14.348  11.541  80.089  1.00 20.06 ? 48   LEU B C     1 
ATOM   2750 O O     . LEU B 1 48  ? 14.509  12.471  80.874  1.00 19.98 ? 48   LEU B O     1 
ATOM   2751 C CB    . LEU B 1 48  ? 13.629  9.311   80.998  1.00 18.18 ? 48   LEU B CB    1 
ATOM   2752 C CG    . LEU B 1 48  ? 13.916  7.823   81.232  1.00 18.72 ? 48   LEU B CG    1 
ATOM   2753 C CD1   . LEU B 1 48  ? 12.740  7.180   81.929  1.00 17.57 ? 48   LEU B CD1   1 
ATOM   2754 C CD2   . LEU B 1 48  ? 14.197  7.137   79.904  1.00 14.06 ? 48   LEU B CD2   1 
ATOM   2755 N N     . PRO B 1 49  ? 13.755  11.724  78.898  1.00 21.92 ? 49   PRO B N     1 
ATOM   2756 C CA    . PRO B 1 49  ? 13.489  10.734  77.846  1.00 20.71 ? 49   PRO B CA    1 
ATOM   2757 C C     . PRO B 1 49  ? 14.743  10.330  77.092  1.00 20.75 ? 49   PRO B C     1 
ATOM   2758 O O     . PRO B 1 49  ? 15.699  11.105  77.002  1.00 20.83 ? 49   PRO B O     1 
ATOM   2759 C CB    . PRO B 1 49  ? 12.503  11.466  76.944  1.00 20.77 ? 49   PRO B CB    1 
ATOM   2760 C CG    . PRO B 1 49  ? 13.040  12.878  76.991  1.00 23.23 ? 49   PRO B CG    1 
ATOM   2761 C CD    . PRO B 1 49  ? 13.287  13.060  78.483  1.00 22.94 ? 49   PRO B CD    1 
ATOM   2762 N N     . LEU B 1 50  ? 14.738  9.111   76.561  1.00 19.60 ? 50   LEU B N     1 
ATOM   2763 C CA    . LEU B 1 50  ? 15.859  8.590   75.786  1.00 20.50 ? 50   LEU B CA    1 
ATOM   2764 C C     . LEU B 1 50  ? 15.264  7.865   74.578  1.00 21.76 ? 50   LEU B C     1 
ATOM   2765 O O     . LEU B 1 50  ? 14.126  7.394   74.626  1.00 22.29 ? 50   LEU B O     1 
ATOM   2766 C CB    . LEU B 1 50  ? 16.704  7.621   76.623  1.00 20.76 ? 50   LEU B CB    1 
ATOM   2767 C CG    . LEU B 1 50  ? 17.454  8.141   77.863  1.00 21.03 ? 50   LEU B CG    1 
ATOM   2768 C CD1   . LEU B 1 50  ? 18.015  6.956   78.662  1.00 16.96 ? 50   LEU B CD1   1 
ATOM   2769 C CD2   . LEU B 1 50  ? 18.583  9.077   77.440  1.00 20.39 ? 50   LEU B CD2   1 
ATOM   2770 N N     . LYS B 1 51  ? 16.027  7.788   73.495  1.00 23.15 ? 51   LYS B N     1 
ATOM   2771 C CA    . LYS B 1 51  ? 15.563  7.136   72.278  1.00 24.12 ? 51   LYS B CA    1 
ATOM   2772 C C     . LYS B 1 51  ? 16.095  5.705   72.221  1.00 23.57 ? 51   LYS B C     1 
ATOM   2773 O O     . LYS B 1 51  ? 17.265  5.454   72.527  1.00 22.31 ? 51   LYS B O     1 
ATOM   2774 C CB    . LYS B 1 51  ? 16.059  7.925   71.067  1.00 28.78 ? 51   LYS B CB    1 
ATOM   2775 C CG    . LYS B 1 51  ? 15.393  7.590   69.745  1.00 33.25 ? 51   LYS B CG    1 
ATOM   2776 C CD    . LYS B 1 51  ? 15.959  8.495   68.654  1.00 35.72 ? 51   LYS B CD    1 
ATOM   2777 C CE    . LYS B 1 51  ? 15.178  8.400   67.358  1.00 37.16 ? 51   LYS B CE    1 
ATOM   2778 N NZ    . LYS B 1 51  ? 15.769  9.301   66.329  1.00 40.32 ? 51   LYS B NZ    1 
ATOM   2779 N N     . VAL B 1 52  ? 15.232  4.770   71.837  1.00 22.03 ? 52   VAL B N     1 
ATOM   2780 C CA    . VAL B 1 52  ? 15.626  3.370   71.744  1.00 21.45 ? 52   VAL B CA    1 
ATOM   2781 C C     . VAL B 1 52  ? 16.382  3.111   70.447  1.00 22.26 ? 52   VAL B C     1 
ATOM   2782 O O     . VAL B 1 52  ? 15.814  3.211   69.364  1.00 22.36 ? 52   VAL B O     1 
ATOM   2783 C CB    . VAL B 1 52  ? 14.397  2.428   71.778  1.00 21.82 ? 52   VAL B CB    1 
ATOM   2784 C CG1   . VAL B 1 52  ? 14.850  0.971   71.672  1.00 19.78 ? 52   VAL B CG1   1 
ATOM   2785 C CG2   . VAL B 1 52  ? 13.607  2.639   73.055  1.00 19.73 ? 52   VAL B CG2   1 
ATOM   2786 N N     . SER B 1 53  ? 17.663  2.786   70.557  1.00 22.78 ? 53   SER B N     1 
ATOM   2787 C CA    . SER B 1 53  ? 18.464  2.486   69.378  1.00 26.36 ? 53   SER B CA    1 
ATOM   2788 C C     . SER B 1 53  ? 18.427  0.990   69.062  1.00 26.84 ? 53   SER B C     1 
ATOM   2789 O O     . SER B 1 53  ? 18.617  0.593   67.915  1.00 28.00 ? 53   SER B O     1 
ATOM   2790 C CB    . SER B 1 53  ? 19.914  2.924   69.581  1.00 25.52 ? 53   SER B CB    1 
ATOM   2791 O OG    . SER B 1 53  ? 20.501  2.244   70.675  1.00 31.38 ? 53   SER B OG    1 
ATOM   2792 N N     . ASN B 1 54  ? 18.178  0.160   70.071  1.00 27.23 ? 54   ASN B N     1 
ATOM   2793 C CA    . ASN B 1 54  ? 18.136  -1.285  69.851  1.00 27.97 ? 54   ASN B CA    1 
ATOM   2794 C C     . ASN B 1 54  ? 17.567  -2.116  70.988  1.00 25.74 ? 54   ASN B C     1 
ATOM   2795 O O     . ASN B 1 54  ? 17.514  -1.682  72.137  1.00 24.66 ? 54   ASN B O     1 
ATOM   2796 C CB    . ASN B 1 54  ? 19.543  -1.820  69.558  1.00 34.16 ? 54   ASN B CB    1 
ATOM   2797 C CG    . ASN B 1 54  ? 19.848  -1.880  68.082  1.00 40.28 ? 54   ASN B CG    1 
ATOM   2798 O OD1   . ASN B 1 54  ? 19.110  -2.496  67.311  1.00 44.44 ? 54   ASN B OD1   1 
ATOM   2799 N ND2   . ASN B 1 54  ? 20.941  -1.243  67.676  1.00 41.67 ? 54   ASN B ND2   1 
ATOM   2800 N N     . VAL B 1 55  ? 17.161  -3.332  70.632  1.00 23.85 ? 55   VAL B N     1 
ATOM   2801 C CA    . VAL B 1 55  ? 16.638  -4.321  71.566  1.00 24.30 ? 55   VAL B CA    1 
ATOM   2802 C C     . VAL B 1 55  ? 17.251  -5.619  71.051  1.00 24.55 ? 55   VAL B C     1 
ATOM   2803 O O     . VAL B 1 55  ? 16.907  -6.081  69.966  1.00 25.05 ? 55   VAL B O     1 
ATOM   2804 C CB    . VAL B 1 55  ? 15.105  -4.427  71.513  1.00 24.15 ? 55   VAL B CB    1 
ATOM   2805 C CG1   . VAL B 1 55  ? 14.631  -5.481  72.507  1.00 25.98 ? 55   VAL B CG1   1 
ATOM   2806 C CG2   . VAL B 1 55  ? 14.471  -3.085  71.842  1.00 24.97 ? 55   VAL B CG2   1 
ATOM   2807 N N     . ASP B 1 56  ? 18.172  -6.201  71.816  1.00 23.70 ? 56   ASP B N     1 
ATOM   2808 C CA    . ASP B 1 56  ? 18.842  -7.416  71.369  1.00 21.44 ? 56   ASP B CA    1 
ATOM   2809 C C     . ASP B 1 56  ? 18.871  -8.501  72.447  1.00 20.93 ? 56   ASP B C     1 
ATOM   2810 O O     . ASP B 1 56  ? 18.450  -8.269  73.589  1.00 17.49 ? 56   ASP B O     1 
ATOM   2811 C CB    . ASP B 1 56  ? 20.260  -7.044  70.930  1.00 22.87 ? 56   ASP B CB    1 
ATOM   2812 C CG    . ASP B 1 56  ? 20.908  -8.099  70.063  1.00 24.11 ? 56   ASP B CG    1 
ATOM   2813 O OD1   . ASP B 1 56  ? 20.249  -9.098  69.716  1.00 27.91 ? 56   ASP B OD1   1 
ATOM   2814 O OD2   . ASP B 1 56  ? 22.090  -7.917  69.719  1.00 25.97 ? 56   ASP B OD2   1 
ATOM   2815 N N     . THR B 1 57  ? 19.361  -9.686  72.084  1.00 18.53 ? 57   THR B N     1 
ATOM   2816 C CA    . THR B 1 57  ? 19.434  -10.795 73.028  1.00 17.20 ? 57   THR B CA    1 
ATOM   2817 C C     . THR B 1 57  ? 20.604  -11.737 72.820  1.00 17.77 ? 57   THR B C     1 
ATOM   2818 O O     . THR B 1 57  ? 21.174  -11.825 71.732  1.00 18.02 ? 57   THR B O     1 
ATOM   2819 C CB    . THR B 1 57  ? 18.171  -11.698 72.974  1.00 18.70 ? 57   THR B CB    1 
ATOM   2820 O OG1   . THR B 1 57  ? 18.197  -12.497 71.783  1.00 16.43 ? 57   THR B OG1   1 
ATOM   2821 C CG2   . THR B 1 57  ? 16.899  -10.861 73.001  1.00 16.10 ? 57   THR B CG2   1 
ATOM   2822 N N     . LYS B 1 58  ? 20.950  -12.437 73.894  1.00 15.43 ? 58   LYS B N     1 
ATOM   2823 C CA    . LYS B 1 58  ? 21.981  -13.458 73.880  1.00 14.52 ? 58   LYS B CA    1 
ATOM   2824 C C     . LYS B 1 58  ? 21.428  -14.536 74.826  1.00 15.74 ? 58   LYS B C     1 
ATOM   2825 O O     . LYS B 1 58  ? 21.317  -14.317 76.035  1.00 13.44 ? 58   LYS B O     1 
ATOM   2826 C CB    . LYS B 1 58  ? 23.324  -12.938 74.399  1.00 13.03 ? 58   LYS B CB    1 
ATOM   2827 C CG    . LYS B 1 58  ? 24.430  -13.989 74.237  1.00 14.17 ? 58   LYS B CG    1 
ATOM   2828 C CD    . LYS B 1 58  ? 25.803  -13.515 74.681  1.00 13.05 ? 58   LYS B CD    1 
ATOM   2829 C CE    . LYS B 1 58  ? 26.854  -14.600 74.425  1.00 15.26 ? 58   LYS B CE    1 
ATOM   2830 N NZ    . LYS B 1 58  ? 28.234  -14.152 74.787  1.00 12.89 ? 58   LYS B NZ    1 
ATOM   2831 N N     . GLY B 1 59  ? 21.063  -15.691 74.278  1.00 14.80 ? 59   GLY B N     1 
ATOM   2832 C CA    . GLY B 1 59  ? 20.500  -16.736 75.121  1.00 15.90 ? 59   GLY B CA    1 
ATOM   2833 C C     . GLY B 1 59  ? 19.154  -16.278 75.666  1.00 15.48 ? 59   GLY B C     1 
ATOM   2834 O O     . GLY B 1 59  ? 18.262  -15.904 74.907  1.00 14.18 ? 59   GLY B O     1 
ATOM   2835 N N     . LYS B 1 60  ? 19.005  -16.278 76.983  1.00 14.79 ? 60   LYS B N     1 
ATOM   2836 C CA    . LYS B 1 60  ? 17.748  -15.859 77.595  1.00 15.22 ? 60   LYS B CA    1 
ATOM   2837 C C     . LYS B 1 60  ? 17.818  -14.420 78.110  1.00 15.23 ? 60   LYS B C     1 
ATOM   2838 O O     . LYS B 1 60  ? 16.868  -13.920 78.712  1.00 17.78 ? 60   LYS B O     1 
ATOM   2839 C CB    . LYS B 1 60  ? 17.399  -16.810 78.749  1.00 13.55 ? 60   LYS B CB    1 
ATOM   2840 C CG    . LYS B 1 60  ? 17.404  -18.282 78.339  1.00 16.05 ? 60   LYS B CG    1 
ATOM   2841 C CD    . LYS B 1 60  ? 17.458  -19.210 79.557  1.00 14.49 ? 60   LYS B CD    1 
ATOM   2842 C CE    . LYS B 1 60  ? 17.481  -20.673 79.135  1.00 14.44 ? 60   LYS B CE    1 
ATOM   2843 N NZ    . LYS B 1 60  ? 17.443  -21.595 80.306  1.00 15.79 ? 60   LYS B NZ    1 
ATOM   2844 N N     . PHE B 1 61  ? 18.941  -13.754 77.865  1.00 14.68 ? 61   PHE B N     1 
ATOM   2845 C CA    . PHE B 1 61  ? 19.148  -12.383 78.322  1.00 12.84 ? 61   PHE B CA    1 
ATOM   2846 C C     . PHE B 1 61  ? 18.785  -11.356 77.248  1.00 14.64 ? 61   PHE B C     1 
ATOM   2847 O O     . PHE B 1 61  ? 19.308  -11.399 76.137  1.00 14.93 ? 61   PHE B O     1 
ATOM   2848 C CB    . PHE B 1 61  ? 20.609  -12.203 78.731  1.00 13.22 ? 61   PHE B CB    1 
ATOM   2849 C CG    . PHE B 1 61  ? 20.953  -10.812 79.173  1.00 14.84 ? 61   PHE B CG    1 
ATOM   2850 C CD1   . PHE B 1 61  ? 20.445  -10.298 80.362  1.00 13.99 ? 61   PHE B CD1   1 
ATOM   2851 C CD2   . PHE B 1 61  ? 21.784  -10.010 78.397  1.00 11.87 ? 61   PHE B CD2   1 
ATOM   2852 C CE1   . PHE B 1 61  ? 20.766  -8.997  80.771  1.00 13.67 ? 61   PHE B CE1   1 
ATOM   2853 C CE2   . PHE B 1 61  ? 22.105  -8.715  78.799  1.00 11.67 ? 61   PHE B CE2   1 
ATOM   2854 C CZ    . PHE B 1 61  ? 21.595  -8.211  79.986  1.00 11.14 ? 61   PHE B CZ    1 
ATOM   2855 N N     . LEU B 1 62  ? 17.894  -10.432 77.593  1.00 12.80 ? 62   LEU B N     1 
ATOM   2856 C CA    . LEU B 1 62  ? 17.452  -9.389  76.678  1.00 14.37 ? 62   LEU B CA    1 
ATOM   2857 C C     . LEU B 1 62  ? 17.828  -7.999  77.174  1.00 13.08 ? 62   LEU B C     1 
ATOM   2858 O O     . LEU B 1 62  ? 17.824  -7.741  78.374  1.00 14.13 ? 62   LEU B O     1 
ATOM   2859 C CB    . LEU B 1 62  ? 15.933  -9.455  76.499  1.00 14.38 ? 62   LEU B CB    1 
ATOM   2860 C CG    . LEU B 1 62  ? 15.305  -8.426  75.550  1.00 14.69 ? 62   LEU B CG    1 
ATOM   2861 C CD1   . LEU B 1 62  ? 14.034  -8.998  74.964  1.00 12.45 ? 62   LEU B CD1   1 
ATOM   2862 C CD2   . LEU B 1 62  ? 15.022  -7.118  76.288  1.00 13.33 ? 62   LEU B CD2   1 
ATOM   2863 N N     . TRP B 1 63  ? 18.161  -7.101  76.255  1.00 13.07 ? 63   TRP B N     1 
ATOM   2864 C CA    . TRP B 1 63  ? 18.493  -5.744  76.666  1.00 15.54 ? 63   TRP B CA    1 
ATOM   2865 C C     . TRP B 1 63  ? 18.103  -4.677  75.658  1.00 15.43 ? 63   TRP B C     1 
ATOM   2866 O O     . TRP B 1 63  ? 18.067  -4.928  74.455  1.00 14.05 ? 63   TRP B O     1 
ATOM   2867 C CB    . TRP B 1 63  ? 19.988  -5.628  77.006  1.00 15.77 ? 63   TRP B CB    1 
ATOM   2868 C CG    . TRP B 1 63  ? 20.913  -5.558  75.837  1.00 18.11 ? 63   TRP B CG    1 
ATOM   2869 C CD1   . TRP B 1 63  ? 21.385  -4.430  75.231  1.00 19.87 ? 63   TRP B CD1   1 
ATOM   2870 C CD2   . TRP B 1 63  ? 21.520  -6.665  75.153  1.00 18.16 ? 63   TRP B CD2   1 
ATOM   2871 N NE1   . TRP B 1 63  ? 22.256  -4.765  74.213  1.00 20.70 ? 63   TRP B NE1   1 
ATOM   2872 C CE2   . TRP B 1 63  ? 22.356  -6.131  74.146  1.00 20.43 ? 63   TRP B CE2   1 
ATOM   2873 C CE3   . TRP B 1 63  ? 21.440  -8.055  75.294  1.00 18.90 ? 63   TRP B CE3   1 
ATOM   2874 C CZ2   . TRP B 1 63  ? 23.110  -6.939  73.287  1.00 21.13 ? 63   TRP B CZ2   1 
ATOM   2875 C CZ3   . TRP B 1 63  ? 22.189  -8.860  74.440  1.00 19.80 ? 63   TRP B CZ3   1 
ATOM   2876 C CH2   . TRP B 1 63  ? 23.013  -8.297  73.449  1.00 19.61 ? 63   TRP B CH2   1 
ATOM   2877 N N     . PHE B 1 64  ? 17.769  -3.495  76.177  1.00 16.76 ? 64   PHE B N     1 
ATOM   2878 C CA    . PHE B 1 64  ? 17.413  -2.343  75.351  1.00 16.95 ? 64   PHE B CA    1 
ATOM   2879 C C     . PHE B 1 64  ? 18.611  -1.407  75.377  1.00 19.07 ? 64   PHE B C     1 
ATOM   2880 O O     . PHE B 1 64  ? 19.262  -1.248  76.410  1.00 16.95 ? 64   PHE B O     1 
ATOM   2881 C CB    . PHE B 1 64  ? 16.234  -1.548  75.932  1.00 15.90 ? 64   PHE B CB    1 
ATOM   2882 C CG    . PHE B 1 64  ? 14.914  -2.268  75.916  1.00 15.75 ? 64   PHE B CG    1 
ATOM   2883 C CD1   . PHE B 1 64  ? 14.665  -3.320  76.789  1.00 16.52 ? 64   PHE B CD1   1 
ATOM   2884 C CD2   . PHE B 1 64  ? 13.898  -1.848  75.064  1.00 15.24 ? 64   PHE B CD2   1 
ATOM   2885 C CE1   . PHE B 1 64  ? 13.421  -3.942  76.825  1.00 15.70 ? 64   PHE B CE1   1 
ATOM   2886 C CE2   . PHE B 1 64  ? 12.653  -2.457  75.084  1.00 16.51 ? 64   PHE B CE2   1 
ATOM   2887 C CZ    . PHE B 1 64  ? 12.413  -3.514  75.974  1.00 18.53 ? 64   PHE B CZ    1 
ATOM   2888 N N     . GLU B 1 65  ? 18.898  -0.782  74.244  1.00 21.22 ? 65   GLU B N     1 
ATOM   2889 C CA    . GLU B 1 65  ? 19.993  0.173   74.179  1.00 23.60 ? 65   GLU B CA    1 
ATOM   2890 C C     . GLU B 1 65  ? 19.336  1.501   73.864  1.00 22.74 ? 65   GLU B C     1 
ATOM   2891 O O     . GLU B 1 65  ? 18.548  1.594   72.928  1.00 22.52 ? 65   GLU B O     1 
ATOM   2892 C CB    . GLU B 1 65  ? 20.987  -0.194  73.078  1.00 26.25 ? 65   GLU B CB    1 
ATOM   2893 C CG    . GLU B 1 65  ? 22.185  0.727   73.029  1.00 32.74 ? 65   GLU B CG    1 
ATOM   2894 C CD    . GLU B 1 65  ? 23.204  0.305   71.993  1.00 37.58 ? 65   GLU B CD    1 
ATOM   2895 O OE1   . GLU B 1 65  ? 24.200  1.034   71.817  1.00 38.64 ? 65   GLU B OE1   1 
ATOM   2896 O OE2   . GLU B 1 65  ? 23.011  -0.756  71.359  1.00 41.50 ? 65   GLU B OE2   1 
ATOM   2897 N N     . LEU B 1 66  ? 19.636  2.516   74.664  1.00 22.53 ? 66   LEU B N     1 
ATOM   2898 C CA    . LEU B 1 66  ? 19.052  3.834   74.466  1.00 23.35 ? 66   LEU B CA    1 
ATOM   2899 C C     . LEU B 1 66  ? 20.118  4.917   74.517  1.00 24.04 ? 66   LEU B C     1 
ATOM   2900 O O     . LEU B 1 66  ? 21.189  4.724   75.094  1.00 25.39 ? 66   LEU B O     1 
ATOM   2901 C CB    . LEU B 1 66  ? 17.989  4.110   75.532  1.00 19.92 ? 66   LEU B CB    1 
ATOM   2902 C CG    . LEU B 1 66  ? 16.848  3.097   75.634  1.00 18.94 ? 66   LEU B CG    1 
ATOM   2903 C CD1   . LEU B 1 66  ? 17.295  1.918   76.484  1.00 19.73 ? 66   LEU B CD1   1 
ATOM   2904 C CD2   . LEU B 1 66  ? 15.632  3.761   76.258  1.00 18.53 ? 66   LEU B CD2   1 
ATOM   2905 N N     . PHE B 1 67  ? 19.817  6.060   73.916  1.00 26.14 ? 67   PHE B N     1 
ATOM   2906 C CA    . PHE B 1 67  ? 20.762  7.168   73.897  1.00 28.46 ? 67   PHE B CA    1 
ATOM   2907 C C     . PHE B 1 67  ? 20.011  8.478   73.781  1.00 29.45 ? 67   PHE B C     1 
ATOM   2908 O O     . PHE B 1 67  ? 18.822  8.493   73.484  1.00 29.93 ? 67   PHE B O     1 
ATOM   2909 C CB    . PHE B 1 67  ? 21.705  7.043   72.699  1.00 26.07 ? 67   PHE B CB    1 
ATOM   2910 C CG    . PHE B 1 67  ? 21.022  7.236   71.380  1.00 25.95 ? 67   PHE B CG    1 
ATOM   2911 C CD1   . PHE B 1 67  ? 20.156  6.275   70.886  1.00 26.70 ? 67   PHE B CD1   1 
ATOM   2912 C CD2   . PHE B 1 67  ? 21.228  8.395   70.640  1.00 28.22 ? 67   PHE B CD2   1 
ATOM   2913 C CE1   . PHE B 1 67  ? 19.500  6.462   69.672  1.00 27.94 ? 67   PHE B CE1   1 
ATOM   2914 C CE2   . PHE B 1 67  ? 20.579  8.595   69.423  1.00 26.61 ? 67   PHE B CE2   1 
ATOM   2915 C CZ    . PHE B 1 67  ? 19.714  7.628   68.938  1.00 28.71 ? 67   PHE B CZ    1 
ATOM   2916 N N     . ASP B 1 68  ? 20.725  9.573   74.006  1.00 34.28 ? 68   ASP B N     1 
ATOM   2917 C CA    . ASP B 1 68  ? 20.154  10.909  73.912  1.00 38.36 ? 68   ASP B CA    1 
ATOM   2918 C C     . ASP B 1 68  ? 20.637  11.517  72.595  1.00 39.95 ? 68   ASP B C     1 
ATOM   2919 O O     . ASP B 1 68  ? 21.837  11.661  72.377  1.00 40.40 ? 68   ASP B O     1 
ATOM   2920 C CB    . ASP B 1 68  ? 20.629  11.759  75.098  1.00 39.99 ? 68   ASP B CB    1 
ATOM   2921 C CG    . ASP B 1 68  ? 19.952  13.121  75.153  1.00 43.18 ? 68   ASP B CG    1 
ATOM   2922 O OD1   . ASP B 1 68  ? 20.154  13.840  76.154  1.00 44.35 ? 68   ASP B OD1   1 
ATOM   2923 O OD2   . ASP B 1 68  ? 19.223  13.475  74.200  1.00 43.23 ? 68   ASP B OD2   1 
ATOM   2924 N N     . PRO B 1 69  ? 19.709  11.866  71.693  1.00 41.80 ? 69   PRO B N     1 
ATOM   2925 C CA    . PRO B 1 69  ? 20.093  12.455  70.406  1.00 45.41 ? 69   PRO B CA    1 
ATOM   2926 C C     . PRO B 1 69  ? 21.085  13.615  70.526  1.00 48.32 ? 69   PRO B C     1 
ATOM   2927 O O     . PRO B 1 69  ? 21.858  13.872  69.605  1.00 47.95 ? 69   PRO B O     1 
ATOM   2928 C CB    . PRO B 1 69  ? 18.754  12.888  69.818  1.00 45.11 ? 69   PRO B CB    1 
ATOM   2929 C CG    . PRO B 1 69  ? 17.824  11.827  70.326  1.00 43.19 ? 69   PRO B CG    1 
ATOM   2930 C CD    . PRO B 1 69  ? 18.247  11.704  71.779  1.00 42.66 ? 69   PRO B CD    1 
ATOM   2931 N N     . ASN B 1 70  ? 21.065  14.308  71.663  1.00 52.10 ? 70   ASN B N     1 
ATOM   2932 C CA    . ASN B 1 70  ? 21.970  15.434  71.885  1.00 55.83 ? 70   ASN B CA    1 
ATOM   2933 C C     . ASN B 1 70  ? 23.302  14.975  72.473  1.00 57.90 ? 70   ASN B C     1 
ATOM   2934 O O     . ASN B 1 70  ? 24.273  15.731  72.494  1.00 59.67 ? 70   ASN B O     1 
ATOM   2935 C CB    . ASN B 1 70  ? 21.327  16.464  72.817  1.00 55.97 ? 70   ASN B CB    1 
ATOM   2936 C CG    . ASN B 1 70  ? 19.945  16.887  72.354  1.00 56.98 ? 70   ASN B CG    1 
ATOM   2937 O OD1   . ASN B 1 70  ? 19.739  17.212  71.185  1.00 56.67 ? 70   ASN B OD1   1 
ATOM   2938 N ND2   . ASN B 1 70  ? 18.989  16.891  73.276  1.00 57.91 ? 70   ASN B ND2   1 
ATOM   2939 N N     . ASP B 1 71  ? 23.339  13.736  72.953  1.00 59.61 ? 71   ASP B N     1 
ATOM   2940 C CA    . ASP B 1 71  ? 24.553  13.160  73.531  1.00 60.65 ? 71   ASP B CA    1 
ATOM   2941 C C     . ASP B 1 71  ? 24.643  11.710  73.052  1.00 60.70 ? 71   ASP B C     1 
ATOM   2942 O O     . ASP B 1 71  ? 24.796  10.784  73.848  1.00 60.46 ? 71   ASP B O     1 
ATOM   2943 C CB    . ASP B 1 71  ? 24.486  13.207  75.062  1.00 62.64 ? 71   ASP B CB    1 
ATOM   2944 C CG    . ASP B 1 71  ? 25.858  13.142  75.713  1.00 64.44 ? 71   ASP B CG    1 
ATOM   2945 O OD1   . ASP B 1 71  ? 26.610  12.176  75.451  1.00 64.61 ? 71   ASP B OD1   1 
ATOM   2946 O OD2   . ASP B 1 71  ? 26.182  14.065  76.493  1.00 65.48 ? 71   ASP B OD2   1 
ATOM   2947 N N     . LYS B 1 72  ? 24.534  11.540  71.737  1.00 60.79 ? 72   LYS B N     1 
ATOM   2948 C CA    . LYS B 1 72  ? 24.572  10.238  71.071  1.00 60.75 ? 72   LYS B CA    1 
ATOM   2949 C C     . LYS B 1 72  ? 25.452  9.170   71.712  1.00 60.34 ? 72   LYS B C     1 
ATOM   2950 O O     . LYS B 1 72  ? 25.068  8.002   71.777  1.00 60.74 ? 72   LYS B O     1 
ATOM   2951 C CB    . LYS B 1 72  ? 25.012  10.415  69.615  1.00 61.38 ? 72   LYS B CB    1 
ATOM   2952 C CG    . LYS B 1 72  ? 25.025  9.123   68.814  1.00 62.61 ? 72   LYS B CG    1 
ATOM   2953 C CD    . LYS B 1 72  ? 25.715  9.290   67.468  0.00 63.33 ? 72   LYS B CD    1 
ATOM   2954 C CE    . LYS B 1 72  ? 27.232  9.331   67.611  0.00 63.85 ? 72   LYS B CE    1 
ATOM   2955 N NZ    . LYS B 1 72  ? 27.712  10.460  68.455  0.00 64.25 ? 72   LYS B NZ    1 
ATOM   2956 N N     . SER B 1 73  ? 26.631  9.568   72.179  1.00 59.62 ? 73   SER B N     1 
ATOM   2957 C CA    . SER B 1 73  ? 27.572  8.625   72.775  1.00 58.14 ? 73   SER B CA    1 
ATOM   2958 C C     . SER B 1 73  ? 27.253  8.196   74.205  1.00 56.66 ? 73   SER B C     1 
ATOM   2959 O O     . SER B 1 73  ? 27.860  7.256   74.720  1.00 57.62 ? 73   SER B O     1 
ATOM   2960 C CB    . SER B 1 73  ? 28.987  9.202   72.703  1.00 57.98 ? 73   SER B CB    1 
ATOM   2961 O OG    . SER B 1 73  ? 29.354  9.435   71.354  1.00 57.49 ? 73   SER B OG    1 
ATOM   2962 N N     . ASN B 1 74  ? 26.316  8.886   74.848  1.00 53.93 ? 74   ASN B N     1 
ATOM   2963 C CA    . ASN B 1 74  ? 25.918  8.537   76.211  1.00 50.91 ? 74   ASN B CA    1 
ATOM   2964 C C     . ASN B 1 74  ? 24.853  7.449   76.105  1.00 47.12 ? 74   ASN B C     1 
ATOM   2965 O O     . ASN B 1 74  ? 23.659  7.740   76.044  1.00 46.47 ? 74   ASN B O     1 
ATOM   2966 C CB    . ASN B 1 74  ? 25.324  9.747   76.931  1.00 52.68 ? 74   ASN B CB    1 
ATOM   2967 C CG    . ASN B 1 74  ? 24.909  9.427   78.358  1.00 55.43 ? 74   ASN B CG    1 
ATOM   2968 O OD1   . ASN B 1 74  ? 24.106  10.145  78.960  1.00 54.49 ? 74   ASN B OD1   1 
ATOM   2969 N ND2   . ASN B 1 74  ? 25.466  8.349   78.911  1.00 55.72 ? 74   ASN B ND2   1 
ATOM   2970 N N     . LYS B 1 75  ? 25.294  6.197   76.083  1.00 42.64 ? 75   LYS B N     1 
ATOM   2971 C CA    . LYS B 1 75  ? 24.384  5.070   75.953  1.00 37.73 ? 75   LYS B CA    1 
ATOM   2972 C C     . LYS B 1 75  ? 23.887  4.502   77.274  1.00 32.77 ? 75   LYS B C     1 
ATOM   2973 O O     . LYS B 1 75  ? 24.653  4.334   78.227  1.00 29.75 ? 75   LYS B O     1 
ATOM   2974 C CB    . LYS B 1 75  ? 25.060  3.955   75.151  1.00 40.34 ? 75   LYS B CB    1 
ATOM   2975 C CG    . LYS B 1 75  ? 25.425  4.343   73.723  1.00 43.70 ? 75   LYS B CG    1 
ATOM   2976 C CD    . LYS B 1 75  ? 26.262  3.261   73.039  1.00 45.38 ? 75   LYS B CD    1 
ATOM   2977 C CE    . LYS B 1 75  ? 27.617  3.088   73.725  1.00 46.87 ? 75   LYS B CE    1 
ATOM   2978 N NZ    . LYS B 1 75  ? 28.507  2.107   73.030  1.00 47.47 ? 75   LYS B NZ    1 
ATOM   2979 N N     . TRP B 1 76  ? 22.589  4.222   77.326  1.00 27.26 ? 76   TRP B N     1 
ATOM   2980 C CA    . TRP B 1 76  ? 21.990  3.621   78.508  1.00 22.49 ? 76   TRP B CA    1 
ATOM   2981 C C     . TRP B 1 76  ? 21.421  2.260   78.136  1.00 18.75 ? 76   TRP B C     1 
ATOM   2982 O O     . TRP B 1 76  ? 20.999  2.047   77.004  1.00 21.06 ? 76   TRP B O     1 
ATOM   2983 C CB    . TRP B 1 76  ? 20.883  4.496   79.073  1.00 21.67 ? 76   TRP B CB    1 
ATOM   2984 C CG    . TRP B 1 76  ? 21.384  5.629   79.896  1.00 24.74 ? 76   TRP B CG    1 
ATOM   2985 C CD1   . TRP B 1 76  ? 21.731  6.875   79.458  1.00 24.48 ? 76   TRP B CD1   1 
ATOM   2986 C CD2   . TRP B 1 76  ? 21.577  5.630   81.313  1.00 24.75 ? 76   TRP B CD2   1 
ATOM   2987 N NE1   . TRP B 1 76  ? 22.122  7.655   80.521  1.00 26.92 ? 76   TRP B NE1   1 
ATOM   2988 C CE2   . TRP B 1 76  ? 22.035  6.915   81.671  1.00 24.63 ? 76   TRP B CE2   1 
ATOM   2989 C CE3   . TRP B 1 76  ? 21.404  4.667   82.318  1.00 26.91 ? 76   TRP B CE3   1 
ATOM   2990 C CZ2   . TRP B 1 76  ? 22.326  7.265   82.990  1.00 25.18 ? 76   TRP B CZ2   1 
ATOM   2991 C CZ3   . TRP B 1 76  ? 21.693  5.014   83.631  1.00 27.02 ? 76   TRP B CZ3   1 
ATOM   2992 C CH2   . TRP B 1 76  ? 22.147  6.305   83.955  1.00 25.35 ? 76   TRP B CH2   1 
ATOM   2993 N N     . TYR B 1 77  ? 21.398  1.342   79.089  1.00 16.09 ? 77   TYR B N     1 
ATOM   2994 C CA    . TYR B 1 77  ? 20.881  0.010   78.819  1.00 16.35 ? 77   TYR B CA    1 
ATOM   2995 C C     . TYR B 1 77  ? 19.915  -0.499  79.880  1.00 14.83 ? 77   TYR B C     1 
ATOM   2996 O O     . TYR B 1 77  ? 20.069  -0.221  81.066  1.00 16.08 ? 77   TYR B O     1 
ATOM   2997 C CB    . TYR B 1 77  ? 22.033  -1.002  78.696  1.00 16.12 ? 77   TYR B CB    1 
ATOM   2998 C CG    . TYR B 1 77  ? 23.156  -0.575  77.776  1.00 18.55 ? 77   TYR B CG    1 
ATOM   2999 C CD1   . TYR B 1 77  ? 24.167  0.264   78.231  1.00 18.27 ? 77   TYR B CD1   1 
ATOM   3000 C CD2   . TYR B 1 77  ? 23.204  -1.007  76.448  1.00 18.49 ? 77   TYR B CD2   1 
ATOM   3001 C CE1   . TYR B 1 77  ? 25.197  0.662   77.398  1.00 22.51 ? 77   TYR B CE1   1 
ATOM   3002 C CE2   . TYR B 1 77  ? 24.231  -0.613  75.601  1.00 18.59 ? 77   TYR B CE2   1 
ATOM   3003 C CZ    . TYR B 1 77  ? 25.225  0.224   76.083  1.00 22.66 ? 77   TYR B CZ    1 
ATOM   3004 O OH    . TYR B 1 77  ? 26.236  0.655   75.257  1.00 25.31 ? 77   TYR B OH    1 
ATOM   3005 N N     . ILE B 1 78  ? 18.914  -1.243  79.430  1.00 13.53 ? 78   ILE B N     1 
ATOM   3006 C CA    . ILE B 1 78  ? 17.943  -1.860  80.317  1.00 14.14 ? 78   ILE B CA    1 
ATOM   3007 C C     . ILE B 1 78  ? 18.206  -3.364  80.180  1.00 12.45 ? 78   ILE B C     1 
ATOM   3008 O O     . ILE B 1 78  ? 18.049  -3.921  79.103  1.00 9.63  ? 78   ILE B O     1 
ATOM   3009 C CB    . ILE B 1 78  ? 16.498  -1.569  79.878  1.00 14.69 ? 78   ILE B CB    1 
ATOM   3010 C CG1   . ILE B 1 78  ? 16.247  -0.061  79.876  1.00 15.93 ? 78   ILE B CG1   1 
ATOM   3011 C CG2   . ILE B 1 78  ? 15.525  -2.273  80.810  1.00 14.00 ? 78   ILE B CG2   1 
ATOM   3012 C CD1   . ILE B 1 78  ? 14.848  0.322   79.436  1.00 15.02 ? 78   ILE B CD1   1 
ATOM   3013 N N     . TRP B 1 79  ? 18.646  -3.995  81.264  1.00 14.02 ? 79   TRP B N     1 
ATOM   3014 C CA    . TRP B 1 79  ? 18.928  -5.431  81.283  1.00 15.03 ? 79   TRP B CA    1 
ATOM   3015 C C     . TRP B 1 79  ? 17.642  -6.114  81.701  1.00 16.95 ? 79   TRP B C     1 
ATOM   3016 O O     . TRP B 1 79  ? 16.972  -5.651  82.621  1.00 18.91 ? 79   TRP B O     1 
ATOM   3017 C CB    . TRP B 1 79  ? 19.997  -5.763  82.322  1.00 15.45 ? 79   TRP B CB    1 
ATOM   3018 C CG    . TRP B 1 79  ? 21.344  -5.196  82.048  1.00 16.90 ? 79   TRP B CG    1 
ATOM   3019 C CD1   . TRP B 1 79  ? 21.649  -4.121  81.254  1.00 17.74 ? 79   TRP B CD1   1 
ATOM   3020 C CD2   . TRP B 1 79  ? 22.577  -5.633  82.625  1.00 18.86 ? 79   TRP B CD2   1 
ATOM   3021 N NE1   . TRP B 1 79  ? 22.999  -3.865  81.306  1.00 19.46 ? 79   TRP B NE1   1 
ATOM   3022 C CE2   . TRP B 1 79  ? 23.592  -4.775  82.141  1.00 19.96 ? 79   TRP B CE2   1 
ATOM   3023 C CE3   . TRP B 1 79  ? 22.923  -6.662  83.510  1.00 19.69 ? 79   TRP B CE3   1 
ATOM   3024 C CZ2   . TRP B 1 79  ? 24.932  -4.918  82.514  1.00 20.13 ? 79   TRP B CZ2   1 
ATOM   3025 C CZ3   . TRP B 1 79  ? 24.254  -6.804  83.881  1.00 20.01 ? 79   TRP B CZ3   1 
ATOM   3026 C CH2   . TRP B 1 79  ? 25.243  -5.935  83.383  1.00 20.76 ? 79   TRP B CH2   1 
ATOM   3027 N N     . ASN B 1 80  ? 17.305  -7.226  81.059  1.00 16.08 ? 80   ASN B N     1 
ATOM   3028 C CA    . ASN B 1 80  ? 16.071  -7.920  81.397  1.00 15.58 ? 80   ASN B CA    1 
ATOM   3029 C C     . ASN B 1 80  ? 16.167  -9.431  81.221  1.00 16.10 ? 80   ASN B C     1 
ATOM   3030 O O     . ASN B 1 80  ? 16.721  -9.901  80.230  1.00 14.16 ? 80   ASN B O     1 
ATOM   3031 C CB    . ASN B 1 80  ? 14.946  -7.363  80.520  1.00 14.75 ? 80   ASN B CB    1 
ATOM   3032 C CG    . ASN B 1 80  ? 13.611  -8.019  80.792  1.00 17.96 ? 80   ASN B CG    1 
ATOM   3033 O OD1   . ASN B 1 80  ? 12.967  -8.540  79.872  1.00 20.52 ? 80   ASN B OD1   1 
ATOM   3034 N ND2   . ASN B 1 80  ? 13.181  -8.002  82.061  1.00 16.46 ? 80   ASN B ND2   1 
ATOM   3035 N N     . THR B 1 81  ? 15.666  -10.181 82.206  1.00 15.94 ? 81   THR B N     1 
ATOM   3036 C CA    . THR B 1 81  ? 15.618  -11.647 82.135  1.00 16.20 ? 81   THR B CA    1 
ATOM   3037 C C     . THR B 1 81  ? 14.162  -11.981 82.453  1.00 17.31 ? 81   THR B C     1 
ATOM   3038 O O     . THR B 1 81  ? 13.534  -11.311 83.274  1.00 19.20 ? 81   THR B O     1 
ATOM   3039 C CB    . THR B 1 81  ? 16.545  -12.341 83.160  1.00 19.37 ? 81   THR B CB    1 
ATOM   3040 O OG1   . THR B 1 81  ? 16.209  -11.910 84.484  1.00 21.05 ? 81   THR B OG1   1 
ATOM   3041 C CG2   . THR B 1 81  ? 18.023  -12.032 82.856  1.00 17.11 ? 81   THR B CG2   1 
ATOM   3042 N N     . PHE B 1 82  ? 13.627  -13.002 81.798  1.00 17.80 ? 82   PHE B N     1 
ATOM   3043 C CA    . PHE B 1 82  ? 12.225  -13.394 81.951  1.00 18.23 ? 82   PHE B CA    1 
ATOM   3044 C C     . PHE B 1 82  ? 11.881  -14.327 83.111  1.00 18.30 ? 82   PHE B C     1 
ATOM   3045 O O     . PHE B 1 82  ? 10.715  -14.432 83.495  1.00 19.73 ? 82   PHE B O     1 
ATOM   3046 C CB    . PHE B 1 82  ? 11.745  -14.059 80.658  1.00 17.70 ? 82   PHE B CB    1 
ATOM   3047 C CG    . PHE B 1 82  ? 11.742  -13.150 79.455  1.00 19.11 ? 82   PHE B CG    1 
ATOM   3048 C CD1   . PHE B 1 82  ? 12.699  -12.156 79.302  1.00 18.91 ? 82   PHE B CD1   1 
ATOM   3049 C CD2   . PHE B 1 82  ? 10.799  -13.325 78.450  1.00 20.45 ? 82   PHE B CD2   1 
ATOM   3050 C CE1   . PHE B 1 82  ? 12.719  -11.350 78.173  1.00 18.57 ? 82   PHE B CE1   1 
ATOM   3051 C CE2   . PHE B 1 82  ? 10.813  -12.522 77.311  1.00 21.67 ? 82   PHE B CE2   1 
ATOM   3052 C CZ    . PHE B 1 82  ? 11.775  -11.533 77.174  1.00 19.18 ? 82   PHE B CZ    1 
ATOM   3053 N N     . GLY B 1 83  ? 12.875  -15.005 83.668  1.00 16.41 ? 83   GLY B N     1 
ATOM   3054 C CA    . GLY B 1 83  ? 12.588  -15.938 84.738  1.00 17.62 ? 83   GLY B CA    1 
ATOM   3055 C C     . GLY B 1 83  ? 11.737  -17.050 84.143  1.00 19.82 ? 83   GLY B C     1 
ATOM   3056 O O     . GLY B 1 83  ? 11.904  -17.400 82.977  1.00 21.69 ? 83   GLY B O     1 
ATOM   3057 N N     . LEU B 1 84  ? 10.806  -17.586 84.922  1.00 20.29 ? 84   LEU B N     1 
ATOM   3058 C CA    . LEU B 1 84  ? 9.931   -18.650 84.451  1.00 20.18 ? 84   LEU B CA    1 
ATOM   3059 C C     . LEU B 1 84  ? 8.609   -18.177 83.851  1.00 20.88 ? 84   LEU B C     1 
ATOM   3060 O O     . LEU B 1 84  ? 7.965   -18.923 83.119  1.00 21.89 ? 84   LEU B O     1 
ATOM   3061 C CB    . LEU B 1 84  ? 9.607   -19.610 85.593  1.00 19.06 ? 84   LEU B CB    1 
ATOM   3062 C CG    . LEU B 1 84  ? 10.721  -20.539 86.056  1.00 21.76 ? 84   LEU B CG    1 
ATOM   3063 C CD1   . LEU B 1 84  ? 10.244  -21.327 87.263  1.00 18.44 ? 84   LEU B CD1   1 
ATOM   3064 C CD2   . LEU B 1 84  ? 11.120  -21.469 84.907  1.00 21.18 ? 84   LEU B CD2   1 
ATOM   3065 N N     . THR B 1 85  ? 8.190   -16.952 84.148  1.00 20.98 ? 85   THR B N     1 
ATOM   3066 C CA    . THR B 1 85  ? 6.899   -16.505 83.633  1.00 18.73 ? 85   THR B CA    1 
ATOM   3067 C C     . THR B 1 85  ? 6.857   -15.115 83.015  1.00 16.66 ? 85   THR B C     1 
ATOM   3068 O O     . THR B 1 85  ? 5.783   -14.600 82.717  1.00 19.03 ? 85   THR B O     1 
ATOM   3069 C CB    . THR B 1 85  ? 5.811   -16.613 84.751  1.00 17.54 ? 85   THR B CB    1 
ATOM   3070 O OG1   . THR B 1 85  ? 6.216   -15.852 85.895  1.00 18.90 ? 85   THR B OG1   1 
ATOM   3071 C CG2   . THR B 1 85  ? 5.623   -18.063 85.175  1.00 14.00 ? 85   THR B CG2   1 
ATOM   3072 N N     . GLY B 1 86  ? 8.017   -14.507 82.809  1.00 17.09 ? 86   GLY B N     1 
ATOM   3073 C CA    . GLY B 1 86  ? 8.046   -13.189 82.203  1.00 15.07 ? 86   GLY B CA    1 
ATOM   3074 C C     . GLY B 1 86  ? 7.527   -13.183 80.775  1.00 16.58 ? 86   GLY B C     1 
ATOM   3075 O O     . GLY B 1 86  ? 7.715   -14.150 80.026  1.00 15.97 ? 86   GLY B O     1 
ATOM   3076 N N     . MET B 1 87  ? 6.867   -12.089 80.403  1.00 17.31 ? 87   MET B N     1 
ATOM   3077 C CA    . MET B 1 87  ? 6.302   -11.914 79.063  1.00 20.14 ? 87   MET B CA    1 
ATOM   3078 C C     . MET B 1 87  ? 6.142   -10.439 78.726  1.00 19.87 ? 87   MET B C     1 
ATOM   3079 O O     . MET B 1 87  ? 5.725   -9.644  79.571  1.00 17.72 ? 87   MET B O     1 
ATOM   3080 C CB    . MET B 1 87  ? 4.906   -12.521 78.955  1.00 22.46 ? 87   MET B CB    1 
ATOM   3081 C CG    . MET B 1 87  ? 4.829   -14.015 78.848  1.00 31.95 ? 87   MET B CG    1 
ATOM   3082 S SD    . MET B 1 87  ? 3.097   -14.453 78.566  1.00 38.68 ? 87   MET B SD    1 
ATOM   3083 C CE    . MET B 1 87  ? 2.446   -14.376 80.236  1.00 38.00 ? 87   MET B CE    1 
ATOM   3084 N N     . TRP B 1 88  ? 6.452   -10.077 77.490  1.00 16.42 ? 88   TRP B N     1 
ATOM   3085 C CA    . TRP B 1 88  ? 6.263   -8.702  77.076  1.00 18.35 ? 88   TRP B CA    1 
ATOM   3086 C C     . TRP B 1 88  ? 4.970   -8.670  76.271  1.00 18.54 ? 88   TRP B C     1 
ATOM   3087 O O     . TRP B 1 88  ? 4.548   -9.693  75.735  1.00 18.16 ? 88   TRP B O     1 
ATOM   3088 C CB    . TRP B 1 88  ? 7.435   -8.211  76.222  1.00 15.69 ? 88   TRP B CB    1 
ATOM   3089 C CG    . TRP B 1 88  ? 8.645   -7.841  77.018  1.00 17.07 ? 88   TRP B CG    1 
ATOM   3090 C CD1   . TRP B 1 88  ? 9.699   -8.654  77.346  1.00 18.22 ? 88   TRP B CD1   1 
ATOM   3091 C CD2   . TRP B 1 88  ? 8.932   -6.561  77.600  1.00 16.03 ? 88   TRP B CD2   1 
ATOM   3092 N NE1   . TRP B 1 88  ? 10.621  -7.956  78.092  1.00 15.59 ? 88   TRP B NE1   1 
ATOM   3093 C CE2   . TRP B 1 88  ? 10.177  -6.669  78.260  1.00 15.08 ? 88   TRP B CE2   1 
ATOM   3094 C CE3   . TRP B 1 88  ? 8.257   -5.332  77.626  1.00 14.61 ? 88   TRP B CE3   1 
ATOM   3095 C CZ2   . TRP B 1 88  ? 10.760  -5.600  78.939  1.00 15.58 ? 88   TRP B CZ2   1 
ATOM   3096 C CZ3   . TRP B 1 88  ? 8.832   -4.270  78.304  1.00 15.62 ? 88   TRP B CZ3   1 
ATOM   3097 C CH2   . TRP B 1 88  ? 10.075  -4.409  78.952  1.00 16.46 ? 88   TRP B CH2   1 
ATOM   3098 N N     . SER B 1 89  ? 4.326   -7.510  76.211  1.00 19.26 ? 89   SER B N     1 
ATOM   3099 C CA    . SER B 1 89  ? 3.094   -7.371  75.447  1.00 23.17 ? 89   SER B CA    1 
ATOM   3100 C C     . SER B 1 89  ? 2.799   -5.912  75.156  1.00 24.78 ? 89   SER B C     1 
ATOM   3101 O O     . SER B 1 89  ? 3.347   -5.015  75.797  1.00 24.80 ? 89   SER B O     1 
ATOM   3102 C CB    . SER B 1 89  ? 1.913   -7.972  76.202  1.00 23.94 ? 89   SER B CB    1 
ATOM   3103 O OG    . SER B 1 89  ? 1.704   -7.279  77.412  1.00 28.46 ? 89   SER B OG    1 
ATOM   3104 N N     . LEU B 1 90  ? 1.923   -5.690  74.184  1.00 24.92 ? 90   LEU B N     1 
ATOM   3105 C CA    . LEU B 1 90  ? 1.542   -4.352  73.790  1.00 25.89 ? 90   LEU B CA    1 
ATOM   3106 C C     . LEU B 1 90  ? 0.302   -3.887  74.541  1.00 26.28 ? 90   LEU B C     1 
ATOM   3107 O O     . LEU B 1 90  ? -0.127  -2.743  74.403  1.00 27.21 ? 90   LEU B O     1 
ATOM   3108 C CB    . LEU B 1 90  ? 1.320   -4.309  72.281  1.00 27.20 ? 90   LEU B CB    1 
ATOM   3109 C CG    . LEU B 1 90  ? 2.623   -4.556  71.516  1.00 27.21 ? 90   LEU B CG    1 
ATOM   3110 C CD1   . LEU B 1 90  ? 2.366   -4.625  70.030  1.00 28.77 ? 90   LEU B CD1   1 
ATOM   3111 C CD2   . LEU B 1 90  ? 3.589   -3.438  71.826  1.00 29.59 ? 90   LEU B CD2   1 
ATOM   3112 N N     . PHE B 1 91  ? -0.276  -4.774  75.342  1.00 25.46 ? 91   PHE B N     1 
ATOM   3113 C CA    . PHE B 1 91  ? -1.439  -4.402  76.131  1.00 26.53 ? 91   PHE B CA    1 
ATOM   3114 C C     . PHE B 1 91  ? -1.198  -4.744  77.603  1.00 26.57 ? 91   PHE B C     1 
ATOM   3115 O O     . PHE B 1 91  ? -0.486  -5.694  77.921  1.00 25.81 ? 91   PHE B O     1 
ATOM   3116 C CB    . PHE B 1 91  ? -2.696  -5.114  75.622  1.00 29.08 ? 91   PHE B CB    1 
ATOM   3117 C CG    . PHE B 1 91  ? -2.725  -6.585  75.911  1.00 28.90 ? 91   PHE B CG    1 
ATOM   3118 C CD1   . PHE B 1 91  ? -1.980  -7.472  75.147  1.00 30.13 ? 91   PHE B CD1   1 
ATOM   3119 C CD2   . PHE B 1 91  ? -3.507  -7.083  76.951  1.00 29.36 ? 91   PHE B CD2   1 
ATOM   3120 C CE1   . PHE B 1 91  ? -2.015  -8.839  75.410  1.00 30.12 ? 91   PHE B CE1   1 
ATOM   3121 C CE2   . PHE B 1 91  ? -3.548  -8.449  77.223  1.00 29.13 ? 91   PHE B CE2   1 
ATOM   3122 C CZ    . PHE B 1 91  ? -2.802  -9.326  76.452  1.00 29.22 ? 91   PHE B CZ    1 
ATOM   3123 N N     . GLU B 1 92  ? -1.789  -3.956  78.493  1.00 26.53 ? 92   GLU B N     1 
ATOM   3124 C CA    . GLU B 1 92  ? -1.644  -4.156  79.929  1.00 28.11 ? 92   GLU B CA    1 
ATOM   3125 C C     . GLU B 1 92  ? -2.344  -5.442  80.358  1.00 28.46 ? 92   GLU B C     1 
ATOM   3126 O O     . GLU B 1 92  ? -3.513  -5.424  80.753  1.00 28.59 ? 92   GLU B O     1 
ATOM   3127 C CB    . GLU B 1 92  ? -2.242  -2.961  80.673  1.00 29.75 ? 92   GLU B CB    1 
ATOM   3128 C CG    . GLU B 1 92  ? -2.059  -2.992  82.178  1.00 34.28 ? 92   GLU B CG    1 
ATOM   3129 C CD    . GLU B 1 92  ? -2.574  -1.723  82.845  1.00 37.99 ? 92   GLU B CD    1 
ATOM   3130 O OE1   . GLU B 1 92  ? -3.780  -1.415  82.709  1.00 39.89 ? 92   GLU B OE1   1 
ATOM   3131 O OE2   . GLU B 1 92  ? -1.771  -1.031  83.504  1.00 39.47 ? 92   GLU B OE2   1 
ATOM   3132 N N     . ALA B 1 93  ? -1.623  -6.555  80.284  1.00 26.68 ? 93   ALA B N     1 
ATOM   3133 C CA    . ALA B 1 93  ? -2.176  -7.857  80.639  1.00 26.85 ? 93   ALA B CA    1 
ATOM   3134 C C     . ALA B 1 93  ? -2.165  -8.107  82.135  1.00 26.65 ? 93   ALA B C     1 
ATOM   3135 O O     . ALA B 1 93  ? -1.689  -7.285  82.908  1.00 27.20 ? 93   ALA B O     1 
ATOM   3136 C CB    . ALA B 1 93  ? -1.399  -8.957  79.931  1.00 26.21 ? 93   ALA B CB    1 
ATOM   3137 N N     . LYS B 1 94  ? -2.708  -9.250  82.537  1.00 27.24 ? 94   LYS B N     1 
ATOM   3138 C CA    . LYS B 1 94  ? -2.732  -9.629  83.945  1.00 27.15 ? 94   LYS B CA    1 
ATOM   3139 C C     . LYS B 1 94  ? -1.278  -9.865  84.360  1.00 25.39 ? 94   LYS B C     1 
ATOM   3140 O O     . LYS B 1 94  ? -0.485  -10.370 83.567  1.00 26.01 ? 94   LYS B O     1 
ATOM   3141 C CB    . LYS B 1 94  ? -3.545  -10.919 84.124  1.00 28.75 ? 94   LYS B CB    1 
ATOM   3142 C CG    . LYS B 1 94  ? -3.812  -11.312 85.568  1.00 29.76 ? 94   LYS B CG    1 
ATOM   3143 C CD    . LYS B 1 94  ? -4.464  -12.683 85.646  1.00 32.35 ? 94   LYS B CD    1 
ATOM   3144 C CE    . LYS B 1 94  ? -4.672  -13.111 87.087  1.00 34.79 ? 94   LYS B CE    1 
ATOM   3145 N NZ    . LYS B 1 94  ? -5.169  -14.514 87.184  1.00 36.90 ? 94   LYS B NZ    1 
ATOM   3146 N N     . TYR B 1 95  ? -0.937  -9.497  85.593  1.00 23.85 ? 95   TYR B N     1 
ATOM   3147 C CA    . TYR B 1 95  ? 0.420   -9.660  86.122  1.00 22.66 ? 95   TYR B CA    1 
ATOM   3148 C C     . TYR B 1 95  ? 1.414   -8.630  85.583  1.00 21.98 ? 95   TYR B C     1 
ATOM   3149 O O     . TYR B 1 95  ? 2.619   -8.824  85.684  1.00 22.49 ? 95   TYR B O     1 
ATOM   3150 C CB    . TYR B 1 95  ? 0.950   -11.072 85.830  1.00 23.24 ? 95   TYR B CB    1 
ATOM   3151 C CG    . TYR B 1 95  ? 0.139   -12.171 86.480  1.00 23.38 ? 95   TYR B CG    1 
ATOM   3152 C CD1   . TYR B 1 95  ? -0.329  -13.247 85.734  1.00 22.30 ? 95   TYR B CD1   1 
ATOM   3153 C CD2   . TYR B 1 95  ? -0.200  -12.109 87.832  1.00 24.64 ? 95   TYR B CD2   1 
ATOM   3154 C CE1   . TYR B 1 95  ? -1.122  -14.233 86.313  1.00 24.76 ? 95   TYR B CE1   1 
ATOM   3155 C CE2   . TYR B 1 95  ? -0.995  -13.089 88.421  1.00 25.87 ? 95   TYR B CE2   1 
ATOM   3156 C CZ    . TYR B 1 95  ? -1.452  -14.144 87.653  1.00 25.58 ? 95   TYR B CZ    1 
ATOM   3157 O OH    . TYR B 1 95  ? -2.256  -15.100 88.214  1.00 29.22 ? 95   TYR B OH    1 
ATOM   3158 N N     . THR B 1 96  ? 0.917   -7.545  85.002  1.00 20.89 ? 96   THR B N     1 
ATOM   3159 C CA    . THR B 1 96  ? 1.809   -6.515  84.481  1.00 21.64 ? 96   THR B CA    1 
ATOM   3160 C C     . THR B 1 96  ? 2.623   -5.933  85.624  1.00 21.04 ? 96   THR B C     1 
ATOM   3161 O O     . THR B 1 96  ? 2.065   -5.360  86.560  1.00 22.29 ? 96   THR B O     1 
ATOM   3162 C CB    . THR B 1 96  ? 1.039   -5.366  83.816  1.00 21.31 ? 96   THR B CB    1 
ATOM   3163 O OG1   . THR B 1 96  ? 0.410   -5.841  82.625  1.00 21.48 ? 96   THR B OG1   1 
ATOM   3164 C CG2   . THR B 1 96  ? 1.990   -4.227  83.456  1.00 21.26 ? 96   THR B CG2   1 
ATOM   3165 N N     . ARG B 1 97  ? 3.941   -6.085  85.541  1.00 18.76 ? 97   ARG B N     1 
ATOM   3166 C CA    . ARG B 1 97  ? 4.834   -5.584  86.569  1.00 16.89 ? 97   ARG B CA    1 
ATOM   3167 C C     . ARG B 1 97  ? 5.462   -4.245  86.179  1.00 19.20 ? 97   ARG B C     1 
ATOM   3168 O O     . ARG B 1 97  ? 5.658   -3.369  87.028  1.00 17.61 ? 97   ARG B O     1 
ATOM   3169 C CB    . ARG B 1 97  ? 5.933   -6.606  86.829  1.00 16.72 ? 97   ARG B CB    1 
ATOM   3170 C CG    . ARG B 1 97  ? 5.417   -8.011  87.090  1.00 20.09 ? 97   ARG B CG    1 
ATOM   3171 C CD    . ARG B 1 97  ? 4.346   -8.031  88.184  1.00 19.58 ? 97   ARG B CD    1 
ATOM   3172 N NE    . ARG B 1 97  ? 4.051   -9.394  88.606  1.00 21.05 ? 97   ARG B NE    1 
ATOM   3173 C CZ    . ARG B 1 97  ? 3.036   -9.737  89.390  1.00 22.39 ? 97   ARG B CZ    1 
ATOM   3174 N NH1   . ARG B 1 97  ? 2.197   -8.814  89.845  1.00 22.14 ? 97   ARG B NH1   1 
ATOM   3175 N NH2   . ARG B 1 97  ? 2.868   -11.007 89.727  1.00 19.75 ? 97   ARG B NH2   1 
ATOM   3176 N N     . ALA B 1 98  ? 5.772   -4.081  84.896  1.00 17.19 ? 98   ALA B N     1 
ATOM   3177 C CA    . ALA B 1 98  ? 6.378   -2.841  84.447  1.00 19.46 ? 98   ALA B CA    1 
ATOM   3178 C C     . ALA B 1 98  ? 5.619   -2.239  83.283  1.00 20.73 ? 98   ALA B C     1 
ATOM   3179 O O     . ALA B 1 98  ? 5.160   -2.950  82.395  1.00 21.40 ? 98   ALA B O     1 
ATOM   3180 C CB    . ALA B 1 98  ? 7.829   -3.078  84.054  1.00 18.16 ? 98   ALA B CB    1 
ATOM   3181 N N     . VAL B 1 99  ? 5.489   -0.918  83.310  1.00 20.34 ? 99   VAL B N     1 
ATOM   3182 C CA    . VAL B 1 99  ? 4.803   -0.182  82.266  1.00 20.96 ? 99   VAL B CA    1 
ATOM   3183 C C     . VAL B 1 99  ? 5.783   0.825   81.681  1.00 21.11 ? 99   VAL B C     1 
ATOM   3184 O O     . VAL B 1 99  ? 6.204   1.751   82.376  1.00 20.95 ? 99   VAL B O     1 
ATOM   3185 C CB    . VAL B 1 99  ? 3.586   0.607   82.823  1.00 23.31 ? 99   VAL B CB    1 
ATOM   3186 C CG1   . VAL B 1 99  ? 2.951   1.434   81.709  1.00 20.69 ? 99   VAL B CG1   1 
ATOM   3187 C CG2   . VAL B 1 99  ? 2.563   -0.350  83.434  1.00 18.72 ? 99   VAL B CG2   1 
ATOM   3188 N N     . LEU B 1 100 ? 6.159   0.628   80.418  1.00 20.36 ? 100  LEU B N     1 
ATOM   3189 C CA    . LEU B 1 100 ? 7.069   1.543   79.732  1.00 19.90 ? 100  LEU B CA    1 
ATOM   3190 C C     . LEU B 1 100 ? 6.242   2.490   78.867  1.00 19.93 ? 100  LEU B C     1 
ATOM   3191 O O     . LEU B 1 100 ? 5.540   2.049   77.959  1.00 21.73 ? 100  LEU B O     1 
ATOM   3192 C CB    . LEU B 1 100 ? 8.061   0.774   78.849  1.00 18.76 ? 100  LEU B CB    1 
ATOM   3193 C CG    . LEU B 1 100 ? 9.247   0.079   79.528  1.00 15.94 ? 100  LEU B CG    1 
ATOM   3194 C CD1   . LEU B 1 100 ? 8.749   -0.987  80.476  1.00 15.05 ? 100  LEU B CD1   1 
ATOM   3195 C CD2   . LEU B 1 100 ? 10.155  -0.538  78.467  1.00 17.79 ? 100  LEU B CD2   1 
ATOM   3196 N N     . SER B 1 101 ? 6.323   3.786   79.157  1.00 19.59 ? 101  SER B N     1 
ATOM   3197 C CA    . SER B 1 101 ? 5.571   4.797   78.412  1.00 20.17 ? 101  SER B CA    1 
ATOM   3198 C C     . SER B 1 101 ? 6.429   5.523   77.396  1.00 19.58 ? 101  SER B C     1 
ATOM   3199 O O     . SER B 1 101 ? 7.449   6.112   77.746  1.00 19.05 ? 101  SER B O     1 
ATOM   3200 C CB    . SER B 1 101 ? 4.972   5.830   79.373  1.00 20.64 ? 101  SER B CB    1 
ATOM   3201 O OG    . SER B 1 101 ? 4.139   5.200   80.323  1.00 26.69 ? 101  SER B OG    1 
ATOM   3202 N N     . PHE B 1 102 ? 6.009   5.486   76.138  1.00 20.63 ? 102  PHE B N     1 
ATOM   3203 C CA    . PHE B 1 102 ? 6.742   6.157   75.075  1.00 23.00 ? 102  PHE B CA    1 
ATOM   3204 C C     . PHE B 1 102 ? 5.975   7.385   74.611  1.00 25.27 ? 102  PHE B C     1 
ATOM   3205 O O     . PHE B 1 102 ? 4.841   7.613   75.025  1.00 24.51 ? 102  PHE B O     1 
ATOM   3206 C CB    . PHE B 1 102 ? 6.973   5.218   73.884  1.00 20.19 ? 102  PHE B CB    1 
ATOM   3207 C CG    . PHE B 1 102 ? 7.863   4.043   74.197  1.00 20.56 ? 102  PHE B CG    1 
ATOM   3208 C CD1   . PHE B 1 102 ? 7.356   2.912   74.843  1.00 19.22 ? 102  PHE B CD1   1 
ATOM   3209 C CD2   . PHE B 1 102 ? 9.209   4.062   73.843  1.00 16.78 ? 102  PHE B CD2   1 
ATOM   3210 C CE1   . PHE B 1 102 ? 8.186   1.817   75.124  1.00 17.71 ? 102  PHE B CE1   1 
ATOM   3211 C CE2   . PHE B 1 102 ? 10.038  2.971   74.123  1.00 15.82 ? 102  PHE B CE2   1 
ATOM   3212 C CZ    . PHE B 1 102 ? 9.523   1.851   74.762  1.00 14.14 ? 102  PHE B CZ    1 
ATOM   3213 N N     . ASP B 1 103 ? 6.603   8.178   73.754  1.00 29.90 ? 103  ASP B N     1 
ATOM   3214 C CA    . ASP B 1 103 ? 5.965   9.373   73.238  1.00 35.25 ? 103  ASP B CA    1 
ATOM   3215 C C     . ASP B 1 103 ? 4.741   8.970   72.422  1.00 37.96 ? 103  ASP B C     1 
ATOM   3216 O O     . ASP B 1 103 ? 4.712   7.898   71.811  1.00 38.41 ? 103  ASP B O     1 
ATOM   3217 C CB    . ASP B 1 103 ? 6.947   10.150  72.362  1.00 39.11 ? 103  ASP B CB    1 
ATOM   3218 C CG    . ASP B 1 103 ? 6.480   11.571  72.072  1.00 44.20 ? 103  ASP B CG    1 
ATOM   3219 O OD1   . ASP B 1 103 ? 7.168   12.272  71.296  1.00 45.60 ? 103  ASP B OD1   1 
ATOM   3220 O OD2   . ASP B 1 103 ? 5.432   11.989  72.618  1.00 45.83 ? 103  ASP B OD2   1 
ATOM   3221 N N     . ASN B 1 104 ? 3.721   9.822   72.438  1.00 40.49 ? 104  ASN B N     1 
ATOM   3222 C CA    . ASN B 1 104 ? 2.494   9.580   71.691  1.00 43.18 ? 104  ASN B CA    1 
ATOM   3223 C C     . ASN B 1 104 ? 1.645   8.404   72.162  1.00 43.98 ? 104  ASN B C     1 
ATOM   3224 O O     . ASN B 1 104 ? 1.130   7.643   71.342  1.00 44.95 ? 104  ASN B O     1 
ATOM   3225 C CB    . ASN B 1 104 ? 2.810   9.404   70.203  1.00 45.14 ? 104  ASN B CB    1 
ATOM   3226 C CG    . ASN B 1 104 ? 3.371   10.660  69.575  1.00 47.95 ? 104  ASN B CG    1 
ATOM   3227 O OD1   . ASN B 1 104 ? 2.728   11.712  69.582  1.00 49.32 ? 104  ASN B OD1   1 
ATOM   3228 N ND2   . ASN B 1 104 ? 4.577   10.560  69.027  1.00 49.49 ? 104  ASN B ND2   1 
ATOM   3229 N N     . GLU B 1 105 ? 1.501   8.250   73.475  1.00 44.81 ? 105  GLU B N     1 
ATOM   3230 C CA    . GLU B 1 105 ? 0.672   7.182   74.041  1.00 45.02 ? 105  GLU B CA    1 
ATOM   3231 C C     . GLU B 1 105 ? 1.130   5.743   73.771  1.00 42.18 ? 105  GLU B C     1 
ATOM   3232 O O     . GLU B 1 105 ? 0.376   4.801   74.010  1.00 41.17 ? 105  GLU B O     1 
ATOM   3233 C CB    . GLU B 1 105 ? -0.767  7.335   73.538  1.00 48.48 ? 105  GLU B CB    1 
ATOM   3234 C CG    . GLU B 1 105 ? -1.255  8.769   73.477  1.00 54.71 ? 105  GLU B CG    1 
ATOM   3235 C CD    . GLU B 1 105 ? -1.448  9.377   74.850  1.00 58.16 ? 105  GLU B CD    1 
ATOM   3236 O OE1   . GLU B 1 105 ? -2.372  8.933   75.565  1.00 60.59 ? 105  GLU B OE1   1 
ATOM   3237 O OE2   . GLU B 1 105 ? -0.676  10.293  75.214  1.00 59.43 ? 105  GLU B OE2   1 
