data_3A7H
# 
_entry.id   3A7H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3A7H         
RCSB  RCSB028907   
WWPDB D_1000028907 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3A7F 'unliganded protein in C2 unit cell'                unspecified 
PDB 3A7G 'unliganded protein in a larger P21 unit cell'      unspecified 
PDB 3A7I 'adenine complex in the same smaller P21 unit cell' unspecified 
PDB 3A7J 'P21 unit cell'                                     unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3A7H 
_pdbx_database_status.recvd_initial_deposition_date   2009-09-26 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ko, T.P.'     1 
'Jeng, W.Y.'   2 
'Liu, C.I.'    3 
'Lai, M.D.'    4 
'Wang, A.H.J.' 5 
# 
_citation.id                        primary 
_citation.title                     'Structures of human MST3 kinase in complex with adenine, ADP and Mn2+.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            66 
_citation.page_first                145 
_citation.page_last                 154 
_citation.year                      2010 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20124694 
_citation.pdbx_database_id_DOI      10.1107/S0907444909047507 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ko, T.P.'     1 
primary 'Jeng, W.Y.'   2 
primary 'Liu, C.I.'    3 
primary 'Lai, M.D.'    4 
primary 'Wu, C.L.'     5 
primary 'Chang, W.J.'  6 
primary 'Shr, H.L.'    7 
primary 'Lu, T.J.'     8 
primary 'Wang, A.H.J.' 9 
# 
_cell.entry_id           3A7H 
_cell.length_a           55.678 
_cell.length_b           95.194 
_cell.length_c           61.482 
_cell.angle_alpha        90.00 
_cell.angle_beta         93.45 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3A7H 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine kinase 24 (STE20 homolog, yeast)' 34336.191 2   ? ? 
'N-terminal kinase domain (UNP RESIDUES 1-303)' ? 
2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                         507.181   2   ? ? ? ? 
3 water       nat water                                               18.015    476 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MST3 kinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MAHSPVQSGLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSP
YVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKL
ADFGVAGQLTDTQIKRN(TPO)FVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNP
PTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAHSPVQSGLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSP
YVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKL
ADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLE
GNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   HIS n 
1 4   SER n 
1 5   PRO n 
1 6   VAL n 
1 7   GLN n 
1 8   SER n 
1 9   GLY n 
1 10  LEU n 
1 11  PRO n 
1 12  GLY n 
1 13  MET n 
1 14  GLN n 
1 15  ASN n 
1 16  LEU n 
1 17  LYS n 
1 18  ALA n 
1 19  ASP n 
1 20  PRO n 
1 21  GLU n 
1 22  GLU n 
1 23  LEU n 
1 24  PHE n 
1 25  THR n 
1 26  LYS n 
1 27  LEU n 
1 28  GLU n 
1 29  LYS n 
1 30  ILE n 
1 31  GLY n 
1 32  LYS n 
1 33  GLY n 
1 34  SER n 
1 35  PHE n 
1 36  GLY n 
1 37  GLU n 
1 38  VAL n 
1 39  PHE n 
1 40  LYS n 
1 41  GLY n 
1 42  ILE n 
1 43  ASP n 
1 44  ASN n 
1 45  ARG n 
1 46  THR n 
1 47  GLN n 
1 48  LYS n 
1 49  VAL n 
1 50  VAL n 
1 51  ALA n 
1 52  ILE n 
1 53  LYS n 
1 54  ILE n 
1 55  ILE n 
1 56  ASP n 
1 57  LEU n 
1 58  GLU n 
1 59  GLU n 
1 60  ALA n 
1 61  GLU n 
1 62  ASP n 
1 63  GLU n 
1 64  ILE n 
1 65  GLU n 
1 66  ASP n 
1 67  ILE n 
1 68  GLN n 
1 69  GLN n 
1 70  GLU n 
1 71  ILE n 
1 72  THR n 
1 73  VAL n 
1 74  LEU n 
1 75  SER n 
1 76  GLN n 
1 77  CYS n 
1 78  ASP n 
1 79  SER n 
1 80  PRO n 
1 81  TYR n 
1 82  VAL n 
1 83  THR n 
1 84  LYS n 
1 85  TYR n 
1 86  TYR n 
1 87  GLY n 
1 88  SER n 
1 89  TYR n 
1 90  LEU n 
1 91  LYS n 
1 92  ASP n 
1 93  THR n 
1 94  LYS n 
1 95  LEU n 
1 96  TRP n 
1 97  ILE n 
1 98  ILE n 
1 99  MET n 
1 100 GLU n 
1 101 TYR n 
1 102 LEU n 
1 103 GLY n 
1 104 GLY n 
1 105 GLY n 
1 106 SER n 
1 107 ALA n 
1 108 LEU n 
1 109 ASP n 
1 110 LEU n 
1 111 LEU n 
1 112 GLU n 
1 113 PRO n 
1 114 GLY n 
1 115 PRO n 
1 116 LEU n 
1 117 ASP n 
1 118 GLU n 
1 119 THR n 
1 120 GLN n 
1 121 ILE n 
1 122 ALA n 
1 123 THR n 
1 124 ILE n 
1 125 LEU n 
1 126 ARG n 
1 127 GLU n 
1 128 ILE n 
1 129 LEU n 
1 130 LYS n 
1 131 GLY n 
1 132 LEU n 
1 133 ASP n 
1 134 TYR n 
1 135 LEU n 
1 136 HIS n 
1 137 SER n 
1 138 GLU n 
1 139 LYS n 
1 140 LYS n 
1 141 ILE n 
1 142 HIS n 
1 143 ARG n 
1 144 ASP n 
1 145 ILE n 
1 146 LYS n 
1 147 ALA n 
1 148 ALA n 
1 149 ASN n 
1 150 VAL n 
1 151 LEU n 
1 152 LEU n 
1 153 SER n 
1 154 GLU n 
1 155 HIS n 
1 156 GLY n 
1 157 GLU n 
1 158 VAL n 
1 159 LYS n 
1 160 LEU n 
1 161 ALA n 
1 162 ASP n 
1 163 PHE n 
1 164 GLY n 
1 165 VAL n 
1 166 ALA n 
1 167 GLY n 
1 168 GLN n 
1 169 LEU n 
1 170 THR n 
1 171 ASP n 
1 172 THR n 
1 173 GLN n 
1 174 ILE n 
1 175 LYS n 
1 176 ARG n 
1 177 ASN n 
1 178 TPO n 
1 179 PHE n 
1 180 VAL n 
1 181 GLY n 
1 182 THR n 
1 183 PRO n 
1 184 PHE n 
1 185 TRP n 
1 186 MET n 
1 187 ALA n 
1 188 PRO n 
1 189 GLU n 
1 190 VAL n 
1 191 ILE n 
1 192 LYS n 
1 193 GLN n 
1 194 SER n 
1 195 ALA n 
1 196 TYR n 
1 197 ASP n 
1 198 SER n 
1 199 LYS n 
1 200 ALA n 
1 201 ASP n 
1 202 ILE n 
1 203 TRP n 
1 204 SER n 
1 205 LEU n 
1 206 GLY n 
1 207 ILE n 
1 208 THR n 
1 209 ALA n 
1 210 ILE n 
1 211 GLU n 
1 212 LEU n 
1 213 ALA n 
1 214 ARG n 
1 215 GLY n 
1 216 GLU n 
1 217 PRO n 
1 218 PRO n 
1 219 HIS n 
1 220 SER n 
1 221 GLU n 
1 222 LEU n 
1 223 HIS n 
1 224 PRO n 
1 225 MET n 
1 226 LYS n 
1 227 VAL n 
1 228 LEU n 
1 229 PHE n 
1 230 LEU n 
1 231 ILE n 
1 232 PRO n 
1 233 LYS n 
1 234 ASN n 
1 235 ASN n 
1 236 PRO n 
1 237 PRO n 
1 238 THR n 
1 239 LEU n 
1 240 GLU n 
1 241 GLY n 
1 242 ASN n 
1 243 TYR n 
1 244 SER n 
1 245 LYS n 
1 246 PRO n 
1 247 LEU n 
1 248 LYS n 
1 249 GLU n 
1 250 PHE n 
1 251 VAL n 
1 252 GLU n 
1 253 ALA n 
1 254 CYS n 
1 255 LEU n 
1 256 ASN n 
1 257 LYS n 
1 258 GLU n 
1 259 PRO n 
1 260 SER n 
1 261 PHE n 
1 262 ARG n 
1 263 PRO n 
1 264 THR n 
1 265 ALA n 
1 266 LYS n 
1 267 GLU n 
1 268 LEU n 
1 269 LEU n 
1 270 LYS n 
1 271 HIS n 
1 272 LYS n 
1 273 PHE n 
1 274 ILE n 
1 275 LEU n 
1 276 ARG n 
1 277 ASN n 
1 278 ALA n 
1 279 LYS n 
1 280 LYS n 
1 281 THR n 
1 282 SER n 
1 283 TYR n 
1 284 LEU n 
1 285 THR n 
1 286 GLU n 
1 287 LEU n 
1 288 ILE n 
1 289 ASP n 
1 290 ARG n 
1 291 TYR n 
1 292 LYS n 
1 293 ARG n 
1 294 TRP n 
1 295 LYS n 
1 296 ALA n 
1 297 GLU n 
1 298 GLN n 
1 299 SER n 
1 300 HIS n 
1 301 ASP n 
1 302 ASP n 
1 303 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 STK24 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'ArcticExpress(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET-32 Xa/LIC' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q6P0Y1_HUMAN 
_struct_ref.pdbx_db_accession          Q6P0Y1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAHSPVQSGLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSP
YVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKL
ADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLE
GNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3A7H A 1 ? 303 ? Q6P0Y1 1 ? 303 ? 1 303 
2 1 3A7H B 1 ? 303 ? Q6P0Y1 1 ? 303 ? 1 303 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ?                  'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ?                  'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ?                  'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ?                  'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ?                  'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ?                  'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ?                  'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ?                  'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ?                  'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ?                  'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                       ?                  'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ?                  'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ?                  'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ?                  'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ?                  'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ?                  'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ?                  'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ?                  'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ?                  'C4 H9 N O3'        119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE            PHOSPHONOTHREONINE 'C4 H10 N O6 P'     199.099 
TRP 'L-peptide linking' y TRYPTOPHAN                  ?                  'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ?                  'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ?                  'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3A7H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.37 
_exptl_crystal.density_percent_sol   48.06 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
;50mM Tris-HCl, 100mM NaCl, 10%(v/v) glycerol, 5mM dithiothreitol, 0.1M Tris-HCl, 200mM MgCl2, 13%(v/v) PEG 3350, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2007-10-08 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 channel' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL12B2' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL12B2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     3A7H 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            1.96 
_reflns.number_obs                   45166 
_reflns.number_all                   45904 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            0.039 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.0 
_reflns.pdbx_netI_over_sigmaI        49.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.96 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.375 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.5 
_reflns_shell.pdbx_redundancy        4.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4541 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3A7H 
_refine.ls_number_reflns_obs                     43940 
_refine.ls_number_reflns_all                     45904 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            1.96 
_refine.ls_percent_reflns_obs                    95.7 
_refine.ls_R_factor_obs                          0.210 
_refine.ls_R_factor_all                          0.210 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2198 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               43 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 3A7G' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3A7H 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.22 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.30 
_refine_analyze.Luzzati_sigma_a_free            0.25 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4644 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             476 
_refine_hist.number_atoms_total               5174 
_refine_hist.d_res_high                       1.96 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.9   ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.020 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.96 
_refine_ls_shell.d_res_low                        2.03 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.287 
_refine_ls_shell.percent_reflns_obs               83.0 
_refine_ls_shell.R_factor_R_free                  0.318 
_refine_ls_shell.R_factor_R_free_error            0.031 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             190 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                3800 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3A7H 
_struct.title                     'Human MST3 kinase in complex with ATP' 
_struct.pdbx_descriptor           'Serine/threonine kinase 24 (STE20 homolog, yeast)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3A7H 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'two-lobe protein kinase fold, ATP-binding, Kinase, Nucleotide-binding, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 19  ? LEU A 23  ? ASP A 19  LEU A 23  1 ? 5  
HELX_P HELX_P2  2  ASP A 62  ? GLN A 76  ? ASP A 62  GLN A 76  1 ? 15 
HELX_P HELX_P3  3  ALA A 107 ? LEU A 111 ? ALA A 107 LEU A 111 1 ? 5  
HELX_P HELX_P4  4  ASP A 117 ? GLU A 138 ? ASP A 117 GLU A 138 1 ? 22 
HELX_P HELX_P5  5  LYS A 146 ? ALA A 148 ? LYS A 146 ALA A 148 5 ? 3  
HELX_P HELX_P6  6  THR A 182 ? MET A 186 ? THR A 182 MET A 186 5 ? 5  
HELX_P HELX_P7  7  ALA A 187 ? LYS A 192 ? ALA A 187 LYS A 192 1 ? 6  
HELX_P HELX_P8  8  ASP A 197 ? GLY A 215 ? ASP A 197 GLY A 215 1 ? 19 
HELX_P HELX_P9  9  HIS A 223 ? ASN A 234 ? HIS A 223 ASN A 234 1 ? 12 
HELX_P HELX_P10 10 SER A 244 ? LEU A 255 ? SER A 244 LEU A 255 1 ? 12 
HELX_P HELX_P11 11 GLU A 258 ? ARG A 262 ? GLU A 258 ARG A 262 5 ? 5  
HELX_P HELX_P12 12 THR A 264 ? LEU A 269 ? THR A 264 LEU A 269 1 ? 6  
HELX_P HELX_P13 13 HIS A 271 ? ALA A 278 ? HIS A 271 ALA A 278 1 ? 8  
HELX_P HELX_P14 14 LYS A 280 ? TYR A 283 ? LYS A 280 TYR A 283 5 ? 4  
HELX_P HELX_P15 15 LEU A 284 ? GLU A 297 ? LEU A 284 GLU A 297 1 ? 14 
HELX_P HELX_P16 16 ASP B 19  ? LEU B 23  ? ASP B 19  LEU B 23  1 ? 5  
HELX_P HELX_P17 17 GLU B 61  ? GLN B 76  ? GLU B 61  GLN B 76  1 ? 16 
HELX_P HELX_P18 18 LEU B 108 ? GLU B 112 ? LEU B 108 GLU B 112 5 ? 5  
HELX_P HELX_P19 19 ASP B 117 ? GLU B 138 ? ASP B 117 GLU B 138 1 ? 22 
HELX_P HELX_P20 20 LYS B 146 ? ALA B 148 ? LYS B 146 ALA B 148 5 ? 3  
HELX_P HELX_P21 21 THR B 182 ? MET B 186 ? THR B 182 MET B 186 5 ? 5  
HELX_P HELX_P22 22 ALA B 187 ? LYS B 192 ? ALA B 187 LYS B 192 1 ? 6  
HELX_P HELX_P23 23 SER B 198 ? GLY B 215 ? SER B 198 GLY B 215 1 ? 18 
HELX_P HELX_P24 24 HIS B 223 ? ASN B 234 ? HIS B 223 ASN B 234 1 ? 12 
HELX_P HELX_P25 25 SER B 244 ? LEU B 255 ? SER B 244 LEU B 255 1 ? 12 
HELX_P HELX_P26 26 GLU B 258 ? ARG B 262 ? GLU B 258 ARG B 262 5 ? 5  
HELX_P HELX_P27 27 THR B 264 ? LEU B 269 ? THR B 264 LEU B 269 1 ? 6  
HELX_P HELX_P28 28 HIS B 271 ? ALA B 278 ? HIS B 271 ALA B 278 1 ? 8  
HELX_P HELX_P29 29 LYS B 280 ? TYR B 283 ? LYS B 280 TYR B 283 5 ? 4  
HELX_P HELX_P30 30 LEU B 284 ? ALA B 296 ? LEU B 284 ALA B 296 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A ASN 177 C ? ? ? 1_555 A TPO 178 N ? ? A ASN 177 A TPO 178 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale ? ? A TPO 178 C ? ? ? 1_555 A PHE 179 N ? ? A TPO 178 A PHE 179 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale3 covale ? ? B ASN 177 C ? ? ? 1_555 B TPO 178 N ? ? B ASN 177 B TPO 178 1_555 ? ? ? ? ? ? ? 1.320 ? 
covale4 covale ? ? B TPO 178 C ? ? ? 1_555 B PHE 179 N ? ? B TPO 178 B PHE 179 1_555 ? ? ? ? ? ? ? 1.321 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 2 ? 
D ? 5 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 24  ? GLY A 31  ? PHE A 24  GLY A 31  
A 2 GLU A 37  ? ASP A 43  ? GLU A 37  ASP A 43  
A 3 LYS A 48  ? ASP A 56  ? LYS A 48  ASP A 56  
A 4 LYS A 94  ? GLU A 100 ? LYS A 94  GLU A 100 
A 5 TYR A 85  ? LYS A 91  ? TYR A 85  LYS A 91  
B 1 GLY A 105 ? SER A 106 ? GLY A 105 SER A 106 
B 2 VAL A 150 ? LEU A 152 ? VAL A 150 LEU A 152 
B 3 VAL A 158 ? LEU A 160 ? VAL A 158 LEU A 160 
C 1 LYS A 140 ? ILE A 141 ? LYS A 140 ILE A 141 
C 2 GLY A 167 ? GLN A 168 ? GLY A 167 GLN A 168 
D 1 PHE B 24  ? LYS B 32  ? PHE B 24  LYS B 32  
D 2 GLU B 37  ? ASP B 43  ? GLU B 37  ASP B 43  
D 3 VAL B 49  ? ASP B 56  ? VAL B 49  ASP B 56  
D 4 LYS B 94  ? GLU B 100 ? LYS B 94  GLU B 100 
D 5 TYR B 85  ? LYS B 91  ? TYR B 85  LYS B 91  
E 1 GLY B 105 ? SER B 106 ? GLY B 105 SER B 106 
E 2 VAL B 150 ? LEU B 152 ? VAL B 150 LEU B 152 
E 3 VAL B 158 ? LEU B 160 ? VAL B 158 LEU B 160 
F 1 LYS B 140 ? ILE B 141 ? LYS B 140 ILE B 141 
F 2 GLY B 167 ? GLN B 168 ? GLY B 167 GLN B 168 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 27  ? N LEU A 27  O LYS A 40  ? O LYS A 40  
A 2 3 N PHE A 39  ? N PHE A 39  O ILE A 52  ? O ILE A 52  
A 3 4 N LYS A 53  ? N LYS A 53  O ILE A 97  ? O ILE A 97  
A 4 5 O ILE A 98  ? O ILE A 98  N TYR A 86  ? N TYR A 86  
B 1 2 N GLY A 105 ? N GLY A 105 O LEU A 152 ? O LEU A 152 
B 2 3 N LEU A 151 ? N LEU A 151 O LYS A 159 ? O LYS A 159 
C 1 2 N ILE A 141 ? N ILE A 141 O GLY A 167 ? O GLY A 167 
D 1 2 N ILE B 30  ? N ILE B 30  O VAL B 38  ? O VAL B 38  
D 2 3 N GLY B 41  ? N GLY B 41  O VAL B 50  ? O VAL B 50  
D 3 4 N LYS B 53  ? N LYS B 53  O ILE B 97  ? O ILE B 97  
D 4 5 O ILE B 98  ? O ILE B 98  N TYR B 86  ? N TYR B 86  
E 1 2 N GLY B 105 ? N GLY B 105 O LEU B 152 ? O LEU B 152 
E 2 3 N LEU B 151 ? N LEU B 151 O LYS B 159 ? O LYS B 159 
F 1 2 N ILE B 141 ? N ILE B 141 O GLY B 167 ? O GLY B 167 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ATP A 400' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ATP B 400' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  GLY A 33  ? GLY A 33  . ? 1_555 ? 
2  AC1 8  VAL A 38  ? VAL A 38  . ? 1_555 ? 
3  AC1 8  ALA A 51  ? ALA A 51  . ? 1_555 ? 
4  AC1 8  LYS A 53  ? LYS A 53  . ? 1_555 ? 
5  AC1 8  GLU A 100 ? GLU A 100 . ? 1_555 ? 
6  AC1 8  LEU A 102 ? LEU A 102 . ? 1_555 ? 
7  AC1 8  ASP A 162 ? ASP A 162 . ? 1_555 ? 
8  AC1 8  HOH E .   ? HOH A 380 . ? 1_555 ? 
9  AC2 11 ILE B 30  ? ILE B 30  . ? 1_555 ? 
10 AC2 11 GLY B 33  ? GLY B 33  . ? 1_555 ? 
11 AC2 11 SER B 34  ? SER B 34  . ? 1_555 ? 
12 AC2 11 VAL B 38  ? VAL B 38  . ? 1_555 ? 
13 AC2 11 ALA B 51  ? ALA B 51  . ? 1_555 ? 
14 AC2 11 LYS B 53  ? LYS B 53  . ? 1_555 ? 
15 AC2 11 GLU B 100 ? GLU B 100 . ? 1_555 ? 
16 AC2 11 LEU B 102 ? LEU B 102 . ? 1_555 ? 
17 AC2 11 ASP B 162 ? ASP B 162 . ? 1_555 ? 
18 AC2 11 HOH F .   ? HOH B 434 . ? 1_555 ? 
19 AC2 11 HOH F .   ? HOH B 438 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3A7H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3A7H 
_atom_sites.fract_transf_matrix[1][1]   0.017960 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001083 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010505 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016294 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLY A 1 9   ? 22.484  21.813  62.836  1.00 62.88 ? 9   GLY A N     1 
ATOM   2    C CA    . GLY A 1 9   ? 21.561  22.942  62.470  1.00 61.90 ? 9   GLY A CA    1 
ATOM   3    C C     . GLY A 1 9   ? 21.179  22.879  60.999  1.00 60.67 ? 9   GLY A C     1 
ATOM   4    O O     . GLY A 1 9   ? 21.130  21.799  60.407  1.00 60.65 ? 9   GLY A O     1 
ATOM   5    N N     . LEU A 1 10  ? 20.908  24.035  60.398  1.00 58.33 ? 10  LEU A N     1 
ATOM   6    C CA    . LEU A 1 10  ? 20.551  24.059  58.992  1.00 55.63 ? 10  LEU A CA    1 
ATOM   7    C C     . LEU A 1 10  ? 21.799  24.189  58.106  1.00 53.52 ? 10  LEU A C     1 
ATOM   8    O O     . LEU A 1 10  ? 22.509  25.194  58.188  1.00 53.13 ? 10  LEU A O     1 
ATOM   9    C CB    . LEU A 1 10  ? 19.605  25.216  58.750  1.00 55.99 ? 10  LEU A CB    1 
ATOM   10   C CG    . LEU A 1 10  ? 18.891  25.140  57.405  1.00 56.72 ? 10  LEU A CG    1 
ATOM   11   C CD1   . LEU A 1 10  ? 17.761  24.100  57.464  1.00 57.55 ? 10  LEU A CD1   1 
ATOM   12   C CD2   . LEU A 1 10  ? 18.322  26.499  57.079  1.00 57.31 ? 10  LEU A CD2   1 
ATOM   13   N N     . PRO A 1 11  ? 22.110  23.168  57.268  1.00 51.69 ? 11  PRO A N     1 
ATOM   14   C CA    . PRO A 1 11  ? 23.307  23.331  56.440  1.00 50.89 ? 11  PRO A CA    1 
ATOM   15   C C     . PRO A 1 11  ? 23.177  24.496  55.477  1.00 51.10 ? 11  PRO A C     1 
ATOM   16   O O     . PRO A 1 11  ? 22.061  24.887  55.103  1.00 49.73 ? 11  PRO A O     1 
ATOM   17   C CB    . PRO A 1 11  ? 23.444  21.987  55.721  1.00 50.45 ? 11  PRO A CB    1 
ATOM   18   C CG    . PRO A 1 11  ? 22.110  21.432  55.721  1.00 48.90 ? 11  PRO A CG    1 
ATOM   19   C CD    . PRO A 1 11  ? 21.533  21.826  57.061  1.00 52.37 ? 11  PRO A CD    1 
ATOM   20   N N     . GLY A 1 12  ? 24.317  25.070  55.124  1.00 49.20 ? 12  GLY A N     1 
ATOM   21   C CA    . GLY A 1 12  ? 24.321  26.178  54.194  1.00 51.24 ? 12  GLY A CA    1 
ATOM   22   C C     . GLY A 1 12  ? 23.819  27.501  54.763  1.00 51.86 ? 12  GLY A C     1 
ATOM   23   O O     . GLY A 1 12  ? 23.809  28.504  54.060  1.00 49.57 ? 12  GLY A O     1 
ATOM   24   N N     . MET A 1 13  ? 23.399  27.475  56.027  1.00 53.61 ? 13  MET A N     1 
ATOM   25   C CA    . MET A 1 13  ? 22.911  28.646  56.746  1.00 56.44 ? 13  MET A CA    1 
ATOM   26   C C     . MET A 1 13  ? 24.061  29.643  56.911  1.00 57.94 ? 13  MET A C     1 
ATOM   27   O O     . MET A 1 13  ? 25.122  29.302  57.443  1.00 58.36 ? 13  MET A O     1 
ATOM   28   C CB    . MET A 1 13  ? 22.434  28.208  58.119  1.00 58.78 ? 13  MET A CB    1 
ATOM   29   C CG    . MET A 1 13  ? 21.014  28.573  58.467  1.00 61.27 ? 13  MET A CG    1 
ATOM   30   S SD    . MET A 1 13  ? 21.085  30.204  59.108  1.00 69.15 ? 13  MET A SD    1 
ATOM   31   C CE    . MET A 1 13  ? 20.852  31.151  57.633  1.00 64.95 ? 13  MET A CE    1 
ATOM   32   N N     . GLN A 1 14  ? 23.842  30.874  56.474  1.00 59.00 ? 14  GLN A N     1 
ATOM   33   C CA    . GLN A 1 14  ? 24.839  31.941  56.564  1.00 60.37 ? 14  GLN A CA    1 
ATOM   34   C C     . GLN A 1 14  ? 24.527  32.858  57.742  1.00 61.39 ? 14  GLN A C     1 
ATOM   35   O O     . GLN A 1 14  ? 23.357  33.080  58.095  1.00 60.27 ? 14  GLN A O     1 
ATOM   36   C CB    . GLN A 1 14  ? 24.838  32.778  55.291  1.00 60.77 ? 14  GLN A CB    1 
ATOM   37   C CG    . GLN A 1 14  ? 25.019  31.951  54.062  1.00 62.43 ? 14  GLN A CG    1 
ATOM   38   C CD    . GLN A 1 14  ? 26.457  31.748  53.756  1.00 64.42 ? 14  GLN A CD    1 
ATOM   39   O OE1   . GLN A 1 14  ? 27.264  31.458  54.656  1.00 64.54 ? 14  GLN A OE1   1 
ATOM   40   N NE2   . GLN A 1 14  ? 26.815  31.902  52.472  1.00 65.40 ? 14  GLN A NE2   1 
ATOM   41   N N     . ASN A 1 15  ? 25.586  33.390  58.348  1.00 62.27 ? 15  ASN A N     1 
ATOM   42   C CA    . ASN A 1 15  ? 25.441  34.282  59.492  1.00 63.41 ? 15  ASN A CA    1 
ATOM   43   C C     . ASN A 1 15  ? 24.620  35.516  59.125  1.00 62.96 ? 15  ASN A C     1 
ATOM   44   O O     . ASN A 1 15  ? 24.438  35.827  57.936  1.00 62.59 ? 15  ASN A O     1 
ATOM   45   C CB    . ASN A 1 15  ? 26.829  34.692  60.016  1.00 64.81 ? 15  ASN A CB    1 
ATOM   46   C CG    . ASN A 1 15  ? 27.819  34.930  58.903  1.00 66.32 ? 15  ASN A CG    1 
ATOM   47   O OD1   . ASN A 1 15  ? 27.828  35.992  58.266  1.00 66.59 ? 15  ASN A OD1   1 
ATOM   48   N ND2   . ASN A 1 15  ? 28.654  33.935  58.650  1.00 66.95 ? 15  ASN A ND2   1 
ATOM   49   N N     . LEU A 1 16  ? 24.104  36.205  60.140  1.00 61.40 ? 16  LEU A N     1 
ATOM   50   C CA    . LEU A 1 16  ? 23.313  37.395  59.884  1.00 61.35 ? 16  LEU A CA    1 
ATOM   51   C C     . LEU A 1 16  ? 24.141  38.446  59.183  1.00 60.79 ? 16  LEU A C     1 
ATOM   52   O O     . LEU A 1 16  ? 23.575  39.368  58.615  1.00 61.33 ? 16  LEU A O     1 
ATOM   53   C CB    . LEU A 1 16  ? 22.780  38.033  61.163  1.00 62.92 ? 16  LEU A CB    1 
ATOM   54   C CG    . LEU A 1 16  ? 21.733  37.411  62.074  1.00 64.31 ? 16  LEU A CG    1 
ATOM   55   C CD1   . LEU A 1 16  ? 21.459  38.392  63.205  1.00 63.79 ? 16  LEU A CD1   1 
ATOM   56   C CD2   . LEU A 1 16  ? 20.466  37.082  61.302  1.00 65.57 ? 16  LEU A CD2   1 
ATOM   57   N N     . LYS A 1 17  ? 25.468  38.326  59.239  1.00 59.34 ? 17  LYS A N     1 
ATOM   58   C CA    . LYS A 1 17  ? 26.366  39.291  58.593  1.00 58.13 ? 17  LYS A CA    1 
ATOM   59   C C     . LYS A 1 17  ? 26.048  39.389  57.094  1.00 56.46 ? 17  LYS A C     1 
ATOM   60   O O     . LYS A 1 17  ? 26.156  40.449  56.483  1.00 55.82 ? 17  LYS A O     1 
ATOM   61   C CB    . LYS A 1 17  ? 27.824  38.859  58.776  1.00 58.19 ? 17  LYS A CB    1 
ATOM   62   C CG    . LYS A 1 17  ? 28.831  39.948  58.499  1.00 59.91 ? 17  LYS A CG    1 
ATOM   63   C CD    . LYS A 1 17  ? 28.731  41.063  59.526  1.00 59.68 ? 17  LYS A CD    1 
ATOM   64   C CE    . LYS A 1 17  ? 29.966  41.954  59.511  1.00 61.12 ? 17  LYS A CE    1 
ATOM   65   N NZ    . LYS A 1 17  ? 30.050  42.914  58.363  1.00 59.63 ? 17  LYS A NZ    1 
ATOM   66   N N     . ALA A 1 18  ? 25.657  38.268  56.506  1.00 54.73 ? 18  ALA A N     1 
ATOM   67   C CA    . ALA A 1 18  ? 25.314  38.260  55.099  1.00 52.59 ? 18  ALA A CA    1 
ATOM   68   C C     . ALA A 1 18  ? 23.862  38.688  54.953  1.00 52.05 ? 18  ALA A C     1 
ATOM   69   O O     . ALA A 1 18  ? 22.927  37.905  55.249  1.00 51.95 ? 18  ALA A O     1 
ATOM   70   C CB    . ALA A 1 18  ? 25.525  36.892  54.539  1.00 54.31 ? 18  ALA A CB    1 
ATOM   71   N N     . ASP A 1 19  ? 23.676  39.943  54.535  1.00 49.43 ? 19  ASP A N     1 
ATOM   72   C CA    . ASP A 1 19  ? 22.346  40.520  54.341  1.00 48.58 ? 19  ASP A CA    1 
ATOM   73   C C     . ASP A 1 19  ? 21.827  40.029  52.994  1.00 47.46 ? 19  ASP A C     1 
ATOM   74   O O     . ASP A 1 19  ? 22.348  40.394  51.947  1.00 46.98 ? 19  ASP A O     1 
ATOM   75   C CB    . ASP A 1 19  ? 22.411  42.060  54.363  1.00 49.35 ? 19  ASP A CB    1 
ATOM   76   C CG    . ASP A 1 19  ? 21.013  42.734  54.373  1.00 51.36 ? 19  ASP A CG    1 
ATOM   77   O OD1   . ASP A 1 19  ? 20.944  43.953  54.707  1.00 53.14 ? 19  ASP A OD1   1 
ATOM   78   O OD2   . ASP A 1 19  ? 19.983  42.083  54.043  1.00 47.59 ? 19  ASP A OD2   1 
ATOM   79   N N     . PRO A 1 20  ? 20.800  39.180  53.014  1.00 46.76 ? 20  PRO A N     1 
ATOM   80   C CA    . PRO A 1 20  ? 20.264  38.677  51.748  1.00 48.30 ? 20  PRO A CA    1 
ATOM   81   C C     . PRO A 1 20  ? 19.637  39.774  50.917  1.00 48.07 ? 20  PRO A C     1 
ATOM   82   O O     . PRO A 1 20  ? 19.531  39.643  49.700  1.00 49.06 ? 20  PRO A O     1 
ATOM   83   C CB    . PRO A 1 20  ? 19.233  37.634  52.169  1.00 45.91 ? 20  PRO A CB    1 
ATOM   84   C CG    . PRO A 1 20  ? 18.761  38.159  53.529  1.00 46.91 ? 20  PRO A CG    1 
ATOM   85   C CD    . PRO A 1 20  ? 20.053  38.656  54.176  1.00 46.30 ? 20  PRO A CD    1 
ATOM   86   N N     . GLU A 1 21  ? 19.195  40.844  51.561  1.00 49.40 ? 21  GLU A N     1 
ATOM   87   C CA    . GLU A 1 21  ? 18.601  41.929  50.794  1.00 50.55 ? 21  GLU A CA    1 
ATOM   88   C C     . GLU A 1 21  ? 19.689  42.680  50.003  1.00 51.18 ? 21  GLU A C     1 
ATOM   89   O O     . GLU A 1 21  ? 19.391  43.416  49.073  1.00 51.83 ? 21  GLU A O     1 
ATOM   90   C CB    . GLU A 1 21  ? 17.736  42.839  51.703  1.00 51.75 ? 21  GLU A CB    1 
ATOM   91   C CG    . GLU A 1 21  ? 16.240  42.350  51.736  1.00 50.30 ? 21  GLU A CG    1 
ATOM   92   C CD    . GLU A 1 21  ? 15.375  42.955  52.834  1.00 52.45 ? 21  GLU A CD    1 
ATOM   93   O OE1   . GLU A 1 21  ? 14.184  42.578  52.964  1.00 50.91 ? 21  GLU A OE1   1 
ATOM   94   O OE2   . GLU A 1 21  ? 15.862  43.824  53.583  1.00 55.61 ? 21  GLU A OE2   1 
ATOM   95   N N     . GLU A 1 22  ? 20.956  42.454  50.324  1.00 51.33 ? 22  GLU A N     1 
ATOM   96   C CA    . GLU A 1 22  ? 21.998  43.116  49.558  1.00 51.81 ? 22  GLU A CA    1 
ATOM   97   C C     . GLU A 1 22  ? 22.731  42.155  48.652  1.00 50.57 ? 22  GLU A C     1 
ATOM   98   O O     . GLU A 1 22  ? 23.354  42.570  47.694  1.00 52.06 ? 22  GLU A O     1 
ATOM   99   C CB    . GLU A 1 22  ? 22.986  43.815  50.478  1.00 54.84 ? 22  GLU A CB    1 
ATOM   100  C CG    . GLU A 1 22  ? 22.401  45.118  51.082  1.00 59.25 ? 22  GLU A CG    1 
ATOM   101  C CD    . GLU A 1 22  ? 23.134  45.581  52.331  1.00 60.93 ? 22  GLU A CD    1 
ATOM   102  O OE1   . GLU A 1 22  ? 22.480  46.247  53.173  1.00 61.62 ? 22  GLU A OE1   1 
ATOM   103  O OE2   . GLU A 1 22  ? 24.351  45.276  52.458  1.00 60.93 ? 22  GLU A OE2   1 
ATOM   104  N N     . LEU A 1 23  ? 22.675  40.866  48.952  1.00 47.84 ? 23  LEU A N     1 
ATOM   105  C CA    . LEU A 1 23  ? 23.355  39.897  48.111  1.00 45.88 ? 23  LEU A CA    1 
ATOM   106  C C     . LEU A 1 23  ? 22.403  39.390  46.990  1.00 43.13 ? 23  LEU A C     1 
ATOM   107  O O     . LEU A 1 23  ? 22.861  38.919  45.979  1.00 42.09 ? 23  LEU A O     1 
ATOM   108  C CB    . LEU A 1 23  ? 23.869  38.718  48.957  1.00 43.94 ? 23  LEU A CB    1 
ATOM   109  C CG    . LEU A 1 23  ? 24.928  38.963  50.041  1.00 45.81 ? 23  LEU A CG    1 
ATOM   110  C CD1   . LEU A 1 23  ? 25.134  37.642  50.843  1.00 43.93 ? 23  LEU A CD1   1 
ATOM   111  C CD2   . LEU A 1 23  ? 26.264  39.469  49.389  1.00 43.39 ? 23  LEU A CD2   1 
ATOM   112  N N     . PHE A 1 24  ? 21.096  39.505  47.177  1.00 42.18 ? 24  PHE A N     1 
ATOM   113  C CA    . PHE A 1 24  ? 20.142  39.043  46.168  1.00 42.07 ? 24  PHE A CA    1 
ATOM   114  C C     . PHE A 1 24  ? 19.160  40.124  45.762  1.00 42.56 ? 24  PHE A C     1 
ATOM   115  O O     . PHE A 1 24  ? 18.739  40.924  46.590  1.00 42.38 ? 24  PHE A O     1 
ATOM   116  C CB    . PHE A 1 24  ? 19.365  37.835  46.676  1.00 40.75 ? 24  PHE A CB    1 
ATOM   117  C CG    . PHE A 1 24  ? 20.233  36.669  47.014  1.00 39.83 ? 24  PHE A CG    1 
ATOM   118  C CD1   . PHE A 1 24  ? 20.554  35.698  46.050  1.00 39.89 ? 24  PHE A CD1   1 
ATOM   119  C CD2   . PHE A 1 24  ? 20.764  36.549  48.285  1.00 39.95 ? 24  PHE A CD2   1 
ATOM   120  C CE1   . PHE A 1 24  ? 21.391  34.637  46.366  1.00 37.55 ? 24  PHE A CE1   1 
ATOM   121  C CE2   . PHE A 1 24  ? 21.598  35.499  48.611  1.00 40.19 ? 24  PHE A CE2   1 
ATOM   122  C CZ    . PHE A 1 24  ? 21.917  34.532  47.639  1.00 38.13 ? 24  PHE A CZ    1 
ATOM   123  N N     . THR A 1 25  ? 18.832  40.179  44.476  1.00 43.67 ? 25  THR A N     1 
ATOM   124  C CA    . THR A 1 25  ? 17.853  41.134  43.992  1.00 44.85 ? 25  THR A CA    1 
ATOM   125  C C     . THR A 1 25  ? 16.636  40.364  43.573  1.00 46.39 ? 25  THR A C     1 
ATOM   126  O O     . THR A 1 25  ? 16.721  39.514  42.679  1.00 46.69 ? 25  THR A O     1 
ATOM   127  C CB    . THR A 1 25  ? 18.305  41.885  42.755  1.00 45.05 ? 25  THR A CB    1 
ATOM   128  O OG1   . THR A 1 25  ? 19.455  42.697  43.056  1.00 46.13 ? 25  THR A OG1   1 
ATOM   129  C CG2   . THR A 1 25  ? 17.155  42.753  42.284  1.00 45.16 ? 25  THR A CG2   1 
ATOM   130  N N     . LYS A 1 26  ? 15.503  40.664  44.205  1.00 47.26 ? 26  LYS A N     1 
ATOM   131  C CA    . LYS A 1 26  ? 14.259  40.003  43.886  1.00 48.00 ? 26  LYS A CA    1 
ATOM   132  C C     . LYS A 1 26  ? 13.706  40.667  42.635  1.00 49.29 ? 26  LYS A C     1 
ATOM   133  O O     . LYS A 1 26  ? 13.627  41.893  42.541  1.00 48.90 ? 26  LYS A O     1 
ATOM   134  C CB    . LYS A 1 26  ? 13.255  40.144  45.038  1.00 49.22 ? 26  LYS A CB    1 
ATOM   135  C CG    . LYS A 1 26  ? 13.861  39.791  46.378  1.00 50.31 ? 26  LYS A CG    1 
ATOM   136  C CD    . LYS A 1 26  ? 12.847  39.275  47.379  1.00 53.07 ? 26  LYS A CD    1 
ATOM   137  C CE    . LYS A 1 26  ? 11.905  40.335  47.877  1.00 51.94 ? 26  LYS A CE    1 
ATOM   138  N NZ    . LYS A 1 26  ? 11.868  40.269  49.370  1.00 53.22 ? 26  LYS A NZ    1 
ATOM   139  N N     . LEU A 1 27  ? 13.330  39.862  41.665  1.00 49.50 ? 27  LEU A N     1 
ATOM   140  C CA    . LEU A 1 27  ? 12.806  40.423  40.430  1.00 51.31 ? 27  LEU A CA    1 
ATOM   141  C C     . LEU A 1 27  ? 11.288  40.452  40.441  1.00 52.31 ? 27  LEU A C     1 
ATOM   142  O O     . LEU A 1 27  ? 10.689  41.453  40.078  1.00 52.34 ? 27  LEU A O     1 
ATOM   143  C CB    . LEU A 1 27  ? 13.326  39.616  39.237  1.00 50.27 ? 27  LEU A CB    1 
ATOM   144  C CG    . LEU A 1 27  ? 14.866  39.652  39.144  1.00 50.68 ? 27  LEU A CG    1 
ATOM   145  C CD1   . LEU A 1 27  ? 15.380  38.673  38.118  1.00 49.79 ? 27  LEU A CD1   1 
ATOM   146  C CD2   . LEU A 1 27  ? 15.313  41.111  38.799  1.00 51.01 ? 27  LEU A CD2   1 
ATOM   147  N N     . GLU A 1 28  ? 10.676  39.363  40.874  1.00 54.13 ? 28  GLU A N     1 
ATOM   148  C CA    . GLU A 1 28  ? 9.221   39.250  40.920  1.00 56.28 ? 28  GLU A CA    1 
ATOM   149  C C     . GLU A 1 28  ? 8.766   38.069  41.809  1.00 56.67 ? 28  GLU A C     1 
ATOM   150  O O     . GLU A 1 28  ? 9.440   37.036  41.898  1.00 57.02 ? 28  GLU A O     1 
ATOM   151  C CB    . GLU A 1 28  ? 8.676   39.029  39.502  1.00 58.98 ? 28  GLU A CB    1 
ATOM   152  C CG    . GLU A 1 28  ? 8.392   37.547  39.199  1.00 61.70 ? 28  GLU A CG    1 
ATOM   153  C CD    . GLU A 1 28  ? 7.577   37.305  37.932  1.00 64.33 ? 28  GLU A CD    1 
ATOM   154  O OE1   . GLU A 1 28  ? 8.213   37.120  36.858  1.00 64.76 ? 28  GLU A OE1   1 
ATOM   155  O OE2   . GLU A 1 28  ? 6.307   37.291  38.019  1.00 63.75 ? 28  GLU A OE2   1 
ATOM   156  N N     . LYS A 1 29  ? 7.610   38.222  42.441  1.00 56.38 ? 29  LYS A N     1 
ATOM   157  C CA    . LYS A 1 29  ? 7.043   37.176  43.283  1.00 56.17 ? 29  LYS A CA    1 
ATOM   158  C C     . LYS A 1 29  ? 6.550   36.112  42.317  1.00 56.01 ? 29  LYS A C     1 
ATOM   159  O O     . LYS A 1 29  ? 5.764   36.427  41.433  1.00 55.62 ? 29  LYS A O     1 
ATOM   160  C CB    . LYS A 1 29  ? 5.865   37.744  44.067  1.00 56.55 ? 29  LYS A CB    1 
ATOM   161  C CG    . LYS A 1 29  ? 5.153   36.743  44.934  1.00 56.63 ? 29  LYS A CG    1 
ATOM   162  C CD    . LYS A 1 29  ? 4.804   37.373  46.272  1.00 56.99 ? 29  LYS A CD    1 
ATOM   163  C CE    . LYS A 1 29  ? 3.893   38.595  46.099  1.00 57.61 ? 29  LYS A CE    1 
ATOM   164  N NZ    . LYS A 1 29  ? 3.618   39.239  47.404  1.00 57.56 ? 29  LYS A NZ    1 
ATOM   165  N N     . ILE A 1 30  ? 7.002   34.865  42.466  1.00 55.49 ? 30  ILE A N     1 
ATOM   166  C CA    . ILE A 1 30  ? 6.574   33.819  41.543  1.00 55.34 ? 30  ILE A CA    1 
ATOM   167  C C     . ILE A 1 30  ? 5.775   32.696  42.181  1.00 56.44 ? 30  ILE A C     1 
ATOM   168  O O     . ILE A 1 30  ? 5.494   31.701  41.543  1.00 57.15 ? 30  ILE A O     1 
ATOM   169  C CB    . ILE A 1 30  ? 7.784   33.190  40.740  1.00 54.45 ? 30  ILE A CB    1 
ATOM   170  C CG1   . ILE A 1 30  ? 8.771   32.474  41.666  1.00 51.97 ? 30  ILE A CG1   1 
ATOM   171  C CG2   . ILE A 1 30  ? 8.497   34.268  39.926  1.00 54.40 ? 30  ILE A CG2   1 
ATOM   172  C CD1   . ILE A 1 30  ? 9.898   31.779  40.916  1.00 49.77 ? 30  ILE A CD1   1 
ATOM   173  N N     . GLY A 1 31  ? 5.391   32.849  43.437  1.00 57.49 ? 31  GLY A N     1 
ATOM   174  C CA    . GLY A 1 31  ? 4.639   31.797  44.097  1.00 59.04 ? 31  GLY A CA    1 
ATOM   175  C C     . GLY A 1 31  ? 4.386   32.086  45.563  1.00 60.37 ? 31  GLY A C     1 
ATOM   176  O O     . GLY A 1 31  ? 5.090   32.862  46.187  1.00 58.88 ? 31  GLY A O     1 
ATOM   177  N N     . LYS A 1 32  ? 3.351   31.472  46.116  1.00 63.15 ? 32  LYS A N     1 
ATOM   178  C CA    . LYS A 1 32  ? 3.016   31.675  47.524  1.00 66.39 ? 32  LYS A CA    1 
ATOM   179  C C     . LYS A 1 32  ? 2.519   30.364  48.033  1.00 67.97 ? 32  LYS A C     1 
ATOM   180  O O     . LYS A 1 32  ? 1.326   30.084  47.922  1.00 69.04 ? 32  LYS A O     1 
ATOM   181  C CB    . LYS A 1 32  ? 1.894   32.708  47.728  1.00 66.45 ? 32  LYS A CB    1 
ATOM   182  C CG    . LYS A 1 32  ? 2.273   34.173  47.490  1.00 68.09 ? 32  LYS A CG    1 
ATOM   183  C CD    . LYS A 1 32  ? 1.212   35.133  48.054  1.00 69.36 ? 32  LYS A CD    1 
ATOM   184  C CE    . LYS A 1 32  ? -0.198  34.732  47.611  1.00 69.81 ? 32  LYS A CE    1 
ATOM   185  N NZ    . LYS A 1 32  ? -1.290  35.628  48.093  1.00 70.33 ? 32  LYS A NZ    1 
ATOM   186  N N     . GLY A 1 33  ? 3.420   29.558  48.579  1.00 69.47 ? 33  GLY A N     1 
ATOM   187  C CA    . GLY A 1 33  ? 3.001   28.273  49.108  1.00 71.59 ? 33  GLY A CA    1 
ATOM   188  C C     . GLY A 1 33  ? 2.367   28.436  50.477  1.00 72.61 ? 33  GLY A C     1 
ATOM   189  O O     . GLY A 1 33  ? 1.702   29.450  50.757  1.00 71.73 ? 33  GLY A O     1 
ATOM   190  N N     . SER A 1 34  ? 2.575   27.422  51.321  1.00 73.97 ? 34  SER A N     1 
ATOM   191  C CA    . SER A 1 34  ? 2.061   27.397  52.695  1.00 74.71 ? 34  SER A CA    1 
ATOM   192  C C     . SER A 1 34  ? 2.982   28.212  53.599  1.00 74.02 ? 34  SER A C     1 
ATOM   193  O O     . SER A 1 34  ? 2.578   29.173  54.260  1.00 74.00 ? 34  SER A O     1 
ATOM   194  C CB    . SER A 1 34  ? 2.034   25.952  53.217  1.00 75.48 ? 34  SER A CB    1 
ATOM   195  O OG    . SER A 1 34  ? 0.756   25.357  53.052  1.00 77.75 ? 34  SER A OG    1 
ATOM   196  N N     . PHE A 1 35  ? 4.234   27.784  53.594  1.00 73.44 ? 35  PHE A N     1 
ATOM   197  C CA    . PHE A 1 35  ? 5.324   28.335  54.384  1.00 72.65 ? 35  PHE A CA    1 
ATOM   198  C C     . PHE A 1 35  ? 5.619   29.840  54.251  1.00 70.40 ? 35  PHE A C     1 
ATOM   199  O O     . PHE A 1 35  ? 5.768   30.542  55.266  1.00 72.17 ? 35  PHE A O     1 
ATOM   200  C CB    . PHE A 1 35  ? 6.603   27.558  54.040  1.00 75.17 ? 35  PHE A CB    1 
ATOM   201  C CG    . PHE A 1 35  ? 6.520   26.057  54.274  1.00 77.54 ? 35  PHE A CG    1 
ATOM   202  C CD1   . PHE A 1 35  ? 7.475   25.208  53.703  1.00 78.06 ? 35  PHE A CD1   1 
ATOM   203  C CD2   . PHE A 1 35  ? 5.553   25.499  55.122  1.00 78.54 ? 35  PHE A CD2   1 
ATOM   204  C CE1   . PHE A 1 35  ? 7.479   23.835  53.973  1.00 78.82 ? 35  PHE A CE1   1 
ATOM   205  C CE2   . PHE A 1 35  ? 5.548   24.116  55.402  1.00 79.14 ? 35  PHE A CE2   1 
ATOM   206  C CZ    . PHE A 1 35  ? 6.515   23.285  54.827  1.00 78.91 ? 35  PHE A CZ    1 
ATOM   207  N N     . GLY A 1 36  ? 5.745   30.334  53.023  1.00 66.02 ? 36  GLY A N     1 
ATOM   208  C CA    . GLY A 1 36  ? 6.051   31.745  52.839  1.00 60.72 ? 36  GLY A CA    1 
ATOM   209  C C     . GLY A 1 36  ? 5.781   32.236  51.429  1.00 57.24 ? 36  GLY A C     1 
ATOM   210  O O     . GLY A 1 36  ? 4.670   32.068  50.929  1.00 56.50 ? 36  GLY A O     1 
ATOM   211  N N     . GLU A 1 37  ? 6.767   32.869  50.795  1.00 53.60 ? 37  GLU A N     1 
ATOM   212  C CA    . GLU A 1 37  ? 6.610   33.360  49.417  1.00 50.95 ? 37  GLU A CA    1 
ATOM   213  C C     . GLU A 1 37  ? 7.824   32.975  48.586  1.00 48.27 ? 37  GLU A C     1 
ATOM   214  O O     . GLU A 1 37  ? 8.923   32.821  49.121  1.00 48.17 ? 37  GLU A O     1 
ATOM   215  C CB    . GLU A 1 37  ? 6.447   34.874  49.387  1.00 52.02 ? 37  GLU A CB    1 
ATOM   216  C CG    . GLU A 1 37  ? 5.054   35.379  49.761  1.00 55.51 ? 37  GLU A CG    1 
ATOM   217  C CD    . GLU A 1 37  ? 5.004   36.904  49.875  1.00 57.93 ? 37  GLU A CD    1 
ATOM   218  O OE1   . GLU A 1 37  ? 6.067   37.498  50.193  1.00 58.75 ? 37  GLU A OE1   1 
ATOM   219  O OE2   . GLU A 1 37  ? 3.921   37.507  49.665  1.00 57.93 ? 37  GLU A OE2   1 
ATOM   220  N N     . VAL A 1 38  ? 7.632   32.787  47.289  1.00 45.35 ? 38  VAL A N     1 
ATOM   221  C CA    . VAL A 1 38  ? 8.747   32.431  46.430  1.00 44.05 ? 38  VAL A CA    1 
ATOM   222  C C     . VAL A 1 38  ? 8.976   33.498  45.362  1.00 44.94 ? 38  VAL A C     1 
ATOM   223  O O     . VAL A 1 38  ? 8.030   33.970  44.682  1.00 43.57 ? 38  VAL A O     1 
ATOM   224  C CB    . VAL A 1 38  ? 8.545   31.031  45.775  1.00 42.95 ? 38  VAL A CB    1 
ATOM   225  C CG1   . VAL A 1 38  ? 9.799   30.640  44.936  1.00 41.86 ? 38  VAL A CG1   1 
ATOM   226  C CG2   . VAL A 1 38  ? 8.289   29.995  46.850  1.00 40.15 ? 38  VAL A CG2   1 
ATOM   227  N N     . PHE A 1 39  ? 10.238  33.909  45.235  1.00 44.51 ? 39  PHE A N     1 
ATOM   228  C CA    . PHE A 1 39  ? 10.591  34.942  44.266  1.00 44.28 ? 39  PHE A CA    1 
ATOM   229  C C     . PHE A 1 39  ? 11.630  34.437  43.304  1.00 44.90 ? 39  PHE A C     1 
ATOM   230  O O     . PHE A 1 39  ? 12.354  33.464  43.605  1.00 42.95 ? 39  PHE A O     1 
ATOM   231  C CB    . PHE A 1 39  ? 11.213  36.157  44.940  1.00 45.59 ? 39  PHE A CB    1 
ATOM   232  C CG    . PHE A 1 39  ? 10.283  36.917  45.828  1.00 48.81 ? 39  PHE A CG    1 
ATOM   233  C CD1   . PHE A 1 39  ? 9.866   36.389  47.047  1.00 48.66 ? 39  PHE A CD1   1 
ATOM   234  C CD2   . PHE A 1 39  ? 9.789   38.158  45.427  1.00 48.63 ? 39  PHE A CD2   1 
ATOM   235  C CE1   . PHE A 1 39  ? 8.963   37.090  47.843  1.00 50.12 ? 39  PHE A CE1   1 
ATOM   236  C CE2   . PHE A 1 39  ? 8.890   38.857  46.217  1.00 48.59 ? 39  PHE A CE2   1 
ATOM   237  C CZ    . PHE A 1 39  ? 8.470   38.330  47.425  1.00 48.11 ? 39  PHE A CZ    1 
ATOM   238  N N     . LYS A 1 40  ? 11.677  35.114  42.147  1.00 43.93 ? 40  LYS A N     1 
ATOM   239  C CA    . LYS A 1 40  ? 12.675  34.867  41.147  1.00 41.54 ? 40  LYS A CA    1 
ATOM   240  C C     . LYS A 1 40  ? 13.627  35.998  41.452  1.00 40.17 ? 40  LYS A C     1 
ATOM   241  O O     . LYS A 1 40  ? 13.220  37.169  41.662  1.00 40.06 ? 40  LYS A O     1 
ATOM   242  C CB    . LYS A 1 40  ? 12.129  35.028  39.718  1.00 44.89 ? 40  LYS A CB    1 
ATOM   243  C CG    . LYS A 1 40  ? 13.194  34.877  38.614  1.00 44.22 ? 40  LYS A CG    1 
ATOM   244  C CD    . LYS A 1 40  ? 12.596  35.061  37.188  1.00 48.72 ? 40  LYS A CD    1 
ATOM   245  C CE    . LYS A 1 40  ? 13.633  34.806  36.075  1.00 48.94 ? 40  LYS A CE    1 
ATOM   246  N NZ    . LYS A 1 40  ? 13.005  34.647  34.680  1.00 51.78 ? 40  LYS A NZ    1 
ATOM   247  N N     . GLY A 1 41  ? 14.898  35.681  41.509  1.00 37.90 ? 41  GLY A N     1 
ATOM   248  C CA    . GLY A 1 41  ? 15.841  36.732  41.781  1.00 37.84 ? 41  GLY A CA    1 
ATOM   249  C C     . GLY A 1 41  ? 17.153  36.412  41.133  1.00 36.91 ? 41  GLY A C     1 
ATOM   250  O O     . GLY A 1 41  ? 17.258  35.394  40.417  1.00 35.70 ? 41  GLY A O     1 
ATOM   251  N N     . ILE A 1 42  ? 18.128  37.268  41.441  1.00 36.70 ? 42  ILE A N     1 
ATOM   252  C CA    . ILE A 1 42  ? 19.498  37.218  40.959  1.00 38.17 ? 42  ILE A CA    1 
ATOM   253  C C     . ILE A 1 42  ? 20.502  37.220  42.125  1.00 39.59 ? 42  ILE A C     1 
ATOM   254  O O     . ILE A 1 42  ? 20.372  38.013  43.073  1.00 40.20 ? 42  ILE A O     1 
ATOM   255  C CB    . ILE A 1 42  ? 19.891  38.519  40.166  1.00 40.57 ? 42  ILE A CB    1 
ATOM   256  C CG1   . ILE A 1 42  ? 18.987  38.753  38.965  1.00 41.20 ? 42  ILE A CG1   1 
ATOM   257  C CG2   . ILE A 1 42  ? 21.402  38.473  39.798  1.00 39.19 ? 42  ILE A CG2   1 
ATOM   258  C CD1   . ILE A 1 42  ? 19.299  37.865  37.766  1.00 43.23 ? 42  ILE A CD1   1 
ATOM   259  N N     . ASP A 1 43  ? 21.508  36.372  42.055  1.00 39.31 ? 43  ASP A N     1 
ATOM   260  C CA    . ASP A 1 43  ? 22.566  36.395  43.059  1.00 42.18 ? 43  ASP A CA    1 
ATOM   261  C C     . ASP A 1 43  ? 23.438  37.463  42.439  1.00 43.74 ? 43  ASP A C     1 
ATOM   262  O O     . ASP A 1 43  ? 24.040  37.213  41.391  1.00 43.51 ? 43  ASP A O     1 
ATOM   263  C CB    . ASP A 1 43  ? 23.353  35.082  43.080  1.00 42.76 ? 43  ASP A CB    1 
ATOM   264  C CG    . ASP A 1 43  ? 24.524  35.113  44.085  1.00 46.10 ? 43  ASP A CG    1 
ATOM   265  O OD1   . ASP A 1 43  ? 25.197  36.177  44.244  1.00 46.06 ? 43  ASP A OD1   1 
ATOM   266  O OD2   . ASP A 1 43  ? 24.773  34.057  44.714  1.00 47.35 ? 43  ASP A OD2   1 
ATOM   267  N N     . ASN A 1 44  ? 23.474  38.656  43.041  1.00 46.31 ? 44  ASN A N     1 
ATOM   268  C CA    . ASN A 1 44  ? 24.262  39.783  42.502  1.00 48.68 ? 44  ASN A CA    1 
ATOM   269  C C     . ASN A 1 44  ? 25.749  39.496  42.413  1.00 49.98 ? 44  ASN A C     1 
ATOM   270  O O     . ASN A 1 44  ? 26.444  40.047  41.601  1.00 51.84 ? 44  ASN A O     1 
ATOM   271  C CB    . ASN A 1 44  ? 24.133  41.036  43.358  1.00 45.68 ? 44  ASN A CB    1 
ATOM   272  C CG    . ASN A 1 44  ? 22.738  41.461  43.573  1.00 46.68 ? 44  ASN A CG    1 
ATOM   273  O OD1   . ASN A 1 44  ? 21.898  41.391  42.677  1.00 46.92 ? 44  ASN A OD1   1 
ATOM   274  N ND2   . ASN A 1 44  ? 22.457  41.945  44.794  1.00 47.19 ? 44  ASN A ND2   1 
ATOM   275  N N     . ARG A 1 45  ? 26.243  38.649  43.278  1.00 53.34 ? 45  ARG A N     1 
ATOM   276  C CA    . ARG A 1 45  ? 27.658  38.336  43.275  1.00 55.71 ? 45  ARG A CA    1 
ATOM   277  C C     . ARG A 1 45  ? 28.115  37.585  42.035  1.00 55.56 ? 45  ARG A C     1 
ATOM   278  O O     . ARG A 1 45  ? 29.234  37.815  41.544  1.00 55.54 ? 45  ARG A O     1 
ATOM   279  C CB    . ARG A 1 45  ? 27.988  37.518  44.526  1.00 59.51 ? 45  ARG A CB    1 
ATOM   280  C CG    . ARG A 1 45  ? 29.230  36.630  44.404  1.00 64.09 ? 45  ARG A CG    1 
ATOM   281  C CD    . ARG A 1 45  ? 29.028  35.263  45.084  1.00 66.64 ? 45  ARG A CD    1 
ATOM   282  N NE    . ARG A 1 45  ? 30.172  34.391  44.815  1.00 70.35 ? 45  ARG A NE    1 
ATOM   283  C CZ    . ARG A 1 45  ? 31.424  34.657  45.191  1.00 71.22 ? 45  ARG A CZ    1 
ATOM   284  N NH1   . ARG A 1 45  ? 31.699  35.770  45.870  1.00 71.12 ? 45  ARG A NH1   1 
ATOM   285  N NH2   . ARG A 1 45  ? 32.410  33.822  44.865  1.00 71.54 ? 45  ARG A NH2   1 
ATOM   286  N N     . THR A 1 46  ? 27.269  36.680  41.540  1.00 54.47 ? 46  THR A N     1 
ATOM   287  C CA    . THR A 1 46  ? 27.604  35.874  40.366  1.00 53.40 ? 46  THR A CA    1 
ATOM   288  C C     . THR A 1 46  ? 26.680  36.108  39.189  1.00 51.81 ? 46  THR A C     1 
ATOM   289  O O     . THR A 1 46  ? 26.846  35.471  38.161  1.00 50.28 ? 46  THR A O     1 
ATOM   290  C CB    . THR A 1 46  ? 27.565  34.339  40.645  1.00 52.49 ? 46  THR A CB    1 
ATOM   291  O OG1   . THR A 1 46  ? 26.329  33.983  41.298  1.00 52.78 ? 46  THR A OG1   1 
ATOM   292  C CG2   . THR A 1 46  ? 28.757  33.915  41.468  1.00 53.29 ? 46  THR A CG2   1 
ATOM   293  N N     . GLN A 1 47  ? 25.730  37.018  39.348  1.00 51.61 ? 47  GLN A N     1 
ATOM   294  C CA    . GLN A 1 47  ? 24.743  37.304  38.296  1.00 51.68 ? 47  GLN A CA    1 
ATOM   295  C C     . GLN A 1 47  ? 24.123  36.026  37.725  1.00 50.91 ? 47  GLN A C     1 
ATOM   296  O O     . GLN A 1 47  ? 24.066  35.820  36.517  1.00 49.78 ? 47  GLN A O     1 
ATOM   297  C CB    . GLN A 1 47  ? 25.365  38.147  37.167  1.00 53.53 ? 47  GLN A CB    1 
ATOM   298  C CG    . GLN A 1 47  ? 25.435  39.669  37.476  1.00 55.73 ? 47  GLN A CG    1 
ATOM   299  C CD    . GLN A 1 47  ? 24.071  40.382  37.330  1.00 57.22 ? 47  GLN A CD    1 
ATOM   300  O OE1   . GLN A 1 47  ? 23.775  41.317  38.069  1.00 58.32 ? 47  GLN A OE1   1 
ATOM   301  N NE2   . GLN A 1 47  ? 23.255  39.948  36.368  1.00 57.83 ? 47  GLN A NE2   1 
ATOM   302  N N     . LYS A 1 48  ? 23.699  35.143  38.619  1.00 50.92 ? 48  LYS A N     1 
ATOM   303  C CA    . LYS A 1 48  ? 23.021  33.919  38.205  1.00 50.21 ? 48  LYS A CA    1 
ATOM   304  C C     . LYS A 1 48  ? 21.626  33.948  38.786  1.00 47.03 ? 48  LYS A C     1 
ATOM   305  O O     . LYS A 1 48  ? 21.435  34.354  39.941  1.00 46.03 ? 48  LYS A O     1 
ATOM   306  C CB    . LYS A 1 48  ? 23.742  32.690  38.727  1.00 53.60 ? 48  LYS A CB    1 
ATOM   307  C CG    . LYS A 1 48  ? 23.009  31.397  38.364  1.00 58.87 ? 48  LYS A CG    1 
ATOM   308  C CD    . LYS A 1 48  ? 22.577  31.319  36.876  1.00 59.94 ? 48  LYS A CD    1 
ATOM   309  C CE    . LYS A 1 48  ? 22.658  29.867  36.361  1.00 60.94 ? 48  LYS A CE    1 
ATOM   310  N NZ    . LYS A 1 48  ? 21.652  28.963  37.004  1.00 62.02 ? 48  LYS A NZ    1 
ATOM   311  N N     . VAL A 1 49  ? 20.649  33.539  37.994  1.00 42.66 ? 49  VAL A N     1 
ATOM   312  C CA    . VAL A 1 49  ? 19.272  33.541  38.455  1.00 38.36 ? 49  VAL A CA    1 
ATOM   313  C C     . VAL A 1 49  ? 19.042  32.422  39.490  1.00 35.80 ? 49  VAL A C     1 
ATOM   314  O O     . VAL A 1 49  ? 19.570  31.336  39.388  1.00 32.56 ? 49  VAL A O     1 
ATOM   315  C CB    . VAL A 1 49  ? 18.357  33.343  37.269  1.00 40.38 ? 49  VAL A CB    1 
ATOM   316  C CG1   . VAL A 1 49  ? 16.872  33.508  37.667  1.00 40.64 ? 49  VAL A CG1   1 
ATOM   317  C CG2   . VAL A 1 49  ? 18.729  34.318  36.210  1.00 41.97 ? 49  VAL A CG2   1 
ATOM   318  N N     . VAL A 1 50  ? 18.240  32.706  40.498  1.00 35.61 ? 50  VAL A N     1 
ATOM   319  C CA    . VAL A 1 50  ? 17.924  31.736  41.531  1.00 33.06 ? 50  VAL A CA    1 
ATOM   320  C C     . VAL A 1 50  ? 16.454  31.884  41.908  1.00 32.96 ? 50  VAL A C     1 
ATOM   321  O O     . VAL A 1 50  ? 15.843  32.902  41.598  1.00 32.24 ? 50  VAL A O     1 
ATOM   322  C CB    . VAL A 1 50  ? 18.749  32.021  42.843  1.00 32.19 ? 50  VAL A CB    1 
ATOM   323  C CG1   . VAL A 1 50  ? 20.227  31.691  42.607  1.00 30.80 ? 50  VAL A CG1   1 
ATOM   324  C CG2   . VAL A 1 50  ? 18.582  33.491  43.293  1.00 32.69 ? 50  VAL A CG2   1 
ATOM   325  N N     . ALA A 1 51  ? 15.921  30.895  42.634  1.00 34.43 ? 51  ALA A N     1 
ATOM   326  C CA    . ALA A 1 51  ? 14.543  30.973  43.183  1.00 33.71 ? 51  ALA A CA    1 
ATOM   327  C C     . ALA A 1 51  ? 14.838  31.325  44.633  1.00 34.76 ? 51  ALA A C     1 
ATOM   328  O O     . ALA A 1 51  ? 15.802  30.793  45.225  1.00 33.01 ? 51  ALA A O     1 
ATOM   329  C CB    . ALA A 1 51  ? 13.873  29.652  43.138  1.00 35.31 ? 51  ALA A CB    1 
ATOM   330  N N     . ILE A 1 52  ? 14.078  32.266  45.190  1.00 35.62 ? 52  ILE A N     1 
ATOM   331  C CA    . ILE A 1 52  ? 14.268  32.686  46.575  1.00 36.17 ? 52  ILE A CA    1 
ATOM   332  C C     . ILE A 1 52  ? 12.987  32.442  47.373  1.00 37.97 ? 52  ILE A C     1 
ATOM   333  O O     . ILE A 1 52  ? 11.915  33.052  47.087  1.00 38.13 ? 52  ILE A O     1 
ATOM   334  C CB    . ILE A 1 52  ? 14.619  34.187  46.693  1.00 36.80 ? 52  ILE A CB    1 
ATOM   335  C CG1   . ILE A 1 52  ? 15.882  34.499  45.924  1.00 35.46 ? 52  ILE A CG1   1 
ATOM   336  C CG2   . ILE A 1 52  ? 14.787  34.596  48.217  1.00 38.71 ? 52  ILE A CG2   1 
ATOM   337  C CD1   . ILE A 1 52  ? 16.160  35.974  45.827  1.00 34.52 ? 52  ILE A CD1   1 
ATOM   338  N N     . LYS A 1 53  ? 13.090  31.566  48.362  1.00 36.59 ? 53  LYS A N     1 
ATOM   339  C CA    . LYS A 1 53  ? 11.939  31.252  49.204  1.00 38.64 ? 53  LYS A CA    1 
ATOM   340  C C     . LYS A 1 53  ? 12.167  31.959  50.537  1.00 39.39 ? 53  LYS A C     1 
ATOM   341  O O     . LYS A 1 53  ? 13.194  31.734  51.175  1.00 37.60 ? 53  LYS A O     1 
ATOM   342  C CB    . LYS A 1 53  ? 11.862  29.737  49.388  1.00 39.62 ? 53  LYS A CB    1 
ATOM   343  C CG    . LYS A 1 53  ? 10.703  29.210  50.212  1.00 44.77 ? 53  LYS A CG    1 
ATOM   344  C CD    . LYS A 1 53  ? 10.626  27.673  50.084  1.00 47.84 ? 53  LYS A CD    1 
ATOM   345  C CE    . LYS A 1 53  ? 9.522   27.131  50.993  1.00 51.67 ? 53  LYS A CE    1 
ATOM   346  N NZ    . LYS A 1 53  ? 9.332   25.646  50.856  1.00 53.32 ? 53  LYS A NZ    1 
ATOM   347  N N     . ILE A 1 54  ? 11.214  32.807  50.941  1.00 38.67 ? 54  ILE A N     1 
ATOM   348  C CA    . ILE A 1 54  ? 11.309  33.583  52.173  1.00 39.91 ? 54  ILE A CA    1 
ATOM   349  C C     . ILE A 1 54  ? 10.252  33.135  53.168  1.00 41.66 ? 54  ILE A C     1 
ATOM   350  O O     . ILE A 1 54  ? 9.083   33.101  52.846  1.00 39.78 ? 54  ILE A O     1 
ATOM   351  C CB    . ILE A 1 54  ? 11.119  35.069  51.894  1.00 38.28 ? 54  ILE A CB    1 
ATOM   352  C CG1   . ILE A 1 54  ? 12.148  35.519  50.855  1.00 40.36 ? 54  ILE A CG1   1 
ATOM   353  C CG2   . ILE A 1 54  ? 11.205  35.853  53.172  1.00 40.60 ? 54  ILE A CG2   1 
ATOM   354  C CD1   . ILE A 1 54  ? 12.308  37.041  50.691  1.00 39.29 ? 54  ILE A CD1   1 
ATOM   355  N N     . ILE A 1 55  ? 10.667  32.756  54.369  1.00 42.68 ? 55  ILE A N     1 
ATOM   356  C CA    . ILE A 1 55  ? 9.690   32.281  55.361  1.00 45.73 ? 55  ILE A CA    1 
ATOM   357  C C     . ILE A 1 55  ? 9.883   33.094  56.617  1.00 45.88 ? 55  ILE A C     1 
ATOM   358  O O     . ILE A 1 55  ? 10.999  33.451  56.952  1.00 43.35 ? 55  ILE A O     1 
ATOM   359  C CB    . ILE A 1 55  ? 9.894   30.746  55.616  1.00 47.41 ? 55  ILE A CB    1 
ATOM   360  C CG1   . ILE A 1 55  ? 9.909   30.033  54.253  1.00 48.60 ? 55  ILE A CG1   1 
ATOM   361  C CG2   . ILE A 1 55  ? 8.766   30.166  56.527  1.00 48.69 ? 55  ILE A CG2   1 
ATOM   362  C CD1   . ILE A 1 55  ? 9.833   28.490  54.304  1.00 50.42 ? 55  ILE A CD1   1 
ATOM   363  N N     . ASP A 1 56  ? 8.787   33.471  57.275  1.00 49.11 ? 56  ASP A N     1 
ATOM   364  C CA    . ASP A 1 56  ? 8.942   34.245  58.501  1.00 51.19 ? 56  ASP A CA    1 
ATOM   365  C C     . ASP A 1 56  ? 9.064   33.267  59.659  1.00 52.11 ? 56  ASP A C     1 
ATOM   366  O O     . ASP A 1 56  ? 8.126   32.543  59.934  1.00 50.97 ? 56  ASP A O     1 
ATOM   367  C CB    . ASP A 1 56  ? 7.760   35.179  58.763  1.00 53.08 ? 56  ASP A CB    1 
ATOM   368  C CG    . ASP A 1 56  ? 8.116   36.257  59.767  1.00 53.90 ? 56  ASP A CG    1 
ATOM   369  O OD1   . ASP A 1 56  ? 8.730   35.931  60.799  1.00 56.24 ? 56  ASP A OD1   1 
ATOM   370  O OD2   . ASP A 1 56  ? 7.815   37.437  59.535  1.00 57.19 ? 56  ASP A OD2   1 
ATOM   371  N N     . LEU A 1 57  ? 10.221  33.262  60.322  1.00 54.17 ? 57  LEU A N     1 
ATOM   372  C CA    . LEU A 1 57  ? 10.471  32.333  61.432  1.00 57.31 ? 57  LEU A CA    1 
ATOM   373  C C     . LEU A 1 57  ? 9.641   32.606  62.680  1.00 60.20 ? 57  LEU A C     1 
ATOM   374  O O     . LEU A 1 57  ? 9.483   31.713  63.522  1.00 60.47 ? 57  LEU A O     1 
ATOM   375  C CB    . LEU A 1 57  ? 11.943  32.354  61.808  1.00 56.35 ? 57  LEU A CB    1 
ATOM   376  C CG    . LEU A 1 57  ? 12.956  31.921  60.745  1.00 56.04 ? 57  LEU A CG    1 
ATOM   377  C CD1   . LEU A 1 57  ? 14.342  32.323  61.210  1.00 56.36 ? 57  LEU A CD1   1 
ATOM   378  C CD2   . LEU A 1 57  ? 12.879  30.427  60.504  1.00 54.87 ? 57  LEU A CD2   1 
ATOM   379  N N     . GLU A 1 58  ? 9.152   33.842  62.804  1.00 62.69 ? 58  GLU A N     1 
ATOM   380  C CA    . GLU A 1 58  ? 8.316   34.265  63.935  1.00 66.44 ? 58  GLU A CA    1 
ATOM   381  C C     . GLU A 1 58  ? 6.899   33.790  63.630  1.00 67.97 ? 58  GLU A C     1 
ATOM   382  O O     . GLU A 1 58  ? 6.282   33.121  64.437  1.00 68.14 ? 58  GLU A O     1 
ATOM   383  C CB    . GLU A 1 58  ? 8.329   35.802  64.071  1.00 67.11 ? 58  GLU A CB    1 
ATOM   384  C CG    . GLU A 1 58  ? 8.229   36.370  65.497  1.00 68.10 ? 58  GLU A CG    1 
ATOM   385  C CD    . GLU A 1 58  ? 8.469   37.886  65.527  1.00 69.89 ? 58  GLU A CD    1 
ATOM   386  O OE1   . GLU A 1 58  ? 9.179   38.378  66.438  1.00 69.97 ? 58  GLU A OE1   1 
ATOM   387  O OE2   . GLU A 1 58  ? 7.946   38.596  64.634  1.00 70.32 ? 58  GLU A OE2   1 
ATOM   388  N N     . GLU A 1 59  ? 6.412   34.105  62.435  1.00 70.48 ? 59  GLU A N     1 
ATOM   389  C CA    . GLU A 1 59  ? 5.058   33.731  62.022  1.00 73.19 ? 59  GLU A CA    1 
ATOM   390  C C     . GLU A 1 59  ? 4.790   32.249  61.803  1.00 73.84 ? 59  GLU A C     1 
ATOM   391  O O     . GLU A 1 59  ? 3.742   31.885  61.268  1.00 74.41 ? 59  GLU A O     1 
ATOM   392  C CB    . GLU A 1 59  ? 4.662   34.474  60.743  1.00 75.00 ? 59  GLU A CB    1 
ATOM   393  C CG    . GLU A 1 59  ? 4.745   35.990  60.829  1.00 77.64 ? 59  GLU A CG    1 
ATOM   394  C CD    . GLU A 1 59  ? 4.280   36.669  59.550  1.00 78.55 ? 59  GLU A CD    1 
ATOM   395  O OE1   . GLU A 1 59  ? 4.792   36.323  58.461  1.00 79.26 ? 59  GLU A OE1   1 
ATOM   396  O OE2   . GLU A 1 59  ? 3.402   37.556  59.638  1.00 79.28 ? 59  GLU A OE2   1 
ATOM   397  N N     . ALA A 1 60  ? 5.719   31.387  62.181  1.00 74.67 ? 60  ALA A N     1 
ATOM   398  C CA    . ALA A 1 60  ? 5.489   29.957  61.994  1.00 75.67 ? 60  ALA A CA    1 
ATOM   399  C C     . ALA A 1 60  ? 6.131   29.138  63.111  1.00 75.99 ? 60  ALA A C     1 
ATOM   400  O O     . ALA A 1 60  ? 6.926   29.660  63.896  1.00 75.41 ? 60  ALA A O     1 
ATOM   401  C CB    . ALA A 1 60  ? 6.004   29.498  60.627  1.00 75.24 ? 60  ALA A CB    1 
ATOM   402  N N     . GLU A 1 61  ? 5.781   27.855  63.169  1.00 76.12 ? 61  GLU A N     1 
ATOM   403  C CA    . GLU A 1 61  ? 6.298   26.992  64.211  1.00 76.40 ? 61  GLU A CA    1 
ATOM   404  C C     . GLU A 1 61  ? 6.533   25.570  63.759  1.00 75.95 ? 61  GLU A C     1 
ATOM   405  O O     . GLU A 1 61  ? 7.643   25.185  63.419  1.00 76.64 ? 61  GLU A O     1 
ATOM   406  C CB    . GLU A 1 61  ? 5.314   26.960  65.371  1.00 77.81 ? 61  GLU A CB    1 
ATOM   407  C CG    . GLU A 1 61  ? 5.813   27.573  66.650  1.00 79.49 ? 61  GLU A CG    1 
ATOM   408  C CD    . GLU A 1 61  ? 5.125   26.982  67.845  1.00 80.34 ? 61  GLU A CD    1 
ATOM   409  O OE1   . GLU A 1 61  ? 3.890   26.808  67.775  1.00 81.54 ? 61  GLU A OE1   1 
ATOM   410  O OE2   . GLU A 1 61  ? 5.817   26.690  68.846  1.00 81.18 ? 61  GLU A OE2   1 