ATOM   3238 N N     . LEU B 1 106 ? 2.343   5.562   73.264  1.00 40.36 ? 106  LEU B N     1 
ATOM   3239 C CA    . LEU B 1 106 ? 2.840   4.212   73.004  1.00 38.77 ? 106  LEU B CA    1 
ATOM   3240 C C     . LEU B 1 106 ? 3.185   3.513   74.319  1.00 36.41 ? 106  LEU B C     1 
ATOM   3241 O O     . LEU B 1 106 ? 3.837   4.097   75.180  1.00 34.88 ? 106  LEU B O     1 
ATOM   3242 C CB    . LEU B 1 106 ? 4.086   4.259   72.122  1.00 40.24 ? 106  LEU B CB    1 
ATOM   3243 C CG    . LEU B 1 106 ? 3.921   3.637   70.741  1.00 42.43 ? 106  LEU B CG    1 
ATOM   3244 C CD1   . LEU B 1 106 ? 3.467   2.185   70.879  1.00 40.83 ? 106  LEU B CD1   1 
ATOM   3245 C CD2   . LEU B 1 106 ? 2.906   4.456   69.943  1.00 45.58 ? 106  LEU B CD2   1 
ATOM   3246 N N     . MET B 1 107 ? 2.758   2.263   74.471  1.00 33.76 ? 107  MET B N     1 
ATOM   3247 C CA    . MET B 1 107 ? 3.037   1.533   75.703  1.00 32.67 ? 107  MET B CA    1 
ATOM   3248 C C     . MET B 1 107 ? 3.590   0.121   75.482  1.00 29.89 ? 107  MET B C     1 
ATOM   3249 O O     . MET B 1 107 ? 3.222   -0.563  74.533  1.00 29.67 ? 107  MET B O     1 
ATOM   3250 C CB    . MET B 1 107 ? 1.763   1.423   76.550  1.00 34.41 ? 107  MET B CB    1 
ATOM   3251 C CG    . MET B 1 107 ? 0.937   2.702   76.684  1.00 35.66 ? 107  MET B CG    1 
ATOM   3252 S SD    . MET B 1 107 ? 1.728   4.003   77.633  1.00 37.95 ? 107  MET B SD    1 
ATOM   3253 C CE    . MET B 1 107 ? 1.525   3.377   79.299  1.00 36.20 ? 107  MET B CE    1 
ATOM   3254 N N     . ALA B 1 108 ? 4.483   -0.299  76.369  1.00 27.50 ? 108  ALA B N     1 
ATOM   3255 C CA    . ALA B 1 108 ? 5.051   -1.642  76.333  1.00 24.44 ? 108  ALA B CA    1 
ATOM   3256 C C     . ALA B 1 108 ? 4.859   -2.149  77.756  1.00 22.19 ? 108  ALA B C     1 
ATOM   3257 O O     . ALA B 1 108 ? 5.067   -1.402  78.713  1.00 20.14 ? 108  ALA B O     1 
ATOM   3258 C CB    . ALA B 1 108 ? 6.520   -1.599  75.980  1.00 23.78 ? 108  ALA B CB    1 
ATOM   3259 N N     . TYR B 1 109 ? 4.446   -3.404  77.899  1.00 20.24 ? 109  TYR B N     1 
ATOM   3260 C CA    . TYR B 1 109 ? 4.205   -3.969  79.221  1.00 18.06 ? 109  TYR B CA    1 
ATOM   3261 C C     . TYR B 1 109 ? 4.944   -5.275  79.465  1.00 16.45 ? 109  TYR B C     1 
ATOM   3262 O O     . TYR B 1 109 ? 5.066   -6.107  78.575  1.00 15.30 ? 109  TYR B O     1 
ATOM   3263 C CB    . TYR B 1 109 ? 2.710   -4.223  79.423  1.00 17.99 ? 109  TYR B CB    1 
ATOM   3264 C CG    . TYR B 1 109 ? 1.819   -3.027  79.182  1.00 20.10 ? 109  TYR B CG    1 
ATOM   3265 C CD1   . TYR B 1 109 ? 1.371   -2.708  77.898  1.00 21.48 ? 109  TYR B CD1   1 
ATOM   3266 C CD2   . TYR B 1 109 ? 1.392   -2.230  80.246  1.00 21.27 ? 109  TYR B CD2   1 
ATOM   3267 C CE1   . TYR B 1 109 ? 0.507   -1.618  77.684  1.00 22.57 ? 109  TYR B CE1   1 
ATOM   3268 C CE2   . TYR B 1 109 ? 0.538   -1.147  80.046  1.00 21.48 ? 109  TYR B CE2   1 
ATOM   3269 C CZ    . TYR B 1 109 ? 0.099   -0.846  78.769  1.00 22.71 ? 109  TYR B CZ    1 
ATOM   3270 O OH    . TYR B 1 109 ? -0.736  0.229   78.585  1.00 23.43 ? 109  TYR B OH    1 
ATOM   3271 N N     . PHE B 1 110 ? 5.428   -5.452  80.688  1.00 16.05 ? 110  PHE B N     1 
ATOM   3272 C CA    . PHE B 1 110 ? 6.121   -6.676  81.051  1.00 16.00 ? 110  PHE B CA    1 
ATOM   3273 C C     . PHE B 1 110 ? 5.298   -7.350  82.132  1.00 14.97 ? 110  PHE B C     1 
ATOM   3274 O O     . PHE B 1 110 ? 4.988   -6.733  83.154  1.00 15.54 ? 110  PHE B O     1 
ATOM   3275 C CB    . PHE B 1 110 ? 7.530   -6.379  81.578  1.00 13.94 ? 110  PHE B CB    1 
ATOM   3276 C CG    . PHE B 1 110 ? 8.292   -7.613  81.985  1.00 12.47 ? 110  PHE B CG    1 
ATOM   3277 C CD1   . PHE B 1 110 ? 8.736   -8.525  81.026  1.00 10.56 ? 110  PHE B CD1   1 
ATOM   3278 C CD2   . PHE B 1 110 ? 8.528   -7.885  83.329  1.00 12.28 ? 110  PHE B CD2   1 
ATOM   3279 C CE1   . PHE B 1 110 ? 9.397   -9.693  81.399  1.00 11.14 ? 110  PHE B CE1   1 
ATOM   3280 C CE2   . PHE B 1 110 ? 9.191   -9.053  83.719  1.00 11.02 ? 110  PHE B CE2   1 
ATOM   3281 C CZ    . PHE B 1 110 ? 9.625   -9.959  82.756  1.00 10.65 ? 110  PHE B CZ    1 
ATOM   3282 N N     . SER B 1 111 ? 4.940   -8.606  81.891  1.00 14.98 ? 111  SER B N     1 
ATOM   3283 C CA    . SER B 1 111 ? 4.141   -9.404  82.826  1.00 17.18 ? 111  SER B CA    1 
ATOM   3284 C C     . SER B 1 111 ? 5.023   -10.458 83.444  1.00 17.29 ? 111  SER B C     1 
ATOM   3285 O O     . SER B 1 111 ? 5.958   -10.934 82.811  1.00 19.26 ? 111  SER B O     1 
ATOM   3286 C CB    . SER B 1 111 ? 2.990   -10.120 82.110  1.00 15.36 ? 111  SER B CB    1 
ATOM   3287 O OG    . SER B 1 111 ? 1.944   -9.231  81.802  1.00 24.84 ? 111  SER B OG    1 
ATOM   3288 N N     . ASP B 1 112 ? 4.702   -10.849 84.669  1.00 18.28 ? 112  ASP B N     1 
ATOM   3289 C CA    . ASP B 1 112 ? 5.494   -11.846 85.350  1.00 18.91 ? 112  ASP B CA    1 
ATOM   3290 C C     . ASP B 1 112 ? 4.778   -12.355 86.594  1.00 19.50 ? 112  ASP B C     1 
ATOM   3291 O O     . ASP B 1 112 ? 4.985   -11.846 87.690  1.00 19.12 ? 112  ASP B O     1 
ATOM   3292 C CB    . ASP B 1 112 ? 6.843   -11.235 85.715  1.00 18.89 ? 112  ASP B CB    1 
ATOM   3293 C CG    . ASP B 1 112 ? 7.787   -12.236 86.312  1.00 20.42 ? 112  ASP B CG    1 
ATOM   3294 O OD1   . ASP B 1 112 ? 7.448   -13.446 86.317  1.00 17.37 ? 112  ASP B OD1   1 
ATOM   3295 O OD2   . ASP B 1 112 ? 8.867   -11.805 86.768  1.00 21.21 ? 112  ASP B OD2   1 
ATOM   3296 N N     . MET B 1 113 ? 3.941   -13.372 86.416  1.00 20.26 ? 113  MET B N     1 
ATOM   3297 C CA    . MET B 1 113 ? 3.185   -13.933 87.532  1.00 19.87 ? 113  MET B CA    1 
ATOM   3298 C C     . MET B 1 113 ? 4.018   -14.245 88.777  1.00 21.01 ? 113  MET B C     1 
ATOM   3299 O O     . MET B 1 113 ? 3.738   -13.723 89.855  1.00 20.92 ? 113  MET B O     1 
ATOM   3300 C CB    . MET B 1 113 ? 2.451   -15.195 87.092  1.00 18.12 ? 113  MET B CB    1 
ATOM   3301 C CG    . MET B 1 113 ? 1.767   -15.931 88.242  1.00 22.32 ? 113  MET B CG    1 
ATOM   3302 S SD    . MET B 1 113 ? 0.819   -17.362 87.696  1.00 25.49 ? 113  MET B SD    1 
ATOM   3303 C CE    . MET B 1 113 ? 2.132   -18.601 87.509  1.00 23.06 ? 113  MET B CE    1 
ATOM   3304 N N     . ARG B 1 114 ? 5.048   -15.075 88.629  1.00 21.46 ? 114  ARG B N     1 
ATOM   3305 C CA    . ARG B 1 114 ? 5.875   -15.457 89.768  1.00 20.87 ? 114  ARG B CA    1 
ATOM   3306 C C     . ARG B 1 114 ? 6.935   -14.440 90.201  1.00 20.16 ? 114  ARG B C     1 
ATOM   3307 O O     . ARG B 1 114 ? 7.543   -14.584 91.262  1.00 19.60 ? 114  ARG B O     1 
ATOM   3308 C CB    . ARG B 1 114 ? 6.518   -16.819 89.495  1.00 20.82 ? 114  ARG B CB    1 
ATOM   3309 C CG    . ARG B 1 114 ? 5.483   -17.925 89.305  1.00 20.94 ? 114  ARG B CG    1 
ATOM   3310 C CD    . ARG B 1 114 ? 6.118   -19.286 89.064  1.00 18.98 ? 114  ARG B CD    1 
ATOM   3311 N NE    . ARG B 1 114 ? 6.786   -19.813 90.247  1.00 20.54 ? 114  ARG B NE    1 
ATOM   3312 C CZ    . ARG B 1 114 ? 7.387   -21.000 90.292  1.00 22.76 ? 114  ARG B CZ    1 
ATOM   3313 N NH1   . ARG B 1 114 ? 7.399   -21.781 89.215  1.00 24.87 ? 114  ARG B NH1   1 
ATOM   3314 N NH2   . ARG B 1 114 ? 7.982   -21.406 91.405  1.00 19.70 ? 114  ARG B NH2   1 
ATOM   3315 N N     . ASN B 1 115 ? 7.143   -13.411 89.390  1.00 18.86 ? 115  ASN B N     1 
ATOM   3316 C CA    . ASN B 1 115 ? 8.119   -12.365 89.702  1.00 20.71 ? 115  ASN B CA    1 
ATOM   3317 C C     . ASN B 1 115 ? 9.578   -12.805 89.720  1.00 18.92 ? 115  ASN B C     1 
ATOM   3318 O O     . ASN B 1 115 ? 10.366  -12.258 90.482  1.00 18.86 ? 115  ASN B O     1 
ATOM   3319 C CB    . ASN B 1 115 ? 7.803   -11.713 91.055  1.00 21.75 ? 115  ASN B CB    1 
ATOM   3320 C CG    . ASN B 1 115 ? 6.468   -11.003 91.063  1.00 22.74 ? 115  ASN B CG    1 
ATOM   3321 O OD1   . ASN B 1 115 ? 6.254   -10.049 90.321  1.00 25.89 ? 115  ASN B OD1   1 
ATOM   3322 N ND2   . ASN B 1 115 ? 5.560   -11.474 91.899  1.00 24.57 ? 115  ASN B ND2   1 
ATOM   3323 N N     . PHE B 1 116 ? 9.950   -13.778 88.897  1.00 17.72 ? 116  PHE B N     1 
ATOM   3324 C CA    . PHE B 1 116 ? 11.347  -14.217 88.878  1.00 18.45 ? 116  PHE B CA    1 
ATOM   3325 C C     . PHE B 1 116 ? 12.148  -13.423 87.838  1.00 17.74 ? 116  PHE B C     1 
ATOM   3326 O O     . PHE B 1 116 ? 13.374  -13.524 87.779  1.00 18.37 ? 116  PHE B O     1 
ATOM   3327 C CB    . PHE B 1 116 ? 11.454  -15.728 88.590  1.00 15.48 ? 116  PHE B CB    1 
ATOM   3328 C CG    . PHE B 1 116 ? 10.897  -16.614 89.692  1.00 17.77 ? 116  PHE B CG    1 
ATOM   3329 C CD1   . PHE B 1 116 ? 10.634  -16.103 90.968  1.00 17.59 ? 116  PHE B CD1   1 
ATOM   3330 C CD2   . PHE B 1 116 ? 10.670  -17.974 89.461  1.00 14.63 ? 116  PHE B CD2   1 
ATOM   3331 C CE1   . PHE B 1 116 ? 10.159  -16.930 91.994  1.00 16.17 ? 116  PHE B CE1   1 
ATOM   3332 C CE2   . PHE B 1 116 ? 10.196  -18.806 90.472  1.00 15.99 ? 116  PHE B CE2   1 
ATOM   3333 C CZ    . PHE B 1 116 ? 9.941   -18.282 91.748  1.00 18.10 ? 116  PHE B CZ    1 
ATOM   3334 N N     . GLY B 1 117 ? 11.448  -12.633 87.027  1.00 18.44 ? 117  GLY B N     1 
ATOM   3335 C CA    . GLY B 1 117 ? 12.113  -11.831 86.009  1.00 17.89 ? 117  GLY B CA    1 
ATOM   3336 C C     . GLY B 1 117 ? 12.923  -10.732 86.669  1.00 18.21 ? 117  GLY B C     1 
ATOM   3337 O O     . GLY B 1 117 ? 12.700  -10.430 87.838  1.00 17.97 ? 117  GLY B O     1 
ATOM   3338 N N     . THR B 1 118 ? 13.859  -10.135 85.940  1.00 17.28 ? 118  THR B N     1 
ATOM   3339 C CA    . THR B 1 118 ? 14.685  -9.080  86.518  1.00 18.87 ? 118  THR B CA    1 
ATOM   3340 C C     . THR B 1 118 ? 14.935  -7.896  85.591  1.00 18.47 ? 118  THR B C     1 
ATOM   3341 O O     . THR B 1 118 ? 14.893  -8.010  84.366  1.00 18.39 ? 118  THR B O     1 
ATOM   3342 C CB    . THR B 1 118 ? 16.076  -9.604  86.945  1.00 20.24 ? 118  THR B CB    1 
ATOM   3343 O OG1   . THR B 1 118 ? 16.763  -10.107 85.792  1.00 21.52 ? 118  THR B OG1   1 
ATOM   3344 C CG2   . THR B 1 118 ? 15.956  -10.712 87.995  1.00 20.54 ? 118  THR B CG2   1 
ATOM   3345 N N     . PHE B 1 119 ? 15.201  -6.754  86.206  1.00 18.15 ? 119  PHE B N     1 
ATOM   3346 C CA    . PHE B 1 119 ? 15.503  -5.533  85.484  1.00 17.79 ? 119  PHE B CA    1 
ATOM   3347 C C     . PHE B 1 119 ? 16.699  -4.874  86.142  1.00 19.51 ? 119  PHE B C     1 
ATOM   3348 O O     . PHE B 1 119 ? 16.845  -4.904  87.366  1.00 20.34 ? 119  PHE B O     1 
ATOM   3349 C CB    . PHE B 1 119 ? 14.334  -4.554  85.526  1.00 16.45 ? 119  PHE B CB    1 
ATOM   3350 C CG    . PHE B 1 119 ? 13.221  -4.886  84.576  1.00 13.46 ? 119  PHE B CG    1 
ATOM   3351 C CD1   . PHE B 1 119 ? 12.183  -5.718  84.964  1.00 9.37  ? 119  PHE B CD1   1 
ATOM   3352 C CD2   . PHE B 1 119 ? 13.199  -4.336  83.297  1.00 13.68 ? 119  PHE B CD2   1 
ATOM   3353 C CE1   . PHE B 1 119 ? 11.134  -5.995  84.093  1.00 11.27 ? 119  PHE B CE1   1 
ATOM   3354 C CE2   . PHE B 1 119 ? 12.147  -4.611  82.413  1.00 12.78 ? 119  PHE B CE2   1 
ATOM   3355 C CZ    . PHE B 1 119 ? 11.115  -5.437  82.814  1.00 9.50  ? 119  PHE B CZ    1 
ATOM   3356 N N     . LYS B 1 120 ? 17.551  -4.281  85.317  1.00 19.60 ? 120  LYS B N     1 
ATOM   3357 C CA    . LYS B 1 120 ? 18.730  -3.570  85.787  1.00 19.36 ? 120  LYS B CA    1 
ATOM   3358 C C     . LYS B 1 120 ? 18.976  -2.464  84.774  1.00 19.72 ? 120  LYS B C     1 
ATOM   3359 O O     . LYS B 1 120 ? 18.791  -2.658  83.576  1.00 19.09 ? 120  LYS B O     1 
ATOM   3360 C CB    . LYS B 1 120 ? 19.932  -4.511  85.858  1.00 20.26 ? 120  LYS B CB    1 
ATOM   3361 C CG    . LYS B 1 120 ? 21.260  -3.833  86.129  1.00 22.03 ? 120  LYS B CG    1 
ATOM   3362 C CD    . LYS B 1 120 ? 22.299  -4.874  86.515  1.00 27.28 ? 120  LYS B CD    1 
ATOM   3363 C CE    . LYS B 1 120 ? 23.726  -4.343  86.411  1.00 29.56 ? 120  LYS B CE    1 
ATOM   3364 N NZ    . LYS B 1 120 ? 23.981  -3.189  87.311  1.00 32.19 ? 120  LYS B NZ    1 
ATOM   3365 N N     . PHE B 1 121 ? 19.369  -1.297  85.258  1.00 19.75 ? 121  PHE B N     1 
ATOM   3366 C CA    . PHE B 1 121 ? 19.624  -0.165  84.383  1.00 18.25 ? 121  PHE B CA    1 
ATOM   3367 C C     . PHE B 1 121 ? 21.071  0.209   84.543  1.00 20.08 ? 121  PHE B C     1 
ATOM   3368 O O     . PHE B 1 121 ? 21.576  0.338   85.656  1.00 21.72 ? 121  PHE B O     1 
ATOM   3369 C CB    . PHE B 1 121 ? 18.723  0.999   84.773  1.00 15.14 ? 121  PHE B CB    1 
ATOM   3370 C CG    . PHE B 1 121 ? 17.265  0.671   84.692  1.00 11.42 ? 121  PHE B CG    1 
ATOM   3371 C CD1   . PHE B 1 121 ? 16.570  0.823   83.500  1.00 9.84  ? 121  PHE B CD1   1 
ATOM   3372 C CD2   . PHE B 1 121 ? 16.598  0.154   85.802  1.00 12.82 ? 121  PHE B CD2   1 
ATOM   3373 C CE1   . PHE B 1 121 ? 15.225  0.462   83.405  1.00 11.14 ? 121  PHE B CE1   1 
ATOM   3374 C CE2   . PHE B 1 121 ? 15.251  -0.213  85.720  1.00 13.54 ? 121  PHE B CE2   1 
ATOM   3375 C CZ    . PHE B 1 121 ? 14.567  -0.056  84.513  1.00 11.53 ? 121  PHE B CZ    1 
ATOM   3376 N N     . SER B 1 122 ? 21.744  0.384   83.423  1.00 21.56 ? 122  SER B N     1 
ATOM   3377 C CA    . SER B 1 122 ? 23.151  0.717   83.459  1.00 24.02 ? 122  SER B CA    1 
ATOM   3378 C C     . SER B 1 122 ? 23.483  1.653   82.325  1.00 24.37 ? 122  SER B C     1 
ATOM   3379 O O     . SER B 1 122 ? 22.786  1.680   81.309  1.00 25.20 ? 122  SER B O     1 
ATOM   3380 C CB    . SER B 1 122 ? 23.968  -0.569  83.324  1.00 25.14 ? 122  SER B CB    1 
ATOM   3381 O OG    . SER B 1 122 ? 25.346  -0.297  83.160  1.00 28.44 ? 122  SER B OG    1 
ATOM   3382 N N     . ASN B 1 123 ? 24.530  2.445   82.499  1.00 25.87 ? 123  ASN B N     1 
ATOM   3383 C CA    . ASN B 1 123 ? 24.946  3.328   81.424  1.00 30.29 ? 123  ASN B CA    1 
ATOM   3384 C C     . ASN B 1 123 ? 26.404  2.975   81.115  1.00 31.16 ? 123  ASN B C     1 
ATOM   3385 O O     . ASN B 1 123 ? 27.176  3.787   80.606  1.00 31.23 ? 123  ASN B O     1 
ATOM   3386 C CB    . ASN B 1 123 ? 24.763  4.801   81.821  1.00 33.30 ? 123  ASN B CB    1 
ATOM   3387 C CG    . ASN B 1 123 ? 25.783  5.274   82.818  1.00 37.15 ? 123  ASN B CG    1 
ATOM   3388 O OD1   . ASN B 1 123 ? 26.088  4.585   83.791  1.00 39.66 ? 123  ASN B OD1   1 
ATOM   3389 N ND2   . ASN B 1 123 ? 26.314  6.472   82.589  1.00 38.80 ? 123  ASN B ND2   1 
ATOM   3390 N N     . SER B 1 124 ? 26.754  1.727   81.420  1.00 30.66 ? 124  SER B N     1 
ATOM   3391 C CA    . SER B 1 124 ? 28.094  1.210   81.186  1.00 32.13 ? 124  SER B CA    1 
ATOM   3392 C C     . SER B 1 124 ? 28.121  0.090   80.151  1.00 32.37 ? 124  SER B C     1 
ATOM   3393 O O     . SER B 1 124 ? 27.657  -1.020  80.416  1.00 31.34 ? 124  SER B O     1 
ATOM   3394 C CB    . SER B 1 124 ? 28.695  0.675   82.486  1.00 32.36 ? 124  SER B CB    1 
ATOM   3395 O OG    . SER B 1 124 ? 29.847  -0.109  82.215  1.00 33.28 ? 124  SER B OG    1 
ATOM   3396 N N     . GLU B 1 125 ? 28.667  0.379   78.976  1.00 32.97 ? 125  GLU B N     1 
ATOM   3397 C CA    . GLU B 1 125 ? 28.771  -0.636  77.941  1.00 35.81 ? 125  GLU B CA    1 
ATOM   3398 C C     . GLU B 1 125 ? 29.763  -1.692  78.426  1.00 34.15 ? 125  GLU B C     1 
ATOM   3399 O O     . GLU B 1 125 ? 29.670  -2.862  78.068  1.00 33.28 ? 125  GLU B O     1 
ATOM   3400 C CB    . GLU B 1 125 ? 29.280  -0.030  76.637  1.00 40.58 ? 125  GLU B CB    1 
ATOM   3401 C CG    . GLU B 1 125 ? 29.325  -1.033  75.498  1.00 48.91 ? 125  GLU B CG    1 
ATOM   3402 C CD    . GLU B 1 125 ? 30.163  -0.556  74.330  1.00 54.30 ? 125  GLU B CD    1 
ATOM   3403 O OE1   . GLU B 1 125 ? 31.384  -0.356  74.520  1.00 58.37 ? 125  GLU B OE1   1 
ATOM   3404 O OE2   . GLU B 1 125 ? 29.605  -0.383  73.224  1.00 57.14 ? 125  GLU B OE2   1 
ATOM   3405 N N     . LYS B 1 126 ? 30.712  -1.257  79.248  1.00 33.46 ? 126  LYS B N     1 
ATOM   3406 C CA    . LYS B 1 126 ? 31.730  -2.133  79.811  1.00 33.65 ? 126  LYS B CA    1 
ATOM   3407 C C     . LYS B 1 126 ? 31.078  -3.276  80.584  1.00 32.08 ? 126  LYS B C     1 
ATOM   3408 O O     . LYS B 1 126 ? 31.372  -4.449  80.355  1.00 31.45 ? 126  LYS B O     1 
ATOM   3409 C CB    . LYS B 1 126 ? 32.628  -1.349  80.771  1.00 35.39 ? 126  LYS B CB    1 
ATOM   3410 C CG    . LYS B 1 126 ? 33.331  -0.136  80.177  1.00 39.32 ? 126  LYS B CG    1 
ATOM   3411 C CD    . LYS B 1 126 ? 34.636  -0.523  79.520  1.00 42.52 ? 126  LYS B CD    1 
ATOM   3412 C CE    . LYS B 1 126 ? 35.485  0.699   79.211  1.00 44.06 ? 126  LYS B CE    1 
ATOM   3413 N NZ    . LYS B 1 126 ? 34.845  1.602   78.214  1.00 45.94 ? 126  LYS B NZ    1 
ATOM   3414 N N     . GLU B 1 127 ? 30.194  -2.918  81.507  1.00 30.47 ? 127  GLU B N     1 
ATOM   3415 C CA    . GLU B 1 127 ? 29.514  -3.898  82.340  1.00 29.54 ? 127  GLU B CA    1 
ATOM   3416 C C     . GLU B 1 127 ? 28.626  -4.845  81.524  1.00 26.82 ? 127  GLU B C     1 
ATOM   3417 O O     . GLU B 1 127 ? 28.494  -6.027  81.854  1.00 24.83 ? 127  GLU B O     1 
ATOM   3418 C CB    . GLU B 1 127 ? 28.685  -3.180  83.402  1.00 31.88 ? 127  GLU B CB    1 
ATOM   3419 C CG    . GLU B 1 127 ? 28.398  -4.019  84.625  1.00 38.65 ? 127  GLU B CG    1 
ATOM   3420 C CD    . GLU B 1 127 ? 27.573  -3.274  85.656  1.00 43.93 ? 127  GLU B CD    1 
ATOM   3421 O OE1   . GLU B 1 127 ? 27.857  -2.080  85.901  1.00 45.82 ? 127  GLU B OE1   1 
ATOM   3422 O OE2   . GLU B 1 127 ? 26.648  -3.887  86.228  1.00 46.79 ? 127  GLU B OE2   1 
ATOM   3423 N N     . LEU B 1 128 ? 28.019  -4.331  80.460  1.00 23.95 ? 128  LEU B N     1 
ATOM   3424 C CA    . LEU B 1 128 ? 27.169  -5.165  79.624  1.00 23.46 ? 128  LEU B CA    1 
ATOM   3425 C C     . LEU B 1 128 ? 28.035  -6.223  78.942  1.00 22.93 ? 128  LEU B C     1 
ATOM   3426 O O     . LEU B 1 128 ? 27.709  -7.410  78.953  1.00 22.06 ? 128  LEU B O     1 
ATOM   3427 C CB    . LEU B 1 128 ? 26.449  -4.322  78.563  1.00 21.42 ? 128  LEU B CB    1 
ATOM   3428 C CG    . LEU B 1 128 ? 25.562  -5.135  77.613  1.00 20.99 ? 128  LEU B CG    1 
ATOM   3429 C CD1   . LEU B 1 128 ? 24.431  -5.765  78.402  1.00 21.92 ? 128  LEU B CD1   1 
ATOM   3430 C CD2   . LEU B 1 128 ? 25.016  -4.255  76.512  1.00 21.33 ? 128  LEU B CD2   1 
ATOM   3431 N N     . LYS B 1 129 ? 29.149  -5.781  78.365  1.00 23.26 ? 129  LYS B N     1 
ATOM   3432 C CA    . LYS B 1 129 ? 30.072  -6.671  77.670  1.00 24.53 ? 129  LYS B CA    1 
ATOM   3433 C C     . LYS B 1 129 ? 30.515  -7.822  78.576  1.00 25.55 ? 129  LYS B C     1 
ATOM   3434 O O     . LYS B 1 129 ? 30.477  -8.981  78.169  1.00 25.96 ? 129  LYS B O     1 
ATOM   3435 C CB    . LYS B 1 129 ? 31.287  -5.882  77.183  1.00 25.39 ? 129  LYS B CB    1 
ATOM   3436 C CG    . LYS B 1 129 ? 31.810  -6.319  75.829  1.00 27.82 ? 129  LYS B CG    1 
ATOM   3437 C CD    . LYS B 1 129 ? 32.947  -5.425  75.362  0.00 28.79 ? 129  LYS B CD    1 
ATOM   3438 C CE    . LYS B 1 129 ? 33.328  -5.719  73.919  0.00 29.70 ? 129  LYS B CE    1 
ATOM   3439 N NZ    . LYS B 1 129 ? 32.218  -5.405  72.974  0.00 30.36 ? 129  LYS B NZ    1 
ATOM   3440 N N     . ARG B 1 130 ? 30.936  -7.509  79.799  1.00 24.25 ? 130  ARG B N     1 
ATOM   3441 C CA    . ARG B 1 130 ? 31.350  -8.556  80.725  1.00 25.31 ? 130  ARG B CA    1 
ATOM   3442 C C     . ARG B 1 130 ? 30.162  -9.470  81.029  1.00 25.71 ? 130  ARG B C     1 
ATOM   3443 O O     . ARG B 1 130 ? 30.329  -10.679 81.199  1.00 26.69 ? 130  ARG B O     1 
ATOM   3444 C CB    . ARG B 1 130 ? 31.898  -7.952  82.023  1.00 25.16 ? 130  ARG B CB    1 
ATOM   3445 C CG    . ARG B 1 130 ? 33.249  -7.257  81.856  1.00 27.78 ? 130  ARG B CG    1 
ATOM   3446 C CD    . ARG B 1 130 ? 33.862  -6.868  83.205  1.00 28.55 ? 130  ARG B CD    1 
ATOM   3447 N NE    . ARG B 1 130 ? 33.141  -5.787  83.875  1.00 28.40 ? 130  ARG B NE    1 
ATOM   3448 C CZ    . ARG B 1 130 ? 33.454  -4.497  83.777  1.00 31.17 ? 130  ARG B CZ    1 
ATOM   3449 N NH1   . ARG B 1 130 ? 34.486  -4.113  83.034  1.00 27.73 ? 130  ARG B NH1   1 
ATOM   3450 N NH2   . ARG B 1 130 ? 32.738  -3.585  84.430  1.00 29.21 ? 130  ARG B NH2   1 
ATOM   3451 N N     . LYS B 1 131 ? 28.964  -8.889  81.093  1.00 24.50 ? 131  LYS B N     1 
ATOM   3452 C CA    . LYS B 1 131 ? 27.750  -9.661  81.351  1.00 24.20 ? 131  LYS B CA    1 
ATOM   3453 C C     . LYS B 1 131 ? 27.510  -10.652 80.210  1.00 23.13 ? 131  LYS B C     1 
ATOM   3454 O O     . LYS B 1 131 ? 27.221  -11.827 80.443  1.00 22.89 ? 131  LYS B O     1 
ATOM   3455 C CB    . LYS B 1 131 ? 26.542  -8.723  81.487  1.00 25.88 ? 131  LYS B CB    1 
ATOM   3456 C CG    . LYS B 1 131 ? 25.180  -9.416  81.388  1.00 27.69 ? 131  LYS B CG    1 
ATOM   3457 C CD    . LYS B 1 131 ? 24.957  -10.428 82.506  1.00 29.88 ? 131  LYS B CD    1 
ATOM   3458 C CE    . LYS B 1 131 ? 23.665  -11.208 82.295  1.00 29.90 ? 131  LYS B CE    1 
ATOM   3459 N NZ    . LYS B 1 131 ? 23.489  -12.286 83.307  1.00 32.15 ? 131  LYS B NZ    1 
ATOM   3460 N N     . LEU B 1 132 ? 27.641  -10.175 78.977  1.00 21.47 ? 132  LEU B N     1 
ATOM   3461 C CA    . LEU B 1 132 ? 27.437  -11.028 77.818  1.00 22.24 ? 132  LEU B CA    1 
ATOM   3462 C C     . LEU B 1 132 ? 28.494  -12.132 77.765  1.00 23.81 ? 132  LEU B C     1 
ATOM   3463 O O     . LEU B 1 132 ? 28.213  -13.246 77.305  1.00 22.48 ? 132  LEU B O     1 
ATOM   3464 C CB    . LEU B 1 132 ? 27.458  -10.189 76.532  1.00 22.57 ? 132  LEU B CB    1 
ATOM   3465 C CG    . LEU B 1 132 ? 26.319  -9.158  76.386  1.00 22.15 ? 132  LEU B CG    1 
ATOM   3466 C CD1   . LEU B 1 132 ? 26.531  -8.277  75.161  1.00 21.55 ? 132  LEU B CD1   1 
ATOM   3467 C CD2   . LEU B 1 132 ? 25.002  -9.883  76.279  1.00 20.61 ? 132  LEU B CD2   1 
ATOM   3468 N N     . ASN B 1 133 ? 29.698  -11.832 78.253  1.00 25.55 ? 133  ASN B N     1 
ATOM   3469 C CA    . ASN B 1 133 ? 30.787  -12.815 78.265  1.00 28.90 ? 133  ASN B CA    1 
ATOM   3470 C C     . ASN B 1 133 ? 30.572  -13.931 79.283  1.00 28.80 ? 133  ASN B C     1 
ATOM   3471 O O     . ASN B 1 133 ? 31.285  -14.931 79.260  1.00 29.34 ? 133  ASN B O     1 
ATOM   3472 C CB    . ASN B 1 133 ? 32.139  -12.149 78.554  1.00 32.01 ? 133  ASN B CB    1 
ATOM   3473 C CG    . ASN B 1 133 ? 32.623  -11.276 77.410  1.00 36.52 ? 133  ASN B CG    1 
ATOM   3474 O OD1   . ASN B 1 133 ? 32.473  -11.621 76.236  1.00 38.21 ? 133  ASN B OD1   1 
ATOM   3475 N ND2   . ASN B 1 133 ? 33.228  -10.142 77.751  1.00 40.30 ? 133  ASN B ND2   1 
ATOM   3476 N N     . GLU B 1 134 ? 29.604  -13.751 80.181  1.00 29.56 ? 134  GLU B N     1 
ATOM   3477 C CA    . GLU B 1 134 ? 29.286  -14.761 81.196  1.00 29.05 ? 134  GLU B CA    1 
ATOM   3478 C C     . GLU B 1 134 ? 28.344  -15.804 80.603  1.00 27.94 ? 134  GLU B C     1 
ATOM   3479 O O     . GLU B 1 134 ? 28.044  -16.812 81.235  1.00 30.57 ? 134  GLU B O     1 
ATOM   3480 C CB    . GLU B 1 134 ? 28.592  -14.125 82.402  1.00 30.95 ? 134  GLU B CB    1 
ATOM   3481 C CG    . GLU B 1 134 ? 29.460  -13.241 83.267  1.00 35.59 ? 134  GLU B CG    1 
ATOM   3482 C CD    . GLU B 1 134 ? 28.652  -12.535 84.347  1.00 40.31 ? 134  GLU B CD    1 
ATOM   3483 O OE1   . GLU B 1 134 ? 29.257  -11.835 85.185  1.00 44.49 ? 134  GLU B OE1   1 
ATOM   3484 O OE2   . GLU B 1 134 ? 27.408  -12.672 84.357  1.00 41.35 ? 134  GLU B OE2   1 
ATOM   3485 N N     . LEU B 1 135 ? 27.866  -15.546 79.391  1.00 24.29 ? 135  LEU B N     1 
ATOM   3486 C CA    . LEU B 1 135 ? 26.961  -16.461 78.714  1.00 21.42 ? 135  LEU B CA    1 
ATOM   3487 C C     . LEU B 1 135 ? 27.668  -17.082 77.527  1.00 19.93 ? 135  LEU B C     1 
ATOM   3488 O O     . LEU B 1 135 ? 28.376  -16.388 76.787  1.00 18.78 ? 135  LEU B O     1 
ATOM   3489 C CB    . LEU B 1 135 ? 25.722  -15.712 78.218  1.00 22.03 ? 135  LEU B CB    1 
ATOM   3490 C CG    . LEU B 1 135 ? 24.863  -15.026 79.279  1.00 22.55 ? 135  LEU B CG    1 
ATOM   3491 C CD1   . LEU B 1 135 ? 23.897  -14.056 78.601  1.00 23.07 ? 135  LEU B CD1   1 
ATOM   3492 C CD2   . LEU B 1 135 ? 24.117  -16.080 80.095  1.00 20.38 ? 135  LEU B CD2   1 
ATOM   3493 N N     . GLY B 1 136 ? 27.484  -18.388 77.351  1.00 16.73 ? 136  GLY B N     1 
ATOM   3494 C CA    . GLY B 1 136 ? 28.099  -19.071 76.230  1.00 17.07 ? 136  GLY B CA    1 
ATOM   3495 C C     . GLY B 1 136 ? 27.473  -18.629 74.916  1.00 18.28 ? 136  GLY B C     1 
ATOM   3496 O O     . GLY B 1 136 ? 26.504  -17.871 74.918  1.00 18.74 ? 136  GLY B O     1 
ATOM   3497 N N     . PRO B 1 137 ? 27.997  -19.096 73.773  1.00 20.17 ? 137  PRO B N     1 
ATOM   3498 C CA    . PRO B 1 137 ? 27.471  -18.732 72.455  1.00 20.33 ? 137  PRO B CA    1 
ATOM   3499 C C     . PRO B 1 137 ? 25.978  -19.030 72.379  1.00 21.77 ? 137  PRO B C     1 
ATOM   3500 O O     . PRO B 1 137 ? 25.518  -20.054 72.888  1.00 23.66 ? 137  PRO B O     1 
ATOM   3501 C CB    . PRO B 1 137 ? 28.268  -19.624 71.500  1.00 20.29 ? 137  PRO B CB    1 
ATOM   3502 C CG    . PRO B 1 137 ? 29.513  -19.945 72.268  1.00 21.26 ? 137  PRO B CG    1 
ATOM   3503 C CD    . PRO B 1 137 ? 29.004  -20.166 73.654  1.00 20.42 ? 137  PRO B CD    1 
ATOM   3504 N N     . ASP B 1 138 ? 25.233  -18.142 71.735  1.00 20.64 ? 138  ASP B N     1 
ATOM   3505 C CA    . ASP B 1 138 ? 23.791  -18.295 71.587  1.00 20.38 ? 138  ASP B CA    1 
ATOM   3506 C C     . ASP B 1 138 ? 23.490  -19.451 70.625  1.00 19.95 ? 138  ASP B C     1 
ATOM   3507 O O     . ASP B 1 138 ? 23.820  -19.376 69.438  1.00 19.19 ? 138  ASP B O     1 
ATOM   3508 C CB    . ASP B 1 138 ? 23.202  -16.981 71.055  1.00 20.45 ? 138  ASP B CB    1 
ATOM   3509 C CG    . ASP B 1 138 ? 21.693  -16.951 71.108  1.00 23.33 ? 138  ASP B CG    1 
ATOM   3510 O OD1   . ASP B 1 138 ? 21.069  -17.928 70.648  1.00 24.93 ? 138  ASP B OD1   1 
ATOM   3511 O OD2   . ASP B 1 138 ? 21.130  -15.946 71.603  1.00 23.58 ? 138  ASP B OD2   1 
ATOM   3512 N N     . PHE B 1 139 ? 22.863  -20.511 71.138  1.00 19.08 ? 139  PHE B N     1 
ATOM   3513 C CA    . PHE B 1 139 ? 22.528  -21.700 70.335  1.00 19.30 ? 139  PHE B CA    1 
ATOM   3514 C C     . PHE B 1 139 ? 21.630  -21.450 69.120  1.00 19.24 ? 139  PHE B C     1 
ATOM   3515 O O     . PHE B 1 139 ? 21.669  -22.207 68.150  1.00 20.16 ? 139  PHE B O     1 
ATOM   3516 C CB    . PHE B 1 139 ? 21.884  -22.784 71.217  1.00 18.44 ? 139  PHE B CB    1 
ATOM   3517 C CG    . PHE B 1 139 ? 22.875  -23.625 71.986  1.00 18.95 ? 139  PHE B CG    1 
ATOM   3518 C CD1   . PHE B 1 139 ? 22.702  -23.854 73.350  1.00 17.79 ? 139  PHE B CD1   1 
ATOM   3519 C CD2   . PHE B 1 139 ? 23.941  -24.246 71.336  1.00 18.41 ? 139  PHE B CD2   1 
ATOM   3520 C CE1   . PHE B 1 139 ? 23.571  -24.696 74.058  1.00 20.08 ? 139  PHE B CE1   1 
ATOM   3521 C CE2   . PHE B 1 139 ? 24.819  -25.088 72.035  1.00 20.37 ? 139  PHE B CE2   1 
ATOM   3522 C CZ    . PHE B 1 139 ? 24.630  -25.315 73.400  1.00 19.54 ? 139  PHE B CZ    1 
ATOM   3523 N N     . LEU B 1 140 ? 20.819  -20.402 69.164  1.00 19.62 ? 140  LEU B N     1 
ATOM   3524 C CA    . LEU B 1 140 ? 19.949  -20.091 68.037  1.00 22.06 ? 140  LEU B CA    1 
ATOM   3525 C C     . LEU B 1 140 ? 20.605  -19.173 67.002  1.00 23.62 ? 140  LEU B C     1 
ATOM   3526 O O     . LEU B 1 140 ? 20.486  -19.395 65.803  1.00 25.42 ? 140  LEU B O     1 
ATOM   3527 C CB    . LEU B 1 140 ? 18.654  -19.419 68.514  1.00 18.33 ? 140  LEU B CB    1 
ATOM   3528 C CG    . LEU B 1 140 ? 17.823  -18.752 67.398  1.00 17.17 ? 140  LEU B CG    1 
ATOM   3529 C CD1   . LEU B 1 140 ? 17.234  -19.825 66.484  1.00 13.46 ? 140  LEU B CD1   1 
ATOM   3530 C CD2   . LEU B 1 140 ? 16.703  -17.890 67.996  1.00 14.71 ? 140  LEU B CD2   1 
ATOM   3531 N N     . LYS B 1 141 ? 21.303  -18.149 67.473  1.00 26.14 ? 141  LYS B N     1 
ATOM   3532 C CA    . LYS B 1 141 ? 21.902  -17.162 66.582  1.00 30.19 ? 141  LYS B CA    1 
ATOM   3533 C C     . LYS B 1 141 ? 23.312  -17.451 66.075  1.00 32.79 ? 141  LYS B C     1 
ATOM   3534 O O     . LYS B 1 141 ? 23.689  -16.998 64.995  1.00 33.55 ? 141  LYS B O     1 
ATOM   3535 C CB    . LYS B 1 141 ? 21.851  -15.793 67.272  1.00 28.37 ? 141  LYS B CB    1 
ATOM   3536 C CG    . LYS B 1 141 ? 20.454  -15.474 67.780  1.00 28.78 ? 141  LYS B CG    1 
ATOM   3537 C CD    . LYS B 1 141 ? 20.417  -14.388 68.841  1.00 29.53 ? 141  LYS B CD    1 
ATOM   3538 C CE    . LYS B 1 141 ? 20.482  -13.008 68.246  1.00 31.00 ? 141  LYS B CE    1 
ATOM   3539 N NZ    . LYS B 1 141 ? 20.156  -11.955 69.259  1.00 32.33 ? 141  LYS B NZ    1 
ATOM   3540 N N     . ASN B 1 142 ? 24.087  -18.208 66.837  1.00 35.64 ? 142  ASN B N     1 
ATOM   3541 C CA    . ASN B 1 142 ? 25.448  -18.519 66.432  1.00 39.03 ? 142  ASN B CA    1 
ATOM   3542 C C     . ASN B 1 142 ? 25.480  -19.859 65.697  1.00 41.74 ? 142  ASN B C     1 
ATOM   3543 O O     . ASN B 1 142 ? 25.246  -20.916 66.285  1.00 42.08 ? 142  ASN B O     1 
ATOM   3544 C CB    . ASN B 1 142 ? 26.351  -18.550 67.664  1.00 40.82 ? 142  ASN B CB    1 
ATOM   3545 C CG    . ASN B 1 142 ? 27.815  -18.532 67.308  1.00 42.25 ? 142  ASN B CG    1 
ATOM   3546 O OD1   . ASN B 1 142 ? 28.299  -19.405 66.584  1.00 45.50 ? 142  ASN B OD1   1 
ATOM   3547 N ND2   . ASN B 1 142 ? 28.536  -17.536 67.813  1.00 38.87 ? 142  ASN B ND2   1 
ATOM   3548 N N     . ASP B 1 143 ? 25.779  -19.804 64.404  1.00 43.89 ? 143  ASP B N     1 
ATOM   3549 C CA    . ASP B 1 143 ? 25.809  -20.996 63.563  1.00 46.66 ? 143  ASP B CA    1 
ATOM   3550 C C     . ASP B 1 143 ? 27.144  -21.746 63.562  1.00 46.42 ? 143  ASP B C     1 
ATOM   3551 O O     . ASP B 1 143 ? 27.286  -22.762 62.884  1.00 46.03 ? 143  ASP B O     1 
ATOM   3552 C CB    . ASP B 1 143 ? 25.432  -20.607 62.128  1.00 48.65 ? 143  ASP B CB    1 
ATOM   3553 C CG    . ASP B 1 143 ? 25.026  -21.800 61.285  1.00 51.71 ? 143  ASP B CG    1 
ATOM   3554 O OD1   . ASP B 1 143 ? 24.064  -22.500 61.671  1.00 52.36 ? 143  ASP B OD1   1 
ATOM   3555 O OD2   . ASP B 1 143 ? 25.665  -22.035 60.236  1.00 54.08 ? 143  ASP B OD2   1 
ATOM   3556 N N     . ASP B 1 144 ? 28.117  -21.258 64.323  1.00 47.88 ? 144  ASP B N     1 
ATOM   3557 C CA    . ASP B 1 144 ? 29.426  -21.906 64.373  1.00 48.93 ? 144  ASP B CA    1 
ATOM   3558 C C     . ASP B 1 144 ? 29.951  -22.102 65.791  1.00 48.07 ? 144  ASP B C     1 
ATOM   3559 O O     . ASP B 1 144 ? 31.026  -21.618 66.142  1.00 48.10 ? 144  ASP B O     1 
ATOM   3560 C CB    . ASP B 1 144 ? 30.439  -21.097 63.564  1.00 52.57 ? 144  ASP B CB    1 
ATOM   3561 C CG    . ASP B 1 144 ? 30.519  -19.655 64.015  1.00 55.29 ? 144  ASP B CG    1 
ATOM   3562 O OD1   . ASP B 1 144 ? 29.522  -18.921 63.848  1.00 57.14 ? 144  ASP B OD1   1 
ATOM   3563 O OD2   . ASP B 1 144 ? 31.579  -19.257 64.543  1.00 57.86 ? 144  ASP B OD2   1 
ATOM   3564 N N     . ILE B 1 145 ? 29.184  -22.819 66.602  1.00 46.78 ? 145  ILE B N     1 
ATOM   3565 C CA    . ILE B 1 145 ? 29.567  -23.099 67.980  1.00 46.35 ? 145  ILE B CA    1 
ATOM   3566 C C     . ILE B 1 145 ? 30.290  -24.440 67.983  1.00 46.54 ? 145  ILE B C     1 
ATOM   3567 O O     . ILE B 1 145 ? 29.871  -25.370 67.304  1.00 47.36 ? 145  ILE B O     1 
ATOM   3568 C CB    . ILE B 1 145 ? 28.327  -23.236 68.894  1.00 45.01 ? 145  ILE B CB    1 
ATOM   3569 C CG1   . ILE B 1 145 ? 27.540  -21.928 68.916  1.00 44.45 ? 145  ILE B CG1   1 
ATOM   3570 C CG2   . ILE B 1 145 ? 28.757  -23.628 70.298  1.00 44.39 ? 145  ILE B CG2   1 
ATOM   3571 C CD1   . ILE B 1 145 ? 26.240  -22.015 69.692  1.00 43.12 ? 145  ILE B CD1   1 
ATOM   3572 N N     . ASP B 1 146 ? 31.370  -24.571 68.740  1.00 46.29 ? 146  ASP B N     1 
ATOM   3573 C CA    . ASP B 1 146 ? 32.031  -25.870 68.750  1.00 46.18 ? 146  ASP B CA    1 
ATOM   3574 C C     . ASP B 1 146 ? 31.576  -26.642 69.973  1.00 44.25 ? 146  ASP B C     1 
ATOM   3575 O O     . ASP B 1 146 ? 32.074  -26.444 71.086  1.00 43.21 ? 146  ASP B O     1 
ATOM   3576 C CB    . ASP B 1 146 ? 33.553  -25.754 68.760  1.00 49.23 ? 146  ASP B CB    1 
ATOM   3577 C CG    . ASP B 1 146 ? 34.224  -27.118 68.653  1.00 51.43 ? 146  ASP B CG    1 
ATOM   3578 O OD1   . ASP B 1 146 ? 33.843  -27.889 67.737  1.00 51.87 ? 146  ASP B OD1   1 
ATOM   3579 O OD2   . ASP B 1 146 ? 35.113  -27.426 69.481  1.00 53.29 ? 146  ASP B OD2   1 
ATOM   3580 N N     . ILE B 1 147 ? 30.605  -27.517 69.757  1.00 44.47 ? 147  ILE B N     1 
ATOM   3581 C CA    . ILE B 1 147 ? 30.054  -28.305 70.841  1.00 44.06 ? 147  ILE B CA    1 
ATOM   3582 C C     . ILE B 1 147 ? 30.911  -29.516 71.177  1.00 43.26 ? 147  ILE B C     1 
ATOM   3583 O O     . ILE B 1 147 ? 30.567  -30.298 72.059  1.00 42.27 ? 147  ILE B O     1 
ATOM   3584 C CB    . ILE B 1 147 ? 28.635  -28.762 70.496  1.00 44.00 ? 147  ILE B CB    1 
ATOM   3585 C CG1   . ILE B 1 147 ? 28.677  -29.853 69.433  1.00 43.63 ? 147  ILE B CG1   1 
ATOM   3586 C CG2   . ILE B 1 147 ? 27.840  -27.577 69.960  1.00 42.57 ? 147  ILE B CG2   1 
ATOM   3587 C CD1   . ILE B 1 147 ? 27.340  -30.510 69.220  1.00 45.22 ? 147  ILE B CD1   1 
ATOM   3588 N N     . SER B 1 148 ? 32.032  -29.681 70.485  1.00 43.21 ? 148  SER B N     1 
ATOM   3589 C CA    . SER B 1 148 ? 32.890  -30.822 70.777  1.00 43.79 ? 148  SER B CA    1 
ATOM   3590 C C     . SER B 1 148 ? 33.473  -30.621 72.176  1.00 43.48 ? 148  SER B C     1 
ATOM   3591 O O     . SER B 1 148 ? 34.113  -31.511 72.740  1.00 44.16 ? 148  SER B O     1 
ATOM   3592 C CB    . SER B 1 148 ? 34.011  -30.935 69.746  1.00 43.94 ? 148  SER B CB    1 
ATOM   3593 O OG    . SER B 1 148 ? 35.104  -30.109 70.099  1.00 45.06 ? 148  SER B OG    1 
ATOM   3594 N N     . LYS B 1 149 ? 33.243  -29.432 72.726  1.00 42.60 ? 149  LYS B N     1 
ATOM   3595 C CA    . LYS B 1 149 ? 33.718  -29.100 74.057  1.00 40.83 ? 149  LYS B CA    1 
ATOM   3596 C C     . LYS B 1 149 ? 32.977  -29.988 75.053  1.00 38.40 ? 149  LYS B C     1 
ATOM   3597 O O     . LYS B 1 149 ? 33.413  -30.163 76.187  1.00 35.77 ? 149  LYS B O     1 
ATOM   3598 C CB    . LYS B 1 149 ? 33.453  -27.621 74.362  1.00 43.89 ? 149  LYS B CB    1 
ATOM   3599 C CG    . LYS B 1 149 ? 34.057  -27.157 75.672  1.00 47.40 ? 149  LYS B CG    1 
ATOM   3600 C CD    . LYS B 1 149 ? 33.771  -25.686 75.930  1.00 49.62 ? 149  LYS B CD    1 
ATOM   3601 C CE    . LYS B 1 149 ? 34.362  -25.249 77.267  1.00 51.90 ? 149  LYS B CE    1 
ATOM   3602 N NZ    . LYS B 1 149 ? 33.962  -23.863 77.660  1.00 52.76 ? 149  LYS B NZ    1 
ATOM   3603 N N     . ILE B 1 150 ? 31.848  -30.539 74.612  1.00 36.61 ? 150  ILE B N     1 
ATOM   3604 C CA    . ILE B 1 150 ? 31.025  -31.429 75.433  1.00 34.94 ? 150  ILE B CA    1 
ATOM   3605 C C     . ILE B 1 150 ? 31.876  -32.565 75.991  1.00 34.75 ? 150  ILE B C     1 
ATOM   3606 O O     . ILE B 1 150 ? 31.747  -32.951 77.154  1.00 32.79 ? 150  ILE B O     1 
ATOM   3607 C CB    . ILE B 1 150 ? 29.875  -32.067 74.597  1.00 35.33 ? 150  ILE B CB    1 
ATOM   3608 C CG1   . ILE B 1 150 ? 28.835  -31.013 74.212  1.00 35.56 ? 150  ILE B CG1   1 
ATOM   3609 C CG2   . ILE B 1 150 ? 29.220  -33.188 75.382  1.00 35.21 ? 150  ILE B CG2   1 
ATOM   3610 C CD1   . ILE B 1 150 ? 28.088  -30.430 75.389  1.00 39.58 ? 150  ILE B CD1   1 
ATOM   3611 N N     . LYS B 1 151 ? 32.744  -33.093 75.135  1.00 35.38 ? 151  LYS B N     1 
ATOM   3612 C CA    . LYS B 1 151 ? 33.621  -34.197 75.491  1.00 36.53 ? 151  LYS B CA    1 
ATOM   3613 C C     . LYS B 1 151 ? 34.500  -33.935 76.710  1.00 36.15 ? 151  LYS B C     1 
ATOM   3614 O O     . LYS B 1 151 ? 34.918  -34.873 77.378  1.00 35.82 ? 151  LYS B O     1 
ATOM   3615 C CB    . LYS B 1 151 ? 34.493  -34.565 74.285  1.00 37.86 ? 151  LYS B CB    1 
ATOM   3616 C CG    . LYS B 1 151 ? 33.678  -34.913 73.041  1.00 40.68 ? 151  LYS B CG    1 
ATOM   3617 C CD    . LYS B 1 151 ? 34.559  -35.145 71.820  1.00 44.62 ? 151  LYS B CD    1 
ATOM   3618 C CE    . LYS B 1 151 ? 35.315  -36.459 71.926  1.00 47.28 ? 151  LYS B CE    1 
ATOM   3619 N NZ    . LYS B 1 151 ? 34.391  -37.631 71.999  1.00 49.04 ? 151  LYS B NZ    1 
ATOM   3620 N N     . LYS B 1 152 ? 34.773  -32.670 77.001  1.00 36.34 ? 152  LYS B N     1 
ATOM   3621 C CA    . LYS B 1 152 ? 35.615  -32.340 78.140  1.00 38.56 ? 152  LYS B CA    1 
ATOM   3622 C C     . LYS B 1 152 ? 34.892  -32.494 79.465  1.00 38.91 ? 152  LYS B C     1 
ATOM   3623 O O     . LYS B 1 152 ? 35.520  -32.678 80.517  1.00 39.97 ? 152  LYS B O     1 
ATOM   3624 C CB    . LYS B 1 152 ? 36.142  -30.911 78.015  1.00 40.67 ? 152  LYS B CB    1 
ATOM   3625 C CG    . LYS B 1 152 ? 37.538  -30.820 77.392  1.00 45.16 ? 152  LYS B CG    1 
ATOM   3626 C CD    . LYS B 1 152 ? 38.556  -31.583 78.243  1.00 48.92 ? 152  LYS B CD    1 
ATOM   3627 C CE    . LYS B 1 152 ? 39.921  -31.683 77.562  1.00 49.80 ? 152  LYS B CE    1 
ATOM   3628 N NZ    . LYS B 1 152 ? 40.916  -32.380 78.429  1.00 50.70 ? 152  LYS B NZ    1 
ATOM   3629 N N     . TYR B 1 153 ? 33.565  -32.444 79.394  1.00 38.01 ? 153  TYR B N     1 
ATOM   3630 C CA    . TYR B 1 153 ? 32.762  -32.547 80.601  1.00 36.38 ? 153  TYR B CA    1 
ATOM   3631 C C     . TYR B 1 153 ? 32.237  -33.887 80.987  1.00 35.96 ? 153  TYR B C     1 
ATOM   3632 O O     . TYR B 1 153 ? 31.661  -34.651 80.186  1.00 36.44 ? 153  TYR B O     1 
ATOM   3633 C CB    . TYR B 1 153 ? 31.622  -31.569 80.555  1.00 35.60 ? 153  TYR B CB    1 
ATOM   3634 C CG    . TYR B 1 153 ? 32.110  -30.130 80.573  1.00 34.23 ? 153  TYR B CG    1 
ATOM   3635 C CD1   . TYR B 1 153 ? 32.618  -29.544 81.740  1.00 32.82 ? 153  TYR B CD1   1 
ATOM   3636 C CD2   . TYR B 1 153 ? 32.117  -29.368 79.407  1.00 33.43 ? 153  TYR B CD2   1 
ATOM   3637 C CE1   . TYR B 1 153 ? 33.120  -28.242 81.741  1.00 31.80 ? 153  TYR B CE1   1 
ATOM   3638 C CE2   . TYR B 1 153 ? 32.616  -28.073 79.402  1.00 33.98 ? 153  TYR B CE2   1 
ATOM   3639 C CZ    . TYR B 1 153 ? 33.117  -27.513 80.574  1.00 32.15 ? 153  TYR B CZ    1 
ATOM   3640 O OH    . TYR B 1 153 ? 33.620  -26.227 80.592  1.00 35.31 ? 153  TYR B OH    1 
ATOM   3641 N N     . LYS B 1 154 ? 32.502  -34.171 82.241  1.00 34.52 ? 154  LYS B N     1 
ATOM   3642 C CA    . LYS B 1 154 ? 32.147  -35.439 82.735  1.00 33.86 ? 154  LYS B CA    1 
ATOM   3643 C C     . LYS B 1 154 ? 30.886  -35.248 83.518  1.00 32.31 ? 154  LYS B C     1 
ATOM   3644 O O     . LYS B 1 154 ? 30.858  -35.446 84.723  1.00 33.39 ? 154  LYS B O     1 
ATOM   3645 C CB    . LYS B 1 154 ? 33.308  -35.872 83.580  1.00 37.12 ? 154  LYS B CB    1 
ATOM   3646 C CG    . LYS B 1 154 ? 33.197  -37.244 84.138  1.00 41.59 ? 154  LYS B CG    1 
ATOM   3647 C CD    . LYS B 1 154 ? 34.399  -37.552 85.020  1.00 43.80 ? 154  LYS B CD    1 
ATOM   3648 C CE    . LYS B 1 154 ? 34.312  -38.893 85.742  1.00 47.28 ? 154  LYS B CE    1 
ATOM   3649 N NZ    . LYS B 1 154 ? 35.533  -39.092 86.586  1.00 49.01 ? 154  LYS B NZ    1 
ATOM   3650 N N     . GLN B 1 155 ? 29.822  -34.866 82.827  1.00 28.90 ? 155  GLN B N     1 
ATOM   3651 C CA    . GLN B 1 155 ? 28.566  -34.610 83.489  1.00 25.15 ? 155  GLN B CA    1 
ATOM   3652 C C     . GLN B 1 155 ? 27.463  -34.986 82.545  1.00 20.70 ? 155  GLN B C     1 
ATOM   3653 O O     . GLN B 1 155 ? 27.673  -35.010 81.336  1.00 17.58 ? 155  GLN B O     1 
ATOM   3654 C CB    . GLN B 1 155 ? 28.473  -33.123 83.826  1.00 28.29 ? 155  GLN B CB    1 
ATOM   3655 C CG    . GLN B 1 155 ? 29.510  -32.651 84.841  1.00 35.07 ? 155  GLN B CG    1 
ATOM   3656 C CD    . GLN B 1 155 ? 29.374  -31.177 85.185  1.00 40.72 ? 155  GLN B CD    1 
ATOM   3657 O OE1   . GLN B 1 155 ? 29.490  -30.303 84.320  1.00 43.02 ? 155  GLN B OE1   1 
ATOM   3658 N NE2   . GLN B 1 155 ? 29.140  -30.893 86.459  1.00 44.26 ? 155  GLN B NE2   1 
ATOM   3659 N N     . PRO B 1 156 ? 26.275  -35.292 83.080  1.00 18.72 ? 156  PRO B N     1 
ATOM   3660 C CA    . PRO B 1 156 ? 25.123  -35.668 82.259  1.00 17.50 ? 156  PRO B CA    1 
ATOM   3661 C C     . PRO B 1 156 ? 24.911  -34.627 81.162  1.00 19.15 ? 156  PRO B C     1 
ATOM   3662 O O     . PRO B 1 156 ? 24.842  -33.423 81.441  1.00 19.29 ? 156  PRO B O     1 
ATOM   3663 C CB    . PRO B 1 156 ? 23.983  -35.680 83.264  1.00 16.96 ? 156  PRO B CB    1 
ATOM   3664 C CG    . PRO B 1 156 ? 24.663  -36.132 84.522  1.00 17.76 ? 156  PRO B CG    1 
ATOM   3665 C CD    . PRO B 1 156 ? 25.939  -35.329 84.515  1.00 17.00 ? 156  PRO B CD    1 
ATOM   3666 N N     . ILE B 1 157 ? 24.802  -35.092 79.921  1.00 19.29 ? 157  ILE B N     1 
ATOM   3667 C CA    . ILE B 1 157 ? 24.609  -34.197 78.790  1.00 20.24 ? 157  ILE B CA    1 
ATOM   3668 C C     . ILE B 1 157 ? 23.442  -33.237 79.014  1.00 21.40 ? 157  ILE B C     1 
ATOM   3669 O O     . ILE B 1 157 ? 23.474  -32.110 78.535  1.00 23.07 ? 157  ILE B O     1 
ATOM   3670 C CB    . ILE B 1 157 ? 24.380  -34.995 77.477  1.00 18.79 ? 157  ILE B CB    1 
ATOM   3671 C CG1   . ILE B 1 157 ? 24.287  -34.039 76.281  1.00 19.05 ? 157  ILE B CG1   1 
ATOM   3672 C CG2   . ILE B 1 157 ? 23.122  -35.824 77.589  1.00 18.43 ? 157  ILE B CG2   1 
ATOM   3673 C CD1   . ILE B 1 157 ? 25.558  -33.258 76.003  1.00 18.21 ? 157  ILE B CD1   1 
ATOM   3674 N N     . VAL B 1 158 ? 22.420  -33.667 79.749  1.00 21.79 ? 158  VAL B N     1 
ATOM   3675 C CA    . VAL B 1 158 ? 21.277  -32.790 79.993  1.00 21.29 ? 158  VAL B CA    1 
ATOM   3676 C C     . VAL B 1 158 ? 21.680  -31.573 80.828  1.00 21.23 ? 158  VAL B C     1 
ATOM   3677 O O     . VAL B 1 158 ? 21.216  -30.457 80.579  1.00 21.05 ? 158  VAL B O     1 
ATOM   3678 C CB    . VAL B 1 158 ? 20.111  -33.541 80.691  1.00 21.47 ? 158  VAL B CB    1 
ATOM   3679 C CG1   . VAL B 1 158 ? 20.546  -34.061 82.058  1.00 21.85 ? 158  VAL B CG1   1 
ATOM   3680 C CG2   . VAL B 1 158 ? 18.911  -32.619 80.822  1.00 20.07 ? 158  VAL B CG2   1 
ATOM   3681 N N     . ALA B 1 159 ? 22.550  -31.785 81.810  1.00 20.00 ? 159  ALA B N     1 
ATOM   3682 C CA    . ALA B 1 159 ? 23.022  -30.691 82.654  1.00 20.22 ? 159  ALA B CA    1 
ATOM   3683 C C     . ALA B 1 159 ? 23.909  -29.749 81.837  1.00 20.33 ? 159  ALA B C     1 
ATOM   3684 O O     . ALA B 1 159 ? 23.811  -28.531 81.967  1.00 21.63 ? 159  ALA B O     1 
ATOM   3685 C CB    . ALA B 1 159 ? 23.802  -31.236 83.840  1.00 17.71 ? 159  ALA B CB    1 
ATOM   3686 N N     . LEU B 1 160 ? 24.770  -30.319 80.997  1.00 20.28 ? 160  LEU B N     1 
ATOM   3687 C CA    . LEU B 1 160 ? 25.661  -29.518 80.163  1.00 21.01 ? 160  LEU B CA    1 
ATOM   3688 C C     . LEU B 1 160 ? 24.893  -28.604 79.223  1.00 19.75 ? 160  LEU B C     1 
ATOM   3689 O O     . LEU B 1 160 ? 25.317  -27.480 78.960  1.00 18.52 ? 160  LEU B O     1 
ATOM   3690 C CB    . LEU B 1 160 ? 26.583  -30.416 79.336  1.00 20.47 ? 160  LEU B CB    1 
ATOM   3691 C CG    . LEU B 1 160 ? 27.644  -31.175 80.131  1.00 22.76 ? 160  LEU B CG    1 
ATOM   3692 C CD1   . LEU B 1 160 ? 28.443  -32.081 79.182  1.00 21.27 ? 160  LEU B CD1   1 
ATOM   3693 C CD2   . LEU B 1 160 ? 28.548  -30.177 80.857  1.00 18.83 ? 160  LEU B CD2   1 
ATOM   3694 N N     . LEU B 1 161 ? 23.768  -29.094 78.713  1.00 18.55 ? 161  LEU B N     1 
ATOM   3695 C CA    . LEU B 1 161 ? 22.958  -28.303 77.797  1.00 18.79 ? 161  LEU B CA    1 
ATOM   3696 C C     . LEU B 1 161 ? 22.080  -27.278 78.530  1.00 18.37 ? 161  LEU B C     1 
ATOM   3697 O O     . LEU B 1 161 ? 21.757  -26.229 77.982  1.00 17.34 ? 161  LEU B O     1 
ATOM   3698 C CB    . LEU B 1 161 ? 22.106  -29.234 76.929  1.00 18.43 ? 161  LEU B CB    1 
ATOM   3699 C CG    . LEU B 1 161 ? 22.906  -30.117 75.952  1.00 18.39 ? 161  LEU B CG    1 
ATOM   3700 C CD1   . LEU B 1 161 ? 21.961  -30.995 75.163  1.00 17.25 ? 161  LEU B CD1   1 
ATOM   3701 C CD2   . LEU B 1 161 ? 23.715  -29.250 75.004  1.00 17.01 ? 161  LEU B CD2   1 
ATOM   3702 N N     . MET B 1 162 ? 21.714  -27.580 79.772  1.00 18.95 ? 162  MET B N     1 
ATOM   3703 C CA    . MET B 1 162 ? 20.895  -26.681 80.579  1.00 19.89 ? 162  MET B CA    1 
ATOM   3704 C C     . MET B 1 162 ? 21.727  -25.501 81.088  1.00 20.63 ? 162  MET B C     1 
ATOM   3705 O O     . MET B 1 162 ? 21.183  -24.450 81.415  1.00 20.97 ? 162  MET B O     1 
ATOM   3706 C CB    . MET B 1 162 ? 20.307  -27.436 81.768  1.00 20.10 ? 162  MET B CB    1 
ATOM   3707 C CG    . MET B 1 162 ? 19.179  -28.390 81.420  1.00 25.62 ? 162  MET B CG    1 
ATOM   3708 S SD    . MET B 1 162 ? 17.653  -27.530 81.028  1.00 31.09 ? 162  MET B SD    1 
ATOM   3709 C CE    . MET B 1 162 ? 17.093  -27.058 82.645  1.00 28.53 ? 162  MET B CE    1 
ATOM   3710 N N     . ASP B 1 163 ? 23.042  -25.703 81.163  1.00 19.97 ? 163  ASP B N     1 
ATOM   3711 C CA    . ASP B 1 163 ? 24.002  -24.695 81.618  1.00 20.62 ? 163  ASP B CA    1 
ATOM   3712 C C     . ASP B 1 163 ? 24.064  -23.594 80.566  1.00 20.16 ? 163  ASP B C     1 
ATOM   3713 O O     . ASP B 1 163 ? 24.062  -23.875 79.369  1.00 19.98 ? 163  ASP B O     1 
ATOM   3714 C CB    . ASP B 1 163 ? 25.380  -25.354 81.788  1.00 21.86 ? 163  ASP B CB    1 
ATOM   3715 C CG    . ASP B 1 163 ? 26.412  -24.431 82.424  1.00 26.33 ? 163  ASP B CG    1 
ATOM   3716 O OD1   . ASP B 1 163 ? 26.960  -23.544 81.726  1.00 25.60 ? 163  ASP B OD1   1 
ATOM   3717 O OD2   . ASP B 1 163 ? 26.677  -24.600 83.634  1.00 29.39 ? 163  ASP B OD2   1 
ATOM   3718 N N     . GLN B 1 164 ? 24.118  -22.341 81.004  1.00 20.62 ? 164  GLN B N     1 
ATOM   3719 C CA    . GLN B 1 164 ? 24.142  -21.222 80.063  1.00 20.76 ? 164  GLN B CA    1 
ATOM   3720 C C     . GLN B 1 164 ? 25.529  -20.735 79.661  1.00 21.63 ? 164  GLN B C     1 
ATOM   3721 O O     . GLN B 1 164 ? 25.661  -19.873 78.796  1.00 20.06 ? 164  GLN B O     1 
ATOM   3722 C CB    . GLN B 1 164 ? 23.346  -20.046 80.632  1.00 18.25 ? 164  GLN B CB    1 
ATOM   3723 C CG    . GLN B 1 164 ? 21.874  -20.357 80.871  1.00 16.22 ? 164  GLN B CG    1 
ATOM   3724 C CD    . GLN B 1 164 ? 21.185  -20.855 79.619  1.00 14.31 ? 164  GLN B CD    1 
ATOM   3725 O OE1   . GLN B 1 164 ? 21.016  -20.113 78.654  1.00 12.17 ? 164  GLN B OE1   1 
ATOM   3726 N NE2   . GLN B 1 164 ? 20.791  -22.124 79.624  1.00 12.66 ? 164  GLN B NE2   1 