ATOM   411  N N     . ASP A 1 62  ? 5.477   24.771  63.784  1.00 75.35 ? 62  ASP A N     1 
ATOM   412  C CA    . ASP A 1 62  ? 5.587   23.378  63.386  1.00 74.38 ? 62  ASP A CA    1 
ATOM   413  C C     . ASP A 1 62  ? 5.974   23.212  61.910  1.00 72.17 ? 62  ASP A C     1 
ATOM   414  O O     . ASP A 1 62  ? 6.293   22.112  61.458  1.00 73.16 ? 62  ASP A O     1 
ATOM   415  C CB    . ASP A 1 62  ? 4.275   22.647  63.716  1.00 76.93 ? 62  ASP A CB    1 
ATOM   416  C CG    . ASP A 1 62  ? 4.082   22.442  65.226  1.00 78.86 ? 62  ASP A CG    1 
ATOM   417  O OD1   . ASP A 1 62  ? 2.929   22.194  65.659  1.00 80.58 ? 62  ASP A OD1   1 
ATOM   418  O OD2   . ASP A 1 62  ? 5.083   22.522  65.986  1.00 79.90 ? 62  ASP A OD2   1 
ATOM   419  N N     . GLU A 1 63  ? 5.972   24.308  61.159  1.00 68.68 ? 63  GLU A N     1 
ATOM   420  C CA    . GLU A 1 63  ? 6.363   24.257  59.757  1.00 64.64 ? 63  GLU A CA    1 
ATOM   421  C C     . GLU A 1 63  ? 7.897   24.379  59.660  1.00 61.64 ? 63  GLU A C     1 
ATOM   422  O O     . GLU A 1 63  ? 8.485   24.188  58.592  1.00 59.90 ? 63  GLU A O     1 
ATOM   423  C CB    . GLU A 1 63  ? 5.701   25.401  58.982  1.00 66.65 ? 63  GLU A CB    1 
ATOM   424  C CG    . GLU A 1 63  ? 4.177   25.494  59.150  1.00 69.36 ? 63  GLU A CG    1 
ATOM   425  C CD    . GLU A 1 63  ? 3.750   25.875  60.580  1.00 71.43 ? 63  GLU A CD    1 
ATOM   426  O OE1   . GLU A 1 63  ? 4.174   26.952  61.072  1.00 73.55 ? 63  GLU A OE1   1 
ATOM   427  O OE2   . GLU A 1 63  ? 2.996   25.097  61.215  1.00 71.71 ? 63  GLU A OE2   1 
ATOM   428  N N     . ILE A 1 64  ? 8.549   24.677  60.782  1.00 57.30 ? 64  ILE A N     1 
ATOM   429  C CA    . ILE A 1 64  ? 9.995   24.829  60.772  1.00 54.11 ? 64  ILE A CA    1 
ATOM   430  C C     . ILE A 1 64  ? 10.655  23.475  60.668  1.00 51.39 ? 64  ILE A C     1 
ATOM   431  O O     . ILE A 1 64  ? 11.632  23.356  59.979  1.00 49.84 ? 64  ILE A O     1 
ATOM   432  C CB    . ILE A 1 64  ? 10.507  25.634  62.026  1.00 53.27 ? 64  ILE A CB    1 
ATOM   433  C CG1   . ILE A 1 64  ? 9.870   27.022  62.015  1.00 52.88 ? 64  ILE A CG1   1 
ATOM   434  C CG2   . ILE A 1 64  ? 12.014  25.814  61.963  1.00 52.73 ? 64  ILE A CG2   1 
ATOM   435  C CD1   . ILE A 1 64  ? 10.382  27.955  63.110  1.00 54.20 ? 64  ILE A CD1   1 
ATOM   436  N N     . GLU A 1 65  ? 10.107  22.457  61.321  1.00 51.37 ? 65  GLU A N     1 
ATOM   437  C CA    . GLU A 1 65  ? 10.665  21.099  61.233  1.00 53.73 ? 65  GLU A CA    1 
ATOM   438  C C     . GLU A 1 65  ? 10.777  20.659  59.752  1.00 52.20 ? 65  GLU A C     1 
ATOM   439  O O     . GLU A 1 65  ? 11.790  20.125  59.304  1.00 51.19 ? 65  GLU A O     1 
ATOM   440  C CB    . GLU A 1 65  ? 9.757   20.067  61.930  1.00 56.35 ? 65  GLU A CB    1 
ATOM   441  C CG    . GLU A 1 65  ? 9.623   20.176  63.435  1.00 62.19 ? 65  GLU A CG    1 
ATOM   442  C CD    . GLU A 1 65  ? 10.954  19.946  64.155  1.00 65.13 ? 65  GLU A CD    1 
ATOM   443  O OE1   . GLU A 1 65  ? 12.005  19.801  63.449  1.00 66.18 ? 65  GLU A OE1   1 
ATOM   444  O OE2   . GLU A 1 65  ? 10.929  19.911  65.420  1.00 65.84 ? 65  GLU A OE2   1 
ATOM   445  N N     . ASP A 1 66  ? 9.707   20.898  59.009  1.00 50.91 ? 66  ASP A N     1 
ATOM   446  C CA    . ASP A 1 66  ? 9.639   20.484  57.625  1.00 49.99 ? 66  ASP A CA    1 
ATOM   447  C C     . ASP A 1 66  ? 10.585  21.222  56.743  1.00 47.38 ? 66  ASP A C     1 
ATOM   448  O O     . ASP A 1 66  ? 11.122  20.657  55.792  1.00 45.08 ? 66  ASP A O     1 
ATOM   449  C CB    . ASP A 1 66  ? 8.221   20.660  57.108  1.00 53.95 ? 66  ASP A CB    1 
ATOM   450  C CG    . ASP A 1 66  ? 7.189   20.047  58.058  1.00 59.62 ? 66  ASP A CG    1 
ATOM   451  O OD1   . ASP A 1 66  ? 7.467   18.943  58.597  1.00 60.37 ? 66  ASP A OD1   1 
ATOM   452  O OD2   . ASP A 1 66  ? 6.105   20.671  58.268  1.00 63.58 ? 66  ASP A OD2   1 
ATOM   453  N N     . ILE A 1 67  ? 10.738  22.503  57.036  1.00 44.06 ? 67  ILE A N     1 
ATOM   454  C CA    . ILE A 1 67  ? 11.622  23.354  56.280  1.00 43.87 ? 67  ILE A CA    1 
ATOM   455  C C     . ILE A 1 67  ? 13.038  22.869  56.491  1.00 42.76 ? 67  ILE A C     1 
ATOM   456  O O     . ILE A 1 67  ? 13.775  22.652  55.530  1.00 43.04 ? 67  ILE A O     1 
ATOM   457  C CB    . ILE A 1 67  ? 11.511  24.829  56.770  1.00 46.11 ? 67  ILE A CB    1 
ATOM   458  C CG1   . ILE A 1 67  ? 10.142  25.401  56.369  1.00 47.29 ? 67  ILE A CG1   1 
ATOM   459  C CG2   . ILE A 1 67  ? 12.652  25.683  56.222  1.00 45.09 ? 67  ILE A CG2   1 
ATOM   460  C CD1   . ILE A 1 67  ? 9.768   26.710  57.167  1.00 49.43 ? 67  ILE A CD1   1 
ATOM   461  N N     . GLN A 1 68  ? 13.401  22.659  57.749  1.00 41.95 ? 68  GLN A N     1 
ATOM   462  C CA    . GLN A 1 68  ? 14.736  22.239  58.083  1.00 41.36 ? 68  GLN A CA    1 
ATOM   463  C C     . GLN A 1 68  ? 15.023  20.910  57.468  1.00 40.82 ? 68  GLN A C     1 
ATOM   464  O O     . GLN A 1 68  ? 16.128  20.672  56.962  1.00 36.92 ? 68  GLN A O     1 
ATOM   465  C CB    . GLN A 1 68  ? 14.883  22.147  59.593  1.00 44.17 ? 68  GLN A CB    1 
ATOM   466  C CG    . GLN A 1 68  ? 15.917  21.139  60.036  1.00 48.71 ? 68  GLN A CG    1 
ATOM   467  C CD    . GLN A 1 68  ? 17.076  21.796  60.706  1.00 51.84 ? 68  GLN A CD    1 
ATOM   468  O OE1   . GLN A 1 68  ? 16.888  22.634  61.575  1.00 53.41 ? 68  GLN A OE1   1 
ATOM   469  N NE2   . GLN A 1 68  ? 18.296  21.423  60.309  1.00 54.70 ? 68  GLN A NE2   1 
ATOM   470  N N     . GLN A 1 69  ? 14.035  20.026  57.529  1.00 40.15 ? 69  GLN A N     1 
ATOM   471  C CA    . GLN A 1 69  ? 14.204  18.685  56.945  1.00 41.78 ? 69  GLN A CA    1 
ATOM   472  C C     . GLN A 1 69  ? 14.418  18.768  55.444  1.00 41.09 ? 69  GLN A C     1 
ATOM   473  O O     . GLN A 1 69  ? 15.315  18.090  54.898  1.00 40.04 ? 69  GLN A O     1 
ATOM   474  C CB    . GLN A 1 69  ? 12.970  17.805  57.194  1.00 42.80 ? 69  GLN A CB    1 
ATOM   475  C CG    . GLN A 1 69  ? 13.202  16.349  56.870  1.00 45.31 ? 69  GLN A CG    1 
ATOM   476  C CD    . GLN A 1 69  ? 14.364  15.792  57.713  1.00 48.06 ? 69  GLN A CD    1 
ATOM   477  O OE1   . GLN A 1 69  ? 15.537  15.823  57.311  1.00 48.12 ? 69  GLN A OE1   1 
ATOM   478  N NE2   . GLN A 1 69  ? 14.027  15.308  58.906  1.00 48.95 ? 69  GLN A NE2   1 
ATOM   479  N N     . GLU A 1 70  ? 13.593  19.582  54.773  1.00 42.82 ? 70  GLU A N     1 
ATOM   480  C CA    . GLU A 1 70  ? 13.698  19.699  53.322  1.00 44.35 ? 70  GLU A CA    1 
ATOM   481  C C     . GLU A 1 70  ? 15.057  20.205  52.962  1.00 43.54 ? 70  GLU A C     1 
ATOM   482  O O     . GLU A 1 70  ? 15.661  19.710  52.031  1.00 44.47 ? 70  GLU A O     1 
ATOM   483  C CB    . GLU A 1 70  ? 12.638  20.624  52.686  1.00 46.36 ? 70  GLU A CB    1 
ATOM   484  C CG    . GLU A 1 70  ? 12.639  20.464  51.120  1.00 52.19 ? 70  GLU A CG    1 
ATOM   485  C CD    . GLU A 1 70  ? 11.516  21.213  50.357  1.00 54.50 ? 70  GLU A CD    1 
ATOM   486  O OE1   . GLU A 1 70  ? 10.345  21.269  50.851  1.00 58.08 ? 70  GLU A OE1   1 
ATOM   487  O OE2   . GLU A 1 70  ? 11.798  21.715  49.244  1.00 53.28 ? 70  GLU A OE2   1 
ATOM   488  N N     . ILE A 1 71  ? 15.560  21.189  53.692  1.00 43.15 ? 71  ILE A N     1 
ATOM   489  C CA    . ILE A 1 71  ? 16.881  21.681  53.373  1.00 43.21 ? 71  ILE A CA    1 
ATOM   490  C C     . ILE A 1 71  ? 17.976  20.677  53.723  1.00 41.37 ? 71  ILE A C     1 
ATOM   491  O O     . ILE A 1 71  ? 18.998  20.603  53.058  1.00 41.66 ? 71  ILE A O     1 
ATOM   492  C CB    . ILE A 1 71  ? 17.179  23.008  54.080  1.00 45.73 ? 71  ILE A CB    1 
ATOM   493  C CG1   . ILE A 1 71  ? 16.157  24.063  53.687  1.00 47.25 ? 71  ILE A CG1   1 
ATOM   494  C CG2   . ILE A 1 71  ? 18.540  23.536  53.620  1.00 46.23 ? 71  ILE A CG2   1 
ATOM   495  C CD1   . ILE A 1 71  ? 16.276  25.343  54.515  1.00 50.33 ? 71  ILE A CD1   1 
ATOM   496  N N     . THR A 1 72  ? 17.799  19.890  54.767  1.00 40.65 ? 72  THR A N     1 
ATOM   497  C CA    . THR A 1 72  ? 18.880  18.954  55.073  1.00 39.09 ? 72  THR A CA    1 
ATOM   498  C C     . THR A 1 72  ? 19.045  17.946  53.962  1.00 38.57 ? 72  THR A C     1 
ATOM   499  O O     . THR A 1 72  ? 20.191  17.706  53.481  1.00 37.07 ? 72  THR A O     1 
ATOM   500  C CB    . THR A 1 72  ? 18.646  18.287  56.399  1.00 39.33 ? 72  THR A CB    1 
ATOM   501  O OG1   . THR A 1 72  ? 18.639  19.315  57.384  1.00 39.90 ? 72  THR A OG1   1 
ATOM   502  C CG2   . THR A 1 72  ? 19.766  17.327  56.739  1.00 39.44 ? 72  THR A CG2   1 
ATOM   503  N N     . VAL A 1 73  ? 17.914  17.414  53.486  1.00 36.66 ? 73  VAL A N     1 
ATOM   504  C CA    . VAL A 1 73  ? 17.968  16.427  52.423  1.00 36.65 ? 73  VAL A CA    1 
ATOM   505  C C     . VAL A 1 73  ? 18.492  17.056  51.131  1.00 36.46 ? 73  VAL A C     1 
ATOM   506  O O     . VAL A 1 73  ? 19.378  16.508  50.499  1.00 34.86 ? 73  VAL A O     1 
ATOM   507  C CB    . VAL A 1 73  ? 16.581  15.764  52.199  1.00 35.54 ? 73  VAL A CB    1 
ATOM   508  C CG1   . VAL A 1 73  ? 16.627  14.852  51.011  1.00 38.08 ? 73  VAL A CG1   1 
ATOM   509  C CG2   . VAL A 1 73  ? 16.202  15.000  53.422  1.00 36.73 ? 73  VAL A CG2   1 
ATOM   510  N N     . LEU A 1 74  ? 17.981  18.218  50.738  1.00 37.30 ? 74  LEU A N     1 
ATOM   511  C CA    . LEU A 1 74  ? 18.476  18.837  49.507  1.00 38.19 ? 74  LEU A CA    1 
ATOM   512  C C     . LEU A 1 74  ? 19.993  19.124  49.558  1.00 37.48 ? 74  LEU A C     1 
ATOM   513  O O     . LEU A 1 74  ? 20.652  19.077  48.544  1.00 38.03 ? 74  LEU A O     1 
ATOM   514  C CB    . LEU A 1 74  ? 17.760  20.166  49.165  1.00 39.22 ? 74  LEU A CB    1 
ATOM   515  C CG    . LEU A 1 74  ? 16.370  20.172  48.497  1.00 42.03 ? 74  LEU A CG    1 
ATOM   516  C CD1   . LEU A 1 74  ? 16.129  21.548  47.877  1.00 41.60 ? 74  LEU A CD1   1 
ATOM   517  C CD2   . LEU A 1 74  ? 16.297  19.142  47.406  1.00 41.09 ? 74  LEU A CD2   1 
ATOM   518  N N     . SER A 1 75  ? 20.542  19.435  50.715  1.00 37.01 ? 75  SER A N     1 
ATOM   519  C CA    . SER A 1 75  ? 21.985  19.715  50.749  1.00 38.48 ? 75  SER A CA    1 
ATOM   520  C C     . SER A 1 75  ? 22.796  18.401  50.576  1.00 39.73 ? 75  SER A C     1 
ATOM   521  O O     . SER A 1 75  ? 23.994  18.449  50.279  1.00 40.91 ? 75  SER A O     1 
ATOM   522  C CB    . SER A 1 75  ? 22.355  20.379  52.055  1.00 35.94 ? 75  SER A CB    1 
ATOM   523  O OG    . SER A 1 75  ? 22.109  19.510  53.149  1.00 37.85 ? 75  SER A OG    1 
ATOM   524  N N     . GLN A 1 76  ? 22.154  17.245  50.754  1.00 39.07 ? 76  GLN A N     1 
ATOM   525  C CA    . GLN A 1 76  ? 22.881  15.966  50.568  1.00 40.82 ? 76  GLN A CA    1 
ATOM   526  C C     . GLN A 1 76  ? 22.723  15.353  49.197  1.00 39.26 ? 76  GLN A C     1 
ATOM   527  O O     . GLN A 1 76  ? 23.289  14.285  48.920  1.00 38.85 ? 76  GLN A O     1 
ATOM   528  C CB    . GLN A 1 76  ? 22.472  14.937  51.611  1.00 41.56 ? 76  GLN A CB    1 
ATOM   529  C CG    . GLN A 1 76  ? 22.726  15.390  53.015  1.00 44.25 ? 76  GLN A CG    1 
ATOM   530  C CD    . GLN A 1 76  ? 22.020  14.498  53.982  1.00 49.11 ? 76  GLN A CD    1 
ATOM   531  O OE1   . GLN A 1 76  ? 21.030  13.829  53.620  1.00 52.31 ? 76  GLN A OE1   1 
ATOM   532  N NE2   . GLN A 1 76  ? 22.485  14.480  55.225  1.00 50.56 ? 76  GLN A NE2   1 
ATOM   533  N N     . CYS A 1 77  ? 21.960  16.020  48.335  1.00 38.71 ? 77  CYS A N     1 
ATOM   534  C CA    . CYS A 1 77  ? 21.749  15.529  46.985  1.00 38.84 ? 77  CYS A CA    1 
ATOM   535  C C     . CYS A 1 77  ? 22.581  16.287  45.946  1.00 39.93 ? 77  CYS A C     1 
ATOM   536  O O     . CYS A 1 77  ? 22.699  17.515  45.995  1.00 41.60 ? 77  CYS A O     1 
ATOM   537  C CB    . CYS A 1 77  ? 20.274  15.667  46.577  1.00 38.93 ? 77  CYS A CB    1 
ATOM   538  S SG    . CYS A 1 77  ? 19.180  14.642  47.525  1.00 38.77 ? 77  CYS A SG    1 
ATOM   539  N N     . ASP A 1 78  ? 23.151  15.579  44.995  1.00 37.86 ? 78  ASP A N     1 
ATOM   540  C CA    . ASP A 1 78  ? 23.869  16.292  43.950  1.00 40.22 ? 78  ASP A CA    1 
ATOM   541  C C     . ASP A 1 78  ? 23.483  15.583  42.657  1.00 38.61 ? 78  ASP A C     1 
ATOM   542  O O     . ASP A 1 78  ? 24.120  14.652  42.266  1.00 40.34 ? 78  ASP A O     1 
ATOM   543  C CB    . ASP A 1 78  ? 25.389  16.237  44.170  1.00 41.10 ? 78  ASP A CB    1 
ATOM   544  C CG    . ASP A 1 78  ? 26.159  16.789  42.998  1.00 42.61 ? 78  ASP A CG    1 
ATOM   545  O OD1   . ASP A 1 78  ? 25.683  17.721  42.351  1.00 44.18 ? 78  ASP A OD1   1 
ATOM   546  O OD2   . ASP A 1 78  ? 27.265  16.295  42.715  1.00 48.45 ? 78  ASP A OD2   1 
ATOM   547  N N     . SER A 1 79  ? 22.456  16.078  41.974  1.00 38.42 ? 79  SER A N     1 
ATOM   548  C CA    . SER A 1 79  ? 21.960  15.423  40.793  1.00 36.69 ? 79  SER A CA    1 
ATOM   549  C C     . SER A 1 79  ? 21.224  16.415  39.933  1.00 35.61 ? 79  SER A C     1 
ATOM   550  O O     . SER A 1 79  ? 20.571  17.319  40.442  1.00 37.65 ? 79  SER A O     1 
ATOM   551  C CB    . SER A 1 79  ? 21.028  14.270  41.251  1.00 37.02 ? 79  SER A CB    1 
ATOM   552  O OG    . SER A 1 79  ? 20.284  13.725  40.161  1.00 35.24 ? 79  SER A OG    1 
ATOM   553  N N     . PRO A 1 80  ? 21.359  16.319  38.603  1.00 36.13 ? 80  PRO A N     1 
ATOM   554  C CA    . PRO A 1 80  ? 20.613  17.286  37.803  1.00 33.97 ? 80  PRO A CA    1 
ATOM   555  C C     . PRO A 1 80  ? 19.099  16.934  37.822  1.00 35.33 ? 80  PRO A C     1 
ATOM   556  O O     . PRO A 1 80  ? 18.308  17.637  37.224  1.00 37.96 ? 80  PRO A O     1 
ATOM   557  C CB    . PRO A 1 80  ? 21.224  17.136  36.436  1.00 36.53 ? 80  PRO A CB    1 
ATOM   558  C CG    . PRO A 1 80  ? 21.615  15.671  36.402  1.00 34.22 ? 80  PRO A CG    1 
ATOM   559  C CD    . PRO A 1 80  ? 22.216  15.467  37.749  1.00 36.07 ? 80  PRO A CD    1 
ATOM   560  N N     . TYR A 1 81  ? 18.718  15.868  38.513  1.00 34.64 ? 81  TYR A N     1 
ATOM   561  C CA    . TYR A 1 81  ? 17.304  15.472  38.635  1.00 35.73 ? 81  TYR A CA    1 
ATOM   562  C C     . TYR A 1 81  ? 16.638  16.015  39.914  1.00 37.03 ? 81  TYR A C     1 
ATOM   563  O O     . TYR A 1 81  ? 15.419  15.892  40.093  1.00 36.63 ? 81  TYR A O     1 
ATOM   564  C CB    . TYR A 1 81  ? 17.199  13.931  38.596  1.00 37.04 ? 81  TYR A CB    1 
ATOM   565  C CG    . TYR A 1 81  ? 17.705  13.391  37.271  1.00 36.19 ? 81  TYR A CG    1 
ATOM   566  C CD1   . TYR A 1 81  ? 17.131  13.826  36.098  1.00 34.30 ? 81  TYR A CD1   1 
ATOM   567  C CD2   . TYR A 1 81  ? 18.877  12.617  37.192  1.00 37.05 ? 81  TYR A CD2   1 
ATOM   568  C CE1   . TYR A 1 81  ? 17.696  13.542  34.865  1.00 36.99 ? 81  TYR A CE1   1 
ATOM   569  C CE2   . TYR A 1 81  ? 19.469  12.316  35.948  1.00 37.08 ? 81  TYR A CE2   1 
ATOM   570  C CZ    . TYR A 1 81  ? 18.861  12.789  34.787  1.00 37.89 ? 81  TYR A CZ    1 
ATOM   571  O OH    . TYR A 1 81  ? 19.327  12.492  33.532  1.00 38.25 ? 81  TYR A OH    1 
ATOM   572  N N     . VAL A 1 82  ? 17.455  16.590  40.812  1.00 36.18 ? 82  VAL A N     1 
ATOM   573  C CA    . VAL A 1 82  ? 16.988  17.129  42.083  1.00 35.98 ? 82  VAL A CA    1 
ATOM   574  C C     . VAL A 1 82  ? 17.315  18.609  42.198  1.00 37.47 ? 82  VAL A C     1 
ATOM   575  O O     . VAL A 1 82  ? 18.462  19.020  41.975  1.00 37.15 ? 82  VAL A O     1 
ATOM   576  C CB    . VAL A 1 82  ? 17.609  16.375  43.276  1.00 37.35 ? 82  VAL A CB    1 
ATOM   577  C CG1   . VAL A 1 82  ? 17.141  16.975  44.621  1.00 35.04 ? 82  VAL A CG1   1 
ATOM   578  C CG2   . VAL A 1 82  ? 17.188  14.877  43.200  1.00 36.92 ? 82  VAL A CG2   1 
ATOM   579  N N     . THR A 1 83  ? 16.297  19.417  42.512  1.00 35.91 ? 83  THR A N     1 
ATOM   580  C CA    . THR A 1 83  ? 16.507  20.855  42.655  1.00 34.29 ? 83  THR A CA    1 
ATOM   581  C C     . THR A 1 83  ? 17.685  21.203  43.535  1.00 32.73 ? 83  THR A C     1 
ATOM   582  O O     . THR A 1 83  ? 17.829  20.729  44.648  1.00 30.69 ? 83  THR A O     1 
ATOM   583  C CB    . THR A 1 83  ? 15.238  21.533  43.177  1.00 36.08 ? 83  THR A CB    1 
ATOM   584  O OG1   . THR A 1 83  ? 14.957  21.108  44.508  1.00 38.96 ? 83  THR A OG1   1 
ATOM   585  C CG2   . THR A 1 83  ? 14.087  21.165  42.313  1.00 31.73 ? 83  THR A CG2   1 
ATOM   586  N N     . LYS A 1 84  ? 18.569  22.028  43.013  1.00 34.01 ? 84  LYS A N     1 
ATOM   587  C CA    . LYS A 1 84  ? 19.725  22.417  43.806  1.00 37.22 ? 84  LYS A CA    1 
ATOM   588  C C     . LYS A 1 84  ? 19.485  23.428  44.920  1.00 37.01 ? 84  LYS A C     1 
ATOM   589  O O     . LYS A 1 84  ? 18.629  24.320  44.818  1.00 35.63 ? 84  LYS A O     1 
ATOM   590  C CB    . LYS A 1 84  ? 20.838  22.890  42.859  1.00 38.50 ? 84  LYS A CB    1 
ATOM   591  C CG    . LYS A 1 84  ? 21.359  21.695  42.137  1.00 42.06 ? 84  LYS A CG    1 
ATOM   592  C CD    . LYS A 1 84  ? 22.751  21.827  41.615  1.00 46.37 ? 84  LYS A CD    1 
ATOM   593  C CE    . LYS A 1 84  ? 23.138  20.514  40.943  1.00 47.85 ? 84  LYS A CE    1 
ATOM   594  N NZ    . LYS A 1 84  ? 23.234  19.365  41.925  1.00 49.49 ? 84  LYS A NZ    1 
ATOM   595  N N     . TYR A 1 85  ? 20.247  23.279  45.998  1.00 35.71 ? 85  TYR A N     1 
ATOM   596  C CA    . TYR A 1 85  ? 20.126  24.178  47.141  1.00 36.11 ? 85  TYR A CA    1 
ATOM   597  C C     . TYR A 1 85  ? 21.429  24.945  47.295  1.00 37.25 ? 85  TYR A C     1 
ATOM   598  O O     . TYR A 1 85  ? 22.507  24.334  47.386  1.00 35.61 ? 85  TYR A O     1 
ATOM   599  C CB    . TYR A 1 85  ? 19.818  23.383  48.416  1.00 34.14 ? 85  TYR A CB    1 
ATOM   600  C CG    . TYR A 1 85  ? 20.061  24.128  49.703  1.00 34.58 ? 85  TYR A CG    1 
ATOM   601  C CD1   . TYR A 1 85  ? 21.174  23.802  50.523  1.00 36.23 ? 85  TYR A CD1   1 
ATOM   602  C CD2   . TYR A 1 85  ? 19.200  25.136  50.133  1.00 32.33 ? 85  TYR A CD2   1 
ATOM   603  C CE1   . TYR A 1 85  ? 21.404  24.466  51.727  1.00 34.18 ? 85  TYR A CE1   1 
ATOM   604  C CE2   . TYR A 1 85  ? 19.412  25.792  51.321  1.00 34.22 ? 85  TYR A CE2   1 
ATOM   605  C CZ    . TYR A 1 85  ? 20.535  25.454  52.124  1.00 34.07 ? 85  TYR A CZ    1 
ATOM   606  O OH    . TYR A 1 85  ? 20.777  26.117  53.283  1.00 31.61 ? 85  TYR A OH    1 
ATOM   607  N N     . TYR A 1 86  ? 21.323  26.270  47.368  1.00 37.41 ? 86  TYR A N     1 
ATOM   608  C CA    . TYR A 1 86  ? 22.517  27.124  47.439  1.00 38.42 ? 86  TYR A CA    1 
ATOM   609  C C     . TYR A 1 86  ? 22.873  27.787  48.742  1.00 37.80 ? 86  TYR A C     1 
ATOM   610  O O     . TYR A 1 86  ? 23.880  28.514  48.806  1.00 40.87 ? 86  TYR A O     1 
ATOM   611  C CB    . TYR A 1 86  ? 22.446  28.220  46.376  1.00 37.02 ? 86  TYR A CB    1 
ATOM   612  C CG    . TYR A 1 86  ? 22.420  27.693  44.965  1.00 39.96 ? 86  TYR A CG    1 
ATOM   613  C CD1   . TYR A 1 86  ? 21.342  27.965  44.117  1.00 40.52 ? 86  TYR A CD1   1 
ATOM   614  C CD2   . TYR A 1 86  ? 23.452  26.910  44.474  1.00 42.12 ? 86  TYR A CD2   1 
ATOM   615  C CE1   . TYR A 1 86  ? 21.310  27.468  42.834  1.00 42.23 ? 86  TYR A CE1   1 
ATOM   616  C CE2   . TYR A 1 86  ? 23.423  26.405  43.196  1.00 43.14 ? 86  TYR A CE2   1 
ATOM   617  C CZ    . TYR A 1 86  ? 22.356  26.690  42.386  1.00 43.38 ? 86  TYR A CZ    1 
ATOM   618  O OH    . TYR A 1 86  ? 22.347  26.208  41.104  1.00 48.91 ? 86  TYR A OH    1 
ATOM   619  N N     . GLY A 1 87  ? 22.058  27.580  49.757  1.00 35.03 ? 87  GLY A N     1 
ATOM   620  C CA    . GLY A 1 87  ? 22.299  28.156  51.056  1.00 35.65 ? 87  GLY A CA    1 
ATOM   621  C C     . GLY A 1 87  ? 21.080  28.906  51.581  1.00 36.78 ? 87  GLY A C     1 
ATOM   622  O O     . GLY A 1 87  ? 20.099  29.119  50.858  1.00 36.93 ? 87  GLY A O     1 
ATOM   623  N N     . SER A 1 88  ? 21.157  29.310  52.840  1.00 35.60 ? 88  SER A N     1 
ATOM   624  C CA    . SER A 1 88  ? 20.106  30.041  53.511  1.00 37.17 ? 88  SER A CA    1 
ATOM   625  C C     . SER A 1 88  ? 20.705  31.267  54.155  1.00 37.96 ? 88  SER A C     1 
ATOM   626  O O     . SER A 1 88  ? 21.880  31.254  54.591  1.00 37.97 ? 88  SER A O     1 
ATOM   627  C CB    . SER A 1 88  ? 19.475  29.170  54.610  1.00 39.51 ? 88  SER A CB    1 
ATOM   628  O OG    . SER A 1 88  ? 18.768  28.078  54.037  1.00 43.27 ? 88  SER A OG    1 
ATOM   629  N N     . TYR A 1 89  ? 19.900  32.310  54.269  1.00 37.35 ? 89  TYR A N     1 
ATOM   630  C CA    . TYR A 1 89  ? 20.325  33.555  54.892  1.00 37.76 ? 89  TYR A CA    1 
ATOM   631  C C     . TYR A 1 89  ? 19.229  33.964  55.855  1.00 39.43 ? 89  TYR A C     1 
ATOM   632  O O     . TYR A 1 89  ? 18.070  33.641  55.626  1.00 38.18 ? 89  TYR A O     1 
ATOM   633  C CB    . TYR A 1 89  ? 20.485  34.638  53.849  1.00 38.00 ? 89  TYR A CB    1 
ATOM   634  C CG    . TYR A 1 89  ? 21.530  34.308  52.851  1.00 38.46 ? 89  TYR A CG    1 
ATOM   635  C CD1   . TYR A 1 89  ? 22.785  34.897  52.919  1.00 37.37 ? 89  TYR A CD1   1 
ATOM   636  C CD2   . TYR A 1 89  ? 21.300  33.317  51.885  1.00 39.10 ? 89  TYR A CD2   1 
ATOM   637  C CE1   . TYR A 1 89  ? 23.805  34.513  52.056  1.00 40.23 ? 89  TYR A CE1   1 
ATOM   638  C CE2   . TYR A 1 89  ? 22.307  32.922  51.013  1.00 39.75 ? 89  TYR A CE2   1 
ATOM   639  C CZ    . TYR A 1 89  ? 23.558  33.524  51.097  1.00 41.27 ? 89  TYR A CZ    1 
ATOM   640  O OH    . TYR A 1 89  ? 24.533  33.175  50.188  1.00 41.68 ? 89  TYR A OH    1 
ATOM   641  N N     . LEU A 1 90  ? 19.605  34.691  56.904  1.00 40.84 ? 90  LEU A N     1 
ATOM   642  C CA    . LEU A 1 90  ? 18.670  35.116  57.932  1.00 43.34 ? 90  LEU A CA    1 
ATOM   643  C C     . LEU A 1 90  ? 18.570  36.631  57.936  1.00 43.07 ? 90  LEU A C     1 
ATOM   644  O O     . LEU A 1 90  ? 19.575  37.298  57.863  1.00 42.38 ? 90  LEU A O     1 
ATOM   645  C CB    . LEU A 1 90  ? 19.178  34.587  59.275  1.00 44.17 ? 90  LEU A CB    1 
ATOM   646  C CG    . LEU A 1 90  ? 18.285  34.647  60.508  1.00 47.73 ? 90  LEU A CG    1 
ATOM   647  C CD1   . LEU A 1 90  ? 16.786  34.463  60.172  1.00 48.14 ? 90  LEU A CD1   1 
ATOM   648  C CD2   . LEU A 1 90  ? 18.757  33.566  61.461  1.00 48.32 ? 90  LEU A CD2   1 
ATOM   649  N N     . LYS A 1 91  ? 17.364  37.185  57.959  1.00 45.72 ? 91  LYS A N     1 
ATOM   650  C CA    . LYS A 1 91  ? 17.242  38.671  57.995  1.00 48.30 ? 91  LYS A CA    1 
ATOM   651  C C     . LYS A 1 91  ? 16.148  38.992  59.011  1.00 48.60 ? 91  LYS A C     1 
ATOM   652  O O     . LYS A 1 91  ? 14.948  38.889  58.717  1.00 47.16 ? 91  LYS A O     1 
ATOM   653  C CB    . LYS A 1 91  ? 16.895  39.256  56.601  1.00 49.97 ? 91  LYS A CB    1 
ATOM   654  C CG    . LYS A 1 91  ? 16.691  40.784  56.547  1.00 50.45 ? 91  LYS A CG    1 
ATOM   655  C CD    . LYS A 1 91  ? 17.930  41.502  57.000  1.00 53.50 ? 91  LYS A CD    1 
ATOM   656  C CE    . LYS A 1 91  ? 17.665  43.003  57.171  1.00 55.54 ? 91  LYS A CE    1 
ATOM   657  N NZ    . LYS A 1 91  ? 18.936  43.774  57.558  1.00 57.06 ? 91  LYS A NZ    1 
ATOM   658  N N     . ASP A 1 92  ? 16.602  39.369  60.210  1.00 50.29 ? 92  ASP A N     1 
ATOM   659  C CA    . ASP A 1 92  ? 15.715  39.644  61.329  1.00 49.65 ? 92  ASP A CA    1 
ATOM   660  C C     . ASP A 1 92  ? 14.930  38.349  61.509  1.00 48.45 ? 92  ASP A C     1 
ATOM   661  O O     . ASP A 1 92  ? 15.549  37.348  61.884  1.00 48.13 ? 92  ASP A O     1 
ATOM   662  C CB    . ASP A 1 92  ? 14.894  40.899  61.008  1.00 52.98 ? 92  ASP A CB    1 
ATOM   663  C CG    . ASP A 1 92  ? 15.813  42.083  60.696  1.00 55.73 ? 92  ASP A CG    1 
ATOM   664  O OD1   . ASP A 1 92  ? 16.904  42.115  61.323  1.00 59.02 ? 92  ASP A OD1   1 
ATOM   665  O OD2   . ASP A 1 92  ? 15.501  42.954  59.846  1.00 57.59 ? 92  ASP A OD2   1 
ATOM   666  N N     . THR A 1 93  ? 13.628  38.279  61.262  1.00 44.98 ? 93  THR A N     1 
ATOM   667  C CA    . THR A 1 93  ? 12.997  36.950  61.450  1.00 43.93 ? 93  THR A CA    1 
ATOM   668  C C     . THR A 1 93  ? 12.709  36.220  60.164  1.00 43.02 ? 93  THR A C     1 
ATOM   669  O O     . THR A 1 93  ? 11.948  35.244  60.162  1.00 41.64 ? 93  THR A O     1 
ATOM   670  C CB    . THR A 1 93  ? 11.600  36.994  62.121  1.00 45.67 ? 93  THR A CB    1 
ATOM   671  O OG1   . THR A 1 93  ? 10.771  37.941  61.424  1.00 48.46 ? 93  THR A OG1   1 
ATOM   672  C CG2   . THR A 1 93  ? 11.705  37.297  63.563  1.00 46.40 ? 93  THR A CG2   1 
ATOM   673  N N     . LYS A 1 94  ? 13.264  36.690  59.058  1.00 43.27 ? 94  LYS A N     1 
ATOM   674  C CA    . LYS A 1 94  ? 12.964  36.031  57.774  1.00 43.64 ? 94  LYS A CA    1 
ATOM   675  C C     . LYS A 1 94  ? 14.087  35.134  57.327  1.00 41.98 ? 94  LYS A C     1 
ATOM   676  O O     . LYS A 1 94  ? 15.226  35.582  57.262  1.00 44.36 ? 94  LYS A O     1 
ATOM   677  C CB    . LYS A 1 94  ? 12.737  37.071  56.672  1.00 41.63 ? 94  LYS A CB    1 
ATOM   678  C CG    . LYS A 1 94  ? 11.620  38.071  56.949  1.00 42.34 ? 94  LYS A CG    1 
ATOM   679  C CD    . LYS A 1 94  ? 10.282  37.450  56.841  1.00 41.89 ? 94  LYS A CD    1 
ATOM   680  C CE    . LYS A 1 94  ? 9.209   38.522  57.166  1.00 43.31 ? 94  LYS A CE    1 
ATOM   681  N NZ    . LYS A 1 94  ? 9.773   39.831  56.836  1.00 44.02 ? 94  LYS A NZ    1 
ATOM   682  N N     . LEU A 1 95  ? 13.752  33.884  57.025  1.00 41.61 ? 95  LEU A N     1 
ATOM   683  C CA    . LEU A 1 95  ? 14.696  32.914  56.470  1.00 40.26 ? 95  LEU A CA    1 
ATOM   684  C C     . LEU A 1 95  ? 14.548  32.954  54.917  1.00 39.21 ? 95  LEU A C     1 
ATOM   685  O O     . LEU A 1 95  ? 13.469  32.763  54.389  1.00 39.66 ? 95  LEU A O     1 
ATOM   686  C CB    . LEU A 1 95  ? 14.343  31.501  56.927  1.00 40.25 ? 95  LEU A CB    1 
ATOM   687  C CG    . LEU A 1 95  ? 15.212  30.372  56.382  1.00 41.05 ? 95  LEU A CG    1 
ATOM   688  C CD1   . LEU A 1 95  ? 16.632  30.530  56.950  1.00 39.80 ? 95  LEU A CD1   1 
ATOM   689  C CD2   . LEU A 1 95  ? 14.623  29.007  56.731  1.00 40.53 ? 95  LEU A CD2   1 
ATOM   690  N N     . TRP A 1 96  ? 15.636  33.230  54.221  1.00 38.02 ? 96  TRP A N     1 
ATOM   691  C CA    . TRP A 1 96  ? 15.672  33.253  52.755  1.00 38.09 ? 96  TRP A CA    1 
ATOM   692  C C     . TRP A 1 96  ? 16.378  31.968  52.325  1.00 37.81 ? 96  TRP A C     1 
ATOM   693  O O     . TRP A 1 96  ? 17.591  31.791  52.635  1.00 38.06 ? 96  TRP A O     1 
ATOM   694  C CB    . TRP A 1 96  ? 16.524  34.417  52.247  1.00 37.80 ? 96  TRP A CB    1 
ATOM   695  C CG    . TRP A 1 96  ? 15.957  35.802  52.448  1.00 39.39 ? 96  TRP A CG    1 
ATOM   696  C CD1   . TRP A 1 96  ? 15.352  36.293  53.569  1.00 40.21 ? 96  TRP A CD1   1 
ATOM   697  C CD2   . TRP A 1 96  ? 16.000  36.891  51.508  1.00 42.14 ? 96  TRP A CD2   1 
ATOM   698  N NE1   . TRP A 1 96  ? 15.008  37.627  53.388  1.00 38.16 ? 96  TRP A NE1   1 
ATOM   699  C CE2   . TRP A 1 96  ? 15.396  38.018  52.137  1.00 42.63 ? 96  TRP A CE2   1 
ATOM   700  C CE3   . TRP A 1 96  ? 16.492  37.029  50.202  1.00 42.13 ? 96  TRP A CE3   1 
ATOM   701  C CZ2   . TRP A 1 96  ? 15.280  39.263  51.502  1.00 42.83 ? 96  TRP A CZ2   1 
ATOM   702  C CZ3   . TRP A 1 96  ? 16.371  38.270  49.568  1.00 44.23 ? 96  TRP A CZ3   1 
ATOM   703  C CH2   . TRP A 1 96  ? 15.771  39.369  50.226  1.00 43.96 ? 96  TRP A CH2   1 
ATOM   704  N N     . ILE A 1 97  ? 15.674  31.093  51.630  1.00 35.25 ? 97  ILE A N     1 
ATOM   705  C CA    . ILE A 1 97  ? 16.260  29.850  51.124  1.00 34.46 ? 97  ILE A CA    1 
ATOM   706  C C     . ILE A 1 97  ? 16.505  30.010  49.620  1.00 33.22 ? 97  ILE A C     1 
ATOM   707  O O     . ILE A 1 97  ? 15.575  30.278  48.837  1.00 32.86 ? 97  ILE A O     1 
ATOM   708  C CB    . ILE A 1 97  ? 15.328  28.619  51.364  1.00 35.61 ? 97  ILE A CB    1 
ATOM   709  C CG1   . ILE A 1 97  ? 15.124  28.362  52.843  1.00 36.10 ? 97  ILE A CG1   1 
ATOM   710  C CG2   . ILE A 1 97  ? 15.904  27.392  50.695  1.00 34.79 ? 97  ILE A CG2   1 
ATOM   711  C CD1   . ILE A 1 97  ? 13.818  27.587  53.106  1.00 37.85 ? 97  ILE A CD1   1 
ATOM   712  N N     . ILE A 1 98  ? 17.767  29.875  49.228  1.00 31.11 ? 98  ILE A N     1 
ATOM   713  C CA    . ILE A 1 98  ? 18.199  30.051  47.849  1.00 31.30 ? 98  ILE A CA    1 
ATOM   714  C C     . ILE A 1 98  ? 18.319  28.704  47.118  1.00 32.75 ? 98  ILE A C     1 
ATOM   715  O O     . ILE A 1 98  ? 19.078  27.799  47.538  1.00 30.79 ? 98  ILE A O     1 
ATOM   716  C CB    . ILE A 1 98  ? 19.611  30.735  47.794  1.00 32.56 ? 98  ILE A CB    1 
ATOM   717  C CG1   . ILE A 1 98  ? 19.684  31.916  48.770  1.00 31.06 ? 98  ILE A CG1   1 
ATOM   718  C CG2   . ILE A 1 98  ? 19.914  31.181  46.340  1.00 32.76 ? 98  ILE A CG2   1 
ATOM   719  C CD1   . ILE A 1 98  ? 18.594  32.971  48.614  1.00 32.67 ? 98  ILE A CD1   1 
ATOM   720  N N     . MET A 1 99  ? 17.598  28.597  46.014  1.00 32.86 ? 99  MET A N     1 
ATOM   721  C CA    . MET A 1 99  ? 17.590  27.373  45.235  1.00 35.65 ? 99  MET A CA    1 
ATOM   722  C C     . MET A 1 99  ? 17.692  27.658  43.745  1.00 34.72 ? 99  MET A C     1 
ATOM   723  O O     . MET A 1 99  ? 17.599  28.805  43.264  1.00 34.05 ? 99  MET A O     1 
ATOM   724  C CB    . MET A 1 99  ? 16.274  26.589  45.487  1.00 37.69 ? 99  MET A CB    1 
ATOM   725  C CG    . MET A 1 99  ? 15.939  26.304  46.958  1.00 44.31 ? 99  MET A CG    1 
ATOM   726  S SD    . MET A 1 99  ? 14.151  25.770  47.022  1.00 55.57 ? 99  MET A SD    1 
ATOM   727  C CE    . MET A 1 99  ? 13.334  27.409  46.754  1.00 48.42 ? 99  MET A CE    1 
ATOM   728  N N     . GLU A 1 100 ? 17.885  26.565  43.013  1.00 34.05 ? 100 GLU A N     1 
ATOM   729  C CA    . GLU A 1 100 ? 17.947  26.549  41.580  1.00 33.19 ? 100 GLU A CA    1 
ATOM   730  C C     . GLU A 1 100 ? 16.569  27.040  41.102  1.00 34.80 ? 100 GLU A C     1 
ATOM   731  O O     . GLU A 1 100 ? 15.540  26.576  41.591  1.00 34.37 ? 100 GLU A O     1 
ATOM   732  C CB    . GLU A 1 100 ? 18.148  25.098  41.135  1.00 35.84 ? 100 GLU A CB    1 
ATOM   733  C CG    . GLU A 1 100 ? 18.084  24.889  39.638  1.00 39.21 ? 100 GLU A CG    1 
ATOM   734  C CD    . GLU A 1 100 ? 18.336  23.445  39.250  1.00 38.33 ? 100 GLU A CD    1 
ATOM   735  O OE1   . GLU A 1 100 ? 18.543  23.190  38.063  1.00 40.06 ? 100 GLU A OE1   1 
ATOM   736  O OE2   . GLU A 1 100 ? 18.326  22.573  40.129  1.00 40.68 ? 100 GLU A OE2   1 
ATOM   737  N N     . TYR A 1 101 ? 16.546  27.985  40.171  1.00 35.73 ? 101 TYR A N     1 
ATOM   738  C CA    . TYR A 1 101 ? 15.283  28.526  39.660  1.00 37.24 ? 101 TYR A CA    1 
ATOM   739  C C     . TYR A 1 101 ? 14.723  27.621  38.560  1.00 36.62 ? 101 TYR A C     1 
ATOM   740  O O     . TYR A 1 101 ? 15.448  27.258  37.645  1.00 35.90 ? 101 TYR A O     1 
ATOM   741  C CB    . TYR A 1 101 ? 15.520  29.924  39.085  1.00 36.49 ? 101 TYR A CB    1 
ATOM   742  C CG    . TYR A 1 101 ? 14.319  30.483  38.393  1.00 37.11 ? 101 TYR A CG    1 
ATOM   743  C CD1   . TYR A 1 101 ? 13.185  30.862  39.110  1.00 37.91 ? 101 TYR A CD1   1 
ATOM   744  C CD2   . TYR A 1 101 ? 14.291  30.613  37.005  1.00 38.52 ? 101 TYR A CD2   1 
ATOM   745  C CE1   . TYR A 1 101 ? 12.057  31.354  38.462  1.00 37.36 ? 101 TYR A CE1   1 
ATOM   746  C CE2   . TYR A 1 101 ? 13.167  31.104  36.364  1.00 38.14 ? 101 TYR A CE2   1 
ATOM   747  C CZ    . TYR A 1 101 ? 12.063  31.469  37.095  1.00 38.60 ? 101 TYR A CZ    1 
ATOM   748  O OH    . TYR A 1 101 ? 10.962  31.988  36.445  1.00 42.70 ? 101 TYR A OH    1 
ATOM   749  N N     . LEU A 1 102 ? 13.445  27.261  38.646  1.00 36.27 ? 102 LEU A N     1 
ATOM   750  C CA    . LEU A 1 102 ? 12.888  26.389  37.646  1.00 38.06 ? 102 LEU A CA    1 
ATOM   751  C C     . LEU A 1 102 ? 11.690  27.117  37.110  1.00 38.12 ? 102 LEU A C     1 
ATOM   752  O O     . LEU A 1 102 ? 10.632  27.085  37.713  1.00 36.83 ? 102 LEU A O     1 
ATOM   753  C CB    . LEU A 1 102 ? 12.526  25.052  38.323  1.00 38.60 ? 102 LEU A CB    1 
ATOM   754  C CG    . LEU A 1 102 ? 13.816  24.242  38.645  1.00 37.58 ? 102 LEU A CG    1 
ATOM   755  C CD1   . LEU A 1 102 ? 13.543  23.113  39.552  1.00 36.34 ? 102 LEU A CD1   1 
ATOM   756  C CD2   . LEU A 1 102 ? 14.411  23.723  37.345  1.00 36.58 ? 102 LEU A CD2   1 
ATOM   757  N N     . GLY A 1 103 ? 11.876  27.777  35.976  1.00 40.44 ? 103 GLY A N     1 
ATOM   758  C CA    . GLY A 1 103 ? 10.823  28.610  35.407  1.00 42.73 ? 103 GLY A CA    1 
ATOM   759  C C     . GLY A 1 103 ? 9.719   28.026  34.519  1.00 43.85 ? 103 GLY A C     1 
ATOM   760  O O     . GLY A 1 103 ? 8.858   28.792  34.064  1.00 44.33 ? 103 GLY A O     1 
ATOM   761  N N     . GLY A 1 104 ? 9.716   26.711  34.308  1.00 42.94 ? 104 GLY A N     1 
ATOM   762  C CA    . GLY A 1 104 ? 8.711   26.072  33.454  1.00 43.33 ? 104 GLY A CA    1 
ATOM   763  C C     . GLY A 1 104 ? 7.382   25.734  34.111  1.00 43.68 ? 104 GLY A C     1 
ATOM   764  O O     . GLY A 1 104 ? 6.374   25.423  33.427  1.00 46.04 ? 104 GLY A O     1 
ATOM   765  N N     . GLY A 1 105 ? 7.368   25.788  35.439  1.00 42.76 ? 105 GLY A N     1 
ATOM   766  C CA    . GLY A 1 105 ? 6.180   25.487  36.240  1.00 39.82 ? 105 GLY A CA    1 
ATOM   767  C C     . GLY A 1 105 ? 6.206   24.015  36.707  1.00 37.89 ? 105 GLY A C     1 
ATOM   768  O O     . GLY A 1 105 ? 7.100   23.254  36.336  1.00 36.12 ? 105 GLY A O     1 
ATOM   769  N N     . SER A 1 106 ? 5.227   23.610  37.503  1.00 37.05 ? 106 SER A N     1 
ATOM   770  C CA    . SER A 1 106 ? 5.157   22.200  37.906  1.00 35.34 ? 106 SER A CA    1 
ATOM   771  C C     . SER A 1 106 ? 4.389   21.354  36.854  1.00 35.35 ? 106 SER A C     1 
ATOM   772  O O     . SER A 1 106 ? 3.657   21.887  36.018  1.00 33.39 ? 106 SER A O     1 
ATOM   773  C CB    . SER A 1 106 ? 4.460   22.068  39.256  1.00 35.32 ? 106 SER A CB    1 
ATOM   774  O OG    . SER A 1 106 ? 3.037   22.310  39.174  1.00 37.64 ? 106 SER A OG    1 
ATOM   775  N N     . ALA A 1 107 ? 4.576   20.029  36.874  1.00 32.76 ? 107 ALA A N     1 
ATOM   776  C CA    . ALA A 1 107 ? 3.837   19.214  35.947  1.00 32.39 ? 107 ALA A CA    1 
ATOM   777  C C     . ALA A 1 107 ? 2.321   19.444  36.218  1.00 32.34 ? 107 ALA A C     1 
ATOM   778  O O     . ALA A 1 107 ? 1.510   19.377  35.286  1.00 32.77 ? 107 ALA A O     1 
ATOM   779  C CB    . ALA A 1 107 ? 4.207   17.710  36.128  1.00 30.01 ? 107 ALA A CB    1 
ATOM   780  N N     . LEU A 1 108 ? 1.930   19.680  37.468  1.00 33.30 ? 108 LEU A N     1 
ATOM   781  C CA    . LEU A 1 108 ? 0.505   19.906  37.733  1.00 36.38 ? 108 LEU A CA    1 
ATOM   782  C C     . LEU A 1 108 ? 0.037   21.216  37.043  1.00 38.74 ? 108 LEU A C     1 
ATOM   783  O O     . LEU A 1 108 ? -1.106  21.304  36.553  1.00 37.66 ? 108 LEU A O     1 
ATOM   784  C CB    . LEU A 1 108 ? 0.210   19.998  39.232  1.00 36.88 ? 108 LEU A CB    1 
ATOM   785  C CG    . LEU A 1 108 ? -1.327  20.150  39.566  1.00 37.57 ? 108 LEU A CG    1 
ATOM   786  C CD1   . LEU A 1 108 ? -2.068  18.855  39.137  1.00 38.67 ? 108 LEU A CD1   1 
ATOM   787  C CD2   . LEU A 1 108 ? -1.592  20.447  41.042  1.00 35.51 ? 108 LEU A CD2   1 
ATOM   788  N N     . ASP A 1 109 ? 0.903   22.228  37.030  1.00 40.11 ? 109 ASP A N     1 
ATOM   789  C CA    . ASP A 1 109 ? 0.584   23.496  36.359  1.00 41.95 ? 109 ASP A CA    1 
ATOM   790  C C     . ASP A 1 109 ? 0.432   23.235  34.861  1.00 41.74 ? 109 ASP A C     1 
ATOM   791  O O     . ASP A 1 109 ? -0.440  23.819  34.219  1.00 41.83 ? 109 ASP A O     1 
ATOM   792  C CB    . ASP A 1 109 ? 1.717   24.534  36.488  1.00 42.31 ? 109 ASP A CB    1 
ATOM   793  C CG    . ASP A 1 109 ? 1.927   25.031  37.891  1.00 43.07 ? 109 ASP A CG    1 
ATOM   794  O OD1   . ASP A 1 109 ? 3.102   25.387  38.233  1.00 43.36 ? 109 ASP A OD1   1 
ATOM   795  O OD2   . ASP A 1 109 ? 0.948   25.104  38.647  1.00 41.32 ? 109 ASP A OD2   1 
ATOM   796  N N     . LEU A 1 110 ? 1.290   22.390  34.301  1.00 40.23 ? 110 LEU A N     1 
ATOM   797  C CA    . LEU A 1 110 ? 1.236   22.095  32.880  1.00 41.38 ? 110 LEU A CA    1 
ATOM   798  C C     . LEU A 1 110 ? -0.037  21.357  32.456  1.00 41.72 ? 110 LEU A C     1 
ATOM   799  O O     . LEU A 1 110 ? -0.320  21.297  31.276  1.00 41.31 ? 110 LEU A O     1 
ATOM   800  C CB    . LEU A 1 110 ? 2.506   21.347  32.416  1.00 41.78 ? 110 LEU A CB    1 
ATOM   801  C CG    . LEU A 1 110 ? 3.813   22.099  32.776  1.00 42.26 ? 110 LEU A CG    1 
ATOM   802  C CD1   . LEU A 1 110 ? 5.024   21.294  32.393  1.00 42.04 ? 110 LEU A CD1   1 
ATOM   803  C CD2   . LEU A 1 110 ? 3.836   23.423  32.014  1.00 42.10 ? 110 LEU A CD2   1 
ATOM   804  N N     . LEU A 1 111 ? -0.815  20.863  33.427  1.00 43.14 ? 111 LEU A N     1 
ATOM   805  C CA    . LEU A 1 111 ? -2.088  20.167  33.162  1.00 44.32 ? 111 LEU A CA    1 
ATOM   806  C C     . LEU A 1 111 ? -3.245  21.152  33.146  1.00 45.65 ? 111 LEU A C     1 
ATOM   807  O O     . LEU A 1 111 ? -4.328  20.818  32.695  1.00 45.39 ? 111 LEU A O     1 
ATOM   808  C CB    . LEU A 1 111 ? -2.418  19.159  34.278  1.00 43.74 ? 111 LEU A CB    1 
ATOM   809  C CG    . LEU A 1 111 ? -1.574  17.911  34.267  1.00 43.38 ? 111 LEU A CG    1 
ATOM   810  C CD1   . LEU A 1 111 ? -1.751  17.172  35.564  1.00 41.04 ? 111 LEU A CD1   1 
ATOM   811  C CD2   . LEU A 1 111 ? -1.965  17.105  33.069  1.00 45.26 ? 111 LEU A CD2   1 
ATOM   812  N N     . GLU A 1 112 ? -3.020  22.332  33.713  1.00 46.38 ? 112 GLU A N     1 
ATOM   813  C CA    . GLU A 1 112 ? -4.057  23.351  33.806  1.00 49.32 ? 112 GLU A CA    1 
ATOM   814  C C     . GLU A 1 112 ? -4.766  23.673  32.477  1.00 48.73 ? 112 GLU A C     1 
ATOM   815  O O     . GLU A 1 112 ? -5.991  23.777  32.472  1.00 50.25 ? 112 GLU A O     1 
ATOM   816  C CB    . GLU A 1 112 ? -3.496  24.641  34.423  1.00 48.93 ? 112 GLU A CB    1 
ATOM   817  C CG    . GLU A 1 112 ? -3.542  24.737  35.934  1.00 53.01 ? 112 GLU A CG    1 
ATOM   818  C CD    . GLU A 1 112 ? -4.957  24.825  36.474  1.00 54.84 ? 112 GLU A CD    1 
ATOM   819  O OE1   . GLU A 1 112 ? -5.920  24.581  35.714  1.00 59.21 ? 112 GLU A OE1   1 
ATOM   820  O OE2   . GLU A 1 112 ? -5.122  25.131  37.668  1.00 57.28 ? 112 GLU A OE2   1 
ATOM   821  N N     . PRO A 1 113 ? -4.010  23.844  31.363  1.00 48.65 ? 113 PRO A N     1 
ATOM   822  C CA    . PRO A 1 113 ? -4.513  24.158  30.008  1.00 49.24 ? 113 PRO A CA    1 
ATOM   823  C C     . PRO A 1 113 ? -5.336  23.066  29.330  1.00 50.33 ? 113 PRO A C     1 
ATOM   824  O O     . PRO A 1 113 ? -6.364  23.365  28.711  1.00 51.24 ? 113 PRO A O     1 
ATOM   825  C CB    . PRO A 1 113 ? -3.239  24.465  29.214  1.00 49.03 ? 113 PRO A CB    1 
ATOM   826  C CG    . PRO A 1 113 ? -2.329  25.059  30.274  1.00 47.87 ? 113 PRO A CG    1 
ATOM   827  C CD    . PRO A 1 113 ? -2.552  24.068  31.413  1.00 47.78 ? 113 PRO A CD    1 
ATOM   828  N N     . GLY A 1 114 ? -4.894  21.813  29.429  1.00 49.09 ? 114 GLY A N     1 
ATOM   829  C CA    . GLY A 1 114 ? -5.622  20.705  28.827  1.00 47.82 ? 114 GLY A CA    1 
ATOM   830  C C     . GLY A 1 114 ? -4.863  19.417  29.083  1.00 46.48 ? 114 GLY A C     1 
ATOM   831  O O     . GLY A 1 114 ? -3.933  19.417  29.886  1.00 48.11 ? 114 GLY A O     1 
ATOM   832  N N     . PRO A 1 115 ? -5.200  18.319  28.412  1.00 45.68 ? 115 PRO A N     1 
ATOM   833  C CA    . PRO A 1 115 ? -4.467  17.059  28.665  1.00 44.08 ? 115 PRO A CA    1 
ATOM   834  C C     . PRO A 1 115 ? -3.071  16.948  28.060  1.00 42.90 ? 115 PRO A C     1 
ATOM   835  O O     . PRO A 1 115 ? -2.680  17.719  27.184  1.00 44.55 ? 115 PRO A O     1 
ATOM   836  C CB    . PRO A 1 115 ? -5.395  15.980  28.086  1.00 43.13 ? 115 PRO A CB    1 
ATOM   837  C CG    . PRO A 1 115 ? -6.716  16.621  28.059  1.00 44.99 ? 115 PRO A CG    1 
ATOM   838  C CD    . PRO A 1 115 ? -6.458  18.061  27.696  1.00 43.59 ? 115 PRO A CD    1 
ATOM   839  N N     . LEU A 1 116 ? -2.294  15.992  28.539  1.00 39.81 ? 116 LEU A N     1 
ATOM   840  C CA    . LEU A 1 116 ? -1.002  15.786  27.944  1.00 38.46 ? 116 LEU A CA    1 
ATOM   841  C C     . LEU A 1 116 ? -1.195  14.631  26.983  1.00 36.56 ? 116 LEU A C     1 
ATOM   842  O O     . LEU A 1 116 ? -2.153  13.881  27.104  1.00 35.64 ? 116 LEU A O     1 
ATOM   843  C CB    . LEU A 1 116 ? 0.063   15.385  29.002  1.00 36.88 ? 116 LEU A CB    1 
ATOM   844  C CG    . LEU A 1 116 ? 0.106   16.321  30.224  1.00 38.44 ? 116 LEU A CG    1 
ATOM   845  C CD1   . LEU A 1 116 ? 1.048   15.816  31.287  1.00 36.83 ? 116 LEU A CD1   1 
ATOM   846  C CD2   . LEU A 1 116 ? 0.454   17.722  29.777  1.00 36.41 ? 116 LEU A CD2   1 
ATOM   847  N N     . ASP A 1 117 ? -0.295  14.493  26.025  1.00 37.34 ? 117 ASP A N     1 
ATOM   848  C CA    . ASP A 1 117 ? -0.370  13.383  25.124  1.00 37.74 ? 117 ASP A CA    1 
ATOM   849  C C     . ASP A 1 117 ? 0.540   12.347  25.738  1.00 35.78 ? 117 ASP A C     1 
ATOM   850  O O     . ASP A 1 117 ? 1.306   12.659  26.647  1.00 35.26 ? 117 ASP A O     1 
ATOM   851  C CB    . ASP A 1 117 ? -0.002  13.789  23.679  1.00 41.52 ? 117 ASP A CB    1 
ATOM   852  C CG    . ASP A 1 117 ? 1.456   14.123  23.493  1.00 47.16 ? 117 ASP A CG    1 
ATOM   853  O OD1   . ASP A 1 117 ? 1.843   14.470  22.353  1.00 51.86 ? 117 ASP A OD1   1 
ATOM   854  O OD2   . ASP A 1 117 ? 2.222   14.048  24.455  1.00 48.59 ? 117 ASP A OD2   1 
ATOM   855  N N     . GLU A 1 118 ? 0.478   11.119  25.265  1.00 34.38 ? 118 GLU A N     1 
ATOM   856  C CA    . GLU A 1 118 ? 1.265   10.085  25.888  1.00 33.83 ? 118 GLU A CA    1 
ATOM   857  C C     . GLU A 1 118 ? 2.745   10.361  25.767  1.00 35.42 ? 118 GLU A C     1 
ATOM   858  O O     . GLU A 1 118 ? 3.548   9.881   26.578  1.00 33.32 ? 118 GLU A O     1 
ATOM   859  C CB    . GLU A 1 118 ? 0.851   8.708   25.327  1.00 34.11 ? 118 GLU A CB    1 
ATOM   860  C CG    . GLU A 1 118 ? -0.629  8.345   25.789  1.00 31.47 ? 118 GLU A CG    1 
ATOM   861  C CD    . GLU A 1 118 ? -0.971  6.856   25.689  1.00 33.13 ? 118 GLU A CD    1 
ATOM   862  O OE1   . GLU A 1 118 ? -0.024  6.052   25.605  1.00 28.86 ? 118 GLU A OE1   1 
ATOM   863  O OE2   . GLU A 1 118 ? -2.195  6.485   25.742  1.00 28.96 ? 118 GLU A OE2   1 
ATOM   864  N N     . THR A 1 119 ? 3.120   11.129  24.745  1.00 36.17 ? 119 THR A N     1 
ATOM   865  C CA    . THR A 1 119 ? 4.539   11.459  24.587  1.00 36.90 ? 119 THR A CA    1 
ATOM   866  C C     . THR A 1 119 ? 4.984   12.342  25.724  1.00 34.50 ? 119 THR A C     1 
ATOM   867  O O     . THR A 1 119 ? 6.087   12.167  26.285  1.00 33.17 ? 119 THR A O     1 
ATOM   868  C CB    . THR A 1 119 ? 4.842   12.214  23.265  1.00 38.11 ? 119 THR A CB    1 
ATOM   869  O OG1   . THR A 1 119 ? 4.694   11.295  22.180  1.00 43.19 ? 119 THR A OG1   1 
ATOM   870  C CG2   . THR A 1 119 ? 6.301   12.744  23.271  1.00 40.45 ? 119 THR A CG2   1 
ATOM   871  N N     . GLN A 1 120 ? 4.172   13.330  26.022  1.00 32.31 ? 120 GLN A N     1 
ATOM   872  C CA    . GLN A 1 120 ? 4.510   14.230  27.079  1.00 34.43 ? 120 GLN A CA    1 
ATOM   873  C C     . GLN A 1 120 ? 4.503   13.485  28.419  1.00 35.33 ? 120 GLN A C     1 
ATOM   874  O O     . GLN A 1 120 ? 5.445   13.637  29.229  1.00 35.27 ? 120 GLN A O     1 
ATOM   875  C CB    . GLN A 1 120 ? 3.551   15.399  27.065  1.00 34.25 ? 120 GLN A CB    1 
ATOM   876  C CG    . GLN A 1 120 ? 3.622   16.149  25.756  1.00 36.04 ? 120 GLN A CG    1 
ATOM   877  C CD    . GLN A 1 120 ? 2.555   17.170  25.653  1.00 38.89 ? 120 GLN A CD    1 
ATOM   878  O OE1   . GLN A 1 120 ? 1.361   16.895  25.945  1.00 39.01 ? 120 GLN A OE1   1 
ATOM   879  N NE2   . GLN A 1 120 ? 2.934   18.372  25.218  1.00 39.69 ? 120 GLN A NE2   1 
ATOM   880  N N     . ILE A 1 121 ? 3.464   12.673  28.643  1.00 32.17 ? 121 ILE A N     1 
ATOM   881  C CA    . ILE A 1 121 ? 3.389   11.891  29.861  1.00 31.81 ? 121 ILE A CA    1 
ATOM   882  C C     . ILE A 1 121 ? 4.678   11.012  30.044  1.00 31.87 ? 121 ILE A C     1 
ATOM   883  O O     . ILE A 1 121 ? 5.309   11.020  31.135  1.00 31.32 ? 121 ILE A O     1 
ATOM   884  C CB    . ILE A 1 121 ? 2.163   10.960  29.821  1.00 28.51 ? 121 ILE A CB    1 
ATOM   885  C CG1   . ILE A 1 121 ? 0.861   11.778  29.924  1.00 30.17 ? 121 ILE A CG1   1 
ATOM   886  C CG2   . ILE A 1 121 ? 2.249   9.951   30.954  1.00 29.32 ? 121 ILE A CG2   1 
ATOM   887  C CD1   . ILE A 1 121 ? -0.393  10.867  29.619  1.00 30.33 ? 121 ILE A CD1   1 
ATOM   888  N N     . ALA A 1 122 ? 5.039   10.251  29.013  1.00 32.96 ? 122 ALA A N     1 
ATOM   889  C CA    . ALA A 1 122 ? 6.250   9.393   29.043  1.00 32.57 ? 122 ALA A CA    1 
ATOM   890  C C     . ALA A 1 122 ? 7.532   10.171  29.322  1.00 33.54 ? 122 ALA A C     1 
ATOM   891  O O     . ALA A 1 122 ? 8.435   9.678   30.030  1.00 31.92 ? 122 ALA A O     1 
ATOM   892  C CB    . ALA A 1 122 ? 6.452   8.694   27.711  1.00 32.67 ? 122 ALA A CB    1 
ATOM   893  N N     . THR A 1 123 ? 7.631   11.348  28.694  1.00 34.06 ? 123 THR A N     1 
ATOM   894  C CA    . THR A 1 123 ? 8.830   12.171  28.851  1.00 34.55 ? 123 THR A CA    1 
ATOM   895  C C     . THR A 1 123 ? 8.961   12.611  30.290  1.00 34.56 ? 123 THR A C     1 
ATOM   896  O O     . THR A 1 123 ? 10.036  12.469  30.900  1.00 35.42 ? 123 THR A O     1 
ATOM   897  C CB    . THR A 1 123 ? 8.819   13.358  27.848  1.00 34.97 ? 123 THR A CB    1 
ATOM   898  O OG1   . THR A 1 123 ? 8.831   12.803  26.511  1.00 34.31 ? 123 THR A OG1   1 
ATOM   899  C CG2   . THR A 1 123 ? 10.117  14.281  27.999  1.00 35.64 ? 123 THR A CG2   1 
ATOM   900  N N     . ILE A 1 124 ? 7.878   13.135  30.848  1.00 32.14 ? 124 ILE A N     1 
ATOM   901  C CA    . ILE A 1 124 ? 7.880   13.540  32.251  1.00 30.35 ? 124 ILE A CA    1 
ATOM   902  C C     . ILE A 1 124 ? 8.167   12.372  33.191  1.00 30.26 ? 124 ILE A C     1 
ATOM   903  O O     . ILE A 1 124 ? 9.052   12.465  34.069  1.00 31.25 ? 124 ILE A O     1 
ATOM   904  C CB    . ILE A 1 124 ? 6.555   14.238  32.626  1.00 28.04 ? 124 ILE A CB    1 
ATOM   905  C CG1   . ILE A 1 124 ? 6.460   15.589  31.878  1.00 30.62 ? 124 ILE A CG1   1 
ATOM   906  C CG2   . ILE A 1 124 ? 6.499   14.468  34.117  1.00 27.36 ? 124 ILE A CG2   1 
ATOM   907  C CD1   . ILE A 1 124 ? 5.012   16.156  31.726  1.00 30.57 ? 124 ILE A CD1   1 
ATOM   908  N N     . LEU A 1 125 ? 7.479   11.245  33.018  1.00 28.11 ? 125 LEU A N     1 
ATOM   909  C CA    . LEU A 1 125 ? 7.733   10.101  33.879  1.00 27.79 ? 125 LEU A CA    1 
ATOM   910  C C     . LEU A 1 125 ? 9.192   9.605   33.795  1.00 30.04 ? 125 LEU A C     1 
ATOM   911  O O     . LEU A 1 125 ? 9.758   9.196   34.823  1.00 29.89 ? 125 LEU A O     1 
ATOM   912  C CB    . LEU A 1 125 ? 6.816   8.925   33.506  1.00 27.30 ? 125 LEU A CB    1 
ATOM   913  C CG    . LEU A 1 125 ? 5.331   9.140   33.870  1.00 25.25 ? 125 LEU A CG    1 
ATOM   914  C CD1   . LEU A 1 125 ? 4.461   8.010   33.203  1.00 21.17 ? 125 LEU A CD1   1 
ATOM   915  C CD2   . LEU A 1 125 ? 5.221   9.122   35.370  1.00 23.27 ? 125 LEU A CD2   1 
ATOM   916  N N     . ARG A 1 126 ? 9.759   9.633   32.596  1.00 29.65 ? 126 ARG A N     1 
ATOM   917  C CA    . ARG A 1 126 ? 11.098  9.140   32.437  1.00 29.30 ? 126 ARG A CA    1 
ATOM   918  C C     . ARG A 1 126 ? 12.015  9.987   33.278  1.00 29.16 ? 126 ARG A C     1 
ATOM   919  O O     . ARG A 1 126 ? 12.803  9.449   33.963  1.00 29.76 ? 126 ARG A O     1 
ATOM   920  C CB    . ARG A 1 126 ? 11.531  9.142   30.976  1.00 31.20 ? 126 ARG A CB    1 
ATOM   921  C CG    . ARG A 1 126 ? 12.954  8.482   30.774  1.00 35.25 ? 126 ARG A CG    1 
ATOM   922  C CD    . ARG A 1 126 ? 13.498  8.704   29.362  1.00 36.26 ? 126 ARG A CD    1 
ATOM   923  N NE    . ARG A 1 126 ? 13.531  10.146  29.151  1.00 41.92 ? 126 ARG A NE    1 
ATOM   924  C CZ    . ARG A 1 126 ? 13.656  10.746  27.978  1.00 42.11 ? 126 ARG A CZ    1 
ATOM   925  N NH1   . ARG A 1 126 ? 13.760  10.022  26.867  1.00 44.28 ? 126 ARG A NH1   1 
ATOM   926  N NH2   . ARG A 1 126 ? 13.672  12.076  27.936  1.00 44.82 ? 126 ARG A NH2   1 
ATOM   927  N N     . GLU A 1 127 ? 11.895  11.323  33.242  1.00 30.75 ? 127 GLU A N     1 
ATOM   928  C CA    . GLU A 1 127 ? 12.755  12.165  34.046  1.00 30.23 ? 127 GLU A CA    1 
ATOM   929  C C     . GLU A 1 127 ? 12.520  12.019  35.572  1.00 30.01 ? 127 GLU A C     1 
ATOM   930  O O     . GLU A 1 127 ? 13.456  12.144  36.393  1.00 28.44 ? 127 GLU A O     1 
ATOM   931  C CB    . GLU A 1 127 ? 12.569  13.605  33.603  1.00 32.46 ? 127 GLU A CB    1 
ATOM   932  C CG    . GLU A 1 127 ? 12.805  13.773  32.098  1.00 35.66 ? 127 GLU A CG    1 
ATOM   933  C CD    . GLU A 1 127 ? 14.229  13.404  31.684  1.00 37.36 ? 127 GLU A CD    1 
ATOM   934  O OE1   . GLU A 1 127 ? 14.370  12.643  30.742  1.00 42.35 ? 127 GLU A OE1   1 
ATOM   935  O OE2   . GLU A 1 127 ? 15.187  13.878  32.309  1.00 36.38 ? 127 GLU A OE2   1 
ATOM   936  N N     . ILE A 1 128 ? 11.282  11.755  35.973  1.00 27.56 ? 128 ILE A N     1 
ATOM   937  C CA    . ILE A 1 128 ? 11.016  11.568  37.385  1.00 28.36 ? 128 ILE A CA    1 
ATOM   938  C C     . ILE A 1 128 ? 11.690  10.282  37.850  1.00 27.83 ? 128 ILE A C     1 
ATOM   939  O O     . ILE A 1 128 ? 12.167  10.187  38.989  1.00 26.50 ? 128 ILE A O     1 
ATOM   940  C CB    . ILE A 1 128 ? 9.466   11.430  37.662  1.00 27.30 ? 128 ILE A CB    1 
ATOM   941  C CG1   . ILE A 1 128 ? 8.779   12.760  37.256  1.00 25.85 ? 128 ILE A CG1   1 
ATOM   942  C CG2   . ILE A 1 128 ? 9.222   11.023  39.178  1.00 28.78 ? 128 ILE A CG2   1 
ATOM   943  C CD1   . ILE A 1 128 ? 7.188   12.607  37.118  1.00 27.30 ? 128 ILE A CD1   1 
ATOM   944  N N     . LEU A 1 129 ? 11.645  9.294   36.964  1.00 27.26 ? 129 LEU A N     1 
ATOM   945  C CA    . LEU A 1 129 ? 12.205  7.988   37.212  1.00 27.80 ? 129 LEU A CA    1 
ATOM   946  C C     . LEU A 1 129 ? 13.747  8.178   37.346  1.00 28.82 ? 129 LEU A C     1 
ATOM   947  O O     . LEU A 1 129 ? 14.354  7.471   38.109  1.00 28.21 ? 129 LEU A O     1 
ATOM   948  C CB    . LEU A 1 129 ? 11.883  7.095   36.025  1.00 28.73 ? 129 LEU A CB    1 
ATOM   949  C CG    . LEU A 1 129 ? 10.491  6.425   36.046  1.00 29.26 ? 129 LEU A CG    1 
ATOM   950  C CD1   . LEU A 1 129 ? 10.181  5.630   34.708  1.00 31.60 ? 129 LEU A CD1   1 
ATOM   951  C CD2   . LEU A 1 129 ? 10.515  5.483   37.224  1.00 27.97 ? 129 LEU A CD2   1 
ATOM   952  N N     . LYS A 1 130 ? 14.326  9.143   36.617  1.00 28.62 ? 130 LYS A N     1 
ATOM   953  C CA    . LYS A 1 130 ? 15.790  9.323   36.767  1.00 33.06 ? 130 LYS A CA    1 
ATOM   954  C C     . LYS A 1 130 ? 16.068  9.878   38.133  1.00 31.73 ? 130 LYS A C     1 
ATOM   955  O O     . LYS A 1 130 ? 16.997  9.443   38.803  1.00 34.57 ? 130 LYS A O     1 
ATOM   956  C CB    . LYS A 1 130 ? 16.345  10.193  35.647  1.00 33.14 ? 130 LYS A CB    1 
ATOM   957  C CG    . LYS A 1 130 ? 16.353  9.436   34.327  1.00 37.14 ? 130 LYS A CG    1 
ATOM   958  C CD    . LYS A 1 130 ? 16.584  10.312  33.122  1.00 39.39 ? 130 LYS A CD    1 
ATOM   959  C CE    . LYS A 1 130 ? 17.029  9.444   31.916  1.00 40.81 ? 130 LYS A CE    1 
ATOM   960  N NZ    . LYS A 1 130 ? 16.990  10.175  30.652  1.00 39.32 ? 130 LYS A NZ    1 
ATOM   961  N N     . GLY A 1 131 ? 15.242  10.831  38.570  1.00 31.56 ? 131 GLY A N     1 
ATOM   962  C CA    . GLY A 1 131 ? 15.368  11.377  39.905  1.00 29.45 ? 131 GLY A CA    1 
ATOM   963  C C     . GLY A 1 131 ? 15.147  10.321  40.983  1.00 30.65 ? 131 GLY A C     1 
ATOM   964  O O     . GLY A 1 131 ? 15.925  10.266  41.941  1.00 28.94 ? 131 GLY A O     1 
ATOM   965  N N     . LEU A 1 132 ? 14.112  9.469   40.872  1.00 26.46 ? 132 LEU A N     1 
ATOM   966  C CA    . LEU A 1 132 ? 13.901  8.441   41.890  1.00 27.35 ? 132 LEU A CA    1 
ATOM   967  C C     . LEU A 1 132 ? 15.059  7.446   41.948  1.00 27.93 ? 132 LEU A C     1 
ATOM   968  O O     . LEU A 1 132 ? 15.458  7.018   43.007  1.00 30.17 ? 132 LEU A O     1 
ATOM   969  C CB    . LEU A 1 132 ? 12.641  7.637   41.638  1.00 27.58 ? 132 LEU A CB    1 
ATOM   970  C CG    . LEU A 1 132 ? 11.389  8.514   41.850  1.00 28.83 ? 132 LEU A CG    1 
ATOM   971  C CD1   . LEU A 1 132 ? 10.077  7.725   41.449  1.00 28.53 ? 132 LEU A CD1   1 
ATOM   972  C CD2   . LEU A 1 132 ? 11.326  8.933   43.329  1.00 25.37 ? 132 LEU A CD2   1 
ATOM   973  N N     . ASP A 1 133 ? 15.581  7.092   40.798  1.00 29.87 ? 133 ASP A N     1 
ATOM   974  C CA    . ASP A 1 133 ? 16.683  6.135   40.765  1.00 30.47 ? 133 ASP A CA    1 
ATOM   975  C C     . ASP A 1 133 ? 17.882  6.727   41.517  1.00 29.64 ? 133 ASP A C     1 
ATOM   976  O O     . ASP A 1 133 ? 18.554  6.021   42.251  1.00 31.31 ? 133 ASP A O     1 
ATOM   977  C CB    . ASP A 1 133 ? 17.041  5.833   39.317  1.00 31.08 ? 133 ASP A CB    1 
ATOM   978  C CG    . ASP A 1 133 ? 18.181  4.838   39.203  1.00 33.16 ? 133 ASP A CG    1 
ATOM   979  O OD1   . ASP A 1 133 ? 18.077  3.726   39.748  1.00 32.77 ? 133 ASP A OD1   1 
ATOM   980  O OD2   . ASP A 1 133 ? 19.174  5.218   38.572  1.00 35.06 ? 133 ASP A OD2   1 
ATOM   981  N N     . TYR A 1 134 ? 18.153  8.018   41.321  1.00 32.67 ? 134 TYR A N     1 
ATOM   982  C CA    . TYR A 1 134 ? 19.289  8.686   42.036  1.00 32.56 ? 134 TYR A CA    1 
ATOM   983  C C     . TYR A 1 134 ? 19.013  8.656   43.527  1.00 31.92 ? 134 TYR A C     1 
ATOM   984  O O     . TYR A 1 134 ? 19.797  8.157   44.350  1.00 32.38 ? 134 TYR A O     1 
ATOM   985  C CB    . TYR A 1 134 ? 19.422  10.143  41.589  1.00 31.80 ? 134 TYR A CB    1 
ATOM   986  C CG    . TYR A 1 134 ? 20.315  10.919  42.524  1.00 35.21 ? 134 TYR A CG    1 
ATOM   987  C CD1   . TYR A 1 134 ? 21.736  10.839  42.410  1.00 34.41 ? 134 TYR A CD1   1 
ATOM   988  C CD2   . TYR A 1 134 ? 19.772  11.676  43.573  1.00 34.23 ? 134 TYR A CD2   1 
ATOM   989  C CE1   . TYR A 1 134 ? 22.572  11.516  43.313  1.00 35.92 ? 134 TYR A CE1   1 
ATOM   990  C CE2   . TYR A 1 134 ? 20.615  12.348  44.494  1.00 34.54 ? 134 TYR A CE2   1 
ATOM   991  C CZ    . TYR A 1 134 ? 22.003  12.267  44.358  1.00 37.41 ? 134 TYR A CZ    1 
ATOM   992  O OH    . TYR A 1 134 ? 22.798  12.909  45.322  1.00 36.97 ? 134 TYR A OH    1 
ATOM   993  N N     . LEU A 1 135 ? 17.835  9.142   43.903  1.00 30.07 ? 135 LEU A N     1 
ATOM   994  C CA    . LEU A 1 135 ? 17.521  9.142   45.318  1.00 29.65 ? 135 LEU A CA    1 
ATOM   995  C C     . LEU A 1 135 ? 17.561  7.763   45.901  1.00 30.03 ? 135 LEU A C     1 
ATOM   996  O O     . LEU A 1 135 ? 18.125  7.558   47.014  1.00 32.54 ? 135 LEU A O     1 
ATOM   997  C CB    . LEU A 1 135 ? 16.115  9.751   45.598  1.00 28.03 ? 135 LEU A CB    1 
ATOM   998  C CG    . LEU A 1 135 ? 15.963  11.238  45.346  1.00 29.48 ? 135 LEU A CG    1 
ATOM   999  C CD1   . LEU A 1 135 ? 14.470  11.592  45.498  1.00 29.59 ? 135 LEU A CD1   1 
ATOM   1000 C CD2   . LEU A 1 135 ? 16.737  12.025  46.432  1.00 26.53 ? 135 LEU A CD2   1 
ATOM   1001 N N     . HIS A 1 136 ? 17.001  6.785   45.184  1.00 28.94 ? 136 HIS A N     1 
ATOM   1002 C CA    . HIS A 1 136 ? 16.985  5.452   45.761  1.00 30.67 ? 136 HIS A CA    1 
ATOM   1003 C C     . HIS A 1 136 ? 18.381  4.877   45.913  1.00 31.89 ? 136 HIS A C     1 
ATOM   1004 O O     . HIS A 1 136 ? 18.637  4.194   46.877  1.00 33.43 ? 136 HIS A O     1 
ATOM   1005 C CB    . HIS A 1 136 ? 16.046  4.545   44.946  1.00 32.20 ? 136 HIS A CB    1 
ATOM   1006 C CG    . HIS A 1 136 ? 14.606  4.996   45.011  1.00 30.87 ? 136 HIS A CG    1 
ATOM   1007 N ND1   . HIS A 1 136 ? 13.618  4.474   44.211  1.00 33.00 ? 136 HIS A ND1   1 
ATOM   1008 C CD2   . HIS A 1 136 ? 13.987  5.896   45.827  1.00 34.32 ? 136 HIS A CD2   1 
ATOM   1009 C CE1   . HIS A 1 136 ? 12.447  5.024   44.530  1.00 31.24 ? 136 HIS A CE1   1 
ATOM   1010 N NE2   . HIS A 1 136 ? 12.644  5.894   45.511  1.00 29.29 ? 136 HIS A NE2   1 
ATOM   1011 N N     . SER A 1 137 ? 19.256  5.157   44.963  1.00 32.62 ? 137 SER A N     1 
ATOM   1012 C CA    . SER A 1 137 ? 20.658  4.689   44.998  1.00 34.53 ? 137 SER A CA    1 
ATOM   1013 C C     . SER A 1 137 ? 21.382  5.318   46.231  1.00 37.02 ? 137 SER A C     1 
ATOM   1014 O O     . SER A 1 137 ? 22.283  4.725   46.859  1.00 37.48 ? 137 SER A O     1 
ATOM   1015 C CB    . SER A 1 137 ? 21.325  5.113   43.677  1.00 33.37 ? 137 SER A CB    1 
ATOM   1016 O OG    . SER A 1 137 ? 21.581  6.520   43.667  1.00 37.85 ? 137 SER A OG    1 
ATOM   1017 N N     . GLU A 1 138 ? 20.984  6.544   46.576  1.00 37.44 ? 138 GLU A N     1 
ATOM   1018 C CA    . GLU A 1 138 ? 21.530  7.238   47.724  1.00 36.84 ? 138 GLU A CA    1 
ATOM   1019 C C     . GLU A 1 138 ? 20.780  6.854   48.984  1.00 37.27 ? 138 GLU A C     1 