ATOM   3727 N N     . LYS B 1 165 ? 26.563  -21.297 80.267  1.00 22.96 ? 165  LYS B N     1 
ATOM   3728 C CA    . LYS B 1 165 ? 27.915  -20.865 79.959  1.00 25.92 ? 165  LYS B CA    1 
ATOM   3729 C C     . LYS B 1 165 ? 28.834  -21.912 79.332  1.00 25.84 ? 165  LYS B C     1 
ATOM   3730 O O     . LYS B 1 165 ? 29.564  -21.615 78.389  1.00 26.80 ? 165  LYS B O     1 
ATOM   3731 C CB    . LYS B 1 165 ? 28.571  -20.317 81.227  1.00 27.31 ? 165  LYS B CB    1 
ATOM   3732 C CG    . LYS B 1 165 ? 30.052  -19.986 81.067  1.00 33.99 ? 165  LYS B CG    1 
ATOM   3733 C CD    . LYS B 1 165 ? 30.284  -18.988 79.939  1.00 37.41 ? 165  LYS B CD    1 
ATOM   3734 C CE    . LYS B 1 165 ? 31.740  -18.551 79.872  1.00 39.33 ? 165  LYS B CE    1 
ATOM   3735 N NZ    . LYS B 1 165 ? 31.961  -17.610 78.739  1.00 43.82 ? 165  LYS B NZ    1 
ATOM   3736 N N     . LYS B 1 166 ? 28.793  -23.133 79.854  1.00 26.87 ? 166  LYS B N     1 
ATOM   3737 C CA    . LYS B 1 166 ? 29.661  -24.208 79.378  1.00 25.27 ? 166  LYS B CA    1 
ATOM   3738 C C     . LYS B 1 166 ? 29.736  -24.470 77.883  1.00 24.18 ? 166  LYS B C     1 
ATOM   3739 O O     . LYS B 1 166 ? 30.822  -24.486 77.316  1.00 25.58 ? 166  LYS B O     1 
ATOM   3740 C CB    . LYS B 1 166 ? 29.317  -25.514 80.096  1.00 27.67 ? 166  LYS B CB    1 
ATOM   3741 C CG    . LYS B 1 166 ? 29.831  -25.573 81.524  1.00 29.99 ? 166  LYS B CG    1 
ATOM   3742 C CD    . LYS B 1 166 ? 29.767  -26.988 82.075  1.00 34.24 ? 166  LYS B CD    1 
ATOM   3743 C CE    . LYS B 1 166 ? 30.260  -27.043 83.517  1.00 36.74 ? 166  LYS B CE    1 
ATOM   3744 N NZ    . LYS B 1 166 ? 29.483  -26.109 84.386  1.00 38.87 ? 166  LYS B NZ    1 
ATOM   3745 N N     . ILE B 1 167 ? 28.592  -24.674 77.241  1.00 23.09 ? 167  ILE B N     1 
ATOM   3746 C CA    . ILE B 1 167 ? 28.567  -24.968 75.811  1.00 21.34 ? 167  ILE B CA    1 
ATOM   3747 C C     . ILE B 1 167 ? 27.914  -23.847 75.018  1.00 21.96 ? 167  ILE B C     1 
ATOM   3748 O O     . ILE B 1 167 ? 28.513  -23.280 74.107  1.00 22.92 ? 167  ILE B O     1 
ATOM   3749 C CB    . ILE B 1 167 ? 27.773  -26.268 75.526  1.00 20.65 ? 167  ILE B CB    1 
ATOM   3750 C CG1   . ILE B 1 167 ? 28.163  -27.359 76.535  1.00 20.53 ? 167  ILE B CG1   1 
ATOM   3751 C CG2   . ILE B 1 167 ? 27.986  -26.696 74.100  1.00 14.11 ? 167  ILE B CG2   1 
ATOM   3752 C CD1   . ILE B 1 167 ? 29.639  -27.700 76.567  1.00 22.96 ? 167  ILE B CD1   1 
ATOM   3753 N N     . GLY B 1 168 ? 26.668  -23.547 75.364  1.00 21.80 ? 168  GLY B N     1 
ATOM   3754 C CA    . GLY B 1 168 ? 25.943  -22.498 74.679  1.00 19.83 ? 168  GLY B CA    1 
ATOM   3755 C C     . GLY B 1 168 ? 24.870  -21.960 75.594  1.00 19.63 ? 168  GLY B C     1 
ATOM   3756 O O     . GLY B 1 168 ? 24.640  -22.513 76.670  1.00 20.36 ? 168  GLY B O     1 
ATOM   3757 N N     . SER B 1 169 ? 24.215  -20.881 75.176  1.00 17.82 ? 169  SER B N     1 
ATOM   3758 C CA    . SER B 1 169 ? 23.157  -20.284 75.975  1.00 16.21 ? 169  SER B CA    1 
ATOM   3759 C C     . SER B 1 169 ? 21.843  -20.351 75.208  1.00 17.74 ? 169  SER B C     1 
ATOM   3760 O O     . SER B 1 169 ? 21.837  -20.512 73.979  1.00 18.00 ? 169  SER B O     1 
ATOM   3761 C CB    . SER B 1 169 ? 23.508  -18.822 76.310  1.00 16.82 ? 169  SER B CB    1 
ATOM   3762 O OG    . SER B 1 169 ? 23.809  -18.080 75.141  1.00 16.76 ? 169  SER B OG    1 
ATOM   3763 N N     . GLY B 1 170 ? 20.734  -20.254 75.936  1.00 14.64 ? 170  GLY B N     1 
ATOM   3764 C CA    . GLY B 1 170 ? 19.431  -20.277 75.295  1.00 15.01 ? 170  GLY B CA    1 
ATOM   3765 C C     . GLY B 1 170 ? 18.547  -21.500 75.491  1.00 12.16 ? 170  GLY B C     1 
ATOM   3766 O O     . GLY B 1 170 ? 17.331  -21.398 75.351  1.00 14.36 ? 170  GLY B O     1 
ATOM   3767 N N     . LEU B 1 171 ? 19.133  -22.647 75.814  1.00 10.88 ? 171  LEU B N     1 
ATOM   3768 C CA    . LEU B 1 171 ? 18.347  -23.866 76.001  1.00 10.67 ? 171  LEU B CA    1 
ATOM   3769 C C     . LEU B 1 171 ? 17.761  -24.038 77.400  1.00 12.10 ? 171  LEU B C     1 
ATOM   3770 O O     . LEU B 1 171 ? 18.467  -23.941 78.395  1.00 13.44 ? 171  LEU B O     1 
ATOM   3771 C CB    . LEU B 1 171 ? 19.194  -25.099 75.663  1.00 9.43  ? 171  LEU B CB    1 
ATOM   3772 C CG    . LEU B 1 171 ? 19.806  -25.186 74.255  1.00 12.34 ? 171  LEU B CG    1 
ATOM   3773 C CD1   . LEU B 1 171 ? 20.485  -26.550 74.073  1.00 9.98  ? 171  LEU B CD1   1 
ATOM   3774 C CD2   . LEU B 1 171 ? 18.726  -24.981 73.196  1.00 8.60  ? 171  LEU B CD2   1 
ATOM   3775 N N     . GLY B 1 172 ? 16.462  -24.309 77.468  1.00 13.17 ? 172  GLY B N     1 
ATOM   3776 C CA    . GLY B 1 172 ? 15.822  -24.515 78.753  1.00 13.97 ? 172  GLY B CA    1 
ATOM   3777 C C     . GLY B 1 172 ? 15.269  -25.929 78.896  1.00 17.89 ? 172  GLY B C     1 
ATOM   3778 O O     . GLY B 1 172 ? 15.473  -26.797 78.040  1.00 16.92 ? 172  GLY B O     1 
ATOM   3779 N N     . ASN B 1 173 ? 14.529  -26.149 79.972  1.00 18.77 ? 173  ASN B N     1 
ATOM   3780 C CA    . ASN B 1 173 ? 13.969  -27.456 80.253  1.00 20.64 ? 173  ASN B CA    1 
ATOM   3781 C C     . ASN B 1 173 ? 13.163  -28.136 79.146  1.00 21.09 ? 173  ASN B C     1 
ATOM   3782 O O     . ASN B 1 173 ? 13.250  -29.352 78.998  1.00 21.00 ? 173  ASN B O     1 
ATOM   3783 C CB    . ASN B 1 173 ? 13.144  -27.402 81.538  1.00 18.72 ? 173  ASN B CB    1 
ATOM   3784 C CG    . ASN B 1 173 ? 13.157  -28.720 82.279  1.00 20.13 ? 173  ASN B CG    1 
ATOM   3785 O OD1   . ASN B 1 173 ? 14.160  -29.426 82.269  1.00 20.13 ? 173  ASN B OD1   1 
ATOM   3786 N ND2   . ASN B 1 173 ? 12.053  -29.054 82.936  1.00 19.17 ? 173  ASN B ND2   1 
ATOM   3787 N N     . TYR B 1 174 ? 12.386  -27.399 78.357  1.00 20.50 ? 174  TYR B N     1 
ATOM   3788 C CA    . TYR B 1 174 ? 11.636  -28.102 77.325  1.00 20.03 ? 174  TYR B CA    1 
ATOM   3789 C C     . TYR B 1 174 ? 12.452  -28.354 76.063  1.00 19.48 ? 174  TYR B C     1 
ATOM   3790 O O     . TYR B 1 174 ? 12.300  -29.399 75.435  1.00 19.27 ? 174  TYR B O     1 
ATOM   3791 C CB    . TYR B 1 174 ? 10.300  -27.399 77.009  1.00 22.03 ? 174  TYR B CB    1 
ATOM   3792 C CG    . TYR B 1 174 ? 10.333  -26.189 76.093  1.00 25.20 ? 174  TYR B CG    1 
ATOM   3793 C CD1   . TYR B 1 174 ? 9.987   -24.922 76.565  1.00 27.48 ? 174  TYR B CD1   1 
ATOM   3794 C CD2   . TYR B 1 174 ? 10.649  -26.320 74.742  1.00 27.09 ? 174  TYR B CD2   1 
ATOM   3795 C CE1   . TYR B 1 174 ? 9.954   -23.814 75.711  1.00 27.60 ? 174  TYR B CE1   1 
ATOM   3796 C CE2   . TYR B 1 174 ? 10.619  -25.224 73.884  1.00 28.97 ? 174  TYR B CE2   1 
ATOM   3797 C CZ    . TYR B 1 174 ? 10.274  -23.976 74.371  1.00 29.10 ? 174  TYR B CZ    1 
ATOM   3798 O OH    . TYR B 1 174 ? 10.275  -22.897 73.511  1.00 29.47 ? 174  TYR B OH    1 
ATOM   3799 N N     . LEU B 1 175 ? 13.341  -27.427 75.706  1.00 17.95 ? 175  LEU B N     1 
ATOM   3800 C CA    . LEU B 1 175 ? 14.159  -27.601 74.512  1.00 16.25 ? 175  LEU B CA    1 
ATOM   3801 C C     . LEU B 1 175 ? 15.136  -28.758 74.625  1.00 16.92 ? 175  LEU B C     1 
ATOM   3802 O O     . LEU B 1 175 ? 15.272  -29.544 73.695  1.00 15.95 ? 175  LEU B O     1 
ATOM   3803 C CB    . LEU B 1 175 ? 14.939  -26.327 74.189  1.00 16.61 ? 175  LEU B CB    1 
ATOM   3804 C CG    . LEU B 1 175 ? 14.158  -25.251 73.436  1.00 19.50 ? 175  LEU B CG    1 
ATOM   3805 C CD1   . LEU B 1 175 ? 15.034  -24.020 73.248  1.00 15.92 ? 175  LEU B CD1   1 
ATOM   3806 C CD2   . LEU B 1 175 ? 13.703  -25.821 72.085  1.00 17.86 ? 175  LEU B CD2   1 
ATOM   3807 N N     . VAL B 1 176 ? 15.814  -28.857 75.764  1.00 17.06 ? 176  VAL B N     1 
ATOM   3808 C CA    . VAL B 1 176 ? 16.783  -29.918 75.970  1.00 20.60 ? 176  VAL B CA    1 
ATOM   3809 C C     . VAL B 1 176 ? 16.140  -31.306 75.909  1.00 20.00 ? 176  VAL B C     1 
ATOM   3810 O O     . VAL B 1 176 ? 16.727  -32.239 75.364  1.00 20.98 ? 176  VAL B O     1 
ATOM   3811 C CB    . VAL B 1 176 ? 17.527  -29.733 77.312  1.00 21.75 ? 176  VAL B CB    1 
ATOM   3812 C CG1   . VAL B 1 176 ? 18.360  -30.961 77.618  1.00 25.59 ? 176  VAL B CG1   1 
ATOM   3813 C CG2   . VAL B 1 176 ? 18.435  -28.510 77.233  1.00 22.11 ? 176  VAL B CG2   1 
ATOM   3814 N N     . ALA B 1 177 ? 14.934  -31.439 76.448  1.00 19.44 ? 177  ALA B N     1 
ATOM   3815 C CA    . ALA B 1 177 ? 14.249  -32.729 76.423  1.00 20.67 ? 177  ALA B CA    1 
ATOM   3816 C C     . ALA B 1 177 ? 13.938  -33.117 74.980  1.00 20.11 ? 177  ALA B C     1 
ATOM   3817 O O     . ALA B 1 177 ? 14.216  -34.245 74.569  1.00 18.15 ? 177  ALA B O     1 
ATOM   3818 C CB    . ALA B 1 177 ? 12.972  -32.670 77.245  1.00 19.04 ? 177  ALA B CB    1 
ATOM   3819 N N     . GLU B 1 178 ? 13.376  -32.179 74.215  1.00 18.81 ? 178  GLU B N     1 
ATOM   3820 C CA    . GLU B 1 178 ? 13.049  -32.426 72.805  1.00 18.48 ? 178  GLU B CA    1 
ATOM   3821 C C     . GLU B 1 178 ? 14.296  -32.714 71.976  1.00 17.28 ? 178  GLU B C     1 
ATOM   3822 O O     . GLU B 1 178 ? 14.293  -33.595 71.107  1.00 17.41 ? 178  GLU B O     1 
ATOM   3823 C CB    . GLU B 1 178 ? 12.325  -31.226 72.196  1.00 19.93 ? 178  GLU B CB    1 
ATOM   3824 C CG    . GLU B 1 178 ? 10.967  -30.932 72.823  1.00 24.94 ? 178  GLU B CG    1 
ATOM   3825 C CD    . GLU B 1 178 ? 9.990   -32.087 72.662  1.00 26.31 ? 178  GLU B CD    1 
ATOM   3826 O OE1   . GLU B 1 178 ? 9.731   -32.484 71.503  1.00 26.78 ? 178  GLU B OE1   1 
ATOM   3827 O OE2   . GLU B 1 178 ? 9.484   -32.588 73.690  1.00 25.56 ? 178  GLU B OE2   1 
ATOM   3828 N N     . ILE B 1 179 ? 15.360  -31.966 72.244  1.00 15.39 ? 179  ILE B N     1 
ATOM   3829 C CA    . ILE B 1 179 ? 16.617  -32.143 71.526  1.00 15.66 ? 179  ILE B CA    1 
ATOM   3830 C C     . ILE B 1 179 ? 17.236  -33.523 71.779  1.00 15.66 ? 179  ILE B C     1 
ATOM   3831 O O     . ILE B 1 179 ? 17.631  -34.207 70.840  1.00 14.92 ? 179  ILE B O     1 
ATOM   3832 C CB    . ILE B 1 179 ? 17.631  -31.045 71.920  1.00 14.58 ? 179  ILE B CB    1 
ATOM   3833 C CG1   . ILE B 1 179 ? 17.159  -29.696 71.369  1.00 14.99 ? 179  ILE B CG1   1 
ATOM   3834 C CG2   . ILE B 1 179 ? 19.019  -31.385 71.394  1.00 13.09 ? 179  ILE B CG2   1 
ATOM   3835 C CD1   . ILE B 1 179 ? 17.996  -28.505 71.848  1.00 13.07 ? 179  ILE B CD1   1 
ATOM   3836 N N     . LEU B 1 180 ? 17.319  -33.931 73.041  1.00 15.28 ? 180  LEU B N     1 
ATOM   3837 C CA    . LEU B 1 180 ? 17.895  -35.225 73.362  1.00 17.54 ? 180  LEU B CA    1 
ATOM   3838 C C     . LEU B 1 180 ? 17.068  -36.381 72.807  1.00 17.80 ? 180  LEU B C     1 
ATOM   3839 O O     . LEU B 1 180 ? 17.611  -37.432 72.474  1.00 18.10 ? 180  LEU B O     1 
ATOM   3840 C CB    . LEU B 1 180 ? 18.072  -35.365 74.874  1.00 17.31 ? 180  LEU B CB    1 
ATOM   3841 C CG    . LEU B 1 180 ? 19.171  -34.439 75.397  1.00 18.53 ? 180  LEU B CG    1 
ATOM   3842 C CD1   . LEU B 1 180 ? 19.216  -34.504 76.907  1.00 19.90 ? 180  LEU B CD1   1 
ATOM   3843 C CD2   . LEU B 1 180 ? 20.520  -34.836 74.781  1.00 17.21 ? 180  LEU B CD2   1 
ATOM   3844 N N     . TYR B 1 181 ? 15.759  -36.186 72.700  1.00 17.07 ? 181  TYR B N     1 
ATOM   3845 C CA    . TYR B 1 181 ? 14.897  -37.223 72.158  1.00 20.12 ? 181  TYR B CA    1 
ATOM   3846 C C     . TYR B 1 181 ? 15.147  -37.403 70.659  1.00 22.63 ? 181  TYR B C     1 
ATOM   3847 O O     . TYR B 1 181 ? 15.303  -38.529 70.182  1.00 23.95 ? 181  TYR B O     1 
ATOM   3848 C CB    . TYR B 1 181 ? 13.434  -36.867 72.388  1.00 18.48 ? 181  TYR B CB    1 
ATOM   3849 C CG    . TYR B 1 181 ? 12.462  -37.790 71.696  1.00 19.19 ? 181  TYR B CG    1 
ATOM   3850 C CD1   . TYR B 1 181 ? 12.220  -39.090 72.177  1.00 21.75 ? 181  TYR B CD1   1 
ATOM   3851 C CD2   . TYR B 1 181 ? 11.777  -37.368 70.560  1.00 18.28 ? 181  TYR B CD2   1 
ATOM   3852 C CE1   . TYR B 1 181 ? 11.312  -39.939 71.532  1.00 18.88 ? 181  TYR B CE1   1 
ATOM   3853 C CE2   . TYR B 1 181 ? 10.876  -38.201 69.909  1.00 20.10 ? 181  TYR B CE2   1 
ATOM   3854 C CZ    . TYR B 1 181 ? 10.644  -39.480 70.396  1.00 21.53 ? 181  TYR B CZ    1 
ATOM   3855 O OH    . TYR B 1 181 ? 9.729   -40.271 69.741  1.00 21.62 ? 181  TYR B OH    1 
ATOM   3856 N N     . ARG B 1 182 ? 15.180  -36.289 69.929  1.00 22.43 ? 182  ARG B N     1 
ATOM   3857 C CA    . ARG B 1 182 ? 15.412  -36.297 68.481  1.00 24.31 ? 182  ARG B CA    1 
ATOM   3858 C C     . ARG B 1 182 ? 16.775  -36.871 68.143  1.00 23.26 ? 182  ARG B C     1 
ATOM   3859 O O     . ARG B 1 182 ? 16.927  -37.561 67.143  1.00 24.39 ? 182  ARG B O     1 
ATOM   3860 C CB    . ARG B 1 182 ? 15.359  -34.877 67.918  1.00 25.51 ? 182  ARG B CB    1 
ATOM   3861 C CG    . ARG B 1 182 ? 14.047  -34.168 68.114  1.00 31.69 ? 182  ARG B CG    1 
ATOM   3862 C CD    . ARG B 1 182 ? 13.131  -34.370 66.932  1.00 34.56 ? 182  ARG B CD    1 
ATOM   3863 N NE    . ARG B 1 182 ? 12.109  -33.328 66.894  1.00 37.64 ? 182  ARG B NE    1 
ATOM   3864 C CZ    . ARG B 1 182 ? 11.385  -33.027 65.821  1.00 38.69 ? 182  ARG B CZ    1 
ATOM   3865 N NH1   . ARG B 1 182 ? 11.570  -33.692 64.683  1.00 36.44 ? 182  ARG B NH1   1 
ATOM   3866 N NH2   . ARG B 1 182 ? 10.475  -32.061 65.889  1.00 38.16 ? 182  ARG B NH2   1 
ATOM   3867 N N     . ALA B 1 183 ? 17.769  -36.554 68.969  1.00 21.10 ? 183  ALA B N     1 
ATOM   3868 C CA    . ALA B 1 183 ? 19.126  -37.034 68.756  1.00 20.67 ? 183  ALA B CA    1 
ATOM   3869 C C     . ALA B 1 183 ? 19.313  -38.448 69.300  1.00 20.29 ? 183  ALA B C     1 
ATOM   3870 O O     . ALA B 1 183 ? 20.385  -39.026 69.163  1.00 18.55 ? 183  ALA B O     1 
ATOM   3871 C CB    . ALA B 1 183 ? 20.122  -36.086 69.414  1.00 16.07 ? 183  ALA B CB    1 
ATOM   3872 N N     . LYS B 1 184 ? 18.264  -38.982 69.928  1.00 22.49 ? 184  LYS B N     1 
ATOM   3873 C CA    . LYS B 1 184 ? 18.271  -40.327 70.508  1.00 25.12 ? 184  LYS B CA    1 
ATOM   3874 C C     . LYS B 1 184 ? 19.347  -40.547 71.573  1.00 25.06 ? 184  LYS B C     1 
ATOM   3875 O O     . LYS B 1 184 ? 19.963  -41.619 71.641  1.00 24.22 ? 184  LYS B O     1 
ATOM   3876 C CB    . LYS B 1 184 ? 18.416  -41.375 69.401  1.00 26.08 ? 184  LYS B CB    1 
ATOM   3877 C CG    . LYS B 1 184 ? 17.202  -41.449 68.494  1.00 31.09 ? 184  LYS B CG    1 
ATOM   3878 C CD    . LYS B 1 184 ? 17.453  -42.338 67.295  1.00 33.54 ? 184  LYS B CD    1 
ATOM   3879 C CE    . LYS B 1 184 ? 16.187  -42.505 66.460  1.00 36.59 ? 184  LYS B CE    1 
ATOM   3880 N NZ    . LYS B 1 184 ? 15.608  -41.208 66.032  1.00 37.88 ? 184  LYS B NZ    1 
ATOM   3881 N N     . ILE B 1 185 ? 19.558  -39.541 72.418  1.00 23.18 ? 185  ILE B N     1 
ATOM   3882 C CA    . ILE B 1 185 ? 20.559  -39.649 73.471  1.00 22.18 ? 185  ILE B CA    1 
ATOM   3883 C C     . ILE B 1 185 ? 19.957  -39.705 74.866  1.00 23.17 ? 185  ILE B C     1 
ATOM   3884 O O     . ILE B 1 185 ? 19.048  -38.942 75.196  1.00 24.95 ? 185  ILE B O     1 
ATOM   3885 C CB    . ILE B 1 185 ? 21.547  -38.472 73.417  1.00 23.14 ? 185  ILE B CB    1 
ATOM   3886 C CG1   . ILE B 1 185 ? 22.237  -38.443 72.052  1.00 22.54 ? 185  ILE B CG1   1 
ATOM   3887 C CG2   . ILE B 1 185 ? 22.591  -38.614 74.520  1.00 22.16 ? 185  ILE B CG2   1 
ATOM   3888 C CD1   . ILE B 1 185 ? 23.089  -37.219 71.835  1.00 26.47 ? 185  ILE B CD1   1 
ATOM   3889 N N     . ASP B 1 186 ? 20.476  -40.620 75.679  1.00 23.25 ? 186  ASP B N     1 
ATOM   3890 C CA    . ASP B 1 186 ? 20.038  -40.790 77.063  1.00 22.31 ? 186  ASP B CA    1 
ATOM   3891 C C     . ASP B 1 186 ? 20.500  -39.543 77.818  1.00 21.28 ? 186  ASP B C     1 
ATOM   3892 O O     . ASP B 1 186 ? 21.679  -39.206 77.797  1.00 20.80 ? 186  ASP B O     1 
ATOM   3893 C CB    . ASP B 1 186 ? 20.705  -42.039 77.664  1.00 23.25 ? 186  ASP B CB    1 
ATOM   3894 C CG    . ASP B 1 186 ? 20.212  -42.364 79.068  1.00 23.76 ? 186  ASP B CG    1 
ATOM   3895 O OD1   . ASP B 1 186 ? 20.117  -41.454 79.915  1.00 25.17 ? 186  ASP B OD1   1 
ATOM   3896 O OD2   . ASP B 1 186 ? 19.925  -43.547 79.334  1.00 27.56 ? 186  ASP B OD2   1 
ATOM   3897 N N     . PRO B 1 187 ? 19.576  -38.845 78.495  1.00 21.83 ? 187  PRO B N     1 
ATOM   3898 C CA    . PRO B 1 187 ? 19.885  -37.629 79.260  1.00 22.63 ? 187  PRO B CA    1 
ATOM   3899 C C     . PRO B 1 187 ? 21.031  -37.812 80.255  1.00 22.60 ? 187  PRO B C     1 
ATOM   3900 O O     . PRO B 1 187 ? 21.786  -36.878 80.529  1.00 21.36 ? 187  PRO B O     1 
ATOM   3901 C CB    . PRO B 1 187 ? 18.568  -37.329 79.976  1.00 22.78 ? 187  PRO B CB    1 
ATOM   3902 C CG    . PRO B 1 187 ? 17.553  -37.887 79.054  1.00 23.08 ? 187  PRO B CG    1 
ATOM   3903 C CD    . PRO B 1 187 ? 18.149  -39.182 78.610  1.00 20.02 ? 187  PRO B CD    1 
ATOM   3904 N N     . HIS B 1 188 ? 21.145  -39.021 80.798  1.00 22.72 ? 188  HIS B N     1 
ATOM   3905 C CA    . HIS B 1 188 ? 22.185  -39.336 81.776  1.00 23.34 ? 188  HIS B CA    1 
ATOM   3906 C C     . HIS B 1 188 ? 23.573  -39.475 81.162  1.00 23.48 ? 188  HIS B C     1 
ATOM   3907 O O     . HIS B 1 188 ? 24.576  -39.372 81.867  1.00 23.45 ? 188  HIS B O     1 
ATOM   3908 C CB    . HIS B 1 188 ? 21.869  -40.649 82.507  1.00 23.67 ? 188  HIS B CB    1 
ATOM   3909 C CG    . HIS B 1 188 ? 20.535  -40.668 83.183  1.00 24.46 ? 188  HIS B CG    1 
ATOM   3910 N ND1   . HIS B 1 188 ? 19.355  -40.882 82.499  1.00 24.30 ? 188  HIS B ND1   1 
ATOM   3911 C CD2   . HIS B 1 188 ? 20.191  -40.478 84.479  1.00 23.87 ? 188  HIS B CD2   1 
ATOM   3912 C CE1   . HIS B 1 188 ? 18.342  -40.818 83.345  1.00 24.39 ? 188  HIS B CE1   1 
ATOM   3913 N NE2   . HIS B 1 188 ? 18.822  -40.574 84.553  1.00 26.42 ? 188  HIS B NE2   1 
ATOM   3914 N N     . LYS B 1 189 ? 23.643  -39.717 79.858  1.00 22.93 ? 189  LYS B N     1 
ATOM   3915 C CA    . LYS B 1 189 ? 24.942  -39.903 79.227  1.00 25.00 ? 189  LYS B CA    1 
ATOM   3916 C C     . LYS B 1 189 ? 25.915  -38.750 79.452  1.00 25.02 ? 189  LYS B C     1 
ATOM   3917 O O     . LYS B 1 189 ? 25.606  -37.588 79.174  1.00 24.14 ? 189  LYS B O     1 
ATOM   3918 C CB    . LYS B 1 189 ? 24.786  -40.171 77.726  1.00 27.34 ? 189  LYS B CB    1 
ATOM   3919 C CG    . LYS B 1 189 ? 26.066  -40.700 77.094  1.00 30.65 ? 189  LYS B CG    1 
ATOM   3920 C CD    . LYS B 1 189 ? 25.831  -41.337 75.736  1.00 32.03 ? 189  LYS B CD    1 
ATOM   3921 C CE    . LYS B 1 189 ? 27.125  -41.952 75.221  1.00 33.96 ? 189  LYS B CE    1 
ATOM   3922 N NZ    . LYS B 1 189 ? 26.936  -42.758 73.980  1.00 34.77 ? 189  LYS B NZ    1 
ATOM   3923 N N     . LEU B 1 190 ? 27.093  -39.092 79.968  1.00 24.95 ? 190  LEU B N     1 
ATOM   3924 C CA    . LEU B 1 190 ? 28.143  -38.118 80.240  1.00 25.07 ? 190  LEU B CA    1 
ATOM   3925 C C     . LEU B 1 190 ? 28.672  -37.547 78.933  1.00 24.67 ? 190  LEU B C     1 
ATOM   3926 O O     . LEU B 1 190 ? 28.855  -38.280 77.966  1.00 23.20 ? 190  LEU B O     1 
ATOM   3927 C CB    . LEU B 1 190 ? 29.285  -38.787 81.012  1.00 25.99 ? 190  LEU B CB    1 
ATOM   3928 C CG    . LEU B 1 190 ? 29.252  -38.802 82.550  1.00 27.64 ? 190  LEU B CG    1 
ATOM   3929 C CD1   . LEU B 1 190 ? 27.838  -38.666 83.087  1.00 26.48 ? 190  LEU B CD1   1 
ATOM   3930 C CD2   . LEU B 1 190 ? 29.901  -40.081 83.031  1.00 24.73 ? 190  LEU B CD2   1 
ATOM   3931 N N     . GLY B 1 191 ? 28.903  -36.236 78.906  1.00 25.49 ? 191  GLY B N     1 
ATOM   3932 C CA    . GLY B 1 191 ? 29.414  -35.601 77.704  1.00 26.13 ? 191  GLY B CA    1 
ATOM   3933 C C     . GLY B 1 191 ? 30.760  -36.181 77.299  1.00 27.03 ? 191  GLY B C     1 
ATOM   3934 O O     . GLY B 1 191 ? 31.100  -36.263 76.118  1.00 24.78 ? 191  GLY B O     1 
ATOM   3935 N N     . SER B 1 192 ? 31.523  -36.597 78.299  1.00 28.05 ? 192  SER B N     1 
ATOM   3936 C CA    . SER B 1 192 ? 32.837  -37.170 78.079  1.00 30.82 ? 192  SER B CA    1 
ATOM   3937 C C     . SER B 1 192 ? 32.762  -38.562 77.446  1.00 32.67 ? 192  SER B C     1 
ATOM   3938 O O     . SER B 1 192 ? 33.778  -39.099 77.009  1.00 31.91 ? 192  SER B O     1 
ATOM   3939 C CB    . SER B 1 192 ? 33.590  -37.240 79.406  1.00 29.75 ? 192  SER B CB    1 
ATOM   3940 O OG    . SER B 1 192 ? 32.867  -38.002 80.355  1.00 29.56 ? 192  SER B OG    1 
ATOM   3941 N N     . ASN B 1 193 ? 31.566  -39.148 77.406  1.00 34.33 ? 193  ASN B N     1 
ATOM   3942 C CA    . ASN B 1 193 ? 31.396  -40.472 76.805  1.00 35.93 ? 193  ASN B CA    1 
ATOM   3943 C C     . ASN B 1 193 ? 30.711  -40.405 75.445  1.00 35.82 ? 193  ASN B C     1 
ATOM   3944 O O     . ASN B 1 193 ? 30.510  -41.428 74.799  1.00 35.71 ? 193  ASN B O     1 
ATOM   3945 C CB    . ASN B 1 193 ? 30.594  -41.406 77.723  1.00 36.08 ? 193  ASN B CB    1 
ATOM   3946 C CG    . ASN B 1 193 ? 31.345  -41.766 78.988  1.00 37.55 ? 193  ASN B CG    1 
ATOM   3947 O OD1   . ASN B 1 193 ? 32.566  -41.918 78.975  1.00 39.69 ? 193  ASN B OD1   1 
ATOM   3948 N ND2   . ASN B 1 193 ? 30.615  -41.921 80.089  1.00 36.05 ? 193  ASN B ND2   1 
ATOM   3949 N N     . LEU B 1 194 ? 30.345  -39.206 75.011  1.00 36.73 ? 194  LEU B N     1 
ATOM   3950 C CA    . LEU B 1 194 ? 29.702  -39.057 73.713  1.00 38.65 ? 194  LEU B CA    1 
ATOM   3951 C C     . LEU B 1 194 ? 30.727  -39.222 72.600  1.00 40.00 ? 194  LEU B C     1 
ATOM   3952 O O     . LEU B 1 194 ? 31.859  -38.762 72.721  1.00 40.07 ? 194  LEU B O     1 
ATOM   3953 C CB    . LEU B 1 194 ? 29.036  -37.685 73.596  1.00 38.97 ? 194  LEU B CB    1 
ATOM   3954 C CG    . LEU B 1 194 ? 27.799  -37.460 74.466  1.00 39.45 ? 194  LEU B CG    1 
ATOM   3955 C CD1   . LEU B 1 194 ? 27.340  -36.019 74.349  1.00 39.65 ? 194  LEU B CD1   1 
ATOM   3956 C CD2   . LEU B 1 194 ? 26.701  -38.409 74.033  1.00 37.80 ? 194  LEU B CD2   1 
ATOM   3957 N N     . THR B 1 195 ? 30.323  -39.889 71.523  1.00 42.62 ? 195  THR B N     1 
ATOM   3958 C CA    . THR B 1 195 ? 31.198  -40.111 70.372  1.00 44.26 ? 195  THR B CA    1 
ATOM   3959 C C     . THR B 1 195 ? 31.110  -38.898 69.454  1.00 45.70 ? 195  THR B C     1 
ATOM   3960 O O     . THR B 1 195 ? 30.140  -38.142 69.513  1.00 45.42 ? 195  THR B O     1 
ATOM   3961 C CB    . THR B 1 195 ? 30.766  -41.359 69.571  1.00 44.65 ? 195  THR B CB    1 
ATOM   3962 O OG1   . THR B 1 195 ? 29.485  -41.126 68.970  1.00 43.49 ? 195  THR B OG1   1 
ATOM   3963 C CG2   . THR B 1 195 ? 30.665  -42.567 70.486  1.00 44.26 ? 195  THR B CG2   1 
ATOM   3964 N N     . ASP B 1 196 ? 32.114  -38.717 68.602  1.00 47.69 ? 196  ASP B N     1 
ATOM   3965 C CA    . ASP B 1 196 ? 32.132  -37.584 67.679  1.00 49.26 ? 196  ASP B CA    1 
ATOM   3966 C C     . ASP B 1 196 ? 30.922  -37.627 66.767  1.00 48.73 ? 196  ASP B C     1 
ATOM   3967 O O     . ASP B 1 196 ? 30.456  -36.597 66.277  1.00 48.44 ? 196  ASP B O     1 
ATOM   3968 C CB    . ASP B 1 196 ? 33.406  -37.602 66.836  1.00 52.38 ? 196  ASP B CB    1 
ATOM   3969 C CG    . ASP B 1 196 ? 34.660  -37.523 67.679  1.00 55.52 ? 196  ASP B CG    1 
ATOM   3970 O OD1   . ASP B 1 196 ? 34.784  -36.562 68.475  1.00 56.68 ? 196  ASP B OD1   1 
ATOM   3971 O OD2   . ASP B 1 196 ? 35.521  -38.422 67.543  1.00 57.54 ? 196  ASP B OD2   1 
ATOM   3972 N N     . GLN B 1 197 ? 30.421  -38.834 66.543  1.00 48.23 ? 197  GLN B N     1 
ATOM   3973 C CA    . GLN B 1 197 ? 29.258  -39.042 65.697  1.00 47.42 ? 197  GLN B CA    1 
ATOM   3974 C C     . GLN B 1 197 ? 28.031  -38.483 66.417  1.00 46.45 ? 197  GLN B C     1 
ATOM   3975 O O     . GLN B 1 197 ? 27.202  -37.794 65.818  1.00 46.62 ? 197  GLN B O     1 
ATOM   3976 C CB    . GLN B 1 197 ? 29.075  -40.539 65.432  1.00 49.07 ? 197  GLN B CB    1 
ATOM   3977 C CG    . GLN B 1 197 ? 28.734  -40.889 63.994  1.00 51.03 ? 197  GLN B CG    1 
ATOM   3978 C CD    . GLN B 1 197 ? 27.476  -40.206 63.514  1.00 51.59 ? 197  GLN B CD    1 
ATOM   3979 O OE1   . GLN B 1 197 ? 26.400  -40.394 64.082  1.00 51.23 ? 197  GLN B OE1   1 
ATOM   3980 N NE2   . GLN B 1 197 ? 27.602  -39.405 62.461  1.00 52.85 ? 197  GLN B NE2   1 
ATOM   3981 N N     . GLU B 1 198 ? 27.921  -38.782 67.708  1.00 44.00 ? 198  GLU B N     1 
ATOM   3982 C CA    . GLU B 1 198 ? 26.799  -38.303 68.499  1.00 41.74 ? 198  GLU B CA    1 
ATOM   3983 C C     . GLU B 1 198 ? 26.870  -36.789 68.641  1.00 39.30 ? 198  GLU B C     1 
ATOM   3984 O O     . GLU B 1 198 ? 25.849  -36.108 68.629  1.00 37.40 ? 198  GLU B O     1 
ATOM   3985 C CB    . GLU B 1 198 ? 26.805  -38.961 69.880  1.00 43.04 ? 198  GLU B CB    1 
ATOM   3986 C CG    . GLU B 1 198 ? 26.517  -40.454 69.852  1.00 46.13 ? 198  GLU B CG    1 
ATOM   3987 C CD    . GLU B 1 198 ? 26.599  -41.097 71.228  1.00 47.74 ? 198  GLU B CD    1 
ATOM   3988 O OE1   . GLU B 1 198 ? 27.704  -41.102 71.820  1.00 46.92 ? 198  GLU B OE1   1 
ATOM   3989 O OE2   . GLU B 1 198 ? 25.557  -41.594 71.716  1.00 48.55 ? 198  GLU B OE2   1 
ATOM   3990 N N     . ILE B 1 199 ? 28.083  -36.266 68.764  1.00 38.49 ? 199  ILE B N     1 
ATOM   3991 C CA    . ILE B 1 199 ? 28.280  -34.829 68.905  1.00 38.75 ? 199  ILE B CA    1 
ATOM   3992 C C     . ILE B 1 199 ? 27.715  -34.059 67.713  1.00 38.52 ? 199  ILE B C     1 
ATOM   3993 O O     . ILE B 1 199 ? 26.929  -33.132 67.890  1.00 37.73 ? 199  ILE B O     1 
ATOM   3994 C CB    . ILE B 1 199 ? 29.774  -34.482 69.050  1.00 39.42 ? 199  ILE B CB    1 
ATOM   3995 C CG1   . ILE B 1 199 ? 30.338  -35.113 70.326  1.00 39.87 ? 199  ILE B CG1   1 
ATOM   3996 C CG2   . ILE B 1 199 ? 29.959  -32.972 69.083  1.00 38.77 ? 199  ILE B CG2   1 
ATOM   3997 C CD1   . ILE B 1 199 ? 29.703  -34.597 71.599  1.00 41.98 ? 199  ILE B CD1   1 
ATOM   3998 N N     . GLU B 1 200 ? 28.110  -34.443 66.503  1.00 38.06 ? 200  GLU B N     1 
ATOM   3999 C CA    . GLU B 1 200 ? 27.628  -33.760 65.310  1.00 39.07 ? 200  GLU B CA    1 
ATOM   4000 C C     . GLU B 1 200 ? 26.131  -33.962 65.126  1.00 36.87 ? 200  GLU B C     1 
ATOM   4001 O O     . GLU B 1 200 ? 25.442  -33.104 64.577  1.00 35.85 ? 200  GLU B O     1 
ATOM   4002 C CB    . GLU B 1 200 ? 28.382  -34.244 64.068  1.00 42.61 ? 200  GLU B CB    1 
ATOM   4003 C CG    . GLU B 1 200 ? 28.223  -35.720 63.770  1.00 49.59 ? 200  GLU B CG    1 
ATOM   4004 C CD    . GLU B 1 200 ? 28.970  -36.146 62.513  1.00 53.50 ? 200  GLU B CD    1 
ATOM   4005 O OE1   . GLU B 1 200 ? 30.220  -36.084 62.505  1.00 55.96 ? 200  GLU B OE1   1 
ATOM   4006 O OE2   . GLU B 1 200 ? 28.303  -36.540 61.530  1.00 55.86 ? 200  GLU B OE2   1 
ATOM   4007 N N     . ASN B 1 201 ? 25.627  -35.097 65.590  1.00 35.01 ? 201  ASN B N     1 
ATOM   4008 C CA    . ASN B 1 201 ? 24.203  -35.390 65.482  1.00 33.33 ? 201  ASN B CA    1 
ATOM   4009 C C     . ASN B 1 201 ? 23.428  -34.495 66.458  1.00 30.38 ? 201  ASN B C     1 
ATOM   4010 O O     . ASN B 1 201 ? 22.319  -34.039 66.171  1.00 25.17 ? 201  ASN B O     1 
ATOM   4011 C CB    . ASN B 1 201 ? 23.954  -36.862 65.807  1.00 37.00 ? 201  ASN B CB    1 
ATOM   4012 C CG    . ASN B 1 201 ? 22.519  -37.265 65.593  1.00 39.93 ? 201  ASN B CG    1 
ATOM   4013 O OD1   . ASN B 1 201 ? 21.960  -37.054 64.516  1.00 42.09 ? 201  ASN B OD1   1 
ATOM   4014 N ND2   . ASN B 1 201 ? 21.909  -37.856 66.616  1.00 42.43 ? 201  ASN B ND2   1 
ATOM   4015 N N     . LEU B 1 202 ? 24.037  -34.258 67.615  1.00 27.05 ? 202  LEU B N     1 
ATOM   4016 C CA    . LEU B 1 202 ? 23.460  -33.420 68.648  1.00 25.34 ? 202  LEU B CA    1 
ATOM   4017 C C     . LEU B 1 202 ? 23.422  -31.971 68.157  1.00 23.95 ? 202  LEU B C     1 
ATOM   4018 O O     . LEU B 1 202 ? 22.412  -31.285 68.302  1.00 23.50 ? 202  LEU B O     1 
ATOM   4019 C CB    . LEU B 1 202 ? 24.307  -33.526 69.917  1.00 27.11 ? 202  LEU B CB    1 
ATOM   4020 C CG    . LEU B 1 202 ? 23.838  -32.760 71.146  1.00 27.35 ? 202  LEU B CG    1 
ATOM   4021 C CD1   . LEU B 1 202 ? 22.440  -33.221 71.533  1.00 27.67 ? 202  LEU B CD1   1 
ATOM   4022 C CD2   . LEU B 1 202 ? 24.820  -32.991 72.276  1.00 27.64 ? 202  LEU B CD2   1 
ATOM   4023 N N     . TRP B 1 203 ? 24.522  -31.521 67.561  1.00 22.24 ? 203  TRP B N     1 
ATOM   4024 C CA    . TRP B 1 203 ? 24.622  -30.156 67.039  1.00 23.18 ? 203  TRP B CA    1 
ATOM   4025 C C     . TRP B 1 203 ? 23.493  -29.904 66.045  1.00 23.30 ? 203  TRP B C     1 
ATOM   4026 O O     . TRP B 1 203 ? 22.846  -28.852 66.062  1.00 22.07 ? 203  TRP B O     1 
ATOM   4027 C CB    . TRP B 1 203 ? 25.976  -29.962 66.348  1.00 23.85 ? 203  TRP B CB    1 
ATOM   4028 C CG    . TRP B 1 203 ? 26.245  -28.580 65.775  1.00 28.04 ? 203  TRP B CG    1 
ATOM   4029 C CD1   . TRP B 1 203 ? 26.983  -28.297 64.661  1.00 27.53 ? 203  TRP B CD1   1 
ATOM   4030 C CD2   . TRP B 1 203 ? 25.822  -27.310 66.304  1.00 29.27 ? 203  TRP B CD2   1 
ATOM   4031 N NE1   . TRP B 1 203 ? 27.047  -26.942 64.462  1.00 30.84 ? 203  TRP B NE1   1 
ATOM   4032 C CE2   . TRP B 1 203 ? 26.345  -26.311 65.454  1.00 30.91 ? 203  TRP B CE2   1 
ATOM   4033 C CE3   . TRP B 1 203 ? 25.054  -26.921 67.412  1.00 29.91 ? 203  TRP B CE3   1 
ATOM   4034 C CZ2   . TRP B 1 203 ? 26.125  -24.945 65.675  1.00 30.44 ? 203  TRP B CZ2   1 
ATOM   4035 C CZ3   . TRP B 1 203 ? 24.836  -25.565 67.632  1.00 28.79 ? 203  TRP B CZ3   1 
ATOM   4036 C CH2   . TRP B 1 203 ? 25.370  -24.594 66.766  1.00 30.05 ? 203  TRP B CH2   1 
ATOM   4037 N N     . TYR B 1 204 ? 23.254  -30.886 65.185  1.00 21.15 ? 204  TYR B N     1 
ATOM   4038 C CA    . TYR B 1 204 ? 22.206  -30.775 64.182  1.00 20.66 ? 204  TYR B CA    1 
ATOM   4039 C C     . TYR B 1 204 ? 20.825  -30.572 64.802  1.00 20.24 ? 204  TYR B C     1 
ATOM   4040 O O     . TYR B 1 204 ? 20.082  -29.686 64.396  1.00 20.45 ? 204  TYR B O     1 
ATOM   4041 C CB    . TYR B 1 204 ? 22.176  -32.027 63.308  1.00 19.07 ? 204  TYR B CB    1 
ATOM   4042 C CG    . TYR B 1 204 ? 21.020  -32.036 62.346  1.00 19.91 ? 204  TYR B CG    1 
ATOM   4043 C CD1   . TYR B 1 204 ? 21.124  -31.423 61.100  1.00 19.43 ? 204  TYR B CD1   1 
ATOM   4044 C CD2   . TYR B 1 204 ? 19.799  -32.615 62.699  1.00 18.92 ? 204  TYR B CD2   1 
ATOM   4045 C CE1   . TYR B 1 204 ? 20.045  -31.386 60.224  1.00 18.94 ? 204  TYR B CE1   1 
ATOM   4046 C CE2   . TYR B 1 204 ? 18.704  -32.575 61.828  1.00 19.04 ? 204  TYR B CE2   1 
ATOM   4047 C CZ    . TYR B 1 204 ? 18.843  -31.959 60.595  1.00 19.08 ? 204  TYR B CZ    1 
ATOM   4048 O OH    . TYR B 1 204 ? 17.784  -31.911 59.730  1.00 23.73 ? 204  TYR B OH    1 
ATOM   4049 N N     . TRP B 1 205 ? 20.473  -31.401 65.778  1.00 18.95 ? 205  TRP B N     1 
ATOM   4050 C CA    . TRP B 1 205 ? 19.164  -31.283 66.403  1.00 18.86 ? 205  TRP B CA    1 
ATOM   4051 C C     . TRP B 1 205 ? 19.021  -30.021 67.245  1.00 16.38 ? 205  TRP B C     1 
ATOM   4052 O O     . TRP B 1 205 ? 17.930  -29.473 67.353  1.00 18.12 ? 205  TRP B O     1 
ATOM   4053 C CB    . TRP B 1 205 ? 18.850  -32.549 67.200  1.00 17.58 ? 205  TRP B CB    1 
ATOM   4054 C CG    . TRP B 1 205 ? 18.592  -33.694 66.263  1.00 19.97 ? 205  TRP B CG    1 
ATOM   4055 C CD1   . TRP B 1 205 ? 19.402  -34.774 66.024  1.00 18.87 ? 205  TRP B CD1   1 
ATOM   4056 C CD2   . TRP B 1 205 ? 17.482  -33.819 65.362  1.00 19.14 ? 205  TRP B CD2   1 
ATOM   4057 N NE1   . TRP B 1 205 ? 18.861  -35.558 65.027  1.00 18.85 ? 205  TRP B NE1   1 
ATOM   4058 C CE2   . TRP B 1 205 ? 17.684  -34.995 64.607  1.00 17.15 ? 205  TRP B CE2   1 
ATOM   4059 C CE3   . TRP B 1 205 ? 16.332  -33.048 65.123  1.00 18.34 ? 205  TRP B CE3   1 
ATOM   4060 C CZ2   . TRP B 1 205 ? 16.783  -35.417 63.630  1.00 16.46 ? 205  TRP B CZ2   1 
ATOM   4061 C CZ3   . TRP B 1 205 ? 15.437  -33.469 64.150  1.00 16.08 ? 205  TRP B CZ3   1 
ATOM   4062 C CH2   . TRP B 1 205 ? 15.670  -34.647 63.417  1.00 16.59 ? 205  TRP B CH2   1 
ATOM   4063 N N     . ILE B 1 206 ? 20.122  -29.554 67.820  1.00 15.49 ? 206  ILE B N     1 
ATOM   4064 C CA    . ILE B 1 206 ? 20.108  -28.321 68.595  1.00 15.80 ? 206  ILE B CA    1 
ATOM   4065 C C     . ILE B 1 206 ? 19.663  -27.194 67.646  1.00 16.20 ? 206  ILE B C     1 
ATOM   4066 O O     . ILE B 1 206 ? 18.753  -26.424 67.956  1.00 15.22 ? 206  ILE B O     1 
ATOM   4067 C CB    . ILE B 1 206 ? 21.516  -28.014 69.164  1.00 14.65 ? 206  ILE B CB    1 
ATOM   4068 C CG1   . ILE B 1 206 ? 21.822  -28.964 70.323  1.00 13.91 ? 206  ILE B CG1   1 
ATOM   4069 C CG2   . ILE B 1 206 ? 21.609  -26.564 69.621  1.00 13.46 ? 206  ILE B CG2   1 
ATOM   4070 C CD1   . ILE B 1 206 ? 23.282  -28.943 70.772  1.00 10.88 ? 206  ILE B CD1   1 
ATOM   4071 N N     . LYS B 1 207 ? 20.290  -27.124 66.476  1.00 18.09 ? 207  LYS B N     1 
ATOM   4072 C CA    . LYS B 1 207 ? 19.949  -26.102 65.484  1.00 18.40 ? 207  LYS B CA    1 
ATOM   4073 C C     . LYS B 1 207 ? 18.528  -26.253 64.976  1.00 18.22 ? 207  LYS B C     1 
ATOM   4074 O O     . LYS B 1 207 ? 17.802  -25.265 64.812  1.00 17.90 ? 207  LYS B O     1 
ATOM   4075 C CB    . LYS B 1 207 ? 20.928  -26.156 64.311  1.00 16.78 ? 207  LYS B CB    1 
ATOM   4076 C CG    . LYS B 1 207 ? 22.335  -25.712 64.693  1.00 17.69 ? 207  LYS B CG    1 
ATOM   4077 C CD    . LYS B 1 207 ? 23.306  -25.785 63.520  1.00 18.64 ? 207  LYS B CD    1 
ATOM   4078 C CE    . LYS B 1 207 ? 23.520  -27.220 63.054  1.00 20.33 ? 207  LYS B CE    1 
ATOM   4079 N NZ    . LYS B 1 207 ? 24.615  -27.305 62.039  1.00 22.62 ? 207  LYS B NZ    1 
ATOM   4080 N N     . TYR B 1 208 ? 18.139  -27.497 64.722  1.00 18.19 ? 208  TYR B N     1 
ATOM   4081 C CA    . TYR B 1 208 ? 16.801  -27.821 64.236  1.00 16.93 ? 208  TYR B CA    1 
ATOM   4082 C C     . TYR B 1 208 ? 15.729  -27.356 65.221  1.00 16.82 ? 208  TYR B C     1 
ATOM   4083 O O     . TYR B 1 208 ? 14.840  -26.585 64.873  1.00 19.49 ? 208  TYR B O     1 
ATOM   4084 C CB    . TYR B 1 208 ? 16.687  -29.338 64.049  1.00 19.03 ? 208  TYR B CB    1 
ATOM   4085 C CG    . TYR B 1 208 ? 15.445  -29.807 63.327  1.00 21.04 ? 208  TYR B CG    1 
ATOM   4086 C CD1   . TYR B 1 208 ? 15.485  -30.128 61.967  1.00 21.82 ? 208  TYR B CD1   1 
ATOM   4087 C CD2   . TYR B 1 208 ? 14.235  -29.963 64.006  1.00 21.66 ? 208  TYR B CD2   1 
ATOM   4088 C CE1   . TYR B 1 208 ? 14.355  -30.597 61.303  1.00 19.75 ? 208  TYR B CE1   1 
ATOM   4089 C CE2   . TYR B 1 208 ? 13.099  -30.428 63.355  1.00 20.72 ? 208  TYR B CE2   1 
ATOM   4090 C CZ    . TYR B 1 208 ? 13.167  -30.743 62.002  1.00 24.23 ? 208  TYR B CZ    1 
ATOM   4091 O OH    . TYR B 1 208 ? 12.037  -31.187 61.346  1.00 26.14 ? 208  TYR B OH    1 
ATOM   4092 N N     . GLU B 1 209 ? 15.822  -27.827 66.460  1.00 17.57 ? 209  GLU B N     1 
ATOM   4093 C CA    . GLU B 1 209 ? 14.837  -27.487 67.484  1.00 17.03 ? 209  GLU B CA    1 
ATOM   4094 C C     . GLU B 1 209 ? 14.758  -26.008 67.836  1.00 15.67 ? 209  GLU B C     1 
ATOM   4095 O O     . GLU B 1 209 ? 13.663  -25.474 68.001  1.00 15.83 ? 209  GLU B O     1 
ATOM   4096 C CB    . GLU B 1 209 ? 15.093  -28.308 68.747  1.00 18.40 ? 209  GLU B CB    1 
ATOM   4097 C CG    . GLU B 1 209 ? 14.807  -29.791 68.579  1.00 24.37 ? 209  GLU B CG    1 
ATOM   4098 C CD    . GLU B 1 209 ? 13.341  -30.064 68.279  1.00 27.21 ? 209  GLU B CD    1 
ATOM   4099 O OE1   . GLU B 1 209 ? 13.007  -30.354 67.116  1.00 32.60 ? 209  GLU B OE1   1 
ATOM   4100 O OE2   . GLU B 1 209 ? 12.517  -29.977 69.206  1.00 31.20 ? 209  GLU B OE2   1 
ATOM   4101 N N     . THR B 1 210 ? 15.903  -25.344 67.966  1.00 15.60 ? 210  THR B N     1 
ATOM   4102 C CA    . THR B 1 210 ? 15.893  -23.916 68.285  1.00 16.10 ? 210  THR B CA    1 
ATOM   4103 C C     . THR B 1 210 ? 15.244  -23.136 67.143  1.00 17.16 ? 210  THR B C     1 
ATOM   4104 O O     . THR B 1 210 ? 14.381  -22.288 67.367  1.00 15.62 ? 210  THR B O     1 
ATOM   4105 C CB    . THR B 1 210 ? 17.317  -23.357 68.516  1.00 14.69 ? 210  THR B CB    1 
ATOM   4106 O OG1   . THR B 1 210 ? 18.145  -23.669 67.393  1.00 13.20 ? 210  THR B OG1   1 
ATOM   4107 C CG2   . THR B 1 210 ? 17.923  -23.926 69.785  1.00 10.90 ? 210  THR B CG2   1 
ATOM   4108 N N     . LYS B 1 211 ? 15.648  -23.437 65.912  1.00 19.23 ? 211  LYS B N     1 
ATOM   4109 C CA    . LYS B 1 211 ? 15.080  -22.754 64.754  1.00 19.37 ? 211  LYS B CA    1 
ATOM   4110 C C     . LYS B 1 211 ? 13.590  -23.038 64.614  1.00 19.16 ? 211  LYS B C     1 
ATOM   4111 O O     . LYS B 1 211 ? 12.821  -22.148 64.266  1.00 21.40 ? 211  LYS B O     1 
ATOM   4112 C CB    . LYS B 1 211 ? 15.797  -23.170 63.471  1.00 19.81 ? 211  LYS B CB    1 
ATOM   4113 C CG    . LYS B 1 211 ? 15.258  -22.460 62.237  1.00 21.44 ? 211  LYS B CG    1 
ATOM   4114 C CD    . LYS B 1 211 ? 16.169  -22.641 61.046  1.00 24.08 ? 211  LYS B CD    1 
ATOM   4115 C CE    . LYS B 1 211 ? 15.733  -21.766 59.879  1.00 24.17 ? 211  LYS B CE    1 
ATOM   4116 N NZ    . LYS B 1 211 ? 16.684  -21.912 58.746  1.00 26.74 ? 211  LYS B NZ    1 
ATOM   4117 N N     . LEU B 1 212 ? 13.182  -24.278 64.871  1.00 19.37 ? 212  LEU B N     1 
ATOM   4118 C CA    . LEU B 1 212 ? 11.771  -24.633 64.779  1.00 19.90 ? 212  LEU B CA    1 
ATOM   4119 C C     . LEU B 1 212 ? 10.975  -23.886 65.844  1.00 20.27 ? 212  LEU B C     1 
ATOM   4120 O O     . LEU B 1 212 ? 9.864   -23.428 65.591  1.00 21.83 ? 212  LEU B O     1 
ATOM   4121 C CB    . LEU B 1 212 ? 11.576  -26.138 64.969  1.00 20.45 ? 212  LEU B CB    1 
ATOM   4122 C CG    . LEU B 1 212 ? 10.123  -26.613 65.018  1.00 21.86 ? 212  LEU B CG    1 
ATOM   4123 C CD1   . LEU B 1 212 ? 9.431   -26.300 63.706  1.00 24.46 ? 212  LEU B CD1   1 
ATOM   4124 C CD2   . LEU B 1 212 ? 10.082  -28.105 65.289  1.00 25.06 ? 212  LEU B CD2   1 
ATOM   4125 N N     . ALA B 1 213 ? 11.543  -23.783 67.041  1.00 18.79 ? 213  ALA B N     1 
ATOM   4126 C CA    . ALA B 1 213 ? 10.888  -23.090 68.141  1.00 18.44 ? 213  ALA B CA    1 
ATOM   4127 C C     . ALA B 1 213 ? 10.785  -21.611 67.788  1.00 17.88 ? 213  ALA B C     1 
ATOM   4128 O O     . ALA B 1 213 ? 9.733   -20.998 67.926  1.00 16.93 ? 213  ALA B O     1 
ATOM   4129 C CB    . ALA B 1 213 ? 11.690  -23.270 69.430  1.00 18.50 ? 213  ALA B CB    1 
ATOM   4130 N N     . TYR B 1 214 ? 11.885  -21.046 67.313  1.00 18.52 ? 214  TYR B N     1 
ATOM   4131 C CA    . TYR B 1 214 ? 11.915  -19.638 66.931  1.00 19.73 ? 214  TYR B CA    1 
ATOM   4132 C C     . TYR B 1 214 ? 10.823  -19.304 65.911  1.00 20.49 ? 214  TYR B C     1 
ATOM   4133 O O     . TYR B 1 214 ? 10.097  -18.319 66.074  1.00 20.05 ? 214  TYR B O     1 
ATOM   4134 C CB    . TYR B 1 214 ? 13.290  -19.292 66.357  1.00 17.50 ? 214  TYR B CB    1 
ATOM   4135 C CG    . TYR B 1 214 ? 13.414  -17.879 65.832  1.00 20.11 ? 214  TYR B CG    1 
ATOM   4136 C CD1   . TYR B 1 214 ? 13.273  -16.775 66.679  1.00 19.10 ? 214  TYR B CD1   1 
ATOM   4137 C CD2   . TYR B 1 214 ? 13.713  -17.647 64.491  1.00 17.28 ? 214  TYR B CD2   1 
ATOM   4138 C CE1   . TYR B 1 214 ? 13.435  -15.476 66.196  1.00 19.94 ? 214  TYR B CE1   1 
ATOM   4139 C CE2   . TYR B 1 214 ? 13.876  -16.367 64.003  1.00 19.54 ? 214  TYR B CE2   1 
ATOM   4140 C CZ    . TYR B 1 214 ? 13.742  -15.281 64.854  1.00 21.97 ? 214  TYR B CZ    1 
ATOM   4141 O OH    . TYR B 1 214 ? 13.953  -14.012 64.355  1.00 18.90 ? 214  TYR B OH    1 
ATOM   4142 N N     . ASP B 1 215 ? 10.700  -20.140 64.879  1.00 22.53 ? 215  ASP B N     1 
ATOM   4143 C CA    . ASP B 1 215 ? 9.716   -19.942 63.812  1.00 23.95 ? 215  ASP B CA    1 
ATOM   4144 C C     . ASP B 1 215 ? 8.257   -20.155 64.213  1.00 25.95 ? 215  ASP B C     1 
ATOM   4145 O O     . ASP B 1 215 ? 7.353   -19.748 63.483  1.00 26.48 ? 215  ASP B O     1 
ATOM   4146 C CB    . ASP B 1 215 ? 10.028  -20.857 62.618  1.00 24.07 ? 215  ASP B CB    1 
ATOM   4147 C CG    . ASP B 1 215 ? 11.346  -20.510 61.940  1.00 25.86 ? 215  ASP B CG    1 
ATOM   4148 O OD1   . ASP B 1 215 ? 11.723  -19.319 61.943  1.00 25.76 ? 215  ASP B OD1   1 
ATOM   4149 O OD2   . ASP B 1 215 ? 11.998  -21.424 61.389  1.00 27.21 ? 215  ASP B OD2   1 
ATOM   4150 N N     . SER B 1 216 ? 8.025   -20.789 65.357  1.00 25.82 ? 216  SER B N     1 
ATOM   4151 C CA    . SER B 1 216 ? 6.664   -21.052 65.815  1.00 28.55 ? 216  SER B CA    1 
ATOM   4152 C C     . SER B 1 216 ? 5.923   -19.790 66.248  1.00 31.15 ? 216  SER B C     1 
ATOM   4153 O O     . SER B 1 216 ? 6.544   -18.794 66.615  1.00 29.79 ? 216  SER B O     1 
ATOM   4154 C CB    . SER B 1 216 ? 6.685   -22.060 66.967  1.00 28.80 ? 216  SER B CB    1 
ATOM   4155 O OG    . SER B 1 216 ? 7.035   -23.350 66.492  1.00 30.89 ? 216  SER B OG    1 
ATOM   4156 N N     . ASN B 1 217 ? 4.592   -19.849 66.211  1.00 34.57 ? 217  ASN B N     1 
ATOM   4157 C CA    . ASN B 1 217 ? 3.753   -18.712 66.584  1.00 37.63 ? 217  ASN B CA    1 
ATOM   4158 C C     . ASN B 1 217 ? 3.014   -18.881 67.901  1.00 39.76 ? 217  ASN B C     1 
ATOM   4159 O O     . ASN B 1 217 ? 2.462   -17.915 68.431  1.00 41.50 ? 217  ASN B O     1 
ATOM   4160 C CB    . ASN B 1 217 ? 2.721   -18.429 65.492  1.00 38.34 ? 217  ASN B CB    1 
ATOM   4161 C CG    . ASN B 1 217 ? 3.350   -17.948 64.206  1.00 40.25 ? 217  ASN B CG    1 
ATOM   4162 O OD1   . ASN B 1 217 ? 3.980   -16.890 64.166  1.00 39.35 ? 217  ASN B OD1   1 
ATOM   4163 N ND2   . ASN B 1 217 ? 3.184   -18.726 63.140  1.00 41.06 ? 217  ASN B ND2   1 
ATOM   4164 N N     . HIS B 1 218 ? 2.983   -20.097 68.433  1.00 41.11 ? 218  HIS B N     1 
ATOM   4165 C CA    . HIS B 1 218 ? 2.275   -20.307 69.688  1.00 41.94 ? 218  HIS B CA    1 
ATOM   4166 C C     . HIS B 1 218 ? 2.676   -21.549 70.466  1.00 40.92 ? 218  HIS B C     1 
ATOM   4167 O O     . HIS B 1 218 ? 1.866   -22.452 70.671  1.00 41.55 ? 218  HIS B O     1 
ATOM   4168 C CB    . HIS B 1 218 ? 0.759   -20.306 69.433  1.00 43.82 ? 218  HIS B CB    1 
ATOM   4169 C CG    . HIS B 1 218 ? 0.349   -21.083 68.223  1.00 45.65 ? 218  HIS B CG    1 
ATOM   4170 N ND1   . HIS B 1 218 ? 0.429   -22.458 68.158  1.00 48.32 ? 218  HIS B ND1   1 
ATOM   4171 C CD2   . HIS B 1 218 ? -0.106  -20.675 67.015  1.00 47.28 ? 218  HIS B CD2   1 
ATOM   4172 C CE1   . HIS B 1 218 ? 0.041   -22.863 66.961  1.00 48.48 ? 218  HIS B CE1   1 
ATOM   4173 N NE2   . HIS B 1 218 ? -0.288  -21.801 66.248  1.00 49.06 ? 218  HIS B NE2   1 
ATOM   4174 N N     . ILE B 1 219 ? 3.929   -21.590 70.905  1.00 39.79 ? 219  ILE B N     1 
ATOM   4175 C CA    . ILE B 1 219 ? 4.406   -22.717 71.690  1.00 38.78 ? 219  ILE B CA    1 
ATOM   4176 C C     . ILE B 1 219 ? 3.706   -22.645 73.044  1.00 38.65 ? 219  ILE B C     1 
ATOM   4177 O O     . ILE B 1 219 ? 3.452   -23.669 73.678  1.00 38.63 ? 219  ILE B O     1 
ATOM   4178 C CB    . ILE B 1 219 ? 5.940   -22.660 71.891  1.00 39.43 ? 219  ILE B CB    1 
ATOM   4179 C CG1   . ILE B 1 219 ? 6.645   -22.886 70.553  1.00 37.31 ? 219  ILE B CG1   1 
ATOM   4180 C CG2   . ILE B 1 219 ? 6.377   -23.705 72.910  1.00 40.06 ? 219  ILE B CG2   1 
ATOM   4181 C CD1   . ILE B 1 219 ? 8.151   -22.937 70.655  1.00 38.14 ? 219  ILE B CD1   1 
ATOM   4182 N N     . GLY B 1 220 ? 3.404   -21.424 73.486  1.00 37.88 ? 220  GLY B N     1 
ATOM   4183 C CA    . GLY B 1 220 ? 2.706   -21.253 74.748  1.00 35.70 ? 220  GLY B CA    1 
ATOM   4184 C C     . GLY B 1 220 ? 3.345   -20.427 75.851  1.00 35.36 ? 220  GLY B C     1 
ATOM   4185 O O     . GLY B 1 220 ? 2.698   -20.171 76.860  1.00 34.96 ? 220  GLY B O     1 
ATOM   4186 N N     . TYR B 1 221 ? 4.590   -19.994 75.690  1.00 35.44 ? 221  TYR B N     1 
ATOM   4187 C CA    . TYR B 1 221 ? 5.211   -19.219 76.757  1.00 36.18 ? 221  TYR B CA    1 
ATOM   4188 C C     . TYR B 1 221 ? 5.266   -17.709 76.546  1.00 36.21 ? 221  TYR B C     1 
ATOM   4189 O O     . TYR B 1 221 ? 5.801   -16.985 77.383  1.00 36.54 ? 221  TYR B O     1 
ATOM   4190 C CB    . TYR B 1 221 ? 6.602   -19.777 77.069  1.00 36.73 ? 221  TYR B CB    1 
ATOM   4191 C CG    . TYR B 1 221 ? 6.537   -21.225 77.490  1.00 38.80 ? 221  TYR B CG    1 
ATOM   4192 C CD1   . TYR B 1 221 ? 6.564   -22.247 76.543  1.00 39.13 ? 221  TYR B CD1   1 
ATOM   4193 C CD2   . TYR B 1 221 ? 6.368   -21.573 78.832  1.00 38.58 ? 221  TYR B CD2   1 
ATOM   4194 C CE1   . TYR B 1 221 ? 6.423   -23.579 76.917  1.00 38.66 ? 221  TYR B CE1   1 
ATOM   4195 C CE2   . TYR B 1 221 ? 6.224   -22.902 79.218  1.00 38.19 ? 221  TYR B CE2   1 
ATOM   4196 C CZ    . TYR B 1 221 ? 6.253   -23.899 78.254  1.00 38.46 ? 221  TYR B CZ    1 
ATOM   4197 O OH    . TYR B 1 221 ? 6.113   -25.216 78.625  1.00 35.85 ? 221  TYR B OH    1 
ATOM   4198 N N     . MET B 1 222 ? 4.712   -17.238 75.433  1.00 35.04 ? 222  MET B N     1 
ATOM   4199 C CA    . MET B 1 222 ? 4.653   -15.804 75.151  1.00 34.89 ? 222  MET B CA    1 
ATOM   4200 C C     . MET B 1 222 ? 3.307   -15.554 74.485  1.00 34.33 ? 222  MET B C     1 
ATOM   4201 O O     . MET B 1 222 ? 3.213   -14.951 73.417  1.00 32.41 ? 222  MET B O     1 
ATOM   4202 C CB    . MET B 1 222 ? 5.817   -15.358 74.248  1.00 35.01 ? 222  MET B CB    1 
ATOM   4203 C CG    . MET B 1 222 ? 5.869   -15.967 72.854  1.00 34.50 ? 222  MET B CG    1 
ATOM   4204 S SD    . MET B 1 222 ? 7.407   -15.521 71.971  1.00 37.04 ? 222  MET B SD    1 
ATOM   4205 C CE    . MET B 1 222 ? 6.975   -13.900 71.277  1.00 32.28 ? 222  MET B CE    1 
ATOM   4206 N N     . VAL B 1 223 ? 2.259   -16.036 75.146  1.00 35.23 ? 223  VAL B N     1 
ATOM   4207 C CA    . VAL B 1 223 ? 0.899   -15.912 74.639  1.00 36.02 ? 223  VAL B CA    1 
ATOM   4208 C C     . VAL B 1 223 ? 0.449   -14.470 74.422  1.00 35.69 ? 223  VAL B C     1 
ATOM   4209 O O     . VAL B 1 223 ? -0.350  -14.190 73.528  1.00 36.56 ? 223  VAL B O     1 
ATOM   4210 C CB    . VAL B 1 223 ? -0.116  -16.625 75.579  1.00 36.37 ? 223  VAL B CB    1 
ATOM   4211 C CG1   . VAL B 1 223 ? 0.009   -16.088 76.998  1.00 35.30 ? 223  VAL B CG1   1 
ATOM   4212 C CG2   . VAL B 1 223 ? -1.539  -16.427 75.057  1.00 35.77 ? 223  VAL B CG2   1 
ATOM   4213 N N     . ASN B 1 224 ? 0.962   -13.552 75.227  1.00 35.21 ? 224  ASN B N     1 
ATOM   4214 C CA    . ASN B 1 224 ? 0.569   -12.159 75.093  1.00 35.44 ? 224  ASN B CA    1 
ATOM   4215 C C     . ASN B 1 224 ? 1.057   -11.494 73.802  1.00 34.08 ? 224  ASN B C     1 