ATOM   1020 O O     . GLU A 1 138 ? 20.945  7.486   50.021  1.00 37.32 ? 138 GLU A O     1 
ATOM   1021 C CB    . GLU A 1 138 ? 21.466  8.761   47.523  1.00 37.26 ? 138 GLU A CB    1 
ATOM   1022 C CG    . GLU A 1 138 ? 22.373  9.233   46.416  1.00 36.49 ? 138 GLU A CG    1 
ATOM   1023 C CD    . GLU A 1 138 ? 23.859  9.201   46.862  1.00 41.50 ? 138 GLU A CD    1 
ATOM   1024 O OE1   . GLU A 1 138 ? 24.111  9.572   48.029  1.00 39.21 ? 138 GLU A OE1   1 
ATOM   1025 O OE2   . GLU A 1 138 ? 24.731  8.820   46.060  1.00 41.33 ? 138 GLU A OE2   1 
ATOM   1026 N N     . LYS A 1 139 ? 19.987  5.785   48.912  1.00 36.64 ? 139 LYS A N     1 
ATOM   1027 C CA    . LYS A 1 139 ? 19.219  5.350   50.061  1.00 37.50 ? 139 LYS A CA    1 
ATOM   1028 C C     . LYS A 1 139 ? 18.260  6.416   50.604  1.00 36.39 ? 139 LYS A C     1 
ATOM   1029 O O     . LYS A 1 139 ? 17.970  6.464   51.810  1.00 37.18 ? 139 LYS A O     1 
ATOM   1030 C CB    . LYS A 1 139 ? 20.169  4.844   51.179  1.00 41.47 ? 139 LYS A CB    1 
ATOM   1031 C CG    . LYS A 1 139 ? 20.951  3.592   50.745  1.00 46.37 ? 139 LYS A CG    1 
ATOM   1032 C CD    . LYS A 1 139 ? 19.966  2.492   50.289  1.00 50.25 ? 139 LYS A CD    1 
ATOM   1033 C CE    . LYS A 1 139 ? 20.529  1.616   49.155  1.00 52.79 ? 139 LYS A CE    1 
ATOM   1034 N NZ    . LYS A 1 139 ? 21.137  2.408   48.027  1.00 54.54 ? 139 LYS A NZ    1 
ATOM   1035 N N     . LYS A 1 140 ? 17.744  7.275   49.726  1.00 35.42 ? 140 LYS A N     1 
ATOM   1036 C CA    . LYS A 1 140 ? 16.773  8.280   50.197  1.00 35.33 ? 140 LYS A CA    1 
ATOM   1037 C C     . LYS A 1 140 ? 15.371  7.964   49.632  1.00 35.22 ? 140 LYS A C     1 
ATOM   1038 O O     . LYS A 1 140 ? 15.287  7.291   48.602  1.00 33.23 ? 140 LYS A O     1 
ATOM   1039 C CB    . LYS A 1 140 ? 17.198  9.667   49.737  1.00 37.14 ? 140 LYS A CB    1 
ATOM   1040 C CG    . LYS A 1 140 ? 18.422  10.192  50.502  1.00 39.92 ? 140 LYS A CG    1 
ATOM   1041 C CD    . LYS A 1 140 ? 18.680  11.628  50.168  1.00 42.25 ? 140 LYS A CD    1 
ATOM   1042 C CE    . LYS A 1 140 ? 19.686  12.229  51.170  1.00 44.15 ? 140 LYS A CE    1 
ATOM   1043 N NZ    . LYS A 1 140 ? 21.067  11.609  51.126  1.00 43.90 ? 140 LYS A NZ    1 
ATOM   1044 N N     . ILE A 1 141 ? 14.307  8.399   50.313  1.00 32.70 ? 141 ILE A N     1 
ATOM   1045 C CA    . ILE A 1 141 ? 12.951  8.150   49.820  1.00 32.78 ? 141 ILE A CA    1 
ATOM   1046 C C     . ILE A 1 141 ? 12.360  9.537   49.703  1.00 34.19 ? 141 ILE A C     1 
ATOM   1047 O O     . ILE A 1 141 ? 12.487  10.330  50.663  1.00 34.12 ? 141 ILE A O     1 
ATOM   1048 C CB    . ILE A 1 141 ? 12.100  7.360   50.829  1.00 35.32 ? 141 ILE A CB    1 
ATOM   1049 C CG1   . ILE A 1 141 ? 12.754  6.001   51.119  1.00 36.92 ? 141 ILE A CG1   1 
ATOM   1050 C CG2   . ILE A 1 141 ? 10.627  7.037   50.253  1.00 31.86 ? 141 ILE A CG2   1 
ATOM   1051 C CD1   . ILE A 1 141 ? 12.120  5.425   52.328  1.00 37.66 ? 141 ILE A CD1   1 
ATOM   1052 N N     . HIS A 1 142 ? 11.720  9.840   48.566  1.00 31.12 ? 142 HIS A N     1 
ATOM   1053 C CA    . HIS A 1 142 ? 11.108  11.146  48.420  1.00 29.50 ? 142 HIS A CA    1 
ATOM   1054 C C     . HIS A 1 142 ? 9.930   11.293  49.401  1.00 29.13 ? 142 HIS A C     1 
ATOM   1055 O O     . HIS A 1 142 ? 9.832   12.298  50.130  1.00 26.24 ? 142 HIS A O     1 
ATOM   1056 C CB    . HIS A 1 142 ? 10.603  11.372  46.963  1.00 29.75 ? 142 HIS A CB    1 
ATOM   1057 C CG    . HIS A 1 142 ? 10.117  12.777  46.727  1.00 27.53 ? 142 HIS A CG    1 
ATOM   1058 N ND1   . HIS A 1 142 ? 8.861   13.206  47.099  1.00 29.27 ? 142 HIS A ND1   1 
ATOM   1059 C CD2   . HIS A 1 142 ? 10.775  13.876  46.284  1.00 29.49 ? 142 HIS A CD2   1 
ATOM   1060 C CE1   . HIS A 1 142 ? 8.768   14.512  46.899  1.00 28.54 ? 142 HIS A CE1   1 
ATOM   1061 N NE2   . HIS A 1 142 ? 9.914   14.942  46.403  1.00 29.65 ? 142 HIS A NE2   1 
ATOM   1062 N N     . ARG A 1 143 ? 9.027   10.316  49.385  1.00 27.48 ? 143 ARG A N     1 
ATOM   1063 C CA    . ARG A 1 143 ? 7.848   10.296  50.223  1.00 30.54 ? 143 ARG A CA    1 
ATOM   1064 C C     . ARG A 1 143 ? 6.648   11.180  49.831  1.00 29.73 ? 143 ARG A C     1 
ATOM   1065 O O     . ARG A 1 143 ? 5.575   11.034  50.424  1.00 28.80 ? 143 ARG A O     1 
ATOM   1066 C CB    . ARG A 1 143 ? 8.216   10.588  51.672  1.00 33.38 ? 143 ARG A CB    1 
ATOM   1067 C CG    . ARG A 1 143 ? 9.041   9.437   52.311  1.00 39.69 ? 143 ARG A CG    1 
ATOM   1068 C CD    . ARG A 1 143 ? 9.721   9.955   53.603  1.00 44.81 ? 143 ARG A CD    1 
ATOM   1069 N NE    . ARG A 1 143 ? 9.511   9.027   54.675  1.00 46.43 ? 143 ARG A NE    1 
ATOM   1070 C CZ    . ARG A 1 143 ? 9.551   9.319   55.972  1.00 50.28 ? 143 ARG A CZ    1 
ATOM   1071 N NH1   . ARG A 1 143 ? 9.331   8.322   56.821  1.00 48.88 ? 143 ARG A NH1   1 
ATOM   1072 N NH2   . ARG A 1 143 ? 9.802   10.574  56.426  1.00 49.24 ? 143 ARG A NH2   1 
ATOM   1073 N N     . ASP A 1 144 ? 6.828   12.088  48.884  1.00 29.12 ? 144 ASP A N     1 
ATOM   1074 C CA    . ASP A 1 144 ? 5.714   12.961  48.431  1.00 28.09 ? 144 ASP A CA    1 
ATOM   1075 C C     . ASP A 1 144 ? 5.780   13.185  46.892  1.00 27.69 ? 144 ASP A C     1 
ATOM   1076 O O     . ASP A 1 144 ? 5.711   14.341  46.360  1.00 27.48 ? 144 ASP A O     1 
ATOM   1077 C CB    . ASP A 1 144 ? 5.715   14.306  49.213  1.00 26.96 ? 144 ASP A CB    1 
ATOM   1078 C CG    . ASP A 1 144 ? 4.338   15.034  49.172  1.00 32.67 ? 144 ASP A CG    1 
ATOM   1079 O OD1   . ASP A 1 144 ? 3.318   14.390  48.883  1.00 29.90 ? 144 ASP A OD1   1 
ATOM   1080 O OD2   . ASP A 1 144 ? 4.292   16.249  49.429  1.00 34.11 ? 144 ASP A OD2   1 
ATOM   1081 N N     . ILE A 1 145 ? 5.866   12.080  46.155  1.00 24.21 ? 145 ILE A N     1 
ATOM   1082 C CA    . ILE A 1 145 ? 5.877   12.174  44.673  1.00 25.46 ? 145 ILE A CA    1 
ATOM   1083 C C     . ILE A 1 145 ? 4.392   12.434  44.185  1.00 26.42 ? 145 ILE A C     1 
ATOM   1084 O O     . ILE A 1 145 ? 3.504   11.646  44.532  1.00 24.31 ? 145 ILE A O     1 
ATOM   1085 C CB    . ILE A 1 145 ? 6.373   10.861  44.040  1.00 24.05 ? 145 ILE A CB    1 
ATOM   1086 C CG1   . ILE A 1 145 ? 7.899   10.645  44.445  1.00 27.07 ? 145 ILE A CG1   1 
ATOM   1087 C CG2   . ILE A 1 145 ? 6.272   10.930  42.494  1.00 25.18 ? 145 ILE A CG2   1 
ATOM   1088 C CD1   . ILE A 1 145 ? 8.746   11.740  43.900  1.00 21.65 ? 145 ILE A CD1   1 
ATOM   1089 N N     . LYS A 1 146 ? 4.197   13.501  43.399  1.00 26.47 ? 146 LYS A N     1 
ATOM   1090 C CA    . LYS A 1 146 ? 2.904   13.912  42.820  1.00 28.69 ? 146 LYS A CA    1 
ATOM   1091 C C     . LYS A 1 146 ? 3.232   14.994  41.818  1.00 29.83 ? 146 LYS A C     1 
ATOM   1092 O O     . LYS A 1 146 ? 4.300   15.646  41.920  1.00 29.22 ? 146 LYS A O     1 
ATOM   1093 C CB    . LYS A 1 146 ? 1.966   14.429  43.904  1.00 30.24 ? 146 LYS A CB    1 
ATOM   1094 C CG    . LYS A 1 146 ? 2.547   15.557  44.738  1.00 31.38 ? 146 LYS A CG    1 
ATOM   1095 C CD    . LYS A 1 146 ? 1.867   15.618  46.078  1.00 36.16 ? 146 LYS A CD    1 
ATOM   1096 C CE    . LYS A 1 146 ? 0.594   16.335  46.043  1.00 36.18 ? 146 LYS A CE    1 
ATOM   1097 N NZ    . LYS A 1 146 ? 0.350   17.018  47.400  1.00 39.89 ? 146 LYS A NZ    1 
ATOM   1098 N N     . ALA A 1 147 ? 2.366   15.215  40.836  1.00 27.42 ? 147 ALA A N     1 
ATOM   1099 C CA    . ALA A 1 147 ? 2.676   16.189  39.793  1.00 29.70 ? 147 ALA A CA    1 
ATOM   1100 C C     . ALA A 1 147 ? 2.994   17.653  40.307  1.00 30.09 ? 147 ALA A C     1 
ATOM   1101 O O     . ALA A 1 147 ? 3.740   18.414  39.667  1.00 29.60 ? 147 ALA A O     1 
ATOM   1102 C CB    . ALA A 1 147 ? 1.513   16.184  38.765  1.00 31.58 ? 147 ALA A CB    1 
ATOM   1103 N N     . ALA A 1 148 ? 2.461   18.012  41.468  1.00 27.77 ? 148 ALA A N     1 
ATOM   1104 C CA    . ALA A 1 148 ? 2.672   19.335  42.065  1.00 30.34 ? 148 ALA A CA    1 
ATOM   1105 C C     . ALA A 1 148 ? 4.123   19.477  42.540  1.00 31.18 ? 148 ALA A C     1 
ATOM   1106 O O     . ALA A 1 148 ? 4.595   20.583  42.701  1.00 28.72 ? 148 ALA A O     1 
ATOM   1107 C CB    . ALA A 1 148 ? 1.778   19.534  43.289  1.00 31.18 ? 148 ALA A CB    1 
ATOM   1108 N N     . ASN A 1 149 ? 4.781   18.342  42.770  1.00 29.98 ? 149 ASN A N     1 
ATOM   1109 C CA    . ASN A 1 149 ? 6.156   18.357  43.260  1.00 30.80 ? 149 ASN A CA    1 
ATOM   1110 C C     . ASN A 1 149 ? 7.212   18.053  42.181  1.00 31.70 ? 149 ASN A C     1 
ATOM   1111 O O     . ASN A 1 149 ? 8.387   17.825  42.494  1.00 30.32 ? 149 ASN A O     1 
ATOM   1112 C CB    . ASN A 1 149 ? 6.246   17.391  44.472  1.00 25.63 ? 149 ASN A CB    1 
ATOM   1113 C CG    . ASN A 1 149 ? 5.576   17.968  45.723  1.00 24.07 ? 149 ASN A CG    1 
ATOM   1114 O OD1   . ASN A 1 149 ? 5.463   19.195  45.883  1.00 26.08 ? 149 ASN A OD1   1 
ATOM   1115 N ND2   . ASN A 1 149 ? 5.155   17.124  46.615  1.00 22.79 ? 149 ASN A ND2   1 
ATOM   1116 N N     . VAL A 1 150 ? 6.802   18.057  40.909  1.00 31.10 ? 150 VAL A N     1 
ATOM   1117 C CA    . VAL A 1 150 ? 7.712   17.802  39.779  1.00 32.56 ? 150 VAL A CA    1 
ATOM   1118 C C     . VAL A 1 150 ? 7.810   19.134  39.046  1.00 34.43 ? 150 VAL A C     1 
ATOM   1119 O O     . VAL A 1 150 ? 6.830   19.579  38.425  1.00 33.47 ? 150 VAL A O     1 
ATOM   1120 C CB    . VAL A 1 150 ? 7.145   16.668  38.860  1.00 30.13 ? 150 VAL A CB    1 
ATOM   1121 C CG1   . VAL A 1 150 ? 8.062   16.381  37.668  1.00 27.13 ? 150 VAL A CG1   1 
ATOM   1122 C CG2   . VAL A 1 150 ? 7.009   15.396  39.691  1.00 31.04 ? 150 VAL A CG2   1 
ATOM   1123 N N     . LEU A 1 151 ? 8.981   19.787  39.152  1.00 34.83 ? 151 LEU A N     1 
ATOM   1124 C CA    . LEU A 1 151 ? 9.140   21.127  38.559  1.00 35.99 ? 151 LEU A CA    1 
ATOM   1125 C C     . LEU A 1 151 ? 9.882   21.148  37.243  1.00 37.27 ? 151 LEU A C     1 
ATOM   1126 O O     . LEU A 1 151 ? 10.777  20.360  37.012  1.00 36.61 ? 151 LEU A O     1 
ATOM   1127 C CB    . LEU A 1 151 ? 9.847   22.094  39.535  1.00 34.82 ? 151 LEU A CB    1 
ATOM   1128 C CG    . LEU A 1 151 ? 9.188   22.378  40.881  1.00 37.07 ? 151 LEU A CG    1 
ATOM   1129 C CD1   . LEU A 1 151 ? 9.873   23.525  41.581  1.00 33.12 ? 151 LEU A CD1   1 
ATOM   1130 C CD2   . LEU A 1 151 ? 7.673   22.748  40.657  1.00 35.46 ? 151 LEU A CD2   1 
ATOM   1131 N N     . LEU A 1 152 ? 9.479   22.040  36.343  1.00 36.71 ? 152 LEU A N     1 
ATOM   1132 C CA    . LEU A 1 152 ? 10.204  22.104  35.084  1.00 37.51 ? 152 LEU A CA    1 
ATOM   1133 C C     . LEU A 1 152 ? 10.980  23.414  34.898  1.00 37.79 ? 152 LEU A C     1 
ATOM   1134 O O     . LEU A 1 152 ? 10.579  24.449  35.393  1.00 36.38 ? 152 LEU A O     1 
ATOM   1135 C CB    . LEU A 1 152 ? 9.259   21.868  33.894  1.00 37.72 ? 152 LEU A CB    1 
ATOM   1136 C CG    . LEU A 1 152 ? 8.970   20.375  33.619  1.00 35.10 ? 152 LEU A CG    1 
ATOM   1137 C CD1   . LEU A 1 152 ? 7.883   19.874  34.612  1.00 36.69 ? 152 LEU A CD1   1 
ATOM   1138 C CD2   . LEU A 1 152 ? 8.510   20.203  32.237  1.00 36.66 ? 152 LEU A CD2   1 
ATOM   1139 N N     . SER A 1 153 ? 12.113  23.325  34.222  1.00 39.88 ? 153 SER A N     1 
ATOM   1140 C CA    . SER A 1 153 ? 12.932  24.509  33.913  1.00 42.77 ? 153 SER A CA    1 
ATOM   1141 C C     . SER A 1 153 ? 12.272  25.095  32.646  1.00 45.09 ? 153 SER A C     1 
ATOM   1142 O O     . SER A 1 153 ? 11.424  24.432  32.023  1.00 41.33 ? 153 SER A O     1 
ATOM   1143 C CB    . SER A 1 153 ? 14.377  24.101  33.598  1.00 41.93 ? 153 SER A CB    1 
ATOM   1144 O OG    . SER A 1 153 ? 14.491  23.518  32.310  1.00 42.14 ? 153 SER A OG    1 
ATOM   1145 N N     . GLU A 1 154 ? 12.610  26.328  32.259  1.00 47.46 ? 154 GLU A N     1 
ATOM   1146 C CA    . GLU A 1 154 ? 11.953  26.834  31.065  1.00 51.18 ? 154 GLU A CA    1 
ATOM   1147 C C     . GLU A 1 154 ? 12.329  26.072  29.784  1.00 51.53 ? 154 GLU A C     1 
ATOM   1148 O O     . GLU A 1 154 ? 11.583  26.103  28.810  1.00 52.16 ? 154 GLU A O     1 
ATOM   1149 C CB    . GLU A 1 154 ? 12.157  28.359  30.901  1.00 53.39 ? 154 GLU A CB    1 
ATOM   1150 C CG    . GLU A 1 154 ? 13.595  28.869  30.841  1.00 56.99 ? 154 GLU A CG    1 
ATOM   1151 C CD    . GLU A 1 154 ? 13.673  30.353  30.396  1.00 59.49 ? 154 GLU A CD    1 
ATOM   1152 O OE1   . GLU A 1 154 ? 12.837  31.177  30.852  1.00 60.18 ? 154 GLU A OE1   1 
ATOM   1153 O OE2   . GLU A 1 154 ? 14.574  30.691  29.597  1.00 60.75 ? 154 GLU A OE2   1 
ATOM   1154 N N     . HIS A 1 155 ? 13.457  25.369  29.762  1.00 51.71 ? 155 HIS A N     1 
ATOM   1155 C CA    . HIS A 1 155 ? 13.803  24.619  28.553  1.00 52.76 ? 155 HIS A CA    1 
ATOM   1156 C C     . HIS A 1 155 ? 13.285  23.201  28.571  1.00 52.21 ? 155 HIS A C     1 
ATOM   1157 O O     . HIS A 1 155 ? 13.632  22.432  27.686  1.00 52.40 ? 155 HIS A O     1 
ATOM   1158 C CB    . HIS A 1 155 ? 15.324  24.536  28.319  1.00 55.39 ? 155 HIS A CB    1 
ATOM   1159 C CG    . HIS A 1 155 ? 15.945  25.843  27.952  1.00 58.02 ? 155 HIS A CG    1 
ATOM   1160 N ND1   . HIS A 1 155 ? 15.211  26.892  27.436  1.00 59.02 ? 155 HIS A ND1   1 
ATOM   1161 C CD2   . HIS A 1 155 ? 17.223  26.284  28.053  1.00 58.81 ? 155 HIS A CD2   1 
ATOM   1162 C CE1   . HIS A 1 155 ? 16.009  27.926  27.240  1.00 59.69 ? 155 HIS A CE1   1 
ATOM   1163 N NE2   . HIS A 1 155 ? 17.234  27.583  27.604  1.00 60.02 ? 155 HIS A NE2   1 
ATOM   1164 N N     . GLY A 1 156 ? 12.499  22.823  29.584  1.00 51.88 ? 156 GLY A N     1 
ATOM   1165 C CA    . GLY A 1 156 ? 11.963  21.456  29.608  1.00 50.52 ? 156 GLY A CA    1 
ATOM   1166 C C     . GLY A 1 156 ? 12.597  20.442  30.546  1.00 49.21 ? 156 GLY A C     1 
ATOM   1167 O O     . GLY A 1 156 ? 12.180  19.281  30.563  1.00 49.41 ? 156 GLY A O     1 
ATOM   1168 N N     . GLU A 1 157 ? 13.617  20.831  31.309  1.00 46.66 ? 157 GLU A N     1 
ATOM   1169 C CA    . GLU A 1 157 ? 14.232  19.900  32.248  1.00 45.28 ? 157 GLU A CA    1 
ATOM   1170 C C     . GLU A 1 157 ? 13.282  19.658  33.417  1.00 42.74 ? 157 GLU A C     1 
ATOM   1171 O O     . GLU A 1 157 ? 12.669  20.581  33.946  1.00 42.50 ? 157 GLU A O     1 
ATOM   1172 C CB    . GLU A 1 157 ? 15.539  20.459  32.790  1.00 47.80 ? 157 GLU A CB    1 
ATOM   1173 C CG    . GLU A 1 157 ? 16.734  19.838  32.151  1.00 52.67 ? 157 GLU A CG    1 
ATOM   1174 C CD    . GLU A 1 157 ? 16.771  20.030  30.659  1.00 55.57 ? 157 GLU A CD    1 
ATOM   1175 O OE1   . GLU A 1 157 ? 16.698  21.215  30.210  1.00 58.39 ? 157 GLU A OE1   1 
ATOM   1176 O OE2   . GLU A 1 157 ? 16.892  19.000  29.934  1.00 57.53 ? 157 GLU A OE2   1 
ATOM   1177 N N     . VAL A 1 158 ? 13.194  18.407  33.822  1.00 41.95 ? 158 VAL A N     1 
ATOM   1178 C CA    . VAL A 1 158 ? 12.295  17.998  34.890  1.00 40.91 ? 158 VAL A CA    1 
ATOM   1179 C C     . VAL A 1 158 ? 13.005  17.621  36.166  1.00 40.04 ? 158 VAL A C     1 
ATOM   1180 O O     . VAL A 1 158 ? 13.877  16.766  36.146  1.00 40.71 ? 158 VAL A O     1 
ATOM   1181 C CB    . VAL A 1 158 ? 11.460  16.785  34.470  1.00 39.05 ? 158 VAL A CB    1 
ATOM   1182 C CG1   . VAL A 1 158 ? 10.484  16.414  35.605  1.00 39.49 ? 158 VAL A CG1   1 
ATOM   1183 C CG2   . VAL A 1 158 ? 10.745  17.075  33.157  1.00 39.34 ? 158 VAL A CG2   1 
ATOM   1184 N N     . LYS A 1 159 ? 12.568  18.200  37.287  1.00 39.09 ? 159 LYS A N     1 
ATOM   1185 C CA    . LYS A 1 159 ? 13.220  17.908  38.568  1.00 39.00 ? 159 LYS A CA    1 
ATOM   1186 C C     . LYS A 1 159 ? 12.317  17.705  39.752  1.00 38.00 ? 159 LYS A C     1 
ATOM   1187 O O     . LYS A 1 159 ? 11.201  18.250  39.838  1.00 37.48 ? 159 LYS A O     1 
ATOM   1188 C CB    . LYS A 1 159 ? 14.219  19.015  38.886  1.00 38.64 ? 159 LYS A CB    1 
ATOM   1189 C CG    . LYS A 1 159 ? 14.976  19.377  37.621  1.00 41.16 ? 159 LYS A CG    1 
ATOM   1190 C CD    . LYS A 1 159 ? 16.002  20.460  37.823  1.00 42.91 ? 159 LYS A CD    1 
ATOM   1191 C CE    . LYS A 1 159 ? 16.766  20.753  36.511  1.00 40.68 ? 159 LYS A CE    1 
ATOM   1192 N NZ    . LYS A 1 159 ? 18.212  20.602  36.704  1.00 41.13 ? 159 LYS A NZ    1 
ATOM   1193 N N     . LEU A 1 160 ? 12.832  16.913  40.683  1.00 38.41 ? 160 LEU A N     1 
ATOM   1194 C CA    . LEU A 1 160 ? 12.143  16.634  41.912  1.00 35.98 ? 160 LEU A CA    1 
ATOM   1195 C C     . LEU A 1 160 ? 12.313  17.763  42.923  1.00 38.84 ? 160 LEU A C     1 
ATOM   1196 O O     . LEU A 1 160 ? 13.412  18.281  43.147  1.00 37.80 ? 160 LEU A O     1 
ATOM   1197 C CB    . LEU A 1 160 ? 12.630  15.313  42.516  1.00 33.41 ? 160 LEU A CB    1 
ATOM   1198 C CG    . LEU A 1 160 ? 12.367  14.092  41.633  1.00 31.90 ? 160 LEU A CG    1 
ATOM   1199 C CD1   . LEU A 1 160 ? 12.711  12.845  42.441  1.00 31.18 ? 160 LEU A CD1   1 
ATOM   1200 C CD2   . LEU A 1 160 ? 10.907  14.025  41.156  1.00 31.45 ? 160 LEU A CD2   1 
ATOM   1201 N N     . ALA A 1 161 ? 11.191  18.125  43.545  1.00 37.82 ? 161 ALA A N     1 
ATOM   1202 C CA    . ALA A 1 161 ? 11.158  19.181  44.532  1.00 39.67 ? 161 ALA A CA    1 
ATOM   1203 C C     . ALA A 1 161 ? 10.338  18.764  45.742  1.00 38.72 ? 161 ALA A C     1 
ATOM   1204 O O     . ALA A 1 161 ? 9.750   17.684  45.748  1.00 35.99 ? 161 ALA A O     1 
ATOM   1205 C CB    . ALA A 1 161 ? 10.560  20.399  43.891  1.00 38.27 ? 161 ALA A CB    1 
ATOM   1206 N N     . ASP A 1 162 ? 10.311  19.606  46.772  1.00 38.38 ? 162 ASP A N     1 
ATOM   1207 C CA    . ASP A 1 162 ? 9.479   19.351  47.949  1.00 41.11 ? 162 ASP A CA    1 
ATOM   1208 C C     . ASP A 1 162 ? 9.677   17.993  48.646  1.00 41.86 ? 162 ASP A C     1 
ATOM   1209 O O     . ASP A 1 162 ? 8.806   17.141  48.738  1.00 40.48 ? 162 ASP A O     1 
ATOM   1210 C CB    . ASP A 1 162 ? 7.993   19.589  47.602  1.00 41.26 ? 162 ASP A CB    1 
ATOM   1211 C CG    . ASP A 1 162 ? 7.125   20.024  48.856  1.00 46.55 ? 162 ASP A CG    1 
ATOM   1212 O OD1   . ASP A 1 162 ? 7.673   20.230  49.981  1.00 50.00 ? 162 ASP A OD1   1 
ATOM   1213 O OD2   . ASP A 1 162 ? 5.869   20.159  48.739  1.00 48.80 ? 162 ASP A OD2   1 
ATOM   1214 N N     . PHE A 1 163 ? 10.853  17.811  49.186  1.00 44.96 ? 163 PHE A N     1 
ATOM   1215 C CA    . PHE A 1 163 ? 11.116  16.571  49.864  1.00 46.88 ? 163 PHE A CA    1 
ATOM   1216 C C     . PHE A 1 163 ? 10.280  16.635  51.128  1.00 49.90 ? 163 PHE A C     1 
ATOM   1217 O O     . PHE A 1 163 ? 9.358   15.762  51.320  1.00 45.73 ? 163 PHE A O     1 
ATOM   1218 C CB    . PHE A 1 163 ? 12.626  16.514  50.081  1.00 49.02 ? 163 PHE A CB    1 
ATOM   1219 C CG    . PHE A 1 163 ? 13.337  16.266  48.814  1.00 47.75 ? 163 PHE A CG    1 
ATOM   1220 C CD1   . PHE A 1 163 ? 13.841  15.008  48.529  1.00 45.92 ? 163 PHE A CD1   1 
ATOM   1221 C CD2   . PHE A 1 163 ? 13.279  17.229  47.797  1.00 48.36 ? 163 PHE A CD2   1 
ATOM   1222 C CE1   . PHE A 1 163 ? 14.271  14.683  47.255  1.00 45.52 ? 163 PHE A CE1   1 
ATOM   1223 C CE2   . PHE A 1 163 ? 13.703  16.922  46.489  1.00 47.62 ? 163 PHE A CE2   1 
ATOM   1224 C CZ    . PHE A 1 163 ? 14.198  15.634  46.220  1.00 46.03 ? 163 PHE A CZ    1 
ATOM   1225 N N     . GLY A 1 164 ? 10.603  17.722  51.886  1.00 49.95 ? 164 GLY A N     1 
ATOM   1226 C CA    . GLY A 1 164 ? 10.006  18.153  53.156  1.00 51.13 ? 164 GLY A CA    1 
ATOM   1227 C C     . GLY A 1 164 ? 9.826   17.034  54.152  1.00 50.53 ? 164 GLY A C     1 
ATOM   1228 O O     . GLY A 1 164 ? 10.144  17.141  55.332  1.00 51.00 ? 164 GLY A O     1 
ATOM   1229 N N     . VAL A 1 165 ? 9.318   15.935  53.627  1.00 49.70 ? 165 VAL A N     1 
ATOM   1230 C CA    . VAL A 1 165 ? 9.051   14.747  54.398  1.00 49.44 ? 165 VAL A CA    1 
ATOM   1231 C C     . VAL A 1 165 ? 9.871   13.640  53.820  1.00 48.37 ? 165 VAL A C     1 
ATOM   1232 O O     . VAL A 1 165 ? 9.563   12.490  54.050  1.00 48.26 ? 165 VAL A O     1 
ATOM   1233 C CB    . VAL A 1 165 ? 7.572   14.345  54.291  1.00 48.43 ? 165 VAL A CB    1 
ATOM   1234 C CG1   . VAL A 1 165 ? 6.720   15.434  54.837  1.00 50.36 ? 165 VAL A CG1   1 
ATOM   1235 C CG2   . VAL A 1 165 ? 7.213   14.049  52.813  1.00 47.90 ? 165 VAL A CG2   1 
ATOM   1236 N N     . ALA A 1 166 ? 10.894  13.982  53.042  1.00 49.90 ? 166 ALA A N     1 
ATOM   1237 C CA    . ALA A 1 166 ? 11.759  12.947  52.462  1.00 53.48 ? 166 ALA A CA    1 
ATOM   1238 C C     . ALA A 1 166 ? 12.443  12.173  53.590  1.00 57.17 ? 166 ALA A C     1 
ATOM   1239 O O     . ALA A 1 166 ? 12.867  12.793  54.600  1.00 57.09 ? 166 ALA A O     1 
ATOM   1240 C CB    . ALA A 1 166 ? 12.796  13.572  51.571  1.00 52.90 ? 166 ALA A CB    1 
ATOM   1241 N N     . GLY A 1 167 ? 12.531  10.836  53.414  1.00 60.01 ? 167 GLY A N     1 
ATOM   1242 C CA    . GLY A 1 167 ? 13.140  9.946   54.398  1.00 63.48 ? 167 GLY A CA    1 
ATOM   1243 C C     . GLY A 1 167 ? 14.550  9.397   54.097  1.00 65.82 ? 167 GLY A C     1 
ATOM   1244 O O     . GLY A 1 167 ? 15.007  9.366   52.948  1.00 63.38 ? 167 GLY A O     1 
ATOM   1245 N N     . GLN A 1 168 ? 15.255  8.973   55.145  1.00 68.96 ? 168 GLN A N     1 
ATOM   1246 C CA    . GLN A 1 168 ? 16.601  8.417   54.955  1.00 73.28 ? 168 GLN A CA    1 
ATOM   1247 C C     . GLN A 1 168 ? 16.722  6.993   55.514  1.00 75.60 ? 168 GLN A C     1 
ATOM   1248 O O     . GLN A 1 168 ? 16.784  6.793   56.731  1.00 76.25 ? 168 GLN A O     1 
ATOM   1249 C CB    . GLN A 1 168 ? 17.662  9.327   55.596  1.00 72.51 ? 168 GLN A CB    1 
ATOM   1250 C CG    . GLN A 1 168 ? 19.120  8.905   55.332  1.00 72.20 ? 168 GLN A CG    1 
ATOM   1251 C CD    . GLN A 1 168 ? 19.640  9.242   53.922  1.00 72.42 ? 168 GLN A CD    1 
ATOM   1252 O OE1   . GLN A 1 168 ? 19.637  10.398  53.505  1.00 72.69 ? 168 GLN A OE1   1 
ATOM   1253 N NE2   . GLN A 1 168 ? 20.107  8.220   53.195  1.00 71.89 ? 168 GLN A NE2   1 
ATOM   1254 N N     . LEU A 1 169 ? 16.751  6.014   54.609  1.00 78.66 ? 169 LEU A N     1 
ATOM   1255 C CA    . LEU A 1 169 ? 16.879  4.601   54.981  1.00 81.28 ? 169 LEU A CA    1 
ATOM   1256 C C     . LEU A 1 169 ? 18.358  4.325   55.172  1.00 83.00 ? 169 LEU A C     1 
ATOM   1257 O O     . LEU A 1 169 ? 18.980  3.697   54.317  1.00 83.47 ? 169 LEU A O     1 
ATOM   1258 C CB    . LEU A 1 169 ? 16.380  3.682   53.856  1.00 80.73 ? 169 LEU A CB    1 
ATOM   1259 C CG    . LEU A 1 169 ? 15.017  3.827   53.191  1.00 80.62 ? 169 LEU A CG    1 
ATOM   1260 C CD1   . LEU A 1 169 ? 15.030  3.077   51.855  1.00 80.13 ? 169 LEU A CD1   1 
ATOM   1261 C CD2   . LEU A 1 169 ? 13.936  3.305   54.111  1.00 80.42 ? 169 LEU A CD2   1 
ATOM   1262 N N     . THR A 1 170 ? 18.927  4.807   56.270  1.00 85.48 ? 170 THR A N     1 
ATOM   1263 C CA    . THR A 1 170 ? 20.341  4.574   56.540  1.00 87.88 ? 170 THR A CA    1 
ATOM   1264 C C     . THR A 1 170 ? 20.664  3.250   57.243  1.00 89.50 ? 170 THR A C     1 
ATOM   1265 O O     . THR A 1 170 ? 19.803  2.385   57.436  1.00 89.50 ? 170 THR A O     1 
ATOM   1266 C CB    . THR A 1 170 ? 20.986  5.731   57.364  1.00 87.83 ? 170 THR A CB    1 
ATOM   1267 O OG1   . THR A 1 170 ? 20.013  6.327   58.230  1.00 86.81 ? 170 THR A OG1   1 
ATOM   1268 C CG2   . THR A 1 170 ? 21.591  6.773   56.430  1.00 87.99 ? 170 THR A CG2   1 
ATOM   1269 N N     . ASP A 1 171 ? 21.931  3.123   57.617  1.00 91.41 ? 171 ASP A N     1 
ATOM   1270 C CA    . ASP A 1 171 ? 22.496  1.940   58.266  1.00 93.37 ? 171 ASP A CA    1 
ATOM   1271 C C     . ASP A 1 171 ? 21.664  1.183   59.315  1.00 94.16 ? 171 ASP A C     1 
ATOM   1272 O O     . ASP A 1 171 ? 21.353  -0.002  59.128  1.00 93.87 ? 171 ASP A O     1 
ATOM   1273 C CB    . ASP A 1 171 ? 23.854  2.322   58.873  1.00 94.39 ? 171 ASP A CB    1 
ATOM   1274 C CG    . ASP A 1 171 ? 24.749  3.064   57.884  1.00 95.30 ? 171 ASP A CG    1 
ATOM   1275 O OD1   . ASP A 1 171 ? 24.319  4.107   57.334  1.00 95.56 ? 171 ASP A OD1   1 
ATOM   1276 O OD2   . ASP A 1 171 ? 25.885  2.602   57.659  1.00 95.86 ? 171 ASP A OD2   1 
ATOM   1277 N N     . THR A 1 172 ? 21.320  1.857   60.416  1.00 94.78 ? 172 THR A N     1 
ATOM   1278 C CA    . THR A 1 172 ? 20.557  1.235   61.502  1.00 95.20 ? 172 THR A CA    1 
ATOM   1279 C C     . THR A 1 172 ? 19.046  1.382   61.364  1.00 95.63 ? 172 THR A C     1 
ATOM   1280 O O     . THR A 1 172 ? 18.302  1.161   62.325  1.00 95.65 ? 172 THR A O     1 
ATOM   1281 C CB    . THR A 1 172 ? 20.960  1.808   62.876  1.00 95.26 ? 172 THR A CB    1 
ATOM   1282 O OG1   . THR A 1 172 ? 20.717  3.220   62.892  1.00 94.57 ? 172 THR A OG1   1 
ATOM   1283 C CG2   . THR A 1 172 ? 22.438  1.520   63.171  1.00 95.49 ? 172 THR A CG2   1 
ATOM   1284 N N     . GLN A 1 173 ? 18.598  1.761   60.171  1.00 95.75 ? 173 GLN A N     1 
ATOM   1285 C CA    . GLN A 1 173 ? 17.174  1.928   59.906  1.00 95.85 ? 173 GLN A CA    1 
ATOM   1286 C C     . GLN A 1 173 ? 16.884  1.749   58.418  1.00 95.32 ? 173 GLN A C     1 
ATOM   1287 O O     . GLN A 1 173 ? 16.674  2.721   57.679  1.00 95.17 ? 173 GLN A O     1 
ATOM   1288 C CB    . GLN A 1 173 ? 16.712  3.293   60.409  1.00 96.51 ? 173 GLN A CB    1 
ATOM   1289 C CG    . GLN A 1 173 ? 16.447  3.269   61.904  1.00 97.80 ? 173 GLN A CG    1 
ATOM   1290 C CD    . GLN A 1 173 ? 16.263  4.645   62.499  1.00 98.67 ? 173 GLN A CD    1 
ATOM   1291 O OE1   . GLN A 1 173 ? 15.587  5.502   61.915  1.00 99.16 ? 173 GLN A OE1   1 
ATOM   1292 N NE2   . GLN A 1 173 ? 16.851  4.865   63.680  1.00 98.82 ? 173 GLN A NE2   1 
ATOM   1293 N N     . ILE A 1 174 ? 16.883  0.476   58.012  1.00 94.64 ? 174 ILE A N     1 
ATOM   1294 C CA    . ILE A 1 174 ? 16.656  0.043   56.631  1.00 93.92 ? 174 ILE A CA    1 
ATOM   1295 C C     . ILE A 1 174 ? 15.204  0.190   56.149  1.00 92.53 ? 174 ILE A C     1 
ATOM   1296 O O     . ILE A 1 174 ? 14.892  -0.124  54.996  1.00 92.68 ? 174 ILE A O     1 
ATOM   1297 C CB    . ILE A 1 174 ? 17.155  -1.447  56.441  1.00 94.28 ? 174 ILE A CB    1 
ATOM   1298 C CG1   . ILE A 1 174 ? 18.692  -1.481  56.375  1.00 94.92 ? 174 ILE A CG1   1 
ATOM   1299 C CG2   . ILE A 1 174 ? 16.581  -2.071  55.168  1.00 94.74 ? 174 ILE A CG2   1 
ATOM   1300 C CD1   . ILE A 1 174 ? 19.310  -0.724  55.180  1.00 94.65 ? 174 ILE A CD1   1 
ATOM   1301 N N     . LYS A 1 175 ? 14.331  0.687   57.022  1.00 90.70 ? 175 LYS A N     1 
ATOM   1302 C CA    . LYS A 1 175 ? 12.922  0.880   56.681  1.00 88.82 ? 175 LYS A CA    1 
ATOM   1303 C C     . LYS A 1 175 ? 12.329  2.001   57.546  1.00 87.22 ? 175 LYS A C     1 
ATOM   1304 O O     . LYS A 1 175 ? 12.834  2.282   58.639  1.00 86.56 ? 175 LYS A O     1 
ATOM   1305 C CB    . LYS A 1 175 ? 12.141  -0.428  56.898  1.00 89.16 ? 175 LYS A CB    1 
ATOM   1306 C CG    . LYS A 1 175 ? 12.030  -0.861  58.366  1.00 90.06 ? 175 LYS A CG    1 
ATOM   1307 C CD    . LYS A 1 175 ? 13.395  -1.024  59.035  1.00 89.70 ? 175 LYS A CD    1 
ATOM   1308 C CE    . LYS A 1 175 ? 13.249  -1.328  60.506  1.00 89.43 ? 175 LYS A CE    1 
ATOM   1309 N NZ    . LYS A 1 175 ? 12.380  -2.516  60.718  1.00 89.72 ? 175 LYS A NZ    1 
ATOM   1310 N N     . ARG A 1 176 ? 11.272  2.644   57.045  1.00 85.31 ? 176 ARG A N     1 
ATOM   1311 C CA    . ARG A 1 176 ? 10.607  3.722   57.769  1.00 83.40 ? 176 ARG A CA    1 
ATOM   1312 C C     . ARG A 1 176 ? 9.196   3.268   58.126  1.00 82.01 ? 176 ARG A C     1 
ATOM   1313 O O     . ARG A 1 176 ? 8.711   2.282   57.579  1.00 81.92 ? 176 ARG A O     1 
ATOM   1314 C CB    . ARG A 1 176 ? 10.534  4.993   56.919  1.00 83.88 ? 176 ARG A CB    1 
ATOM   1315 C CG    . ARG A 1 176 ? 11.857  5.439   56.310  1.00 84.23 ? 176 ARG A CG    1 
ATOM   1316 C CD    . ARG A 1 176 ? 12.995  5.578   57.321  1.00 84.71 ? 176 ARG A CD    1 
ATOM   1317 N NE    . ARG A 1 176 ? 12.645  6.379   58.492  1.00 85.15 ? 176 ARG A NE    1 
ATOM   1318 C CZ    . ARG A 1 176 ? 13.536  6.946   59.305  1.00 85.36 ? 176 ARG A CZ    1 
ATOM   1319 N NH1   . ARG A 1 176 ? 14.833  6.809   59.067  1.00 85.80 ? 176 ARG A NH1   1 
ATOM   1320 N NH2   . ARG A 1 176 ? 13.133  7.629   60.372  1.00 85.02 ? 176 ARG A NH2   1 
ATOM   1321 N N     . ASN A 1 177 ? 8.543   3.988   59.038  1.00 80.29 ? 177 ASN A N     1 
ATOM   1322 C CA    . ASN A 1 177 ? 7.181   3.651   59.493  1.00 78.09 ? 177 ASN A CA    1 
ATOM   1323 C C     . ASN A 1 177 ? 6.247   4.876   59.627  1.00 75.91 ? 177 ASN A C     1 
ATOM   1324 O O     . ASN A 1 177 ? 5.048   4.730   59.871  1.00 74.73 ? 177 ASN A O     1 
ATOM   1325 C CB    . ASN A 1 177 ? 7.250   2.929   60.855  1.00 78.73 ? 177 ASN A CB    1 
ATOM   1326 C CG    . ASN A 1 177 ? 7.826   1.517   60.752  1.00 79.89 ? 177 ASN A CG    1 
ATOM   1327 O OD1   . ASN A 1 177 ? 7.172   0.588   60.245  1.00 79.78 ? 177 ASN A OD1   1 
ATOM   1328 N ND2   . ASN A 1 177 ? 9.060   1.349   61.236  1.00 80.26 ? 177 ASN A ND2   1 
HETATM 1329 N N     . TPO A 1 178 ? 6.814   6.069   59.454  1.00 73.48 ? 178 TPO A N     1 
HETATM 1330 C CA    . TPO A 1 178 ? 6.085   7.325   59.588  1.00 71.17 ? 178 TPO A CA    1 
HETATM 1331 C CB    . TPO A 1 178 ? 7.049   8.550   59.494  1.00 72.96 ? 178 TPO A CB    1 
HETATM 1332 C CG2   . TPO A 1 178 ? 6.298   9.872   59.758  1.00 73.22 ? 178 TPO A CG2   1 
HETATM 1333 O OG1   . TPO A 1 178 ? 8.093   8.414   60.459  1.00 75.01 ? 178 TPO A OG1   1 
HETATM 1334 P P     . TPO A 1 178 ? 9.623   8.416   59.982  1.00 77.06 ? 178 TPO A P     1 
HETATM 1335 O O1P   . TPO A 1 178 ? 9.774   7.340   58.931  1.00 76.45 ? 178 TPO A O1P   1 
HETATM 1336 O O2P   . TPO A 1 178 ? 10.533  8.116   61.148  1.00 77.22 ? 178 TPO A O2P   1 
HETATM 1337 O O3P   . TPO A 1 178 ? 9.980   9.783   59.446  1.00 77.68 ? 178 TPO A O3P   1 
HETATM 1338 C C     . TPO A 1 178 ? 4.964   7.555   58.579  1.00 68.77 ? 178 TPO A C     1 
HETATM 1339 O O     . TPO A 1 178 ? 5.165   7.489   57.355  1.00 66.48 ? 178 TPO A O     1 
ATOM   1340 N N     . PHE A 1 179 ? 3.781   7.840   59.115  1.00 66.02 ? 179 PHE A N     1 
ATOM   1341 C CA    . PHE A 1 179 ? 2.641   8.135   58.283  1.00 63.92 ? 179 PHE A CA    1 
ATOM   1342 C C     . PHE A 1 179 ? 2.954   9.520   57.738  1.00 62.69 ? 179 PHE A C     1 
ATOM   1343 O O     . PHE A 1 179 ? 2.794   10.536  58.435  1.00 61.79 ? 179 PHE A O     1 
ATOM   1344 C CB    . PHE A 1 179 ? 1.366   8.203   59.105  1.00 63.94 ? 179 PHE A CB    1 
ATOM   1345 C CG    . PHE A 1 179 ? 0.143   8.446   58.282  1.00 62.94 ? 179 PHE A CG    1 
ATOM   1346 C CD1   . PHE A 1 179 ? -0.641  7.385   57.857  1.00 62.70 ? 179 PHE A CD1   1 
ATOM   1347 C CD2   . PHE A 1 179 ? -0.212  9.737   57.902  1.00 63.53 ? 179 PHE A CD2   1 
ATOM   1348 C CE1   . PHE A 1 179 ? -1.765  7.596   57.065  1.00 62.04 ? 179 PHE A CE1   1 
ATOM   1349 C CE2   . PHE A 1 179 ? -1.350  9.967   57.096  1.00 63.27 ? 179 PHE A CE2   1 
ATOM   1350 C CZ    . PHE A 1 179 ? -2.121  8.888   56.682  1.00 62.76 ? 179 PHE A CZ    1 
ATOM   1351 N N     . VAL A 1 180 ? 3.404   9.550   56.488  1.00 60.82 ? 180 VAL A N     1 
ATOM   1352 C CA    . VAL A 1 180 ? 3.778   10.793  55.840  1.00 58.86 ? 180 VAL A CA    1 
ATOM   1353 C C     . VAL A 1 180 ? 3.433   10.799  54.333  1.00 57.43 ? 180 VAL A C     1 
ATOM   1354 O O     . VAL A 1 180 ? 3.378   9.730   53.719  1.00 56.16 ? 180 VAL A O     1 
ATOM   1355 C CB    . VAL A 1 180 ? 5.291   11.044  56.095  1.00 59.42 ? 180 VAL A CB    1 
ATOM   1356 C CG1   . VAL A 1 180 ? 5.975   11.570  54.837  1.00 59.38 ? 180 VAL A CG1   1 
ATOM   1357 C CG2   . VAL A 1 180 ? 5.451   12.026  57.279  1.00 59.23 ? 180 VAL A CG2   1 
ATOM   1358 N N     . GLY A 1 181 ? 3.182   12.003  53.780  1.00 55.31 ? 181 GLY A N     1 
ATOM   1359 C CA    . GLY A 1 181 ? 2.820   12.187  52.372  1.00 53.70 ? 181 GLY A CA    1 
ATOM   1360 C C     . GLY A 1 181 ? 1.419   12.807  52.186  1.00 52.83 ? 181 GLY A C     1 
ATOM   1361 O O     . GLY A 1 181 ? 0.801   13.306  53.129  1.00 53.62 ? 181 GLY A O     1 
ATOM   1362 N N     . THR A 1 182 ? 0.903   12.785  50.966  1.00 50.42 ? 182 THR A N     1 
ATOM   1363 C CA    . THR A 1 182 ? -0.436  13.336  50.681  1.00 47.44 ? 182 THR A CA    1 
ATOM   1364 C C     . THR A 1 182 ? -1.276  12.084  50.422  1.00 45.02 ? 182 THR A C     1 
ATOM   1365 O O     . THR A 1 182 ? -0.976  11.361  49.436  1.00 40.74 ? 182 THR A O     1 
ATOM   1366 C CB    . THR A 1 182 ? -0.435  14.146  49.376  1.00 47.32 ? 182 THR A CB    1 
ATOM   1367 O OG1   . THR A 1 182 ? 0.821   14.827  49.269  1.00 41.19 ? 182 THR A OG1   1 
ATOM   1368 C CG2   . THR A 1 182 ? -1.656  15.146  49.343  1.00 44.73 ? 182 THR A CG2   1 
ATOM   1369 N N     . PRO A 1 183 ? -2.356  11.862  51.245  1.00 42.10 ? 183 PRO A N     1 
ATOM   1370 C CA    . PRO A 1 183 ? -3.255  10.699  51.159  1.00 37.93 ? 183 PRO A CA    1 
ATOM   1371 C C     . PRO A 1 183 ? -3.514  10.043  49.817  1.00 33.90 ? 183 PRO A C     1 
ATOM   1372 O O     . PRO A 1 183 ? -3.261  8.863   49.694  1.00 32.36 ? 183 PRO A O     1 
ATOM   1373 C CB    . PRO A 1 183 ? -4.539  11.182  51.827  1.00 39.70 ? 183 PRO A CB    1 
ATOM   1374 C CG    . PRO A 1 183 ? -4.568  12.578  51.484  1.00 42.69 ? 183 PRO A CG    1 
ATOM   1375 C CD    . PRO A 1 183 ? -3.108  13.005  51.782  1.00 40.97 ? 183 PRO A CD    1 
ATOM   1376 N N     . PHE A 1 184 ? -4.000  10.783  48.817  1.00 30.85 ? 184 PHE A N     1 
ATOM   1377 C CA    . PHE A 1 184 ? -4.311  10.194  47.512  1.00 29.99 ? 184 PHE A CA    1 
ATOM   1378 C C     . PHE A 1 184 ? -3.139  9.508   46.816  1.00 28.67 ? 184 PHE A C     1 
ATOM   1379 O O     . PHE A 1 184 ? -3.339  8.567   46.062  1.00 29.21 ? 184 PHE A O     1 
ATOM   1380 C CB    . PHE A 1 184 ? -4.834  11.250  46.545  1.00 31.41 ? 184 PHE A CB    1 
ATOM   1381 C CG    . PHE A 1 184 ? -6.018  12.001  47.064  1.00 36.68 ? 184 PHE A CG    1 
ATOM   1382 C CD1   . PHE A 1 184 ? -5.906  13.341  47.390  1.00 39.65 ? 184 PHE A CD1   1 
ATOM   1383 C CD2   . PHE A 1 184 ? -7.217  11.355  47.269  1.00 38.56 ? 184 PHE A CD2   1 
ATOM   1384 C CE1   . PHE A 1 184 ? -6.984  14.039  47.917  1.00 42.19 ? 184 PHE A CE1   1 
ATOM   1385 C CE2   . PHE A 1 184 ? -8.324  12.054  47.810  1.00 40.97 ? 184 PHE A CE2   1 
ATOM   1386 C CZ    . PHE A 1 184 ? -8.199  13.377  48.127  1.00 40.77 ? 184 PHE A CZ    1 
ATOM   1387 N N     . TRP A 1 185 ? -1.937  9.965   47.106  1.00 24.45 ? 185 TRP A N     1 
ATOM   1388 C CA    . TRP A 1 185 ? -0.727  9.394   46.417  1.00 26.02 ? 185 TRP A CA    1 
ATOM   1389 C C     . TRP A 1 185 ? 0.050   8.407   47.328  1.00 26.86 ? 185 TRP A C     1 
ATOM   1390 O O     . TRP A 1 185 ? 1.127   7.890   46.917  1.00 27.11 ? 185 TRP A O     1 
ATOM   1391 C CB    . TRP A 1 185 ? 0.220   10.570  46.043  1.00 21.75 ? 185 TRP A CB    1 
ATOM   1392 C CG    . TRP A 1 185 ? -0.252  11.486  44.929  1.00 24.87 ? 185 TRP A CG    1 
ATOM   1393 C CD1   . TRP A 1 185 ? 0.033   11.389  43.599  1.00 24.86 ? 185 TRP A CD1   1 
ATOM   1394 C CD2   . TRP A 1 185 ? -1.109  12.619  45.065  1.00 26.20 ? 185 TRP A CD2   1 
ATOM   1395 N NE1   . TRP A 1 185 ? -0.581  12.391  42.908  1.00 25.49 ? 185 TRP A NE1   1 
ATOM   1396 C CE2   . TRP A 1 185 ? -1.297  13.155  43.784  1.00 25.94 ? 185 TRP A CE2   1 
ATOM   1397 C CE3   . TRP A 1 185 ? -1.755  13.244  46.182  1.00 27.28 ? 185 TRP A CE3   1 
ATOM   1398 C CZ2   . TRP A 1 185 ? -2.103  14.288  43.550  1.00 27.14 ? 185 TRP A CZ2   1 
ATOM   1399 C CZ3   . TRP A 1 185 ? -2.555  14.377  45.944  1.00 27.99 ? 185 TRP A CZ3   1 
ATOM   1400 C CH2   . TRP A 1 185 ? -2.723  14.881  44.638  1.00 25.26 ? 185 TRP A CH2   1 
ATOM   1401 N N     . MET A 1 186 ? -0.478  8.154   48.532  1.00 26.72 ? 186 MET A N     1 
ATOM   1402 C CA    . MET A 1 186 ? 0.180   7.315   49.461  1.00 29.73 ? 186 MET A CA    1 
ATOM   1403 C C     . MET A 1 186 ? -0.005  5.830   49.248  1.00 27.53 ? 186 MET A C     1 
ATOM   1404 O O     . MET A 1 186 ? -1.096  5.339   48.981  1.00 26.56 ? 186 MET A O     1 
ATOM   1405 C CB    . MET A 1 186 ? -0.239  7.662   50.903  1.00 30.75 ? 186 MET A CB    1 
ATOM   1406 C CG    . MET A 1 186 ? 0.275   8.957   51.470  1.00 35.78 ? 186 MET A CG    1 
ATOM   1407 S SD    . MET A 1 186 ? -0.457  9.273   53.150  1.00 43.48 ? 186 MET A SD    1 
ATOM   1408 C CE    . MET A 1 186 ? 0.003   7.860   54.049  1.00 41.68 ? 186 MET A CE    1 
ATOM   1409 N N     . ALA A 1 187 ? 1.112   5.118   49.336  1.00 27.70 ? 187 ALA A N     1 
ATOM   1410 C CA    . ALA A 1 187 ? 1.134   3.658   49.224  1.00 26.64 ? 187 ALA A CA    1 
ATOM   1411 C C     . ALA A 1 187 ? 0.419   3.028   50.420  1.00 28.68 ? 187 ALA A C     1 
ATOM   1412 O O     . ALA A 1 187 ? 0.455   3.507   51.520  1.00 28.46 ? 187 ALA A O     1 
ATOM   1413 C CB    . ALA A 1 187 ? 2.595   3.165   49.187  1.00 27.69 ? 187 ALA A CB    1 
ATOM   1414 N N     . PRO A 1 188 ? -0.198  1.866   50.189  1.00 30.35 ? 188 PRO A N     1 
ATOM   1415 C CA    . PRO A 1 188 ? -0.940  1.121   51.219  1.00 30.58 ? 188 PRO A CA    1 
ATOM   1416 C C     . PRO A 1 188 ? -0.105  0.831   52.477  1.00 32.60 ? 188 PRO A C     1 
ATOM   1417 O O     . PRO A 1 188 ? -0.622  0.980   53.581  1.00 32.53 ? 188 PRO A O     1 
ATOM   1418 C CB    . PRO A 1 188 ? -1.400  -0.157  50.515  1.00 30.07 ? 188 PRO A CB    1 
ATOM   1419 C CG    . PRO A 1 188 ? -0.613  -0.198  49.194  1.00 31.64 ? 188 PRO A CG    1 
ATOM   1420 C CD    . PRO A 1 188 ? -0.127  1.208   48.889  1.00 26.21 ? 188 PRO A CD    1 
ATOM   1421 N N     . GLU A 1 189 ? 1.178   0.457   52.323  1.00 32.45 ? 189 GLU A N     1 
ATOM   1422 C CA    . GLU A 1 189 ? 1.982   0.168   53.511  1.00 33.51 ? 189 GLU A CA    1 
ATOM   1423 C C     . GLU A 1 189 ? 2.323   1.401   54.320  1.00 34.80 ? 189 GLU A C     1 
ATOM   1424 O O     . GLU A 1 189 ? 2.556   1.299   55.523  1.00 37.44 ? 189 GLU A O     1 
ATOM   1425 C CB    . GLU A 1 189 ? 3.271   -0.614  53.156  1.00 33.80 ? 189 GLU A CB    1 
ATOM   1426 C CG    . GLU A 1 189 ? 4.329   0.149   52.375  1.00 32.39 ? 189 GLU A CG    1 
ATOM   1427 C CD    . GLU A 1 189 ? 4.067   0.227   50.876  1.00 31.18 ? 189 GLU A CD    1 
ATOM   1428 O OE1   . GLU A 1 189 ? 2.955   -0.125  50.428  1.00 33.04 ? 189 GLU A OE1   1 
ATOM   1429 O OE2   . GLU A 1 189 ? 4.979   0.649   50.118  1.00 28.34 ? 189 GLU A OE2   1 
ATOM   1430 N N     . VAL A 1 190 ? 2.403   2.561   53.666  1.00 34.97 ? 190 VAL A N     1 
ATOM   1431 C CA    . VAL A 1 190 ? 2.684   3.818   54.339  1.00 35.30 ? 190 VAL A CA    1 
ATOM   1432 C C     . VAL A 1 190 ? 1.440   4.178   55.165  1.00 38.20 ? 190 VAL A C     1 
ATOM   1433 O O     . VAL A 1 190 ? 1.531   4.562   56.323  1.00 38.61 ? 190 VAL A O     1 
ATOM   1434 C CB    . VAL A 1 190 ? 2.974   4.962   53.330  1.00 32.90 ? 190 VAL A CB    1 
ATOM   1435 C CG1   . VAL A 1 190 ? 3.011   6.301   54.063  1.00 30.80 ? 190 VAL A CG1   1 
ATOM   1436 C CG2   . VAL A 1 190 ? 4.322   4.702   52.593  1.00 31.11 ? 190 VAL A CG2   1 
ATOM   1437 N N     . ILE A 1 191 ? 0.263   4.043   54.579  1.00 39.70 ? 191 ILE A N     1 
ATOM   1438 C CA    . ILE A 1 191 ? -0.929  4.330   55.356  1.00 41.83 ? 191 ILE A CA    1 
ATOM   1439 C C     . ILE A 1 191 ? -1.040  3.383   56.559  1.00 43.75 ? 191 ILE A C     1 
ATOM   1440 O O     . ILE A 1 191 ? -1.362  3.828   57.679  1.00 44.26 ? 191 ILE A O     1 
ATOM   1441 C CB    . ILE A 1 191 ? -2.208  4.222   54.501  1.00 42.96 ? 191 ILE A CB    1 
ATOM   1442 C CG1   . ILE A 1 191 ? -2.257  5.400   53.535  1.00 43.18 ? 191 ILE A CG1   1 
ATOM   1443 C CG2   . ILE A 1 191 ? -3.495  4.296   55.406  1.00 43.53 ? 191 ILE A CG2   1 
ATOM   1444 C CD1   . ILE A 1 191 ? -3.178  5.175   52.387  1.00 44.85 ? 191 ILE A CD1   1 
ATOM   1445 N N     . LYS A 1 192 ? -0.793  2.093   56.364  1.00 44.13 ? 192 LYS A N     1 
ATOM   1446 C CA    . LYS A 1 192 ? -0.881  1.182   57.505  1.00 47.76 ? 192 LYS A CA    1 
ATOM   1447 C C     . LYS A 1 192 ? 0.342   1.232   58.435  1.00 48.40 ? 192 LYS A C     1 
ATOM   1448 O O     . LYS A 1 192 ? 0.402   0.495   59.408  1.00 47.76 ? 192 LYS A O     1 
ATOM   1449 C CB    . LYS A 1 192 ? -1.072  -0.283  57.049  1.00 49.19 ? 192 LYS A CB    1 
ATOM   1450 C CG    . LYS A 1 192 ? -2.365  -0.588  56.307  1.00 52.71 ? 192 LYS A CG    1 
ATOM   1451 C CD    . LYS A 1 192 ? -3.592  0.083   56.966  1.00 54.49 ? 192 LYS A CD    1 
ATOM   1452 C CE    . LYS A 1 192 ? -4.329  -0.803  57.970  1.00 56.69 ? 192 LYS A CE    1 
ATOM   1453 N NZ    . LYS A 1 192 ? -5.610  -1.402  57.388  1.00 57.84 ? 192 LYS A NZ    1 
ATOM   1454 N N     . GLN A 1 193 ? 1.290   2.112   58.117  1.00 50.51 ? 193 GLN A N     1 
ATOM   1455 C CA    . GLN A 1 193 ? 2.560   2.310   58.810  1.00 51.05 ? 193 GLN A CA    1 
ATOM   1456 C C     . GLN A 1 193 ? 3.396   1.053   58.993  1.00 52.32 ? 193 GLN A C     1 
ATOM   1457 O O     . GLN A 1 193 ? 4.010   0.838   60.038  1.00 52.11 ? 193 GLN A O     1 
ATOM   1458 C CB    . GLN A 1 193 ? 2.357   3.066   60.134  1.00 53.20 ? 193 GLN A CB    1 
ATOM   1459 C CG    . GLN A 1 193 ? 1.785   4.516   59.870  1.00 55.20 ? 193 GLN A CG    1 
ATOM   1460 C CD    . GLN A 1 193 ? 1.634   5.365   61.127  1.00 57.41 ? 193 GLN A CD    1 
ATOM   1461 O OE1   . GLN A 1 193 ? 2.628   5.681   61.799  1.00 57.46 ? 193 GLN A OE1   1 
ATOM   1462 N NE2   . GLN A 1 193 ? 0.380   5.742   61.457  1.00 56.21 ? 193 GLN A NE2   1 
ATOM   1463 N N     . SER A 1 194 ? 3.415   0.214   57.968  1.00 53.39 ? 194 SER A N     1 
ATOM   1464 C CA    . SER A 1 194 ? 4.249   -0.982  57.991  1.00 54.59 ? 194 SER A CA    1 
ATOM   1465 C C     . SER A 1 194 ? 5.649   -0.483  57.694  1.00 55.26 ? 194 SER A C     1 
ATOM   1466 O O     . SER A 1 194 ? 5.835   0.685   57.318  1.00 55.40 ? 194 SER A O     1 
ATOM   1467 C CB    . SER A 1 194 ? 3.837   -1.955  56.892  1.00 54.53 ? 194 SER A CB    1 
ATOM   1468 O OG    . SER A 1 194 ? 2.547   -2.475  57.146  1.00 56.59 ? 194 SER A OG    1 
ATOM   1469 N N     . ALA A 1 195 ? 6.643   -1.349  57.865  1.00 55.51 ? 195 ALA A N     1 
ATOM   1470 C CA    . ALA A 1 195 ? 8.016   -0.954  57.552  1.00 55.04 ? 195 ALA A CA    1 
ATOM   1471 C C     . ALA A 1 195 ? 8.006   -0.770  56.027  1.00 54.82 ? 195 ALA A C     1 
ATOM   1472 O O     . ALA A 1 195 ? 7.597   -1.698  55.283  1.00 55.78 ? 195 ALA A O     1 
ATOM   1473 C CB    . ALA A 1 195 ? 9.028   -2.067  57.964  1.00 55.01 ? 195 ALA A CB    1 
ATOM   1474 N N     . TYR A 1 196 ? 8.414   0.418   55.555  1.00 51.03 ? 196 TYR A N     1 
ATOM   1475 C CA    . TYR A 1 196 ? 8.437   0.662   54.110  1.00 47.43 ? 196 TYR A CA    1 
ATOM   1476 C C     . TYR A 1 196 ? 9.737   1.315   53.637  1.00 45.12 ? 196 TYR A C     1 
ATOM   1477 O O     . TYR A 1 196 ? 10.597  1.681   54.448  1.00 44.48 ? 196 TYR A O     1 
ATOM   1478 C CB    . TYR A 1 196 ? 7.233   1.514   53.715  1.00 46.51 ? 196 TYR A CB    1 
ATOM   1479 C CG    . TYR A 1 196 ? 7.282   2.938   54.233  1.00 45.97 ? 196 TYR A CG    1 
ATOM   1480 C CD1   . TYR A 1 196 ? 8.058   3.916   53.588  1.00 45.17 ? 196 TYR A CD1   1 
ATOM   1481 C CD2   . TYR A 1 196 ? 6.496   3.323   55.319  1.00 45.05 ? 196 TYR A CD2   1 
ATOM   1482 C CE1   . TYR A 1 196 ? 8.031   5.247   54.008  1.00 45.98 ? 196 TYR A CE1   1 
ATOM   1483 C CE2   . TYR A 1 196 ? 6.468   4.637   55.750  1.00 45.04 ? 196 TYR A CE2   1 
ATOM   1484 C CZ    . TYR A 1 196 ? 7.221   5.589   55.104  1.00 45.83 ? 196 TYR A CZ    1 
ATOM   1485 O OH    . TYR A 1 196 ? 7.157   6.878   55.556  1.00 46.05 ? 196 TYR A OH    1 
ATOM   1486 N N     . ASP A 1 197 ? 9.891   1.432   52.329  1.00 42.21 ? 197 ASP A N     1 
ATOM   1487 C CA    . ASP A 1 197 ? 11.094  2.036   51.736  1.00 40.20 ? 197 ASP A CA    1 
ATOM   1488 C C     . ASP A 1 197 ? 10.859  2.639   50.341  1.00 36.67 ? 197 ASP A C     1 
ATOM   1489 O O     . ASP A 1 197 ? 9.760   3.136   50.038  1.00 35.21 ? 197 ASP A O     1 
ATOM   1490 C CB    . ASP A 1 197 ? 12.238  1.000   51.643  1.00 43.47 ? 197 ASP A CB    1 
ATOM   1491 C CG    . ASP A 1 197 ? 11.824  -0.264  50.916  1.00 47.79 ? 197 ASP A CG    1 
ATOM   1492 O OD1   . ASP A 1 197 ? 10.756  -0.261  50.207  1.00 47.48 ? 197 ASP A OD1   1 
ATOM   1493 O OD2   . ASP A 1 197 ? 12.584  -1.263  51.060  1.00 48.87 ? 197 ASP A OD2   1 
ATOM   1494 N N     . SER A 1 198 ? 11.890  2.574   49.507  1.00 30.84 ? 198 SER A N     1 
ATOM   1495 C CA    . SER A 1 198 ? 11.848  3.133   48.148  1.00 30.33 ? 198 SER A CA    1 
ATOM   1496 C C     . SER A 1 198 ? 10.585  2.722   47.349  1.00 28.02 ? 198 SER A C     1 
ATOM   1497 O O     . SER A 1 198 ? 10.099  3.474   46.500  1.00 27.22 ? 198 SER A O     1 
ATOM   1498 C CB    . SER A 1 198 ? 13.104  2.713   47.376  1.00 28.34 ? 198 SER A CB    1 
ATOM   1499 O OG    . SER A 1 198 ? 13.049  1.311   47.151  1.00 33.62 ? 198 SER A OG    1 
ATOM   1500 N N     . LYS A 1 199 ? 10.069  1.519   47.618  1.00 29.13 ? 199 LYS A N     1 
ATOM   1501 C CA    . LYS A 1 199 ? 8.877   1.033   46.896  1.00 29.99 ? 199 LYS A CA    1 
ATOM   1502 C C     . LYS A 1 199 ? 7.628   1.905   47.125  1.00 29.55 ? 199 LYS A C     1 
ATOM   1503 O O     . LYS A 1 199 ? 6.680   1.836   46.327  1.00 30.70 ? 199 LYS A O     1 
ATOM   1504 C CB    . LYS A 1 199 ? 8.533   -0.405  47.293  1.00 28.55 ? 199 LYS A CB    1 
ATOM   1505 C CG    . LYS A 1 199 ? 9.666   -1.439  47.024  1.00 31.87 ? 199 LYS A CG    1 
ATOM   1506 C CD    . LYS A 1 199 ? 10.042  -1.515  45.542  1.00 30.45 ? 199 LYS A CD    1 
ATOM   1507 C CE    . LYS A 1 199 ? 11.110  -2.594  45.277  1.00 28.71 ? 199 LYS A CE    1 
ATOM   1508 N NZ    . LYS A 1 199 ? 11.703  -2.312  43.944  1.00 24.84 ? 199 LYS A NZ    1 
ATOM   1509 N N     . ALA A 1 200 ? 7.579   2.652   48.224  1.00 28.72 ? 200 ALA A N     1 
ATOM   1510 C CA    . ALA A 1 200 ? 6.423   3.534   48.445  1.00 28.97 ? 200 ALA A CA    1 
ATOM   1511 C C     . ALA A 1 200 ? 6.444   4.633   47.370  1.00 27.38 ? 200 ALA A C     1 
ATOM   1512 O O     . ALA A 1 200 ? 5.396   5.128   46.925  1.00 26.70 ? 200 ALA A O     1 
ATOM   1513 C CB    . ALA A 1 200 ? 6.475   4.188   49.843  1.00 30.05 ? 200 ALA A CB    1 
ATOM   1514 N N     . ASP A 1 201 ? 7.650   5.051   46.995  1.00 25.60 ? 201 ASP A N     1 
ATOM   1515 C CA    . ASP A 1 201 ? 7.799   6.069   45.973  1.00 25.69 ? 201 ASP A CA    1 
ATOM   1516 C C     . ASP A 1 201 ? 7.349   5.504   44.646  1.00 26.62 ? 201 ASP A C     1 
ATOM   1517 O O     . ASP A 1 201 ? 6.875   6.267   43.810  1.00 24.21 ? 201 ASP A O     1 
ATOM   1518 C CB    . ASP A 1 201 ? 9.232   6.519   45.796  1.00 28.98 ? 201 ASP A CB    1 
ATOM   1519 C CG    . ASP A 1 201 ? 9.648   7.568   46.812  1.00 30.77 ? 201 ASP A CG    1 
ATOM   1520 O OD1   . ASP A 1 201 ? 8.757   8.151   47.463  1.00 30.83 ? 201 ASP A OD1   1 
ATOM   1521 O OD2   . ASP A 1 201 ? 10.884  7.805   46.929  1.00 25.90 ? 201 ASP A OD2   1 
ATOM   1522 N N     . ILE A 1 202 ? 7.540   4.181   44.415  1.00 22.69 ? 202 ILE A N     1 
ATOM   1523 C CA    . ILE A 1 202 ? 7.135   3.628   43.146  1.00 23.95 ? 202 ILE A CA    1 
ATOM   1524 C C     . ILE A 1 202 ? 5.578   3.608   43.059  1.00 21.14 ? 202 ILE A C     1 
ATOM   1525 O O     . ILE A 1 202 ? 5.011   3.786   41.972  1.00 21.01 ? 202 ILE A O     1 
ATOM   1526 C CB    . ILE A 1 202 ? 7.617   2.180   42.995  1.00 23.68 ? 202 ILE A CB    1 
ATOM   1527 C CG1   . ILE A 1 202 ? 9.138   2.142   43.165  1.00 25.63 ? 202 ILE A CG1   1 
ATOM   1528 C CG2   . ILE A 1 202 ? 7.233   1.664   41.648  1.00 27.58 ? 202 ILE A CG2   1 
ATOM   1529 C CD1   . ILE A 1 202 ? 9.941   3.087   42.148  1.00 23.83 ? 202 ILE A CD1   1 
ATOM   1530 N N     . TRP A 1 203 ? 4.929   3.311   44.160  1.00 23.24 ? 203 TRP A N     1 
ATOM   1531 C CA    . TRP A 1 203 ? 3.444   3.338   44.140  1.00 23.76 ? 203 TRP A CA    1 
ATOM   1532 C C     . TRP A 1 203 ? 3.052   4.798   43.859  1.00 25.04 ? 203 TRP A C     1 
ATOM   1533 O O     . TRP A 1 203 ? 2.239   5.102   42.964  1.00 27.17 ? 203 TRP A O     1 
ATOM   1534 C CB    . TRP A 1 203 ? 2.912   2.924   45.486  1.00 25.74 ? 203 TRP A CB    1 
ATOM   1535 C CG    . TRP A 1 203 ? 1.436   3.187   45.640  1.00 23.88 ? 203 TRP A CG    1 
ATOM   1536 C CD1   . TRP A 1 203 ? 0.832   4.375   45.884  1.00 26.65 ? 203 TRP A CD1   1 
ATOM   1537 C CD2   . TRP A 1 203 ? 0.375   2.215   45.516  1.00 25.43 ? 203 TRP A CD2   1 
ATOM   1538 N NE1   . TRP A 1 203 ? -0.552  4.222   45.918  1.00 22.22 ? 203 TRP A NE1   1 
ATOM   1539 C CE2   . TRP A 1 203 ? -0.855  2.907   45.717  1.00 26.22 ? 203 TRP A CE2   1 
ATOM   1540 C CE3   . TRP A 1 203 ? 0.344   0.858   45.266  1.00 25.69 ? 203 TRP A CE3   1 
ATOM   1541 C CZ2   . TRP A 1 203 ? -2.097  2.269   45.689  1.00 25.59 ? 203 TRP A CZ2   1 
ATOM   1542 C CZ3   . TRP A 1 203 ? -0.925  0.195   45.226  1.00 24.51 ? 203 TRP A CZ3   1 
ATOM   1543 C CH2   . TRP A 1 203 ? -2.113  0.917   45.443  1.00 28.32 ? 203 TRP A CH2   1 
ATOM   1544 N N     . SER A 1 204 ? 3.635   5.731   44.596  1.00 25.72 ? 204 SER A N     1 
ATOM   1545 C CA    . SER A 1 204 ? 3.282   7.146   44.354  1.00 24.61 ? 204 SER A CA    1 
ATOM   1546 C C     . SER A 1 204 ? 3.474   7.554   42.896  1.00 25.93 ? 204 SER A C     1 
ATOM   1547 O O     . SER A 1 204 ? 2.692   8.349   42.354  1.00 23.55 ? 204 SER A O     1 
ATOM   1548 C CB    . SER A 1 204 ? 4.111   8.078   45.242  1.00 24.65 ? 204 SER A CB    1 
ATOM   1549 O OG    . SER A 1 204 ? 3.739   7.902   46.583  1.00 25.40 ? 204 SER A OG    1 
ATOM   1550 N N     . LEU A 1 205 ? 4.541   7.046   42.262  1.00 20.43 ? 205 LEU A N     1 
ATOM   1551 C CA    . LEU A 1 205 ? 4.799   7.356   40.870  1.00 21.73 ? 205 LEU A CA    1 
ATOM   1552 C C     . LEU A 1 205 ? 3.651   6.808   39.999  1.00 21.63 ? 205 LEU A C     1 
ATOM   1553 O O     . LEU A 1 205 ? 3.332   7.402   38.995  1.00 22.39 ? 205 LEU A O     1 
ATOM   1554 C CB    . LEU A 1 205 ? 6.130   6.682   40.410  1.00 25.27 ? 205 LEU A CB    1 
ATOM   1555 C CG    . LEU A 1 205 ? 6.417   6.841   38.924  1.00 28.33 ? 205 LEU A CG    1 
ATOM   1556 C CD1   . LEU A 1 205 ? 6.834   8.279   38.606  1.00 31.78 ? 205 LEU A CD1   1 
ATOM   1557 C CD2   . LEU A 1 205 ? 7.483   5.832   38.540  1.00 30.43 ? 205 LEU A CD2   1 
ATOM   1558 N N     . GLY A 1 206 ? 3.184   5.590   40.315  1.00 24.45 ? 206 GLY A N     1 
ATOM   1559 C CA    . GLY A 1 206 ? 2.059   5.034   39.598  1.00 23.91 ? 206 GLY A CA    1 
ATOM   1560 C C     . GLY A 1 206 ? 0.826   5.966   39.704  1.00 22.50 ? 206 GLY A C     1 
ATOM   1561 O O     . GLY A 1 206 ? 0.135   6.180   38.689  1.00 24.06 ? 206 GLY A O     1 
ATOM   1562 N N     . ILE A 1 207 ? 0.519   6.449   40.912  1.00 22.99 ? 207 ILE A N     1 
ATOM   1563 C CA    . ILE A 1 207 ? -0.611  7.381   41.113  1.00 24.82 ? 207 ILE A CA    1 
ATOM   1564 C C     . ILE A 1 207 ? -0.310  8.677   40.339  1.00 25.59 ? 207 ILE A C     1 
ATOM   1565 O O     . ILE A 1 207 ? -1.160  9.236   39.666  1.00 22.50 ? 207 ILE A O     1 
ATOM   1566 C CB    . ILE A 1 207 ? -0.856  7.684   42.587  1.00 27.06 ? 207 ILE A CB    1 
ATOM   1567 C CG1   . ILE A 1 207 ? -1.122  6.372   43.341  1.00 27.17 ? 207 ILE A CG1   1 
ATOM   1568 C CG2   . ILE A 1 207 ? -2.038  8.667   42.722  1.00 23.92 ? 207 ILE A CG2   1 
ATOM   1569 C CD1   . ILE A 1 207 ? -2.517  5.699   43.031  1.00 23.04 ? 207 ILE A CD1   1 
ATOM   1570 N N     . THR A 1 208 ? 0.939   9.152   40.361  1.00 24.06 ? 208 THR A N     1 
ATOM   1571 C CA    . THR A 1 208 ? 1.251   10.349  39.543  1.00 22.75 ? 208 THR A CA    1 
ATOM   1572 C C     . THR A 1 208 ? 1.084   10.072  38.038  1.00 23.39 ? 208 THR A C     1 
ATOM   1573 O O     . THR A 1 208 ? 0.766   11.005  37.309  1.00 22.63 ? 208 THR A O     1 
ATOM   1574 C CB    . THR A 1 208 ? 2.739   10.809  39.770  1.00 22.22 ? 208 THR A CB    1 
ATOM   1575 O OG1   . THR A 1 208 ? 2.860   11.058  41.154  1.00 22.50 ? 208 THR A OG1   1 
ATOM   1576 C CG2   . THR A 1 208 ? 3.067   12.055  39.003  1.00 24.80 ? 208 THR A CG2   1 
ATOM   1577 N N     . ALA A 1 209 ? 1.283   8.816   37.568  1.00 22.66 ? 209 ALA A N     1 
ATOM   1578 C CA    . ALA A 1 209 ? 1.141   8.523   36.133  1.00 23.11 ? 209 ALA A CA    1 
ATOM   1579 C C     . ALA A 1 209 ? -0.402  8.643   35.797  1.00 25.01 ? 209 ALA A C     1 
ATOM   1580 O O     . ALA A 1 209 ? -0.777  9.241   34.776  1.00 26.57 ? 209 ALA A O     1 
ATOM   1581 C CB    . ALA A 1 209 ? 1.661   7.036   35.789  1.00 23.86 ? 209 ALA A CB    1 
ATOM   1582 N N     . ILE A 1 210 ? -1.257  8.117   36.672  1.00 24.29 ? 210 ILE A N     1 
ATOM   1583 C CA    . ILE A 1 210 ? -2.727  8.277   36.419  1.00 25.23 ? 210 ILE A CA    1 
ATOM   1584 C C     . ILE A 1 210 ? -3.051  9.791   36.398  1.00 24.84 ? 210 ILE A C     1 
ATOM   1585 O O     . ILE A 1 210 ? -3.823  10.274  35.524  1.00 27.20 ? 210 ILE A O     1 
ATOM   1586 C CB    . ILE A 1 210 ? -3.513  7.560   37.506  1.00 24.13 ? 210 ILE A CB    1 
ATOM   1587 C CG1   . ILE A 1 210 ? -3.339  6.053   37.310  1.00 24.53 ? 210 ILE A CG1   1 
ATOM   1588 C CG2   . ILE A 1 210 ? -5.064  7.944   37.473  1.00 24.09 ? 210 ILE A CG2   1 
ATOM   1589 C CD1   . ILE A 1 210 ? -3.996  5.192   38.470  1.00 23.96 ? 210 ILE A CD1   1 
ATOM   1590 N N     . GLU A 1 211 ? -2.416  10.541  37.313  1.00 26.43 ? 211 GLU A N     1 
ATOM   1591 C CA    . GLU A 1 211 ? -2.605  12.010  37.432  1.00 27.17 ? 211 GLU A CA    1 
ATOM   1592 C C     . GLU A 1 211 ? -2.191  12.809  36.198  1.00 27.60 ? 211 GLU A C     1 
ATOM   1593 O O     . GLU A 1 211 ? -2.868  13.798  35.826  1.00 25.89 ? 211 GLU A O     1 
ATOM   1594 C CB    . GLU A 1 211 ? -1.918  12.565  38.690  1.00 29.78 ? 211 GLU A CB    1 
ATOM   1595 C CG    . GLU A 1 211 ? -1.956  14.119  38.825  1.00 30.43 ? 211 GLU A CG    1 
ATOM   1596 C CD    . GLU A 1 211 ? -1.142  14.626  40.017  1.00 32.28 ? 211 GLU A CD    1 
ATOM   1597 O OE1   . GLU A 1 211 ? -0.095  13.972  40.392  1.00 29.46 ? 211 GLU A OE1   1 
ATOM   1598 O OE2   . GLU A 1 211 ? -1.568  15.682  40.558  1.00 29.99 ? 211 GLU A OE2   1 
ATOM   1599 N N     . LEU A 1 212 ? -1.101  12.386  35.543  1.00 25.63 ? 212 LEU A N     1 
ATOM   1600 C CA    . LEU A 1 212 ? -0.646  13.061  34.334  1.00 27.49 ? 212 LEU A CA    1 
ATOM   1601 C C     . LEU A 1 212 ? -1.577  12.717  33.130  1.00 27.40 ? 212 LEU A C     1 
ATOM   1602 O O     . LEU A 1 212 ? -1.679  13.478  32.170  1.00 26.23 ? 212 LEU A O     1 
ATOM   1603 C CB    . LEU A 1 212 ? 0.809   12.638  34.015  1.00 27.98 ? 212 LEU A CB    1 
ATOM   1604 C CG    . LEU A 1 212 ? 1.890   13.070  35.064  1.00 26.59 ? 212 LEU A CG    1 
ATOM   1605 C CD1   . LEU A 1 212 ? 3.238   12.393  34.788  1.00 27.68 ? 212 LEU A CD1   1 
ATOM   1606 C CD2   . LEU A 1 212 ? 1.996   14.590  34.973  1.00 27.59 ? 212 LEU A CD2   1 
ATOM   1607 N N     . ALA A 1 213 ? -2.226  11.553  33.183  1.00 27.07 ? 213 ALA A N     1 
ATOM   1608 C CA    . ALA A 1 213 ? -3.091  11.082  32.109  1.00 28.72 ? 213 ALA A CA    1 
ATOM   1609 C C     . ALA A 1 213 ? -4.529  11.592  32.242  1.00 30.29 ? 213 ALA A C     1 
ATOM   1610 O O     . ALA A 1 213 ? -5.173  11.918  31.256  1.00 32.24 ? 213 ALA A O     1 
ATOM   1611 C CB    . ALA A 1 213 ? -3.102  9.550   32.127  1.00 27.45 ? 213 ALA A CB    1 
ATOM   1612 N N     . ARG A 1 214 ? -5.009  11.676  33.474  1.00 30.34 ? 214 ARG A N     1 
ATOM   1613 C CA    . ARG A 1 214 ? -6.367  12.090  33.766  1.00 33.00 ? 214 ARG A CA    1 
ATOM   1614 C C     . ARG A 1 214 ? -6.477  13.413  34.461  1.00 33.56 ? 214 ARG A C     1 
ATOM   1615 O O     . ARG A 1 214 ? -7.589  13.896  34.594  1.00 30.68 ? 214 ARG A O     1 
ATOM   1616 C CB    . ARG A 1 214 ? -7.068  11.062  34.668  1.00 34.06 ? 214 ARG A CB    1 
ATOM   1617 C CG    . ARG A 1 214 ? -7.198  9.678   34.026  1.00 38.26 ? 214 ARG A CG    1 
ATOM   1618 C CD    . ARG A 1 214 ? -8.316  9.686   32.959  1.00 45.54 ? 214 ARG A CD    1 
ATOM   1619 N NE    . ARG A 1 214 ? -9.639  9.921   33.573  1.00 49.92 ? 214 ARG A NE    1 
ATOM   1620 C CZ    . ARG A 1 214 ? -10.346 9.024   34.286  1.00 51.88 ? 214 ARG A CZ    1 
ATOM   1621 N NH1   . ARG A 1 214 ? -9.885  7.799   34.508  1.00 51.93 ? 214 ARG A NH1   1 
ATOM   1622 N NH2   . ARG A 1 214 ? -11.551 9.342   34.755  1.00 52.32 ? 214 ARG A NH2   1 
ATOM   1623 N N     . GLY A 1 215 ? -5.366  13.981  34.969  1.00 32.57 ? 215 GLY A N     1 
ATOM   1624 C CA    . GLY A 1 215 ? -5.490  15.265  35.685  1.00 33.84 ? 215 GLY A CA    1 
ATOM   1625 C C     . GLY A 1 215 ? -5.685  15.286  37.218  1.00 34.38 ? 215 GLY A C     1 
ATOM   1626 O O     . GLY A 1 215 ? -5.503  16.337  37.863  1.00 32.41 ? 215 GLY A O     1 
ATOM   1627 N N     . GLU A 1 216 ? -6.002  14.128  37.816  1.00 32.42 ? 216 GLU A N     1 
ATOM   1628 C CA    . GLU A 1 216 ? -6.257  14.032  39.232  1.00 32.03 ? 216 GLU A CA    1 