ATOM   4216 O O     . ASN B 1 224 ? 0.629   -10.393 73.470  1.00 32.68 ? 224  ASN B O     1 
ATOM   4217 C CB    . ASN B 1 224 ? 1.038   -11.372 76.321  1.00 37.02 ? 224  ASN B CB    1 
ATOM   4218 C CG    . ASN B 1 224 ? 0.278   -11.762 77.585  1.00 38.65 ? 224  ASN B CG    1 
ATOM   4219 O OD1   . ASN B 1 224 ? 0.687   -11.434 78.704  1.00 40.19 ? 224  ASN B OD1   1 
ATOM   4220 N ND2   . ASN B 1 224 ? -0.841  -12.457 77.409  1.00 38.50 ? 224  ASN B ND2   1 
ATOM   4221 N N     . LEU B 1 225 ? 1.937   -12.166 73.067  1.00 33.17 ? 225  LEU B N     1 
ATOM   4222 C CA    . LEU B 1 225 ? 2.447   -11.614 71.814  1.00 34.63 ? 225  LEU B CA    1 
ATOM   4223 C C     . LEU B 1 225 ? 2.123   -12.498 70.618  1.00 35.52 ? 225  LEU B C     1 
ATOM   4224 O O     . LEU B 1 225 ? 2.570   -12.227 69.506  1.00 34.71 ? 225  LEU B O     1 
ATOM   4225 C CB    . LEU B 1 225 ? 3.963   -11.416 71.894  1.00 32.90 ? 225  LEU B CB    1 
ATOM   4226 C CG    . LEU B 1 225 ? 4.482   -10.195 72.652  1.00 31.05 ? 225  LEU B CG    1 
ATOM   4227 C CD1   . LEU B 1 225 ? 5.997   -10.288 72.808  1.00 30.92 ? 225  LEU B CD1   1 
ATOM   4228 C CD2   . LEU B 1 225 ? 4.103   -8.939  71.896  1.00 30.34 ? 225  LEU B CD2   1 
ATOM   4229 N N     . GLU B 1 226 ? 1.340   -13.547 70.852  1.00 39.10 ? 226  GLU B N     1 
ATOM   4230 C CA    . GLU B 1 226 ? 0.967   -14.487 69.799  1.00 42.44 ? 226  GLU B CA    1 
ATOM   4231 C C     . GLU B 1 226 ? 0.448   -13.859 68.512  1.00 42.69 ? 226  GLU B C     1 
ATOM   4232 O O     . GLU B 1 226 ? 0.710   -14.374 67.427  1.00 43.16 ? 226  GLU B O     1 
ATOM   4233 C CB    . GLU B 1 226 ? -0.045  -15.503 70.333  1.00 44.83 ? 226  GLU B CB    1 
ATOM   4234 C CG    . GLU B 1 226 ? 0.612   -16.733 70.942  1.00 48.97 ? 226  GLU B CG    1 
ATOM   4235 C CD    . GLU B 1 226 ? -0.387  -17.727 71.505  1.00 51.91 ? 226  GLU B CD    1 
ATOM   4236 O OE1   . GLU B 1 226 ? -1.339  -18.098 70.782  1.00 53.20 ? 226  GLU B OE1   1 
ATOM   4237 O OE2   . GLU B 1 226 ? -0.212  -18.145 72.671  1.00 53.87 ? 226  GLU B OE2   1 
ATOM   4238 N N     . ASN B 1 227 ? -0.285  -12.756 68.616  1.00 43.09 ? 227  ASN B N     1 
ATOM   4239 C CA    . ASN B 1 227 ? -0.783  -12.102 67.415  1.00 43.37 ? 227  ASN B CA    1 
ATOM   4240 C C     . ASN B 1 227 ? 0.364   -11.455 66.668  1.00 41.77 ? 227  ASN B C     1 
ATOM   4241 O O     . ASN B 1 227 ? 0.450   -11.546 65.444  1.00 42.90 ? 227  ASN B O     1 
ATOM   4242 C CB    . ASN B 1 227 ? -1.828  -11.043 67.753  1.00 46.39 ? 227  ASN B CB    1 
ATOM   4243 C CG    . ASN B 1 227 ? -3.203  -11.631 67.936  1.00 49.99 ? 227  ASN B CG    1 
ATOM   4244 O OD1   . ASN B 1 227 ? -3.634  -12.476 67.146  1.00 52.31 ? 227  ASN B OD1   1 
ATOM   4245 N ND2   . ASN B 1 227 ? -3.912  -11.185 68.971  1.00 51.42 ? 227  ASN B ND2   1 
ATOM   4246 N N     . GLU B 1 228 ? 1.243   -10.795 67.411  1.00 40.18 ? 228  GLU B N     1 
ATOM   4247 C CA    . GLU B 1 228 ? 2.392   -10.132 66.816  1.00 38.49 ? 228  GLU B CA    1 
ATOM   4248 C C     . GLU B 1 228 ? 3.299   -11.153 66.153  1.00 36.22 ? 228  GLU B C     1 
ATOM   4249 O O     . GLU B 1 228 ? 3.863   -10.893 65.094  1.00 34.99 ? 228  GLU B O     1 
ATOM   4250 C CB    . GLU B 1 228 ? 3.180   -9.372  67.883  1.00 41.09 ? 228  GLU B CB    1 
ATOM   4251 C CG    . GLU B 1 228 ? 2.508   -8.110  68.376  1.00 46.75 ? 228  GLU B CG    1 
ATOM   4252 C CD    . GLU B 1 228 ? 1.118   -8.364  68.906  1.00 50.86 ? 228  GLU B CD    1 
ATOM   4253 O OE1   . GLU B 1 228 ? 0.196   -8.582  68.088  1.00 53.34 ? 228  GLU B OE1   1 
ATOM   4254 O OE2   . GLU B 1 228 ? 0.949   -8.355  70.145  1.00 54.03 ? 228  GLU B OE2   1 
ATOM   4255 N N     . SER B 1 229 ? 3.430   -12.315 66.785  1.00 35.07 ? 229  SER B N     1 
ATOM   4256 C CA    . SER B 1 229 ? 4.277   -13.385 66.268  1.00 35.04 ? 229  SER B CA    1 
ATOM   4257 C C     . SER B 1 229 ? 3.963   -13.723 64.819  1.00 34.01 ? 229  SER B C     1 
ATOM   4258 O O     . SER B 1 229 ? 4.869   -13.930 64.013  1.00 32.82 ? 229  SER B O     1 
ATOM   4259 C CB    . SER B 1 229 ? 4.118   -14.644 67.120  1.00 35.25 ? 229  SER B CB    1 
ATOM   4260 O OG    . SER B 1 229 ? 4.555   -14.418 68.446  1.00 39.03 ? 229  SER B OG    1 
ATOM   4261 N N     . SER B 1 230 ? 2.678   -13.774 64.492  1.00 34.00 ? 230  SER B N     1 
ATOM   4262 C CA    . SER B 1 230 ? 2.257   -14.104 63.138  1.00 36.23 ? 230  SER B CA    1 
ATOM   4263 C C     . SER B 1 230 ? 2.381   -12.932 62.168  1.00 37.22 ? 230  SER B C     1 
ATOM   4264 O O     . SER B 1 230 ? 2.536   -13.132 60.967  1.00 39.55 ? 230  SER B O     1 
ATOM   4265 C CB    . SER B 1 230 ? 0.815   -14.618 63.152  1.00 35.49 ? 230  SER B CB    1 
ATOM   4266 O OG    . SER B 1 230 ? -0.079  -13.617 63.609  1.00 37.14 ? 230  SER B OG    1 
ATOM   4267 N N     . LYS B 1 231 ? 2.332   -11.710 62.687  1.00 38.00 ? 231  LYS B N     1 
ATOM   4268 C CA    . LYS B 1 231 ? 2.421   -10.521 61.842  1.00 38.18 ? 231  LYS B CA    1 
ATOM   4269 C C     . LYS B 1 231 ? 3.848   -10.064 61.547  1.00 37.08 ? 231  LYS B C     1 
ATOM   4270 O O     . LYS B 1 231 ? 4.053   -9.043  60.889  1.00 38.13 ? 231  LYS B O     1 
ATOM   4271 C CB    . LYS B 1 231 ? 1.647   -9.365  62.481  1.00 39.54 ? 231  LYS B CB    1 
ATOM   4272 C CG    . LYS B 1 231 ? 0.255   -9.746  62.963  1.00 43.70 ? 231  LYS B CG    1 
ATOM   4273 C CD    . LYS B 1 231 ? -0.431  -8.573  63.648  1.00 46.99 ? 231  LYS B CD    1 
ATOM   4274 C CE    . LYS B 1 231 ? -1.527  -9.048  64.603  1.00 50.31 ? 231  LYS B CE    1 
ATOM   4275 N NZ    . LYS B 1 231 ? -2.595  -9.862  63.946  1.00 51.65 ? 231  LYS B NZ    1 
ATOM   4276 N N     . ILE B 1 232 ? 4.836   -10.803 62.035  1.00 34.73 ? 232  ILE B N     1 
ATOM   4277 C CA    . ILE B 1 232 ? 6.225   -10.436 61.790  1.00 32.26 ? 232  ILE B CA    1 
ATOM   4278 C C     . ILE B 1 232 ? 6.978   -11.612 61.175  1.00 31.86 ? 232  ILE B C     1 
ATOM   4279 O O     . ILE B 1 232 ? 6.566   -12.763 61.313  1.00 32.59 ? 232  ILE B O     1 
ATOM   4280 C CB    . ILE B 1 232 ? 6.942   -10.013 63.099  1.00 31.15 ? 232  ILE B CB    1 
ATOM   4281 C CG1   . ILE B 1 232 ? 8.319   -9.427  62.768  1.00 28.89 ? 232  ILE B CG1   1 
ATOM   4282 C CG2   . ILE B 1 232 ? 7.093   -11.216 64.025  1.00 28.51 ? 232  ILE B CG2   1 
ATOM   4283 C CD1   . ILE B 1 232 ? 9.038   -8.814  63.946  1.00 30.04 ? 232  ILE B CD1   1 
ATOM   4284 N N     . GLY B 1 233 ? 8.075   -11.319 60.489  1.00 30.65 ? 233  GLY B N     1 
ATOM   4285 C CA    . GLY B 1 233 ? 8.858   -12.379 59.882  1.00 31.63 ? 233  GLY B CA    1 
ATOM   4286 C C     . GLY B 1 233 ? 9.812   -13.003 60.887  1.00 30.66 ? 233  GLY B C     1 
ATOM   4287 O O     . GLY B 1 233 ? 9.629   -12.866 62.098  1.00 31.83 ? 233  GLY B O     1 
ATOM   4288 N N     . ARG B 1 234 ? 10.836  -13.683 60.385  1.00 28.21 ? 234  ARG B N     1 
ATOM   4289 C CA    . ARG B 1 234 ? 11.819  -14.328 61.243  1.00 27.42 ? 234  ARG B CA    1 
ATOM   4290 C C     . ARG B 1 234 ? 13.213  -14.142 60.657  1.00 27.91 ? 234  ARG B C     1 
ATOM   4291 O O     . ARG B 1 234 ? 13.368  -14.081 59.439  1.00 27.91 ? 234  ARG B O     1 
ATOM   4292 C CB    . ARG B 1 234 ? 11.517  -15.831 61.355  1.00 26.04 ? 234  ARG B CB    1 
ATOM   4293 C CG    . ARG B 1 234 ? 10.175  -16.176 61.998  1.00 25.20 ? 234  ARG B CG    1 
ATOM   4294 C CD    . ARG B 1 234 ? 10.213  -15.925 63.500  1.00 25.22 ? 234  ARG B CD    1 
ATOM   4295 N NE    . ARG B 1 234 ? 9.019   -16.408 64.188  1.00 20.99 ? 234  ARG B NE    1 
ATOM   4296 C CZ    . ARG B 1 234 ? 7.820   -15.844 64.109  1.00 22.83 ? 234  ARG B CZ    1 
ATOM   4297 N NH1   . ARG B 1 234 ? 7.635   -14.762 63.364  1.00 22.19 ? 234  ARG B NH1   1 
ATOM   4298 N NH2   . ARG B 1 234 ? 6.805   -16.353 64.791  1.00 21.15 ? 234  ARG B NH2   1 
ATOM   4299 N N     . LYS B 1 235 ? 14.224  -14.036 61.518  1.00 27.89 ? 235  LYS B N     1 
ATOM   4300 C CA    . LYS B 1 235 ? 15.591  -13.902 61.043  1.00 28.73 ? 235  LYS B CA    1 
ATOM   4301 C C     . LYS B 1 235 ? 15.965  -15.268 60.482  1.00 30.79 ? 235  LYS B C     1 
ATOM   4302 O O     . LYS B 1 235 ? 15.416  -16.289 60.889  1.00 29.56 ? 235  LYS B O     1 
ATOM   4303 C CB    . LYS B 1 235 ? 16.548  -13.555 62.182  1.00 29.86 ? 235  LYS B CB    1 
ATOM   4304 C CG    . LYS B 1 235 ? 16.209  -12.295 62.939  1.00 31.29 ? 235  LYS B CG    1 
ATOM   4305 C CD    . LYS B 1 235 ? 16.373  -11.063 62.102  1.00 31.00 ? 235  LYS B CD    1 
ATOM   4306 C CE    . LYS B 1 235 ? 16.011  -9.846  62.923  1.00 33.96 ? 235  LYS B CE    1 
ATOM   4307 N NZ    . LYS B 1 235 ? 16.782  -9.829  64.198  1.00 34.36 ? 235  LYS B NZ    1 
ATOM   4308 N N     . ASN B 1 236 ? 16.920  -15.285 59.563  1.00 32.92 ? 236  ASN B N     1 
ATOM   4309 C CA    . ASN B 1 236 ? 17.333  -16.526 58.935  1.00 34.19 ? 236  ASN B CA    1 
ATOM   4310 C C     . ASN B 1 236 ? 18.466  -17.243 59.672  1.00 32.28 ? 236  ASN B C     1 
ATOM   4311 O O     . ASN B 1 236 ? 19.566  -17.392 59.139  1.00 34.65 ? 236  ASN B O     1 
ATOM   4312 C CB    . ASN B 1 236 ? 17.731  -16.230 57.491  1.00 38.19 ? 236  ASN B CB    1 
ATOM   4313 C CG    . ASN B 1 236 ? 17.894  -17.476 56.678  1.00 41.88 ? 236  ASN B CG    1 
ATOM   4314 O OD1   . ASN B 1 236 ? 17.055  -18.378 56.738  1.00 45.33 ? 236  ASN B OD1   1 
ATOM   4315 N ND2   . ASN B 1 236 ? 18.971  -17.541 55.901  1.00 45.96 ? 236  ASN B ND2   1 
ATOM   4316 N N     . TYR B 1 237 ? 18.192  -17.686 60.898  1.00 29.47 ? 237  TYR B N     1 
ATOM   4317 C CA    . TYR B 1 237 ? 19.185  -18.394 61.706  1.00 27.03 ? 237  TYR B CA    1 
ATOM   4318 C C     . TYR B 1 237 ? 19.305  -19.829 61.205  1.00 25.37 ? 237  TYR B C     1 
ATOM   4319 O O     . TYR B 1 237 ? 18.329  -20.390 60.697  1.00 24.26 ? 237  TYR B O     1 
ATOM   4320 C CB    . TYR B 1 237 ? 18.778  -18.384 63.181  1.00 25.39 ? 237  TYR B CB    1 
ATOM   4321 C CG    . TYR B 1 237 ? 18.665  -16.998 63.771  1.00 25.06 ? 237  TYR B CG    1 
ATOM   4322 C CD1   . TYR B 1 237 ? 19.733  -16.096 63.708  1.00 24.77 ? 237  TYR B CD1   1 
ATOM   4323 C CD2   . TYR B 1 237 ? 17.504  -16.596 64.418  1.00 24.21 ? 237  TYR B CD2   1 
ATOM   4324 C CE1   . TYR B 1 237 ? 19.639  -14.831 64.277  1.00 24.11 ? 237  TYR B CE1   1 
ATOM   4325 C CE2   . TYR B 1 237 ? 17.401  -15.339 64.993  1.00 24.71 ? 237  TYR B CE2   1 
ATOM   4326 C CZ    . TYR B 1 237 ? 18.467  -14.464 64.923  1.00 25.51 ? 237  TYR B CZ    1 
ATOM   4327 O OH    . TYR B 1 237 ? 18.362  -13.229 65.519  1.00 26.82 ? 237  TYR B OH    1 
ATOM   4328 N N     . HIS B 1 238 ? 20.488  -20.421 61.355  1.00 24.22 ? 238  HIS B N     1 
ATOM   4329 C CA    . HIS B 1 238 ? 20.726  -21.782 60.865  1.00 25.42 ? 238  HIS B CA    1 
ATOM   4330 C C     . HIS B 1 238 ? 20.045  -21.876 59.496  1.00 26.95 ? 238  HIS B C     1 
ATOM   4331 O O     . HIS B 1 238 ? 19.070  -22.613 59.302  1.00 25.62 ? 238  HIS B O     1 
ATOM   4332 C CB    . HIS B 1 238 ? 20.153  -22.809 61.839  1.00 22.98 ? 238  HIS B CB    1 
ATOM   4333 C CG    . HIS B 1 238 ? 20.653  -22.649 63.241  1.00 22.44 ? 238  HIS B CG    1 
ATOM   4334 N ND1   . HIS B 1 238 ? 21.979  -22.417 63.537  1.00 22.00 ? 238  HIS B ND1   1 
ATOM   4335 C CD2   . HIS B 1 238 ? 20.006  -22.703 64.430  1.00 19.53 ? 238  HIS B CD2   1 
ATOM   4336 C CE1   . HIS B 1 238 ? 22.127  -22.333 64.848  1.00 21.54 ? 238  HIS B CE1   1 
ATOM   4337 N NE2   . HIS B 1 238 ? 20.945  -22.504 65.413  1.00 21.06 ? 238  HIS B NE2   1 
ATOM   4338 N N     . PRO B 1 239 ? 20.567  -21.109 58.524  1.00 28.87 ? 239  PRO B N     1 
ATOM   4339 C CA    . PRO B 1 239 ? 20.080  -21.020 57.143  1.00 30.88 ? 239  PRO B CA    1 
ATOM   4340 C C     . PRO B 1 239 ? 19.942  -22.369 56.457  1.00 32.37 ? 239  PRO B C     1 
ATOM   4341 O O     . PRO B 1 239 ? 18.933  -22.643 55.809  1.00 33.43 ? 239  PRO B O     1 
ATOM   4342 C CB    . PRO B 1 239 ? 21.140  -20.165 56.446  1.00 29.95 ? 239  PRO B CB    1 
ATOM   4343 C CG    . PRO B 1 239 ? 21.808  -19.422 57.561  1.00 30.05 ? 239  PRO B CG    1 
ATOM   4344 C CD    . PRO B 1 239 ? 21.873  -20.436 58.656  1.00 28.39 ? 239  PRO B CD    1 
ATOM   4345 N N     . ASN B 1 240 ? 20.968  -23.202 56.612  1.00 33.20 ? 240  ASN B N     1 
ATOM   4346 C CA    . ASN B 1 240 ? 21.021  -24.518 55.986  1.00 35.63 ? 240  ASN B CA    1 
ATOM   4347 C C     . ASN B 1 240 ? 20.162  -25.621 56.604  1.00 36.43 ? 240  ASN B C     1 
ATOM   4348 O O     . ASN B 1 240 ? 20.135  -26.740 56.093  1.00 37.99 ? 240  ASN B O     1 
ATOM   4349 C CB    . ASN B 1 240 ? 22.484  -24.968 55.910  1.00 35.82 ? 240  ASN B CB    1 
ATOM   4350 C CG    . ASN B 1 240 ? 23.349  -23.989 55.127  1.00 38.07 ? 240  ASN B CG    1 
ATOM   4351 O OD1   . ASN B 1 240 ? 24.516  -23.769 55.454  1.00 40.04 ? 240  ASN B OD1   1 
ATOM   4352 N ND2   . ASN B 1 240 ? 22.777  -23.400 54.084  1.00 36.24 ? 240  ASN B ND2   1 
ATOM   4353 N N     . ILE B 1 241 ? 19.468  -25.324 57.697  1.00 38.17 ? 241  ILE B N     1 
ATOM   4354 C CA    . ILE B 1 241 ? 18.599  -26.325 58.325  1.00 39.19 ? 241  ILE B CA    1 
ATOM   4355 C C     . ILE B 1 241 ? 17.159  -25.891 58.077  1.00 39.48 ? 241  ILE B C     1 
ATOM   4356 O O     . ILE B 1 241 ? 16.839  -24.709 58.181  1.00 40.73 ? 241  ILE B O     1 
ATOM   4357 C CB    . ILE B 1 241 ? 18.858  -26.452 59.855  1.00 39.56 ? 241  ILE B CB    1 
ATOM   4358 C CG1   . ILE B 1 241 ? 20.211  -27.119 60.111  1.00 40.79 ? 241  ILE B CG1   1 
ATOM   4359 C CG2   . ILE B 1 241 ? 17.773  -27.297 60.505  1.00 40.36 ? 241  ILE B CG2   1 
ATOM   4360 C CD1   . ILE B 1 241 ? 21.406  -26.300 59.671  1.00 44.37 ? 241  ILE B CD1   1 
ATOM   4361 N N     . HIS B 1 242 ? 16.294  -26.840 57.739  1.00 40.16 ? 242  HIS B N     1 
ATOM   4362 C CA    . HIS B 1 242 ? 14.905  -26.507 57.452  1.00 41.81 ? 242  HIS B CA    1 
ATOM   4363 C C     . HIS B 1 242 ? 13.909  -27.483 58.044  1.00 41.48 ? 242  HIS B C     1 
ATOM   4364 O O     . HIS B 1 242 ? 13.578  -28.489 57.426  1.00 41.39 ? 242  HIS B O     1 
ATOM   4365 C CB    . HIS B 1 242 ? 14.695  -26.438 55.940  1.00 44.83 ? 242  HIS B CB    1 
ATOM   4366 C CG    . HIS B 1 242 ? 15.570  -25.435 55.256  1.00 46.80 ? 242  HIS B CG    1 
ATOM   4367 N ND1   . HIS B 1 242 ? 15.284  -24.086 55.241  1.00 47.70 ? 242  HIS B ND1   1 
ATOM   4368 C CD2   . HIS B 1 242 ? 16.743  -25.580 54.595  1.00 46.49 ? 242  HIS B CD2   1 
ATOM   4369 C CE1   . HIS B 1 242 ? 16.244  -23.444 54.598  1.00 49.25 ? 242  HIS B CE1   1 
ATOM   4370 N NE2   . HIS B 1 242 ? 17.142  -24.328 54.196  1.00 47.64 ? 242  HIS B NE2   1 
ATOM   4371 N N     . PRO B 1 243 ? 13.416  -27.196 59.256  1.00 42.20 ? 243  PRO B N     1 
ATOM   4372 C CA    . PRO B 1 243 ? 12.444  -28.061 59.926  1.00 41.92 ? 243  PRO B CA    1 
ATOM   4373 C C     . PRO B 1 243 ? 11.307  -28.474 58.994  1.00 42.54 ? 243  PRO B C     1 
ATOM   4374 O O     . PRO B 1 243 ? 10.951  -27.742 58.073  1.00 41.06 ? 243  PRO B O     1 
ATOM   4375 C CB    . PRO B 1 243 ? 11.974  -27.195 61.083  1.00 41.80 ? 243  PRO B CB    1 
ATOM   4376 C CG    . PRO B 1 243 ? 13.239  -26.502 61.471  1.00 42.11 ? 243  PRO B CG    1 
ATOM   4377 C CD    . PRO B 1 243 ? 13.823  -26.087 60.137  1.00 41.76 ? 243  PRO B CD    1 
ATOM   4378 N N     . THR B 1 244 ? 10.749  -29.654 59.245  1.00 43.50 ? 244  THR B N     1 
ATOM   4379 C CA    . THR B 1 244 ? 9.661   -30.194 58.439  1.00 46.00 ? 244  THR B CA    1 
ATOM   4380 C C     . THR B 1 244 ? 8.292   -29.684 58.865  1.00 46.56 ? 244  THR B C     1 
ATOM   4381 O O     . THR B 1 244 ? 7.468   -29.325 58.027  1.00 47.38 ? 244  THR B O     1 
ATOM   4382 C CB    . THR B 1 244 ? 9.630   -31.728 58.515  1.00 47.09 ? 244  THR B CB    1 
ATOM   4383 O OG1   . THR B 1 244 ? 10.848  -32.254 57.978  1.00 47.63 ? 244  THR B OG1   1 
ATOM   4384 C CG2   . THR B 1 244 ? 8.445   -32.279 57.727  1.00 48.53 ? 244  THR B CG2   1 
ATOM   4385 N N     . GLU B 1 245 ? 8.045   -29.672 60.168  1.00 47.13 ? 245  GLU B N     1 
ATOM   4386 C CA    . GLU B 1 245 ? 6.769   -29.211 60.686  1.00 48.29 ? 245  GLU B CA    1 
ATOM   4387 C C     . GLU B 1 245 ? 6.618   -27.694 60.634  1.00 48.61 ? 245  GLU B C     1 
ATOM   4388 O O     . GLU B 1 245 ? 7.601   -26.957 60.583  1.00 48.26 ? 245  GLU B O     1 
ATOM   4389 C CB    . GLU B 1 245 ? 6.565   -29.722 62.116  1.00 48.93 ? 245  GLU B CB    1 
ATOM   4390 C CG    . GLU B 1 245 ? 7.785   -29.655 63.022  1.00 49.92 ? 245  GLU B CG    1 
ATOM   4391 C CD    . GLU B 1 245 ? 8.843   -30.695 62.688  1.00 49.52 ? 245  GLU B CD    1 
ATOM   4392 O OE1   . GLU B 1 245 ? 9.772   -30.385 61.917  1.00 48.93 ? 245  GLU B OE1   1 
ATOM   4393 O OE2   . GLU B 1 245 ? 8.746   -31.829 63.198  1.00 51.59 ? 245  GLU B OE2   1 
ATOM   4394 N N     . LYS B 1 246 ? 5.370   -27.238 60.637  1.00 50.13 ? 246  LYS B N     1 
ATOM   4395 C CA    . LYS B 1 246 ? 5.061   -25.813 60.580  1.00 51.52 ? 246  LYS B CA    1 
ATOM   4396 C C     . LYS B 1 246 ? 4.995   -25.190 61.968  1.00 51.67 ? 246  LYS B C     1 
ATOM   4397 O O     . LYS B 1 246 ? 5.193   -23.985 62.131  1.00 52.11 ? 246  LYS B O     1 
ATOM   4398 C CB    . LYS B 1 246 ? 3.732   -25.607 59.851  1.00 52.84 ? 246  LYS B CB    1 
ATOM   4399 C CG    . LYS B 1 246 ? 2.591   -26.451 60.401  1.00 54.56 ? 246  LYS B CG    1 
ATOM   4400 C CD    . LYS B 1 246 ? 1.382   -26.411 59.479  1.00 55.82 ? 246  LYS B CD    1 
ATOM   4401 C CE    . LYS B 1 246 ? 0.266   -27.311 59.987  1.00 56.36 ? 246  LYS B CE    1 
ATOM   4402 N NZ    . LYS B 1 246 ? -0.234  -26.890 61.325  1.00 56.55 ? 246  LYS B NZ    1 
ATOM   4403 N N     . GLU B 1 247 ? 4.715   -26.018 62.966  1.00 51.66 ? 247  GLU B N     1 
ATOM   4404 C CA    . GLU B 1 247 ? 4.626   -25.554 64.345  1.00 51.82 ? 247  GLU B CA    1 
ATOM   4405 C C     . GLU B 1 247 ? 5.432   -26.493 65.235  1.00 50.51 ? 247  GLU B C     1 
ATOM   4406 O O     . GLU B 1 247 ? 5.621   -27.662 64.906  1.00 51.51 ? 247  GLU B O     1 
ATOM   4407 C CB    . GLU B 1 247 ? 3.163   -25.536 64.790  1.00 54.00 ? 247  GLU B CB    1 
ATOM   4408 C CG    . GLU B 1 247 ? 2.916   -24.964 66.175  1.00 57.20 ? 247  GLU B CG    1 
ATOM   4409 C CD    . GLU B 1 247 ? 3.252   -23.485 66.278  1.00 59.84 ? 247  GLU B CD    1 
ATOM   4410 O OE1   . GLU B 1 247 ? 2.924   -22.725 65.340  1.00 61.16 ? 247  GLU B OE1   1 
ATOM   4411 O OE2   . GLU B 1 247 ? 3.831   -23.078 67.307  1.00 60.63 ? 247  GLU B OE2   1 
ATOM   4412 N N     . PHE B 1 248 ? 5.906   -25.978 66.361  1.00 48.37 ? 248  PHE B N     1 
ATOM   4413 C CA    . PHE B 1 248 ? 6.696   -26.771 67.293  1.00 45.27 ? 248  PHE B CA    1 
ATOM   4414 C C     . PHE B 1 248 ? 5.778   -27.582 68.197  1.00 44.71 ? 248  PHE B C     1 
ATOM   4415 O O     . PHE B 1 248 ? 4.956   -27.017 68.921  1.00 45.36 ? 248  PHE B O     1 
ATOM   4416 C CB    . PHE B 1 248 ? 7.561   -25.849 68.155  1.00 43.68 ? 248  PHE B CB    1 
ATOM   4417 C CG    . PHE B 1 248 ? 8.527   -26.573 69.052  1.00 42.65 ? 248  PHE B CG    1 
ATOM   4418 C CD1   . PHE B 1 248 ? 9.812   -26.872 68.613  1.00 41.79 ? 248  PHE B CD1   1 
ATOM   4419 C CD2   . PHE B 1 248 ? 8.152   -26.955 70.335  1.00 42.27 ? 248  PHE B CD2   1 
ATOM   4420 C CE1   . PHE B 1 248 ? 10.711  -27.539 69.437  1.00 42.17 ? 248  PHE B CE1   1 
ATOM   4421 C CE2   . PHE B 1 248 ? 9.044   -27.626 71.169  1.00 41.97 ? 248  PHE B CE2   1 
ATOM   4422 C CZ    . PHE B 1 248 ? 10.326  -27.918 70.720  1.00 41.78 ? 248  PHE B CZ    1 
ATOM   4423 N N     . ASP B 1 249 ? 5.909   -28.904 68.153  1.00 42.23 ? 249  ASP B N     1 
ATOM   4424 C CA    . ASP B 1 249 ? 5.097   -29.772 69.006  1.00 40.90 ? 249  ASP B CA    1 
ATOM   4425 C C     . ASP B 1 249 ? 5.989   -30.522 69.993  1.00 38.30 ? 249  ASP B C     1 
ATOM   4426 O O     . ASP B 1 249 ? 7.104   -30.917 69.656  1.00 37.69 ? 249  ASP B O     1 
ATOM   4427 C CB    . ASP B 1 249 ? 4.300   -30.774 68.162  1.00 41.56 ? 249  ASP B CB    1 
ATOM   4428 C CG    . ASP B 1 249 ? 3.093   -30.148 67.496  0.00 42.28 ? 249  ASP B CG    1 
ATOM   4429 O OD1   . ASP B 1 249 ? 2.409   -30.853 66.726  0.00 42.68 ? 249  ASP B OD1   1 
ATOM   4430 O OD2   . ASP B 1 249 ? 2.824   -28.954 67.747  0.00 42.69 ? 249  ASP B OD2   1 
ATOM   4431 N N     . PHE B 1 250 ? 5.506   -30.702 71.218  1.00 35.83 ? 250  PHE B N     1 
ATOM   4432 C CA    . PHE B 1 250 ? 6.285   -31.416 72.221  1.00 32.61 ? 250  PHE B CA    1 
ATOM   4433 C C     . PHE B 1 250 ? 6.185   -32.909 71.959  1.00 29.93 ? 250  PHE B C     1 
ATOM   4434 O O     . PHE B 1 250 ? 5.101   -33.484 71.988  1.00 30.65 ? 250  PHE B O     1 
ATOM   4435 C CB    . PHE B 1 250 ? 5.773   -31.108 73.632  1.00 33.55 ? 250  PHE B CB    1 
ATOM   4436 C CG    . PHE B 1 250 ? 5.938   -29.671 74.040  1.00 33.79 ? 250  PHE B CG    1 
ATOM   4437 C CD1   . PHE B 1 250 ? 7.170   -29.037 73.924  1.00 33.98 ? 250  PHE B CD1   1 
ATOM   4438 C CD2   . PHE B 1 250 ? 4.860   -28.951 74.542  1.00 33.97 ? 250  PHE B CD2   1 
ATOM   4439 C CE1   . PHE B 1 250 ? 7.326   -27.704 74.302  1.00 34.04 ? 250  PHE B CE1   1 
ATOM   4440 C CE2   . PHE B 1 250 ? 5.007   -27.618 74.923  1.00 33.76 ? 250  PHE B CE2   1 
ATOM   4441 C CZ    . PHE B 1 250 ? 6.241   -26.996 74.802  1.00 33.12 ? 250  PHE B CZ    1 
ATOM   4442 N N     . LEU B 1 251 ? 7.322   -33.535 71.691  1.00 27.31 ? 251  LEU B N     1 
ATOM   4443 C CA    . LEU B 1 251 ? 7.354   -34.965 71.435  1.00 23.23 ? 251  LEU B CA    1 
ATOM   4444 C C     . LEU B 1 251 ? 7.426   -35.743 72.743  1.00 20.30 ? 251  LEU B C     1 
ATOM   4445 O O     . LEU B 1 251 ? 6.840   -36.818 72.854  1.00 20.01 ? 251  LEU B O     1 
ATOM   4446 C CB    . LEU B 1 251 ? 8.540   -35.304 70.524  1.00 23.73 ? 251  LEU B CB    1 
ATOM   4447 C CG    . LEU B 1 251 ? 8.266   -35.164 69.013  1.00 27.93 ? 251  LEU B CG    1 
ATOM   4448 C CD1   . LEU B 1 251 ? 7.459   -33.918 68.738  1.00 27.72 ? 251  LEU B CD1   1 
ATOM   4449 C CD2   . LEU B 1 251 ? 9.576   -35.134 68.232  1.00 28.98 ? 251  LEU B CD2   1 
ATOM   4450 N N     . VAL B 1 252 ? 8.132   -35.198 73.731  1.00 16.50 ? 252  VAL B N     1 
ATOM   4451 C CA    . VAL B 1 252 ? 8.259   -35.856 75.029  1.00 17.33 ? 252  VAL B CA    1 
ATOM   4452 C C     . VAL B 1 252 ? 8.000   -34.962 76.230  1.00 17.99 ? 252  VAL B C     1 
ATOM   4453 O O     . VAL B 1 252 ? 7.582   -35.452 77.276  1.00 17.20 ? 252  VAL B O     1 
ATOM   4454 C CB    . VAL B 1 252 ? 9.653   -36.498 75.230  1.00 17.98 ? 252  VAL B CB    1 
ATOM   4455 C CG1   . VAL B 1 252 ? 9.788   -37.728 74.351  1.00 16.53 ? 252  VAL B CG1   1 
ATOM   4456 C CG2   . VAL B 1 252 ? 10.744  -35.485 74.927  1.00 16.09 ? 252  VAL B CG2   1 
ATOM   4457 N N     . TYR B 1 253 ? 8.246   -33.661 76.089  1.00 17.47 ? 253  TYR B N     1 
ATOM   4458 C CA    . TYR B 1 253 ? 8.037   -32.734 77.198  1.00 18.72 ? 253  TYR B CA    1 
ATOM   4459 C C     . TYR B 1 253 ? 6.626   -32.798 77.766  1.00 19.51 ? 253  TYR B C     1 
ATOM   4460 O O     . TYR B 1 253 ? 5.652   -32.522 77.067  1.00 18.80 ? 253  TYR B O     1 
ATOM   4461 C CB    . TYR B 1 253 ? 8.337   -31.289 76.779  1.00 17.82 ? 253  TYR B CB    1 
ATOM   4462 C CG    . TYR B 1 253 ? 8.235   -30.314 77.937  1.00 16.47 ? 253  TYR B CG    1 
ATOM   4463 C CD1   . TYR B 1 253 ? 7.190   -29.395 78.014  1.00 16.39 ? 253  TYR B CD1   1 
ATOM   4464 C CD2   . TYR B 1 253 ? 9.169   -30.337 78.974  1.00 16.01 ? 253  TYR B CD2   1 
ATOM   4465 C CE1   . TYR B 1 253 ? 7.077   -28.515 79.102  1.00 16.78 ? 253  TYR B CE1   1 
ATOM   4466 C CE2   . TYR B 1 253 ? 9.067   -29.466 80.068  1.00 17.39 ? 253  TYR B CE2   1 
ATOM   4467 C CZ    . TYR B 1 253 ? 8.016   -28.558 80.124  1.00 16.47 ? 253  TYR B CZ    1 
ATOM   4468 O OH    . TYR B 1 253 ? 7.895   -27.708 81.205  1.00 15.42 ? 253  TYR B OH    1 
ATOM   4469 N N     . ARG B 1 254 ? 6.536   -33.150 79.043  1.00 20.64 ? 254  ARG B N     1 
ATOM   4470 C CA    . ARG B 1 254 ? 5.257   -33.269 79.728  1.00 24.08 ? 254  ARG B CA    1 
ATOM   4471 C C     . ARG B 1 254 ? 4.311   -34.264 79.065  1.00 25.45 ? 254  ARG B C     1 
ATOM   4472 O O     . ARG B 1 254 ? 3.092   -34.178 79.228  1.00 25.42 ? 254  ARG B O     1 
ATOM   4473 C CB    . ARG B 1 254 ? 4.571   -31.906 79.824  1.00 25.85 ? 254  ARG B CB    1 
ATOM   4474 C CG    . ARG B 1 254 ? 5.136   -30.996 80.900  1.00 28.97 ? 254  ARG B CG    1 
ATOM   4475 C CD    . ARG B 1 254 ? 4.153   -29.871 81.212  1.00 33.96 ? 254  ARG B CD    1 
ATOM   4476 N NE    . ARG B 1 254 ? 4.049   -29.622 82.646  1.00 40.31 ? 254  ARG B NE    1 
ATOM   4477 C CZ    . ARG B 1 254 ? 3.670   -30.531 83.542  1.00 42.72 ? 254  ARG B CZ    1 
ATOM   4478 N NH1   . ARG B 1 254 ? 3.349   -31.761 83.158  1.00 46.22 ? 254  ARG B NH1   1 
ATOM   4479 N NH2   . ARG B 1 254 ? 3.633   -30.217 84.829  1.00 45.91 ? 254  ARG B NH2   1 
ATOM   4480 N N     . LYS B 1 255 ? 4.866   -35.202 78.306  1.00 26.32 ? 255  LYS B N     1 
ATOM   4481 C CA    . LYS B 1 255 ? 4.037   -36.209 77.654  1.00 27.51 ? 255  LYS B CA    1 
ATOM   4482 C C     . LYS B 1 255 ? 4.199   -37.527 78.406  1.00 26.70 ? 255  LYS B C     1 
ATOM   4483 O O     . LYS B 1 255 ? 5.168   -37.713 79.137  1.00 24.38 ? 255  LYS B O     1 
ATOM   4484 C CB    . LYS B 1 255 ? 4.447   -36.386 76.187  1.00 27.78 ? 255  LYS B CB    1 
ATOM   4485 C CG    . LYS B 1 255 ? 4.529   -35.089 75.395  1.00 29.43 ? 255  LYS B CG    1 
ATOM   4486 C CD    . LYS B 1 255 ? 3.212   -34.320 75.401  1.00 31.02 ? 255  LYS B CD    1 
ATOM   4487 C CE    . LYS B 1 255 ? 2.168   -34.972 74.509  1.00 31.08 ? 255  LYS B CE    1 
ATOM   4488 N NZ    . LYS B 1 255 ? 2.581   -34.952 73.076  1.00 32.90 ? 255  LYS B NZ    1 
ATOM   4489 N N     . LYS B 1 256 ? 3.237   -38.427 78.238  1.00 27.85 ? 256  LYS B N     1 
ATOM   4490 C CA    . LYS B 1 256 ? 3.282   -39.724 78.898  1.00 28.98 ? 256  LYS B CA    1 
ATOM   4491 C C     . LYS B 1 256 ? 3.811   -40.758 77.925  1.00 28.04 ? 256  LYS B C     1 
ATOM   4492 O O     . LYS B 1 256 ? 4.344   -41.795 78.319  1.00 28.54 ? 256  LYS B O     1 
ATOM   4493 C CB    . LYS B 1 256 ? 1.884   -40.123 79.370  1.00 32.19 ? 256  LYS B CB    1 
ATOM   4494 C CG    . LYS B 1 256 ? 1.258   -39.139 80.332  1.00 37.33 ? 256  LYS B CG    1 
ATOM   4495 C CD    . LYS B 1 256 ? 2.053   -39.054 81.628  1.00 41.81 ? 256  LYS B CD    1 
ATOM   4496 C CE    . LYS B 1 256 ? 1.446   -38.024 82.569  1.00 44.90 ? 256  LYS B CE    1 
ATOM   4497 N NZ    . LYS B 1 256 ? 0.021   -38.344 82.880  1.00 46.67 ? 256  LYS B NZ    1 
ATOM   4498 N N     . LYS B 1 257 ? 3.655   -40.464 76.642  1.00 29.02 ? 257  LYS B N     1 
ATOM   4499 C CA    . LYS B 1 257 ? 4.113   -41.348 75.583  1.00 29.04 ? 257  LYS B CA    1 
ATOM   4500 C C     . LYS B 1 257 ? 4.587   -40.484 74.430  1.00 27.40 ? 257  LYS B C     1 
ATOM   4501 O O     . LYS B 1 257 ? 4.073   -39.385 74.231  1.00 24.62 ? 257  LYS B O     1 
ATOM   4502 C CB    . LYS B 1 257 ? 2.972   -42.247 75.111  1.00 31.39 ? 257  LYS B CB    1 
ATOM   4503 C CG    . LYS B 1 257 ? 2.479   -43.255 76.141  1.00 34.85 ? 257  LYS B CG    1 
ATOM   4504 C CD    . LYS B 1 257 ? 1.309   -44.052 75.582  1.00 36.70 ? 257  LYS B CD    1 
ATOM   4505 C CE    . LYS B 1 257 ? 0.786   -45.061 76.587  1.00 39.44 ? 257  LYS B CE    1 
ATOM   4506 N NZ    . LYS B 1 257 ? -0.393  -45.787 76.041  1.00 39.24 ? 257  LYS B NZ    1 
ATOM   4507 N N     . ASP B 1 258 ? 5.571   -40.969 73.680  1.00 26.85 ? 258  ASP B N     1 
ATOM   4508 C CA    . ASP B 1 258 ? 6.087   -40.220 72.548  1.00 26.23 ? 258  ASP B CA    1 
ATOM   4509 C C     . ASP B 1 258 ? 5.105   -40.481 71.412  1.00 28.28 ? 258  ASP B C     1 
ATOM   4510 O O     . ASP B 1 258 ? 4.101   -41.164 71.612  1.00 28.77 ? 258  ASP B O     1 
ATOM   4511 C CB    . ASP B 1 258 ? 7.516   -40.679 72.197  1.00 26.63 ? 258  ASP B CB    1 
ATOM   4512 C CG    . ASP B 1 258 ? 7.566   -42.063 71.542  1.00 27.47 ? 258  ASP B CG    1 
ATOM   4513 O OD1   . ASP B 1 258 ? 6.544   -42.783 71.516  1.00 28.06 ? 258  ASP B OD1   1 
ATOM   4514 O OD2   . ASP B 1 258 ? 8.651   -42.436 71.050  1.00 27.29 ? 258  ASP B OD2   1 
ATOM   4515 N N     . PRO B 1 259 ? 5.361   -39.931 70.216  1.00 29.35 ? 259  PRO B N     1 
ATOM   4516 C CA    . PRO B 1 259 ? 4.448   -40.146 69.087  1.00 31.48 ? 259  PRO B CA    1 
ATOM   4517 C C     . PRO B 1 259 ? 4.191   -41.610 68.716  1.00 32.95 ? 259  PRO B C     1 
ATOM   4518 O O     . PRO B 1 259 ? 3.142   -41.940 68.161  1.00 33.36 ? 259  PRO B O     1 
ATOM   4519 C CB    . PRO B 1 259 ? 5.123   -39.374 67.956  1.00 31.44 ? 259  PRO B CB    1 
ATOM   4520 C CG    . PRO B 1 259 ? 5.765   -38.223 68.688  1.00 29.12 ? 259  PRO B CG    1 
ATOM   4521 C CD    . PRO B 1 259 ? 6.389   -38.931 69.870  1.00 29.49 ? 259  PRO B CD    1 
ATOM   4522 N N     . ASN B 1 260 ? 5.136   -42.487 69.037  1.00 33.60 ? 260  ASN B N     1 
ATOM   4523 C CA    . ASN B 1 260 ? 5.002   -43.899 68.700  1.00 33.85 ? 260  ASN B CA    1 
ATOM   4524 C C     . ASN B 1 260 ? 4.345   -44.746 69.780  1.00 34.15 ? 260  ASN B C     1 
ATOM   4525 O O     . ASN B 1 260 ? 3.989   -45.898 69.539  1.00 35.91 ? 260  ASN B O     1 
ATOM   4526 C CB    . ASN B 1 260 ? 6.374   -44.484 68.375  1.00 34.78 ? 260  ASN B CB    1 
ATOM   4527 C CG    . ASN B 1 260 ? 7.077   -43.727 67.269  1.00 36.64 ? 260  ASN B CG    1 
ATOM   4528 O OD1   . ASN B 1 260 ? 6.524   -43.543 66.188  1.00 36.76 ? 260  ASN B OD1   1 
ATOM   4529 N ND2   . ASN B 1 260 ? 8.306   -43.286 67.534  1.00 37.43 ? 260  ASN B ND2   1 
ATOM   4530 N N     . GLY B 1 261 ? 4.184   -44.184 70.971  1.00 32.53 ? 261  GLY B N     1 
ATOM   4531 C CA    . GLY B 1 261 ? 3.580   -44.944 72.049  1.00 30.46 ? 261  GLY B CA    1 
ATOM   4532 C C     . GLY B 1 261 ? 4.602   -45.410 73.071  1.00 27.72 ? 261  GLY B C     1 
ATOM   4533 O O     . GLY B 1 261 ? 4.260   -46.093 74.030  1.00 30.33 ? 261  GLY B O     1 
ATOM   4534 N N     . ASN B 1 262 ? 5.863   -45.052 72.865  1.00 25.74 ? 262  ASN B N     1 
ATOM   4535 C CA    . ASN B 1 262 ? 6.907   -45.426 73.804  1.00 24.47 ? 262  ASN B CA    1 
ATOM   4536 C C     . ASN B 1 262 ? 6.707   -44.611 75.065  1.00 24.95 ? 262  ASN B C     1 
ATOM   4537 O O     . ASN B 1 262 ? 6.419   -43.410 75.000  1.00 24.89 ? 262  ASN B O     1 
ATOM   4538 C CB    . ASN B 1 262 ? 8.278   -45.125 73.220  1.00 25.04 ? 262  ASN B CB    1 
ATOM   4539 C CG    . ASN B 1 262 ? 8.541   -45.899 71.964  1.00 25.84 ? 262  ASN B CG    1 
ATOM   4540 O OD1   . ASN B 1 262 ? 8.866   -45.327 70.923  1.00 26.52 ? 262  ASN B OD1   1 
ATOM   4541 N ND2   . ASN B 1 262 ? 8.402   -47.217 72.048  1.00 25.77 ? 262  ASN B ND2   1 
ATOM   4542 N N     . LYS B 1 263 ? 6.868   -45.256 76.212  1.00 22.14 ? 263  LYS B N     1 
ATOM   4543 C CA    . LYS B 1 263 ? 6.679   -44.571 77.477  1.00 22.90 ? 263  LYS B CA    1 
ATOM   4544 C C     . LYS B 1 263 ? 7.681   -43.439 77.707  1.00 22.50 ? 263  LYS B C     1 
ATOM   4545 O O     . LYS B 1 263 ? 8.854   -43.537 77.337  1.00 21.87 ? 263  LYS B O     1 
ATOM   4546 C CB    . LYS B 1 263 ? 6.750   -45.564 78.640  1.00 21.48 ? 263  LYS B CB    1 
ATOM   4547 C CG    . LYS B 1 263 ? 6.540   -44.909 80.004  1.00 24.49 ? 263  LYS B CG    1 
ATOM   4548 C CD    . LYS B 1 263 ? 5.886   -45.859 81.003  1.00 27.55 ? 263  LYS B CD    1 
ATOM   4549 C CE    . LYS B 1 263 ? 6.797   -47.003 81.390  1.00 28.46 ? 263  LYS B CE    1 
ATOM   4550 N NZ    . LYS B 1 263 ? 6.079   -47.978 82.256  1.00 29.80 ? 263  LYS B NZ    1 
ATOM   4551 N N     . VAL B 1 264 ? 7.192   -42.365 78.320  1.00 20.59 ? 264  VAL B N     1 
ATOM   4552 C CA    . VAL B 1 264 ? 8.011   -41.207 78.642  1.00 19.30 ? 264  VAL B CA    1 
ATOM   4553 C C     . VAL B 1 264 ? 8.183   -41.161 80.156  1.00 19.90 ? 264  VAL B C     1 
ATOM   4554 O O     . VAL B 1 264 ? 7.205   -41.183 80.900  1.00 20.38 ? 264  VAL B O     1 
ATOM   4555 C CB    . VAL B 1 264 ? 7.337   -39.917 78.154  1.00 19.46 ? 264  VAL B CB    1 
ATOM   4556 C CG1   . VAL B 1 264 ? 8.123   -38.699 78.616  1.00 15.79 ? 264  VAL B CG1   1 
ATOM   4557 C CG2   . VAL B 1 264 ? 7.241   -39.948 76.625  1.00 18.36 ? 264  VAL B CG2   1 
ATOM   4558 N N     . ILE B 1 265 ? 9.435   -41.127 80.600  1.00 22.33 ? 265  ILE B N     1 
ATOM   4559 C CA    . ILE B 1 265 ? 9.759   -41.079 82.021  1.00 23.11 ? 265  ILE B CA    1 
ATOM   4560 C C     . ILE B 1 265 ? 9.966   -39.635 82.457  1.00 24.94 ? 265  ILE B C     1 
ATOM   4561 O O     . ILE B 1 265 ? 10.672  -38.875 81.787  1.00 24.54 ? 265  ILE B O     1 
ATOM   4562 C CB    . ILE B 1 265 ? 11.075  -41.819 82.338  1.00 24.06 ? 265  ILE B CB    1 
ATOM   4563 C CG1   . ILE B 1 265 ? 10.961  -43.301 82.011  1.00 26.74 ? 265  ILE B CG1   1 
ATOM   4564 C CG2   . ILE B 1 265 ? 11.409  -41.664 83.812  1.00 27.92 ? 265  ILE B CG2   1 
ATOM   4565 C CD1   . ILE B 1 265 ? 12.253  -44.061 82.297  1.00 26.50 ? 265  ILE B CD1   1 
ATOM   4566 N N     . ALA B 1 266 ? 9.351   -39.266 83.575  1.00 26.61 ? 266  ALA B N     1 
ATOM   4567 C CA    . ALA B 1 266 ? 9.493   -37.929 84.137  1.00 27.75 ? 266  ALA B CA    1 
ATOM   4568 C C     . ALA B 1 266 ? 10.650  -38.055 85.125  1.00 29.57 ? 266  ALA B C     1 
ATOM   4569 O O     . ALA B 1 266 ? 10.446  -38.274 86.318  1.00 30.15 ? 266  ALA B O     1 
ATOM   4570 C CB    . ALA B 1 266 ? 8.221   -37.526 84.858  1.00 26.67 ? 266  ALA B CB    1 
ATOM   4571 N N     . ASP B 1 267 ? 11.867  -37.917 84.613  1.00 32.07 ? 267  ASP B N     1 
ATOM   4572 C CA    . ASP B 1 267 ? 13.067  -38.062 85.425  1.00 34.84 ? 267  ASP B CA    1 
ATOM   4573 C C     . ASP B 1 267 ? 13.600  -36.805 86.101  1.00 36.25 ? 267  ASP B C     1 
ATOM   4574 O O     . ASP B 1 267 ? 13.517  -35.702 85.565  1.00 37.28 ? 267  ASP B O     1 
ATOM   4575 C CB    . ASP B 1 267 ? 14.178  -38.685 84.570  1.00 36.33 ? 267  ASP B CB    1 
ATOM   4576 C CG    . ASP B 1 267 ? 14.708  -39.976 85.156  1.00 37.19 ? 267  ASP B CG    1 
ATOM   4577 O OD1   . ASP B 1 267 ? 15.480  -40.676 84.466  1.00 37.53 ? 267  ASP B OD1   1 
ATOM   4578 O OD2   . ASP B 1 267 ? 14.350  -40.288 86.310  1.00 37.54 ? 267  ASP B OD2   1 
ATOM   4579 N N     . LYS B 1 268 ? 14.160  -36.996 87.289  1.00 37.34 ? 268  LYS B N     1 
ATOM   4580 C CA    . LYS B 1 268 ? 14.751  -35.912 88.062  1.00 39.38 ? 268  LYS B CA    1 
ATOM   4581 C C     . LYS B 1 268 ? 16.247  -36.142 88.067  1.00 40.09 ? 268  LYS B C     1 
ATOM   4582 O O     . LYS B 1 268 ? 16.767  -36.765 88.991  1.00 41.71 ? 268  LYS B O     1 
ATOM   4583 C CB    . LYS B 1 268 ? 14.256  -35.955 89.497  1.00 41.37 ? 268  LYS B CB    1 
ATOM   4584 C CG    . LYS B 1 268 ? 13.456  -34.768 89.869  1.00 44.63 ? 268  LYS B CG    1 
ATOM   4585 C CD    . LYS B 1 268 ? 12.119  -35.192 90.395  1.00 46.45 ? 268  LYS B CD    1 
ATOM   4586 C CE    . LYS B 1 268 ? 11.151  -34.077 90.112  1.00 48.40 ? 268  LYS B CE    1 
ATOM   4587 N NZ    . LYS B 1 268 ? 10.128  -33.932 91.178  1.00 50.15 ? 268  LYS B NZ    1 
ATOM   4588 N N     . ILE B 1 269 ? 16.940  -35.646 87.048  1.00 38.65 ? 269  ILE B N     1 
ATOM   4589 C CA    . ILE B 1 269 ? 18.381  -35.851 86.950  1.00 37.16 ? 269  ILE B CA    1 
ATOM   4590 C C     . ILE B 1 269 ? 19.204  -34.686 87.493  1.00 37.27 ? 269  ILE B C     1 
ATOM   4591 O O     . ILE B 1 269 ? 20.152  -34.883 88.252  1.00 37.23 ? 269  ILE B O     1 
ATOM   4592 C CB    . ILE B 1 269 ? 18.798  -36.110 85.476  1.00 36.48 ? 269  ILE B CB    1 
ATOM   4593 C CG1   . ILE B 1 269 ? 17.945  -37.240 84.892  1.00 37.68 ? 269  ILE B CG1   1 
ATOM   4594 C CG2   . ILE B 1 269 ? 20.280  -36.468 85.393  1.00 34.88 ? 269  ILE B CG2   1 
ATOM   4595 C CD1   . ILE B 1 269 ? 18.165  -37.481 83.406  1.00 35.73 ? 269  ILE B CD1   1 
ATOM   4596 N N     . ILE B 1 270 ? 18.838  -33.470 87.111  1.00 36.87 ? 270  ILE B N     1 
ATOM   4597 C CA    . ILE B 1 270 ? 19.586  -32.301 87.545  1.00 37.10 ? 270  ILE B CA    1 
ATOM   4598 C C     . ILE B 1 270 ? 19.015  -31.583 88.762  1.00 35.42 ? 270  ILE B C     1 
ATOM   4599 O O     . ILE B 1 270 ? 17.814  -31.619 89.026  1.00 32.66 ? 270  ILE B O     1 
ATOM   4600 C CB    . ILE B 1 270 ? 19.714  -31.276 86.402  1.00 38.09 ? 270  ILE B CB    1 
ATOM   4601 C CG1   . ILE B 1 270 ? 18.379  -30.569 86.182  1.00 40.44 ? 270  ILE B CG1   1 
ATOM   4602 C CG2   . ILE B 1 270 ? 20.132  -31.979 85.118  1.00 38.94 ? 270  ILE B CG2   1 
ATOM   4603 C CD1   . ILE B 1 270 ? 18.430  -29.515 85.092  1.00 43.83 ? 270  ILE B CD1   1 
ATOM   4604 N N     . GLY B 1 271 ? 19.904  -30.933 89.504  1.00 34.67 ? 271  GLY B N     1 
ATOM   4605 C CA    . GLY B 1 271 ? 19.483  -30.183 90.668  1.00 35.12 ? 271  GLY B CA    1 
ATOM   4606 C C     . GLY B 1 271 ? 19.427  -30.956 91.963  1.00 34.81 ? 271  GLY B C     1 
ATOM   4607 O O     . GLY B 1 271 ? 19.553  -32.186 91.988  1.00 33.90 ? 271  GLY B O     1 
ATOM   4608 N N     . SER B 1 272 ? 19.228  -30.208 93.044  1.00 34.85 ? 272  SER B N     1 
ATOM   4609 C CA    . SER B 1 272 ? 19.145  -30.756 94.392  1.00 33.32 ? 272  SER B CA    1 
ATOM   4610 C C     . SER B 1 272 ? 18.176  -29.894 95.189  1.00 33.44 ? 272  SER B C     1 
ATOM   4611 O O     . SER B 1 272 ? 17.647  -28.907 94.670  1.00 32.85 ? 272  SER B O     1 
ATOM   4612 C CB    . SER B 1 272 ? 20.523  -30.729 95.059  1.00 33.12 ? 272  SER B CB    1 
ATOM   4613 O OG    . SER B 1 272 ? 21.018  -29.401 95.159  1.00 33.00 ? 272  SER B OG    1 
ATOM   4614 N N     . GLY B 1 273 ? 17.954  -30.268 96.446  1.00 32.12 ? 273  GLY B N     1 
ATOM   4615 C CA    . GLY B 1 273 ? 17.054  -29.522 97.305  1.00 31.26 ? 273  GLY B CA    1 
ATOM   4616 C C     . GLY B 1 273 ? 15.797  -29.038 96.610  1.00 30.95 ? 273  GLY B C     1 
ATOM   4617 O O     . GLY B 1 273 ? 15.020  -29.835 96.095  1.00 30.43 ? 273  GLY B O     1 
ATOM   4618 N N     . LYS B 1 274 ? 15.610  -27.722 96.588  1.00 31.56 ? 274  LYS B N     1 
ATOM   4619 C CA    . LYS B 1 274 ? 14.435  -27.112 95.971  1.00 32.81 ? 274  LYS B CA    1 
ATOM   4620 C C     . LYS B 1 274 ? 14.656  -26.566 94.555  1.00 31.65 ? 274  LYS B C     1 
ATOM   4621 O O     . LYS B 1 274 ? 13.921  -25.688 94.103  1.00 30.68 ? 274  LYS B O     1 
ATOM   4622 C CB    . LYS B 1 274 ? 13.909  -25.990 96.880  1.00 34.69 ? 274  LYS B CB    1 
ATOM   4623 C CG    . LYS B 1 274 ? 12.864  -26.437 97.899  1.00 36.60 ? 274  LYS B CG    1 
ATOM   4624 C CD    . LYS B 1 274 ? 13.257  -27.725 98.591  1.00 39.61 ? 274  LYS B CD    1 
ATOM   4625 C CE    . LYS B 1 274 ? 12.101  -28.303 99.407  1.00 41.20 ? 274  LYS B CE    1 
ATOM   4626 N NZ    . LYS B 1 274 ? 11.684  -27.411 100.528 1.00 42.81 ? 274  LYS B NZ    1 
ATOM   4627 N N     . ASN B 1 275 ? 15.652  -27.091 93.851  1.00 30.99 ? 275  ASN B N     1 
ATOM   4628 C CA    . ASN B 1 275 ? 15.938  -26.622 92.500  1.00 29.74 ? 275  ASN B CA    1 
ATOM   4629 C C     . ASN B 1 275 ? 15.963  -27.750 91.465  1.00 29.02 ? 275  ASN B C     1 
ATOM   4630 O O     . ASN B 1 275 ? 16.401  -27.549 90.333  1.00 26.53 ? 275  ASN B O     1 
ATOM   4631 C CB    . ASN B 1 275 ? 17.269  -25.853 92.485  1.00 30.72 ? 275  ASN B CB    1 
ATOM   4632 C CG    . ASN B 1 275 ? 18.447  -26.710 92.906  1.00 31.03 ? 275  ASN B CG    1 
ATOM   4633 O OD1   . ASN B 1 275 ? 18.888  -27.586 92.167  1.00 33.39 ? 275  ASN B OD1   1 
ATOM   4634 N ND2   . ASN B 1 275 ? 18.954  -26.469 94.106  1.00 32.27 ? 275  ASN B ND2   1 
ATOM   4635 N N     . LYS B 1 276 ? 15.486  -28.930 91.857  1.00 27.83 ? 276  LYS B N     1 
ATOM   4636 C CA    . LYS B 1 276 ? 15.445  -30.078 90.954  1.00 28.45 ? 276  LYS B CA    1 
ATOM   4637 C C     . LYS B 1 276 ? 14.537  -29.765 89.764  1.00 28.32 ? 276  LYS B C     1 
ATOM   4638 O O     . LYS B 1 276 ? 13.505  -29.109 89.925  1.00 28.71 ? 276  LYS B O     1 
ATOM   4639 C CB    . LYS B 1 276 ? 14.894  -31.304 91.684  1.00 30.14 ? 276  LYS B CB    1 
ATOM   4640 C CG    . LYS B 1 276 ? 15.657  -31.721 92.935  1.00 33.95 ? 276  LYS B CG    1 
ATOM   4641 C CD    . LYS B 1 276 ? 14.799  -32.659 93.787  1.00 36.71 ? 276  LYS B CD    1 
ATOM   4642 C CE    . LYS B 1 276 ? 15.475  -33.046 95.093  1.00 37.97 ? 276  LYS B CE    1 
ATOM   4643 N NZ    . LYS B 1 276 ? 16.606  -33.982 94.864  1.00 42.18 ? 276  LYS B NZ    1 
ATOM   4644 N N     . ARG B 1 277 ? 14.920  -30.232 88.577  1.00 26.54 ? 277  ARG B N     1 
ATOM   4645 C CA    . ARG B 1 277 ? 14.131  -30.014 87.361  1.00 25.22 ? 277  ARG B CA    1 
ATOM   4646 C C     . ARG B 1 277 ? 13.721  -31.381 86.821  1.00 24.44 ? 277  ARG B C     1 
ATOM   4647 O O     . ARG B 1 277 ? 14.383  -32.376 87.091  1.00 25.13 ? 277  ARG B O     1 
ATOM   4648 C CB    . ARG B 1 277 ? 14.959  -29.283 86.290  1.00 26.58 ? 277  ARG B CB    1 
ATOM   4649 C CG    . ARG B 1 277 ? 15.585  -27.958 86.731  1.00 27.83 ? 277  ARG B CG    1 
ATOM   4650 C CD    . ARG B 1 277 ? 14.534  -26.947 87.161  1.00 25.06 ? 277  ARG B CD    1 
ATOM   4651 N NE    . ARG B 1 277 ? 13.757  -26.425 86.039  1.00 25.78 ? 277  ARG B NE    1 
ATOM   4652 C CZ    . ARG B 1 277 ? 14.231  -25.566 85.143  1.00 24.83 ? 277  ARG B CZ    1 
ATOM   4653 N NH1   . ARG B 1 277 ? 15.483  -25.136 85.237  1.00 26.05 ? 277  ARG B NH1   1 
ATOM   4654 N NH2   . ARG B 1 277 ? 13.454  -25.125 84.165  1.00 22.35 ? 277  ARG B NH2   1 
ATOM   4655 N N     . THR B 1 278 ? 12.636  -31.429 86.059  1.00 22.81 ? 278  THR B N     1 
ATOM   4656 C CA    . THR B 1 278 ? 12.169  -32.686 85.496  1.00 22.88 ? 278  THR B CA    1 
ATOM   4657 C C     . THR B 1 278 ? 12.571  -32.861 84.034  1.00 22.28 ? 278  THR B C     1 
ATOM   4658 O O     . THR B 1 278 ? 12.261  -32.018 83.190  1.00 22.04 ? 278  THR B O     1 
ATOM   4659 C CB    . THR B 1 278 ? 10.638  -32.798 85.582  1.00 22.59 ? 278  THR B CB    1 
ATOM   4660 O OG1   . THR B 1 278 ? 10.239  -32.727 86.952  1.00 26.20 ? 278  THR B OG1   1 
ATOM   4661 C CG2   . THR B 1 278 ? 10.161  -34.125 84.986  1.00 23.38 ? 278  THR B CG2   1 
ATOM   4662 N N     . THR B 1 279 ? 13.254  -33.961 83.740  1.00 20.55 ? 279  THR B N     1 
ATOM   4663 C CA    . THR B 1 279 ? 13.673  -34.253 82.381  1.00 20.46 ? 279  THR B CA    1 
ATOM   4664 C C     . THR B 1 279 ? 12.804  -35.375 81.819  1.00 20.32 ? 279  THR B C     1 
ATOM   4665 O O     . THR B 1 279 ? 12.792  -36.485 82.344  1.00 20.47 ? 279  THR B O     1 
ATOM   4666 C CB    . THR B 1 279 ? 15.142  -34.705 82.328  1.00 21.94 ? 279  THR B CB    1 
ATOM   4667 O OG1   . THR B 1 279 ? 15.964  -33.746 83.007  1.00 24.12 ? 279  THR B OG1   1 
ATOM   4668 C CG2   . THR B 1 279 ? 15.613  -34.823 80.879  1.00 19.35 ? 279  THR B CG2   1 
ATOM   4669 N N     . TYR B 1 280 ? 12.066  -35.082 80.756  1.00 18.60 ? 280  TYR B N     1 
ATOM   4670 C CA    . TYR B 1 280 ? 11.220  -36.095 80.137  1.00 17.27 ? 280  TYR B CA    1 
ATOM   4671 C C     . TYR B 1 280 ? 12.003  -36.741 79.010  1.00 17.73 ? 280  TYR B C     1 
ATOM   4672 O O     . TYR B 1 280 ? 12.635  -36.047 78.213  1.00 16.94 ? 280  TYR B O     1 
ATOM   4673 C CB    . TYR B 1 280 ? 9.945   -35.465 79.578  1.00 14.35 ? 280  TYR B CB    1 
ATOM   4674 C CG    . TYR B 1 280 ? 9.043   -34.897 80.642  1.00 14.39 ? 280  TYR B CG    1 
ATOM   4675 C CD1   . TYR B 1 280 ? 8.090   -35.693 81.272  1.00 13.66 ? 280  TYR B CD1   1 
ATOM   4676 C CD2   . TYR B 1 280 ? 9.170   -33.570 81.050  1.00 12.97 ? 280  TYR B CD2   1 
ATOM   4677 C CE1   . TYR B 1 280 ? 7.285   -35.181 82.288  1.00 15.93 ? 280  TYR B CE1   1 
ATOM   4678 C CE2   . TYR B 1 280 ? 8.374   -33.046 82.063  1.00 13.07 ? 280  TYR B CE2   1 
ATOM   4679 C CZ    . TYR B 1 280 ? 7.435   -33.853 82.680  1.00 16.50 ? 280  TYR B CZ    1 
ATOM   4680 O OH    . TYR B 1 280 ? 6.653   -33.340 83.694  1.00 19.69 ? 280  TYR B OH    1 
ATOM   4681 N N     . TRP B 1 281 ? 11.973  -38.068 78.949  1.00 17.37 ? 281  TRP B N     1 
ATOM   4682 C CA    . TRP B 1 281 ? 12.682  -38.778 77.894  1.00 17.50 ? 281  TRP B CA    1 
ATOM   4683 C C     . TRP B 1 281 ? 12.081  -40.161 77.638  1.00 19.48 ? 281  TRP B C     1 
ATOM   4684 O O     . TRP B 1 281 ? 11.415  -40.734 78.504  1.00 19.33 ? 281  TRP B O     1 
ATOM   4685 C CB    . TRP B 1 281 ? 14.182  -38.888 78.230  1.00 15.70 ? 281  TRP B CB    1 
ATOM   4686 C CG    . TRP B 1 281 ? 14.512  -39.725 79.438  1.00 16.81 ? 281  TRP B CG    1 
ATOM   4687 C CD1   . TRP B 1 281 ? 14.147  -39.485 80.729  1.00 14.47 ? 281  TRP B CD1   1 
ATOM   4688 C CD2   . TRP B 1 281 ? 15.260  -40.955 79.454  1.00 15.41 ? 281  TRP B CD2   1 
ATOM   4689 N NE1   . TRP B 1 281 ? 14.614  -40.488 81.548  1.00 17.28 ? 281  TRP B NE1   1 
ATOM   4690 C CE2   . TRP B 1 281 ? 15.300  -41.402 80.794  1.00 16.51 ? 281  TRP B CE2   1 
ATOM   4691 C CE3   . TRP B 1 281 ? 15.899  -41.716 78.467  1.00 14.88 ? 281  TRP B CE3   1 
ATOM   4692 C CZ2   . TRP B 1 281 ? 15.956  -42.585 81.176  1.00 18.33 ? 281  TRP B CZ2   1 
ATOM   4693 C CZ3   . TRP B 1 281 ? 16.558  -42.900 78.846  1.00 17.31 ? 281  TRP B CZ3   1 
ATOM   4694 C CH2   . TRP B 1 281 ? 16.578  -43.318 80.189  1.00 17.67 ? 281  TRP B CH2   1 
ATOM   4695 N N     . ALA B 1 282 ? 12.309  -40.685 76.435  1.00 19.24 ? 282  ALA B N     1 
ATOM   4696 C CA    . ALA B 1 282 ? 11.790  -41.993 76.065  1.00 19.23 ? 282  ALA B CA    1 
ATOM   4697 C C     . ALA B 1 282 ? 12.909  -43.039 75.994  1.00 19.24 ? 282  ALA B C     1 
ATOM   4698 O O     . ALA B 1 282 ? 13.667  -43.097 75.029  1.00 17.37 ? 282  ALA B O     1 
ATOM   4699 C CB    . ALA B 1 282 ? 11.063  -41.901 74.730  1.00 15.80 ? 282  ALA B CB    1 
ATOM   4700 N N     . PRO B 1 283 ? 13.025  -43.872 77.037  1.00 20.53 ? 283  PRO B N     1 
ATOM   4701 C CA    . PRO B 1 283 ? 14.030  -44.933 77.147  1.00 21.84 ? 283  PRO B CA    1 
ATOM   4702 C C     . PRO B 1 283 ? 14.152  -45.807 75.906  1.00 22.13 ? 283  PRO B C     1 
ATOM   4703 O O     . PRO B 1 283 ? 15.253  -46.181 75.517  1.00 24.76 ? 283  PRO B O     1 
ATOM   4704 C CB    . PRO B 1 283 ? 13.559  -45.721 78.364  1.00 20.77 ? 283  PRO B CB    1 
ATOM   4705 C CG    . PRO B 1 283 ? 13.038  -44.642 79.237  1.00 23.47 ? 283  PRO B CG    1 
ATOM   4706 C CD    . PRO B 1 283 ? 12.252  -43.758 78.287  1.00 20.16 ? 283  PRO B CD    1 
ATOM   4707 N N     . ALA B 1 284 ? 13.028  -46.131 75.282  1.00 22.38 ? 284  ALA B N     1 
ATOM   4708 C CA    . ALA B 1 284 ? 13.056  -46.969 74.085  1.00 25.11 ? 284  ALA B CA    1 
ATOM   4709 C C     . ALA B 1 284 ? 13.822  -46.321 72.927  1.00 26.40 ? 284  ALA B C     1 
ATOM   4710 O O     . ALA B 1 284 ? 14.499  -47.011 72.165  1.00 28.37 ? 284  ALA B O     1 
ATOM   4711 C CB    . ALA B 1 284 ? 11.626  -47.306 73.649  1.00 23.65 ? 284  ALA B CB    1 
ATOM   4712 N N     . ILE B 1 285 ? 13.721  -44.999 72.799  1.00 27.43 ? 285  ILE B N     1 
ATOM   4713 C CA    . ILE B 1 285 ? 14.402  -44.277 71.724  1.00 28.29 ? 285  ILE B CA    1 
ATOM   4714 C C     . ILE B 1 285 ? 15.789  -43.812 72.133  1.00 29.76 ? 285  ILE B C     1 
ATOM   4715 O O     . ILE B 1 285 ? 16.749  -43.947 71.379  1.00 29.00 ? 285  ILE B O     1 
ATOM   4716 C CB    . ILE B 1 285 ? 13.593  -43.031 71.273  1.00 30.00 ? 285  ILE B CB    1 
ATOM   4717 C CG1   . ILE B 1 285 ? 12.281  -43.462 70.611  1.00 31.27 ? 285  ILE B CG1   1 
ATOM   4718 C CG2   . ILE B 1 285 ? 14.411  -42.192 70.292  1.00 28.42 ? 285  ILE B CG2   1 
ATOM   4719 C CD1   . ILE B 1 285 ? 11.209  -43.858 71.578  1.00 33.52 ? 285  ILE B CD1   1 
ATOM   4720 N N     . GLN B 1 286 ? 15.886  -43.258 73.334  1.00 32.66 ? 286  GLN B N     1 
ATOM   4721 C CA    . GLN B 1 286 ? 17.149  -42.760 73.848  1.00 35.38 ? 286  GLN B CA    1 
ATOM   4722 C C     . GLN B 1 286 ? 17.813  -43.859 74.684  1.00 40.33 ? 286  GLN B C     1 
ATOM   4723 O O     . GLN B 1 286 ? 17.672  -43.899 75.902  1.00 42.38 ? 286  GLN B O     1 
ATOM   4724 C CB    . GLN B 1 286 ? 16.878  -41.503 74.688  1.00 30.41 ? 286  GLN B CB    1 
ATOM   4725 C CG    . GLN B 1 286 ? 16.039  -40.457 73.944  1.00 25.76 ? 286  GLN B CG    1 
ATOM   4726 C CD    . GLN B 1 286 ? 15.508  -39.350 74.845  1.00 23.22 ? 286  GLN B CD    1 
ATOM   4727 O OE1   . GLN B 1 286 ? 14.302  -39.241 75.078  1.00 20.73 ? 286  GLN B OE1   1 
ATOM   4728 N NE2   . GLN B 1 286 ? 16.408  -38.527 75.355  1.00 19.13 ? 286  GLN B NE2   1 
ATOM   4729 N N     . LYS B 1 287 ? 18.526  -44.758 74.015  1.00 47.26 ? 287  LYS B N     1 
ATOM   4730 C CA    . LYS B 1 287 ? 19.202  -45.869 74.690  1.00 54.12 ? 287  LYS B CA    1 
ATOM   4731 C C     . LYS B 1 287 ? 20.674  -45.607 75.002  1.00 57.90 ? 287  LYS B C     1 
ATOM   4732 O O     . LYS B 1 287 ? 21.201  -44.530 74.730  1.00 59.10 ? 287  LYS B O     1 
ATOM   4733 C CB    . LYS B 1 287 ? 19.110  -47.144 73.846  1.00 53.64 ? 287  LYS B CB    1 
ATOM   4734 C CG    . LYS B 1 287 ? 17.783  -47.862 73.913  1.00 54.92 ? 287  LYS B CG    1 
ATOM   4735 C CD    . LYS B 1 287 ? 17.917  -49.288 73.390  1.00 56.89 ? 287  LYS B CD    1 
ATOM   4736 C CE    . LYS B 1 287 ? 18.953  -50.089 74.189  1.00 58.13 ? 287  LYS B CE    1 
ATOM   4737 N NZ    . LYS B 1 287 ? 18.634  -50.192 75.649  1.00 57.33 ? 287  LYS B NZ    1 
ATOM   4738 N N     . LEU B 1 288 ? 21.329  -46.615 75.572  1.00 62.34 ? 288  LEU B N     1 
ATOM   4739 C CA    . LEU B 1 288 ? 22.744  -46.531 75.919  1.00 65.57 ? 288  LEU B CA    1 
ATOM   4740 C C     . LEU B 1 288 ? 23.081  -45.335 76.799  1.00 67.16 ? 288  LEU B C     1 
ATOM   4741 O O     . LEU B 1 288 ? 23.758  -44.400 76.364  1.00 67.21 ? 288  LEU B O     1 
ATOM   4742 C CB    . LEU B 1 288 ? 23.594  -46.496 74.644  1.00 66.25 ? 288  LEU B CB    1 
ATOM   4743 C CG    . LEU B 1 288 ? 23.910  -47.843 73.981  1.00 67.28 ? 288  LEU B CG    1 
ATOM   4744 C CD1   . LEU B 1 288 ? 24.924  -48.590 74.839  1.00 66.87 ? 288  LEU B CD1   1 
ATOM   4745 C CD2   . LEU B 1 288 ? 22.638  -48.666 73.791  1.00 65.74 ? 288  LEU B CD2   1 
ATOM   4746 N N     . GLU B 1 289 ? 22.606  -45.388 78.041  1.00 68.80 ? 289  GLU B N     1 
ATOM   4747 C CA    . GLU B 1 289 ? 22.833  -44.338 79.030  1.00 70.59 ? 289  GLU B CA    1 
ATOM   4748 C C     . GLU B 1 289 ? 24.311  -44.042 79.244  1.00 70.82 ? 289  GLU B C     1 
ATOM   4749 C CB    . GLU B 1 289 ? 22.180  -44.735 80.361  1.00 72.49 ? 289  GLU B CB    1 
ATOM   4750 C CG    . GLU B 1 289 ? 22.257  -46.229 80.683  1.00 74.20 ? 289  GLU B CG    1 
ATOM   4751 C CD    . GLU B 1 289 ? 21.214  -46.671 81.704  1.00 74.82 ? 289  GLU B CD    1 
ATOM   4752 O OE1   . GLU B 1 289 ? 21.332  -46.296 82.892  1.00 75.96 ? 289  GLU B OE1   1 
ATOM   4753 O OE2   . GLU B 1 289 ? 20.268  -47.390 81.313  1.00 74.16 ? 289  GLU B OE2   1 
ATOM   4754 O OXT   . GLU B 1 289 ? 25.017  -44.980 79.664  1.00 73.31 ? 289  GLU B OXT   1 
ATOM   4755 O "O5'" . DG  C 2 1   ? 0.232   19.122  51.733  1.00 69.21 ? 1    DG  C "O5'" 1 
ATOM   4756 C "C5'" . DG  C 2 1   ? -0.284  20.159  52.574  1.00 66.83 ? 1    DG  C "C5'" 1 
ATOM   4757 C "C4'" . DG  C 2 1   ? 0.393   20.154  53.924  1.00 65.08 ? 1    DG  C "C4'" 1 
ATOM   4758 O "O4'" . DG  C 2 1   ? -0.109  19.038  54.707  1.00 63.04 ? 1    DG  C "O4'" 1 
ATOM   4759 C "C3'" . DG  C 2 1   ? 1.908   19.963  53.820  1.00 64.78 ? 1    DG  C "C3'" 1 
ATOM   4760 O "O3'" . DG  C 2 1   ? 2.631   20.819  54.705  1.00 63.97 ? 1    DG  C "O3'" 1 
ATOM   4761 C "C2'" . DG  C 2 1   ? 2.116   18.521  54.229  1.00 64.09 ? 1    DG  C "C2'" 1 
ATOM   4762 C "C1'" . DG  C 2 1   ? 0.983   18.292  55.210  1.00 62.50 ? 1    DG  C "C1'" 1 
ATOM   4763 N N9    . DG  C 2 1   ? 0.610   16.886  55.270  1.00 59.85 ? 1    DG  C N9    1 
ATOM   4764 C C8    . DG  C 2 1   ? 0.362   16.052  54.206  1.00 59.52 ? 1    DG  C C8    1 
ATOM   4765 N N7    . DG  C 2 1   ? 0.197   14.808  54.560  1.00 59.25 ? 1    DG  C N7    1 
ATOM   4766 C C5    . DG  C 2 1   ? 0.311   14.825  55.943  1.00 57.93 ? 1    DG  C C5    1 
ATOM   4767 C C6    . DG  C 2 1   ? 0.256   13.765  56.881  1.00 57.84 ? 1    DG  C C6    1 
ATOM   4768 O O6    . DG  C 2 1   ? 0.111   12.554  56.667  1.00 58.55 ? 1    DG  C O6    1 
ATOM   4769 N N1    . DG  C 2 1   ? 0.403   14.226  58.185  1.00 57.19 ? 1    DG  C N1    1 
ATOM   4770 C C2    . DG  C 2 1   ? 0.596   15.538  58.540  1.00 57.64 ? 1    DG  C C2    1 
ATOM   4771 N N2    . DG  C 2 1   ? 0.711   15.783  59.851  1.00 57.11 ? 1    DG  C N2    1 
ATOM   4772 N N3    . DG  C 2 1   ? 0.671   16.535  57.673  1.00 57.99 ? 1    DG  C N3    1 
ATOM   4773 C C4    . DG  C 2 1   ? 0.524   16.107  56.399  1.00 58.86 ? 1    DG  C C4    1 
ATOM   4774 P P     . DT  C 2 2   ? 4.230   20.672  54.806  1.00 63.14 ? 2    DT  C P     1 
ATOM   4775 O OP1   . DT  C 2 2   ? 4.796   21.995  55.165  1.00 63.38 ? 2    DT  C OP1   1 
ATOM   4776 O OP2   . DT  C 2 2   ? 4.716   19.974  53.591  1.00 63.17 ? 2    DT  C OP2   1 
ATOM   4777 O "O5'" . DT  C 2 2   ? 4.422   19.688  56.042  1.00 62.41 ? 2    DT  C "O5'" 1 
ATOM   4778 C "C5'" . DT  C 2 2   ? 4.048   20.091  57.357  1.00 60.17 ? 2    DT  C "C5'" 1 
ATOM   4779 C "C4'" . DT  C 2 2   ? 4.738   19.212  58.369  1.00 59.24 ? 2    DT  C "C4'" 1 
ATOM   4780 O "O4'" . DT  C 2 2   ? 4.021   17.953  58.448  1.00 59.10 ? 2    DT  C "O4'" 1 
ATOM   4781 C "C3'" . DT  C 2 2   ? 6.160   18.882  57.917  1.00 58.87 ? 2    DT  C "C3'" 1 
ATOM   4782 O "O3'" . DT  C 2 2   ? 7.152   19.042  58.916  1.00 58.08 ? 2    DT  C "O3'" 1 
ATOM   4783 C "C2'" . DT  C 2 2   ? 6.105   17.421  57.527  1.00 59.66 ? 2    DT  C "C2'" 1 
ATOM   4784 C "C1'" . DT  C 2 2   ? 4.917   16.868  58.286  1.00 58.95 ? 2    DT  C "C1'" 1 
ATOM   4785 N N1    . DT  C 2 2   ? 4.278   15.851  57.442  1.00 57.46 ? 2    DT  C N1    1 
ATOM   4786 C C2    . DT  C 2 2   ? 3.901   14.647  57.983  1.00 56.37 ? 2    DT  C C2    1 
ATOM   4787 O O2    . DT  C 2 2   ? 3.932   14.413  59.177  1.00 57.09 ? 2    DT  C O2    1 
ATOM   4788 N N3    . DT  C 2 2   ? 3.476   13.721  57.062  1.00 56.60 ? 2    DT  C N3    1 
ATOM   4789 C C4    . DT  C 2 2   ? 3.373   13.892  55.692  1.00 56.78 ? 2    DT  C C4    1 
ATOM   4790 O O4    . DT  C 2 2   ? 3.020   12.954  54.981  1.00 57.38 ? 2    DT  C O4    1 
ATOM   4791 C C5    . DT  C 2 2   ? 3.715   15.210  55.210  1.00 56.57 ? 2    DT  C C5    1 
ATOM   4792 C C7    . DT  C 2 2   ? 3.595   15.511  53.750  1.00 56.31 ? 2    DT  C C7    1 
ATOM   4793 C C6    . DT  C 2 2   ? 4.133   16.109  56.099  1.00 56.85 ? 2    DT  C C6    1 
ATOM   4794 P P     . DA  C 2 3   ? 8.620   18.449  58.645  1.00 56.10 ? 3    DA  C P     1 
ATOM   4795 O OP1   . DA  C 2 3   ? 9.598   19.300  59.366  1.00 59.04 ? 3    DA  C OP1   1 
ATOM   4796 O OP2   . DA  C 2 3   ? 8.782   18.228  57.186  1.00 56.28 ? 3    DA  C OP2   1 
ATOM   4797 O "O5'" . DA  C 2 3   ? 8.555   17.025  59.351  1.00 54.43 ? 3    DA  C "O5'" 1 
ATOM   4798 C "C5'" . DA  C 2 3   ? 8.248   16.919  60.739  1.00 50.85 ? 3    DA  C "C5'" 1 
ATOM   4799 C "C4'" . DA  C 2 3   ? 8.760   15.605  61.271  1.00 48.69 ? 3    DA  C "C4'" 1 
ATOM   4800 O "O4'" . DA  C 2 3   ? 7.804   14.570  60.929  1.00 48.02 ? 3    DA  C "O4'" 1 
ATOM   4801 C "C3'" . DA  C 2 3   ? 10.079  15.225  60.602  1.00 48.65 ? 3    DA  C "C3'" 1 
ATOM   4802 O "O3'" . DA  C 2 3   ? 11.108  14.845  61.494  1.00 48.18 ? 3    DA  C "O3'" 1 
ATOM   4803 C "C2'" . DA  C 2 3   ? 9.743   14.049  59.711  1.00 48.59 ? 3    DA  C "C2'" 1 
ATOM   4804 C "C1'" . DA  C 2 3   ? 8.428   13.507  60.230  1.00 47.54 ? 3    DA  C "C1'" 1 
ATOM   4805 N N9    . DA  C 2 3   ? 7.615   13.191  59.060  1.00 45.88 ? 3    DA  C N9    1 
ATOM   4806 C C8    . DA  C 2 3   ? 7.186   14.084  58.112  1.00 45.05 ? 3    DA  C C8    1 
ATOM   4807 N N7    . DA  C 2 3   ? 6.627   13.521  57.072  1.00 46.43 ? 3    DA  C N7    1 
ATOM   4808 C C5    . DA  C 2 3   ? 6.654   12.168  57.372  1.00 45.13 ? 3    DA  C C5    1 
ATOM   4809 C C6    . DA  C 2 3   ? 6.242   11.036  56.655  1.00 44.79 ? 3    DA  C C6    1 
ATOM   4810 N N6    . DA  C 2 3   ? 5.720   11.090  55.429  1.00 46.01 ? 3    DA  C N6    1 
ATOM   4811 N N1    . DA  C 2 3   ? 6.397   9.830   57.242  1.00 44.49 ? 3    DA  C N1    1 
ATOM   4812 C C2    . DA  C 2 3   ? 6.943   9.777   58.463  1.00 42.66 ? 3    DA  C C2    1 
ATOM   4813 N N3    . DA  C 2 3   ? 7.387   10.769  59.230  1.00 44.15 ? 3    DA  C N3    1 
ATOM   4814 C C4    . DA  C 2 3   ? 7.217   11.952  58.618  1.00 45.28 ? 3    DA  C C4    1 
ATOM   4815 P P     . DG  C 2 4   ? 12.465  14.250  60.886  1.00 47.88 ? 4    DG  C P     1 
ATOM   4816 O OP1   . DG  C 2 4   ? 13.585  14.614  61.793  1.00 48.59 ? 4    DG  C OP1   1 
ATOM   4817 O OP2   . DG  C 2 4   ? 12.533  14.628  59.451  1.00 45.38 ? 4    DG  C OP2   1 
ATOM   4818 O "O5'" . DG  C 2 4   ? 12.202  12.685  60.979  1.00 46.66 ? 4    DG  C "O5'" 1 
ATOM   4819 C "C5'" . DG  C 2 4   ? 11.538  12.142  62.116  1.00 47.51 ? 4    DG  C "C5'" 1 
ATOM   4820 C "C4'" . DG  C 2 4   ? 11.604  10.636  62.079  1.00 48.99 ? 4    DG  C "C4'" 1 
ATOM   4821 O "O4'" . DG  C 2 4   ? 10.614  10.147  61.136  1.00 46.84 ? 4    DG  C "O4'" 1 
ATOM   4822 C "C3'" . DG  C 2 4   ? 12.965  10.148  61.587  1.00 49.79 ? 4    DG  C "C3'" 1 
ATOM   4823 O "O3'" . DG  C 2 4   ? 13.523  9.109   62.378  1.00 53.14 ? 4    DG  C "O3'" 1 
ATOM   4824 C "C2'" . DG  C 2 4   ? 12.702  9.635   60.188  1.00 48.77 ? 4    DG  C "C2'" 1 
ATOM   4825 C "C1'" . DG  C 2 4   ? 11.221  9.301   60.173  1.00 47.02 ? 4    DG  C "C1'" 1 
ATOM   4826 N N9    . DG  C 2 4   ? 10.690  9.635   58.859  1.00 44.45 ? 4    DG  C N9    1 
ATOM   4827 C C8    . DG  C 2 4   ? 10.732  10.868  58.248  1.00 43.93 ? 4    DG  C C8    1 
ATOM   4828 N N7    . DG  C 2 4   ? 10.345  10.837  57.004  1.00 43.08 ? 4    DG  C N7    1 
ATOM   4829 C C5    . DG  C 2 4   ? 9.990   9.511   56.787  1.00 42.09 ? 4    DG  C C5    1 
ATOM   4830 C C6    . DG  C 2 4   ? 9.527   8.869   55.617  1.00 42.21 ? 4    DG  C C6    1 
ATOM   4831 O O6    . DG  C 2 4   ? 9.363   9.346   54.487  1.00 44.52 ? 4    DG  C O6    1 
ATOM   4832 N N1    . DG  C 2 4   ? 9.258   7.525   55.846  1.00 40.07 ? 4    DG  C N1    1 
ATOM   4833 C C2    . DG  C 2 4   ? 9.425   6.879   57.042  1.00 40.04 ? 4    DG  C C2    1 
ATOM   4834 N N2    . DG  C 2 4   ? 9.084   5.579   57.062  1.00 38.28 ? 4    DG  C N2    1 
ATOM   4835 N N3    . DG  C 2 4   ? 9.886   7.460   58.137  1.00 40.06 ? 4    DG  C N3    1 
ATOM   4836 C C4    . DG  C 2 4   ? 10.148  8.771   57.938  1.00 42.40 ? 4    DG  C C4    1 
ATOM   4837 P P     . DA  C 2 5   ? 14.919  8.455   61.922  1.00 55.21 ? 5    DA  C P     1 
ATOM   4838 O OP1   . DA  C 2 5   ? 15.651  8.005   63.135  1.00 55.62 ? 5    DA  C OP1   1 
ATOM   4839 O OP2   . DA  C 2 5   ? 15.576  9.389   60.971  1.00 53.76 ? 5    DA  C OP2   1 
ATOM   4840 O "O5'" . DA  C 2 5   ? 14.448  7.179   61.104  1.00 52.71 ? 5    DA  C "O5'" 1 
ATOM   4841 C "C5'" . DA  C 2 5   ? 13.362  6.388   61.574  1.00 51.60 ? 5    DA  C "C5'" 1 
ATOM   4842 C "C4'" . DA  C 2 5   ? 13.293  5.110   60.781  1.00 49.82 ? 5    DA  C "C4'" 1 
ATOM   4843 O "O4'" . DA  C 2 5   ? 12.591  5.350   59.534  1.00 48.71 ? 5    DA  C "O4'" 1 
ATOM   4844 C "C3'" . DA  C 2 5   ? 14.694  4.636   60.412  1.00 48.46 ? 5    DA  C "C3'" 1 
ATOM   4845 O "O3'" . DA  C 2 5   ? 14.878  3.251   60.650  1.00 49.28 ? 5    DA  C "O3'" 1 
ATOM   4846 C "C2'" . DA  C 2 5   ? 14.819  4.953   58.936  1.00 48.72 ? 5    DA  C "C2'" 1 
ATOM   4847 C "C1'" . DA  C 2 5   ? 13.384  4.932   58.437  1.00 46.77 ? 5    DA  C "C1'" 1 
ATOM   4848 N N9    . DA  C 2 5   ? 13.192  5.886   57.344  1.00 43.52 ? 5    DA  C N9    1 
ATOM   4849 C C8    . DA  C 2 5   ? 13.543  7.213   57.352  1.00 41.73 ? 5    DA  C C8    1 
ATOM   4850 N N7    . DA  C 2 5   ? 13.357  7.817   56.207  1.00 40.71 ? 5    DA  C N7    1 
ATOM   4851 C C5    . DA  C 2 5   ? 12.826  6.828   55.391  1.00 39.14 ? 5    DA  C C5    1 
ATOM   4852 C C6    . DA  C 2 5   ? 12.436  6.831   54.045  1.00 37.13 ? 5    DA  C C6    1 
ATOM   4853 N N6    . DA  C 2 5   ? 12.540  7.900   53.251  1.00 36.16 ? 5    DA  C N6    1 
ATOM   4854 N N1    . DA  C 2 5   ? 11.940  5.684   53.531  1.00 35.39 ? 5    DA  C N1    1 
ATOM   4855 C C2    . DA  C 2 5   ? 11.856  4.611   54.328  1.00 36.60 ? 5    DA  C C2    1 
ATOM   4856 N N3    . DA  C 2 5   ? 12.202  4.481   55.608  1.00 37.88 ? 5    DA  C N3    1 
ATOM   4857 C C4    . DA  C 2 5   ? 12.691  5.640   56.087  1.00 40.43 ? 5    DA  C C4    1 
ATOM   4858 P P     . DC  C 2 6   ? 16.310  2.597   60.352  1.00 50.48 ? 6    DC  C P     1 
ATOM   4859 O OP1   . DC  C 2 6   ? 16.561  1.536   61.361  1.00 49.68 ? 6    DC  C OP1   1 
ATOM   4860 O OP2   . DC  C 2 6   ? 17.306  3.684   60.160  1.00 48.97 ? 6    DC  C OP2   1 
ATOM   4861 O "O5'" . DC  C 2 6   ? 16.069  1.921   58.939  1.00 48.92 ? 6    DC  C "O5'" 1 
ATOM   4862 C "C5'" . DC  C 2 6   ? 14.881  1.182   58.690  1.00 46.89 ? 6    DC  C "C5'" 1 
ATOM   4863 C "C4'" . DC  C 2 6   ? 15.077  0.342   57.457  1.00 44.28 ? 6    DC  C "C4'" 1 
ATOM   4864 O "O4'" . DC  C 2 6   ? 14.556  1.057   56.315  1.00 42.44 ? 6    DC  C "O4'" 1 
ATOM   4865 C "C3'" . DC  C 2 6   ? 16.568  0.145   57.215  1.00 44.73 ? 6    DC  C "C3'" 1 
ATOM   4866 O "O3'" . DC  C 2 6   ? 16.965  -1.212  57.143  1.00 45.55 ? 6    DC  C "O3'" 1 
ATOM   4867 C "C2'" . DC  C 2 6   ? 16.884  0.927   55.956  1.00 43.11 ? 6    DC  C "C2'" 1 
ATOM   4868 C "C1'" . DC  C 2 6   ? 15.539  1.199   55.303  1.00 41.82 ? 6    DC  C "C1'" 1 
ATOM   4869 N N1    . DC  C 2 6   ? 15.469  2.582   54.802  1.00 38.48 ? 6    DC  C N1    1 
ATOM   4870 C C2    . DC  C 2 6   ? 14.881  2.835   53.557  1.00 35.75 ? 6    DC  C C2    1 
ATOM   4871 O O2    . DC  C 2 6   ? 14.364  1.896   52.934  1.00 35.09 ? 6    DC  C O2    1 
ATOM   4872 N N3    . DC  C 2 6   ? 14.890  4.097   53.070  1.00 34.40 ? 6    DC  C N3    1 
ATOM   4873 C C4    . DC  C 2 6   ? 15.444  5.083   53.781  1.00 35.86 ? 6    DC  C C4    1 
ATOM   4874 N N4    . DC  C 2 6   ? 15.466  6.305   53.249  1.00 36.45 ? 6    DC  C N4    1 
ATOM   4875 C C5    . DC  C 2 6   ? 16.011  4.858   55.067  1.00 36.77 ? 6    DC  C C5    1 
ATOM   4876 C C6    . DC  C 2 6   ? 16.000  3.607   55.535  1.00 36.70 ? 6    DC  C C6    1 
ATOM   4877 P P     . DC  C 2 7   ? 18.404  -1.611  57.721  1.00 47.07 ? 7    DC  C P     1 
ATOM   4878 O OP1   . DC  C 2 7   ? 18.506  -3.095  57.780  1.00 47.71 ? 7    DC  C OP1   1 
ATOM   4879 O OP2   . DC  C 2 7   ? 18.656  -0.802  58.939  1.00 45.54 ? 7    DC  C OP2   1 
ATOM   4880 O "O5'" . DC  C 2 7   ? 19.384  -1.079  56.590  1.00 46.10 ? 7    DC  C "O5'" 1 
ATOM   4881 C "C5'" . DC  C 2 7   ? 19.233  -1.526  55.251  1.00 42.28 ? 7    DC  C "C5'" 1 
ATOM   4882 C "C4'" . DC  C 2 7   ? 20.374  -1.013  54.414  1.00 40.23 ? 7    DC  C "C4'" 1 
ATOM   4883 O "O4'" . DC  C 2 7   ? 20.095  0.331   53.956  1.00 39.12 ? 7    DC  C "O4'" 1 
ATOM   4884 C "C3'" . DC  C 2 7   ? 21.686  -0.946  55.189  1.00 38.99 ? 7    DC  C "C3'" 1 
ATOM   4885 O "O3'" . DC  C 2 7   ? 22.739  -1.481  54.405  1.00 38.83 ? 7    DC  C "O3'" 1 
ATOM   4886 C "C2'" . DC  C 2 7   ? 21.892  0.539   55.429  1.00 40.27 ? 7    DC  C "C2'" 1 
ATOM   4887 C "C1'" . DC  C 2 7   ? 21.188  1.180   54.245  1.00 37.42 ? 7    DC  C "C1'" 1 
ATOM   4888 N N1    . DC  C 2 7   ? 20.649  2.525   54.513  1.00 35.42 ? 7    DC  C N1    1 
ATOM   4889 C C2    . DC  C 2 7   ? 20.873  3.545   53.579  1.00 33.60 ? 7    DC  C C2    1 
ATOM   4890 O O2    . DC  C 2 7   ? 21.524  3.288   52.555  1.00 31.20 ? 7    DC  C O2    1 
ATOM   4891 N N3    . DC  C 2 7   ? 20.371  4.783   53.817  1.00 32.47 ? 7    DC  C N3    1 
ATOM   4892 C C4    . DC  C 2 7   ? 19.670  5.016   54.931  1.00 33.31 ? 7    DC  C C4    1 
ATOM   4893 N N4    . DC  C 2 7   ? 19.185  6.247   55.123  1.00 32.32 ? 7    DC  C N4    1 
ATOM   4894 C C5    . DC  C 2 7   ? 19.431  3.996   55.899  1.00 32.74 ? 7    DC  C C5    1 
ATOM   4895 C C6    . DC  C 2 7   ? 19.934  2.778   55.652  1.00 35.37 ? 7    DC  C C6    1 
ATOM   4896 P P     . DT  C 2 8   ? 24.200  -1.619  55.037  1.00 38.23 ? 8    DT  C P     1 
ATOM   4897 O OP1   . DT  C 2 8   ? 24.647  -3.018  54.803  1.00 37.73 ? 8    DT  C OP1   1 
ATOM   4898 O OP2   . DT  C 2 8   ? 24.169  -1.072  56.414  1.00 39.33 ? 8    DT  C OP2   1 
ATOM   4899 O "O5'" . DT  C 2 8   ? 25.071  -0.673  54.107  1.00 37.49 ? 8    DT  C "O5'" 1 
ATOM   4900 C "C5'" . DT  C 2 8   ? 25.112  -0.915  52.708  1.00 34.27 ? 8    DT  C "C5'" 1 
ATOM   4901 C "C4'" . DT  C 2 8   ? 25.861  0.186   52.001  1.00 32.25 ? 8    DT  C "C4'" 1 
ATOM   4902 O "O4'" . DT  C 2 8   ? 25.066  1.394   51.990  1.00 30.78 ? 8    DT  C "O4'" 1 
ATOM   4903 C "C3'" . DT  C 2 8   ? 27.202  0.560   52.632  1.00 31.55 ? 8    DT  C "C3'" 1 
ATOM   4904 O "O3'" . DT  C 2 8   ? 28.207  0.623   51.628  1.00 31.68 ? 8    DT  C "O3'" 1 
ATOM   4905 C "C2'" . DT  C 2 8   ? 26.954  1.941   53.217  1.00 30.12 ? 8    DT  C "C2'" 1 
ATOM   4906 C "C1'" . DT  C 2 8   ? 25.915  2.486   52.261  1.00 29.57 ? 8    DT  C "C1'" 1 
ATOM   4907 N N1    . DT  C 2 8   ? 25.089  3.609   52.750  1.00 28.06 ? 8    DT  C N1    1 
ATOM   4908 C C2    . DT  C 2 8   ? 24.762  4.580   51.833  1.00 27.02 ? 8    DT  C C2    1 
ATOM   4909 O O2    . DT  C 2 8   ? 25.071  4.511   50.656  1.00 26.19 ? 8    DT  C O2    1 
ATOM   4910 N N3    . DT  C 2 8   ? 24.051  5.634   52.341  1.00 25.82 ? 8    DT  C N3    1 
ATOM   4911 C C4    . DT  C 2 8   ? 23.621  5.800   53.639  1.00 26.15 ? 8    DT  C C4    1 
ATOM   4912 O O4    . DT  C 2 8   ? 22.998  6.811   53.947  1.00 25.82 ? 8    DT  C O4    1 
ATOM   4913 C C5    . DT  C 2 8   ? 23.964  4.724   54.543  1.00 25.52 ? 8    DT  C C5    1 
ATOM   4914 C C7    . DT  C 2 8   ? 23.512  4.802   55.965  1.00 25.32 ? 8    DT  C C7    1 
ATOM   4915 C C6    . DT  C 2 8   ? 24.676  3.697   54.061  1.00 26.17 ? 8    DT  C C6    1 
ATOM   4916 P P     . DG  C 2 9   ? 29.752  0.611   52.061  1.00 35.33 ? 9    DG  C P     1 
ATOM   4917 O OP1   . DG  C 2 9   ? 30.564  0.525   50.815  1.00 33.22 ? 9    DG  C OP1   1 
ATOM   4918 O OP2   . DG  C 2 9   ? 29.945  -0.399  53.131  1.00 34.49 ? 9    DG  C OP2   1 
ATOM   4919 O "O5'" . DG  C 2 9   ? 29.939  2.051   52.710  1.00 35.26 ? 9    DG  C "O5'" 1 
ATOM   4920 C "C5'" . DG  C 2 9   ? 30.703  3.050   52.052  1.00 32.88 ? 9    DG  C "C5'" 1 
ATOM   4921 C "C4'" . DG  C 2 9   ? 30.073  3.402   50.724  1.00 33.66 ? 9    DG  C "C4'" 1 
ATOM   4922 O "O4'" . DG  C 2 9   ? 28.720  3.881   50.931  1.00 32.98 ? 9    DG  C "O4'" 1 
ATOM   4923 C "C3'" . DG  C 2 9   ? 30.826  4.523   50.015  1.00 34.80 ? 9    DG  C "C3'" 1 
ATOM   4924 O "O3'" . DG  C 2 9   ? 31.104  4.223   48.659  1.00 38.78 ? 9    DG  C "O3'" 1 
ATOM   4925 C "C2'" . DG  C 2 9   ? 29.929  5.737   50.129  1.00 33.34 ? 9    DG  C "C2'" 1 
ATOM   4926 C "C1'" . DG  C 2 9   ? 28.543  5.183   50.387  1.00 29.60 ? 9    DG  C "C1'" 1 
ATOM   4927 N N9    . DG  C 2 9   ? 27.866  6.000   51.385  1.00 26.32 ? 9    DG  C N9    1 
ATOM   4928 C C8    . DG  C 2 9   ? 27.779  5.759   52.735  1.00 26.02 ? 9    DG  C C8    1 
ATOM   4929 N N7    . DG  C 2 9   ? 27.170  6.711   53.388  1.00 24.83 ? 9    DG  C N7    1 
ATOM   4930 C C5    . DG  C 2 9   ? 26.821  7.633   52.409  1.00 21.88 ? 9    DG  C C5    1 
ATOM   4931 C C6    . DG  C 2 9   ? 26.156  8.868   52.520  1.00 22.03 ? 9    DG  C C6    1 
ATOM   4932 O O6    . DG  C 2 9   ? 25.732  9.424   53.536  1.00 25.11 ? 9    DG  C O6    1 
ATOM   4933 N N1    . DG  C 2 9   ? 26.002  9.478   51.283  1.00 19.79 ? 9    DG  C N1    1 
ATOM   4934 C C2    . DG  C 2 9   ? 26.440  8.963   50.091  1.00 20.79 ? 9    DG  C C2    1 
ATOM   4935 N N2    . DG  C 2 9   ? 26.201  9.697   49.009  1.00 18.69 ? 9    DG  C N2    1 
ATOM   4936 N N3    . DG  C 2 9   ? 27.069  7.809   49.973  1.00 23.46 ? 9    DG  C N3    1 
ATOM   4937 C C4    . DG  C 2 9   ? 27.225  7.198   51.169  1.00 23.65 ? 9    DG  C C4    1 
ATOM   4938 P P     . DG  C 2 10  ? 32.466  4.765   48.020  1.00 39.68 ? 10   DG  C P     1 
ATOM   4939 O OP1   . DG  C 2 10  ? 32.901  3.779   46.999  1.00 41.13 ? 10   DG  C OP1   1 
ATOM   4940 O OP2   . DG  C 2 10  ? 33.372  5.116   49.142  1.00 39.36 ? 10   DG  C OP2   1 
ATOM   4941 O "O5'" . DG  C 2 10  ? 32.041  6.123   47.309  1.00 37.82 ? 10   DG  C "O5'" 1 
ATOM   4942 C "C5'" . DG  C 2 10  ? 31.123  6.116   46.229  1.00 35.99 ? 10   DG  C "C5'" 1 
ATOM   4943 C "C4'" . DG  C 2 10  ? 30.821  7.531   45.798  1.00 36.14 ? 10   DG  C "C4'" 1 
ATOM   4944 O "O4'" . DG  C 2 10  ? 30.004  8.188   46.795  1.00 34.95 ? 10   DG  C "O4'" 1 
ATOM   4945 C "C3'" . DG  C 2 10  ? 32.052  8.414   45.603  1.00 36.04 ? 10   DG  C "C3'" 1 
ATOM   4946 O "O3'" . DG  C 2 10  ? 31.869  9.230   44.442  1.00 36.85 ? 10   DG  C "O3'" 1 
ATOM   4947 C "C2'" . DG  C 2 10  ? 32.095  9.249   46.871  1.00 34.16 ? 10   DG  C "C2'" 1 
ATOM   4948 C "C1'" . DG  C 2 10  ? 30.623  9.391   47.228  1.00 33.40 ? 10   DG  C "C1'" 1 
ATOM   4949 N N9    . DG  C 2 10  ? 30.339  9.539   48.654  1.00 30.74 ? 10   DG  C N9    1 
ATOM   4950 C C8    . DG  C 2 10  ? 30.768  8.722   49.670  1.00 31.63 ? 10   DG  C C8    1 
ATOM   4951 N N7    . DG  C 2 10  ? 30.321  9.081   50.845  1.00 30.58 ? 10   DG  C N7    1 
ATOM   4952 C C5    . DG  C 2 10  ? 29.557  10.210  50.590  1.00 30.81 ? 10   DG  C C5    1 
ATOM   4953 C C6    . DG  C 2 10  ? 28.811  11.032  51.473  1.00 30.24 ? 10   DG  C C6    1 
ATOM   4954 O O6    . DG  C 2 10  ? 28.665  10.916  52.693  1.00 33.53 ? 10   DG  C O6    1 
ATOM   4955 N N1    . DG  C 2 10  ? 28.187  12.075  50.797  1.00 29.07 ? 10   DG  C N1    1 
ATOM   4956 C C2    . DG  C 2 10  ? 28.262  12.294  49.444  1.00 29.29 ? 10   DG  C C2    1 
ATOM   4957 N N2    . DG  C 2 10  ? 27.590  13.354  48.980  1.00 29.40 ? 10   DG  C N2    1 
ATOM   4958 N N3    . DG  C 2 10  ? 28.946  11.530  48.606  1.00 30.20 ? 10   DG  C N3    1 
ATOM   4959 C C4    . DG  C 2 10  ? 29.566  10.514  49.243  1.00 30.65 ? 10   DG  C C4    1 
ATOM   4960 P P     . DA  C 2 11  ? 33.116  10.037  43.826  1.00 37.74 ? 11   DA  C P     1 
ATOM   4961 O OP1   . DA  C 2 11  ? 32.970  10.022  42.347  1.00 36.10 ? 11   DA  C OP1   1 
ATOM   4962 O OP2   . DA  C 2 11  ? 34.374  9.550   44.450  1.00 34.99 ? 11   DA  C OP2   1 
ATOM   4963 O "O5'" . DA  C 2 11  ? 32.863  11.522  44.338  1.00 37.41 ? 11   DA  C "O5'" 1 
ATOM   4964 C "C5'" . DA  C 2 11  ? 31.657  12.200  44.017  1.00 34.40 ? 11   DA  C "C5'" 1 
ATOM   4965 C "C4'" . DA  C 2 11  ? 31.576  13.503  44.777  1.00 36.08 ? 11   DA  C "C4'" 1 
ATOM   4966 O "O4'" . DA  C 2 11  ? 31.184  13.272  46.153  1.00 34.49 ? 11   DA  C "O4'" 1 
ATOM   4967 C "C3'" . DA  C 2 11  ? 32.880  14.304  44.829  1.00 35.11 ? 11   DA  C "C3'" 1 
ATOM   4968 O "O3'" . DA  C 2 11  ? 32.613  15.675  44.543  1.00 37.09 ? 11   DA  C "O3'" 1 
ATOM   4969 C "C2'" . DA  C 2 11  ? 33.334  14.157  46.272  1.00 35.21 ? 11   DA  C "C2'" 1 
ATOM   4970 C "C1'" . DA  C 2 11  ? 32.008  14.050  47.002  1.00 34.17 ? 11   DA  C "C1'" 1 
ATOM   4971 N N9    . DA  C 2 11  ? 32.065  13.394  48.309  1.00 32.41 ? 11   DA  C N9    1 
ATOM   4972 C C8    . DA  C 2 11  ? 32.699  12.223  48.639  1.00 31.92 ? 11   DA  C C8    1 
ATOM   4973 N N7    . DA  C 2 11  ? 32.568  11.888  49.899  1.00 31.11 ? 11   DA  C N7    1 
ATOM   4974 C C5    . DA  C 2 11  ? 31.798  12.909  50.438  1.00 28.02 ? 11   DA  C C5    1 
ATOM   4975 C C6    . DA  C 2 11  ? 31.314  13.142  51.738  1.00 28.98 ? 11   DA  C C6    1 
ATOM   4976 N N6    . DA  C 2 11  ? 31.551  12.331  52.774  1.00 25.90 ? 11   DA  C N6    1 
ATOM   4977 N N1    . DA  C 2 11  ? 30.570  14.252  51.941  1.00 29.09 ? 11   DA  C N1    1 
ATOM   4978 C C2    . DA  C 2 11  ? 30.341  15.068  50.902  1.00 27.68 ? 11   DA  C C2    1 
ATOM   4979 N N3    . DA  C 2 11  ? 30.747  14.960  49.640  1.00 28.46 ? 11   DA  C N3    1 
ATOM   4980 C C4    . DA  C 2 11  ? 31.479  13.843  49.472  1.00 29.42 ? 11   DA  C C4    1 
ATOM   4981 P P     . DC  C 2 12  ? 33.828  16.717  44.424  1.00 34.39 ? 12   DC  C P     1 
ATOM   4982 O OP1   . DC  C 2 12  ? 33.562  17.543  43.226  1.00 34.19 ? 12   DC  C OP1   1 
ATOM   4983 O OP2   . DC  C 2 12  ? 35.116  15.991  44.557  1.00 38.22 ? 12   DC  C OP2   1 
ATOM   4984 O "O5'" . DC  C 2 12  ? 33.652  17.615  45.718  1.00 37.99 ? 12   DC  C "O5'" 1 
ATOM   4985 C "C5'" . DC  C 2 12  ? 32.369  18.111  46.076  1.00 40.23 ? 12   DC  C "C5'" 1 
ATOM   4986 C "C4'" . DC  C 2 12  ? 32.422  18.707  47.459  1.00 42.74 ? 12   DC  C "C4'" 1 
ATOM   4987 O "O4'" . DC  C 2 12  ? 32.427  17.667  48.469  1.00 42.20 ? 12   DC  C "O4'" 1 
ATOM   4988 C "C3'" . DC  C 2 12  ? 33.679  19.542  47.705  1.00 44.97 ? 12   DC  C "C3'" 1 
ATOM   4989 O "O3'" . DC  C 2 12  ? 33.321  20.712  48.433  1.00 49.68 ? 12   DC  C "O3'" 1 
ATOM   4990 C "C2'" . DC  C 2 12  ? 34.538  18.632  48.566  1.00 43.02 ? 12   DC  C "C2'" 1 
ATOM   4991 C "C1'" . DC  C 2 12  ? 33.471  17.938  49.382  1.00 41.68 ? 12   DC  C "C1'" 1 
ATOM   4992 N N1    . DC  C 2 12  ? 33.853  16.684  50.057  1.00 39.45 ? 12   DC  C N1    1 
ATOM   4993 C C2    . DC  C 2 12  ? 33.517  16.538  51.409  1.00 39.25 ? 12   DC  C C2    1 
ATOM   4994 O O2    . DC  C 2 12  ? 32.898  17.456  51.974  1.00 40.53 ? 12   DC  C O2    1 
ATOM   4995 N N3    . DC  C 2 12  ? 33.870  15.411  52.065  1.00 37.34 ? 12   DC  C N3    1 
ATOM   4996 C C4    . DC  C 2 12  ? 34.532  14.448  51.423  1.00 37.12 ? 12   DC  C C4    1 
ATOM   4997 N N4    . DC  C 2 12  ? 34.864  13.355  52.117  1.00 34.45 ? 12   DC  C N4    1 
ATOM   4998 C C5    . DC  C 2 12  ? 34.882  14.563  50.040  1.00 37.30 ? 12   DC  C C5    1 
ATOM   4999 C C6    . DC  C 2 12  ? 34.524  15.689  49.402  1.00 38.54 ? 12   DC  C C6    1 
ATOM   5000 P P     . DG  C 2 13  ? 34.353  21.934  48.536  1.00 52.56 ? 13   DG  C P     1 
ATOM   5001 O OP1   . DG  C 2 13  ? 33.594  23.154  48.153  1.00 51.25 ? 13   DG  C OP1   1 
ATOM   5002 O OP2   . DG  C 2 13  ? 35.607  21.586  47.810  1.00 51.21 ? 13   DG  C OP2   1 
ATOM   5003 O "O5'" . DG  C 2 13  ? 34.665  22.006  50.096  1.00 52.76 ? 13   DG  C "O5'" 1 
ATOM   5004 C "C5'" . DG  C 2 13  ? 33.676  22.466  51.016  1.00 53.12 ? 13   DG  C "C5'" 1 
ATOM   5005 C "C4'" . DG  C 2 13  ? 34.279  22.628  52.391  1.00 52.79 ? 13   DG  C "C4'" 1 
ATOM   5006 O "O4'" . DG  C 2 13  ? 34.441  21.333  53.019  1.00 52.06 ? 13   DG  C "O4'" 1 
ATOM   5007 C "C3'" . DG  C 2 13  ? 35.669  23.263  52.382  1.00 52.74 ? 13   DG  C "C3'" 1 
ATOM   5008 O "O3'" . DG  C 2 13  ? 35.902  23.933  53.623  1.00 54.27 ? 13   DG  C "O3'" 1 
ATOM   5009 C "C2'" . DG  C 2 13  ? 36.579  22.048  52.369  1.00 52.96 ? 13   DG  C "C2'" 1 
ATOM   5010 C "C1'" . DG  C 2 13  ? 35.817  21.096  53.276  1.00 51.54 ? 13   DG  C "C1'" 1 
ATOM   5011 N N9    . DG  C 2 13  ? 36.075  19.675  53.060  1.00 50.24 ? 13   DG  C N9    1 
ATOM   5012 C C8    . DG  C 2 13  ? 36.351  19.046  51.870  1.00 49.90 ? 13   DG  C C8    1 
ATOM   5013 N N7    . DG  C 2 13  ? 36.534  17.758  52.003  1.00 49.66 ? 13   DG  C N7    1 
ATOM   5014 C C5    . DG  C 2 13  ? 36.367  17.525  53.362  1.00 47.70 ? 13   DG  C C5    1 
ATOM   5015 C C6    . DG  C 2 13  ? 36.442  16.319  54.107  1.00 46.40 ? 13   DG  C C6    1 
ATOM   5016 O O6    . DG  C 2 13  ? 36.679  15.178  53.706  1.00 45.67 ? 13   DG  C O6    1 
ATOM   5017 N N1    . DG  C 2 13  ? 36.204  16.537  55.457  1.00 46.97 ? 13   DG  C N1    1 
ATOM   5018 C C2    . DG  C 2 13  ? 35.930  17.754  56.025  1.00 47.78 ? 13   DG  C C2    1 
ATOM   5019 N N2    . DG  C 2 13  ? 35.734  17.755  57.352  1.00 48.16 ? 13   DG  C N2    1 
ATOM   5020 N N3    . DG  C 2 13  ? 35.856  18.885  55.344  1.00 48.09 ? 13   DG  C N3    1 
ATOM   5021 C C4    . DG  C 2 13  ? 36.084  18.698  54.029  1.00 48.63 ? 13   DG  C C4    1 
ATOM   5022 O "O5'" . DC  D 3 1   ? 35.539  9.829   62.726  1.00 71.15 ? 14   DC  D "O5'" 1 
ATOM   5023 C "C5'" . DC  D 3 1   ? 36.367  10.758  62.017  1.00 70.67 ? 14   DC  D "C5'" 1 
ATOM   5024 C "C4'" . DC  D 3 1   ? 36.124  12.171  62.494  1.00 70.92 ? 14   DC  D "C4'" 1 
ATOM   5025 O "O4'" . DC  D 3 1   ? 36.950  13.055  61.694  1.00 70.19 ? 14   DC  D "O4'" 1 
ATOM   5026 C "C3'" . DC  D 3 1   ? 34.676  12.623  62.301  1.00 71.56 ? 14   DC  D "C3'" 1 
ATOM   5027 O "O3'" . DC  D 3 1   ? 34.085  13.229  63.449  1.00 72.28 ? 14   DC  D "O3'" 1 
ATOM   5028 C "C2'" . DC  D 3 1   ? 34.721  13.610  61.154  1.00 71.07 ? 14   DC  D "C2'" 1 
ATOM   5029 C "C1'" . DC  D 3 1   ? 36.170  14.026  61.011  1.00 69.37 ? 14   DC  D "C1'" 1 
ATOM   5030 N N1    . DC  D 3 1   ? 36.479  13.934  59.584  1.00 67.40 ? 14   DC  D N1    1 
ATOM   5031 C C2    . DC  D 3 1   ? 36.523  15.099  58.815  1.00 67.16 ? 14   DC  D C2    1 
ATOM   5032 O O2    . DC  D 3 1   ? 36.456  16.199  59.382  1.00 66.71 ? 14   DC  D O2    1 
ATOM   5033 N N3    . DC  D 3 1   ? 36.639  14.993  57.474  1.00 66.65 ? 14   DC  D N3    1 
ATOM   5034 C C4    . DC  D 3 1   ? 36.737  13.789  56.906  1.00 66.10 ? 14   DC  D C4    1 
ATOM   5035 N N4    . DC  D 3 1   ? 36.793  13.727  55.577  1.00 64.95 ? 14   DC  D N4    1 
ATOM   5036 C C5    . DC  D 3 1   ? 36.773  12.594  57.677  1.00 65.90 ? 14   DC  D C5    1 
ATOM   5037 C C6    . DC  D 3 1   ? 36.651  12.712  59.000  1.00 66.76 ? 14   DC  D C6    1 
ATOM   5038 P P     . DG  D 3 2   ? 32.479  13.292  63.554  1.00 73.07 ? 15   DG  D P     1 
ATOM   5039 O OP1   . DG  D 3 2   ? 32.091  12.922  64.941  1.00 73.44 ? 15   DG  D OP1   1 
ATOM   5040 O OP2   . DG  D 3 2   ? 31.925  12.522  62.405  1.00 71.11 ? 15   DG  D OP2   1 
ATOM   5041 O "O5'" . DG  D 3 2   ? 32.147  14.832  63.321  1.00 70.31 ? 15   DG  D "O5'" 1 
ATOM   5042 C "C5'" . DG  D 3 2   ? 32.813  15.553  62.293  1.00 66.79 ? 15   DG  D "C5'" 1 
ATOM   5043 C "C4'" . DG  D 3 2   ? 31.914  16.621  61.722  1.00 64.42 ? 15   DG  D "C4'" 1 
ATOM   5044 O "O4'" . DG  D 3 2   ? 32.402  16.892  60.386  1.00 63.15 ? 15   DG  D "O4'" 1 
ATOM   5045 C "C3'" . DG  D 3 2   ? 30.462  16.185  61.553  1.00 63.24 ? 15   DG  D "C3'" 1 
ATOM   5046 O "O3'" . DG  D 3 2   ? 29.579  17.293  61.738  1.00 62.41 ? 15   DG  D "O3'" 1 
ATOM   5047 C "C2'" . DG  D 3 2   ? 30.402  15.656  60.135  1.00 62.46 ? 15   DG  D "C2'" 1 
ATOM   5048 C "C1'" . DG  D 3 2   ? 31.486  16.428  59.402  1.00 61.08 ? 15   DG  D "C1'" 1 
ATOM   5049 N N9    . DG  D 3 2   ? 32.219  15.564  58.479  1.00 58.42 ? 15   DG  D N9    1 
ATOM   5050 C C8    . DG  D 3 2   ? 32.706  14.310  58.748  1.00 56.37 ? 15   DG  D C8    1 
ATOM   5051 N N7    . DG  D 3 2   ? 33.261  13.744  57.713  1.00 55.41 ? 15   DG  D N7    1 
ATOM   5052 C C5    . DG  D 3 2   ? 33.145  14.687  56.704  1.00 54.58 ? 15   DG  D C5    1 
ATOM   5053 C C6    . DG  D 3 2   ? 33.552  14.630  55.353  1.00 54.05 ? 15   DG  D C6    1 
ATOM   5054 O O6    . DG  D 3 2   ? 34.102  13.701  54.757  1.00 53.85 ? 15   DG  D O6    1 
ATOM   5055 N N1    . DG  D 3 2   ? 33.252  15.807  54.678  1.00 54.32 ? 15   DG  D N1    1 
ATOM   5056 C C2    . DG  D 3 2   ? 32.630  16.899  55.235  1.00 55.27 ? 15   DG  D C2    1 
ATOM   5057 N N2    . DG  D 3 2   ? 32.432  17.948  54.423  1.00 54.44 ? 15   DG  D N2    1 
ATOM   5058 N N3    . DG  D 3 2   ? 32.234  16.958  56.494  1.00 55.42 ? 15   DG  D N3    1 
ATOM   5059 C C4    . DG  D 3 2   ? 32.521  15.826  57.165  1.00 55.93 ? 15   DG  D C4    1 
ATOM   5060 P P     . DT  D 3 3   ? 28.050  17.178  61.260  1.00 61.70 ? 16   DT  D P     1 
ATOM   5061 O OP1   . DT  D 3 3   ? 27.254  18.162  62.039  1.00 61.11 ? 16   DT  D OP1   1 
ATOM   5062 O OP2   . DT  D 3 3   ? 27.653  15.746  61.262  1.00 60.48 ? 16   DT  D OP2   1 
ATOM   5063 O "O5'" . DT  D 3 3   ? 28.113  17.679  59.752  1.00 60.30 ? 16   DT  D "O5'" 1 
ATOM   5064 C "C5'" . DT  D 3 3   ? 28.661  18.955  59.436  1.00 58.81 ? 16   DT  D "C5'" 1 
ATOM   5065 C "C4'" . DT  D 3 3   ? 28.208  19.381  58.062  1.00 57.32 ? 16   DT  D "C4'" 1 
ATOM   5066 O "O4'" . DT  D 3 3   ? 28.941  18.640  57.056  1.00 56.41 ? 16   DT  D "O4'" 1 
ATOM   5067 C "C3'" . DT  D 3 3   ? 26.729  19.088  57.822  1.00 56.68 ? 16   DT  D "C3'" 1 
ATOM   5068 O "O3'" . DT  D 3 3   ? 26.101  20.154  57.112  1.00 57.05 ? 16   DT  D "O3'" 1 
ATOM   5069 C "C2'" . DT  D 3 3   ? 26.744  17.807  57.007  1.00 55.77 ? 16   DT  D "C2'" 1 
ATOM   5070 C "C1'" . DT  D 3 3   ? 28.048  17.907  56.231  1.00 53.96 ? 16   DT  D "C1'" 1 
ATOM   5071 N N1    . DT  D 3 3   ? 28.670  16.598  55.945  1.00 51.06 ? 16   DT  D N1    1 
ATOM   5072 C C2    . DT  D 3 3   ? 29.094  16.342  54.661  1.00 49.22 ? 16   DT  D C2    1 
ATOM   5073 O O2    . DT  D 3 3   ? 28.991  17.151  53.752  1.00 49.59 ? 16   DT  D O2    1 
ATOM   5074 N N3    . DT  D 3 3   ? 29.645  15.098  54.478  1.00 45.37 ? 16   DT  D N3    1 
ATOM   5075 C C4    . DT  D 3 3   ? 29.810  14.110  55.429  1.00 45.40 ? 16   DT  D C4    1 
ATOM   5076 O O4    . DT  D 3 3   ? 30.313  13.035  55.115  1.00 41.62 ? 16   DT  D O4    1 
ATOM   5077 C C5    . DT  D 3 3   ? 29.351  14.449  56.754  1.00 46.68 ? 16   DT  D C5    1 
ATOM   5078 C C7    . DT  D 3 3   ? 29.494  13.442  57.850  1.00 47.20 ? 16   DT  D C7    1 
ATOM   5079 C C6    . DT  D 3 3   ? 28.813  15.660  56.945  1.00 48.46 ? 16   DT  D C6    1 
ATOM   5080 P P     . DC  D 3 4   ? 24.561  20.013  56.682  1.00 56.52 ? 17   DC  D P     1 
ATOM   5081 O OP1   . DC  D 3 4   ? 24.081  21.336  56.202  1.00 57.05 ? 17   DC  D OP1   1 
ATOM   5082 O OP2   . DC  D 3 4   ? 23.828  19.316  57.767  1.00 55.48 ? 17   DC  D OP2   1 
ATOM   5083 O "O5'" . DC  D 3 4   ? 24.653  19.036  55.436  1.00 54.35 ? 17   DC  D "O5'" 1 
ATOM   5084 C "C5'" . DC  D 3 4   ? 23.567  18.889  54.548  1.00 51.10 ? 17   DC  D "C5'" 1 
ATOM   5085 C "C4'" . DC  D 3 4   ? 24.047  19.037  53.126  1.00 47.36 ? 17   DC  D "C4'" 1 
ATOM   5086 O "O4'" . DC  D 3 4   ? 25.270  18.285  52.953  1.00 46.00 ? 17   DC  D "O4'" 1 
ATOM   5087 C "C3'" . DC  D 3 4   ? 23.048  18.464  52.132  1.00 46.89 ? 17   DC  D "C3'" 1 
ATOM   5088 O "O3'" . DC  D 3 4   ? 22.952  19.270  50.963  1.00 45.31 ? 17   DC  D "O3'" 1 
ATOM   5089 C "C2'" . DC  D 3 4   ? 23.579  17.073  51.843  1.00 45.20 ? 17   DC  D "C2'" 1 
ATOM   5090 C "C1'" . DC  D 3 4   ? 25.079  17.187  52.071  1.00 43.12 ? 17   DC  D "C1'" 1 
ATOM   5091 N N1    . DC  D 3 4   ? 25.649  15.991  52.719  1.00 40.54 ? 17   DC  D N1    1 
ATOM   5092 C C2    . DC  D 3 4   ? 26.443  15.109  51.965  1.00 37.50 ? 17   DC  D C2    1 
ATOM   5093 O O2    . DC  D 3 4   ? 26.665  15.366  50.771  1.00 35.98 ? 17   DC  D O2    1 
ATOM   5094 N N3    . DC  D 3 4   ? 26.944  14.003  52.560  1.00 34.94 ? 17   DC  D N3    1 
ATOM   5095 C C4    . DC  D 3 4   ? 26.686  13.762  53.848  1.00 35.15 ? 17   DC  D C4    1 
ATOM   5096 N N4    . DC  D 3 4   ? 27.194  12.654  54.391  1.00 34.46 ? 17   DC  D N4    1 
ATOM   5097 C C5    . DC  D 3 4   ? 25.894  14.644  54.637  1.00 35.97 ? 17   DC  D C5    1 
ATOM   5098 C C6    . DC  D 3 4   ? 25.400  15.735  54.040  1.00 37.54 ? 17   DC  D C6    1 
ATOM   5099 P P     . DC  D 3 5   ? 21.654  19.136  50.033  1.00 45.79 ? 18   DC  D P     1 
ATOM   5100 O OP1   . DC  D 3 5   ? 21.577  20.348  49.177  1.00 45.25 ? 18   DC  D OP1   1 
ATOM   5101 O OP2   . DC  D 3 5   ? 20.501  18.762  50.888  1.00 43.91 ? 18   DC  D OP2   1 
ATOM   5102 O "O5'" . DC  D 3 5   ? 22.012  17.885  49.125  1.00 43.42 ? 18   DC  D "O5'" 1 
ATOM   5103 C "C5'" . DC  D 3 5   ? 23.165  17.909  48.295  1.00 38.24 ? 18   DC  D "C5'" 1 
ATOM   5104 C "C4'" . DC  D 3 5   ? 23.302  16.591  47.578  1.00 34.28 ? 18   DC  D "C4'" 1 
ATOM   5105 O "O4'" . DC  D 3 5   ? 23.978  15.626  48.420  1.00 33.79 ? 18   DC  D "O4'" 1 
ATOM   5106 C "C3'" . DC  D 3 5   ? 21.955  15.975  47.203  1.00 32.27 ? 18   DC  D "C3'" 1 
ATOM   5107 O "O3'" . DC  D 3 5   ? 21.956  15.569  45.843  1.00 28.82 ? 18   DC  D "O3'" 1 
ATOM   5108 C "C2'" . DC  D 3 5   ? 21.824  14.777  48.128  1.00 33.55 ? 18   DC  D "C2'" 1 
ATOM   5109 C "C1'" . DC  D 3 5   ? 23.272  14.399  48.399  1.00 33.63 ? 18   DC  D "C1'" 1 
ATOM   5110 N N1    . DC  D 3 5   ? 23.493  13.725  49.691  1.00 31.28 ? 18   DC  D N1    1 
ATOM   5111 C C2    . DC  D 3 5   ? 24.289  12.564  49.726  1.00 30.40 ? 18   DC  D C2    1 
ATOM   5112 O O2    . DC  D 3 5   ? 24.807  12.157  48.676  1.00 30.00 ? 18   DC  D O2    1 
ATOM   5113 N N3    . DC  D 3 5   ? 24.474  11.925  50.906  1.00 28.52 ? 18   DC  D N3    1 
ATOM   5114 C C4    . DC  D 3 5   ? 23.911  12.403  52.020  1.00 29.60 ? 18   DC  D C4    1 
ATOM   5115 N N4    . DC  D 3 5   ? 24.108  11.730  53.159  1.00 29.34 ? 18   DC  D N4    1 
ATOM   5116 C C5    . DC  D 3 5   ? 23.114  13.590  52.016  1.00 28.51 ? 18   DC  D C5    1 
ATOM   5117 C C6    . DC  D 3 5   ? 22.932  14.210  50.840  1.00 29.75 ? 18   DC  D C6    1 
ATOM   5118 P P     . DA  D 3 6   ? 20.572  15.187  45.135  1.00 27.80 ? 19   DA  D P     1 
ATOM   5119 O OP1   . DA  D 3 6   ? 20.637  15.679  43.738  1.00 27.09 ? 19   DA  D OP1   1 
ATOM   5120 O OP2   . DA  D 3 6   ? 19.445  15.584  46.005  1.00 26.79 ? 19   DA  D OP2   1 
ATOM   5121 O "O5'" . DA  D 3 6   ? 20.631  13.598  45.111  1.00 28.32 ? 19   DA  D "O5'" 1 
ATOM   5122 C "C5'" . DA  D 3 6   ? 21.783  12.929  44.606  1.00 27.52 ? 19   DA  D "C5'" 1 
ATOM   5123 C "C4'" . DA  D 3 6   ? 21.532  11.445  44.566  1.00 25.92 ? 19   DA  D "C4'" 1 
ATOM   5124 O "O4'" . DA  D 3 6   ? 22.274  10.830  45.645  1.00 27.23 ? 19   DA  D "O4'" 1 
ATOM   5125 C "C3'" . DA  D 3 6   ? 20.060  11.120  44.807  1.00 25.33 ? 19   DA  D "C3'" 1 
ATOM   5126 O "O3'" . DA  D 3 6   ? 19.410  10.474  43.727  1.00 20.09 ? 19   DA  D "O3'" 1 
ATOM   5127 C "C2'" . DA  D 3 6   ? 20.035  10.254  46.049  1.00 26.19 ? 19   DA  D "C2'" 1 
ATOM   5128 C "C1'" . DA  D 3 6   ? 21.476  9.866   46.305  1.00 26.56 ? 19   DA  D "C1'" 1 
ATOM   5129 N N9    . DA  D 3 6   ? 21.734  9.957   47.741  1.00 26.05 ? 19   DA  D N9    1 
ATOM   5130 C C8    . DA  D 3 6   ? 21.209  10.897  48.597  1.00 24.36 ? 19   DA  D C8    1 
ATOM   5131 N N7    . DA  D 3 6   ? 21.469  10.669  49.856  1.00 23.95 ? 19   DA  D N7    1 
ATOM   5132 C C5    . DA  D 3 6   ? 22.246  9.520   49.831  1.00 25.40 ? 19   DA  D C5    1 
ATOM   5133 C C6    . DA  D 3 6   ? 22.814  8.749   50.852  1.00 23.10 ? 19   DA  D C6    1 
ATOM   5134 N N6    . DA  D 3 6   ? 22.664  9.022   52.148  1.00 23.50 ? 19   DA  D N6    1 
ATOM   5135 N N1    . DA  D 3 6   ? 23.541  7.670   50.493  1.00 23.67 ? 19   DA  D N1    1 
ATOM   5136 C C2    . DA  D 3 6   ? 23.672  7.389   49.189  1.00 24.43 ? 19   DA  D C2    1 
ATOM   5137 N N3    . DA  D 3 6   ? 23.172  8.030   48.136  1.00 25.36 ? 19   DA  D N3    1 
ATOM   5138 C C4    . DA  D 3 6   ? 22.455  9.097   48.530  1.00 25.09 ? 19   DA  D C4    1 
HETATM 5139 O "O5'" . 3DR D 3 7   ? 17.402  9.877   42.329  1.00 18.08 ? 20   3DR D "O5'" 1 
HETATM 5140 P P     . 3DR D 3 7   ? 17.972  11.022  43.273  1.00 18.95 ? 20   3DR D P     1 
HETATM 5141 O OP1   . 3DR D 3 7   ? 18.164  12.246  42.453  1.00 15.72 ? 20   3DR D OP1   1 
HETATM 5142 O OP2   . 3DR D 3 7   ? 17.148  11.093  44.502  1.00 20.75 ? 20   3DR D OP2   1 
HETATM 5143 C "C2'" . 3DR D 3 7   ? 17.954  6.486   40.700  1.00 18.54 ? 20   3DR D "C2'" 1 
HETATM 5144 C "C5'" . 3DR D 3 7   ? 18.047  9.581   41.103  1.00 19.46 ? 20   3DR D "C5'" 1 
HETATM 5145 C "C4'" . 3DR D 3 7   ? 17.181  8.682   40.256  1.00 20.26 ? 20   3DR D "C4'" 1 
HETATM 5146 O "O4'" . 3DR D 3 7   ? 17.980  8.252   39.131  1.00 24.29 ? 20   3DR D "O4'" 1 
HETATM 5147 C "C1'" . 3DR D 3 7   ? 18.347  6.882   39.285  1.00 22.13 ? 20   3DR D "C1'" 1 
HETATM 5148 C "C3'" . 3DR D 3 7   ? 16.770  7.395   40.969  1.00 20.29 ? 20   3DR D "C3'" 1 
HETATM 5149 O "O3'" . 3DR D 3 7   ? 15.593  6.869   40.346  1.00 18.49 ? 20   3DR D "O3'" 1 
ATOM   5150 P P     . DG  D 3 8   ? 14.144  7.200   40.951  1.00 18.35 ? 21   DG  D P     1 
ATOM   5151 O OP1   . DG  D 3 8   ? 13.151  6.630   39.998  1.00 16.35 ? 21   DG  D OP1   1 
ATOM   5152 O OP2   . DG  D 3 8   ? 14.064  8.639   41.318  1.00 20.70 ? 21   DG  D OP2   1 
ATOM   5153 O "O5'" . DG  D 3 8   ? 14.101  6.348   42.291  1.00 20.25 ? 21   DG  D "O5'" 1 
ATOM   5154 C "C5'" . DG  D 3 8   ? 14.399  4.962   42.260  1.00 18.23 ? 21   DG  D "C5'" 1 
ATOM   5155 C "C4'" . DG  D 3 8   ? 13.462  4.214   43.173  1.00 20.89 ? 21   DG  D "C4'" 1 
ATOM   5156 O "O4'" . DG  D 3 8   ? 13.929  4.276   44.543  1.00 20.81 ? 21   DG  D "O4'" 1 
ATOM   5157 C "C3'" . DG  D 3 8   ? 12.026  4.737   43.172  1.00 21.07 ? 21   DG  D "C3'" 1 
ATOM   5158 O "O3'" . DG  D 3 8   ? 11.132  3.639   42.999  1.00 25.68 ? 21   DG  D "O3'" 1 
ATOM   5159 C "C2'" . DG  D 3 8   ? 11.879  5.392   44.538  1.00 20.41 ? 21   DG  D "C2'" 1 
ATOM   5160 C "C1'" . DG  D 3 8   ? 12.853  4.609   45.402  1.00 19.36 ? 21   DG  D "C1'" 1 
ATOM   5161 N N9    . DG  D 3 8   ? 13.401  5.348   46.540  1.00 19.00 ? 21   DG  D N9    1 
ATOM   5162 C C8    . DG  D 3 8   ? 13.792  6.663   46.555  1.00 20.52 ? 21   DG  D C8    1 
ATOM   5163 N N7    . DG  D 3 8   ? 14.224  7.058   47.724  1.00 19.46 ? 21   DG  D N7    1 
ATOM   5164 C C5    . DG  D 3 8   ? 14.115  5.937   48.532  1.00 17.20 ? 21   DG  D C5    1 
ATOM   5165 C C6    . DG  D 3 8   ? 14.426  5.759   49.909  1.00 17.57 ? 21   DG  D C6    1 
ATOM   5166 O O6    . DG  D 3 8   ? 14.866  6.586   50.715  1.00 16.61 ? 21   DG  D O6    1 
ATOM   5167 N N1    . DG  D 3 8   ? 14.171  4.459   50.327  1.00 16.19 ? 21   DG  D N1    1 
ATOM   5168 C C2    . DG  D 3 8   ? 13.678  3.460   49.531  1.00 16.70 ? 21   DG  D C2    1 
ATOM   5169 N N2    . DG  D 3 8   ? 13.497  2.265   50.128  1.00 14.79 ? 21   DG  D N2    1 
ATOM   5170 N N3    . DG  D 3 8   ? 13.381  3.613   48.245  1.00 17.12 ? 21   DG  D N3    1 
ATOM   5171 C C4    . DG  D 3 8   ? 13.619  4.867   47.817  1.00 15.55 ? 21   DG  D C4    1 
ATOM   5172 P P     . DT  D 3 9   ? 9.547   3.889   42.938  1.00 26.16 ? 22   DT  D P     1 
ATOM   5173 O OP1   . DT  D 3 9   ? 8.959   2.746   42.189  1.00 26.20 ? 22   DT  D OP1   1 
ATOM   5174 O OP2   . DT  D 3 9   ? 9.287   5.278   42.494  1.00 29.36 ? 22   DT  D OP2   1 
ATOM   5175 O "O5'" . DT  D 3 9   ? 9.133   3.674   44.456  1.00 32.41 ? 22   DT  D "O5'" 1 
ATOM   5176 C "C5'" . DT  D 3 9   ? 9.588   2.491   45.113  1.00 36.07 ? 22   DT  D "C5'" 1 
ATOM   5177 C "C4'" . DT  D 3 9   ? 9.132   2.450   46.548  1.00 36.85 ? 22   DT  D "C4'" 1 
ATOM   5178 O "O4'" . DT  D 3 9   ? 10.025  3.185   47.422  1.00 37.02 ? 22   DT  D "O4'" 1 
ATOM   5179 C "C3'" . DT  D 3 9   ? 7.719   2.968   46.816  1.00 38.03 ? 22   DT  D "C3'" 1 
ATOM   5180 O "O3'" . DT  D 3 9   ? 7.032   1.986   47.585  1.00 43.77 ? 22   DT  D "O3'" 1 
ATOM   5181 C "C2'" . DT  D 3 9   ? 7.957   4.222   47.646  1.00 36.01 ? 22   DT  D "C2'" 1 
ATOM   5182 C "C1'" . DT  D 3 9   ? 9.235   3.856   48.384  1.00 35.04 ? 22   DT  D "C1'" 1 
ATOM   5183 N N1    . DT  D 3 9   ? 10.016  4.980   48.944  1.00 29.31 ? 22   DT  D N1    1 
ATOM   5184 C C2    . DT  D 3 9   ? 10.543  4.827   50.210  1.00 27.16 ? 22   DT  D C2    1 
ATOM   5185 O O2    . DT  D 3 9   ? 10.452  3.795   50.849  1.00 26.48 ? 22   DT  D O2    1 
ATOM   5186 N N3    . DT  D 3 9   ? 11.189  5.932   50.702  1.00 26.46 ? 22   DT  D N3    1 
ATOM   5187 C C4    . DT  D 3 9   ? 11.372  7.142   50.064  1.00 27.67 ? 22   DT  D C4    1 
ATOM   5188 O O4    . DT  D 3 9   ? 11.954  8.052   50.640  1.00 26.07 ? 22   DT  D O4    1 
ATOM   5189 C C5    . DT  D 3 9   ? 10.833  7.219   48.722  1.00 28.20 ? 22   DT  D C5    1 
ATOM   5190 C C7    . DT  D 3 9   ? 11.024  8.478   47.937  1.00 27.33 ? 22   DT  D C7    1 
ATOM   5191 C C6    . DT  D 3 9   ? 10.188  6.148   48.238  1.00 28.19 ? 22   DT  D C6    1 
ATOM   5192 P P     . DC  D 3 10  ? 5.452   2.124   47.847  1.00 49.16 ? 23   DC  D P     1 
ATOM   5193 O OP1   . DC  D 3 10  ? 4.754   1.089   47.035  1.00 47.69 ? 23   DC  D OP1   1 