ATOM   1629 C C     . GLU A 1 216 ? -5.954  12.592  39.625  1.00 30.92 ? 216 GLU A C     1 
ATOM   1630 O O     . GLU A 1 216 ? -6.045  11.671  38.809  1.00 30.31 ? 216 GLU A O     1 
ATOM   1631 C CB    . GLU A 1 216 ? -7.768  14.253  39.589  1.00 35.91 ? 216 GLU A CB    1 
ATOM   1632 C CG    . GLU A 1 216 ? -8.410  15.656  39.348  1.00 43.95 ? 216 GLU A CG    1 
ATOM   1633 C CD    . GLU A 1 216 ? -8.121  16.742  40.421  1.00 47.15 ? 216 GLU A CD    1 
ATOM   1634 O OE1   . GLU A 1 216 ? -7.396  16.465  41.380  1.00 50.11 ? 216 GLU A OE1   1 
ATOM   1635 O OE2   . GLU A 1 216 ? -8.625  17.908  40.319  1.00 51.93 ? 216 GLU A OE2   1 
ATOM   1636 N N     . PRO A 1 217 ? -5.613  12.376  40.890  1.00 28.86 ? 217 PRO A N     1 
ATOM   1637 C CA    . PRO A 1 217 ? -5.341  10.982  41.304  1.00 30.28 ? 217 PRO A CA    1 
ATOM   1638 C C     . PRO A 1 217 ? -6.683  10.282  41.560  1.00 30.69 ? 217 PRO A C     1 
ATOM   1639 O O     . PRO A 1 217 ? -7.741  10.935  41.581  1.00 31.41 ? 217 PRO A O     1 
ATOM   1640 C CB    . PRO A 1 217 ? -4.578  11.126  42.613  1.00 27.47 ? 217 PRO A CB    1 
ATOM   1641 C CG    . PRO A 1 217 ? -5.203  12.537  43.163  1.00 25.28 ? 217 PRO A CG    1 
ATOM   1642 C CD    . PRO A 1 217 ? -5.320  13.367  41.926  1.00 25.25 ? 217 PRO A CD    1 
ATOM   1643 N N     . PRO A 1 218 ? -6.646  8.959   41.721  1.00 30.54 ? 218 PRO A N     1 
ATOM   1644 C CA    . PRO A 1 218 ? -7.852  8.175   42.008  1.00 32.23 ? 218 PRO A CA    1 
ATOM   1645 C C     . PRO A 1 218 ? -8.449  8.696   43.315  1.00 32.62 ? 218 PRO A C     1 
ATOM   1646 O O     . PRO A 1 218 ? -7.722  9.154   44.221  1.00 31.88 ? 218 PRO A O     1 
ATOM   1647 C CB    . PRO A 1 218 ? -7.333  6.754   42.204  1.00 31.13 ? 218 PRO A CB    1 
ATOM   1648 C CG    . PRO A 1 218 ? -6.112  6.687   41.231  1.00 30.28 ? 218 PRO A CG    1 
ATOM   1649 C CD    . PRO A 1 218 ? -5.479  8.097   41.410  1.00 30.16 ? 218 PRO A CD    1 
ATOM   1650 N N     . HIS A 1 219 ? -9.779  8.604   43.411  1.00 32.52 ? 219 HIS A N     1 
ATOM   1651 C CA    . HIS A 1 219 ? -10.558 9.007   44.584  1.00 33.40 ? 219 HIS A CA    1 
ATOM   1652 C C     . HIS A 1 219 ? -10.505 10.483  44.915  1.00 33.66 ? 219 HIS A C     1 
ATOM   1653 O O     . HIS A 1 219 ? -10.945 10.890  45.998  1.00 31.90 ? 219 HIS A O     1 
ATOM   1654 C CB    . HIS A 1 219 ? -10.088 8.274   45.848  1.00 33.72 ? 219 HIS A CB    1 
ATOM   1655 C CG    . HIS A 1 219 ? -9.878  6.792   45.685  1.00 37.86 ? 219 HIS A CG    1 
ATOM   1656 N ND1   . HIS A 1 219 ? -10.817 5.954   45.119  1.00 38.77 ? 219 HIS A ND1   1 
ATOM   1657 C CD2   . HIS A 1 219 ? -8.861  5.993   46.095  1.00 36.50 ? 219 HIS A CD2   1 
ATOM   1658 C CE1   . HIS A 1 219 ? -10.387 4.704   45.191  1.00 39.84 ? 219 HIS A CE1   1 
ATOM   1659 N NE2   . HIS A 1 219 ? -9.204  4.701   45.784  1.00 39.86 ? 219 HIS A NE2   1 
ATOM   1660 N N     . SER A 1 220 ? -9.983  11.289  44.012  1.00 34.66 ? 220 SER A N     1 
ATOM   1661 C CA    . SER A 1 220 ? -9.775  12.706  44.328  1.00 38.18 ? 220 SER A CA    1 
ATOM   1662 C C     . SER A 1 220 ? -11.009 13.493  44.780  1.00 41.41 ? 220 SER A C     1 
ATOM   1663 O O     . SER A 1 220 ? -10.880 14.567  45.355  1.00 42.13 ? 220 SER A O     1 
ATOM   1664 C CB    . SER A 1 220 ? -9.118  13.447  43.152  1.00 36.85 ? 220 SER A CB    1 
ATOM   1665 O OG    . SER A 1 220 ? -9.996  13.614  42.074  1.00 39.83 ? 220 SER A OG    1 
ATOM   1666 N N     . GLU A 1 221 ? -12.185 12.954  44.523  1.00 43.22 ? 221 GLU A N     1 
ATOM   1667 C CA    . GLU A 1 221 ? -13.404 13.663  44.895  1.00 46.63 ? 221 GLU A CA    1 
ATOM   1668 C C     . GLU A 1 221 ? -13.829 13.229  46.293  1.00 45.13 ? 221 GLU A C     1 
ATOM   1669 O O     . GLU A 1 221 ? -14.668 13.878  46.918  1.00 45.56 ? 221 GLU A O     1 
ATOM   1670 C CB    . GLU A 1 221 ? -14.514 13.369  43.864  1.00 49.60 ? 221 GLU A CB    1 
ATOM   1671 C CG    . GLU A 1 221 ? -15.401 14.597  43.533  1.00 58.53 ? 221 GLU A CG    1 
ATOM   1672 C CD    . GLU A 1 221 ? -16.430 14.376  42.376  1.00 62.46 ? 221 GLU A CD    1 
ATOM   1673 O OE1   . GLU A 1 221 ? -17.049 15.383  41.924  1.00 64.14 ? 221 GLU A OE1   1 
ATOM   1674 O OE2   . GLU A 1 221 ? -16.618 13.208  41.928  1.00 64.43 ? 221 GLU A OE2   1 
ATOM   1675 N N     . LEU A 1 222 ? -13.214 12.167  46.820  1.00 41.95 ? 222 LEU A N     1 
ATOM   1676 C CA    . LEU A 1 222 ? -13.654 11.706  48.115  1.00 40.50 ? 222 LEU A CA    1 
ATOM   1677 C C     . LEU A 1 222 ? -13.010 12.436  49.264  1.00 39.59 ? 222 LEU A C     1 
ATOM   1678 O O     . LEU A 1 222 ? -11.990 13.114  49.072  1.00 40.01 ? 222 LEU A O     1 
ATOM   1679 C CB    . LEU A 1 222 ? -13.452 10.200  48.204  1.00 39.30 ? 222 LEU A CB    1 
ATOM   1680 C CG    . LEU A 1 222 ? -14.231 9.528   47.091  1.00 38.18 ? 222 LEU A CG    1 
ATOM   1681 C CD1   . LEU A 1 222 ? -13.868 8.034   47.000  1.00 37.65 ? 222 LEU A CD1   1 
ATOM   1682 C CD2   . LEU A 1 222 ? -15.720 9.724   47.355  1.00 39.45 ? 222 LEU A CD2   1 
ATOM   1683 N N     . HIS A 1 223 ? -13.633 12.383  50.441  1.00 37.39 ? 223 HIS A N     1 
ATOM   1684 C CA    . HIS A 1 223 ? -13.015 13.022  51.593  1.00 37.76 ? 223 HIS A CA    1 
ATOM   1685 C C     . HIS A 1 223 ? -11.782 12.169  51.924  1.00 38.16 ? 223 HIS A C     1 
ATOM   1686 O O     . HIS A 1 223 ? -11.881 10.928  51.922  1.00 34.95 ? 223 HIS A O     1 
ATOM   1687 C CB    . HIS A 1 223 ? -13.925 12.974  52.814  1.00 38.95 ? 223 HIS A CB    1 
ATOM   1688 C CG    . HIS A 1 223 ? -13.339 13.654  54.018  1.00 40.52 ? 223 HIS A CG    1 
ATOM   1689 N ND1   . HIS A 1 223 ? -13.739 14.910  54.439  1.00 41.14 ? 223 HIS A ND1   1 
ATOM   1690 C CD2   . HIS A 1 223 ? -12.347 13.274  54.860  1.00 38.64 ? 223 HIS A CD2   1 
ATOM   1691 C CE1   . HIS A 1 223 ? -13.019 15.267  55.488  1.00 40.84 ? 223 HIS A CE1   1 
ATOM   1692 N NE2   . HIS A 1 223 ? -12.165 14.294  55.761  1.00 41.39 ? 223 HIS A NE2   1 
ATOM   1693 N N     . PRO A 1 224 ? -10.632 12.812  52.253  1.00 38.67 ? 224 PRO A N     1 
ATOM   1694 C CA    . PRO A 1 224 ? -9.358  12.145  52.601  1.00 39.80 ? 224 PRO A CA    1 
ATOM   1695 C C     . PRO A 1 224 ? -9.438  10.995  53.597  1.00 40.05 ? 224 PRO A C     1 
ATOM   1696 O O     . PRO A 1 224 ? -8.720  9.969   53.477  1.00 40.55 ? 224 PRO A O     1 
ATOM   1697 C CB    . PRO A 1 224 ? -8.500  13.280  53.173  1.00 39.73 ? 224 PRO A CB    1 
ATOM   1698 C CG    . PRO A 1 224 ? -8.930  14.444  52.440  1.00 38.87 ? 224 PRO A CG    1 
ATOM   1699 C CD    . PRO A 1 224 ? -10.451 14.273  52.201  1.00 39.63 ? 224 PRO A CD    1 
ATOM   1700 N N     . MET A 1 225 ? -10.300 11.155  54.591  1.00 40.18 ? 225 MET A N     1 
ATOM   1701 C CA    . MET A 1 225 ? -10.417 10.137  55.626  1.00 42.31 ? 225 MET A CA    1 
ATOM   1702 C C     . MET A 1 225 ? -10.984 8.834   55.077  1.00 41.92 ? 225 MET A C     1 
ATOM   1703 O O     . MET A 1 225 ? -10.607 7.738   55.527  1.00 41.07 ? 225 MET A O     1 
ATOM   1704 C CB    . MET A 1 225 ? -11.270 10.649  56.795  1.00 43.99 ? 225 MET A CB    1 
ATOM   1705 C CG    . MET A 1 225 ? -10.993 9.932   58.114  1.00 47.20 ? 225 MET A CG    1 
ATOM   1706 S SD    . MET A 1 225 ? -12.376 10.292  59.306  1.00 51.40 ? 225 MET A SD    1 
ATOM   1707 C CE    . MET A 1 225 ? -12.093 12.038  59.613  1.00 49.30 ? 225 MET A CE    1 
ATOM   1708 N N     . LYS A 1 226 ? -11.896 8.951   54.126  1.00 40.99 ? 226 LYS A N     1 
ATOM   1709 C CA    . LYS A 1 226 ? -12.456 7.777   53.464  1.00 41.56 ? 226 LYS A CA    1 
ATOM   1710 C C     . LYS A 1 226 ? -11.307 7.154   52.674  1.00 40.27 ? 226 LYS A C     1 
ATOM   1711 O O     . LYS A 1 226 ? -11.123 5.945   52.662  1.00 37.33 ? 226 LYS A O     1 
ATOM   1712 C CB    . LYS A 1 226 ? -13.495 8.159   52.414  1.00 44.05 ? 226 LYS A CB    1 
ATOM   1713 C CG    . LYS A 1 226 ? -14.913 8.274   52.877  1.00 47.35 ? 226 LYS A CG    1 
ATOM   1714 C CD    . LYS A 1 226 ? -15.830 7.977   51.684  1.00 50.02 ? 226 LYS A CD    1 
ATOM   1715 C CE    . LYS A 1 226 ? -17.226 7.685   52.174  1.00 52.06 ? 226 LYS A CE    1 
ATOM   1716 N NZ    . LYS A 1 226 ? -17.504 8.625   53.293  1.00 51.95 ? 226 LYS A NZ    1 
ATOM   1717 N N     . VAL A 1 227 ? -10.564 8.011   51.977  1.00 40.72 ? 227 VAL A N     1 
ATOM   1718 C CA    . VAL A 1 227 ? -9.476  7.491   51.166  1.00 42.26 ? 227 VAL A CA    1 
ATOM   1719 C C     . VAL A 1 227 ? -8.512  6.707   52.044  1.00 41.76 ? 227 VAL A C     1 
ATOM   1720 O O     . VAL A 1 227 ? -7.915  5.744   51.584  1.00 42.92 ? 227 VAL A O     1 
ATOM   1721 C CB    . VAL A 1 227 ? -8.774  8.631   50.394  1.00 44.16 ? 227 VAL A CB    1 
ATOM   1722 C CG1   . VAL A 1 227 ? -7.875  8.067   49.337  1.00 43.57 ? 227 VAL A CG1   1 
ATOM   1723 C CG2   . VAL A 1 227 ? -9.849  9.524   49.706  1.00 45.70 ? 227 VAL A CG2   1 
ATOM   1724 N N     . LEU A 1 228 ? -8.444  7.051   53.335  1.00 42.41 ? 228 LEU A N     1 
ATOM   1725 C CA    . LEU A 1 228 ? -7.554  6.369   54.284  1.00 41.98 ? 228 LEU A CA    1 
ATOM   1726 C C     . LEU A 1 228 ? -7.874  4.889   54.473  1.00 41.91 ? 228 LEU A C     1 
ATOM   1727 O O     . LEU A 1 228 ? -6.966  4.129   54.705  1.00 42.98 ? 228 LEU A O     1 
ATOM   1728 C CB    . LEU A 1 228 ? -7.551  7.114   55.629  1.00 43.88 ? 228 LEU A CB    1 
ATOM   1729 C CG    . LEU A 1 228 ? -6.377  6.970   56.579  1.00 44.82 ? 228 LEU A CG    1 
ATOM   1730 C CD1   . LEU A 1 228 ? -5.126  7.679   55.982  1.00 43.42 ? 228 LEU A CD1   1 
ATOM   1731 C CD2   . LEU A 1 228 ? -6.771  7.626   57.929  1.00 46.78 ? 228 LEU A CD2   1 
ATOM   1732 N N     . PHE A 1 229 ? -9.141  4.449   54.389  1.00 40.12 ? 229 PHE A N     1 
ATOM   1733 C CA    . PHE A 1 229 ? -9.408  3.010   54.483  1.00 38.94 ? 229 PHE A CA    1 
ATOM   1734 C C     . PHE A 1 229 ? -9.523  2.367   53.101  1.00 37.12 ? 229 PHE A C     1 
ATOM   1735 O O     . PHE A 1 229 ? -9.320  1.164   52.935  1.00 38.28 ? 229 PHE A O     1 
ATOM   1736 C CB    . PHE A 1 229 ? -10.693 2.681   55.315  1.00 40.11 ? 229 PHE A CB    1 
ATOM   1737 C CG    . PHE A 1 229 ? -12.014 3.196   54.727  1.00 39.75 ? 229 PHE A CG    1 
ATOM   1738 C CD1   . PHE A 1 229 ? -12.700 2.479   53.731  1.00 40.17 ? 229 PHE A CD1   1 
ATOM   1739 C CD2   . PHE A 1 229 ? -12.570 4.388   55.192  1.00 40.58 ? 229 PHE A CD2   1 
ATOM   1740 C CE1   . PHE A 1 229 ? -13.942 2.972   53.196  1.00 39.90 ? 229 PHE A CE1   1 
ATOM   1741 C CE2   . PHE A 1 229 ? -13.794 4.881   54.673  1.00 41.19 ? 229 PHE A CE2   1 
ATOM   1742 C CZ    . PHE A 1 229 ? -14.473 4.176   53.678  1.00 39.99 ? 229 PHE A CZ    1 
ATOM   1743 N N     . LEU A 1 230 ? -9.876  3.149   52.097  1.00 35.26 ? 230 LEU A N     1 
ATOM   1744 C CA    . LEU A 1 230 ? -9.968  2.588   50.765  1.00 34.03 ? 230 LEU A CA    1 
ATOM   1745 C C     . LEU A 1 230 ? -8.638  2.074   50.181  1.00 34.68 ? 230 LEU A C     1 
ATOM   1746 O O     . LEU A 1 230 ? -8.562  1.000   49.591  1.00 32.04 ? 230 LEU A O     1 
ATOM   1747 C CB    . LEU A 1 230 ? -10.547 3.602   49.800  1.00 33.16 ? 230 LEU A CB    1 
ATOM   1748 C CG    . LEU A 1 230 ? -12.051 3.813   50.054  1.00 34.85 ? 230 LEU A CG    1 
ATOM   1749 C CD1   . LEU A 1 230 ? -12.544 5.038   49.278  1.00 34.15 ? 230 LEU A CD1   1 
ATOM   1750 C CD2   . LEU A 1 230 ? -12.784 2.507   49.673  1.00 31.81 ? 230 LEU A CD2   1 
ATOM   1751 N N     . ILE A 1 231 ? -7.597  2.871   50.316  1.00 34.72 ? 231 ILE A N     1 
ATOM   1752 C CA    . ILE A 1 231 ? -6.341  2.440   49.742  1.00 33.17 ? 231 ILE A CA    1 
ATOM   1753 C C     . ILE A 1 231 ? -5.904  1.060   50.232  1.00 34.35 ? 231 ILE A C     1 
ATOM   1754 O O     . ILE A 1 231 ? -5.674  0.198   49.409  1.00 36.21 ? 231 ILE A O     1 
ATOM   1755 C CB    . ILE A 1 231 ? -5.290  3.599   49.868  1.00 30.82 ? 231 ILE A CB    1 
ATOM   1756 C CG1   . ILE A 1 231 ? -5.758  4.723   48.956  1.00 27.33 ? 231 ILE A CG1   1 
ATOM   1757 C CG2   . ILE A 1 231 ? -3.921  3.212   49.250  1.00 29.19 ? 231 ILE A CG2   1 
ATOM   1758 C CD1   . ILE A 1 231 ? -5.131  6.095   49.222  1.00 31.00 ? 231 ILE A CD1   1 
ATOM   1759 N N     . PRO A 1 232 ? -5.830  0.789   51.556  1.00 37.82 ? 232 PRO A N     1 
ATOM   1760 C CA    . PRO A 1 232 ? -5.399  -0.574  51.965  1.00 38.99 ? 232 PRO A CA    1 
ATOM   1761 C C     . PRO A 1 232 ? -6.408  -1.685  51.695  1.00 41.28 ? 232 PRO A C     1 
ATOM   1762 O O     . PRO A 1 232 ? -6.043  -2.833  51.465  1.00 43.77 ? 232 PRO A O     1 
ATOM   1763 C CB    . PRO A 1 232 ? -5.120  -0.440  53.460  1.00 38.83 ? 232 PRO A CB    1 
ATOM   1764 C CG    . PRO A 1 232 ? -4.988  1.050   53.689  1.00 39.30 ? 232 PRO A CG    1 
ATOM   1765 C CD    . PRO A 1 232 ? -5.958  1.673   52.720  1.00 38.44 ? 232 PRO A CD    1 
ATOM   1766 N N     . LYS A 1 233 ? -7.679  -1.327  51.701  1.00 43.67 ? 233 LYS A N     1 
ATOM   1767 C CA    . LYS A 1 233 ? -8.806  -2.271  51.505  1.00 45.42 ? 233 LYS A CA    1 
ATOM   1768 C C     . LYS A 1 233 ? -9.024  -2.684  50.045  1.00 45.48 ? 233 LYS A C     1 
ATOM   1769 O O     . LYS A 1 233 ? -9.072  -3.880  49.717  1.00 45.68 ? 233 LYS A O     1 
ATOM   1770 C CB    . LYS A 1 233 ? -10.095 -1.599  52.075  1.00 46.33 ? 233 LYS A CB    1 
ATOM   1771 C CG    . LYS A 1 233 ? -11.489 -2.310  51.918  1.00 49.41 ? 233 LYS A CG    1 
ATOM   1772 C CD    . LYS A 1 233 ? -12.622 -1.362  52.429  1.00 50.54 ? 233 LYS A CD    1 
ATOM   1773 C CE    . LYS A 1 233 ? -14.068 -1.967  52.316  1.00 53.09 ? 233 LYS A CE    1 
ATOM   1774 N NZ    . LYS A 1 233 ? -14.209 -3.271  53.104  1.00 52.26 ? 233 LYS A NZ    1 
ATOM   1775 N N     . ASN A 1 234 ? -9.133  -1.685  49.164  1.00 44.63 ? 234 ASN A N     1 
ATOM   1776 C CA    . ASN A 1 234 ? -9.410  -1.922  47.738  1.00 42.17 ? 234 ASN A CA    1 
ATOM   1777 C C     . ASN A 1 234 ? -8.308  -2.486  46.888  1.00 40.79 ? 234 ASN A C     1 
ATOM   1778 O O     . ASN A 1 234 ? -7.128  -2.466  47.249  1.00 39.07 ? 234 ASN A O     1 
ATOM   1779 C CB    . ASN A 1 234 ? -9.881  -0.627  47.077  1.00 42.17 ? 234 ASN A CB    1 
ATOM   1780 C CG    . ASN A 1 234 ? -11.252 -0.206  47.547  1.00 43.42 ? 234 ASN A CG    1 
ATOM   1781 O OD1   . ASN A 1 234 ? -11.877 -0.937  48.290  1.00 42.43 ? 234 ASN A OD1   1 
ATOM   1782 N ND2   . ASN A 1 234 ? -11.715 0.977   47.129  1.00 43.97 ? 234 ASN A ND2   1 
ATOM   1783 N N     . ASN A 1 235 ? -8.717  -3.040  45.759  1.00 39.59 ? 235 ASN A N     1 
ATOM   1784 C CA    . ASN A 1 235 ? -7.728  -3.510  44.802  1.00 38.64 ? 235 ASN A CA    1 
ATOM   1785 C C     . ASN A 1 235 ? -7.115  -2.191  44.331  1.00 36.23 ? 235 ASN A C     1 
ATOM   1786 O O     . ASN A 1 235 ? -7.740  -1.118  44.427  1.00 34.65 ? 235 ASN A O     1 
ATOM   1787 C CB    . ASN A 1 235 ? -8.346  -4.201  43.602  1.00 39.69 ? 235 ASN A CB    1 
ATOM   1788 C CG    . ASN A 1 235 ? -8.961  -5.535  43.960  1.00 44.53 ? 235 ASN A CG    1 
ATOM   1789 O OD1   . ASN A 1 235 ? -8.396  -6.322  44.743  1.00 48.53 ? 235 ASN A OD1   1 
ATOM   1790 N ND2   . ASN A 1 235 ? -10.124 -5.808  43.388  1.00 45.39 ? 235 ASN A ND2   1 
ATOM   1791 N N     . PRO A 1 236 ? -5.888  -2.266  43.811  1.00 34.48 ? 236 PRO A N     1 
ATOM   1792 C CA    . PRO A 1 236 ? -5.166  -1.089  43.326  1.00 33.53 ? 236 PRO A CA    1 
ATOM   1793 C C     . PRO A 1 236 ? -5.883  -0.404  42.198  1.00 34.06 ? 236 PRO A C     1 
ATOM   1794 O O     . PRO A 1 236 ? -6.569  -1.050  41.410  1.00 33.12 ? 236 PRO A O     1 
ATOM   1795 C CB    . PRO A 1 236 ? -3.796  -1.665  42.898  1.00 33.85 ? 236 PRO A CB    1 
ATOM   1796 C CG    . PRO A 1 236 ? -4.040  -3.120  42.640  1.00 33.82 ? 236 PRO A CG    1 
ATOM   1797 C CD    . PRO A 1 236 ? -5.105  -3.506  43.641  1.00 34.72 ? 236 PRO A CD    1 
ATOM   1798 N N     . PRO A 1 237 ? -5.748  0.923   42.110  1.00 32.55 ? 237 PRO A N     1 
ATOM   1799 C CA    . PRO A 1 237 ? -6.381  1.679   41.045  1.00 33.22 ? 237 PRO A CA    1 
ATOM   1800 C C     . PRO A 1 237 ? -5.761  1.195   39.716  1.00 32.85 ? 237 PRO A C     1 
ATOM   1801 O O     . PRO A 1 237 ? -4.660  0.622   39.693  1.00 32.42 ? 237 PRO A O     1 
ATOM   1802 C CB    . PRO A 1 237 ? -5.962  3.142   41.363  1.00 31.31 ? 237 PRO A CB    1 
ATOM   1803 C CG    . PRO A 1 237 ? -5.654  3.132   42.732  1.00 30.89 ? 237 PRO A CG    1 
ATOM   1804 C CD    . PRO A 1 237 ? -4.984  1.824   42.987  1.00 31.67 ? 237 PRO A CD    1 
ATOM   1805 N N     . THR A 1 238 ? -6.497  1.345   38.637  1.00 32.05 ? 238 THR A N     1 
ATOM   1806 C CA    . THR A 1 238 ? -5.994  1.031   37.290  1.00 32.95 ? 238 THR A CA    1 
ATOM   1807 C C     . THR A 1 238 ? -6.294  2.316   36.483  1.00 31.13 ? 238 THR A C     1 
ATOM   1808 O O     . THR A 1 238 ? -7.137  3.130   36.906  1.00 33.44 ? 238 THR A O     1 
ATOM   1809 C CB    . THR A 1 238 ? -6.771  -0.153  36.598  1.00 35.75 ? 238 THR A CB    1 
ATOM   1810 O OG1   . THR A 1 238 ? -8.166  0.162   36.572  1.00 38.34 ? 238 THR A OG1   1 
ATOM   1811 C CG2   . THR A 1 238 ? -6.547  -1.485  37.364  1.00 36.29 ? 238 THR A CG2   1 
ATOM   1812 N N     . LEU A 1 239 ? -5.634  2.501   35.348  1.00 27.80 ? 239 LEU A N     1 
ATOM   1813 C CA    . LEU A 1 239 ? -5.869  3.656   34.492  1.00 29.30 ? 239 LEU A CA    1 
ATOM   1814 C C     . LEU A 1 239 ? -7.039  3.308   33.565  1.00 29.60 ? 239 LEU A C     1 
ATOM   1815 O O     . LEU A 1 239 ? -6.916  2.422   32.738  1.00 29.66 ? 239 LEU A O     1 
ATOM   1816 C CB    . LEU A 1 239 ? -4.650  3.981   33.620  1.00 27.08 ? 239 LEU A CB    1 
ATOM   1817 C CG    . LEU A 1 239 ? -4.729  5.144   32.636  1.00 31.06 ? 239 LEU A CG    1 
ATOM   1818 C CD1   . LEU A 1 239 ? -5.182  6.497   33.363  1.00 30.76 ? 239 LEU A CD1   1 
ATOM   1819 C CD2   . LEU A 1 239 ? -3.372  5.298   31.895  1.00 29.02 ? 239 LEU A CD2   1 
ATOM   1820 N N     . GLU A 1 240 ? -8.149  4.019   33.661  1.00 31.65 ? 240 GLU A N     1 
ATOM   1821 C CA    . GLU A 1 240 ? -9.269  3.688   32.782  1.00 33.79 ? 240 GLU A CA    1 
ATOM   1822 C C     . GLU A 1 240 ? -9.390  4.732   31.719  1.00 32.53 ? 240 GLU A C     1 
ATOM   1823 O O     . GLU A 1 240 ? -9.129  5.914   31.971  1.00 34.15 ? 240 GLU A O     1 
ATOM   1824 C CB    . GLU A 1 240 ? -10.571 3.668   33.575  1.00 40.35 ? 240 GLU A CB    1 
ATOM   1825 C CG    . GLU A 1 240 ? -10.548 2.718   34.751  1.00 48.22 ? 240 GLU A CG    1 
ATOM   1826 C CD    . GLU A 1 240 ? -11.667 3.013   35.781  1.00 53.26 ? 240 GLU A CD    1 
ATOM   1827 O OE1   . GLU A 1 240 ? -11.834 4.210   36.196  1.00 55.38 ? 240 GLU A OE1   1 
ATOM   1828 O OE2   . GLU A 1 240 ? -12.353 2.036   36.185  1.00 54.86 ? 240 GLU A OE2   1 
ATOM   1829 N N     . GLY A 1 241 ? -9.795  4.321   30.530  1.00 31.49 ? 241 GLY A N     1 
ATOM   1830 C CA    . GLY A 1 241 ? -9.956  5.300   29.470  1.00 31.84 ? 241 GLY A CA    1 
ATOM   1831 C C     . GLY A 1 241 ? -9.218  4.887   28.214  1.00 29.45 ? 241 GLY A C     1 
ATOM   1832 O O     . GLY A 1 241 ? -8.635  3.785   28.135  1.00 31.01 ? 241 GLY A O     1 
ATOM   1833 N N     . ASN A 1 242 ? -9.223  5.764   27.234  1.00 26.69 ? 242 ASN A N     1 
ATOM   1834 C CA    . ASN A 1 242 ? -8.579  5.419   26.006  1.00 28.24 ? 242 ASN A CA    1 
ATOM   1835 C C     . ASN A 1 242 ? -7.080  5.683   25.975  1.00 28.10 ? 242 ASN A C     1 
ATOM   1836 O O     . ASN A 1 242 ? -6.644  6.617   25.357  1.00 30.33 ? 242 ASN A O     1 
ATOM   1837 C CB    . ASN A 1 242 ? -9.256  6.119   24.862  1.00 29.27 ? 242 ASN A CB    1 
ATOM   1838 C CG    . ASN A 1 242 ? -8.901  5.490   23.536  1.00 29.65 ? 242 ASN A CG    1 
ATOM   1839 O OD1   . ASN A 1 242 ? -8.429  4.361   23.467  1.00 29.77 ? 242 ASN A OD1   1 
ATOM   1840 N ND2   . ASN A 1 242 ? -9.150  6.186   22.503  1.00 28.85 ? 242 ASN A ND2   1 
ATOM   1841 N N     . TYR A 1 243 ? -6.309  4.888   26.688  1.00 26.92 ? 243 TYR A N     1 
ATOM   1842 C CA    . TYR A 1 243 ? -4.836  5.066   26.674  1.00 27.84 ? 243 TYR A CA    1 
ATOM   1843 C C     . TYR A 1 243 ? -4.233  3.797   26.150  1.00 29.85 ? 243 TYR A C     1 
ATOM   1844 O O     . TYR A 1 243 ? -4.889  2.733   26.179  1.00 29.00 ? 243 TYR A O     1 
ATOM   1845 C CB    . TYR A 1 243 ? -4.328  5.313   28.109  1.00 26.14 ? 243 TYR A CB    1 
ATOM   1846 C CG    . TYR A 1 243 ? -4.927  6.589   28.686  1.00 28.62 ? 243 TYR A CG    1 
ATOM   1847 C CD1   . TYR A 1 243 ? -6.094  6.525   29.459  1.00 28.80 ? 243 TYR A CD1   1 
ATOM   1848 C CD2   . TYR A 1 243 ? -4.375  7.827   28.406  1.00 26.64 ? 243 TYR A CD2   1 
ATOM   1849 C CE1   . TYR A 1 243 ? -6.689  7.633   29.945  1.00 32.21 ? 243 TYR A CE1   1 
ATOM   1850 C CE2   . TYR A 1 243 ? -4.978  8.976   28.882  1.00 32.91 ? 243 TYR A CE2   1 
ATOM   1851 C CZ    . TYR A 1 243 ? -6.160  8.863   29.670  1.00 32.56 ? 243 TYR A CZ    1 
ATOM   1852 O OH    . TYR A 1 243 ? -6.859  9.971   30.162  1.00 32.60 ? 243 TYR A OH    1 
ATOM   1853 N N     . SER A 1 244 ? -2.985  3.881   25.678  1.00 28.54 ? 244 SER A N     1 
ATOM   1854 C CA    . SER A 1 244 ? -2.353  2.696   25.149  1.00 29.90 ? 244 SER A CA    1 
ATOM   1855 C C     . SER A 1 244 ? -2.169  1.606   26.178  1.00 30.27 ? 244 SER A C     1 
ATOM   1856 O O     . SER A 1 244 ? -2.123  1.819   27.433  1.00 29.36 ? 244 SER A O     1 
ATOM   1857 C CB    . SER A 1 244 ? -0.991  3.052   24.480  1.00 32.89 ? 244 SER A CB    1 
ATOM   1858 O OG    . SER A 1 244 ? -0.060  3.567   25.431  1.00 32.66 ? 244 SER A OG    1 
ATOM   1859 N N     . LYS A 1 245 ? -2.066  0.388   25.668  1.00 30.21 ? 245 LYS A N     1 
ATOM   1860 C CA    . LYS A 1 245 ? -1.909  -0.744  26.567  1.00 30.72 ? 245 LYS A CA    1 
ATOM   1861 C C     . LYS A 1 245 ? -0.635  -0.599  27.417  1.00 28.76 ? 245 LYS A C     1 
ATOM   1862 O O     . LYS A 1 245 ? -0.656  -0.892  28.602  1.00 28.17 ? 245 LYS A O     1 
ATOM   1863 C CB    . LYS A 1 245 ? -1.843  -2.058  25.779  1.00 33.81 ? 245 LYS A CB    1 
ATOM   1864 C CG    . LYS A 1 245 ? -1.533  -3.310  26.641  1.00 37.72 ? 245 LYS A CG    1 
ATOM   1865 C CD    . LYS A 1 245 ? -1.689  -4.575  25.801  1.00 40.53 ? 245 LYS A CD    1 
ATOM   1866 C CE    . LYS A 1 245 ? -1.168  -5.801  26.510  1.00 44.34 ? 245 LYS A CE    1 
ATOM   1867 N NZ    . LYS A 1 245 ? -1.361  -6.986  25.613  1.00 45.78 ? 245 LYS A NZ    1 
ATOM   1868 N N     . PRO A 1 246 ? 0.475   -0.183  26.813  1.00 28.39 ? 246 PRO A N     1 
ATOM   1869 C CA    . PRO A 1 246 ? 1.737   -0.011  27.593  1.00 29.64 ? 246 PRO A CA    1 
ATOM   1870 C C     . PRO A 1 246 ? 1.564   1.023   28.760  1.00 30.13 ? 246 PRO A C     1 
ATOM   1871 O O     . PRO A 1 246 ? 2.055   0.791   29.875  1.00 31.68 ? 246 PRO A O     1 
ATOM   1872 C CB    . PRO A 1 246 ? 2.730   0.494   26.550  1.00 28.11 ? 246 PRO A CB    1 
ATOM   1873 C CG    . PRO A 1 246 ? 2.258   -0.164  25.302  1.00 30.35 ? 246 PRO A CG    1 
ATOM   1874 C CD    . PRO A 1 246 ? 0.721   -0.031  25.374  1.00 27.22 ? 246 PRO A CD    1 
ATOM   1875 N N     . LEU A 1 247 ? 0.855   2.146   28.523  1.00 29.59 ? 247 LEU A N     1 
ATOM   1876 C CA    . LEU A 1 247 ? 0.617   3.095   29.627  1.00 28.65 ? 247 LEU A CA    1 
ATOM   1877 C C     . LEU A 1 247 ? -0.167  2.438   30.765  1.00 29.89 ? 247 LEU A C     1 
ATOM   1878 O O     . LEU A 1 247 ? 0.192   2.552   31.982  1.00 28.46 ? 247 LEU A O     1 
ATOM   1879 C CB    . LEU A 1 247 ? -0.111  4.369   29.130  1.00 28.56 ? 247 LEU A CB    1 
ATOM   1880 C CG    . LEU A 1 247 ? -0.410  5.428   30.229  1.00 25.72 ? 247 LEU A CG    1 
ATOM   1881 C CD1   . LEU A 1 247 ? 0.847   5.657   31.156  1.00 26.42 ? 247 LEU A CD1   1 
ATOM   1882 C CD2   . LEU A 1 247 ? -0.785  6.693   29.585  1.00 26.05 ? 247 LEU A CD2   1 
ATOM   1883 N N     . LYS A 1 248 ? -1.251  1.724   30.429  1.00 27.70 ? 248 LYS A N     1 
ATOM   1884 C CA    . LYS A 1 248 ? -2.004  1.032   31.451  1.00 28.00 ? 248 LYS A CA    1 
ATOM   1885 C C     . LYS A 1 248 ? -1.168  -0.032  32.180  1.00 26.95 ? 248 LYS A C     1 
ATOM   1886 O O     . LYS A 1 248 ? -1.306  -0.216  33.365  1.00 26.48 ? 248 LYS A O     1 
ATOM   1887 C CB    . LYS A 1 248 ? -3.228  0.329   30.844  1.00 28.90 ? 248 LYS A CB    1 
ATOM   1888 C CG    . LYS A 1 248 ? -4.195  1.346   30.224  1.00 30.11 ? 248 LYS A CG    1 
ATOM   1889 C CD    . LYS A 1 248 ? -5.483  0.642   29.697  1.00 31.88 ? 248 LYS A CD    1 
ATOM   1890 C CE    . LYS A 1 248 ? -6.518  1.726   29.317  1.00 32.48 ? 248 LYS A CE    1 
ATOM   1891 N NZ    . LYS A 1 248 ? -7.831  1.134   28.940  1.00 36.21 ? 248 LYS A NZ    1 
ATOM   1892 N N     . GLU A 1 249 ? -0.300  -0.714  31.453  1.00 25.44 ? 249 GLU A N     1 
ATOM   1893 C CA    . GLU A 1 249 ? 0.535   -1.760  32.088  1.00 28.46 ? 249 GLU A CA    1 
ATOM   1894 C C     . GLU A 1 249 ? 1.625   -1.135  32.991  1.00 26.43 ? 249 GLU A C     1 
ATOM   1895 O O     . GLU A 1 249 ? 1.899   -1.662  34.061  1.00 27.03 ? 249 GLU A O     1 
ATOM   1896 C CB    . GLU A 1 249 ? 1.119   -2.676  30.998  1.00 29.42 ? 249 GLU A CB    1 
ATOM   1897 C CG    . GLU A 1 249 ? 0.000   -3.586  30.484  1.00 36.97 ? 249 GLU A CG    1 
ATOM   1898 C CD    . GLU A 1 249 ? 0.484   -4.593  29.497  1.00 42.19 ? 249 GLU A CD    1 
ATOM   1899 O OE1   . GLU A 1 249 ? 1.425   -4.292  28.700  1.00 46.34 ? 249 GLU A OE1   1 
ATOM   1900 O OE2   . GLU A 1 249 ? -0.112  -5.687  29.508  1.00 48.26 ? 249 GLU A OE2   1 
ATOM   1901 N N     . PHE A 1 250 ? 2.105   0.040   32.585  1.00 26.87 ? 250 PHE A N     1 
ATOM   1902 C CA    . PHE A 1 250 ? 3.095   0.783   33.385  1.00 27.73 ? 250 PHE A CA    1 
ATOM   1903 C C     . PHE A 1 250 ? 2.453   1.136   34.755  1.00 28.12 ? 250 PHE A C     1 
ATOM   1904 O O     . PHE A 1 250 ? 3.032   0.953   35.838  1.00 26.93 ? 250 PHE A O     1 
ATOM   1905 C CB    . PHE A 1 250 ? 3.483   2.053   32.608  1.00 28.84 ? 250 PHE A CB    1 
ATOM   1906 C CG    . PHE A 1 250 ? 4.483   2.920   33.331  1.00 28.08 ? 250 PHE A CG    1 
ATOM   1907 C CD1   . PHE A 1 250 ? 4.067   3.762   34.377  1.00 27.79 ? 250 PHE A CD1   1 
ATOM   1908 C CD2   . PHE A 1 250 ? 5.850   2.861   33.001  1.00 28.07 ? 250 PHE A CD2   1 
ATOM   1909 C CE1   . PHE A 1 250 ? 5.007   4.574   35.130  1.00 27.09 ? 250 PHE A CE1   1 
ATOM   1910 C CE2   . PHE A 1 250 ? 6.803   3.661   33.740  1.00 27.34 ? 250 PHE A CE2   1 
ATOM   1911 C CZ    . PHE A 1 250 ? 6.364   4.509   34.803  1.00 27.14 ? 250 PHE A CZ    1 
ATOM   1912 N N     . VAL A 1 251 ? 1.234   1.687   34.714  1.00 26.55 ? 251 VAL A N     1 
ATOM   1913 C CA    . VAL A 1 251 ? 0.511   1.993   35.947  1.00 24.73 ? 251 VAL A CA    1 
ATOM   1914 C C     . VAL A 1 251 ? 0.286   0.724   36.774  1.00 26.41 ? 251 VAL A C     1 
ATOM   1915 O O     . VAL A 1 251 ? 0.408   0.741   37.997  1.00 28.33 ? 251 VAL A O     1 
ATOM   1916 C CB    . VAL A 1 251 ? -0.931  2.647   35.612  1.00 23.03 ? 251 VAL A CB    1 
ATOM   1917 C CG1   . VAL A 1 251 ? -1.729  2.791   36.828  1.00 24.03 ? 251 VAL A CG1   1 
ATOM   1918 C CG2   . VAL A 1 251 ? -0.716  4.016   35.001  1.00 24.31 ? 251 VAL A CG2   1 
ATOM   1919 N N     . GLU A 1 252 ? -0.104  -0.386  36.151  1.00 27.27 ? 252 GLU A N     1 
ATOM   1920 C CA    . GLU A 1 252 ? -0.291  -1.644  36.936  1.00 29.44 ? 252 GLU A CA    1 
ATOM   1921 C C     . GLU A 1 252 ? 1.007   -2.114  37.601  1.00 28.10 ? 252 GLU A C     1 
ATOM   1922 O O     . GLU A 1 252 ? 1.031   -2.593  38.746  1.00 27.37 ? 252 GLU A O     1 
ATOM   1923 C CB    . GLU A 1 252 ? -0.700  -2.819  36.047  1.00 35.21 ? 252 GLU A CB    1 
ATOM   1924 C CG    . GLU A 1 252 ? -2.127  -3.001  35.704  1.00 44.28 ? 252 GLU A CG    1 
ATOM   1925 C CD    . GLU A 1 252 ? -2.274  -4.382  35.019  1.00 49.32 ? 252 GLU A CD    1 
ATOM   1926 O OE1   . GLU A 1 252 ? -1.507  -4.651  34.046  1.00 50.89 ? 252 GLU A OE1   1 
ATOM   1927 O OE2   . GLU A 1 252 ? -3.110  -5.195  35.482  1.00 52.85 ? 252 GLU A OE2   1 
ATOM   1928 N N     . ALA A 1 253 ? 2.090   -1.992  36.858  1.00 28.38 ? 253 ALA A N     1 
ATOM   1929 C CA    . ALA A 1 253 ? 3.378   -2.438  37.396  1.00 26.69 ? 253 ALA A CA    1 
ATOM   1930 C C     . ALA A 1 253 ? 3.716   -1.677  38.697  1.00 27.28 ? 253 ALA A C     1 
ATOM   1931 O O     . ALA A 1 253 ? 4.125   -2.278  39.713  1.00 27.87 ? 253 ALA A O     1 
ATOM   1932 C CB    . ALA A 1 253 ? 4.457   -2.234  36.318  1.00 29.30 ? 253 ALA A CB    1 
ATOM   1933 N N     . CYS A 1 254 ? 3.498   -0.350  38.694  1.00 27.72 ? 254 CYS A N     1 