ATOM   5194 O OP2   . DC  D 3 10  ? 5.047   3.550   47.728  1.00 48.72 ? 23   DC  D OP2   1 
ATOM   5195 O "O5'" . DC  D 3 10  ? 5.345   1.706   49.376  1.00 47.58 ? 23   DC  D "O5'" 1 
ATOM   5196 C "C5'" . DC  D 3 10  ? 6.244   0.743   49.920  1.00 47.36 ? 23   DC  D "C5'" 1 
ATOM   5197 C "C4'" . DC  D 3 10  ? 6.332   0.912   51.415  1.00 47.15 ? 23   DC  D "C4'" 1 
ATOM   5198 O "O4'" . DC  D 3 10  ? 7.290   1.944   51.767  1.00 44.55 ? 23   DC  D "O4'" 1 
ATOM   5199 C "C3'" . DC  D 3 10  ? 4.995   1.334   52.022  1.00 48.73 ? 23   DC  D "C3'" 1 
ATOM   5200 O "O3'" . DC  D 3 10  ? 4.709   0.581   53.193  1.00 53.84 ? 23   DC  D "O3'" 1 
ATOM   5201 C "C2'" . DC  D 3 10  ? 5.201   2.795   52.372  1.00 45.33 ? 23   DC  D "C2'" 1 
ATOM   5202 C "C1'" . DC  D 3 10  ? 6.685   2.843   52.680  1.00 43.62 ? 23   DC  D "C1'" 1 
ATOM   5203 N N1    . DC  D 3 10  ? 7.282   4.178   52.500  1.00 38.99 ? 23   DC  D N1    1 
ATOM   5204 C C2    . DC  D 3 10  ? 8.071   4.701   53.526  1.00 37.70 ? 23   DC  D C2    1 
ATOM   5205 O O2    . DC  D 3 10  ? 8.317   3.992   54.513  1.00 38.50 ? 23   DC  D O2    1 
ATOM   5206 N N3    . DC  D 3 10  ? 8.548   5.962   53.418  1.00 38.14 ? 23   DC  D N3    1 
ATOM   5207 C C4    . DC  D 3 10  ? 8.272   6.689   52.335  1.00 36.63 ? 23   DC  D C4    1 
ATOM   5208 N N4    . DC  D 3 10  ? 8.723   7.942   52.298  1.00 36.08 ? 23   DC  D N4    1 
ATOM   5209 C C5    . DC  D 3 10  ? 7.511   6.165   51.249  1.00 37.16 ? 23   DC  D C5    1 
ATOM   5210 C C6    . DC  D 3 10  ? 7.043   4.913   51.371  1.00 37.66 ? 23   DC  D C6    1 
ATOM   5211 P P     . DT  D 3 11  ? 3.300   0.782   53.936  1.00 57.05 ? 24   DT  D P     1 
ATOM   5212 O OP1   . DT  D 3 11  ? 2.816   -0.582  54.278  1.00 57.15 ? 24   DT  D OP1   1 
ATOM   5213 O OP2   . DT  D 3 11  ? 2.434   1.693   53.140  1.00 53.12 ? 24   DT  D OP2   1 
ATOM   5214 O "O5'" . DT  D 3 11  ? 3.721   1.528   55.276  1.00 56.96 ? 24   DT  D "O5'" 1 
ATOM   5215 C "C5'" . DT  D 3 11  ? 4.756   0.997   56.097  1.00 58.98 ? 24   DT  D "C5'" 1 
ATOM   5216 C "C4'" . DT  D 3 11  ? 4.827   1.766   57.392  1.00 60.37 ? 24   DT  D "C4'" 1 
ATOM   5217 O "O4'" . DT  D 3 11  ? 5.552   3.003   57.195  1.00 60.09 ? 24   DT  D "O4'" 1 
ATOM   5218 C "C3'" . DT  D 3 11  ? 3.447   2.152   57.917  1.00 62.31 ? 24   DT  D "C3'" 1 
ATOM   5219 O "O3'" . DT  D 3 11  ? 3.367   1.963   59.326  1.00 66.00 ? 24   DT  D "O3'" 1 
ATOM   5220 C "C2'" . DT  D 3 11  ? 3.324   3.623   57.560  1.00 60.98 ? 24   DT  D "C2'" 1 
ATOM   5221 C "C1'" . DT  D 3 11  ? 4.763   4.104   57.614  1.00 58.51 ? 24   DT  D "C1'" 1 
ATOM   5222 N N1    . DT  D 3 11  ? 5.037   5.231   56.703  1.00 55.46 ? 24   DT  D N1    1 
ATOM   5223 C C2    . DT  D 3 11  ? 5.659   6.349   57.211  1.00 54.07 ? 24   DT  D C2    1 
ATOM   5224 O O2    . DT  D 3 11  ? 6.026   6.442   58.372  1.00 53.40 ? 24   DT  D O2    1 
ATOM   5225 N N3    . DT  D 3 11  ? 5.837   7.363   56.305  1.00 52.46 ? 24   DT  D N3    1 
ATOM   5226 C C4    . DT  D 3 11  ? 5.467   7.368   54.974  1.00 52.44 ? 24   DT  D C4    1 
ATOM   5227 O O4    . DT  D 3 11  ? 5.676   8.361   54.285  1.00 51.70 ? 24   DT  D O4    1 
ATOM   5228 C C5    . DT  D 3 11  ? 4.839   6.156   54.505  1.00 52.71 ? 24   DT  D C5    1 
ATOM   5229 C C7    . DT  D 3 11  ? 4.417   6.063   53.073  1.00 52.47 ? 24   DT  D C7    1 
ATOM   5230 C C6    . DT  D 3 11  ? 4.661   5.161   55.381  1.00 53.74 ? 24   DT  D C6    1 
ATOM   5231 P P     . DA  D 3 12  ? 1.955   2.142   60.065  1.00 68.05 ? 25   DA  D P     1 
ATOM   5232 O OP1   . DA  D 3 12  ? 1.847   1.060   61.076  1.00 68.18 ? 25   DA  D OP1   1 
ATOM   5233 O OP2   . DA  D 3 12  ? 0.891   2.293   59.038  1.00 67.03 ? 25   DA  D OP2   1 
ATOM   5234 O "O5'" . DA  D 3 12  ? 2.127   3.530   60.822  1.00 68.21 ? 25   DA  D "O5'" 1 
ATOM   5235 C "C5'" . DA  D 3 12  ? 3.236   3.749   61.692  1.00 69.53 ? 25   DA  D "C5'" 1 
ATOM   5236 C "C4'" . DA  D 3 12  ? 3.189   5.152   62.247  1.00 70.59 ? 25   DA  D "C4'" 1 
ATOM   5237 O "O4'" . DA  D 3 12  ? 3.612   6.099   61.234  1.00 69.62 ? 25   DA  D "O4'" 1 
ATOM   5238 C "C3'" . DA  D 3 12  ? 1.788   5.588   62.681  1.00 71.64 ? 25   DA  D "C3'" 1 
ATOM   5239 O "O3'" . DA  D 3 12  ? 1.842   6.352   63.887  1.00 75.02 ? 25   DA  D "O3'" 1 
ATOM   5240 C "C2'" . DA  D 3 12  ? 1.328   6.472   61.537  1.00 69.92 ? 25   DA  D "C2'" 1 
ATOM   5241 C "C1'" . DA  D 3 12  ? 2.631   7.117   61.111  1.00 67.95 ? 25   DA  D "C1'" 1 
ATOM   5242 N N9    . DA  D 3 12  ? 2.643   7.606   59.734  1.00 65.11 ? 25   DA  D N9    1 
ATOM   5243 C C8    . DA  D 3 12  ? 2.262   6.950   58.590  1.00 64.23 ? 25   DA  D C8    1 
ATOM   5244 N N7    . DA  D 3 12  ? 2.357   7.680   57.506  1.00 63.45 ? 25   DA  D N7    1 
ATOM   5245 C C5    . DA  D 3 12  ? 2.840   8.899   57.966  1.00 62.17 ? 25   DA  D C5    1 
ATOM   5246 C C6    . DA  D 3 12  ? 3.151   10.104  57.310  1.00 61.22 ? 25   DA  D C6    1 
ATOM   5247 N N6    . DA  D 3 12  ? 3.008   10.294  55.996  1.00 59.07 ? 25   DA  D N6    1 
ATOM   5248 N N1    . DA  D 3 12  ? 3.619   11.124  58.063  1.00 60.17 ? 25   DA  D N1    1 
ATOM   5249 C C2    . DA  D 3 12  ? 3.756   10.938  59.380  1.00 60.33 ? 25   DA  D C2    1 
ATOM   5250 N N3    . DA  D 3 12  ? 3.492   9.858   60.110  1.00 61.34 ? 25   DA  D N3    1 
ATOM   5251 C C4    . DA  D 3 12  ? 3.031   8.861   59.333  1.00 62.83 ? 25   DA  D C4    1 
ATOM   5252 P P     . DC  D 3 13  ? 0.484   6.659   64.690  1.00 77.30 ? 26   DC  D P     1 
ATOM   5253 O OP1   . DC  D 3 13  ? 0.617   6.040   66.033  1.00 78.32 ? 26   DC  D OP1   1 
ATOM   5254 O OP2   . DC  D 3 13  ? -0.674  6.303   63.827  1.00 76.58 ? 26   DC  D OP2   1 
ATOM   5255 O "O5'" . DC  D 3 13  ? 0.500   8.241   64.870  1.00 78.13 ? 26   DC  D "O5'" 1 
ATOM   5256 C "C5'" . DC  D 3 13  ? 1.521   8.879   65.632  1.00 78.94 ? 26   DC  D "C5'" 1 
ATOM   5257 C "C4'" . DC  D 3 13  ? 1.318   10.377  65.619  1.00 79.54 ? 26   DC  D "C4'" 1 
ATOM   5258 O "O4'" . DC  D 3 13  ? 1.541   10.876  64.277  1.00 79.24 ? 26   DC  D "O4'" 1 
ATOM   5259 C "C3'" . DC  D 3 13  ? -0.092  10.825  66.001  1.00 79.67 ? 26   DC  D "C3'" 1 
ATOM   5260 O "O3'" . DC  D 3 13  ? -0.063  12.140  66.562  1.00 79.52 ? 26   DC  D "O3'" 1 
ATOM   5261 C "C2'" . DC  D 3 13  ? -0.777  10.951  64.653  1.00 79.74 ? 26   DC  D "C2'" 1 
ATOM   5262 C "C1'" . DC  D 3 13  ? 0.351   11.472  63.776  1.00 79.60 ? 26   DC  D "C1'" 1 
ATOM   5263 N N1    . DC  D 3 13  ? 0.233   11.118  62.352  1.00 79.14 ? 26   DC  D N1    1 
ATOM   5264 C C2    . DC  D 3 13  ? 0.305   12.136  61.393  1.00 78.97 ? 26   DC  D C2    1 
ATOM   5265 O O2    . DC  D 3 13  ? 0.468   13.305  61.768  1.00 79.03 ? 26   DC  D O2    1 
ATOM   5266 N N3    . DC  D 3 13  ? 0.196   11.819  60.082  1.00 78.34 ? 26   DC  D N3    1 
ATOM   5267 C C4    . DC  D 3 13  ? 0.021   10.547  59.716  1.00 77.62 ? 26   DC  D C4    1 
ATOM   5268 N N4    . DC  D 3 13  ? -0.081  10.280  58.414  1.00 76.79 ? 26   DC  D N4    1 
ATOM   5269 C C5    . DC  D 3 13  ? -0.056  9.491   60.671  1.00 78.33 ? 26   DC  D C5    1 
ATOM   5270 C C6    . DC  D 3 13  ? 0.055   9.818   61.966  1.00 79.09 ? 26   DC  D C6    1 
ATOM   5271 O "O5'" . DG  E 2 1   ? 27.070  -32.876 92.831  1.00 55.34 ? 1    DG  E "O5'" 1 
ATOM   5272 C "C5'" . DG  E 2 1   ? 27.674  -34.123 93.193  1.00 54.47 ? 1    DG  E "C5'" 1 
ATOM   5273 C "C4'" . DG  E 2 1   ? 27.286  -34.509 94.601  1.00 53.88 ? 1    DG  E "C4'" 1 
ATOM   5274 O "O4'" . DG  E 2 1   ? 28.038  -33.659 95.506  1.00 52.47 ? 1    DG  E "O4'" 1 
ATOM   5275 C "C3'" . DG  E 2 1   ? 25.804  -34.251 94.879  1.00 54.46 ? 1    DG  E "C3'" 1 
ATOM   5276 O "O3'" . DG  E 2 1   ? 25.090  -35.324 95.479  1.00 55.05 ? 1    DG  E "O3'" 1 
ATOM   5277 C "C2'" . DG  E 2 1   ? 25.778  -33.076 95.828  1.00 54.42 ? 1    DG  E "C2'" 1 
ATOM   5278 C "C1'" . DG  E 2 1   ? 27.178  -32.960 96.394  1.00 51.94 ? 1    DG  E "C1'" 1 
ATOM   5279 N N9    . DG  E 2 1   ? 27.495  -31.544 96.328  1.00 48.36 ? 1    DG  E N9    1 
ATOM   5280 C C8    . DG  E 2 1   ? 27.687  -30.803 95.188  1.00 47.25 ? 1    DG  E C8    1 
ATOM   5281 N N7    . DG  E 2 1   ? 27.740  -29.521 95.416  1.00 47.55 ? 1    DG  E N7    1 
ATOM   5282 C C5    . DG  E 2 1   ? 27.622  -29.413 96.794  1.00 45.71 ? 1    DG  E C5    1 
ATOM   5283 C C6    . DG  E 2 1   ? 27.573  -28.268 97.619  1.00 46.24 ? 1    DG  E C6    1 
ATOM   5284 O O6    . DG  E 2 1   ? 27.592  -27.076 97.284  1.00 45.19 ? 1    DG  E O6    1 
ATOM   5285 N N1    . DG  E 2 1   ? 27.472  -28.612 98.964  1.00 46.05 ? 1    DG  E N1    1 
ATOM   5286 C C2    . DG  E 2 1   ? 27.405  -29.895 99.446  1.00 45.38 ? 1    DG  E C2    1 
ATOM   5287 N N2    . DG  E 2 1   ? 27.322  -30.023 100.778 1.00 46.35 ? 1    DG  E N2    1 
ATOM   5288 N N3    . DG  E 2 1   ? 27.421  -30.972 98.681  1.00 45.35 ? 1    DG  E N3    1 
ATOM   5289 C C4    . DG  E 2 1   ? 27.528  -30.657 97.373  1.00 46.47 ? 1    DG  E C4    1 
ATOM   5290 P P     . DT  E 2 2   ? 23.499  -35.170 95.668  1.00 55.27 ? 2    DT  E P     1 
ATOM   5291 O OP1   . DT  E 2 2   ? 22.919  -36.503 95.977  1.00 56.62 ? 2    DT  E OP1   1 
ATOM   5292 O OP2   . DT  E 2 2   ? 22.982  -34.391 94.512  1.00 54.62 ? 2    DT  E OP2   1 
ATOM   5293 O "O5'" . DT  E 2 2   ? 23.368  -34.241 96.953  1.00 53.76 ? 2    DT  E "O5'" 1 
ATOM   5294 C "C5'" . DT  E 2 2   ? 23.695  -34.733 98.249  1.00 51.48 ? 2    DT  E "C5'" 1 
ATOM   5295 C "C4'" . DT  E 2 2   ? 23.019  -33.886 99.297  1.00 49.70 ? 2    DT  E "C4'" 1 
ATOM   5296 O "O4'" . DT  E 2 2   ? 23.786  -32.665 99.459  1.00 49.76 ? 2    DT  E "O4'" 1 
ATOM   5297 C "C3'" . DT  E 2 2   ? 21.619  -33.471 98.842  1.00 50.84 ? 2    DT  E "C3'" 1 
ATOM   5298 O "O3'" . DT  E 2 2   ? 20.577  -33.724 99.770  1.00 49.94 ? 2    DT  E "O3'" 1 
ATOM   5299 C "C2'" . DT  E 2 2   ? 21.704  -31.976 98.624  1.00 51.14 ? 2    DT  E "C2'" 1 
ATOM   5300 C "C1'" . DT  E 2 2   ? 22.941  -31.528 99.376  1.00 50.01 ? 2    DT  E "C1'" 1 
ATOM   5301 N N1    . DT  E 2 2   ? 23.589  -30.515 98.531  1.00 48.22 ? 2    DT  E N1    1 
ATOM   5302 C C2    . DT  E 2 2   ? 23.888  -29.272 99.038  1.00 47.35 ? 2    DT  E C2    1 
ATOM   5303 O O2    . DT  E 2 2   ? 23.823  -28.994 100.224 1.00 46.99 ? 2    DT  E O2    1 
ATOM   5304 N N3    . DT  E 2 2   ? 24.279  -28.358 98.092  1.00 46.79 ? 2    DT  E N3    1 
ATOM   5305 C C4    . DT  E 2 2   ? 24.426  -28.571 96.734  1.00 47.13 ? 2    DT  E C4    1 
ATOM   5306 O O4    . DT  E 2 2   ? 24.720  -27.635 95.994  1.00 46.88 ? 2    DT  E O4    1 
ATOM   5307 C C5    . DT  E 2 2   ? 24.192  -29.925 96.296  1.00 47.44 ? 2    DT  E C5    1 
ATOM   5308 C C7    . DT  E 2 2   ? 24.382  -30.272 94.853  1.00 48.02 ? 2    DT  E C7    1 
ATOM   5309 C C6    . DT  E 2 2   ? 23.804  -30.816 97.207  1.00 47.62 ? 2    DT  E C6    1 
ATOM   5310 P P     . DA  E 2 3   ? 19.110  -33.156 99.447  1.00 49.92 ? 3    DA  E P     1 
ATOM   5311 O OP1   . DA  E 2 3   ? 18.110  -34.004 100.148 1.00 51.51 ? 3    DA  E OP1   1 
ATOM   5312 O OP2   . DA  E 2 3   ? 18.994  -32.946 97.978  1.00 46.29 ? 3    DA  E OP2   1 
ATOM   5313 O "O5'" . DA  E 2 3   ? 19.142  -31.725 100.136 1.00 47.49 ? 3    DA  E "O5'" 1 
ATOM   5314 C "C5'" . DA  E 2 3   ? 19.552  -31.586 101.490 1.00 44.24 ? 3    DA  E "C5'" 1 
ATOM   5315 C "C4'" . DA  E 2 3   ? 19.129  -30.236 102.009 1.00 42.12 ? 3    DA  E "C4'" 1 
ATOM   5316 O "O4'" . DA  E 2 3   ? 20.118  -29.257 101.599 1.00 40.66 ? 3    DA  E "O4'" 1 
ATOM   5317 C "C3'" . DA  E 2 3   ? 17.798  -29.805 101.393 1.00 41.26 ? 3    DA  E "C3'" 1 
ATOM   5318 O "O3'" . DA  E 2 3   ? 16.794  -29.444 102.324 1.00 41.74 ? 3    DA  E "O3'" 1 
ATOM   5319 C "C2'" . DA  E 2 3   ? 18.131  -28.596 100.547 1.00 41.60 ? 3    DA  E "C2'" 1 
ATOM   5320 C "C1'" . DA  E 2 3   ? 19.490  -28.128 101.025 1.00 39.54 ? 3    DA  E "C1'" 1 
ATOM   5321 N N9    . DA  E 2 3   ? 20.233  -27.745 99.831  1.00 39.82 ? 3    DA  E N9    1 
ATOM   5322 C C8    . DA  E 2 3   ? 20.614  -28.566 98.797  1.00 39.15 ? 3    DA  E C8    1 
ATOM   5323 N N7    . DA  E 2 3   ? 21.086  -27.919 97.760  1.00 39.39 ? 3    DA  E N7    1 
ATOM   5324 C C5    . DA  E 2 3   ? 21.054  -26.589 98.156  1.00 37.23 ? 3    DA  E C5    1 
ATOM   5325 C C6    . DA  E 2 3   ? 21.392  -25.404 97.495  1.00 36.51 ? 3    DA  E C6    1 
ATOM   5326 N N6    . DA  E 2 3   ? 21.807  -25.362 96.230  1.00 35.95 ? 3    DA  E N6    1 
ATOM   5327 N N1    . DA  E 2 3   ? 21.271  -24.246 98.178  1.00 37.19 ? 3    DA  E N1    1 
ATOM   5328 C C2    . DA  E 2 3   ? 20.819  -24.290 99.436  1.00 38.43 ? 3    DA  E C2    1 
ATOM   5329 N N3    . DA  E 2 3   ? 20.442  -25.342 100.158 1.00 37.57 ? 3    DA  E N3    1 
ATOM   5330 C C4    . DA  E 2 3   ? 20.583  -26.474 99.449  1.00 37.50 ? 3    DA  E C4    1 
ATOM   5331 P P     . DG  E 2 4   ? 15.371  -28.952 101.766 1.00 41.07 ? 4    DG  E P     1 
ATOM   5332 O OP1   . DG  E 2 4   ? 14.315  -29.366 102.726 1.00 40.76 ? 4    DG  E OP1   1 
ATOM   5333 O OP2   . DG  E 2 4   ? 15.273  -29.378 100.345 1.00 38.73 ? 4    DG  E OP2   1 
ATOM   5334 O "O5'" . DG  E 2 4   ? 15.530  -27.371 101.798 1.00 38.45 ? 4    DG  E "O5'" 1 
ATOM   5335 C "C5'" . DG  E 2 4   ? 16.237  -26.746 102.864 1.00 39.47 ? 4    DG  E "C5'" 1 
ATOM   5336 C "C4'" . DG  E 2 4   ? 16.161  -25.247 102.723 1.00 40.36 ? 4    DG  E "C4'" 1 
ATOM   5337 O "O4'" . DG  E 2 4   ? 17.214  -24.788 101.829 1.00 39.29 ? 4    DG  E "O4'" 1 
ATOM   5338 C "C3'" . DG  E 2 4   ? 14.830  -24.818 102.108 1.00 41.16 ? 4    DG  E "C3'" 1 
ATOM   5339 O "O3'" . DG  E 2 4   ? 14.166  -23.784 102.818 1.00 44.18 ? 4    DG  E "O3'" 1 
ATOM   5340 C "C2'" . DG  E 2 4   ? 15.199  -24.319 100.730 1.00 41.22 ? 4    DG  E "C2'" 1 
ATOM   5341 C "C1'" . DG  E 2 4   ? 16.671  -23.951 100.824 1.00 37.85 ? 4    DG  E "C1'" 1 
ATOM   5342 N N9    . DG  E 2 4   ? 17.253  -24.326 99.541  1.00 34.58 ? 4    DG  E N9    1 
ATOM   5343 C C8    . DG  E 2 4   ? 17.247  -25.583 98.991  1.00 32.63 ? 4    DG  E C8    1 
ATOM   5344 N N7    . DG  E 2 4   ? 17.620  -25.593 97.743  1.00 31.21 ? 4    DG  E N7    1 
ATOM   5345 C C5    . DG  E 2 4   ? 17.935  -24.271 97.469  1.00 30.14 ? 4    DG  E C5    1 
ATOM   5346 C C6    . DG  E 2 4   ? 18.356  -23.662 96.267  1.00 28.63 ? 4    DG  E C6    1 
ATOM   5347 O O6    . DG  E 2 4   ? 18.476  -24.173 95.152  1.00 29.35 ? 4    DG  E O6    1 
ATOM   5348 N N1    . DG  E 2 4   ? 18.619  -22.310 96.442  1.00 27.96 ? 4    DG  E N1    1 
ATOM   5349 C C2    . DG  E 2 4   ? 18.467  -21.624 97.618  1.00 27.64 ? 4    DG  E C2    1 
ATOM   5350 N N2    . DG  E 2 4   ? 18.813  -20.330 97.595  1.00 25.83 ? 4    DG  E N2    1 
ATOM   5351 N N3    . DG  E 2 4   ? 18.019  -22.168 98.734  1.00 28.74 ? 4    DG  E N3    1 
ATOM   5352 C C4    . DG  E 2 4   ? 17.777  -23.485 98.589  1.00 30.10 ? 4    DG  E C4    1 
ATOM   5353 P P     . DA  E 2 5   ? 12.698  -23.329 102.337 1.00 44.76 ? 5    DA  E P     1 
ATOM   5354 O OP1   . DA  E 2 5   ? 11.823  -23.230 103.540 1.00 48.06 ? 5    DA  E OP1   1 
ATOM   5355 O OP2   . DA  E 2 5   ? 12.296  -24.204 101.209 1.00 41.83 ? 5    DA  E OP2   1 
ATOM   5356 O "O5'" . DA  E 2 5   ? 12.956  -21.867 101.767 1.00 41.06 ? 5    DA  E "O5'" 1 
ATOM   5357 C "C5'" . DA  E 2 5   ? 14.022  -21.649 100.859 1.00 42.67 ? 5    DA  E "C5'" 1 
ATOM   5358 C "C4'" . DA  E 2 5   ? 14.318  -20.177 100.732 1.00 41.39 ? 5    DA  E "C4'" 1 
ATOM   5359 O "O4'" . DA  E 2 5   ? 15.399  -20.066 99.778  1.00 40.68 ? 5    DA  E "O4'" 1 
ATOM   5360 C "C3'" . DA  E 2 5   ? 13.140  -19.402 100.151 1.00 41.02 ? 5    DA  E "C3'" 1 
ATOM   5361 O "O3'" . DA  E 2 5   ? 12.826  -18.219 100.865 1.00 39.43 ? 5    DA  E "O3'" 1 
ATOM   5362 C "C2'" . DA  E 2 5   ? 13.517  -19.087 98.719  1.00 39.90 ? 5    DA  E "C2'" 1 
ATOM   5363 C "C1'" . DA  E 2 5   ? 14.962  -19.513 98.545  1.00 39.67 ? 5    DA  E "C1'" 1 
ATOM   5364 N N9    . DA  E 2 5   ? 14.975  -20.580 97.545  1.00 35.98 ? 5    DA  E N9    1 
ATOM   5365 C C8    . DA  E 2 5   ? 14.481  -21.847 97.710  1.00 35.17 ? 5    DA  E C8    1 
ATOM   5366 N N7    . DA  E 2 5   ? 14.493  -22.567 96.619  1.00 35.18 ? 5    DA  E N7    1 
ATOM   5367 C C5    . DA  E 2 5   ? 15.060  -21.727 95.675  1.00 32.97 ? 5    DA  E C5    1 
ATOM   5368 C C6    . DA  E 2 5   ? 15.332  -21.898 94.315  1.00 31.57 ? 5    DA  E C6    1 
ATOM   5369 N N6    . DA  E 2 5   ? 15.039  -23.015 93.641  1.00 28.77 ? 5    DA  E N6    1 
ATOM   5370 N N1    . DA  E 2 5   ? 15.913  -20.871 93.658  1.00 31.94 ? 5    DA  E N1    1 
ATOM   5371 C C2    . DA  E 2 5   ? 16.186  -19.748 94.337  1.00 32.07 ? 5    DA  E C2    1 
ATOM   5372 N N3    . DA  E 2 5   ? 15.965  -19.465 95.617  1.00 32.82 ? 5    DA  E N3    1 
ATOM   5373 C C4    . DA  E 2 5   ? 15.392  -20.509 96.238  1.00 34.24 ? 5    DA  E C4    1 
ATOM   5374 P P     . DC  E 2 6   ? 11.413  -17.515 100.595 1.00 37.40 ? 6    DC  E P     1 
ATOM   5375 O OP1   . DC  E 2 6   ? 11.179  -16.540 101.692 1.00 42.14 ? 6    DC  E OP1   1 
ATOM   5376 O OP2   . DC  E 2 6   ? 10.409  -18.575 100.330 1.00 37.40 ? 6    DC  E OP2   1 
ATOM   5377 O "O5'" . DC  E 2 6   ? 11.665  -16.733 99.237  1.00 34.81 ? 6    DC  E "O5'" 1 
ATOM   5378 C "C5'" . DC  E 2 6   ? 12.736  -15.805 99.127  1.00 33.79 ? 6    DC  E "C5'" 1 
ATOM   5379 C "C4'" . DC  E 2 6   ? 12.625  -15.054 97.825  1.00 34.40 ? 6    DC  E "C4'" 1 
ATOM   5380 O "O4'" . DC  E 2 6   ? 13.245  -15.829 96.770  1.00 33.03 ? 6    DC  E "O4'" 1 
ATOM   5381 C "C3'" . DC  E 2 6   ? 11.166  -14.852 97.426  1.00 35.13 ? 6    DC  E "C3'" 1 
ATOM   5382 O "O3'" . DC  E 2 6   ? 10.793  -13.494 97.288  1.00 37.95 ? 6    DC  E "O3'" 1 
ATOM   5383 C "C2'" . DC  E 2 6   ? 10.988  -15.611 96.128  1.00 34.66 ? 6    DC  E "C2'" 1 
ATOM   5384 C "C1'" . DC  E 2 6   ? 12.391  -15.933 95.645  1.00 32.11 ? 6    DC  E "C1'" 1 
ATOM   5385 N N1    . DC  E 2 6   ? 12.437  -17.323 95.176  1.00 30.13 ? 6    DC  E N1    1 
ATOM   5386 C C2    . DC  E 2 6   ? 13.010  -17.610 93.938  1.00 28.85 ? 6    DC  E C2    1 
ATOM   5387 O O2    . DC  E 2 6   ? 13.548  -16.696 93.299  1.00 28.18 ? 6    DC  E O2    1 
ATOM   5388 N N3    . DC  E 2 6   ? 12.960  -18.878 93.470  1.00 28.03 ? 6    DC  E N3    1 
ATOM   5389 C C4    . DC  E 2 6   ? 12.375  -19.837 94.196  1.00 29.30 ? 6    DC  E C4    1 
ATOM   5390 N N4    . DC  E 2 6   ? 12.301  -21.063 93.677  1.00 27.76 ? 6    DC  E N4    1 
ATOM   5391 C C5    . DC  E 2 6   ? 11.829  -19.578 95.484  1.00 29.24 ? 6    DC  E C5    1 
ATOM   5392 C C6    . DC  E 2 6   ? 11.885  -18.321 95.932  1.00 30.10 ? 6    DC  E C6    1 
ATOM   5393 P P     . DC  E 2 7   ? 9.348   -13.044 97.822  1.00 37.94 ? 7    DC  E P     1 
ATOM   5394 O OP1   . DC  E 2 7   ? 9.318   -11.561 97.905  1.00 39.06 ? 7    DC  E OP1   1 
ATOM   5395 O OP2   . DC  E 2 7   ? 9.020   -13.860 99.018  1.00 36.07 ? 7    DC  E OP2   1 
ATOM   5396 O "O5'" . DC  E 2 7   ? 8.378   -13.527 96.662  1.00 36.74 ? 7    DC  E "O5'" 1 
ATOM   5397 C "C5'" . DC  E 2 7   ? 8.628   -13.161 95.316  1.00 34.90 ? 7    DC  E "C5'" 1 
ATOM   5398 C "C4'" . DC  E 2 7   ? 7.556   -13.741 94.433  1.00 33.12 ? 7    DC  E "C4'" 1 
ATOM   5399 O "O4'" . DC  E 2 7   ? 7.905   -15.087 94.029  1.00 33.70 ? 7    DC  E "O4'" 1 
ATOM   5400 C "C3'" . DC  E 2 7   ? 6.217   -13.836 95.155  1.00 33.22 ? 7    DC  E "C3'" 1 
ATOM   5401 O "O3'" . DC  E 2 7   ? 5.202   -13.191 94.414  1.00 33.96 ? 7    DC  E "O3'" 1 
ATOM   5402 C "C2'" . DC  E 2 7   ? 5.947   -15.328 95.273  1.00 34.05 ? 7    DC  E "C2'" 1 
ATOM   5403 C "C1'" . DC  E 2 7   ? 6.787   -15.944 94.168  1.00 32.38 ? 7    DC  E "C1'" 1 
ATOM   5404 N N1    . DC  E 2 7   ? 7.292   -17.290 94.496  1.00 31.65 ? 7    DC  E N1    1 
ATOM   5405 C C2    . DC  E 2 7   ? 7.001   -18.356 93.638  1.00 30.43 ? 7    DC  E C2    1 
ATOM   5406 O O2    . DC  E 2 7   ? 6.354   -18.138 92.608  1.00 32.41 ? 7    DC  E O2    1 
ATOM   5407 N N3    . DC  E 2 7   ? 7.437   -19.596 93.952  1.00 29.70 ? 7    DC  E N3    1 
ATOM   5408 C C4    . DC  E 2 7   ? 8.143   -19.794 95.069  1.00 30.07 ? 7    DC  E C4    1 
ATOM   5409 N N4    . DC  E 2 7   ? 8.548   -21.039 95.343  1.00 30.01 ? 7    DC  E N4    1 
ATOM   5410 C C5    . DC  E 2 7   ? 8.465   -18.727 95.955  1.00 30.10 ? 7    DC  E C5    1 
ATOM   5411 C C6    . DC  E 2 7   ? 8.027   -17.502 95.631  1.00 32.42 ? 7    DC  E C6    1 
ATOM   5412 P P     . DT  E 2 8   ? 3.735   -13.078 95.034  1.00 33.19 ? 8    DT  E P     1 
ATOM   5413 O OP1   . DT  E 2 8   ? 3.239   -11.713 94.737  1.00 33.65 ? 8    DT  E OP1   1 
ATOM   5414 O OP2   . DT  E 2 8   ? 3.754   -13.575 96.432  1.00 33.01 ? 8    DT  E OP2   1 
ATOM   5415 O "O5'" . DT  E 2 8   ? 2.928   -14.087 94.122  1.00 32.79 ? 8    DT  E "O5'" 1 
ATOM   5416 C "C5'" . DT  E 2 8   ? 2.974   -13.924 92.716  1.00 31.59 ? 8    DT  E "C5'" 1 
ATOM   5417 C "C4'" . DT  E 2 8   ? 2.113   -14.961 92.049  1.00 30.48 ? 8    DT  E "C4'" 1 
ATOM   5418 O "O4'" . DT  E 2 8   ? 2.828   -16.217 91.986  1.00 27.35 ? 8    DT  E "O4'" 1 
ATOM   5419 C "C3'" . DT  E 2 8   ? 0.794   -15.233 92.774  1.00 31.01 ? 8    DT  E "C3'" 1 
ATOM   5420 O "O3'" . DT  E 2 8   ? -0.266  -15.135 91.833  1.00 35.09 ? 8    DT  E "O3'" 1 
ATOM   5421 C "C2'" . DT  E 2 8   ? 0.957   -16.644 93.319  1.00 27.97 ? 8    DT  E "C2'" 1 
ATOM   5422 C "C1'" . DT  E 2 8   ? 1.951   -17.264 92.347  1.00 28.19 ? 8    DT  E "C1'" 1 
ATOM   5423 N N1    . DT  E 2 8   ? 2.762   -18.373 92.883  1.00 25.75 ? 8    DT  E N1    1 
ATOM   5424 C C2    . DT  E 2 8   ? 3.083   -19.404 92.028  1.00 23.42 ? 8    DT  E C2    1 
ATOM   5425 O O2    . DT  E 2 8   ? 2.768   -19.416 90.851  1.00 23.25 ? 8    DT  E O2    1 
ATOM   5426 N N3    . DT  E 2 8   ? 3.797   -20.421 92.603  1.00 21.57 ? 8    DT  E N3    1 
ATOM   5427 C C4    . DT  E 2 8   ? 4.226   -20.506 93.909  1.00 22.36 ? 8    DT  E C4    1 
ATOM   5428 O O4    . DT  E 2 8   ? 4.856   -21.492 94.283  1.00 25.04 ? 8    DT  E O4    1 
ATOM   5429 C C5    . DT  E 2 8   ? 3.877   -19.381 94.747  1.00 22.70 ? 8    DT  E C5    1 
ATOM   5430 C C7    . DT  E 2 8   ? 4.314   -19.379 96.178  1.00 21.46 ? 8    DT  E C7    1 
ATOM   5431 C C6    . DT  E 2 8   ? 3.171   -18.383 94.198  1.00 22.97 ? 8    DT  E C6    1 
ATOM   5432 P P     . DG  E 2 9   ? -1.772  -15.458 92.273  1.00 38.64 ? 9    DG  E P     1 
ATOM   5433 O OP1   . DG  E 2 9   ? -2.636  -14.381 91.735  1.00 40.24 ? 9    DG  E OP1   1 
ATOM   5434 O OP2   . DG  E 2 9   ? -1.831  -15.808 93.710  1.00 43.75 ? 9    DG  E OP2   1 
ATOM   5435 O "O5'" . DG  E 2 9   ? -2.032  -16.751 91.404  1.00 41.90 ? 9    DG  E "O5'" 1 
ATOM   5436 C "C5'" . DG  E 2 9   ? -1.322  -16.873 90.184  1.00 41.60 ? 9    DG  E "C5'" 1 
ATOM   5437 C "C4'" . DG  E 2 9   ? -1.396  -18.280 89.661  1.00 39.05 ? 9    DG  E "C4'" 1 
ATOM   5438 O "O4'" . DG  E 2 9   ? -0.377  -19.141 90.223  1.00 38.66 ? 9    DG  E "O4'" 1 
ATOM   5439 C "C3'" . DG  E 2 9   ? -2.735  -18.968 89.886  1.00 38.01 ? 9    DG  E "C3'" 1 
ATOM   5440 O "O3'" . DG  E 2 9   ? -3.121  -19.507 88.640  1.00 40.00 ? 9    DG  E "O3'" 1 
ATOM   5441 C "C2'" . DG  E 2 9   ? -2.397  -20.085 90.859  1.00 38.15 ? 9    DG  E "C2'" 1 
ATOM   5442 C "C1'" . DG  E 2 9   ? -0.962  -20.399 90.472  1.00 35.22 ? 9    DG  E "C1'" 1 
ATOM   5443 N N9    . DG  E 2 9   ? -0.175  -21.085 91.494  1.00 30.59 ? 9    DG  E N9    1 
ATOM   5444 C C8    . DG  E 2 9   ? -0.066  -20.762 92.823  1.00 28.25 ? 9    DG  E C8    1 
ATOM   5445 N N7    . DG  E 2 9   ? 0.653   -21.620 93.499  1.00 27.03 ? 9    DG  E N7    1 
ATOM   5446 C C5    . DG  E 2 9   ? 1.051   -22.556 92.556  1.00 25.86 ? 9    DG  E C5    1 
ATOM   5447 C C6    . DG  E 2 9   ? 1.827   -23.741 92.700  1.00 25.93 ? 9    DG  E C6    1 
ATOM   5448 O O6    . DG  E 2 9   ? 2.309   -24.226 93.728  1.00 25.17 ? 9    DG  E O6    1 
ATOM   5449 N N1    . DG  E 2 9   ? 2.007   -24.385 91.481  1.00 23.46 ? 9    DG  E N1    1 
ATOM   5450 C C2    . DG  E 2 9   ? 1.501   -23.957 90.280  1.00 22.66 ? 9    DG  E C2    1 
ATOM   5451 N N2    . DG  E 2 9   ? 1.795   -24.712 89.210  1.00 20.27 ? 9    DG  E N2    1 
ATOM   5452 N N3    . DG  E 2 9   ? 0.763   -22.869 90.136  1.00 23.42 ? 9    DG  E N3    1 
ATOM   5453 C C4    . DG  E 2 9   ? 0.576   -22.224 91.307  1.00 26.85 ? 9    DG  E C4    1 
ATOM   5454 P P     . DG  E 2 10  ? -4.584  -20.104 88.448  1.00 38.90 ? 10   DG  E P     1 
ATOM   5455 O OP1   . DG  E 2 10  ? -5.304  -19.141 87.577  1.00 38.54 ? 10   DG  E OP1   1 
ATOM   5456 O OP2   . DG  E 2 10  ? -5.152  -20.485 89.767  1.00 36.64 ? 10   DG  E OP2   1 
ATOM   5457 O "O5'" . DG  E 2 10  ? -4.272  -21.410 87.601  1.00 34.85 ? 10   DG  E "O5'" 1 
ATOM   5458 C "C5'" . DG  E 2 10  ? -3.312  -21.353 86.553  1.00 32.39 ? 10   DG  E "C5'" 1 
ATOM   5459 C "C4'" . DG  E 2 10  ? -2.962  -22.747 86.103  1.00 33.39 ? 10   DG  E "C4'" 1 
ATOM   5460 O "O4'" . DG  E 2 10  ? -2.109  -23.369 87.090  1.00 30.64 ? 10   DG  E "O4'" 1 
ATOM   5461 C "C3'" . DG  E 2 10  ? -4.185  -23.649 85.954  1.00 32.83 ? 10   DG  E "C3'" 1 
ATOM   5462 O "O3'" . DG  E 2 10  ? -4.058  -24.465 84.794  1.00 36.53 ? 10   DG  E "O3'" 1 
ATOM   5463 C "C2'" . DG  E 2 10  ? -4.187  -24.471 87.231  1.00 30.07 ? 10   DG  E "C2'" 1 
ATOM   5464 C "C1'" . DG  E 2 10  ? -2.715  -24.541 87.614  1.00 29.14 ? 10   DG  E "C1'" 1 
ATOM   5465 N N9    . DG  E 2 10  ? -2.462  -24.556 89.054  1.00 25.18 ? 10   DG  E N9    1 
ATOM   5466 C C8    . DG  E 2 10  ? -2.901  -23.640 89.979  1.00 25.67 ? 10   DG  E C8    1 
ATOM   5467 N N7    . DG  E 2 10  ? -2.501  -23.908 91.194  1.00 26.66 ? 10   DG  E N7    1 
ATOM   5468 C C5    . DG  E 2 10  ? -1.754  -25.070 91.064  1.00 24.57 ? 10   DG  E C5    1 
ATOM   5469 C C6    . DG  E 2 10  ? -1.059  -25.835 92.042  1.00 26.48 ? 10   DG  E C6    1 
ATOM   5470 O O6    . DG  E 2 10  ? -0.955  -25.625 93.259  1.00 30.20 ? 10   DG  E O6    1 
ATOM   5471 N N1    . DG  E 2 10  ? -0.441  -26.946 91.478  1.00 25.31 ? 10   DG  E N1    1 
ATOM   5472 C C2    . DG  E 2 10  ? -0.482  -27.278 90.147  1.00 25.03 ? 10   DG  E C2    1 
ATOM   5473 N N2    . DG  E 2 10  ? 0.168   -28.393 89.798  1.00 25.44 ? 10   DG  E N2    1 
ATOM   5474 N N3    . DG  E 2 10  ? -1.116  -26.570 89.225  1.00 25.40 ? 10   DG  E N3    1 
ATOM   5475 C C4    . DG  E 2 10  ? -1.726  -25.488 89.750  1.00 24.69 ? 10   DG  E C4    1 
ATOM   5476 P P     . DA  E 2 11  ? -5.283  -25.395 84.344  1.00 39.07 ? 11   DA  E P     1 
ATOM   5477 O OP1   . DA  E 2 11  ? -5.191  -25.545 82.873  1.00 38.62 ? 11   DA  E OP1   1 
ATOM   5478 O OP2   . DA  E 2 11  ? -6.541  -24.884 84.961  1.00 39.70 ? 11   DA  E OP2   1 
ATOM   5479 O "O5'" . DA  E 2 11  ? -4.924  -26.789 85.013  1.00 36.62 ? 11   DA  E "O5'" 1 
ATOM   5480 C "C5'" . DA  E 2 11  ? -3.664  -27.391 84.765  1.00 33.85 ? 11   DA  E "C5'" 1 
ATOM   5481 C "C4'" . DA  E 2 11  ? -3.572  -28.712 85.489  1.00 33.30 ? 11   DA  E "C4'" 1 
ATOM   5482 O "O4'" . DA  E 2 11  ? -3.204  -28.514 86.875  1.00 30.31 ? 11   DA  E "O4'" 1 
ATOM   5483 C "C3'" . DA  E 2 11  ? -4.870  -29.520 85.492  1.00 32.33 ? 11   DA  E "C3'" 1 
ATOM   5484 O "O3'" . DA  E 2 11  ? -4.574  -30.877 85.175  1.00 34.04 ? 11   DA  E "O3'" 1 
ATOM   5485 C "C2'" . DA  E 2 11  ? -5.385  -29.371 86.916  1.00 31.14 ? 11   DA  E "C2'" 1 
ATOM   5486 C "C1'" . DA  E 2 11  ? -4.102  -29.215 87.720  1.00 30.21 ? 11   DA  E "C1'" 1 
ATOM   5487 N N9    . DA  E 2 11  ? -4.233  -28.448 88.961  1.00 28.83 ? 11   DA  E N9    1 
ATOM   5488 C C8    . DA  E 2 11  ? -4.936  -27.285 89.177  1.00 27.81 ? 11   DA  E C8    1 
ATOM   5489 N N7    . DA  E 2 11  ? -4.845  -26.833 90.406  1.00 27.07 ? 11   DA  E N7    1 
ATOM   5490 C C5    . DA  E 2 11  ? -4.030  -27.760 91.045  1.00 27.33 ? 11   DA  E C5    1 
ATOM   5491 C C6    . DA  E 2 11  ? -3.547  -27.852 92.366  1.00 27.13 ? 11   DA  E C6    1 
ATOM   5492 N N6    . DA  E 2 11  ? -3.843  -26.979 93.333  1.00 25.00 ? 11   DA  E N6    1 
ATOM   5493 N N1    . DA  E 2 11  ? -2.742  -28.894 92.667  1.00 28.04 ? 11   DA  E N1    1 
ATOM   5494 C C2    . DA  E 2 11  ? -2.459  -29.786 91.708  1.00 27.06 ? 11   DA  E C2    1 
ATOM   5495 N N3    . DA  E 2 11  ? -2.859  -29.814 90.440  1.00 27.73 ? 11   DA  E N3    1 
ATOM   5496 C C4    . DA  E 2 11  ? -3.648  -28.761 90.167  1.00 27.87 ? 11   DA  E C4    1 
ATOM   5497 P P     . DC  E 2 12  ? -5.750  -31.965 85.136  1.00 35.73 ? 12   DC  E P     1 
ATOM   5498 O OP1   . DC  E 2 12  ? -5.348  -32.984 84.130  1.00 34.77 ? 12   DC  E OP1   1 
ATOM   5499 O OP2   . DC  E 2 12  ? -7.063  -31.288 85.010  1.00 38.93 ? 12   DC  E OP2   1 
ATOM   5500 O "O5'" . DC  E 2 12  ? -5.659  -32.619 86.579  1.00 38.41 ? 12   DC  E "O5'" 1 
ATOM   5501 C "C5'" . DC  E 2 12  ? -4.436  -33.191 87.027  1.00 41.15 ? 12   DC  E "C5'" 1 
ATOM   5502 C "C4'" . DC  E 2 12  ? -4.595  -33.734 88.425  1.00 43.59 ? 12   DC  E "C4'" 1 
ATOM   5503 O "O4'" . DC  E 2 12  ? -4.619  -32.651 89.388  1.00 44.47 ? 12   DC  E "O4'" 1 
ATOM   5504 C "C3'" . DC  E 2 12  ? -5.883  -34.528 88.643  1.00 46.00 ? 12   DC  E "C3'" 1 
ATOM   5505 O "O3'" . DC  E 2 12  ? -5.600  -35.685 89.427  1.00 51.47 ? 12   DC  E "O3'" 1 
ATOM   5506 C "C2'" . DC  E 2 12  ? -6.759  -33.569 89.431  1.00 44.69 ? 12   DC  E "C2'" 1 
ATOM   5507 C "C1'" . DC  E 2 12  ? -5.719  -32.838 90.258  1.00 43.74 ? 12   DC  E "C1'" 1 
ATOM   5508 N N1    . DC  E 2 12  ? -6.123  -31.526 90.785  1.00 40.82 ? 12   DC  E N1    1 
ATOM   5509 C C2    . DC  E 2 12  ? -5.755  -31.200 92.086  1.00 40.18 ? 12   DC  E C2    1 
ATOM   5510 O O2    . DC  E 2 12  ? -5.073  -32.009 92.725  1.00 41.18 ? 12   DC  E O2    1 
ATOM   5511 N N3    . DC  E 2 12  ? -6.146  -30.020 92.615  1.00 39.36 ? 12   DC  E N3    1 
ATOM   5512 C C4    . DC  E 2 12  ? -6.872  -29.173 91.885  1.00 40.60 ? 12   DC  E C4    1 
ATOM   5513 N N4    . DC  E 2 12  ? -7.251  -28.025 92.452  1.00 39.49 ? 12   DC  E N4    1 
ATOM   5514 C C5    . DC  E 2 12  ? -7.247  -29.469 90.539  1.00 41.03 ? 12   DC  E C5    1 
ATOM   5515 C C6    . DC  E 2 12  ? -6.854  -30.647 90.034  1.00 41.30 ? 12   DC  E C6    1 
ATOM   5516 P P     . DG  E 2 13  ? -6.696  -36.853 89.547  1.00 54.18 ? 13   DG  E P     1 
ATOM   5517 O OP1   . DG  E 2 13  ? -6.031  -38.104 89.094  1.00 54.19 ? 13   DG  E OP1   1 
ATOM   5518 O OP2   . DG  E 2 13  ? -7.956  -36.411 88.894  1.00 53.43 ? 13   DG  E OP2   1 
ATOM   5519 O "O5'" . DG  E 2 13  ? -6.961  -36.946 91.115  1.00 53.57 ? 13   DG  E "O5'" 1 
ATOM   5520 C "C5'" . DG  E 2 13  ? -5.937  -37.387 92.006  1.00 51.42 ? 13   DG  E "C5'" 1 
ATOM   5521 C "C4'" . DG  E 2 13  ? -6.443  -37.380 93.431  1.00 50.53 ? 13   DG  E "C4'" 1 
ATOM   5522 O "O4'" . DG  E 2 13  ? -6.490  -36.025 93.944  1.00 48.14 ? 13   DG  E "O4'" 1 
ATOM   5523 C "C3'" . DG  E 2 13  ? -7.850  -37.952 93.618  1.00 49.07 ? 13   DG  E "C3'" 1 
ATOM   5524 O "O3'" . DG  E 2 13  ? -7.983  -38.555 94.903  1.00 52.08 ? 13   DG  E "O3'" 1 
ATOM   5525 C "C2'" . DG  E 2 13  ? -8.714  -36.706 93.677  1.00 47.76 ? 13   DG  E "C2'" 1 
ATOM   5526 C "C1'" . DG  E 2 13  ? -7.799  -35.737 94.407  1.00 45.89 ? 13   DG  E "C1'" 1 
ATOM   5527 N N9    . DG  E 2 13  ? -8.067  -34.326 94.148  1.00 44.51 ? 13   DG  E N9    1 
ATOM   5528 C C8    . DG  E 2 13  ? -8.284  -33.734 92.928  1.00 43.28 ? 13   DG  E C8    1 
ATOM   5529 N N7    . DG  E 2 13  ? -8.493  -32.447 93.015  1.00 43.01 ? 13   DG  E N7    1 
ATOM   5530 C C5    . DG  E 2 13  ? -8.408  -32.174 94.373  1.00 41.62 ? 13   DG  E C5    1 
ATOM   5531 C C6    . DG  E 2 13  ? -8.543  -30.947 95.073  1.00 41.87 ? 13   DG  E C6    1 
ATOM   5532 O O6    . DG  E 2 13  ? -8.762  -29.819 94.617  1.00 42.40 ? 13   DG  E O6    1 
ATOM   5533 N N1    . DG  E 2 13  ? -8.393  -31.120 96.444  1.00 40.78 ? 13   DG  E N1    1 
ATOM   5534 C C2    . DG  E 2 13  ? -8.137  -32.320 97.064  1.00 42.38 ? 13   DG  E C2    1 
ATOM   5535 N N2    . DG  E 2 13  ? -8.025  -32.284 98.404  1.00 40.67 ? 13   DG  E N2    1 
ATOM   5536 N N3    . DG  E 2 13  ? -8.001  -33.471 96.419  1.00 41.85 ? 13   DG  E N3    1 
ATOM   5537 C C4    . DG  E 2 13  ? -8.149  -33.323 95.087  1.00 42.09 ? 13   DG  E C4    1 
ATOM   5538 O "O5'" . DC  F 3 1   ? -8.077  -24.239 102.073 1.00 68.65 ? 14   DC  F "O5'" 1 
ATOM   5539 C "C5'" . DC  F 3 1   ? -8.035  -24.770 103.400 1.00 68.08 ? 14   DC  F "C5'" 1 
ATOM   5540 C "C4'" . DC  F 3 1   ? -7.872  -26.273 103.460 1.00 67.05 ? 14   DC  F "C4'" 1 
ATOM   5541 O "O4'" . DC  F 3 1   ? -8.770  -26.867 102.485 1.00 65.93 ? 14   DC  F "O4'" 1 
ATOM   5542 C "C3'" . DC  F 3 1   ? -6.465  -26.772 103.119 1.00 67.02 ? 14   DC  F "C3'" 1 
ATOM   5543 O "O3'" . DC  F 3 1   ? -5.914  -27.631 104.116 1.00 67.37 ? 14   DC  F "O3'" 1 
ATOM   5544 C "C2'" . DC  F 3 1   ? -6.631  -27.556 101.834 1.00 66.63 ? 14   DC  F "C2'" 1 
ATOM   5545 C "C1'" . DC  F 3 1   ? -8.105  -27.896 101.771 1.00 66.03 ? 14   DC  F "C1'" 1 
ATOM   5546 N N1    . DC  F 3 1   ? -8.509  -27.825 100.363 1.00 65.45 ? 14   DC  F N1    1 
ATOM   5547 C C2    . DC  F 3 1   ? -8.750  -29.010 99.665  1.00 64.35 ? 14   DC  F C2    1 
ATOM   5548 O O2    . DC  F 3 1   ? -8.792  -30.079 100.289 1.00 64.43 ? 14   DC  F O2    1 
ATOM   5549 N N3    . DC  F 3 1   ? -8.935  -28.959 98.330  1.00 63.86 ? 14   DC  F N3    1 
ATOM   5550 C C4    . DC  F 3 1   ? -8.914  -27.783 97.699  1.00 63.73 ? 14   DC  F C4    1 
ATOM   5551 N N4    . DC  F 3 1   ? -9.028  -27.788 96.372  1.00 63.60 ? 14   DC  F N4    1 
ATOM   5552 C C5    . DC  F 3 1   ? -8.761  -26.553 98.402  1.00 64.48 ? 14   DC  F C5    1 
ATOM   5553 C C6    . DC  F 3 1   ? -8.571  -26.620 99.722  1.00 65.03 ? 14   DC  F C6    1 
ATOM   5554 P P     . DG  F 3 2   ? -4.329  -27.909 104.117 1.00 67.30 ? 15   DG  F P     1 
ATOM   5555 O OP1   . DG  F 3 2   ? -3.755  -27.451 105.411 1.00 67.40 ? 15   DG  F OP1   1 
ATOM   5556 O OP2   . DG  F 3 2   ? -3.785  -27.369 102.843 1.00 65.15 ? 15   DG  F OP2   1 
ATOM   5557 O "O5'" . DG  F 3 2   ? -4.242  -29.496 104.069 1.00 65.51 ? 15   DG  F "O5'" 1 
ATOM   5558 C "C5'" . DG  F 3 2   ? -5.066  -30.223 103.170 1.00 63.26 ? 15   DG  F "C5'" 1 
ATOM   5559 C "C4'" . DG  F 3 2   ? -4.238  -31.216 102.395 1.00 61.72 ? 15   DG  F "C4'" 1 
ATOM   5560 O "O4'" . DG  F 3 2   ? -4.807  -31.286 101.064 1.00 61.04 ? 15   DG  F "O4'" 1 
ATOM   5561 C "C3'" . DG  F 3 2   ? -2.787  -30.774 102.207 1.00 61.12 ? 15   DG  F "C3'" 1 
ATOM   5562 O "O3'" . DG  F 3 2   ? -1.906  -31.897 102.199 1.00 60.44 ? 15   DG  F "O3'" 1 
ATOM   5563 C "C2'" . DG  F 3 2   ? -2.792  -30.098 100.853 1.00 60.67 ? 15   DG  F "C2'" 1 
ATOM   5564 C "C1'" . DG  F 3 2   ? -3.852  -30.875 100.100 1.00 59.08 ? 15   DG  F "C1'" 1 
ATOM   5565 N N9    . DG  F 3 2   ? -4.528  -30.052 99.105  1.00 56.56 ? 15   DG  F N9    1 
ATOM   5566 C C8    . DG  F 3 2   ? -5.035  -28.787 99.279  1.00 55.24 ? 15   DG  F C8    1 
ATOM   5567 N N7    . DG  F 3 2   ? -5.502  -28.268 98.178  1.00 54.63 ? 15   DG  F N7    1 
ATOM   5568 C C5    . DG  F 3 2   ? -5.309  -29.258 97.225  1.00 53.75 ? 15   DG  F C5    1 
ATOM   5569 C C6    . DG  F 3 2   ? -5.599  -29.268 95.840  1.00 53.71 ? 15   DG  F C6    1 
ATOM   5570 O O6    . DG  F 3 2   ? -6.087  -28.365 95.149  1.00 54.27 ? 15   DG  F O6    1 
ATOM   5571 N N1    . DG  F 3 2   ? -5.249  -30.481 95.254  1.00 53.01 ? 15   DG  F N1    1 
ATOM   5572 C C2    . DG  F 3 2   ? -4.683  -31.544 95.914  1.00 52.36 ? 15   DG  F C2    1 
ATOM   5573 N N2    . DG  F 3 2   ? -4.420  -32.634 95.178  1.00 51.46 ? 15   DG  F N2    1 
ATOM   5574 N N3    . DG  F 3 2   ? -4.396  -31.540 97.201  1.00 53.25 ? 15   DG  F N3    1 
ATOM   5575 C C4    . DG  F 3 2   ? -4.732  -30.374 97.789  1.00 54.00 ? 15   DG  F C4    1 
ATOM   5576 P P     . DT  F 3 3   ? -0.331  -31.667 101.977 1.00 60.32 ? 16   DT  F P     1 
ATOM   5577 O OP1   . DT  F 3 3   ? 0.393   -32.515 102.958 1.00 60.56 ? 16   DT  F OP1   1 
ATOM   5578 O OP2   . DT  F 3 3   ? -0.073  -30.204 101.941 1.00 61.11 ? 16   DT  F OP2   1 
ATOM   5579 O "O5'" . DT  F 3 3   ? -0.071  -32.249 100.519 1.00 58.56 ? 16   DT  F "O5'" 1 
ATOM   5580 C "C5'" . DT  F 3 3   ? -0.468  -33.576 100.187 1.00 56.18 ? 16   DT  F "C5'" 1 
ATOM   5581 C "C4'" . DT  F 3 3   ? -0.066  -33.899 98.768  1.00 53.54 ? 16   DT  F "C4'" 1 
ATOM   5582 O "O4'" . DT  F 3 3   ? -0.905  -33.167 97.840  1.00 52.61 ? 16   DT  F "O4'" 1 
ATOM   5583 C "C3'" . DT  F 3 3   ? 1.376   -33.511 98.443  1.00 52.77 ? 16   DT  F "C3'" 1 
ATOM   5584 O "O3'" . DT  F 3 3   ? 1.990   -34.507 97.628  1.00 52.46 ? 16   DT  F "O3'" 1 
ATOM   5585 C "C2'" . DT  F 3 3   ? 1.231   -32.213 97.672  1.00 51.47 ? 16   DT  F "C2'" 1 
ATOM   5586 C "C1'" . DT  F 3 3   ? -0.097  -32.401 96.958  1.00 50.04 ? 16   DT  F "C1'" 1 
ATOM   5587 N N1    . DT  F 3 3   ? -0.798  -31.133 96.672  1.00 47.15 ? 16   DT  F N1    1 
ATOM   5588 C C2    . DT  F 3 3   ? -1.256  -30.920 95.393  1.00 43.22 ? 16   DT  F C2    1 
ATOM   5589 O O2    . DT  F 3 3   ? -1.158  -31.748 94.506  1.00 44.49 ? 16   DT  F O2    1 
ATOM   5590 N N3    . DT  F 3 3   ? -1.837  -29.697 95.191  1.00 40.88 ? 16   DT  F N3    1 
ATOM   5591 C C4    . DT  F 3 3   ? -2.009  -28.689 96.120  1.00 41.21 ? 16   DT  F C4    1 
ATOM   5592 O O4    . DT  F 3 3   ? -2.525  -27.629 95.781  1.00 39.91 ? 16   DT  F O4    1 
ATOM   5593 C C5    . DT  F 3 3   ? -1.535  -28.992 97.452  1.00 41.59 ? 16   DT  F C5    1 
ATOM   5594 C C7    . DT  F 3 3   ? -1.699  -27.970 98.532  1.00 42.33 ? 16   DT  F C7    1 
ATOM   5595 C C6    . DT  F 3 3   ? -0.965  -30.184 97.660  1.00 43.84 ? 16   DT  F C6    1 
ATOM   5596 P P     . DC  F 3 4   ? 3.573   -34.449 97.366  1.00 53.03 ? 17   DC  F P     1 
ATOM   5597 O OP1   . DC  F 3 4   ? 4.104   -35.831 97.509  1.00 51.45 ? 17   DC  F OP1   1 
ATOM   5598 O OP2   . DC  F 3 4   ? 4.138   -33.350 98.191  1.00 51.19 ? 17   DC  F OP2   1 
ATOM   5599 O "O5'" . DC  F 3 4   ? 3.669   -34.037 95.833  1.00 49.71 ? 17   DC  F "O5'" 1 
ATOM   5600 C "C5'" . DC  F 3 4   ? 3.067   -34.851 94.837  1.00 45.03 ? 17   DC  F "C5'" 1 
ATOM   5601 C "C4'" . DC  F 3 4   ? 3.179   -34.193 93.483  1.00 43.38 ? 17   DC  F "C4'" 1 
ATOM   5602 O "O4'" . DC  F 3 4   ? 2.255   -33.080 93.401  1.00 42.10 ? 17   DC  F "O4'" 1 
ATOM   5603 C "C3'" . DC  F 3 4   ? 4.567   -33.639 93.147  1.00 41.52 ? 17   DC  F "C3'" 1 
ATOM   5604 O "O3'" . DC  F 3 4   ? 4.956   -34.043 91.831  1.00 39.00 ? 17   DC  F "O3'" 1 
ATOM   5605 C "C2'" . DC  F 3 4   ? 4.388   -32.132 93.236  1.00 39.74 ? 17   DC  F "C2'" 1 
ATOM   5606 C "C1'" . DC  F 3 4   ? 2.919   -31.941 92.886  1.00 40.77 ? 17   DC  F "C1'" 1 
ATOM   5607 N N1    . DC  F 3 4   ? 2.295   -30.742 93.481  1.00 39.49 ? 17   DC  F N1    1 
ATOM   5608 C C2    . DC  F 3 4   ? 1.478   -29.937 92.677  1.00 37.59 ? 17   DC  F C2    1 
ATOM   5609 O O2    . DC  F 3 4   ? 1.272   -30.273 91.503  1.00 38.67 ? 17   DC  F O2    1 
ATOM   5610 N N3    . DC  F 3 4   ? 0.933   -28.817 93.198  1.00 37.09 ? 17   DC  F N3    1 
ATOM   5611 C C4    . DC  F 3 4   ? 1.168   -28.491 94.471  1.00 37.64 ? 17   DC  F C4    1 
ATOM   5612 N N4    . DC  F 3 4   ? 0.617   -27.369 94.940  1.00 37.08 ? 17   DC  F N4    1 
ATOM   5613 C C5    . DC  F 3 4   ? 1.980   -29.300 95.319  1.00 37.97 ? 17   DC  F C5    1 
ATOM   5614 C C6    . DC  F 3 4   ? 2.518   -30.408 94.788  1.00 38.42 ? 17   DC  F C6    1 
ATOM   5615 P P     . DC  F 3 5   ? 6.379   -33.580 91.234  1.00 38.87 ? 18   DC  F P     1 
ATOM   5616 O OP1   . DC  F 3 5   ? 6.958   -34.751 90.533  1.00 39.32 ? 18   DC  F OP1   1 
ATOM   5617 O OP2   . DC  F 3 5   ? 7.179   -32.880 92.276  1.00 40.65 ? 18   DC  F OP2   1 
ATOM   5618 O "O5'" . DC  F 3 5   ? 5.947   -32.511 90.142  1.00 37.39 ? 18   DC  F "O5'" 1 
ATOM   5619 C "C5'" . DC  F 3 5   ? 4.890   -32.809 89.235  1.00 33.49 ? 18   DC  F "C5'" 1 
ATOM   5620 C "C4'" . DC  F 3 5   ? 4.636   -31.628 88.333  1.00 31.18 ? 18   DC  F "C4'" 1 
ATOM   5621 O "O4'" . DC  F 3 5   ? 3.840   -30.636 89.024  1.00 31.25 ? 18   DC  F "O4'" 1 
ATOM   5622 C "C3'" . DC  F 3 5   ? 5.922   -30.932 87.892  1.00 30.48 ? 18   DC  F "C3'" 1 
ATOM   5623 O "O3'" . DC  F 3 5   ? 5.915   -30.679 86.500  1.00 27.94 ? 18   DC  F "O3'" 1 
ATOM   5624 C "C2'" . DC  F 3 5   ? 5.927   -29.626 88.664  1.00 30.95 ? 18   DC  F "C2'" 1 
ATOM   5625 C "C1'" . DC  F 3 5   ? 4.454   -29.360 88.922  1.00 31.09 ? 18   DC  F "C1'" 1 
ATOM   5626 N N1    . DC  F 3 5   ? 4.224   -28.647 90.188  1.00 28.92 ? 18   DC  F N1    1 
ATOM   5627 C C2    . DC  F 3 5   ? 3.473   -27.468 90.175  1.00 26.65 ? 18   DC  F C2    1 
ATOM   5628 O O2    . DC  F 3 5   ? 2.970   -27.092 89.108  1.00 26.67 ? 18   DC  F O2    1 
ATOM   5629 N N3    . DC  F 3 5   ? 3.312   -26.775 91.325  1.00 24.40 ? 18   DC  F N3    1 
ATOM   5630 C C4    . DC  F 3 5   ? 3.852   -27.230 92.456  1.00 25.14 ? 18   DC  F C4    1 
ATOM   5631 N N4    . DC  F 3 5   ? 3.685   -26.510 93.564  1.00 24.05 ? 18   DC  F N4    1 
ATOM   5632 C C5    . DC  F 3 5   ? 4.595   -28.447 92.502  1.00 26.12 ? 18   DC  F C5    1 
ATOM   5633 C C6    . DC  F 3 5   ? 4.755   -29.115 91.357  1.00 26.18 ? 18   DC  F C6    1 
ATOM   5634 P P     . DA  F 3 6   ? 7.298   -30.355 85.758  1.00 29.56 ? 19   DA  F P     1 
ATOM   5635 O OP1   . DA  F 3 6   ? 7.191   -30.930 84.393  1.00 27.31 ? 19   DA  F OP1   1 
ATOM   5636 O OP2   . DA  F 3 6   ? 8.441   -30.725 86.630  1.00 23.48 ? 19   DA  F OP2   1 
ATOM   5637 O "O5'" . DA  F 3 6   ? 7.273   -28.767 85.660  1.00 26.96 ? 19   DA  F "O5'" 1 
ATOM   5638 C "C5'" . DA  F 3 6   ? 6.228   -28.102 84.963  1.00 25.68 ? 19   DA  F "C5'" 1 
ATOM   5639 C "C4'" . DA  F 3 6   ? 6.469   -26.614 84.994  1.00 26.28 ? 19   DA  F "C4'" 1 
ATOM   5640 O "O4'" . DA  F 3 6   ? 5.734   -26.048 86.109  1.00 26.96 ? 19   DA  F "O4'" 1 
ATOM   5641 C "C3'" . DA  F 3 6   ? 7.944   -26.297 85.240  1.00 26.23 ? 19   DA  F "C3'" 1 
ATOM   5642 O "O3'" . DA  F 3 6   ? 8.609   -25.647 84.167  1.00 24.84 ? 19   DA  F "O3'" 1 
ATOM   5643 C "C2'" . DA  F 3 6   ? 7.968   -25.456 86.500  1.00 27.42 ? 19   DA  F "C2'" 1 
ATOM   5644 C "C1'" . DA  F 3 6   ? 6.522   -25.076 86.761  1.00 26.46 ? 19   DA  F "C1'" 1 
ATOM   5645 N N9    . DA  F 3 6   ? 6.257   -25.136 88.198  1.00 24.92 ? 19   DA  F N9    1 
ATOM   5646 C C8    . DA  F 3 6   ? 6.771   -26.044 89.096  1.00 22.68 ? 19   DA  F C8    1 
ATOM   5647 N N7    . DA  F 3 6   ? 6.522   -25.750 90.348  1.00 21.56 ? 19   DA  F N7    1 
ATOM   5648 C C5    . DA  F 3 6   ? 5.753   -24.591 90.269  1.00 23.31 ? 19   DA  F C5    1 
ATOM   5649 C C6    . DA  F 3 6   ? 5.194   -23.755 91.254  1.00 20.86 ? 19   DA  F C6    1 
ATOM   5650 N N6    . DA  F 3 6   ? 5.346   -23.944 92.565  1.00 19.11 ? 19   DA  F N6    1 
ATOM   5651 N N1    . DA  F 3 6   ? 4.476   -22.693 90.837  1.00 22.41 ? 19   DA  F N1    1 
ATOM   5652 C C2    . DA  F 3 6   ? 4.344   -22.483 89.525  1.00 21.96 ? 19   DA  F C2    1 
ATOM   5653 N N3    . DA  F 3 6   ? 4.834   -23.182 88.505  1.00 25.48 ? 19   DA  F N3    1 
ATOM   5654 C C4    . DA  F 3 6   ? 5.543   -24.235 88.951  1.00 22.93 ? 19   DA  F C4    1 
HETATM 5655 O "O5'" . 3DR F 3 7   ? 10.599  -25.135 82.680  1.00 22.78 ? 20   3DR F "O5'" 1 
HETATM 5656 P P     . 3DR F 3 7   ? 10.023  -26.237 83.679  1.00 23.96 ? 20   3DR F P     1 
HETATM 5657 O OP1   . 3DR F 3 7   ? 9.740   -27.484 82.927  1.00 24.33 ? 20   3DR F OP1   1 
HETATM 5658 O OP2   . 3DR F 3 7   ? 10.897  -26.299 84.873  1.00 24.21 ? 20   3DR F OP2   1 
HETATM 5659 C "C2'" . 3DR F 3 7   ? 10.203  -21.514 81.272  1.00 17.66 ? 20   3DR F "C2'" 1 
HETATM 5660 C "C5'" . 3DR F 3 7   ? 9.824   -24.666 81.579  1.00 21.26 ? 20   3DR F "C5'" 1 
HETATM 5661 C "C4'" . 3DR F 3 7   ? 10.662  -23.774 80.692  1.00 19.42 ? 20   3DR F "C4'" 1 
HETATM 5662 O "O4'" . 3DR F 3 7   ? 9.823   -23.200 79.663  1.00 22.91 ? 20   3DR F "O4'" 1 
HETATM 5663 C "C1'" . 3DR F 3 7   ? 9.648   -21.803 79.885  1.00 18.00 ? 20   3DR F "C1'" 1 
HETATM 5664 C "C3'" . 3DR F 3 7   ? 11.271  -22.581 81.419  1.00 19.49 ? 20   3DR F "C3'" 1 
HETATM 5665 O "O3'" . 3DR F 3 7   ? 12.464  -22.192 80.738  1.00 16.48 ? 20   3DR F "O3'" 1 
ATOM   5666 P P     . DG  F 3 8   ? 13.885  -22.490 81.398  1.00 17.68 ? 21   DG  F P     1 
ATOM   5667 O OP1   . DG  F 3 8   ? 14.886  -21.888 80.475  1.00 17.40 ? 21   DG  F OP1   1 
ATOM   5668 O OP2   . DG  F 3 8   ? 13.980  -23.932 81.740  1.00 20.27 ? 21   DG  F OP2   1 
ATOM   5669 O "O5'" . DG  F 3 8   ? 13.852  -21.644 82.742  1.00 17.68 ? 21   DG  F "O5'" 1 
ATOM   5670 C "C5'" . DG  F 3 8   ? 13.567  -20.251 82.686  1.00 19.32 ? 21   DG  F "C5'" 1 
ATOM   5671 C "C4'" . DG  F 3 8   ? 14.497  -19.484 83.593  1.00 23.59 ? 21   DG  F "C4'" 1 
ATOM   5672 O "O4'" . DG  F 3 8   ? 13.987  -19.488 84.950  1.00 26.32 ? 21   DG  F "O4'" 1 
ATOM   5673 C "C3'" . DG  F 3 8   ? 15.938  -19.998 83.656  1.00 24.03 ? 21   DG  F "C3'" 1 
ATOM   5674 O "O3'" . DG  F 3 8   ? 16.837  -18.907 83.442  1.00 29.11 ? 21   DG  F "O3'" 1 
ATOM   5675 C "C2'" . DG  F 3 8   ? 16.064  -20.563 85.065  1.00 22.08 ? 21   DG  F "C2'" 1 
ATOM   5676 C "C1'" . DG  F 3 8   ? 15.038  -19.759 85.859  1.00 23.22 ? 21   DG  F "C1'" 1 
ATOM   5677 N N9    . DG  F 3 8   ? 14.465  -20.462 87.006  1.00 22.07 ? 21   DG  F N9    1 
ATOM   5678 C C8    . DG  F 3 8   ? 14.075  -21.781 87.054  1.00 21.42 ? 21   DG  F C8    1 
ATOM   5679 N N7    . DG  F 3 8   ? 13.627  -22.142 88.225  1.00 19.51 ? 21   DG  F N7    1 
ATOM   5680 C C5    . DG  F 3 8   ? 13.717  -20.993 89.001  1.00 18.75 ? 21   DG  F C5    1 
ATOM   5681 C C6    . DG  F 3 8   ? 13.385  -20.777 90.369  1.00 19.13 ? 21   DG  F C6    1 
ATOM   5682 O O6    . DG  F 3 8   ? 12.948  -21.592 91.200  1.00 16.24 ? 21   DG  F O6    1 
ATOM   5683 N N1    . DG  F 3 8   ? 13.624  -19.457 90.750  1.00 17.79 ? 21   DG  F N1    1 
ATOM   5684 C C2    . DG  F 3 8   ? 14.130  -18.478 89.930  1.00 19.10 ? 21   DG  F C2    1 
ATOM   5685 N N2    . DG  F 3 8   ? 14.306  -17.270 90.491  1.00 15.87 ? 21   DG  F N2    1 
ATOM   5686 N N3    . DG  F 3 8   ? 14.448  -18.670 88.655  1.00 20.09 ? 21   DG  F N3    1 
ATOM   5687 C C4    . DG  F 3 8   ? 14.219  -19.942 88.261  1.00 19.88 ? 21   DG  F C4    1 
ATOM   5688 P P     . DT  F 3 9   ? 18.424  -19.170 83.320  1.00 30.66 ? 22   DT  F P     1 
ATOM   5689 O OP1   . DT  F 3 9   ? 18.965  -18.072 82.473  1.00 30.88 ? 22   DT  F OP1   1 
ATOM   5690 O OP2   . DT  F 3 9   ? 18.683  -20.579 82.949  1.00 32.21 ? 22   DT  F OP2   1 
ATOM   5691 O "O5'" . DT  F 3 9   ? 18.923  -18.870 84.798  1.00 33.91 ? 22   DT  F "O5'" 1 
ATOM   5692 C "C5'" . DT  F 3 9   ? 18.557  -17.627 85.394  1.00 36.60 ? 22   DT  F "C5'" 1 
ATOM   5693 C "C4'" . DT  F 3 9   ? 18.888  -17.603 86.865  1.00 39.36 ? 22   DT  F "C4'" 1 
ATOM   5694 O "O4'" . DT  F 3 9   ? 17.955  -18.374 87.662  1.00 38.29 ? 22   DT  F "O4'" 1 
ATOM   5695 C "C3'" . DT  F 3 9   ? 20.289  -18.079 87.254  1.00 40.44 ? 22   DT  F "C3'" 1 
ATOM   5696 O "O3'" . DT  F 3 9   ? 20.835  -17.111 88.143  1.00 45.25 ? 22   DT  F "O3'" 1 
ATOM   5697 C "C2'" . DT  F 3 9   ? 20.017  -19.355 88.032  1.00 38.69 ? 22   DT  F "C2'" 1 
ATOM   5698 C "C1'" . DT  F 3 9   ? 18.704  -18.986 88.690  1.00 36.38 ? 22   DT  F "C1'" 1 
ATOM   5699 N N1    . DT  F 3 9   ? 17.910  -20.080 89.287  1.00 32.33 ? 22   DT  F N1    1 
ATOM   5700 C C2    . DT  F 3 9   ? 17.378  -19.842 90.533  1.00 30.21 ? 22   DT  F C2    1 
ATOM   5701 O O2    . DT  F 3 9   ? 17.498  -18.775 91.110  1.00 30.28 ? 22   DT  F O2    1 
ATOM   5702 N N3    . DT  F 3 9   ? 16.699  -20.897 91.081  1.00 27.95 ? 22   DT  F N3    1 
ATOM   5703 C C4    . DT  F 3 9   ? 16.495  -22.139 90.519  1.00 27.73 ? 22   DT  F C4    1 
ATOM   5704 O O4    . DT  F 3 9   ? 15.876  -22.999 91.144  1.00 25.67 ? 22   DT  F O4    1 
ATOM   5705 C C5    . DT  F 3 9   ? 17.055  -22.316 89.198  1.00 27.38 ? 22   DT  F C5    1 
ATOM   5706 C C7    . DT  F 3 9   ? 16.869  -23.629 88.506  1.00 26.09 ? 22   DT  F C7    1 
ATOM   5707 C C6    . DT  F 3 9   ? 17.724  -21.288 88.652  1.00 29.13 ? 22   DT  F C6    1 
ATOM   5708 P P     . DC  F 3 10  ? 22.423  -17.005 88.338  1.00 48.92 ? 23   DC  F P     1 
ATOM   5709 O OP1   . DC  F 3 10  ? 22.912  -15.906 87.465  1.00 50.08 ? 23   DC  F OP1   1 
ATOM   5710 O OP2   . DC  F 3 10  ? 23.021  -18.359 88.216  1.00 47.33 ? 23   DC  F OP2   1 
ATOM   5711 O "O5'" . DC  F 3 10  ? 22.523  -16.528 89.852  1.00 48.28 ? 23   DC  F "O5'" 1 
ATOM   5712 C "C5'" . DC  F 3 10  ? 21.509  -15.695 90.414  1.00 47.40 ? 23   DC  F "C5'" 1 
ATOM   5713 C "C4'" . DC  F 3 10  ? 21.433  -15.903 91.907  1.00 48.06 ? 23   DC  F "C4'" 1 
ATOM   5714 O "O4'" . DC  F 3 10  ? 20.509  -16.966 92.260  1.00 46.09 ? 23   DC  F "O4'" 1 
ATOM   5715 C "C3'" . DC  F 3 10  ? 22.780  -16.280 92.522  1.00 49.53 ? 23   DC  F "C3'" 1 
ATOM   5716 O "O3'" . DC  F 3 10  ? 23.025  -15.531 93.702  1.00 53.45 ? 23   DC  F "O3'" 1 
ATOM   5717 C "C2'" . DC  F 3 10  ? 22.614  -17.745 92.881  1.00 47.83 ? 23   DC  F "C2'" 1 
ATOM   5718 C "C1'" . DC  F 3 10  ? 21.134  -17.827 93.198  1.00 45.01 ? 23   DC  F "C1'" 1 
ATOM   5719 N N1    . DC  F 3 10  ? 20.577  -19.181 93.042  1.00 42.13 ? 23   DC  F N1    1 
ATOM   5720 C C2    . DC  F 3 10  ? 19.774  -19.701 94.064  1.00 41.06 ? 23   DC  F C2    1 
ATOM   5721 O O2    . DC  F 3 10  ? 19.488  -18.978 95.030  1.00 39.60 ? 23   DC  F O2    1 
ATOM   5722 N N3    . DC  F 3 10  ? 19.326  -20.975 93.969  1.00 39.70 ? 23   DC  F N3    1 
ATOM   5723 C C4    . DC  F 3 10  ? 19.635  -21.714 92.900  1.00 40.40 ? 23   DC  F C4    1 
ATOM   5724 N N4    . DC  F 3 10  ? 19.189  -22.971 92.858  1.00 35.86 ? 23   DC  F N4    1 
ATOM   5725 C C5    . DC  F 3 10  ? 20.420  -21.195 91.827  1.00 39.58 ? 23   DC  F C5    1 
ATOM   5726 C C6    . DC  F 3 10  ? 20.862  -19.936 91.937  1.00 40.97 ? 23   DC  F C6    1 
ATOM   5727 P P     . DT  F 3 11  ? 24.478  -15.587 94.378  1.00 54.69 ? 24   DT  F P     1 
ATOM   5728 O OP1   . DT  F 3 11  ? 24.989  -14.192 94.408  1.00 56.01 ? 24   DT  F OP1   1 
ATOM   5729 O OP2   . DT  F 3 11  ? 25.281  -16.650 93.719  1.00 53.63 ? 24   DT  F OP2   1 
ATOM   5730 O "O5'" . DT  F 3 11  ? 24.154  -16.057 95.861  1.00 54.69 ? 24   DT  F "O5'" 1 
ATOM   5731 C "C5'" . DT  F 3 11  ? 23.026  -15.533 96.556  1.00 54.12 ? 24   DT  F "C5'" 1 
ATOM   5732 C "C4'" . DT  F 3 11  ? 22.809  -16.308 97.831  1.00 54.89 ? 24   DT  F "C4'" 1 
ATOM   5733 O "O4'" . DT  F 3 11  ? 22.152  -17.571 97.554  1.00 52.15 ? 24   DT  F "O4'" 1 
ATOM   5734 C "C3'" . DT  F 3 11  ? 24.124  -16.656 98.528  1.00 55.97 ? 24   DT  F "C3'" 1 
ATOM   5735 O "O3'" . DT  F 3 11  ? 24.005  -16.507 99.939  1.00 60.68 ? 24   DT  F "O3'" 1 
ATOM   5736 C "C2'" . DT  F 3 11  ? 24.335  -18.117 98.179  1.00 53.90 ? 24   DT  F "C2'" 1 
ATOM   5737 C "C1'" . DT  F 3 11  ? 22.909  -18.627 98.124  1.00 50.09 ? 24   DT  F "C1'" 1 
ATOM   5738 N N1    . DT  F 3 11  ? 22.726  -19.826 97.294  1.00 45.16 ? 24   DT  F N1    1 
ATOM   5739 C C2    . DT  F 3 11  ? 22.127  -20.919 97.873  1.00 43.16 ? 24   DT  F C2    1 
ATOM   5740 O O2    . DT  F 3 11  ? 21.746  -20.933 99.034  1.00 42.41 ? 24   DT  F O2    1 
ATOM   5741 N N3    . DT  F 3 11  ? 21.988  -22.002 97.042  1.00 39.47 ? 24   DT  F N3    1 
ATOM   5742 C C4    . DT  F 3 11  ? 22.378  -22.096 95.724  1.00 38.91 ? 24   DT  F C4    1 
ATOM   5743 O O4    . DT  F 3 11  ? 22.175  -23.131 95.101  1.00 37.36 ? 24   DT  F O4    1 
ATOM   5744 C C5    . DT  F 3 11  ? 23.009  -20.914 95.182  1.00 40.83 ? 24   DT  F C5    1 
ATOM   5745 C C7    . DT  F 3 11  ? 23.478  -20.929 93.762  1.00 39.01 ? 24   DT  F C7    1 
ATOM   5746 C C6    . DT  F 3 11  ? 23.147  -19.851 95.983  1.00 42.74 ? 24   DT  F C6    1 
ATOM   5747 P P     . DA  F 3 12  ? 25.294  -16.743 100.861 1.00 64.17 ? 25   DA  F P     1 
ATOM   5748 O OP1   . DA  F 3 12  ? 25.247  -15.739 101.955 1.00 63.70 ? 25   DA  F OP1   1 
ATOM   5749 O OP2   . DA  F 3 12  ? 26.483  -16.812 99.969  1.00 63.03 ? 25   DA  F OP2   1 
ATOM   5750 O "O5'" . DA  F 3 12  ? 25.047  -18.188 101.483 1.00 64.52 ? 25   DA  F "O5'" 1 
ATOM   5751 C "C5'" . DA  F 3 12  ? 24.017  -18.403 102.446 1.00 64.19 ? 25   DA  F "C5'" 1 
ATOM   5752 C "C4'" . DA  F 3 12  ? 24.196  -19.752 103.101 1.00 64.03 ? 25   DA  F "C4'" 1 
ATOM   5753 O "O4'" . DA  F 3 12  ? 23.869  -20.806 102.161 1.00 62.80 ? 25   DA  F "O4'" 1 
ATOM   5754 C "C3'" . DA  F 3 12  ? 25.628  -20.025 103.558 1.00 65.33 ? 25   DA  F "C3'" 1 
ATOM   5755 O "O3'" . DA  F 3 12  ? 25.615  -20.749 104.788 1.00 68.25 ? 25   DA  F "O3'" 1 
ATOM   5756 C "C2'" . DA  F 3 12  ? 26.189  -20.893 102.447 1.00 63.11 ? 25   DA  F "C2'" 1 
ATOM   5757 C "C1'" . DA  F 3 12  ? 24.970  -21.694 102.034 1.00 61.28 ? 25   DA  F "C1'" 1 
ATOM   5758 N N9    . DA  F 3 12  ? 25.006  -22.183 100.654 1.00 58.61 ? 25   DA  F N9    1 
ATOM   5759 C C8    . DA  F 3 12  ? 25.316  -21.483 99.513  1.00 56.43 ? 25   DA  F C8    1 
ATOM   5760 N N7    . DA  F 3 12  ? 25.260  -22.204 98.420  1.00 54.99 ? 25   DA  F N7    1 
ATOM   5761 C C5    . DA  F 3 12  ? 24.886  -23.463 98.869  1.00 54.69 ? 25   DA  F C5    1 
ATOM   5762 C C6    . DA  F 3 12  ? 24.645  -24.674 98.198  1.00 52.83 ? 25   DA  F C6    1 
ATOM   5763 N N6    . DA  F 3 12  ? 24.743  -24.819 96.874  1.00 51.42 ? 25   DA  F N6    1 
ATOM   5764 N N1    . DA  F 3 12  ? 24.292  -25.745 98.941  1.00 52.55 ? 25   DA  F N1    1 
ATOM   5765 C C2    . DA  F 3 12  ? 24.183  -25.597 100.267 1.00 53.76 ? 25   DA  F C2    1 
ATOM   5766 N N3    . DA  F 3 12  ? 24.375  -24.511 101.012 1.00 55.93 ? 25   DA  F N3    1 
ATOM   5767 C C4    . DA  F 3 12  ? 24.729  -23.466 100.243 1.00 56.10 ? 25   DA  F C4    1 
ATOM   5768 P P     . DC  F 3 13  ? 26.990  -21.013 105.574 1.00 69.91 ? 26   DC  F P     1 
ATOM   5769 O OP1   . DC  F 3 13  ? 27.145  -19.924 106.575 1.00 69.78 ? 26   DC  F OP1   1 
ATOM   5770 O OP2   . DC  F 3 13  ? 28.070  -21.256 104.578 1.00 69.10 ? 26   DC  F OP2   1 
ATOM   5771 O "O5'" . DC  F 3 13  ? 26.703  -22.376 106.343 1.00 68.79 ? 26   DC  F "O5'" 1 
ATOM   5772 C "C5'" . DC  F 3 13  ? 25.767  -23.315 105.816 1.00 66.86 ? 26   DC  F "C5'" 1 
ATOM   5773 C "C4'" . DC  F 3 13  ? 26.304  -24.721 105.942 1.00 65.70 ? 26   DC  F "C4'" 1 
ATOM   5774 O "O4'" . DC  F 3 13  ? 26.213  -25.363 104.645 1.00 64.53 ? 26   DC  F "O4'" 1 
ATOM   5775 C "C3'" . DC  F 3 13  ? 27.776  -24.809 106.345 1.00 65.14 ? 26   DC  F "C3'" 1 
ATOM   5776 O "O3'" . DC  F 3 13  ? 28.033  -26.048 107.010 1.00 65.51 ? 26   DC  F "O3'" 1 
ATOM   5777 C "C2'" . DC  F 3 13  ? 28.485  -24.892 105.007 1.00 64.62 ? 26   DC  F "C2'" 1 
ATOM   5778 C "C1'" . DC  F 3 13  ? 27.509  -25.727 104.191 1.00 63.11 ? 26   DC  F "C1'" 1 
ATOM   5779 N N1    . DC  F 3 13  ? 27.567  -25.502 102.736 1.00 60.41 ? 26   DC  F N1    1 
ATOM   5780 C C2    . DC  F 3 13  ? 27.299  -26.575 101.876 1.00 59.48 ? 26   DC  F C2    1 
ATOM   5781 O O2    . DC  F 3 13  ? 27.011  -27.678 102.364 1.00 58.29 ? 26   DC  F O2    1 
ATOM   5782 N N3    . DC  F 3 13  ? 27.362  -26.381 100.537 1.00 57.77 ? 26   DC  F N3    1 
ATOM   5783 C C4    . DC  F 3 13  ? 27.678  -25.178 100.052 1.00 58.17 ? 26   DC  F C4    1 
ATOM   5784 N N4    . DC  F 3 13  ? 27.733  -25.031 98.728  1.00 57.88 ? 26   DC  F N4    1 
ATOM   5785 C C5    . DC  F 3 13  ? 27.953  -24.070 100.905 1.00 58.90 ? 26   DC  F C5    1 
ATOM   5786 C C6    . DC  F 3 13  ? 27.885  -24.273 102.227 1.00 59.78 ? 26   DC  F C6    1 
HETATM 5787 C C1    . GOL G 4 .   ? 16.530  9.192   50.647  1.00 50.93 ? 3545 GOL A C1    1 
HETATM 5788 O O1    . GOL G 4 .   ? 17.067  9.077   51.968  1.00 55.80 ? 3545 GOL A O1    1 
HETATM 5789 C C2    . GOL G 4 .   ? 15.633  10.432  50.557  1.00 50.73 ? 3545 GOL A C2    1 
HETATM 5790 O O2    . GOL G 4 .   ? 16.365  11.580  51.001  1.00 48.95 ? 3545 GOL A O2    1 
HETATM 5791 C C3    . GOL G 4 .   ? 15.172  10.657  49.117  1.00 50.82 ? 3545 GOL A C3    1 
HETATM 5792 O O3    . GOL G 4 .   ? 14.675  9.444   48.552  1.00 50.49 ? 3545 GOL A O3    1 
HETATM 5793 O O     . HOH H 5 .   ? 14.030  1.690   40.821  1.00 20.89 ? 2001 HOH A O     1 
HETATM 5794 O O     . HOH H 5 .   ? 15.470  16.500  39.830  1.00 16.69 ? 2002 HOH A O     1 
HETATM 5795 O O     . HOH H 5 .   ? 13.053  20.647  35.404  1.00 9.39  ? 2003 HOH A O     1 
HETATM 5796 O O     . HOH H 5 .   ? 7.160   1.960   38.182  1.00 20.93 ? 2004 HOH A O     1 
HETATM 5797 O O     . HOH H 5 .   ? 17.599  29.999  34.825  1.00 14.23 ? 2006 HOH A O     1 
HETATM 5798 O O     . HOH H 5 .   ? 11.167  18.360  44.561  1.00 25.83 ? 2009 HOH A O     1 
HETATM 5799 O O     . HOH H 5 .   ? 18.616  0.178   45.937  1.00 18.15 ? 2010 HOH A O     1 
HETATM 5800 O O     . HOH H 5 .   ? 7.787   -19.583 51.212  1.00 18.01 ? 2014 HOH A O     1 
HETATM 5801 O O     . HOH H 5 .   ? 13.027  22.447  24.747  1.00 30.35 ? 2016 HOH A O     1 
HETATM 5802 O O     . HOH H 5 .   ? 18.986  9.043   48.990  1.00 33.55 ? 2017 HOH A O     1 
HETATM 5803 O O     . HOH H 5 .   ? 20.462  -3.138  35.771  1.00 12.68 ? 2018 HOH A O     1 
HETATM 5804 O O     . HOH H 5 .   ? 2.171   9.311   37.104  1.00 20.17 ? 2019 HOH A O     1 
HETATM 5805 O O     . HOH H 5 .   ? 9.840   -10.161 50.106  1.00 17.77 ? 2021 HOH A O     1 
HETATM 5806 O O     . HOH H 5 .   ? 6.126   7.905   36.508  1.00 14.84 ? 2022 HOH A O     1 
HETATM 5807 O O     . HOH H 5 .   ? 23.577  22.015  31.568  1.00 23.60 ? 2024 HOH A O     1 
HETATM 5808 O O     . HOH H 5 .   ? 19.704  -9.258  49.873  1.00 12.36 ? 2025 HOH A O     1 
HETATM 5809 O O     . HOH H 5 .   ? 24.502  -29.024 34.243  1.00 50.01 ? 2026 HOH A O     1 
HETATM 5810 O O     . HOH H 5 .   ? 20.116  -0.653  37.315  1.00 12.34 ? 2028 HOH A O     1 
HETATM 5811 O O     . HOH H 5 .   ? -3.416  5.534   36.012  1.00 31.14 ? 2030 HOH A O     1 
HETATM 5812 O O     . HOH H 5 .   ? 24.554  3.126   32.745  1.00 26.04 ? 2034 HOH A O     1 
HETATM 5813 O O     . HOH H 5 .   ? 13.108  -1.278  50.074  1.00 26.06 ? 2036 HOH A O     1 
HETATM 5814 O O     . HOH H 5 .   ? 0.156   26.445  38.701  1.00 24.64 ? 2037 HOH A O     1 
HETATM 5815 O O     . HOH H 5 .   ? 23.893  -7.722  24.876  1.00 29.46 ? 2040 HOH A O     1 
HETATM 5816 O O     . HOH H 5 .   ? 9.638   -0.524  31.899  1.00 30.58 ? 2042 HOH A O     1 
HETATM 5817 O O     . HOH H 5 .   ? -1.750  0.557   33.611  1.00 33.55 ? 2043 HOH A O     1 
HETATM 5818 O O     . HOH H 5 .   ? 2.983   -13.594 41.195  1.00 31.03 ? 2046 HOH A O     1 
HETATM 5819 O O     . HOH H 5 .   ? 11.685  -3.577  26.954  1.00 28.01 ? 2047 HOH A O     1 
HETATM 5820 O O     . HOH H 5 .   ? 12.217  0.334   44.032  1.00 33.41 ? 2049 HOH A O     1 
HETATM 5821 O O     . HOH H 5 .   ? 17.522  -27.218 41.332  1.00 24.66 ? 2051 HOH A O     1 
HETATM 5822 O O     . HOH H 5 .   ? 1.666   -0.132  30.385  1.00 20.02 ? 2052 HOH A O     1 
HETATM 5823 O O     . HOH H 5 .   ? 7.116   -1.105  41.661  1.00 26.09 ? 2053 HOH A O     1 
HETATM 5824 O O     . HOH H 5 .   ? 2.813   -1.193  43.814  1.00 33.60 ? 2054 HOH A O     1 
HETATM 5825 O O     . HOH H 5 .   ? 18.607  -7.140  20.142  1.00 60.01 ? 2055 HOH A O     1 
HETATM 5826 O O     . HOH H 5 .   ? 32.709  -4.913  40.759  1.00 18.10 ? 2057 HOH A O     1 
HETATM 5827 O O     . HOH H 5 .   ? 4.690   12.300  43.671  1.00 27.25 ? 2059 HOH A O     1 
HETATM 5828 O O     . HOH H 5 .   ? 9.303   2.279   31.483  1.00 23.57 ? 2062 HOH A O     1 
HETATM 5829 O O     . HOH H 5 .   ? 12.436  28.036  44.079  1.00 39.93 ? 2064 HOH A O     1 
HETATM 5830 O O     . HOH H 5 .   ? 9.498   -7.219  44.697  1.00 24.68 ? 2066 HOH A O     1 
HETATM 5831 O O     . HOH H 5 .   ? 8.262   30.347  36.265  1.00 31.03 ? 2069 HOH A O     1 
HETATM 5832 O O     . HOH H 5 .   ? 10.896  13.314  16.767  1.00 43.12 ? 2072 HOH A O     1 
HETATM 5833 O O     . HOH H 5 .   ? 28.284  -5.259  30.702  1.00 40.25 ? 2077 HOH A O     1 
HETATM 5834 O O     . HOH H 5 .   ? -7.658  22.763  23.737  1.00 49.20 ? 2078 HOH A O     1 
HETATM 5835 O O     . HOH H 5 .   ? 21.778  23.410  40.786  1.00 27.52 ? 2080 HOH A O     1 
HETATM 5836 O O     . HOH H 5 .   ? -4.545  -3.687  42.233  1.00 34.85 ? 2086 HOH A O     1 
HETATM 5837 O O     . HOH H 5 .   ? 22.641  -30.420 33.071  1.00 60.30 ? 2091 HOH A O     1 
HETATM 5838 O O     . HOH H 5 .   ? -7.398  24.893  26.879  1.00 72.72 ? 2092 HOH A O     1 
HETATM 5839 O O     . HOH H 5 .   ? 18.139  -5.611  47.787  1.00 22.18 ? 2093 HOH A O     1 
HETATM 5840 O O     . HOH H 5 .   ? 10.686  -4.565  29.106  1.00 19.63 ? 2094 HOH A O     1 
HETATM 5841 O O     . HOH H 5 .   ? 19.960  26.071  44.263  1.00 24.40 ? 2096 HOH A O     1 
HETATM 5842 O O     . HOH H 5 .   ? 27.634  -7.716  33.337  1.00 22.74 ? 2099 HOH A O     1 
HETATM 5843 O O     . HOH H 5 .   ? 14.001  24.042  26.785  1.00 16.01 ? 2100 HOH A O     1 
HETATM 5844 O O     . HOH H 5 .   ? 17.789  -20.438 26.023  1.00 37.48 ? 2102 HOH A O     1 
HETATM 5845 O O     . HOH H 5 .   ? 27.000  22.556  36.060  1.00 37.93 ? 2103 HOH A O     1 
HETATM 5846 O O     . HOH H 5 .   ? 26.620  23.190  33.657  1.00 39.41 ? 2106 HOH A O     1 
HETATM 5847 O O     . HOH H 5 .   ? 10.496  -3.340  18.187  1.00 34.69 ? 2108 HOH A O     1 
HETATM 5848 O O     . HOH H 5 .   ? 14.007  2.897   20.814  1.00 22.48 ? 2112 HOH A O     1 
HETATM 5849 O O     . HOH H 5 .   ? 25.123  -5.858  39.167  1.00 39.24 ? 2113 HOH A O     1 
HETATM 5850 O O     . HOH H 5 .   ? 5.747   13.655  52.196  1.00 35.39 ? 2114 HOH A O     1 
HETATM 5851 O O     . HOH H 5 .   ? 19.585  -14.424 22.745  1.00 42.56 ? 2115 HOH A O     1 
HETATM 5852 O O     . HOH H 5 .   ? 25.802  32.449  33.118  1.00 31.28 ? 2119 HOH A O     1 
HETATM 5853 O O     . HOH H 5 .   ? 11.510  -7.084  28.588  1.00 35.73 ? 2120 HOH A O     1 
HETATM 5854 O O     . HOH H 5 .   ? 14.143  -28.072 44.364  1.00 19.98 ? 2122 HOH A O     1 
HETATM 5855 O O     . HOH H 5 .   ? -4.875  -16.839 36.816  1.00 45.45 ? 2128 HOH A O     1 
HETATM 5856 O O     . HOH H 5 .   ? 17.657  -16.627 25.462  1.00 34.81 ? 2135 HOH A O     1 
HETATM 5857 O O     . HOH H 5 .   ? 1.032   27.093  41.542  1.00 36.51 ? 2140 HOH A O     1 
HETATM 5858 O O     . HOH H 5 .   ? 9.411   -6.959  26.623  1.00 44.28 ? 2142 HOH A O     1 
HETATM 5859 O O     . HOH H 5 .   ? 27.395  21.283  41.078  1.00 42.05 ? 2146 HOH A O     1 
HETATM 5860 O O     . HOH H 5 .   ? 24.928  -0.918  43.639  1.00 23.42 ? 2147 HOH A O     1 
HETATM 5861 O O     . HOH H 5 .   ? 23.880  1.073   30.149  1.00 26.07 ? 2148 HOH A O     1 
HETATM 5862 O O     . HOH H 5 .   ? 12.513  -0.586  40.569  1.00 18.07 ? 2154 HOH A O     1 
HETATM 5863 O O     . HOH H 5 .   ? 17.096  14.075  45.330  1.00 22.99 ? 2159 HOH A O     1 
HETATM 5864 O O     . HOH H 5 .   ? 14.709  14.554  53.384  1.00 35.27 ? 2161 HOH A O     1 
HETATM 5865 O O     . HOH H 5 .   ? 16.720  -27.392 43.832  1.00 25.90 ? 2163 HOH A O     1 
HETATM 5866 O O     . HOH H 5 .   ? 21.001  -5.351  54.894  1.00 40.67 ? 2169 HOH A O     1 
HETATM 5867 O O     . HOH H 5 .   ? 0.279   -17.401 32.209  1.00 42.84 ? 2173 HOH A O     1 
HETATM 5868 O O     . HOH H 5 .   ? 19.761  -6.633  49.597  1.00 20.13 ? 2174 HOH A O     1 
HETATM 5869 O O     . HOH H 5 .   ? 12.127  16.271  41.260  1.00 29.22 ? 2176 HOH A O     1 
HETATM 5870 O O     . HOH H 5 .   ? 30.271  -6.425  48.059  1.00 27.72 ? 2179 HOH A O     1 
HETATM 5871 O O     . HOH H 5 .   ? 19.580  -17.772 50.160  1.00 33.96 ? 2181 HOH A O     1 
HETATM 5872 O O     . HOH H 5 .   ? 28.513  -9.863  48.478  1.00 31.22 ? 2182 HOH A O     1 
HETATM 5873 O O     . HOH H 5 .   ? 22.490  -19.730 43.011  1.00 22.76 ? 2184 HOH A O     1 
HETATM 5874 O O     . HOH H 5 .   ? 19.832  -23.701 31.401  1.00 41.30 ? 2189 HOH A O     1 
HETATM 5875 O O     . HOH H 5 .   ? 7.573   28.903  40.623  1.00 27.54 ? 2195 HOH A O     1 
HETATM 5876 O O     . HOH H 5 .   ? 21.453  6.350   46.154  1.00 15.57 ? 2197 HOH A O     1 
HETATM 5877 O O     . HOH H 5 .   ? 25.492  1.498   42.764  1.00 33.70 ? 2198 HOH A O     1 
HETATM 5878 O O     . HOH H 5 .   ? 30.735  -9.387  45.695  1.00 35.09 ? 2200 HOH A O     1 
HETATM 5879 O O     . HOH H 5 .   ? 21.919  10.623  40.700  1.00 20.44 ? 2201 HOH A O     1 
HETATM 5880 O O     . HOH H 5 .   ? 4.874   -11.628 30.536  1.00 40.58 ? 2202 HOH A O     1 
HETATM 5881 O O     . HOH H 5 .   ? 16.112  -8.948  24.520  1.00 25.33 ? 2204 HOH A O     1 
HETATM 5882 O O     . HOH H 5 .   ? -0.646  -8.242  44.327  1.00 36.98 ? 2208 HOH A O     1 
HETATM 5883 O O     . HOH H 5 .   ? 6.606   -5.344  27.150  1.00 38.47 ? 2210 HOH A O     1 
HETATM 5884 O O     . HOH H 5 .   ? 3.631   13.577  20.543  1.00 30.06 ? 2211 HOH A O     1 
HETATM 5885 O O     . HOH H 5 .   ? 24.721  31.247  35.936  1.00 33.13 ? 2213 HOH A O     1 
HETATM 5886 O O     . HOH H 5 .   ? -2.529  -5.370  34.691  1.00 44.12 ? 2217 HOH A O     1 
HETATM 5887 O O     . HOH H 5 .   ? -5.063  -0.988  42.305  1.00 39.78 ? 2218 HOH A O     1 
HETATM 5888 O O     . HOH H 5 .   ? 13.445  -8.798  24.702  1.00 41.45 ? 2220 HOH A O     1 
HETATM 5889 O O     . HOH H 5 .   ? 1.167   -12.175 49.872  1.00 42.89 ? 2221 HOH A O     1 
HETATM 5890 O O     . HOH H 5 .   ? 21.093  6.350   43.310  1.00 28.35 ? 2225 HOH A O     1 
HETATM 5891 O O     . HOH H 5 .   ? 25.213  -5.430  52.711  1.00 36.50 ? 2227 HOH A O     1 
HETATM 5892 O O     . HOH H 5 .   ? 31.556  -13.201 37.997  1.00 32.18 ? 2234 HOH A O     1 
HETATM 5893 O O     . HOH H 5 .   ? 23.046  1.180   21.916  1.00 37.63 ? 2238 HOH A O     1 
HETATM 5894 O O     . HOH H 5 .   ? 25.196  -7.954  54.255  1.00 42.07 ? 2243 HOH A O     1 
HETATM 5895 O O     . HOH H 5 .   ? 23.447  -3.048  35.313  1.00 23.02 ? 2245 HOH A O     1 
HETATM 5896 O O     . HOH H 5 .   ? 4.961   -1.691  23.525  1.00 35.91 ? 2248 HOH A O     1 
HETATM 5897 O O     . HOH H 5 .   ? 8.443   -9.755  27.120  1.00 46.90 ? 2252 HOH A O     1 
HETATM 5898 O O     . HOH H 5 .   ? 28.201  -17.384 44.877  1.00 40.67 ? 2253 HOH A O     1 
HETATM 5899 O O     . HOH H 5 .   ? 22.229  -0.482  19.908  1.00 39.15 ? 2254 HOH A O     1 
HETATM 5900 O O     . HOH H 5 .   ? 28.400  -3.254  41.950  1.00 38.88 ? 2258 HOH A O     1 
HETATM 5901 O O     . HOH H 5 .   ? 2.220   -15.280 46.826  1.00 51.99 ? 2260 HOH A O     1 
HETATM 5902 O O     . HOH H 5 .   ? 13.737  18.595  56.401  1.00 66.83 ? 2266 HOH A O     1 
HETATM 5903 O O     . HOH H 5 .   ? 33.350  -0.120  49.902  1.00 49.06 ? 2267 HOH A O     1 
HETATM 5904 O O     . HOH H 5 .   ? -9.245  19.512  28.992  1.00 54.95 ? 2268 HOH A O     1 
HETATM 5905 O O     . HOH H 5 .   ? 18.536  -24.257 27.246  1.00 48.81 ? 2270 HOH A O     1 
HETATM 5906 O O     . HOH H 5 .   ? 10.449  -18.102 52.723  1.00 37.61 ? 2271 HOH A O     1 
HETATM 5907 O O     . HOH H 5 .   ? 23.549  -30.196 30.356  1.00 52.36 ? 2273 HOH A O     1 
HETATM 5908 O O     . HOH H 5 .   ? 15.620  -6.853  22.719  1.00 45.28 ? 2275 HOH A O     1 
HETATM 5909 O O     . HOH H 5 .   ? 10.991  8.151   42.901  1.00 35.19 ? 2278 HOH A O     1 
HETATM 5910 O O     . HOH H 5 .   ? 1.293   -20.734 28.734  1.00 50.04 ? 2279 HOH A O     1 
HETATM 5911 O O     . HOH H 5 .   ? 27.050  -14.572 33.485  1.00 37.75 ? 2281 HOH A O     1 
HETATM 5912 O O     . HOH H 5 .   ? -3.149  -16.187 45.518  1.00 53.93 ? 2289 HOH A O     1 
HETATM 5913 O O     . HOH H 5 .   ? 21.630  19.230  45.321  1.00 38.48 ? 2293 HOH A O     1 
HETATM 5914 O O     . HOH H 5 .   ? 27.641  -4.579  51.242  1.00 38.13 ? 2294 HOH A O     1 
HETATM 5915 O O     . HOH H 5 .   ? 26.845  -18.909 49.186  1.00 56.11 ? 2295 HOH A O     1 
HETATM 5916 O O     . HOH H 5 .   ? 24.666  9.325   28.589  1.00 45.11 ? 2296 HOH A O     1 
HETATM 5917 O O     . HOH H 5 .   ? -0.016  -30.858 38.188  1.00 43.24 ? 2297 HOH A O     1 
HETATM 5918 O O     . HOH H 5 .   ? 3.878   -3.842  31.030  1.00 33.56 ? 2301 HOH A O     1 
HETATM 5919 O O     . HOH H 5 .   ? -1.700  28.837  32.356  1.00 33.16 ? 2302 HOH A O     1 
HETATM 5920 O O     . HOH H 5 .   ? 16.315  -23.631 25.306  1.00 68.99 ? 2303 HOH A O     1 
HETATM 5921 O O     . HOH H 5 .   ? -0.760  -16.252 47.008  1.00 40.65 ? 2304 HOH A O     1 
HETATM 5922 O O     . HOH H 5 .   ? 13.447  -18.662 54.335  1.00 42.23 ? 2306 HOH A O     1 
HETATM 5923 O O     . HOH H 5 .   ? 16.576  -4.544  23.083  1.00 28.52 ? 2307 HOH A O     1 
HETATM 5924 O O     . HOH H 5 .   ? 12.220  -24.981 50.902  1.00 42.33 ? 2309 HOH A O     1 
HETATM 5925 O O     . HOH H 5 .   ? 21.139  18.363  23.581  1.00 44.79 ? 2311 HOH A O     1 
HETATM 5926 O O     . HOH H 5 .   ? -4.903  -24.721 36.491  1.00 51.61 ? 2312 HOH A O     1 
HETATM 5927 O O     . HOH H 5 .   ? 8.942   22.969  24.357  1.00 29.26 ? 2314 HOH A O     1 
HETATM 5928 O O     . HOH H 5 .   ? 23.580  -22.407 28.637  1.00 59.55 ? 2315 HOH A O     1 
HETATM 5929 O O     . HOH H 5 .   ? -3.174  7.559   32.479  1.00 45.20 ? 2317 HOH A O     1 
HETATM 5930 O O     . HOH H 5 .   ? 3.817   -22.830 31.389  1.00 47.62 ? 2319 HOH A O     1 
HETATM 5931 O O     . HOH H 5 .   ? 11.396  29.210  27.461  1.00 45.70 ? 2320 HOH A O     1 
HETATM 5932 O O     . HOH H 5 .   ? 26.988  -14.839 30.302  1.00 40.48 ? 2323 HOH A O     1 
HETATM 5933 O O     . HOH H 5 .   ? 25.660  -7.905  19.163  1.00 44.17 ? 2327 HOH A O     1 
HETATM 5934 O O     . HOH H 5 .   ? 22.512  3.532   30.533  1.00 33.74 ? 2331 HOH A O     1 
HETATM 5935 O O     . HOH H 5 .   ? 9.478   9.118   41.087  1.00 43.08 ? 2332 HOH A O     1 
HETATM 5936 O O     . HOH H 5 .   ? 25.886  -18.822 46.244  1.00 42.10 ? 2334 HOH A O     1 
HETATM 5937 O O     . HOH H 5 .   ? 0.557   -15.612 49.479  1.00 42.11 ? 2335 HOH A O     1 
HETATM 5938 O O     . HOH H 5 .   ? 21.936  18.593  21.052  1.00 40.84 ? 2338 HOH A O     1 
HETATM 5939 O O     . HOH H 5 .   ? 28.812  -7.307  49.896  1.00 37.86 ? 2339 HOH A O     1 
HETATM 5940 O O     . HOH H 5 .   ? 26.541  -11.122 57.947  1.00 66.75 ? 2342 HOH A O     1 
HETATM 5941 O O     . HOH H 5 .   ? 4.572   10.043  18.383  1.00 35.13 ? 2343 HOH A O     1 
HETATM 5942 O O     . HOH H 5 .   ? 23.647  15.912  20.498  1.00 37.77 ? 2345 HOH A O     1 
HETATM 5943 O O     . HOH H 5 .   ? 5.426   32.914  32.908  1.00 40.74 ? 2347 HOH A O     1 
HETATM 5944 O O     . HOH H 5 .   ? 6.601   32.571  35.127  1.00 48.02 ? 2348 HOH A O     1 
HETATM 5945 O O     . HOH H 5 .   ? 18.165  15.077  29.041  1.00 34.38 ? 2350 HOH A O     1 
HETATM 5946 O O     . HOH H 5 .   ? -3.792  -4.074  44.683  1.00 29.49 ? 2352 HOH A O     1 
HETATM 5947 O O     . HOH H 5 .   ? 7.423   -0.760  44.525  1.00 41.75 ? 2353 HOH A O     1 
HETATM 5948 O O     . HOH H 5 .   ? 4.697   9.816   44.191  1.00 31.37 ? 2355 HOH A O     1 
HETATM 5949 O O     . HOH H 5 .   ? -3.020  0.850   36.036  1.00 46.26 ? 2360 HOH A O     1 
HETATM 5950 O O     . HOH H 5 .   ? 10.843  -7.666  51.009  1.00 31.05 ? 2362 HOH A O     1 
HETATM 5951 O O     . HOH H 5 .   ? 12.593  -10.566 54.323  1.00 38.19 ? 2364 HOH A O     1 
HETATM 5952 O O     . HOH H 5 .   ? 7.062   -16.973 52.522  1.00 38.75 ? 2368 HOH A O     1 
HETATM 5953 O O     . HOH H 5 .   ? 23.583  17.213  25.484  1.00 41.24 ? 2370 HOH A O     1 
HETATM 5954 O O     . HOH H 5 .   ? -9.411  12.841  27.546  1.00 49.50 ? 2371 HOH A O     1 
HETATM 5955 O O     . HOH H 5 .   ? 23.067  22.220  43.122  1.00 46.69 ? 2375 HOH A O     1 
HETATM 5956 O O     . HOH H 5 .   ? -5.836  -10.550 39.681  1.00 26.41 ? 2377 HOH A O     1 
HETATM 5957 O O     . HOH H 5 .   ? 5.048   28.343  42.677  1.00 39.25 ? 2380 HOH A O     1 
HETATM 5958 O O     . HOH H 5 .   ? -3.221  29.766  30.577  1.00 36.04 ? 2381 HOH A O     1 
HETATM 5959 O O     . HOH H 5 .   ? -6.003  24.914  39.349  1.00 30.99 ? 2383 HOH A O     1 
HETATM 5960 O O     . HOH H 5 .   ? -4.836  -6.215  45.980  1.00 31.13 ? 2386 HOH A O     1 
HETATM 5961 O O     . HOH H 5 .   ? -13.005 14.840  39.571  1.00 35.81 ? 2388 HOH A O     1 
HETATM 5962 O O     . HOH H 5 .   ? 13.647  -8.022  53.926  1.00 47.58 ? 2396 HOH A O     1 
HETATM 5963 O O     . HOH H 5 .   ? -0.690  -31.380 40.702  1.00 57.92 ? 2401 HOH A O     1 
HETATM 5964 O O     . HOH H 5 .   ? 5.292   7.462   18.529  1.00 41.67 ? 2402 HOH A O     1 
HETATM 5965 O O     . HOH H 5 .   ? 16.163  25.538  26.476  1.00 45.28 ? 2403 HOH A O     1 
HETATM 5966 O O     . HOH H 5 .   ? 4.125   -7.243  29.938  1.00 44.21 ? 2404 HOH A O     1 
HETATM 5967 O O     . HOH H 5 .   ? 18.129  33.918  30.309  1.00 35.50 ? 2409 HOH A O     1 
HETATM 5968 O O     . HOH H 5 .   ? 4.407   31.337  25.446  1.00 52.67 ? 2412 HOH A O     1 
HETATM 5969 O O     . HOH H 5 .   ? 5.997   -35.427 31.689  1.00 44.96 ? 2414 HOH A O     1 
HETATM 5970 O O     . HOH H 5 .   ? 21.995  4.440   33.269  1.00 33.87 ? 2415 HOH A O     1 
HETATM 5971 O O     . HOH H 5 .   ? -2.989  -8.600  45.974  1.00 35.72 ? 2416 HOH A O     1 
HETATM 5972 O O     . HOH I 5 .   ? 7.992   -5.801  89.651  1.00 11.76 ? 2005 HOH B O     1 
HETATM 5973 O O     . HOH I 5 .   ? 14.854  -36.160 76.520  1.00 9.27  ? 2007 HOH B O     1 
HETATM 5974 O O     . HOH I 5 .   ? 13.946  -17.005 80.941  1.00 16.58 ? 2008 HOH B O     1 
HETATM 5975 O O     . HOH I 5 .   ? 21.798  -23.407 76.961  1.00 19.32 ? 2011 HOH B O     1 
HETATM 5976 O O     . HOH I 5 .   ? 21.039  -17.417 78.561  1.00 11.11 ? 2012 HOH B O     1 
HETATM 5977 O O     . HOH I 5 .   ? 9.497   -15.352 86.059  1.00 21.37 ? 2015 HOH B O     1 
HETATM 5978 O O     . HOH I 5 .   ? 14.336  12.622  83.426  1.00 16.78 ? 2020 HOH B O     1 
HETATM 5979 O O     . HOH I 5 .   ? 25.822  -0.482  85.841  1.00 44.88 ? 2023 HOH B O     1 
HETATM 5980 O O     . HOH I 5 .   ? 18.130  -4.996  89.659  1.00 14.28 ? 2027 HOH B O     1 
HETATM 5981 O O     . HOH I 5 .   ? 27.570  -42.197 80.172  1.00 31.74 ? 2029 HOH B O     1 
HETATM 5982 O O     . HOH I 5 .   ? 16.207  -43.353 84.935  1.00 32.36 ? 2031 HOH B O     1 
HETATM 5983 O O     . HOH I 5 .   ? 16.823  -8.491  67.988  1.00 26.84 ? 2032 HOH B O     1 
HETATM 5984 O O     . HOH I 5 .   ? 16.249  -12.324 66.986  1.00 23.96 ? 2033 HOH B O     1 
HETATM 5985 O O     . HOH I 5 .   ? 12.215  -31.925 80.410  1.00 18.45 ? 2035 HOH B O     1 
HETATM 5986 O O     . HOH I 5 .   ? 9.883   0.968   65.182  1.00 28.72 ? 2038 HOH B O     1 
HETATM 5987 O O     . HOH I 5 .   ? 7.614   -12.345 75.799  1.00 16.82 ? 2039 HOH B O     1 
HETATM 5988 O O     . HOH I 5 .   ? 5.277   4.345   82.542  1.00 16.91 ? 2041 HOH B O     1 
HETATM 5989 O O     . HOH I 5 .   ? 15.490  -14.789 80.649  1.00 16.96 ? 2048 HOH B O     1 
HETATM 5990 O O     . HOH I 5 .   ? 18.630  -24.279 81.710  1.00 30.88 ? 2050 HOH B O     1 
HETATM 5991 O O     . HOH I 5 .   ? 22.901  -27.549 84.640  1.00 32.96 ? 2056 HOH B O     1 
HETATM 5992 O O     . HOH I 5 .   ? -4.632  -10.525 80.553  1.00 19.27 ? 2058 HOH B O     1 
HETATM 5993 O O     . HOH I 5 .   ? 23.520  -3.218  72.100  1.00 32.28 ? 2060 HOH B O     1 
HETATM 5994 O O     . HOH I 5 .   ? 14.924  -37.883 65.499  1.00 32.99 ? 2061 HOH B O     1 
HETATM 5995 O O     . HOH I 5 .   ? 35.568  -2.190  77.330  1.00 45.29 ? 2063 HOH B O     1 
HETATM 5996 O O     . HOH I 5 .   ? 12.376  -6.758  64.367  1.00 31.48 ? 2065 HOH B O     1 
HETATM 5997 O O     . HOH I 5 .   ? 10.095  -45.442 75.967  1.00 15.18 ? 2067 HOH B O     1 
HETATM 5998 O O     . HOH I 5 .   ? 8.188   -8.313  89.260  1.00 18.05 ? 2068 HOH B O     1 
HETATM 5999 O O     . HOH I 5 .   ? 14.000  -39.674 67.654  1.00 30.00 ? 2071 HOH B O     1 
HETATM 6000 O O     . HOH I 5 .   ? 5.777   14.504  72.222  1.00 41.20 ? 2073 HOH B O     1 
HETATM 6001 O O     . HOH I 5 .   ? 15.680  -31.520 81.739  1.00 27.15 ? 2075 HOH B O     1 
HETATM 6002 O O     . HOH I 5 .   ? 17.203  -29.549 57.347  1.00 42.30 ? 2076 HOH B O     1 
HETATM 6003 O O     . HOH I 5 .   ? 9.895   -9.593  87.710  1.00 21.01 ? 2081 HOH B O     1 
HETATM 6004 O O     . HOH I 5 .   ? 25.914  -25.020 77.891  1.00 19.19 ? 2082 HOH B O     1 
HETATM 6005 O O     . HOH I 5 .   ? 3.319   -18.801 72.889  1.00 28.13 ? 2083 HOH B O     1 
HETATM 6006 O O     . HOH I 5 .   ? 25.065  -1.816  80.640  1.00 23.68 ? 2084 HOH B O     1 
HETATM 6007 O O     . HOH I 5 .   ? 20.364  16.931  77.202  1.00 48.31 ? 2090 HOH B O     1 
HETATM 6008 O O     . HOH I 5 .   ? 3.252   -14.408 83.704  1.00 31.35 ? 2095 HOH B O     1 
HETATM 6009 O O     . HOH I 5 .   ? 0.505   -11.365 91.715  1.00 41.81 ? 2097 HOH B O     1 
HETATM 6010 O O     . HOH I 5 .   ? 24.979  -40.218 84.350  1.00 50.09 ? 2101 HOH B O     1 
HETATM 6011 O O     . HOH I 5 .   ? 5.804   -15.304 60.457  1.00 31.86 ? 2104 HOH B O     1 
HETATM 6012 O O     . HOH I 5 .   ? 19.895  -44.232 82.164  1.00 31.70 ? 2105 HOH B O     1 
HETATM 6013 O O     . HOH I 5 .   ? 0.303   1.917   73.746  1.00 49.05 ? 2107 HOH B O     1 
HETATM 6014 O O     . HOH I 5 .   ? 18.699  -26.452 89.258  1.00 36.73 ? 2110 HOH B O     1 
HETATM 6015 O O     . HOH I 5 .   ? 6.409   -7.168  60.406  1.00 37.28 ? 2116 HOH B O     1 
HETATM 6016 O O     . HOH I 5 .   ? 17.087  -12.195 91.514  1.00 28.02 ? 2117 HOH B O     1 
HETATM 6017 O O     . HOH I 5 .   ? 6.586   -20.006 73.562  1.00 30.27 ? 2118 HOH B O     1 
HETATM 6018 O O     . HOH I 5 .   ? 2.687   -5.129  61.489  1.00 36.76 ? 2123 HOH B O     1 
HETATM 6019 O O     . HOH I 5 .   ? 2.472   -6.627  94.220  1.00 30.26 ? 2124 HOH B O     1 
HETATM 6020 O O     . HOH I 5 .   ? 11.608  12.020  82.797  1.00 14.18 ? 2126 HOH B O     1 
HETATM 6021 O O     . HOH I 5 .   ? 1.816   -16.839 83.276  1.00 31.46 ? 2127 HOH B O     1 
HETATM 6022 O O     . HOH I 5 .   ? 16.483  -33.191 85.511  1.00 25.46 ? 2129 HOH B O     1 
HETATM 6023 O O     . HOH I 5 .   ? 18.880  -18.203 72.053  1.00 23.29 ? 2131 HOH B O     1 
HETATM 6024 O O     . HOH I 5 .   ? 9.695   -49.238 70.798  1.00 27.59 ? 2133 HOH B O     1 
HETATM 6025 O O     . HOH I 5 .   ? 28.580  -7.223  84.552  1.00 25.75 ? 2134 HOH B O     1 
HETATM 6026 O O     . HOH I 5 .   ? 0.900   -0.805  73.051  1.00 27.09 ? 2136 HOH B O     1 
HETATM 6027 O O     . HOH I 5 .   ? -1.530  -7.419  70.702  1.00 48.18 ? 2137 HOH B O     1 
HETATM 6028 O O     . HOH I 5 .   ? 3.603   -27.070 83.037  1.00 48.84 ? 2139 HOH B O     1 
HETATM 6029 O O     . HOH I 5 .   ? 14.182  -46.326 84.310  1.00 45.32 ? 2141 HOH B O     1 
HETATM 6030 O O     . HOH I 5 .   ? 22.262  -19.214 62.987  1.00 27.13 ? 2143 HOH B O     1 
HETATM 6031 O O     . HOH I 5 .   ? 22.272  -31.118 88.485  1.00 39.31 ? 2144 HOH B O     1 
HETATM 6032 O O     . HOH I 5 .   ? 26.292  -31.406 62.610  1.00 34.96 ? 2145 HOH B O     1 
HETATM 6033 O O     . HOH I 5 .   ? 2.281   3.925   84.720  1.00 35.90 ? 2149 HOH B O     1 
HETATM 6034 O O     . HOH I 5 .   ? 8.344   2.811   89.168  1.00 33.95 ? 2150 HOH B O     1 
HETATM 6035 O O     . HOH I 5 .   ? 20.169  4.655   90.303  1.00 31.77 ? 2152 HOH B O     1 
HETATM 6036 O O     . HOH I 5 .   ? 18.364  -15.216 72.233  1.00 24.00 ? 2155 HOH B O     1 
HETATM 6037 O O     . HOH I 5 .   ? 17.515  -11.319 69.041  1.00 20.67 ? 2156 HOH B O     1 
HETATM 6038 O O     . HOH I 5 .   ? 18.338  -8.010  84.447  1.00 22.16 ? 2157 HOH B O     1 
HETATM 6039 O O     . HOH I 5 .   ? 29.813  -16.337 73.714  1.00 29.94 ? 2158 HOH B O     1 
HETATM 6040 O O     . HOH I 5 .   ? 4.388   -37.600 72.228  1.00 23.54 ? 2160 HOH B O     1 
HETATM 6041 O O     . HOH I 5 .   ? 29.868  2.847   78.792  1.00 42.84 ? 2165 HOH B O     1 
HETATM 6042 O O     . HOH I 5 .   ? 22.969  -23.630 59.510  1.00 32.23 ? 2166 HOH B O     1 
HETATM 6043 O O     . HOH I 5 .   ? 2.643   -9.495  79.203  1.00 35.36 ? 2167 HOH B O     1 
HETATM 6044 O O     . HOH I 5 .   ? 15.083  -13.543 90.436  1.00 29.45 ? 2170 HOH B O     1 
HETATM 6045 O O     . HOH I 5 .   ? 4.177   -8.225  64.661  1.00 29.86 ? 2177 HOH B O     1 
HETATM 6046 O O     . HOH I 5 .   ? 0.714   -7.980  72.882  1.00 27.62 ? 2178 HOH B O     1 
HETATM 6047 O O     . HOH I 5 .   ? 10.920  11.972  80.183  1.00 24.90 ? 2180 HOH B O     1 
HETATM 6048 O O     . HOH I 5 .   ? 24.659  -29.896 61.185  1.00 28.06 ? 2183 HOH B O     1 
HETATM 6049 O O     . HOH I 5 .   ? 17.100  -7.160  90.786  1.00 21.18 ? 2186 HOH B O     1 
HETATM 6050 O O     . HOH I 5 .   ? 5.862   -38.734 81.403  1.00 23.92 ? 2187 HOH B O     1 
HETATM 6051 O O     . HOH I 5 .   ? 9.153   -23.610 89.724  1.00 29.84 ? 2190 HOH B O     1 
HETATM 6052 O O     . HOH I 5 .   ? 8.116   -24.019 60.757  1.00 34.69 ? 2191 HOH B O     1 
HETATM 6053 O O     . HOH I 5 .   ? -0.939  -10.485 70.995  1.00 28.18 ? 2194 HOH B O     1 
HETATM 6054 O O     . HOH I 5 .   ? 25.855  -7.474  87.056  1.00 53.64 ? 2196 HOH B O     1 
HETATM 6055 O O     . HOH I 5 .   ? 3.010   -21.580 63.099  1.00 36.39 ? 2199 HOH B O     1 
HETATM 6056 O O     . HOH I 5 .   ? 6.215   -21.361 86.348  1.00 16.50 ? 2203 HOH B O     1 
HETATM 6057 O O     . HOH I 5 .   ? 18.100  2.960   91.777  1.00 51.25 ? 2206 HOH B O     1 
HETATM 6058 O O     . HOH I 5 .   ? 11.141  -6.678  97.079  1.00 40.60 ? 2207 HOH B O     1 
HETATM 6059 O O     . HOH I 5 .   ? 16.240  -4.285  93.542  1.00 35.19 ? 2209 HOH B O     1 
HETATM 6060 O O     . HOH I 5 .   ? 14.246  -18.760 60.854  1.00 30.12 ? 2212 HOH B O     1 
HETATM 6061 O O     . HOH I 5 .   ? 23.643  -21.665 83.919  1.00 27.36 ? 2214 HOH B O     1 
HETATM 6062 O O     . HOH I 5 .   ? 26.334  -15.753 70.828  1.00 27.12 ? 2215 HOH B O     1 
HETATM 6063 O O     . HOH I 5 .   ? -2.434  -8.826  87.776  1.00 29.44 ? 2216 HOH B O     1 
HETATM 6064 O O     . HOH I 5 .   ? 25.666  2.197   84.960  1.00 33.45 ? 2219 HOH B O     1 
HETATM 6065 O O     . HOH I 5 .   ? 11.488  9.141   68.921  1.00 20.73 ? 2222 HOH B O     1 
HETATM 6066 O O     . HOH I 5 .   ? 18.977  -46.115 78.161  1.00 47.61 ? 2223 HOH B O     1 
HETATM 6067 O O     . HOH I 5 .   ? 1.577   4.730   87.192  1.00 53.30 ? 2224 HOH B O     1 
HETATM 6068 O O     . HOH I 5 .   ? -5.384  -4.710  79.270  1.00 30.86 ? 2226 HOH B O     1 
HETATM 6069 O O     . HOH I 5 .   ? 34.490  -40.432 72.945  1.00 46.47 ? 2228 HOH B O     1 
HETATM 6070 O O     . HOH I 5 .   ? 28.815  -17.618 83.521  1.00 48.10 ? 2229 HOH B O     1 
HETATM 6071 O O     . HOH I 5 .   ? 7.968   -14.778 77.159  1.00 25.86 ? 2230 HOH B O     1 
HETATM 6072 O O     . HOH I 5 .   ? 0.865   -0.797  70.256  1.00 37.60 ? 2231 HOH B O     1 
HETATM 6073 O O     . HOH I 5 .   ? -0.558  -12.273 81.535  1.00 37.54 ? 2232 HOH B O     1 
HETATM 6074 O O     . HOH I 5 .   ? 8.006   -41.406 85.208  1.00 27.95 ? 2233 HOH B O     1 
HETATM 6075 O O     . HOH I 5 .   ? 22.806  -4.292  69.695  1.00 61.35 ? 2237 HOH B O     1 
HETATM 6076 O O     . HOH I 5 .   ? 4.872   1.285   67.626  1.00 43.59 ? 2240 HOH B O     1 
HETATM 6077 O O     . HOH I 5 .   ? 26.967  -17.212 63.437  1.00 42.57 ? 2241 HOH B O     1 
HETATM 6078 O O     . HOH I 5 .   ? 20.897  -6.115  89.968  1.00 45.17 ? 2244 HOH B O     1 
HETATM 6079 O O     . HOH I 5 .   ? 11.479  -12.482 93.162  1.00 30.90 ? 2246 HOH B O     1 
HETATM 6080 O O     . HOH I 5 .   ? 19.728  5.788   94.523  1.00 34.99 ? 2247 HOH B O     1 
HETATM 6081 O O     . HOH I 5 .   ? 14.865  -46.882 82.089  1.00 35.94 ? 2250 HOH B O     1 
HETATM 6082 O O     . HOH I 5 .   ? 10.024  1.573   93.050  1.00 44.55 ? 2255 HOH B O     1 
HETATM 6083 O O     . HOH I 5 .   ? 18.818  16.210  67.532  1.00 47.45 ? 2256 HOH B O     1 
HETATM 6084 O O     . HOH I 5 .   ? 18.337  -7.492  65.637  1.00 53.14 ? 2257 HOH B O     1 
HETATM 6085 O O     . HOH I 5 .   ? 6.983   -9.179  94.698  1.00 43.09 ? 2259 HOH B O     1 
HETATM 6086 O O     . HOH I 5 .   ? 2.853   10.197  75.431  1.00 36.48 ? 2261 HOH B O     1 
HETATM 6087 O O     . HOH I 5 .   ? 28.649  -11.512 73.405  1.00 29.47 ? 2262 HOH B O     1 
HETATM 6088 O O     . HOH I 5 .   ? 12.246  -42.786 66.156  1.00 36.78 ? 2265 HOH B O     1 
HETATM 6089 O O     . HOH I 5 .   ? 3.015   -46.918 67.007  1.00 47.37 ? 2269 HOH B O     1 
HETATM 6090 O O     . HOH I 5 .   ? 25.306  -14.173 83.830  1.00 58.82 ? 2274 HOH B O     1 
HETATM 6091 O O     . HOH I 5 .   ? 17.771  -45.470 83.278  1.00 35.61 ? 2276 HOH B O     1 
HETATM 6092 O O     . HOH I 5 .   ? 8.425   8.191   70.643  1.00 60.61 ? 2277 HOH B O     1 
HETATM 6093 O O     . HOH I 5 .   ? 1.025   -38.558 76.477  1.00 47.08 ? 2282 HOH B O     1 
HETATM 6094 O O     . HOH I 5 .   ? 1.742   -47.730 74.133  1.00 38.16 ? 2283 HOH B O     1 
HETATM 6095 O O     . HOH I 5 .   ? 37.177  -25.845 72.816  1.00 51.32 ? 2284 HOH B O     1 
HETATM 6096 O O     . HOH I 5 .   ? 15.582  -38.311 91.520  1.00 48.68 ? 2288 HOH B O     1 
HETATM 6097 O O     . HOH I 5 .   ? 21.444  16.810  68.976  1.00 46.84 ? 2290 HOH B O     1 
HETATM 6098 O O     . HOH I 5 .   ? 33.619  -41.060 68.072  1.00 57.56 ? 2291 HOH B O     1 
HETATM 6099 O O     . HOH I 5 .   ? 27.918  -44.108 78.490  1.00 38.85 ? 2298 HOH B O     1 
HETATM 6100 O O     . HOH I 5 .   ? 24.014  -11.842 71.056  1.00 31.72 ? 2299 HOH B O     1 
HETATM 6101 O O     . HOH I 5 .   ? 12.720  -41.499 64.040  1.00 43.68 ? 2300 HOH B O     1 
HETATM 6102 O O     . HOH I 5 .   ? 4.583   -12.525 75.318  1.00 31.86 ? 2305 HOH B O     1 
HETATM 6103 O O     . HOH I 5 .   ? 3.261   6.675   76.780  1.00 27.75 ? 2308 HOH B O     1 
HETATM 6104 O O     . HOH I 5 .   ? 20.082  -11.167 64.924  1.00 38.04 ? 2310 HOH B O     1 
HETATM 6105 O O     . HOH I 5 .   ? 11.754  -11.244 63.043  1.00 43.19 ? 2318 HOH B O     1 
HETATM 6106 O O     . HOH I 5 .   ? 34.256  -15.959 79.639  1.00 41.00 ? 2321 HOH B O     1 
HETATM 6107 O O     . HOH I 5 .   ? 33.984  -40.601 80.868  1.00 44.56 ? 2322 HOH B O     1 
HETATM 6108 O O     . HOH I 5 .   ? 3.343   -31.525 76.813  1.00 35.41 ? 2326 HOH B O     1 
HETATM 6109 O O     . HOH I 5 .   ? -3.469  -17.653 69.012  1.00 62.22 ? 2328 HOH B O     1 
HETATM 6110 O O     . HOH I 5 .   ? -1.693  -16.986 66.586  1.00 57.40 ? 2329 HOH B O     1 
HETATM 6111 O O     . HOH I 5 .   ? 18.371  -46.861 85.542  1.00 36.87 ? 2336 HOH B O     1 
HETATM 6112 O O     . HOH I 5 .   ? 2.215   -34.638 82.523  1.00 55.82 ? 2337 HOH B O     1 
HETATM 6113 O O     . HOH I 5 .   ? 2.962   -28.926 77.518  1.00 47.75 ? 2341 HOH B O     1 
HETATM 6114 O O     . HOH I 5 .   ? 26.054  -14.956 66.083  1.00 40.73 ? 2344 HOH B O     1 
HETATM 6115 O O     . HOH I 5 .   ? 20.753  -47.957 85.716  1.00 55.53 ? 2346 HOH B O     1 
HETATM 6116 O O     . HOH I 5 .   ? 17.532  -49.987 78.186  1.00 40.10 ? 2349 HOH B O     1 
HETATM 6117 O O     . HOH I 5 .   ? 18.858  -38.749 65.271  1.00 34.63 ? 2351 HOH B O     1 
HETATM 6118 O O     . HOH I 5 .   ? 22.360  -42.474 74.336  1.00 30.46 ? 2354 HOH B O     1 
HETATM 6119 O O     . HOH I 5 .   ? 15.769  -15.231 83.838  1.00 42.10 ? 2356 HOH B O     1 
HETATM 6120 O O     . HOH I 5 .   ? 12.835  -18.638 58.470  1.00 44.68 ? 2357 HOH B O     1 
HETATM 6121 O O     . HOH I 5 .   ? 27.470  -8.920  88.460  1.00 36.92 ? 2361 HOH B O     1 
HETATM 6122 O O     . HOH I 5 .   ? 15.831  9.501   90.038  1.00 44.96 ? 2363 HOH B O     1 
HETATM 6123 O O     . HOH I 5 .   ? 19.215  -34.611 95.333  1.00 37.24 ? 2365 HOH B O     1 
HETATM 6124 O O     . HOH I 5 .   ? -3.667  -16.754 86.351  1.00 38.25 ? 2367 HOH B O     1 
HETATM 6125 O O     . HOH I 5 .   ? 6.697   -18.320 61.303  1.00 35.01 ? 2369 HOH B O     1 
HETATM 6126 O O     . HOH I 5 .   ? 5.822   -26.106 81.097  1.00 33.78 ? 2373 HOH B O     1 
HETATM 6127 O O     . HOH I 5 .   ? 27.187  -28.142 84.254  1.00 52.96 ? 2374 HOH B O     1 
HETATM 6128 O O     . HOH I 5 .   ? 28.646  -30.676 62.518  1.00 40.60 ? 2376 HOH B O     1 
HETATM 6129 O O     . HOH I 5 .   ? 24.603  6.974   90.085  1.00 43.43 ? 2378 HOH B O     1 
HETATM 6130 O O     . HOH I 5 .   ? 3.007   -24.905 69.073  1.00 39.62 ? 2384 HOH B O     1 
HETATM 6131 O O     . HOH I 5 .   ? 18.111  -26.097 86.285  1.00 30.59 ? 2385 HOH B O     1 
HETATM 6132 O O     . HOH I 5 .   ? 23.146  -0.835  87.173  1.00 50.53 ? 2387 HOH B O     1 
HETATM 6133 O O     . HOH I 5 .   ? 31.645  -18.576 61.423  1.00 51.29 ? 2389 HOH B O     1 
HETATM 6134 O O     . HOH I 5 .   ? 19.813  -10.842 86.984  1.00 40.55 ? 2392 HOH B O     1 
HETATM 6135 O O     . HOH I 5 .   ? 31.682  -11.329 84.925  1.00 34.38 ? 2393 HOH B O     1 
HETATM 6136 O O     . HOH I 5 .   ? 23.450  -29.089 87.096  1.00 36.72 ? 2394 HOH B O     1 
HETATM 6137 O O     . HOH I 5 .   ? 6.345   -16.871 79.698  1.00 28.60 ? 2395 HOH B O     1 
HETATM 6138 O O     . HOH I 5 .   ? 33.826  -33.789 68.204  1.00 45.96 ? 2397 HOH B O     1 
HETATM 6139 O O     . HOH I 5 .   ? 37.038  0.457   76.786  1.00 37.19 ? 2398 HOH B O     1 
HETATM 6140 O O     . HOH I 5 .   ? -3.092  -9.429  72.010  1.00 49.65 ? 2399 HOH B O     1 
HETATM 6141 O O     . HOH I 5 .   ? 18.158  -9.540  90.749  1.00 33.37 ? 2400 HOH B O     1 
HETATM 6142 O O     . HOH I 5 .   ? 34.524  -11.673 73.801  1.00 50.38 ? 2405 HOH B O     1 
HETATM 6143 O O     . HOH I 5 .   ? 31.251  -6.470  85.838  1.00 34.03 ? 2407 HOH B O     1 
HETATM 6144 O O     . HOH I 5 .   ? 12.409  -8.881  61.891  1.00 43.38 ? 2408 HOH B O     1 
HETATM 6145 O O     . HOH I 5 .   ? 19.025  -4.522  93.517  1.00 43.14 ? 2413 HOH B O     1 
HETATM 6146 O O     . HOH J 5 .   ? 13.202  7.866   64.880  1.00 43.05 ? 2089 HOH C O     1 
HETATM 6147 O O     . HOH J 5 .   ? 12.104  15.949  63.990  1.00 37.76 ? 2098 HOH C O     1 
HETATM 6148 O O     . HOH J 5 .   ? 31.144  19.100  50.629  1.00 59.06 ? 2162 HOH C O     1 
HETATM 6149 O O     . HOH J 5 .   ? 18.062  5.691   58.185  1.00 40.98 ? 2168 HOH C O     1 
HETATM 6150 O O     . HOH J 5 .   ? 15.987  8.565   55.506  1.00 26.44 ? 2171 HOH C O     1 
HETATM 6151 O O     . HOH J 5 .   ? 31.047  8.064   53.078  1.00 40.79 ? 2188 HOH C O     1 
HETATM 6152 O O     . HOH J 5 .   ? 31.658  1.644   46.232  1.00 34.90 ? 2242 HOH C O     1 
HETATM 6153 O O     . HOH J 5 .   ? 13.203  17.266  58.529  1.00 55.80 ? 2264 HOH C O     1 
HETATM 6154 O O     . HOH J 5 .   ? 38.046  15.906  50.725  1.00 51.24 ? 2280 HOH C O     1 
HETATM 6155 O O     . HOH J 5 .   ? 24.135  1.604   57.635  1.00 45.05 ? 2286 HOH C O     1 
HETATM 6156 O O     . HOH J 5 .   ? 14.049  0.008   62.306  1.00 44.23 ? 2313 HOH C O     1 
HETATM 6157 O O     . HOH J 5 .   ? 29.023  -2.799  52.723  1.00 56.11 ? 2316 HOH C O     1 
HETATM 6158 O O     . HOH J 5 .   ? 9.265   5.405   60.570  1.00 43.33 ? 2325 HOH C O     1 
HETATM 6159 O O     . HOH J 5 .   ? 21.944  2.616   58.507  1.00 44.98 ? 2333 HOH C O     1 
HETATM 6160 O O     . HOH J 5 .   ? 9.371   3.047   61.359  1.00 54.97 ? 2340 HOH C O     1 
HETATM 6161 O O     . HOH J 5 .   ? 14.394  -0.775  52.382  1.00 30.36 ? 2358 HOH C O     1 
HETATM 6162 O O     . HOH J 5 .   ? 27.539  6.941   46.814  1.00 34.56 ? 2359 HOH C O     1 
HETATM 6163 O O     . HOH J 5 .   ? 34.278  9.092   50.303  1.00 48.87 ? 2390 HOH C O     1 
HETATM 6164 O O     . HOH J 5 .   ? 23.439  -2.178  58.725  1.00 44.19 ? 2411 HOH C O     1 
HETATM 6165 O O     . HOH J 5 .   ? 27.122  6.830   56.377  1.00 56.18 ? 2417 HOH C O     1 
HETATM 6166 O O     . HOH K 5 .   ? 7.744   7.273   44.183  1.00 43.06 ? 2013 HOH D O     1 
HETATM 6167 O O     . HOH K 5 .   ? 17.602  10.910  47.343  1.00 33.05 ? 2070 HOH D O     1 
HETATM 6168 O O     . HOH K 5 .   ? 10.302  0.338   42.312  1.00 29.21 ? 2085 HOH D O     1 
HETATM 6169 O O     . HOH K 5 .   ? 25.117  11.713  46.064  1.00 28.04 ? 2121 HOH D O     1 
HETATM 6170 O O     . HOH K 5 .   ? 23.502  16.935  56.960  1.00 52.43 ? 2138 HOH D O     1 
HETATM 6171 O O     . HOH K 5 .   ? 6.893   1.527   41.366  1.00 21.15 ? 2175 HOH D O     1 
HETATM 6172 O O     . HOH K 5 .   ? 29.787  15.273  65.403  1.00 46.05 ? 2263 HOH D O     1 
HETATM 6173 O O     . HOH K 5 .   ? 7.038   6.835   60.814  1.00 42.64 ? 2285 HOH D O     1 
HETATM 6174 O O     . HOH K 5 .   ? 26.905  17.077  48.268  1.00 32.04 ? 2292 HOH D O     1 
HETATM 6175 O O     . HOH K 5 .   ? 4.922   2.083   43.178  1.00 41.10 ? 2372 HOH D O     1 
HETATM 6176 O O     . HOH L 5 .   ? 13.585  -14.191 92.689  1.00 24.66 ? 2044 HOH E O     1 
HETATM 6177 O O     . HOH L 5 .   ? -10.620 -31.205 91.274  1.00 38.12 ? 2079 HOH E O     1 
HETATM 6178 O O     . HOH L 5 .   ? -8.426  -22.706 83.620  1.00 32.13 ? 2087 HOH E O     1 
HETATM 6179 O O     . HOH L 5 .   ? 28.640  -28.031 92.784  1.00 42.00 ? 2088 HOH E O     1 
HETATM 6180 O O     . HOH L 5 .   ? -3.279  -11.505 90.301  1.00 42.60 ? 2111 HOH E O     1 
HETATM 6181 O O     . HOH L 5 .   ? 5.585   -23.579 96.415  1.00 45.84 ? 2125 HOH E O     1 
HETATM 6182 O O     . HOH L 5 .   ? 1.992   -23.508 96.846  1.00 38.85 ? 2132 HOH E O     1 
HETATM 6183 O O     . HOH L 5 .   ? -0.646  -29.897 86.228  1.00 41.97 ? 2151 HOH E O     1 
HETATM 6184 O O     . HOH L 5 .   ? 11.370  -23.206 95.960  1.00 37.08 ? 2172 HOH E O     1 
HETATM 6185 O O     . HOH L 5 .   ? 16.337  -34.855 97.883  1.00 34.15 ? 2192 HOH E O     1 
HETATM 6186 O O     . HOH L 5 .   ? -6.211  -24.786 90.936  1.00 33.99 ? 2193 HOH E O     1 
HETATM 6187 O O     . HOH L 5 .   ? 0.194   -24.072 85.763  1.00 41.52 ? 2251 HOH E O     1 
HETATM 6188 O O     . HOH L 5 .   ? -1.716  -31.988 89.204  1.00 31.03 ? 2272 HOH E O     1 
HETATM 6189 O O     . HOH L 5 .   ? 15.482  -16.624 102.537 1.00 56.91 ? 2324 HOH E O     1 
HETATM 6190 O O     . HOH L 5 .   ? 9.078   -15.515 102.617 1.00 45.19 ? 2330 HOH E O     1 
HETATM 6191 O O     . HOH L 5 .   ? 8.994   -9.184  96.570  1.00 49.39 ? 2379 HOH E O     1 
HETATM 6192 O O     . HOH L 5 .   ? -2.935  -34.252 91.893  1.00 47.81 ? 2391 HOH E O     1 
HETATM 6193 O O     . HOH M 5 .   ? 10.711  -25.898 87.646  1.00 34.58 ? 2045 HOH F O     1 
HETATM 6194 O O     . HOH M 5 .   ? 1.229   -31.270 89.018  1.00 52.81 ? 2074 HOH F O     1 
HETATM 6195 O O     . HOH M 5 .   ? 10.787  -29.140 85.843  1.00 19.44 ? 2109 HOH F O     1 
HETATM 6196 O O     . HOH M 5 .   ? 12.774  -24.560 88.667  1.00 19.15 ? 2130 HOH F O     1 
HETATM 6197 O O     . HOH M 5 .   ? 15.477  -16.350 87.109  1.00 46.88 ? 2153 HOH F O     1 
HETATM 6198 O O     . HOH M 5 .   ? 21.308  -16.893 81.398  1.00 22.55 ? 2164 HOH F O     1 
HETATM 6199 O O     . HOH M 5 .   ? 17.978  -15.556 82.634  1.00 38.81 ? 2185 HOH F O     1 
HETATM 6200 O O     . HOH M 5 .   ? 20.678  -14.203 81.937  1.00 26.08 ? 2205 HOH F O     1 
HETATM 6201 O O     . HOH M 5 .   ? 8.400   -35.378 88.322  1.00 46.83 ? 2235 HOH F O     1 
HETATM 6202 O O     . HOH M 5 .   ? 21.347  -14.693 84.767  1.00 45.72 ? 2236 HOH F O     1 
HETATM 6203 O O     . HOH M 5 .   ? 1.609   -26.563 97.380  1.00 40.37 ? 2239 HOH F O     1 
HETATM 6204 O O     . HOH M 5 .   ? 23.290  -17.308 83.224  1.00 38.64 ? 2249 HOH F O     1 
HETATM 6205 O O     . HOH M 5 .   ? 9.117   -28.219 88.423  1.00 42.74 ? 2287 HOH F O     1 
HETATM 6206 O O     . HOH M 5 .   ? 3.291   -21.751 86.262  1.00 42.93 ? 2366 HOH F O     1 
HETATM 6207 O O     . HOH M 5 .   ? 23.149  -12.216 95.170  1.00 48.00 ? 2382 HOH F O     1 
HETATM 6208 O O     . HOH M 5 .   ? -2.854  -25.333 96.855  1.00 42.06 ? 2406 HOH F O     1 
HETATM 6209 O O     . HOH M 5 .   ? 11.400  -24.623 91.273  1.00 43.81 ? 2410 HOH F O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  TYR 17  17  17  TYR TYR A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  TRP 63  63  63  TRP TRP A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  TRP 76  76  76  TRP TRP A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  TRP 79  79  79  TRP TRP A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  MET 87  87  87  MET MET A . n 
A 1 88  TRP 88  88  88  TRP TRP A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 ASN 104 104 104 ASN ASN A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 MET 107 107 107 MET MET A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 MET 113 113 113 MET MET A . n 
A 1 114 ARG 114 114 114 ARG ARG A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 ARG 130 130 130 ARG ARG A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 ASN 133 133 133 ASN ASN A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 PRO 137 137 137 PRO PRO A . n 
A 1 138 ASP 138 138 138 ASP ASP A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 ASP 143 143 143 ASP ASP A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 TYR 153 153 153 TYR TYR A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLN 155 155 155 GLN GLN A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 MET 162 162 162 MET MET A . n 
A 1 163 ASP 163 163 163 ASP ASP A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 ASN 173 173 173 ASN ASN A . n 
A 1 174 TYR 174 174 174 TYR TYR A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 LYS 184 184 184 LYS LYS A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 HIS 188 188 188 HIS HIS A . n 
A 1 189 LYS 189 189 189 LYS LYS A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 GLU 198 198 198 GLU GLU A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 TRP 203 203 203 TRP TRP A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 TRP 205 205 205 TRP TRP A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 TYR 208 208 208 TYR TYR A . n 
A 1 209 GLU 209 209 209 GLU GLU A . n 
A 1 210 THR 210 210 210 THR THR A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 TYR 214 214 214 TYR TYR A . n 
A 1 215 ASP 215 215 215 ASP ASP A . n 
A 1 216 SER 216 216 216 SER SER A . n 
A 1 217 ASN 217 217 217 ASN ASN A . n 
A 1 218 HIS 218 218 218 HIS HIS A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 TYR 221 221 221 TYR TYR A . n 
A 1 222 MET 222 222 222 MET MET A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 ASN 224 224 224 ASN ASN A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 GLU 226 226 226 GLU GLU A . n 
A 1 227 ASN 227 227 227 ASN ASN A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 ILE 232 232 232 ILE ILE A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 LYS 235 235 235 LYS LYS A . n 
A 1 236 ASN 236 236 236 ASN ASN A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 HIS 238 238 238 HIS HIS A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 ASN 240 240 240 ASN ASN A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 HIS 242 242 242 HIS HIS A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 LYS 246 246 246 LYS LYS A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 PHE 248 248 248 PHE PHE A . n 
A 1 249 ASP 249 249 249 ASP ASP A . n 
A 1 250 PHE 250 250 250 PHE PHE A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 TYR 253 253 253 TYR TYR A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 LYS 256 256 256 LYS LYS A . n 
A 1 257 LYS 257 257 257 LYS LYS A . n 
A 1 258 ASP 258 258 258 ASP ASP A . n 
A 1 259 PRO 259 259 259 PRO PRO A . n 
A 1 260 ASN 260 260 260 ASN ASN A . n 
A 1 261 GLY 261 261 261 GLY GLY A . n 
A 1 262 ASN 262 262 262 ASN ASN A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 ALA 266 266 266 ALA ALA A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 ILE 269 269 269 ILE ILE A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 GLY 271 271 271 GLY GLY A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 LYS 274 274 274 LYS LYS A . n 
A 1 275 ASN 275 275 275 ASN ASN A . n 
A 1 276 LYS 276 276 276 LYS LYS A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 THR 278 278 278 THR THR A . n 
A 1 279 THR 279 279 279 THR THR A . n 
A 1 280 TYR 280 280 280 TYR TYR A . n 
A 1 281 TRP 281 281 281 TRP TRP A . n 
A 1 282 ALA 282 282 282 ALA ALA A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 ALA 284 284 284 ALA ALA A . n 
A 1 285 ILE 285 285 285 ILE ILE A . n 
A 1 286 GLN 286 286 286 GLN GLN A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 LEU 288 288 288 LEU LEU A . n 
A 1 289 GLU 289 289 289 GLU GLU A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   PRO 2   2   2   PRO PRO B . n 
B 1 3   GLU 3   3   3   GLU GLU B . n 
B 1 4   GLY 4   4   4   GLY GLY B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   GLU 6   6   6   GLU GLU B . n 
B 1 7   VAL 7   7   7   VAL VAL B . n 
B 1 8   ALA 8   8   8   ALA ALA B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  THR 10  10  10  THR THR B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  ASP 12  12  12  ASP ASP B . n 
B 1 13  ILE 13  13  13  ILE ILE B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  LYS 16  16  16  LYS LYS B . n 
B 1 17  TYR 17  17  17  TYR TYR B . n 
B 1 18  PHE 18  18  18  PHE PHE B . n 
B 1 19  LYS 19  19  19  LYS LYS B . n 
B 1 20  GLY 20  20  20  GLY GLY B . n 
B 1 21  LYS 21  21  21  LYS LYS B . n 
B 1 22  THR 22  22  22  THR THR B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  TYR 25  25  25  TYR TYR B . n 
B 1 26  ILE 26  26  26  ILE ILE B . n 
B 1 27  ASP 27  27  27  ASP ASP B . n 
B 1 28  PHE 28  28  28  PHE PHE B . n 
B 1 29  ILE 29  29  29  ILE ILE B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  ARG 32  32  32  ARG ARG B . n 
B 1 33  TYR 33  33  33  TYR TYR B . n 
B 1 34  SER 34  34  34  SER SER B . n 
B 1 35  LYS 35  35  35  LYS LYS B . n 
B 1 36  SER 36  36  36  SER SER B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  PRO 38  38  38  PRO PRO B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  GLY 40  40  40  GLY GLY B . n 
B 1 41  TYR 41  41  41  TYR TYR B . n 
B 1 42  ASP 42  42  42  ASP ASP B . n 
B 1 43  ASP 43  43  43  ASP ASP B . n 
B 1 44  PHE 44  44  44  PHE PHE B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  ALA 46  46  46  ALA ALA B . n 
B 1 47  ASN 47  47  47  ASN ASN B . n 
B 1 48  LEU 48  48  48  LEU LEU B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  VAL 52  52  52  VAL VAL B . n 
B 1 53  SER 53  53  53  SER SER B . n 
B 1 54  ASN 54  54  54  ASN ASN B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  ASP 56  56  56  ASP ASP B . n 
B 1 57  THR 57  57  57  THR THR B . n 
B 1 58  LYS 58  58  58  LYS LYS B . n 
B 1 59  GLY 59  59  59  GLY GLY B . n 
B 1 60  LYS 60  60  60  LYS LYS B . n 
B 1 61  PHE 61  61  61  PHE PHE B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  TRP 63  63  63  TRP TRP B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  LEU 66  66  66  LEU LEU B . n 
B 1 67  PHE 67  67  67  PHE PHE B . n 
B 1 68  ASP 68  68  68  ASP ASP B . n 
B 1 69  PRO 69  69  69  PRO PRO B . n 
B 1 70  ASN 70  70  70  ASN ASN B . n 
B 1 71  ASP 71  71  71  ASP ASP B . n 
B 1 72  LYS 72  72  72  LYS LYS B . n 
B 1 73  SER 73  73  73  SER SER B . n 
B 1 74  ASN 74  74  74  ASN ASN B . n 
B 1 75  LYS 75  75  75  LYS LYS B . n 
B 1 76  TRP 76  76  76  TRP TRP B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  ILE 78  78  78  ILE ILE B . n 
B 1 79  TRP 79  79  79  TRP TRP B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  THR 81  81  81  THR THR B . n 
B 1 82  PHE 82  82  82  PHE PHE B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  LEU 84  84  84  LEU LEU B . n 
B 1 85  THR 85  85  85  THR THR B . n 
B 1 86  GLY 86  86  86  GLY GLY B . n 
B 1 87  MET 87  87  87  MET MET B . n 
B 1 88  TRP 88  88  88  TRP TRP B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  PHE 91  91  91  PHE PHE B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  TYR 95  95  95  TYR TYR B . n 
B 1 96  THR 96  96  96  THR THR B . n 
B 1 97  ARG 97  97  97  ARG ARG B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 LEU 100 100 100 LEU LEU B . n 
B 1 101 SER 101 101 101 SER SER B . n 
B 1 102 PHE 102 102 102 PHE PHE B . n 
B 1 103 ASP 103 103 103 ASP ASP B . n 
B 1 104 ASN 104 104 104 ASN ASN B . n 
B 1 105 GLU 105 105 105 GLU GLU B . n 
B 1 106 LEU 106 106 106 LEU LEU B . n 
B 1 107 MET 107 107 107 MET MET B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 TYR 109 109 109 TYR TYR B . n 
B 1 110 PHE 110 110 110 PHE PHE B . n 
B 1 111 SER 111 111 111 SER SER B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 MET 113 113 113 MET MET B . n 
B 1 114 ARG 114 114 114 ARG ARG B . n 
B 1 115 ASN 115 115 115 ASN ASN B . n 
B 1 116 PHE 116 116 116 PHE PHE B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 THR 118 118 118 THR THR B . n 
B 1 119 PHE 119 119 119 PHE PHE B . n 
B 1 120 LYS 120 120 120 LYS LYS B . n 
B 1 121 PHE 121 121 121 PHE PHE B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 ASN 123 123 123 ASN ASN B . n 
B 1 124 SER 124 124 124 SER SER B . n 
B 1 125 GLU 125 125 125 GLU GLU B . n 
B 1 126 LYS 126 126 126 LYS LYS B . n 
B 1 127 GLU 127 127 127 GLU GLU B . n 
B 1 128 LEU 128 128 128 LEU LEU B . n 
B 1 129 LYS 129 129 129 LYS LYS B . n 
B 1 130 ARG 130 130 130 ARG ARG B . n 
B 1 131 LYS 131 131 131 LYS LYS B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 ASN 133 133 133 ASN ASN B . n 
B 1 134 GLU 134 134 134 GLU GLU B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 GLY 136 136 136 GLY GLY B . n 
B 1 137 PRO 137 137 137 PRO PRO B . n 
B 1 138 ASP 138 138 138 ASP ASP B . n 
B 1 139 PHE 139 139 139 PHE PHE B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 ASN 142 142 142 ASN ASN B . n 
B 1 143 ASP 143 143 143 ASP ASP B . n 
B 1 144 ASP 144 144 144 ASP ASP B . n 
B 1 145 ILE 145 145 145 ILE ILE B . n 
B 1 146 ASP 146 146 146 ASP ASP B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 LYS 149 149 149 LYS LYS B . n 
B 1 150 ILE 150 150 150 ILE ILE B . n 
B 1 151 LYS 151 151 151 LYS LYS B . n 
B 1 152 LYS 152 152 152 LYS LYS B . n 
B 1 153 TYR 153 153 153 TYR TYR B . n 
B 1 154 LYS 154 154 154 LYS LYS B . n 
B 1 155 GLN 155 155 155 GLN GLN B . n 
B 1 156 PRO 156 156 156 PRO PRO B . n 
B 1 157 ILE 157 157 157 ILE ILE B . n 
B 1 158 VAL 158 158 158 VAL VAL B . n 
B 1 159 ALA 159 159 159 ALA ALA B . n 
B 1 160 LEU 160 160 160 LEU LEU B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 MET 162 162 162 MET MET B . n 
B 1 163 ASP 163 163 163 ASP ASP B . n 
B 1 164 GLN 164 164 164 GLN GLN B . n 
B 1 165 LYS 165 165 165 LYS LYS B . n 
B 1 166 LYS 166 166 166 LYS LYS B . n 
B 1 167 ILE 167 167 167 ILE ILE B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 SER 169 169 169 SER SER B . n 
B 1 170 GLY 170 170 170 GLY GLY B . n 
B 1 171 LEU 171 171 171 LEU LEU B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 ASN 173 173 173 ASN ASN B . n 
B 1 174 TYR 174 174 174 TYR TYR B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 VAL 176 176 176 VAL VAL B . n 
B 1 177 ALA 177 177 177 ALA ALA B . n 
B 1 178 GLU 178 178 178 GLU GLU B . n 
B 1 179 ILE 179 179 179 ILE ILE B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 TYR 181 181 181 TYR TYR B . n 
B 1 182 ARG 182 182 182 ARG ARG B . n 
B 1 183 ALA 183 183 183 ALA ALA B . n 
B 1 184 LYS 184 184 184 LYS LYS B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 ASP 186 186 186 ASP ASP B . n 
B 1 187 PRO 187 187 187 PRO PRO B . n 
B 1 188 HIS 188 188 188 HIS HIS B . n 
B 1 189 LYS 189 189 189 LYS LYS B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 SER 192 192 192 SER SER B . n 
B 1 193 ASN 193 193 193 ASN ASN B . n 
B 1 194 LEU 194 194 194 LEU LEU B . n 
B 1 195 THR 195 195 195 THR THR B . n 
B 1 196 ASP 196 196 196 ASP ASP B . n 
B 1 197 GLN 197 197 197 GLN GLN B . n 
B 1 198 GLU 198 198 198 GLU GLU B . n 
B 1 199 ILE 199 199 199 ILE ILE B . n 
B 1 200 GLU 200 200 200 GLU GLU B . n 
B 1 201 ASN 201 201 201 ASN ASN B . n 
B 1 202 LEU 202 202 202 LEU LEU B . n 
B 1 203 TRP 203 203 203 TRP TRP B . n 
B 1 204 TYR 204 204 204 TYR TYR B . n 
B 1 205 TRP 205 205 205 TRP TRP B . n 
B 1 206 ILE 206 206 206 ILE ILE B . n 
B 1 207 LYS 207 207 207 LYS LYS B . n 
B 1 208 TYR 208 208 208 TYR TYR B . n 
B 1 209 GLU 209 209 209 GLU GLU B . n 
B 1 210 THR 210 210 210 THR THR B . n 
B 1 211 LYS 211 211 211 LYS LYS B . n 
B 1 212 LEU 212 212 212 LEU LEU B . n 
B 1 213 ALA 213 213 213 ALA ALA B . n 
B 1 214 TYR 214 214 214 TYR TYR B . n 
B 1 215 ASP 215 215 215 ASP ASP B . n 
B 1 216 SER 216 216 216 SER SER B . n 
B 1 217 ASN 217 217 217 ASN ASN B . n 
B 1 218 HIS 218 218 218 HIS HIS B . n 
B 1 219 ILE 219 219 219 ILE ILE B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 TYR 221 221 221 TYR TYR B . n 
B 1 222 MET 222 222 222 MET MET B . n 
B 1 223 VAL 223 223 223 VAL VAL B . n 
B 1 224 ASN 224 224 224 ASN ASN B . n 
B 1 225 LEU 225 225 225 LEU LEU B . n 
B 1 226 GLU 226 226 226 GLU GLU B . n 
B 1 227 ASN 227 227 227 ASN ASN B . n 
B 1 228 GLU 228 228 228 GLU GLU B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 SER 230 230 230 SER SER B . n 
B 1 231 LYS 231 231 231 LYS LYS B . n 
B 1 232 ILE 232 232 232 ILE ILE B . n 
B 1 233 GLY 233 233 233 GLY GLY B . n 
B 1 234 ARG 234 234 234 ARG ARG B . n 
B 1 235 LYS 235 235 235 LYS LYS B . n 
B 1 236 ASN 236 236 236 ASN ASN B . n 
B 1 237 TYR 237 237 237 TYR TYR B . n 
B 1 238 HIS 238 238 238 HIS HIS B . n 
B 1 239 PRO 239 239 239 PRO PRO B . n 
B 1 240 ASN 240 240 240 ASN ASN B . n 
B 1 241 ILE 241 241 241 ILE ILE B . n 
B 1 242 HIS 242 242 242 HIS HIS B . n 
B 1 243 PRO 243 243 243 PRO PRO B . n 
B 1 244 THR 244 244 244 THR THR B . n 
B 1 245 GLU 245 245 245 GLU GLU B . n 
B 1 246 LYS 246 246 246 LYS LYS B . n 
B 1 247 GLU 247 247 247 GLU GLU B . n 
B 1 248 PHE 248 248 248 PHE PHE B . n 
B 1 249 ASP 249 249 249 ASP ASP B . n 
B 1 250 PHE 250 250 250 PHE PHE B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 VAL 252 252 252 VAL VAL B . n 
B 1 253 TYR 253 253 253 TYR TYR B . n 
B 1 254 ARG 254 254 254 ARG ARG B . n 
B 1 255 LYS 255 255 255 LYS LYS B . n 
B 1 256 LYS 256 256 256 LYS LYS B . n 
B 1 257 LYS 257 257 257 LYS LYS B . n 
B 1 258 ASP 258 258 258 ASP ASP B . n 
B 1 259 PRO 259 259 259 PRO PRO B . n 
B 1 260 ASN 260 260 260 ASN ASN B . n 
B 1 261 GLY 261 261 261 GLY GLY B . n 
B 1 262 ASN 262 262 262 ASN ASN B . n 
B 1 263 LYS 263 263 263 LYS LYS B . n 
B 1 264 VAL 264 264 264 VAL VAL B . n 
B 1 265 ILE 265 265 265 ILE ILE B . n 
B 1 266 ALA 266 266 266 ALA ALA B . n 
B 1 267 ASP 267 267 267 ASP ASP B . n 
B 1 268 LYS 268 268 268 LYS LYS B . n 
B 1 269 ILE 269 269 269 ILE ILE B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 GLY 271 271 271 GLY GLY B . n 
B 1 272 SER 272 272 272 SER SER B . n 
B 1 273 GLY 273 273 273 GLY GLY B . n 
B 1 274 LYS 274 274 274 LYS LYS B . n 
B 1 275 ASN 275 275 275 ASN ASN B . n 
B 1 276 LYS 276 276 276 LYS LYS B . n 
B 1 277 ARG 277 277 277 ARG ARG B . n 
B 1 278 THR 278 278 278 THR THR B . n 
B 1 279 THR 279 279 279 THR THR B . n 
B 1 280 TYR 280 280 280 TYR TYR B . n 
B 1 281 TRP 281 281 281 TRP TRP B . n 
B 1 282 ALA 282 282 282 ALA ALA B . n 
B 1 283 PRO 283 283 283 PRO PRO B . n 
B 1 284 ALA 284 284 284 ALA ALA B . n 
B 1 285 ILE 285 285 285 ILE ILE B . n 
B 1 286 GLN 286 286 286 GLN GLN B . n 
B 1 287 LYS 287 287 287 LYS LYS B . n 
B 1 288 LEU 288 288 288 LEU LEU B . n 
B 1 289 GLU 289 289 289 GLU GLU B . n 
C 2 1   DG  1   1   1   DG  DG  C . n 
C 2 2   DT  2   2   2   DT  DT  C . n 
C 2 3   DA  3   3   3   DA  DA  C . n 
C 2 4   DG  4   4   4   DG  DG  C . n 
C 2 5   DA  5   5   5   DA  DA  C . n 
C 2 6   DC  6   6   6   DC  DC  C . n 
C 2 7   DC  7   7   7   DC  DC  C . n 
C 2 8   DT  8   8   8   DT  DT  C . n 
C 2 9   DG  9   9   9   DG  DG  C . n 
C 2 10  DG  10  10  10  DG  DG  C . n 
C 2 11  DA  11  11  11  DA  DA  C . n 
C 2 12  DC  12  12  12  DC  DC  C . n 
C 2 13  DG  13  13  13  DG  DG  C . n 
D 3 1   DC  1   14  14  DC  DC  D . n 
D 3 2   DG  2   15  15  DG  DG  D . n 
D 3 3   DT  3   16  16  DT  DT  D . n 
D 3 4   DC  4   17  17  DC  DC  D . n 
D 3 5   DC  5   18  18  DC  DC  D . n 
D 3 6   DA  6   19  19  DA  DA  D . n 
D 3 7   3DR 7   20  20  3DR 3DR D . n 
D 3 8   DG  8   21  21  DG  DG  D . n 
D 3 9   DT  9   22  22  DT  DT  D . n 
D 3 10  DC  10  23  23  DC  DC  D . n 
D 3 11  DT  11  24  24  DT  DT  D . n 
D 3 12  DA  12  25  25  DA  DA  D . n 
D 3 13  DC  13  26  26  DC  DC  D . n 
E 2 1   DG  1   1   1   DG  DG  E . n 
E 2 2   DT  2   2   2   DT  DT  E . n 
E 2 3   DA  3   3   3   DA  DA  E . n 
E 2 4   DG  4   4   4   DG  DG  E . n 
E 2 5   DA  5   5   5   DA  DA  E . n 
E 2 6   DC  6   6   6   DC  DC  E . n 
E 2 7   DC  7   7   7   DC  DC  E . n 
E 2 8   DT  8   8   8   DT  DT  E . n 
E 2 9   DG  9   9   9   DG  DG  E . n 
E 2 10  DG  10  10  10  DG  DG  E . n 
E 2 11  DA  11  11  11  DA  DA  E . n 
E 2 12  DC  12  12  12  DC  DC  E . n 
E 2 13  DG  13  13  13  DG  DG  E . n 
F 3 1   DC  1   14  14  DC  DC  F . n 
F 3 2   DG  2   15  15  DG  DG  F . n 
F 3 3   DT  3   16  16  DT  DT  F . n 
F 3 4   DC  4   17  17  DC  DC  F . n 
F 3 5   DC  5   18  18  DC  DC  F . n 
F 3 6   DA  6   19  19  DA  DA  F . n 
F 3 7   3DR 7   20  20  3DR 3DR F . n 
F 3 8   DG  8   21  21  DG  DG  F . n 
F 3 9   DT  9   22  22  DT  DT  F . n 
F 3 10  DC  10  23  23  DC  DC  F . n 
F 3 11  DT  11  24  24  DT  DT  F . n 
F 3 12  DA  12  25  25  DA  DA  F . n 
F 3 13  DC  13  26  26  DC  DC  F . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G,H,J,K 
2 1 B,E,F,I,L,M   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4220  ? 
1 MORE         -20   ? 
1 'SSA (A^2)'  16220 ? 
2 'ABSA (A^2)' 3900  ? 
2 MORE         -18   ? 
2 'SSA (A^2)'  16360 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-07-21 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Non-polymer description'   
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .       ?               package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk 'data reduction'  
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/ ?          ? 
2 SCALA       .       ?               other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk    'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 
3 CNS         .       ?               package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns-online.org/                     Fortran_77 ? 
4 PDB_EXTRACT 3.005   'June 11, 2008' package PDB                  help@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/  C++        ? 
5 ADSC        Quantum ?               ?       ?                    ?                        'data collection' ? ?          ? 
6 MOLREP      .       ?               ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 72  ? ? -57.80  -6.27   
2  1 ALA A 93  ? ? -68.03  -177.62 
3  1 ASN A 104 ? ? 70.12   32.16   
4  1 ASP A 112 ? ? -160.89 98.08   
5  1 HIS A 218 ? ? -159.42 63.93   
6  1 MET A 222 ? ? -153.76 54.47   
7  1 VAL A 252 ? ? -134.09 -34.40  
8  1 GLU B 92  ? ? -68.28  87.33   
9  1 ASP B 112 ? ? -167.55 87.35   
10 1 LYS B 154 ? ? -101.45 64.97   
11 1 HIS B 218 ? ? -159.43 63.54   
12 1 MET B 222 ? ? -142.20 51.90   
13 1 PRO B 243 ? ? -46.97  150.55  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1 DG C 1  ? ? 0.058 'SIDE CHAIN' 
2  1 DT C 2  ? ? 0.066 'SIDE CHAIN' 
3  1 DA C 3  ? ? 0.069 'SIDE CHAIN' 
4  1 DG C 4  ? ? 0.071 'SIDE CHAIN' 
5  1 DC D 14 ? ? 0.069 'SIDE CHAIN' 
6  1 DA D 19 ? ? 0.062 'SIDE CHAIN' 
7  1 DG E 1  ? ? 0.081 'SIDE CHAIN' 
8  1 DT E 2  ? ? 0.087 'SIDE CHAIN' 
9  1 DA E 3  ? ? 0.080 'SIDE CHAIN' 
10 1 DG E 4  ? ? 0.098 'SIDE CHAIN' 
11 1 DC F 14 ? ? 0.080 'SIDE CHAIN' 
12 1 DA F 19 ? ? 0.073 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A ASP 27  ? CG  ? A ASP 27  CG  
2  1 Y 0 A ASP 27  ? OD1 ? A ASP 27  OD1 
3  1 Y 0 A ASP 27  ? OD2 ? A ASP 27  OD2 
4  1 Y 1 A GLU 289 ? O   ? A GLU 289 O   
5  1 Y 0 B LYS 72  ? CD  ? B LYS 72  CD  
6  1 Y 0 B LYS 72  ? CE  ? B LYS 72  CE  
7  1 Y 0 B LYS 72  ? NZ  ? B LYS 72  NZ  
8  1 Y 0 B LYS 129 ? CD  ? B LYS 129 CD  
9  1 Y 0 B LYS 129 ? CE  ? B LYS 129 CE  
10 1 Y 0 B LYS 129 ? NZ  ? B LYS 129 NZ  
11 1 Y 0 B ASP 249 ? CG  ? B ASP 249 CG  
12 1 Y 0 B ASP 249 ? OD1 ? B ASP 249 OD1 
13 1 Y 0 B ASP 249 ? OD2 ? B ASP 249 OD2 
14 1 Y 1 B GLU 289 ? O   ? B GLU 289 O   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 B MET 1 ? B MET 1 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3A46 'double helix'         
3A46 'b-form double helix'  
3A46 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 1  1_555 D DC 13 1_555 -0.429 -0.069 -0.016 -0.043  1.542  -5.148 1  C_DG1:DC26_D  C 1  ? D 26 ? 19 1 
1 C DT 2  1_555 D DA 12 1_555 0.064  -0.309 -0.810 -0.399  -0.656 0.385  2  C_DT2:DA25_D  C 2  ? D 25 ? 20 1 
1 C DA 3  1_555 D DT 11 1_555 0.330  -0.257 -0.727 -12.114 15.606 0.484  3  C_DA3:DT24_D  C 3  ? D 24 ? 20 1 
1 C DG 4  1_555 D DC 10 1_555 0.033  -0.167 -0.883 -13.155 -0.028 -7.071 4  C_DG4:DC23_D  C 4  ? D 23 ? 19 1 
1 C DA 5  1_555 D DT 9  1_555 -0.135 -0.141 -0.335 -6.903  3.642  -9.037 5  C_DA5:DT22_D  C 5  ? D 22 ? 20 1 
1 C DC 6  1_555 D DG 8  1_555 0.181  -0.230 -0.395 12.101  1.551  -6.195 6  C_DC6:DG21_D  C 6  ? D 21 ? 19 1 
1 C DT 8  1_555 D DA 6  1_555 0.020  -0.206 -0.359 -13.741 10.254 -1.598 7  C_DT8:DA19_D  C 8  ? D 19 ? 20 1 
1 C DG 9  1_555 D DC 5  1_555 0.218  -0.096 0.041  -5.509  -3.549 -1.898 8  C_DG9:DC18_D  C 9  ? D 18 ? 19 1 
1 C DG 10 1_555 D DC 4  1_555 -0.258 -0.183 -0.305 0.044   -7.974 -0.856 9  C_DG10:DC17_D C 10 ? D 17 ? 19 1 
1 C DA 11 1_555 D DT 3  1_555 0.298  -0.151 0.001  4.253   -8.247 -4.789 10 C_DA11:DT16_D C 11 ? D 16 ? 20 1 
1 C DC 12 1_555 D DG 2  1_555 0.625  -0.430 -0.266 -0.494  -2.493 1.698  11 C_DC12:DG15_D C 12 ? D 15 ? 19 1 
1 C DG 13 1_555 D DC 1  1_555 0.687  -0.519 -0.465 -1.503  -6.050 -4.073 12 C_DG13:DC14_D C 13 ? D 14 ? 19 1 
1 E DG 1  1_555 F DC 13 1_555 -0.188 -0.379 -0.486 -10.676 -6.312 -5.535 13 E_DG1:DC26_F  E 1  ? F 26 ? 19 1 
1 E DT 2  1_555 F DA 12 1_555 -0.088 -0.229 -0.528 -0.628  3.430  2.703  14 E_DT2:DA25_F  E 2  ? F 25 ? 20 1 
1 E DA 3  1_555 F DT 11 1_555 0.124  -0.393 -0.467 -12.159 7.797  -5.981 15 E_DA3:DT24_F  E 3  ? F 24 ? 20 1 
1 E DG 4  1_555 F DC 10 1_555 -0.132 -0.236 -0.851 -14.858 -0.751 -5.443 16 E_DG4:DC23_F  E 4  ? F 23 ? 19 1 
1 E DA 5  1_555 F DT 9  1_555 0.315  -0.276 -0.306 -10.480 -1.252 -3.906 17 E_DA5:DT22_F  E 5  ? F 22 ? 20 1 
1 E DC 6  1_555 F DG 8  1_555 0.033  -0.208 -0.368 10.024  -0.061 -6.070 18 E_DC6:DG21_F  E 6  ? F 21 ? 19 1 
1 E DT 8  1_555 F DA 6  1_555 -0.062 -0.011 -0.276 -13.403 10.528 -0.839 19 E_DT8:DA19_F  E 8  ? F 19 ? 20 1 
1 E DG 9  1_555 F DC 5  1_555 0.143  -0.279 -0.125 1.641   -0.646 -1.309 20 E_DG9:DC18_F  E 9  ? F 18 ? 19 1 
1 E DG 10 1_555 F DC 4  1_555 -0.045 -0.118 -0.239 -3.367  -6.400 0.505  21 E_DG10:DC17_F E 10 ? F 17 ? 19 1 
1 E DA 11 1_555 F DT 3  1_555 0.346  -0.150 -0.066 5.144   -8.508 -0.411 22 E_DA11:DT16_F E 11 ? F 16 ? 20 1 
1 E DC 12 1_555 F DG 2  1_555 1.068  -0.456 -0.152 6.604   -6.050 3.571  23 E_DC12:DG15_F E 12 ? F 15 ? 19 1 
1 E DG 13 1_555 F DC 1  1_555 0.272  -0.163 -0.779 -12.180 -6.387 -4.007 24 E_DG13:DC14_F E 13 ? F 14 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 1  1_555 D DC 13 1_555 C DT 2  1_555 D DA 12 1_555 0.973  -0.526 3.321 6.828  9.753  38.984 -1.862 -0.625 3.223 14.216 
-9.953 40.693 1  CC_DG1DT2:DA25DC26_DD   C 1  ? D 26 ? C 2  ? D 25 ? 
1 C DT 2  1_555 D DA 12 1_555 C DA 3  1_555 D DT 11 1_555 -0.127 -0.862 3.713 -3.999 12.221 32.396 -3.482 -0.454 3.184 20.906 
6.841  34.791 2  CC_DT2DA3:DT24DA25_DD   C 2  ? D 25 ? C 3  ? D 24 ? 
1 C DA 3  1_555 D DT 11 1_555 C DG 4  1_555 D DC 10 1_555 -0.248 -1.185 3.842 3.417  -1.030 29.852 -2.037 1.303  3.828 -1.991 
-6.604 30.059 3  CC_DA3DG4:DC23DT24_DD   C 3  ? D 24 ? C 4  ? D 23 ? 
1 C DG 4  1_555 D DC 10 1_555 C DA 5  1_555 D DT 9  1_555 0.068  -0.945 3.420 -0.883 -1.330 30.955 -1.499 -0.307 3.453 -2.490 
1.654  30.995 4  CC_DG4DA5:DT22DC23_DD   C 4  ? D 23 ? C 5  ? D 22 ? 
1 C DA 5  1_555 D DT 9  1_555 C DC 6  1_555 D DG 8  1_555 -0.551 -0.789 2.940 0.802  5.110  26.684 -2.803 1.350  2.726 10.940 
-1.718 27.172 5  CC_DA5DC6:DG21DT22_DD   C 5  ? D 22 ? C 6  ? D 21 ? 
1 C DT 8  1_555 D DA 6  1_555 C DG 9  1_555 D DC 5  1_555 0.453  -0.810 3.150 -2.053 2.979  25.647 -2.587 -1.547 2.994 6.669  
4.595  25.897 6  CC_DT8DG9:DC18DA19_DD   C 8  ? D 19 ? C 9  ? D 18 ? 
1 C DG 9  1_555 D DC 5  1_555 C DG 10 1_555 D DC 4  1_555 -0.575 -0.396 3.226 2.859  2.496  35.219 -1.009 1.355  3.137 4.111  
-4.709 35.416 7  CC_DG9DG10:DC17DC18_DD  C 9  ? D 18 ? C 10 ? D 17 ? 
1 C DG 10 1_555 D DC 4  1_555 C DA 11 1_555 D DT 3  1_555 -0.120 -0.325 3.125 -3.796 5.694  35.714 -1.276 -0.311 3.035 9.181  
6.120  36.343 8  CC_DG10DA11:DT16DC17_DD C 10 ? D 17 ? C 11 ? D 16 ? 
1 C DA 11 1_555 D DT 3  1_555 C DC 12 1_555 D DG 2  1_555 0.639  -0.621 3.466 1.797  2.640  33.449 -1.532 -0.795 3.437 4.574  
-3.113 33.597 9  CC_DA11DC12:DG15DT16_DD C 11 ? D 16 ? C 12 ? D 15 ? 
1 C DC 12 1_555 D DG 2  1_555 C DG 13 1_555 D DC 1  1_555 -0.639 -0.565 3.280 0.632  19.799 36.078 -2.896 0.980  2.627 29.402 
-0.939 41.000 10 CC_DC12DG13:DC14DG15_DD C 12 ? D 15 ? C 13 ? D 14 ? 
1 E DG 1  1_555 F DC 13 1_555 E DT 2  1_555 F DA 12 1_555 0.786  -0.768 3.028 2.193  7.810  33.572 -2.394 -1.017 2.827 13.282 
-3.730 34.511 11 EE_DG1DT2:DA25DC26_FF   E 1  ? F 26 ? E 2  ? F 25 ? 
1 E DT 2  1_555 F DA 12 1_555 E DA 3  1_555 F DT 11 1_555 -0.107 -1.125 3.725 -0.748 11.011 32.856 -3.736 0.054  3.196 18.816 
1.278  34.611 12 EE_DT2DA3:DT24DA25_FF   E 2  ? F 25 ? E 3  ? F 24 ? 
1 E DA 3  1_555 F DT 11 1_555 E DG 4  1_555 F DC 10 1_555 0.239  -1.157 3.707 3.851  0.576  30.957 -2.275 0.387  3.688 1.074  
-7.179 31.195 13 EE_DA3DG4:DC23DT24_FF   E 3  ? F 24 ? E 4  ? F 23 ? 
1 E DG 4  1_555 F DC 10 1_555 E DA 5  1_555 F DT 9  1_555 0.262  -1.105 3.556 -0.291 -5.160 35.838 -0.973 -0.467 3.672 -8.331 
0.470  36.197 14 EE_DG4DA5:DT22DC23_FF   E 4  ? F 23 ? E 5  ? F 22 ? 
1 E DA 5  1_555 F DT 9  1_555 E DC 6  1_555 F DG 8  1_555 -0.635 -0.597 2.942 2.116  7.053  22.265 -3.535 2.182  2.563 17.654 
-5.298 23.436 15 EE_DA5DC6:DG21DT22_FF   E 5  ? F 22 ? E 6  ? F 21 ? 
1 E DT 8  1_555 F DA 6  1_555 E DG 9  1_555 F DC 5  1_555 0.226  -0.797 3.054 -0.293 3.758  24.818 -2.849 -0.599 2.901 8.679  
0.678  25.098 16 EE_DT8DG9:DC18DA19_FF   E 8  ? F 19 ? E 9  ? F 18 ? 
1 E DG 9  1_555 F DC 5  1_555 E DG 10 1_555 F DC 4  1_555 -0.379 -0.316 3.471 1.234  2.097  37.520 -0.779 0.758  3.436 3.256  
-1.916 37.596 17 EE_DG9DG10:DC17DC18_FF  E 9  ? F 18 ? E 10 ? F 17 ? 
1 E DG 10 1_555 F DC 4  1_555 E DA 11 1_555 F DT 3  1_555 0.047  -0.193 3.027 -1.690 4.649  34.637 -0.968 -0.313 2.971 7.760  
2.821  34.977 18 EE_DG10DA11:DT16DC17_FF E 10 ? F 17 ? E 11 ? F 16 ? 
1 E DA 11 1_555 F DT 3  1_555 E DC 12 1_555 F DG 2  1_555 0.637  -0.410 3.265 0.787  4.126  35.319 -1.268 -0.929 3.211 6.771  
-1.292 35.560 19 EE_DA11DC12:DG15DT16_FF E 11 ? F 16 ? E 12 ? F 15 ? 
1 E DC 12 1_555 F DG 2  1_555 E DG 13 1_555 F DC 1  1_555 -0.731 -0.948 3.605 3.108  22.678 32.570 -4.097 1.448  2.399 35.496 
-4.864 39.630 20 EE_DC12DG13:DC14DG15_FF E 12 ? F 15 ? E 13 ? F 14 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 GLYCEROL GOL 
5 water    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 GOL 1   3545 3545 GOL GOL A . 
H 5 HOH 1   2001 2001 HOH HOH A . 
H 5 HOH 2   2002 2002 HOH HOH A . 
H 5 HOH 3   2003 2003 HOH HOH A . 
H 5 HOH 4   2004 2004 HOH HOH A . 
H 5 HOH 5   2006 2006 HOH HOH A . 
H 5 HOH 6   2009 2009 HOH HOH A . 
H 5 HOH 7   2010 2010 HOH HOH A . 
H 5 HOH 8   2014 2014 HOH HOH A . 
H 5 HOH 9   2016 2016 HOH HOH A . 
H 5 HOH 10  2017 2017 HOH HOH A . 
H 5 HOH 11  2018 2018 HOH HOH A . 
H 5 HOH 12  2019 2019 HOH HOH A . 
H 5 HOH 13  2021 2021 HOH HOH A . 
H 5 HOH 14  2022 2022 HOH HOH A . 
H 5 HOH 15  2024 2024 HOH HOH A . 
H 5 HOH 16  2025 2025 HOH HOH A . 
H 5 HOH 17  2026 2026 HOH HOH A . 
H 5 HOH 18  2028 2028 HOH HOH A . 
H 5 HOH 19  2030 2030 HOH HOH A . 
H 5 HOH 20  2034 2034 HOH HOH A . 
H 5 HOH 21  2036 2036 HOH HOH A . 
H 5 HOH 22  2037 2037 HOH HOH A . 
H 5 HOH 23  2040 2040 HOH HOH A . 
H 5 HOH 24  2042 2042 HOH HOH A . 
H 5 HOH 25  2043 2043 HOH HOH A . 
H 5 HOH 26  2046 2046 HOH HOH A . 
H 5 HOH 27  2047 2047 HOH HOH A . 
H 5 HOH 28  2049 2049 HOH HOH A . 
H 5 HOH 29  2051 2051 HOH HOH A . 
H 5 HOH 30  2052 2052 HOH HOH A . 
H 5 HOH 31  2053 2053 HOH HOH A . 
H 5 HOH 32  2054 2054 HOH HOH A . 
H 5 HOH 33  2055 2055 HOH HOH A . 
H 5 HOH 34  2057 2057 HOH HOH A . 
H 5 HOH 35  2059 2059 HOH HOH A . 
H 5 HOH 36  2062 2062 HOH HOH A . 
H 5 HOH 37  2064 2064 HOH HOH A . 
H 5 HOH 38  2066 2066 HOH HOH A . 
H 5 HOH 39  2069 2069 HOH HOH A . 
H 5 HOH 40  2072 2072 HOH HOH A . 
H 5 HOH 41  2077 2077 HOH HOH A . 
H 5 HOH 42  2078 2078 HOH HOH A . 
H 5 HOH 43  2080 2080 HOH HOH A . 
H 5 HOH 44  2086 2086 HOH HOH A . 
H 5 HOH 45  2091 2091 HOH HOH A . 
H 5 HOH 46  2092 2092 HOH HOH A . 
H 5 HOH 47  2093 2093 HOH HOH A . 
H 5 HOH 48  2094 2094 HOH HOH A . 
H 5 HOH 49  2096 2096 HOH HOH A . 
H 5 HOH 50  2099 2099 HOH HOH A . 
H 5 HOH 51  2100 2100 HOH HOH A . 
H 5 HOH 52  2102 2102 HOH HOH A . 
H 5 HOH 53  2103 2103 HOH HOH A . 
H 5 HOH 54  2106 2106 HOH HOH A . 
H 5 HOH 55  2108 2108 HOH HOH A . 
H 5 HOH 56  2112 2112 HOH HOH A . 
H 5 HOH 57  2113 2113 HOH HOH A . 
H 5 HOH 58  2114 2114 HOH HOH A . 
H 5 HOH 59  2115 2115 HOH HOH A . 
H 5 HOH 60  2119 2119 HOH HOH A . 
H 5 HOH 61  2120 2120 HOH HOH A . 
H 5 HOH 62  2122 2122 HOH HOH A . 
H 5 HOH 63  2128 2128 HOH HOH A . 
H 5 HOH 64  2135 2135 HOH HOH A . 
H 5 HOH 65  2140 2140 HOH HOH A . 
H 5 HOH 66  2142 2142 HOH HOH A . 
H 5 HOH 67  2146 2146 HOH HOH A . 
H 5 HOH 68  2147 2147 HOH HOH A . 
H 5 HOH 69  2148 2148 HOH HOH A . 
H 5 HOH 70  2154 2154 HOH HOH A . 
H 5 HOH 71  2159 2159 HOH HOH A . 
H 5 HOH 72  2161 2161 HOH HOH A . 
H 5 HOH 73  2163 2163 HOH HOH A . 
H 5 HOH 74  2169 2169 HOH HOH A . 
H 5 HOH 75  2173 2173 HOH HOH A . 
H 5 HOH 76  2174 2174 HOH HOH A . 
H 5 HOH 77  2176 2176 HOH HOH A . 
H 5 HOH 78  2179 2179 HOH HOH A . 
H 5 HOH 79  2181 2181 HOH HOH A . 
H 5 HOH 80  2182 2182 HOH HOH A . 
H 5 HOH 81  2184 2184 HOH HOH A . 
H 5 HOH 82  2189 2189 HOH HOH A . 
H 5 HOH 83  2195 2195 HOH HOH A . 
H 5 HOH 84  2197 2197 HOH HOH A . 
H 5 HOH 85  2198 2198 HOH HOH A . 
H 5 HOH 86  2200 2200 HOH HOH A . 
H 5 HOH 87  2201 2201 HOH HOH A . 
H 5 HOH 88  2202 2202 HOH HOH A . 
H 5 HOH 89  2204 2204 HOH HOH A . 
H 5 HOH 90  2208 2208 HOH HOH A . 
H 5 HOH 91  2210 2210 HOH HOH A . 
H 5 HOH 92  2211 2211 HOH HOH A . 
H 5 HOH 93  2213 2213 HOH HOH A . 
H 5 HOH 94  2217 2217 HOH HOH A . 
H 5 HOH 95  2218 2218 HOH HOH A . 
H 5 HOH 96  2220 2220 HOH HOH A . 
H 5 HOH 97  2221 2221 HOH HOH A . 
H 5 HOH 98  2225 2225 HOH HOH A . 
H 5 HOH 99  2227 2227 HOH HOH A . 
H 5 HOH 100 2234 2234 HOH HOH A . 
H 5 HOH 101 2238 2238 HOH HOH A . 
H 5 HOH 102 2243 2243 HOH HOH A . 
H 5 HOH 103 2245 2245 HOH HOH A . 
H 5 HOH 104 2248 2248 HOH HOH A . 
H 5 HOH 105 2252 2252 HOH HOH A . 
H 5 HOH 106 2253 2253 HOH HOH A . 
H 5 HOH 107 2254 2254 HOH HOH A . 
H 5 HOH 108 2258 2258 HOH HOH A . 
H 5 HOH 109 2260 2260 HOH HOH A . 
H 5 HOH 110 2266 2266 HOH HOH A . 
H 5 HOH 111 2267 2267 HOH HOH A . 
H 5 HOH 112 2268 2268 HOH HOH A . 
H 5 HOH 113 2270 2270 HOH HOH A . 
H 5 HOH 114 2271 2271 HOH HOH A . 
H 5 HOH 115 2273 2273 HOH HOH A . 
H 5 HOH 116 2275 2275 HOH HOH A . 
H 5 HOH 117 2278 2278 HOH HOH A . 
H 5 HOH 118 2279 2279 HOH HOH A . 
H 5 HOH 119 2281 2281 HOH HOH A . 
H 5 HOH 120 2289 2289 HOH HOH A . 
H 5 HOH 121 2293 2293 HOH HOH A . 
H 5 HOH 122 2294 2294 HOH HOH A . 
H 5 HOH 123 2295 2295 HOH HOH A . 
H 5 HOH 124 2296 2296 HOH HOH A . 
H 5 HOH 125 2297 2297 HOH HOH A . 
H 5 HOH 126 2301 2301 HOH HOH A . 
H 5 HOH 127 2302 2302 HOH HOH A . 
H 5 HOH 128 2303 2303 HOH HOH A . 
H 5 HOH 129 2304 2304 HOH HOH A . 
H 5 HOH 130 2306 2306 HOH HOH A . 
H 5 HOH 131 2307 2307 HOH HOH A . 
H 5 HOH 132 2309 2309 HOH HOH A . 
H 5 HOH 133 2311 2311 HOH HOH A . 
H 5 HOH 134 2312 2312 HOH HOH A . 
H 5 HOH 135 2314 2314 HOH HOH A . 
H 5 HOH 136 2315 2315 HOH HOH A . 
H 5 HOH 137 2317 2317 HOH HOH A . 
H 5 HOH 138 2319 2319 HOH HOH A . 
H 5 HOH 139 2320 2320 HOH HOH A . 
H 5 HOH 140 2323 2323 HOH HOH A . 
H 5 HOH 141 2327 2327 HOH HOH A . 
H 5 HOH 142 2331 2331 HOH HOH A . 
H 5 HOH 143 2332 2332 HOH HOH A . 
H 5 HOH 144 2334 2334 HOH HOH A . 
H 5 HOH 145 2335 2335 HOH HOH A . 
H 5 HOH 146 2338 2338 HOH HOH A . 
H 5 HOH 147 2339 2339 HOH HOH A . 
H 5 HOH 148 2342 2342 HOH HOH A . 
H 5 HOH 149 2343 2343 HOH HOH A . 
H 5 HOH 150 2345 2345 HOH HOH A . 
H 5 HOH 151 2347 2347 HOH HOH A . 
H 5 HOH 152 2348 2348 HOH HOH A . 
H 5 HOH 153 2350 2350 HOH HOH A . 
H 5 HOH 154 2352 2352 HOH HOH A . 
H 5 HOH 155 2353 2353 HOH HOH A . 
H 5 HOH 156 2355 2355 HOH HOH A . 
H 5 HOH 157 2360 2360 HOH HOH A . 
H 5 HOH 158 2362 2362 HOH HOH A . 
H 5 HOH 159 2364 2364 HOH HOH A . 
H 5 HOH 160 2368 2368 HOH HOH A . 
H 5 HOH 161 2370 2370 HOH HOH A . 
H 5 HOH 162 2371 2371 HOH HOH A . 
H 5 HOH 163 2375 2375 HOH HOH A . 
H 5 HOH 164 2377 2377 HOH HOH A . 
H 5 HOH 165 2380 2380 HOH HOH A . 
H 5 HOH 166 2381 2381 HOH HOH A . 
H 5 HOH 167 2383 2383 HOH HOH A . 
H 5 HOH 168 2386 2386 HOH HOH A . 
H 5 HOH 169 2388 2388 HOH HOH A . 
H 5 HOH 170 2396 2396 HOH HOH A . 
H 5 HOH 171 2401 2401 HOH HOH A . 
H 5 HOH 172 2402 2402 HOH HOH A . 
H 5 HOH 173 2403 2403 HOH HOH A . 
H 5 HOH 174 2404 2404 HOH HOH A . 
H 5 HOH 175 2409 2409 HOH HOH A . 
H 5 HOH 176 2412 2412 HOH HOH A . 
H 5 HOH 177 2414 2414 HOH HOH A . 
H 5 HOH 178 2415 2415 HOH HOH A . 
H 5 HOH 179 2416 2416 HOH HOH A . 
I 5 HOH 1   2005 2005 HOH HOH B . 
I 5 HOH 2   2007 2007 HOH HOH B . 
I 5 HOH 3   2008 2008 HOH HOH B . 
I 5 HOH 4   2011 2011 HOH HOH B . 
I 5 HOH 5   2012 2012 HOH HOH B . 
I 5 HOH 6   2015 2015 HOH HOH B . 
I 5 HOH 7   2020 2020 HOH HOH B . 
I 5 HOH 8   2023 2023 HOH HOH B . 
I 5 HOH 9   2027 2027 HOH HOH B . 
I 5 HOH 10  2029 2029 HOH HOH B . 
I 5 HOH 11  2031 2031 HOH HOH B . 
I 5 HOH 12  2032 2032 HOH HOH B . 
I 5 HOH 13  2033 2033 HOH HOH B . 
I 5 HOH 14  2035 2035 HOH HOH B . 
I 5 HOH 15  2038 2038 HOH HOH B . 
I 5 HOH 16  2039 2039 HOH HOH B . 
I 5 HOH 17  2041 2041 HOH HOH B . 
I 5 HOH 18  2048 2048 HOH HOH B . 
I 5 HOH 19  2050 2050 HOH HOH B . 
I 5 HOH 20  2056 2056 HOH HOH B . 
I 5 HOH 21  2058 2058 HOH HOH B . 
I 5 HOH 22  2060 2060 HOH HOH B . 
I 5 HOH 23  2061 2061 HOH HOH B . 
I 5 HOH 24  2063 2063 HOH HOH B . 
I 5 HOH 25  2065 2065 HOH HOH B . 
I 5 HOH 26  2067 2067 HOH HOH B . 
I 5 HOH 27  2068 2068 HOH HOH B . 
I 5 HOH 28  2071 2071 HOH HOH B . 
I 5 HOH 29  2073 2073 HOH HOH B . 
I 5 HOH 30  2075 2075 HOH HOH B . 
I 5 HOH 31  2076 2076 HOH HOH B . 
I 5 HOH 32  2081 2081 HOH HOH B . 
I 5 HOH 33  2082 2082 HOH HOH B . 
I 5 HOH 34  2083 2083 HOH HOH B . 
I 5 HOH 35  2084 2084 HOH HOH B . 
I 5 HOH 36  2090 2090 HOH HOH B . 
I 5 HOH 37  2095 2095 HOH HOH B . 
I 5 HOH 38  2097 2097 HOH HOH B . 
I 5 HOH 39  2101 2101 HOH HOH B . 
I 5 HOH 40  2104 2104 HOH HOH B . 
I 5 HOH 41  2105 2105 HOH HOH B . 
I 5 HOH 42  2107 2107 HOH HOH B . 
I 5 HOH 43  2110 2110 HOH HOH B . 
I 5 HOH 44  2116 2116 HOH HOH B . 
I 5 HOH 45  2117 2117 HOH HOH B . 
I 5 HOH 46  2118 2118 HOH HOH B . 
I 5 HOH 47  2123 2123 HOH HOH B . 
I 5 HOH 48  2124 2124 HOH HOH B . 
I 5 HOH 49  2126 2126 HOH HOH B . 
I 5 HOH 50  2127 2127 HOH HOH B . 
I 5 HOH 51  2129 2129 HOH HOH B . 
I 5 HOH 52  2131 2131 HOH HOH B . 
I 5 HOH 53  2133 2133 HOH HOH B . 
I 5 HOH 54  2134 2134 HOH HOH B . 
I 5 HOH 55  2136 2136 HOH HOH B . 
I 5 HOH 56  2137 2137 HOH HOH B . 
I 5 HOH 57  2139 2139 HOH HOH B . 
I 5 HOH 58  2141 2141 HOH HOH B . 
I 5 HOH 59  2143 2143 HOH HOH B . 
I 5 HOH 60  2144 2144 HOH HOH B . 
I 5 HOH 61  2145 2145 HOH HOH B . 
I 5 HOH 62  2149 2149 HOH HOH B . 
I 5 HOH 63  2150 2150 HOH HOH B . 
I 5 HOH 64  2152 2152 HOH HOH B . 
I 5 HOH 65  2155 2155 HOH HOH B . 
I 5 HOH 66  2156 2156 HOH HOH B . 
I 5 HOH 67  2157 2157 HOH HOH B . 
I 5 HOH 68  2158 2158 HOH HOH B . 
I 5 HOH 69  2160 2160 HOH HOH B . 
I 5 HOH 70  2165 2165 HOH HOH B . 
I 5 HOH 71  2166 2166 HOH HOH B . 
I 5 HOH 72  2167 2167 HOH HOH B . 
I 5 HOH 73  2170 2170 HOH HOH B . 
I 5 HOH 74  2177 2177 HOH HOH B . 
I 5 HOH 75  2178 2178 HOH HOH B . 
I 5 HOH 76  2180 2180 HOH HOH B . 
I 5 HOH 77  2183 2183 HOH HOH B . 
I 5 HOH 78  2186 2186 HOH HOH B . 
I 5 HOH 79  2187 2187 HOH HOH B . 
I 5 HOH 80  2190 2190 HOH HOH B . 
I 5 HOH 81  2191 2191 HOH HOH B . 
I 5 HOH 82  2194 2194 HOH HOH B . 
I 5 HOH 83  2196 2196 HOH HOH B . 
I 5 HOH 84  2199 2199 HOH HOH B . 
I 5 HOH 85  2203 2203 HOH HOH B . 
I 5 HOH 86  2206 2206 HOH HOH B . 
I 5 HOH 87  2207 2207 HOH HOH B . 
I 5 HOH 88  2209 2209 HOH HOH B . 
I 5 HOH 89  2212 2212 HOH HOH B . 
I 5 HOH 90  2214 2214 HOH HOH B . 
I 5 HOH 91  2215 2215 HOH HOH B . 
I 5 HOH 92  2216 2216 HOH HOH B . 
I 5 HOH 93  2219 2219 HOH HOH B . 
I 5 HOH 94  2222 2222 HOH HOH B . 
I 5 HOH 95  2223 2223 HOH HOH B . 
I 5 HOH 96  2224 2224 HOH HOH B . 
I 5 HOH 97  2226 2226 HOH HOH B . 
I 5 HOH 98  2228 2228 HOH HOH B . 
I 5 HOH 99  2229 2229 HOH HOH B . 
I 5 HOH 100 2230 2230 HOH HOH B . 
I 5 HOH 101 2231 2231 HOH HOH B . 
I 5 HOH 102 2232 2232 HOH HOH B . 
I 5 HOH 103 2233 2233 HOH HOH B . 
I 5 HOH 104 2237 2237 HOH HOH B . 
I 5 HOH 105 2240 2240 HOH HOH B . 
I 5 HOH 106 2241 2241 HOH HOH B . 
I 5 HOH 107 2244 2244 HOH HOH B . 
I 5 HOH 108 2246 2246 HOH HOH B . 
I 5 HOH 109 2247 2247 HOH HOH B . 
I 5 HOH 110 2250 2250 HOH HOH B . 
I 5 HOH 111 2255 2255 HOH HOH B . 
I 5 HOH 112 2256 2256 HOH HOH B . 
I 5 HOH 113 2257 2257 HOH HOH B . 
I 5 HOH 114 2259 2259 HOH HOH B . 
I 5 HOH 115 2261 2261 HOH HOH B . 
I 5 HOH 116 2262 2262 HOH HOH B . 
I 5 HOH 117 2265 2265 HOH HOH B . 
I 5 HOH 118 2269 2269 HOH HOH B . 
I 5 HOH 119 2274 2274 HOH HOH B . 
I 5 HOH 120 2276 2276 HOH HOH B . 
I 5 HOH 121 2277 2277 HOH HOH B . 
I 5 HOH 122 2282 2282 HOH HOH B . 
I 5 HOH 123 2283 2283 HOH HOH B . 
I 5 HOH 124 2284 2284 HOH HOH B . 
I 5 HOH 125 2288 2288 HOH HOH B . 
I 5 HOH 126 2290 2290 HOH HOH B . 
I 5 HOH 127 2291 2291 HOH HOH B . 
I 5 HOH 128 2298 2298 HOH HOH B . 
I 5 HOH 129 2299 2299 HOH HOH B . 
I 5 HOH 130 2300 2300 HOH HOH B . 
I 5 HOH 131 2305 2305 HOH HOH B . 
I 5 HOH 132 2308 2308 HOH HOH B . 
I 5 HOH 133 2310 2310 HOH HOH B . 
I 5 HOH 134 2318 2318 HOH HOH B . 
I 5 HOH 135 2321 2321 HOH HOH B . 
I 5 HOH 136 2322 2322 HOH HOH B . 
I 5 HOH 137 2326 2326 HOH HOH B . 
I 5 HOH 138 2328 2328 HOH HOH B . 
I 5 HOH 139 2329 2329 HOH HOH B . 
I 5 HOH 140 2336 2336 HOH HOH B . 
I 5 HOH 141 2337 2337 HOH HOH B . 
I 5 HOH 142 2341 2341 HOH HOH B . 
I 5 HOH 143 2344 2344 HOH HOH B . 
I 5 HOH 144 2346 2346 HOH HOH B . 
I 5 HOH 145 2349 2349 HOH HOH B . 
I 5 HOH 146 2351 2351 HOH HOH B . 
I 5 HOH 147 2354 2354 HOH HOH B . 
I 5 HOH 148 2356 2356 HOH HOH B . 
I 5 HOH 149 2357 2357 HOH HOH B . 
I 5 HOH 150 2361 2361 HOH HOH B . 
I 5 HOH 151 2363 2363 HOH HOH B . 
I 5 HOH 152 2365 2365 HOH HOH B . 
I 5 HOH 153 2367 2367 HOH HOH B . 
I 5 HOH 154 2369 2369 HOH HOH B . 
I 5 HOH 155 2373 2373 HOH HOH B . 
I 5 HOH 156 2374 2374 HOH HOH B . 
I 5 HOH 157 2376 2376 HOH HOH B . 
I 5 HOH 158 2378 2378 HOH HOH B . 
I 5 HOH 159 2384 2384 HOH HOH B . 
I 5 HOH 160 2385 2385 HOH HOH B . 
I 5 HOH 161 2387 2387 HOH HOH B . 
I 5 HOH 162 2389 2389 HOH HOH B . 
I 5 HOH 163 2392 2392 HOH HOH B . 
I 5 HOH 164 2393 2393 HOH HOH B . 
I 5 HOH 165 2394 2394 HOH HOH B . 
I 5 HOH 166 2395 2395 HOH HOH B . 
I 5 HOH 167 2397 2397 HOH HOH B . 
I 5 HOH 168 2398 2398 HOH HOH B . 
I 5 HOH 169 2399 2399 HOH HOH B . 
I 5 HOH 170 2400 2400 HOH HOH B . 
I 5 HOH 171 2405 2405 HOH HOH B . 
I 5 HOH 172 2407 2407 HOH HOH B . 
I 5 HOH 173 2408 2408 HOH HOH B . 
I 5 HOH 174 2413 2413 HOH HOH B . 
J 5 HOH 1   2089 2089 HOH HOH C . 
J 5 HOH 2   2098 2098 HOH HOH C . 
J 5 HOH 3   2162 2162 HOH HOH C . 
J 5 HOH 4   2168 2168 HOH HOH C . 
J 5 HOH 5   2171 2171 HOH HOH C . 
J 5 HOH 6   2188 2188 HOH HOH C . 
J 5 HOH 7   2242 2242 HOH HOH C . 
J 5 HOH 8   2264 2264 HOH HOH C . 
J 5 HOH 9   2280 2280 HOH HOH C . 
J 5 HOH 10  2286 2286 HOH HOH C . 
J 5 HOH 11  2313 2313 HOH HOH C . 
J 5 HOH 12  2316 2316 HOH HOH C . 
J 5 HOH 13  2325 2325 HOH HOH C . 
J 5 HOH 14  2333 2333 HOH HOH C . 
J 5 HOH 15  2340 2340 HOH HOH C . 
J 5 HOH 16  2358 2358 HOH HOH C . 
J 5 HOH 17  2359 2359 HOH HOH C . 
J 5 HOH 18  2390 2390 HOH HOH C . 
J 5 HOH 19  2411 2411 HOH HOH C . 
J 5 HOH 20  2417 2417 HOH HOH C . 
K 5 HOH 1   2013 2013 HOH HOH D . 
K 5 HOH 2   2070 2070 HOH HOH D . 
K 5 HOH 3   2085 2085 HOH HOH D . 
K 5 HOH 4   2121 2121 HOH HOH D . 
K 5 HOH 5   2138 2138 HOH HOH D . 
K 5 HOH 6   2175 2175 HOH HOH D . 
K 5 HOH 7   2263 2263 HOH HOH D . 
K 5 HOH 8   2285 2285 HOH HOH D . 
K 5 HOH 9   2292 2292 HOH HOH D . 
K 5 HOH 10  2372 2372 HOH HOH D . 
L 5 HOH 1   2044 2044 HOH HOH E . 
L 5 HOH 2   2079 2079 HOH HOH E . 
L 5 HOH 3   2087 2087 HOH HOH E . 
L 5 HOH 4   2088 2088 HOH HOH E . 
L 5 HOH 5   2111 2111 HOH HOH E . 
L 5 HOH 6   2125 2125 HOH HOH E . 
L 5 HOH 7   2132 2132 HOH HOH E . 
L 5 HOH 8   2151 2151 HOH HOH E . 
L 5 HOH 9   2172 2172 HOH HOH E . 
L 5 HOH 10  2192 2192 HOH HOH E . 
L 5 HOH 11  2193 2193 HOH HOH E . 
L 5 HOH 12  2251 2251 HOH HOH E . 
L 5 HOH 13  2272 2272 HOH HOH E . 
L 5 HOH 14  2324 2324 HOH HOH E . 
L 5 HOH 15  2330 2330 HOH HOH E . 
L 5 HOH 16  2379 2379 HOH HOH E . 
L 5 HOH 17  2391 2391 HOH HOH E . 
M 5 HOH 1   2045 2045 HOH HOH F . 
M 5 HOH 2   2074 2074 HOH HOH F . 
M 5 HOH 3   2109 2109 HOH HOH F . 
M 5 HOH 4   2130 2130 HOH HOH F . 
M 5 HOH 5   2153 2153 HOH HOH F . 
M 5 HOH 6   2164 2164 HOH HOH F . 
M 5 HOH 7   2185 2185 HOH HOH F . 
M 5 HOH 8   2205 2205 HOH HOH F . 
M 5 HOH 9   2235 2235 HOH HOH F . 
M 5 HOH 10  2236 2236 HOH HOH F . 
M 5 HOH 11  2239 2239 HOH HOH F . 
M 5 HOH 12  2249 2249 HOH HOH F . 
M 5 HOH 13  2287 2287 HOH HOH F . 
M 5 HOH 14  2366 2366 HOH HOH F . 
M 5 HOH 15  2382 2382 HOH HOH F . 
M 5 HOH 16  2406 2406 HOH HOH F . 
M 5 HOH 17  2410 2410 HOH HOH F . 
#