ATOM   1934 C CA    . CYS A 1 254 ? 3.737   0.453   39.876  1.00 26.42 ? 254 CYS A CA    1 
ATOM   1935 C C     . CYS A 1 254 ? 2.743   0.220   40.972  1.00 28.18 ? 254 CYS A C     1 
ATOM   1936 O O     . CYS A 1 254 ? 3.099   0.215   42.159  1.00 25.58 ? 254 CYS A O     1 
ATOM   1937 C CB    . CYS A 1 254 ? 3.674   1.949   39.563  1.00 25.86 ? 254 CYS A CB    1 
ATOM   1938 S SG    . CYS A 1 254 ? 4.835   2.507   38.369  1.00 28.48 ? 254 CYS A SG    1 
ATOM   1939 N N     . LEU A 1 255 ? 1.467   0.052   40.598  1.00 27.46 ? 255 LEU A N     1 
ATOM   1940 C CA    . LEU A 1 255 ? 0.440   -0.076  41.628  1.00 28.33 ? 255 LEU A CA    1 
ATOM   1941 C C     . LEU A 1 255 ? 0.111   -1.529  42.101  1.00 30.73 ? 255 LEU A C     1 
ATOM   1942 O O     . LEU A 1 255 ? -1.031  -2.029  41.985  1.00 29.50 ? 255 LEU A O     1 
ATOM   1943 C CB    . LEU A 1 255 ? -0.842  0.714   41.157  1.00 28.04 ? 255 LEU A CB    1 
ATOM   1944 C CG    . LEU A 1 255 ? -0.591  2.226   40.876  1.00 28.02 ? 255 LEU A CG    1 
ATOM   1945 C CD1   . LEU A 1 255 ? -1.883  2.952   40.427  1.00 25.33 ? 255 LEU A CD1   1 
ATOM   1946 C CD2   . LEU A 1 255 ? -0.052  2.923   42.164  1.00 26.25 ? 255 LEU A CD2   1 
ATOM   1947 N N     . ASN A 1 256 ? 1.106   -2.172  42.711  1.00 28.91 ? 256 ASN A N     1 
ATOM   1948 C CA    . ASN A 1 256 ? 0.948   -3.542  43.244  1.00 30.88 ? 256 ASN A CA    1 
ATOM   1949 C C     . ASN A 1 256 ? 0.762   -3.340  44.729  1.00 31.17 ? 256 ASN A C     1 
ATOM   1950 O O     . ASN A 1 256 ? 1.515   -2.582  45.333  1.00 31.18 ? 256 ASN A O     1 
ATOM   1951 C CB    . ASN A 1 256 ? 2.228   -4.349  42.993  1.00 29.71 ? 256 ASN A CB    1 
ATOM   1952 C CG    . ASN A 1 256 ? 2.039   -5.852  43.176  1.00 31.36 ? 256 ASN A CG    1 
ATOM   1953 O OD1   . ASN A 1 256 ? 1.622   -6.311  44.242  1.00 29.45 ? 256 ASN A OD1   1 
ATOM   1954 N ND2   . ASN A 1 256 ? 2.364   -6.622  42.117  1.00 30.60 ? 256 ASN A ND2   1 
ATOM   1955 N N     . LYS A 1 257 ? -0.286  -3.936  45.306  1.00 31.39 ? 257 LYS A N     1 
ATOM   1956 C CA    . LYS A 1 257 ? -0.486  -3.811  46.745  1.00 33.62 ? 257 LYS A CA    1 
ATOM   1957 C C     . LYS A 1 257 ? 0.698   -4.350  47.538  1.00 32.73 ? 257 LYS A C     1 
ATOM   1958 O O     . LYS A 1 257 ? 0.861   -3.968  48.659  1.00 33.11 ? 257 LYS A O     1 
ATOM   1959 C CB    . LYS A 1 257 ? -1.744  -4.547  47.244  1.00 34.08 ? 257 LYS A CB    1 
ATOM   1960 C CG    . LYS A 1 257 ? -3.082  -4.017  46.658  1.00 37.29 ? 257 LYS A CG    1 
ATOM   1961 C CD    . LYS A 1 257 ? -3.400  -2.630  47.147  1.00 35.83 ? 257 LYS A CD    1 
ATOM   1962 C CE    . LYS A 1 257 ? -3.875  -2.708  48.559  1.00 37.23 ? 257 LYS A CE    1 
ATOM   1963 N NZ    . LYS A 1 257 ? -5.046  -3.589  48.661  1.00 36.35 ? 257 LYS A NZ    1 
ATOM   1964 N N     . GLU A 1 258 ? 1.492   -5.238  46.970  1.00 32.05 ? 258 GLU A N     1 
ATOM   1965 C CA    . GLU A 1 258 ? 2.615   -5.797  47.691  1.00 32.27 ? 258 GLU A CA    1 
ATOM   1966 C C     . GLU A 1 258 ? 3.842   -4.977  47.252  1.00 30.79 ? 258 GLU A C     1 
ATOM   1967 O O     . GLU A 1 258 ? 4.276   -4.997  46.077  1.00 29.93 ? 258 GLU A O     1 
ATOM   1968 C CB    . GLU A 1 258 ? 2.744   -7.332  47.367  1.00 34.86 ? 258 GLU A CB    1 
ATOM   1969 C CG    . GLU A 1 258 ? 4.109   -7.900  47.764  1.00 36.59 ? 258 GLU A CG    1 
ATOM   1970 C CD    . GLU A 1 258 ? 4.409   -7.600  49.211  1.00 39.76 ? 258 GLU A CD    1 
ATOM   1971 O OE1   . GLU A 1 258 ? 5.520   -7.081  49.508  1.00 41.74 ? 258 GLU A OE1   1 
ATOM   1972 O OE2   . GLU A 1 258 ? 3.510   -7.868  50.043  1.00 40.89 ? 258 GLU A OE2   1 
ATOM   1973 N N     . PRO A 1 259 ? 4.432   -4.236  48.189  1.00 32.19 ? 259 PRO A N     1 
ATOM   1974 C CA    . PRO A 1 259 ? 5.588   -3.412  47.825  1.00 31.22 ? 259 PRO A CA    1 
ATOM   1975 C C     . PRO A 1 259 ? 6.787   -4.105  47.185  1.00 31.50 ? 259 PRO A C     1 
ATOM   1976 O O     . PRO A 1 259 ? 7.367   -3.567  46.253  1.00 28.39 ? 259 PRO A O     1 
ATOM   1977 C CB    . PRO A 1 259 ? 5.999   -2.728  49.150  1.00 32.93 ? 259 PRO A CB    1 
ATOM   1978 C CG    . PRO A 1 259 ? 4.886   -2.951  50.070  1.00 34.57 ? 259 PRO A CG    1 
ATOM   1979 C CD    . PRO A 1 259 ? 4.214   -4.247  49.642  1.00 31.05 ? 259 PRO A CD    1 
ATOM   1980 N N     . SER A 1 260 ? 7.174   -5.278  47.705  1.00 32.47 ? 260 SER A N     1 
ATOM   1981 C CA    . SER A 1 260 ? 8.333   -6.004  47.148  1.00 34.36 ? 260 SER A CA    1 
ATOM   1982 C C     . SER A 1 260 ? 8.031   -6.489  45.708  1.00 32.66 ? 260 SER A C     1 
ATOM   1983 O O     . SER A 1 260 ? 8.920   -6.895  44.976  1.00 33.36 ? 260 SER A O     1 
ATOM   1984 C CB    . SER A 1 260 ? 8.742   -7.170  48.112  1.00 36.34 ? 260 SER A CB    1 
ATOM   1985 O OG    . SER A 1 260 ? 7.617   -8.042  48.310  1.00 40.95 ? 260 SER A OG    1 
ATOM   1986 N N     . PHE A 1 261 ? 6.783   -6.397  45.250  1.00 30.44 ? 261 PHE A N     1 
ATOM   1987 C CA    . PHE A 1 261 ? 6.532   -6.808  43.879  1.00 29.57 ? 261 PHE A CA    1 
ATOM   1988 C C     . PHE A 1 261 ? 6.620   -5.631  42.891  1.00 29.80 ? 261 PHE A C     1 
ATOM   1989 O O     . PHE A 1 261 ? 6.572   -5.837  41.683  1.00 31.29 ? 261 PHE A O     1 
ATOM   1990 C CB    . PHE A 1 261 ? 5.185   -7.584  43.743  1.00 33.51 ? 261 PHE A CB    1 
ATOM   1991 C CG    . PHE A 1 261 ? 5.156   -8.894  44.494  1.00 31.86 ? 261 PHE A CG    1 
ATOM   1992 C CD1   . PHE A 1 261 ? 6.352   -9.459  44.962  1.00 32.88 ? 261 PHE A CD1   1 
ATOM   1993 C CD2   . PHE A 1 261 ? 3.942   -9.568  44.710  1.00 32.10 ? 261 PHE A CD2   1 
ATOM   1994 C CE1   . PHE A 1 261 ? 6.354   -10.695 45.636  1.00 33.11 ? 261 PHE A CE1   1 
ATOM   1995 C CE2   . PHE A 1 261 ? 3.908   -10.803 45.383  1.00 31.62 ? 261 PHE A CE2   1 
ATOM   1996 C CZ    . PHE A 1 261 ? 5.127   -11.374 45.848  1.00 33.44 ? 261 PHE A CZ    1 
ATOM   1997 N N     . ARG A 1 262 ? 6.782   -4.391  43.394  1.00 28.91 ? 262 ARG A N     1 
ATOM   1998 C CA    . ARG A 1 262 ? 6.973   -3.247  42.490  1.00 27.29 ? 262 ARG A CA    1 
ATOM   1999 C C     . ARG A 1 262 ? 8.450   -3.224  42.042  1.00 27.96 ? 262 ARG A C     1 
ATOM   2000 O O     . ARG A 1 262 ? 9.370   -3.511  42.838  1.00 29.56 ? 262 ARG A O     1 
ATOM   2001 C CB    . ARG A 1 262 ? 6.632   -1.933  43.217  1.00 27.98 ? 262 ARG A CB    1 
ATOM   2002 C CG    . ARG A 1 262 ? 5.199   -1.945  43.852  1.00 25.84 ? 262 ARG A CG    1 
ATOM   2003 C CD    . ARG A 1 262 ? 4.863   -0.669  44.615  1.00 23.43 ? 262 ARG A CD    1 
ATOM   2004 N NE    . ARG A 1 262 ? 3.813   -0.945  45.559  1.00 24.79 ? 262 ARG A NE    1 
ATOM   2005 C CZ    . ARG A 1 262 ? 3.729   -0.511  46.813  1.00 24.32 ? 262 ARG A CZ    1 
ATOM   2006 N NH1   . ARG A 1 262 ? 4.639   0.310   47.354  1.00 26.03 ? 262 ARG A NH1   1 
ATOM   2007 N NH2   . ARG A 1 262 ? 2.751   -0.982  47.560  1.00 24.77 ? 262 ARG A NH2   1 
ATOM   2008 N N     . PRO A 1 263 ? 8.681   -2.930  40.769  1.00 28.99 ? 263 PRO A N     1 
ATOM   2009 C CA    . PRO A 1 263 ? 9.986   -2.833  40.106  1.00 30.95 ? 263 PRO A CA    1 
ATOM   2010 C C     . PRO A 1 263 ? 10.686  -1.582  40.616  1.00 30.40 ? 263 PRO A C     1 
ATOM   2011 O O     . PRO A 1 263 ? 10.024  -0.676  41.128  1.00 26.99 ? 263 PRO A O     1 
ATOM   2012 C CB    . PRO A 1 263 ? 9.608   -2.656  38.655  1.00 31.30 ? 263 PRO A CB    1 
ATOM   2013 C CG    . PRO A 1 263 ? 8.203   -1.946  38.792  1.00 29.47 ? 263 PRO A CG    1 
ATOM   2014 C CD    . PRO A 1 263 ? 7.595   -2.794  39.772  1.00 29.58 ? 263 PRO A CD    1 
ATOM   2015 N N     . THR A 1 264 ? 12.007  -1.521  40.387  1.00 29.66 ? 264 THR A N     1 
ATOM   2016 C CA    . THR A 1 264 ? 12.773  -0.370  40.754  1.00 28.60 ? 264 THR A CA    1 
ATOM   2017 C C     . THR A 1 264 ? 12.581  0.730   39.729  1.00 28.57 ? 264 THR A C     1 
ATOM   2018 O O     . THR A 1 264 ? 12.062  0.509   38.612  1.00 32.39 ? 264 THR A O     1 
ATOM   2019 C CB    . THR A 1 264 ? 14.335  -0.640  40.725  1.00 28.61 ? 264 THR A CB    1 
ATOM   2020 O OG1   . THR A 1 264 ? 14.710  -0.995  39.392  1.00 28.80 ? 264 THR A OG1   1 
ATOM   2021 C CG2   . THR A 1 264 ? 14.738  -1.658  41.743  1.00 27.57 ? 264 THR A CG2   1 
ATOM   2022 N N     . ALA A 1 265 ? 13.031  1.929   40.068  1.00 28.34 ? 265 ALA A N     1 
ATOM   2023 C CA    . ALA A 1 265 ? 12.952  2.998   39.108  1.00 28.82 ? 265 ALA A CA    1 
ATOM   2024 C C     . ALA A 1 265 ? 13.854  2.648   37.892  1.00 31.68 ? 265 ALA A C     1 
ATOM   2025 O O     . ALA A 1 265 ? 13.533  2.941   36.733  1.00 29.43 ? 265 ALA A O     1 
ATOM   2026 C CB    . ALA A 1 265 ? 13.361  4.312   39.759  1.00 28.74 ? 265 ALA A CB    1 
ATOM   2027 N N     . LYS A 1 266 ? 14.984  1.994   38.130  1.00 34.05 ? 266 LYS A N     1 
ATOM   2028 C CA    . LYS A 1 266 ? 15.855  1.650   37.008  1.00 35.11 ? 266 LYS A CA    1 
ATOM   2029 C C     . LYS A 1 266 ? 15.139  0.722   36.008  1.00 34.77 ? 266 LYS A C     1 
ATOM   2030 O O     . LYS A 1 266 ? 15.224  0.930   34.816  1.00 36.91 ? 266 LYS A O     1 
ATOM   2031 C CB    . LYS A 1 266 ? 17.178  1.024   37.562  1.00 35.66 ? 266 LYS A CB    1 
ATOM   2032 C CG    . LYS A 1 266 ? 18.280  0.656   36.549  1.00 39.21 ? 266 LYS A CG    1 
ATOM   2033 C CD    . LYS A 1 266 ? 19.613  0.264   37.324  1.00 44.25 ? 266 LYS A CD    1 
ATOM   2034 C CE    . LYS A 1 266 ? 20.811  -0.138  36.414  1.00 47.07 ? 266 LYS A CE    1 
ATOM   2035 N NZ    . LYS A 1 266 ? 20.807  -1.622  36.057  1.00 49.69 ? 266 LYS A NZ    1 
ATOM   2036 N N     . GLU A 1 267 ? 14.416  -0.285  36.479  1.00 36.20 ? 267 GLU A N     1 
ATOM   2037 C CA    . GLU A 1 267 ? 13.724  -1.170  35.577  1.00 36.90 ? 267 GLU A CA    1 
ATOM   2038 C C     . GLU A 1 267 ? 12.552  -0.503  34.835  1.00 37.34 ? 267 GLU A C     1 
ATOM   2039 O O     . GLU A 1 267 ? 12.362  -0.764  33.654  1.00 37.04 ? 267 GLU A O     1 
ATOM   2040 C CB    . GLU A 1 267 ? 13.246  -2.450  36.292  1.00 39.56 ? 267 GLU A CB    1 
ATOM   2041 C CG    . GLU A 1 267 ? 14.362  -3.544  36.395  1.00 41.73 ? 267 GLU A CG    1 
ATOM   2042 C CD    . GLU A 1 267 ? 15.185  -3.671  35.092  1.00 42.95 ? 267 GLU A CD    1 
ATOM   2043 O OE1   . GLU A 1 267 ? 14.672  -4.196  34.094  1.00 45.69 ? 267 GLU A OE1   1 
ATOM   2044 O OE2   . GLU A 1 267 ? 16.348  -3.215  35.062  1.00 46.56 ? 267 GLU A OE2   1 
ATOM   2045 N N     . LEU A 1 268 ? 11.800  0.371   35.513  1.00 35.51 ? 268 LEU A N     1 
ATOM   2046 C CA    . LEU A 1 268 ? 10.684  1.089   34.851  1.00 32.41 ? 268 LEU A CA    1 
ATOM   2047 C C     . LEU A 1 268 ? 11.230  1.933   33.750  1.00 32.38 ? 268 LEU A C     1 
ATOM   2048 O O     . LEU A 1 268 ? 10.523  2.238   32.800  1.00 29.44 ? 268 LEU A O     1 
ATOM   2049 C CB    . LEU A 1 268 ? 9.958   2.003   35.847  1.00 29.53 ? 268 LEU A CB    1 
ATOM   2050 C CG    . LEU A 1 268 ? 9.075   1.163   36.706  1.00 29.44 ? 268 LEU A CG    1 
ATOM   2051 C CD1   . LEU A 1 268 ? 8.638   2.051   37.937  1.00 30.87 ? 268 LEU A CD1   1 
ATOM   2052 C CD2   . LEU A 1 268 ? 7.843   0.655   35.830  1.00 28.02 ? 268 LEU A CD2   1 
ATOM   2053 N N     . LEU A 1 269 ? 12.490  2.372   33.903  1.00 31.64 ? 269 LEU A N     1 
ATOM   2054 C CA    . LEU A 1 269 ? 13.119  3.134   32.858  1.00 33.82 ? 269 LEU A CA    1 
ATOM   2055 C C     . LEU A 1 269 ? 13.159  2.328   31.539  1.00 34.87 ? 269 LEU A C     1 
ATOM   2056 O O     . LEU A 1 269 ? 13.268  2.902   30.467  1.00 35.56 ? 269 LEU A O     1 
ATOM   2057 C CB    . LEU A 1 269 ? 14.552  3.562   33.265  1.00 37.02 ? 269 LEU A CB    1 
ATOM   2058 C CG    . LEU A 1 269 ? 14.614  4.842   34.111  1.00 37.75 ? 269 LEU A CG    1 
ATOM   2059 C CD1   . LEU A 1 269 ? 16.034  5.068   34.679  1.00 39.03 ? 269 LEU A CD1   1 
ATOM   2060 C CD2   . LEU A 1 269 ? 14.232  5.966   33.270  1.00 38.67 ? 269 LEU A CD2   1 
ATOM   2061 N N     . LYS A 1 270 ? 13.033  1.008   31.609  1.00 36.14 ? 270 LYS A N     1 
ATOM   2062 C CA    . LYS A 1 270 ? 13.059  0.199   30.389  1.00 39.08 ? 270 LYS A CA    1 
ATOM   2063 C C     . LYS A 1 270 ? 11.669  -0.375  30.057  1.00 39.32 ? 270 LYS A C     1 
ATOM   2064 O O     . LYS A 1 270 ? 11.525  -1.297  29.245  1.00 40.20 ? 270 LYS A O     1 
ATOM   2065 C CB    . LYS A 1 270 ? 14.042  -0.964  30.561  1.00 40.18 ? 270 LYS A CB    1 
ATOM   2066 C CG    . LYS A 1 270 ? 15.492  -0.516  30.886  1.00 44.46 ? 270 LYS A CG    1 
ATOM   2067 C CD    . LYS A 1 270 ? 16.406  -1.747  31.120  1.00 49.57 ? 270 LYS A CD    1 
ATOM   2068 C CE    . LYS A 1 270 ? 16.701  -2.531  29.780  1.00 53.39 ? 270 LYS A CE    1 
ATOM   2069 N NZ    . LYS A 1 270 ? 17.299  -3.949  29.845  1.00 51.37 ? 270 LYS A NZ    1 
ATOM   2070 N N     . HIS A 1 271 ? 10.638  0.121   30.722  1.00 35.13 ? 271 HIS A N     1 
ATOM   2071 C CA    . HIS A 1 271 ? 9.300   -0.380  30.431  1.00 33.73 ? 271 HIS A CA    1 
ATOM   2072 C C     . HIS A 1 271 ? 8.935   -0.007  28.966  1.00 31.71 ? 271 HIS A C     1 
ATOM   2073 O O     . HIS A 1 271 ? 9.296   1.078   28.473  1.00 32.03 ? 271 HIS A O     1 
ATOM   2074 C CB    . HIS A 1 271 ? 8.316   0.230   31.465  1.00 32.68 ? 271 HIS A CB    1 
ATOM   2075 C CG    . HIS A 1 271 ? 6.943   -0.364  31.409  1.00 31.93 ? 271 HIS A CG    1 
ATOM   2076 N ND1   . HIS A 1 271 ? 6.002   0.010   30.465  1.00 30.31 ? 271 HIS A ND1   1 
ATOM   2077 C CD2   . HIS A 1 271 ? 6.392   -1.375  32.114  1.00 34.04 ? 271 HIS A CD2   1 
ATOM   2078 C CE1   . HIS A 1 271 ? 4.933   -0.757  30.588  1.00 32.32 ? 271 HIS A CE1   1 
ATOM   2079 N NE2   . HIS A 1 271 ? 5.142   -1.609  31.582  1.00 34.26 ? 271 HIS A NE2   1 
ATOM   2080 N N     . LYS A 1 272 ? 8.215   -0.862  28.238  1.00 35.85 ? 272 LYS A N     1 
ATOM   2081 C CA    . LYS A 1 272 ? 7.894   -0.453  26.851  1.00 35.87 ? 272 LYS A CA    1 
ATOM   2082 C C     . LYS A 1 272 ? 7.155   0.884   26.710  1.00 33.50 ? 272 LYS A C     1 
ATOM   2083 O O     . LYS A 1 272 ? 7.318   1.561   25.710  1.00 31.88 ? 272 LYS A O     1 
ATOM   2084 C CB    . LYS A 1 272 ? 7.196   -1.558  26.010  1.00 40.65 ? 272 LYS A CB    1 
ATOM   2085 C CG    . LYS A 1 272 ? 5.908   -2.213  26.477  1.00 46.07 ? 272 LYS A CG    1 
ATOM   2086 C CD    . LYS A 1 272 ? 5.084   -2.739  25.238  1.00 49.44 ? 272 LYS A CD    1 
ATOM   2087 C CE    . LYS A 1 272 ? 3.717   -3.447  25.674  1.00 52.22 ? 272 LYS A CE    1 
ATOM   2088 N NZ    . LYS A 1 272 ? 2.602   -3.754  24.582  1.00 52.07 ? 272 LYS A NZ    1 
ATOM   2089 N N     . PHE A 1 273 ? 6.373   1.301   27.701  1.00 32.50 ? 273 PHE A N     1 
ATOM   2090 C CA    . PHE A 1 273 ? 5.678   2.617   27.585  1.00 31.01 ? 273 PHE A CA    1 
ATOM   2091 C C     . PHE A 1 273 ? 6.736   3.735   27.520  1.00 32.48 ? 273 PHE A C     1 
ATOM   2092 O O     . PHE A 1 273 ? 6.636   4.723   26.799  1.00 32.13 ? 273 PHE A O     1 
ATOM   2093 C CB    . PHE A 1 273 ? 4.820   2.915   28.835  1.00 27.69 ? 273 PHE A CB    1 
ATOM   2094 C CG    . PHE A 1 273 ? 4.162   4.286   28.790  1.00 29.05 ? 273 PHE A CG    1 
ATOM   2095 C CD1   . PHE A 1 273 ? 3.305   4.593   27.751  1.00 27.55 ? 273 PHE A CD1   1 
ATOM   2096 C CD2   . PHE A 1 273 ? 4.499   5.300   29.712  1.00 28.25 ? 273 PHE A CD2   1 
ATOM   2097 C CE1   . PHE A 1 273 ? 2.793   5.905   27.600  1.00 27.55 ? 273 PHE A CE1   1 
ATOM   2098 C CE2   . PHE A 1 273 ? 3.995   6.617   29.570  1.00 26.81 ? 273 PHE A CE2   1 
ATOM   2099 C CZ    . PHE A 1 273 ? 3.149   6.912   28.502  1.00 28.01 ? 273 PHE A CZ    1 
ATOM   2100 N N     . ILE A 1 274 ? 7.749   3.616   28.351  1.00 33.10 ? 274 ILE A N     1 
ATOM   2101 C CA    . ILE A 1 274 ? 8.781   4.637   28.297  1.00 34.28 ? 274 ILE A CA    1 
ATOM   2102 C C     . ILE A 1 274 ? 9.608   4.569   26.969  1.00 35.25 ? 274 ILE A C     1 
ATOM   2103 O O     . ILE A 1 274 ? 9.847   5.591   26.281  1.00 36.55 ? 274 ILE A O     1 
ATOM   2104 C CB    . ILE A 1 274 ? 9.748   4.484   29.540  1.00 33.95 ? 274 ILE A CB    1 
ATOM   2105 C CG1   . ILE A 1 274 ? 8.954   4.618   30.896  1.00 29.56 ? 274 ILE A CG1   1 
ATOM   2106 C CG2   . ILE A 1 274 ? 10.844  5.570   29.434  1.00 33.61 ? 274 ILE A CG2   1 
ATOM   2107 C CD1   . ILE A 1 274 ? 8.333   6.022   31.096  1.00 31.50 ? 274 ILE A CD1   1 
ATOM   2108 N N     . LEU A 1 275 ? 10.020  3.371   26.599  1.00 35.92 ? 275 LEU A N     1 
ATOM   2109 C CA    . LEU A 1 275 ? 10.877  3.207   25.418  1.00 39.55 ? 275 LEU A CA    1 
ATOM   2110 C C     . LEU A 1 275 ? 10.217  3.646   24.108  1.00 40.17 ? 275 LEU A C     1 
ATOM   2111 O O     . LEU A 1 275 ? 10.824  4.323   23.285  1.00 37.94 ? 275 LEU A O     1 
ATOM   2112 C CB    . LEU A 1 275 ? 11.359  1.753   25.327  1.00 39.45 ? 275 LEU A CB    1 
ATOM   2113 C CG    . LEU A 1 275 ? 12.457  1.415   26.367  1.00 41.95 ? 275 LEU A CG    1 
ATOM   2114 C CD1   . LEU A 1 275 ? 12.959  -0.038  26.204  1.00 41.33 ? 275 LEU A CD1   1 
ATOM   2115 C CD2   . LEU A 1 275 ? 13.590  2.415   26.232  1.00 40.02 ? 275 LEU A CD2   1 
ATOM   2116 N N     . ARG A 1 276 ? 8.950   3.295   23.953  1.00 40.33 ? 276 ARG A N     1 
ATOM   2117 C CA    . ARG A 1 276 ? 8.243   3.647   22.741  1.00 41.67 ? 276 ARG A CA    1 
ATOM   2118 C C     . ARG A 1 276 ? 7.776   5.082   22.692  1.00 41.71 ? 276 ARG A C     1 
ATOM   2119 O O     . ARG A 1 276 ? 7.592   5.622   21.571  1.00 42.86 ? 276 ARG A O     1 
ATOM   2120 C CB    . ARG A 1 276 ? 7.019   2.747   22.547  1.00 43.78 ? 276 ARG A CB    1 
ATOM   2121 C CG    . ARG A 1 276 ? 7.315   1.261   22.475  1.00 47.24 ? 276 ARG A CG    1 
ATOM   2122 C CD    . ARG A 1 276 ? 6.029   0.433   22.453  1.00 52.29 ? 276 ARG A CD    1 
ATOM   2123 N NE    . ARG A 1 276 ? 6.250   -0.914  21.916  1.00 55.31 ? 276 ARG A NE    1 
ATOM   2124 C CZ    . ARG A 1 276 ? 5.361   -1.898  21.970  1.00 57.00 ? 276 ARG A CZ    1 
ATOM   2125 N NH1   . ARG A 1 276 ? 4.181   -1.703  22.532  1.00 58.37 ? 276 ARG A NH1   1 
ATOM   2126 N NH2   . ARG A 1 276 ? 5.659   -3.086  21.476  1.00 58.16 ? 276 ARG A NH2   1 
ATOM   2127 N N     . ASN A 1 277 ? 7.590   5.734   23.846  1.00 38.37 ? 277 ASN A N     1 
ATOM   2128 C CA    . ASN A 1 277 ? 7.055   7.098   23.799  1.00 38.85 ? 277 ASN A CA    1 
ATOM   2129 C C     . ASN A 1 277 ? 7.870   8.296   24.250  1.00 38.41 ? 277 ASN A C     1 
ATOM   2130 O O     . ASN A 1 277 ? 7.668   9.392   23.759  1.00 38.20 ? 277 ASN A O     1 
ATOM   2131 C CB    . ASN A 1 277 ? 5.688   7.139   24.533  1.00 39.55 ? 277 ASN A CB    1 
ATOM   2132 C CG    . ASN A 1 277 ? 4.704   6.109   23.988  1.00 39.80 ? 277 ASN A CG    1 
ATOM   2133 O OD1   . ASN A 1 277 ? 4.583   4.977   24.487  1.00 40.77 ? 277 ASN A OD1   1 
ATOM   2134 N ND2   . ASN A 1 277 ? 4.009   6.490   22.952  1.00 42.07 ? 277 ASN A ND2   1 
ATOM   2135 N N     . ALA A 1 278 ? 8.783   8.103   25.189  1.00 40.05 ? 278 ALA A N     1 
ATOM   2136 C CA    . ALA A 1 278 ? 9.559   9.229   25.701  1.00 41.10 ? 278 ALA A CA    1 
ATOM   2137 C C     . ALA A 1 278 ? 10.433  9.847   24.597  1.00 43.73 ? 278 ALA A C     1 
ATOM   2138 O O     . ALA A 1 278 ? 10.967  9.157   23.741  1.00 43.40 ? 278 ALA A O     1 
ATOM   2139 C CB    . ALA A 1 278 ? 10.429  8.779   26.890  1.00 39.51 ? 278 ALA A CB    1 
ATOM   2140 N N     . LYS A 1 279 ? 10.555  11.160  24.643  1.00 46.29 ? 279 LYS A N     1 
ATOM   2141 C CA    . LYS A 1 279 ? 11.335  11.923  23.678  1.00 49.55 ? 279 LYS A CA    1 
ATOM   2142 C C     . LYS A 1 279 ? 12.262  12.902  24.392  1.00 50.20 ? 279 LYS A C     1 
ATOM   2143 O O     . LYS A 1 279 ? 12.402  12.857  25.601  1.00 52.09 ? 279 LYS A O     1 
ATOM   2144 C CB    . LYS A 1 279 ? 10.395  12.682  22.737  1.00 49.83 ? 279 LYS A CB    1 
ATOM   2145 C CG    . LYS A 1 279 ? 9.703   11.813  21.716  1.00 50.88 ? 279 LYS A CG    1 
ATOM   2146 C CD    . LYS A 1 279 ? 9.035   12.712  20.722  1.00 54.67 ? 279 LYS A CD    1 
ATOM   2147 C CE    . LYS A 1 279 ? 8.411   11.993  19.551  1.00 56.38 ? 279 LYS A CE    1 
ATOM   2148 N NZ    . LYS A 1 279 ? 8.053   13.071  18.571  1.00 58.77 ? 279 LYS A NZ    1 
ATOM   2149 N N     . LYS A 1 280 ? 12.895  13.799  23.661  1.00 51.67 ? 280 LYS A N     1 
ATOM   2150 C CA    . LYS A 1 280 ? 13.818  14.714  24.315  1.00 52.51 ? 280 LYS A CA    1 
ATOM   2151 C C     . LYS A 1 280 ? 13.050  15.716  25.162  1.00 51.85 ? 280 LYS A C     1 
ATOM   2152 O O     . LYS A 1 280 ? 11.907  16.102  24.841  1.00 50.14 ? 280 LYS A O     1 
ATOM   2153 C CB    . LYS A 1 280 ? 14.707  15.406  23.259  1.00 55.73 ? 280 LYS A CB    1 
ATOM   2154 C CG    . LYS A 1 280 ? 15.599  14.403  22.478  1.00 58.25 ? 280 LYS A CG    1 
ATOM   2155 C CD    . LYS A 1 280 ? 16.534  15.066  21.468  1.00 60.72 ? 280 LYS A CD    1 
ATOM   2156 C CE    . LYS A 1 280 ? 17.255  14.029  20.610  1.00 62.77 ? 280 LYS A CE    1 
ATOM   2157 N NZ    . LYS A 1 280 ? 18.281  14.670  19.698  1.00 65.70 ? 280 LYS A NZ    1 
ATOM   2158 N N     . THR A 1 281 ? 13.668  16.146  26.256  1.00 49.94 ? 281 THR A N     1 
ATOM   2159 C CA    . THR A 1 281 ? 12.993  17.068  27.146  1.00 49.35 ? 281 THR A CA    1 
ATOM   2160 C C     . THR A 1 281 ? 12.648  18.399  26.519  1.00 50.23 ? 281 THR A C     1 
ATOM   2161 O O     . THR A 1 281 ? 11.645  18.993  26.880  1.00 48.74 ? 281 THR A O     1 
ATOM   2162 C CB    . THR A 1 281 ? 13.833  17.340  28.395  1.00 50.29 ? 281 THR A CB    1 
ATOM   2163 O OG1   . THR A 1 281 ? 15.082  17.931  27.991  1.00 50.07 ? 281 THR A OG1   1 
ATOM   2164 C CG2   . THR A 1 281 ? 14.065  16.021  29.191  1.00 48.13 ? 281 THR A CG2   1 
ATOM   2165 N N     . SER A 1 282 ? 13.465  18.864  25.567  1.00 51.14 ? 282 SER A N     1 
ATOM   2166 C CA    . SER A 1 282 ? 13.234  20.164  24.936  1.00 51.78 ? 282 SER A CA    1 
ATOM   2167 C C     . SER A 1 282 ? 11.874  20.220  24.289  1.00 51.80 ? 282 SER A C     1 
ATOM   2168 O O     . SER A 1 282 ? 11.322  21.289  24.056  1.00 51.75 ? 282 SER A O     1 
ATOM   2169 C CB    . SER A 1 282 ? 14.318  20.460  23.901  1.00 52.96 ? 282 SER A CB    1 
ATOM   2170 O OG    . SER A 1 282 ? 14.275  19.523  22.844  1.00 55.93 ? 282 SER A OG    1 
ATOM   2171 N N     . TYR A 1 283 ? 11.329  19.045  24.014  1.00 53.06 ? 283 TYR A N     1 
ATOM   2172 C CA    . TYR A 1 283 ? 10.014  18.942  23.421  1.00 52.89 ? 283 TYR A CA    1 
ATOM   2173 C C     . TYR A 1 283 ? 8.986   19.451  24.396  1.00 52.28 ? 283 TYR A C     1 
ATOM   2174 O O     . TYR A 1 283 ? 7.907   19.854  23.989  1.00 52.93 ? 283 TYR A O     1 
ATOM   2175 C CB    . TYR A 1 283 ? 9.714   17.488  23.050  1.00 57.27 ? 283 TYR A CB    1 
ATOM   2176 C CG    . TYR A 1 283 ? 10.351  17.052  21.750  1.00 61.22 ? 283 TYR A CG    1 
ATOM   2177 C CD1   . TYR A 1 283 ? 9.727   17.311  20.537  1.00 63.44 ? 283 TYR A CD1   1 
ATOM   2178 C CD2   . TYR A 1 283 ? 11.606  16.428  21.726  1.00 63.70 ? 283 TYR A CD2   1 
ATOM   2179 C CE1   . TYR A 1 283 ? 10.331  16.964  19.321  1.00 64.75 ? 283 TYR A CE1   1 
ATOM   2180 C CE2   . TYR A 1 283 ? 12.220  16.075  20.525  1.00 64.46 ? 283 TYR A CE2   1 
ATOM   2181 C CZ    . TYR A 1 283 ? 11.572  16.347  19.323  1.00 65.13 ? 283 TYR A CZ    1 
ATOM   2182 O OH    . TYR A 1 283 ? 12.142  16.003  18.112  1.00 66.89 ? 283 TYR A OH    1 
ATOM   2183 N N     . LEU A 1 284 ? 9.302   19.441  25.692  1.00 49.07 ? 284 LEU A N     1 
ATOM   2184 C CA    . LEU A 1 284 ? 8.360   19.925  26.666  1.00 46.91 ? 284 LEU A CA    1 
ATOM   2185 C C     . LEU A 1 284 ? 8.187   21.461  26.677  1.00 46.57 ? 284 LEU A C     1 
ATOM   2186 O O     . LEU A 1 284 ? 7.291   21.972  27.331  1.00 45.64 ? 284 LEU A O     1 
ATOM   2187 C CB    . LEU A 1 284 ? 8.728   19.378  28.065  1.00 45.66 ? 284 LEU A CB    1 
ATOM   2188 C CG    . LEU A 1 284 ? 8.805   17.838  28.201  1.00 45.69 ? 284 LEU A CG    1 
ATOM   2189 C CD1   . LEU A 1 284 ? 9.313   17.432  29.588  1.00 44.47 ? 284 LEU A CD1   1 
ATOM   2190 C CD2   . LEU A 1 284 ? 7.395   17.236  27.955  1.00 44.38 ? 284 LEU A CD2   1 
ATOM   2191 N N     . THR A 1 285 ? 9.001   22.216  25.926  1.00 49.04 ? 285 THR A N     1 
ATOM   2192 C CA    . THR A 1 285 ? 8.851   23.689  25.910  1.00 47.81 ? 285 THR A CA    1 
ATOM   2193 C C     . THR A 1 285 ? 7.469   24.123  25.392  1.00 48.59 ? 285 THR A C     1 
ATOM   2194 O O     . THR A 1 285 ? 6.885   25.135  25.860  1.00 46.69 ? 285 THR A O     1 
ATOM   2195 C CB    . THR A 1 285 ? 9.983   24.383  25.082  1.00 49.73 ? 285 THR A CB    1 
ATOM   2196 O OG1   . THR A 1 285 ? 9.748   24.204  23.674  1.00 49.73 ? 285 THR A OG1   1 
ATOM   2197 C CG2   . THR A 1 285 ? 11.360  23.769  25.435  1.00 49.57 ? 285 THR A CG2   1 
ATOM   2198 N N     . GLU A 1 286 ? 6.918   23.333  24.466  1.00 49.90 ? 286 GLU A N     1 
ATOM   2199 C CA    . GLU A 1 286 ? 5.585   23.621  23.925  1.00 51.26 ? 286 GLU A CA    1 
ATOM   2200 C C     . GLU A 1 286 ? 4.583   23.628  25.039  1.00 50.28 ? 286 GLU A C     1 
ATOM   2201 O O     . GLU A 1 286 ? 3.829   24.601  25.229  1.00 50.05 ? 286 GLU A O     1 
ATOM   2202 C CB    . GLU A 1 286 ? 5.176   22.585  22.877  1.00 54.66 ? 286 GLU A CB    1 
ATOM   2203 C CG    . GLU A 1 286 ? 3.778   22.839  22.250  1.00 60.15 ? 286 GLU A CG    1 
ATOM   2204 C CD    . GLU A 1 286 ? 3.647   24.225  21.606  1.00 63.09 ? 286 GLU A CD    1 
ATOM   2205 O OE1   . GLU A 1 286 ? 4.483   24.539  20.728  1.00 66.57 ? 286 GLU A OE1   1 
ATOM   2206 O OE2   . GLU A 1 286 ? 2.715   24.997  21.969  1.00 64.45 ? 286 GLU A OE2   1 
ATOM   2207 N N     . LEU A 1 287 ? 4.590   22.537  25.803  1.00 50.53 ? 287 LEU A N     1 
ATOM   2208 C CA    . LEU A 1 287 ? 3.712   22.373  26.944  1.00 48.38 ? 287 LEU A CA    1 
ATOM   2209 C C     . LEU A 1 287 ? 3.919   23.528  27.900  1.00 47.94 ? 287 LEU A C     1 
ATOM   2210 O O     . LEU A 1 287 ? 2.967   24.020  28.517  1.00 47.98 ? 287 LEU A O     1 
ATOM   2211 C CB    . LEU A 1 287 ? 4.044   21.049  27.636  1.00 50.04 ? 287 LEU A CB    1 
ATOM   2212 C CG    . LEU A 1 287 ? 3.006   20.450  28.578  1.00 48.45 ? 287 LEU A CG    1 
ATOM   2213 C CD1   . LEU A 1 287 ? 1.736   20.240  27.797  1.00 48.94 ? 287 LEU A CD1   1 
ATOM   2214 C CD2   . LEU A 1 287 ? 3.502   19.133  29.117  1.00 48.87 ? 287 LEU A CD2   1 
ATOM   2215 N N     . ILE A 1 288 ? 5.173   23.954  28.052  1.00 49.43 ? 288 ILE A N     1 
ATOM   2216 C CA    . ILE A 1 288 ? 5.494   25.075  28.934  1.00 48.57 ? 288 ILE A CA    1 
ATOM   2217 C C     . ILE A 1 288 ? 4.907   26.392  28.357  1.00 48.90 ? 288 ILE A C     1 
ATOM   2218 O O     . ILE A 1 288 ? 4.314   27.191  29.079  1.00 48.82 ? 288 ILE A O     1 
ATOM   2219 C CB    . ILE A 1 288 ? 7.050   25.175  29.156  1.00 49.50 ? 288 ILE A CB    1 
ATOM   2220 C CG1   . ILE A 1 288 ? 7.528   23.949  29.974  1.00 50.21 ? 288 ILE A CG1   1 
ATOM   2221 C CG2   . ILE A 1 288 ? 7.423   26.499  29.922  1.00 47.44 ? 288 ILE A CG2   1 
ATOM   2222 C CD1   . ILE A 1 288 ? 9.029   23.604  29.843  1.00 48.98 ? 288 ILE A CD1   1 
ATOM   2223 N N     . ASP A 1 289 ? 5.034   26.599  27.054  1.00 50.77 ? 289 ASP A N     1 
ATOM   2224 C CA    . ASP A 1 289 ? 4.474   27.816  26.449  1.00 50.99 ? 289 ASP A CA    1 
ATOM   2225 C C     . ASP A 1 289 ? 2.951   27.829  26.485  1.00 51.04 ? 289 ASP A C     1 
ATOM   2226 O O     . ASP A 1 289 ? 2.336   28.885  26.609  1.00 51.75 ? 289 ASP A O     1 
ATOM   2227 C CB    . ASP A 1 289 ? 4.938   27.969  25.009  1.00 54.18 ? 289 ASP A CB    1 
ATOM   2228 C CG    . ASP A 1 289 ? 6.454   28.268  24.903  1.00 56.37 ? 289 ASP A CG    1 
ATOM   2229 O OD1   . ASP A 1 289 ? 7.039   28.825  25.854  1.00 58.87 ? 289 ASP A OD1   1 
ATOM   2230 O OD2   . ASP A 1 289 ? 7.063   27.963  23.865  1.00 57.98 ? 289 ASP A OD2   1 
ATOM   2231 N N     . ARG A 1 290 ? 2.328   26.657  26.420  1.00 49.39 ? 290 ARG A N     1 
ATOM   2232 C CA    . ARG A 1 290 ? 0.888   26.624  26.428  1.00 48.27 ? 290 ARG A CA    1 
ATOM   2233 C C     . ARG A 1 290 ? 0.396   27.145  27.767  1.00 48.84 ? 290 ARG A C     1 
ATOM   2234 O O     . ARG A 1 290 ? -0.644  27.860  27.864  1.00 48.35 ? 290 ARG A O     1 
ATOM   2235 C CB    . ARG A 1 290 ? 0.399   25.182  26.195  1.00 48.80 ? 290 ARG A CB    1 
ATOM   2236 C CG    . ARG A 1 290 ? -1.108  25.046  26.365  1.00 48.47 ? 290 ARG A CG    1 
ATOM   2237 C CD    . ARG A 1 290 ? -1.568  23.624  26.256  1.00 47.67 ? 290 ARG A CD    1 
ATOM   2238 N NE    . ARG A 1 290 ? -1.330  22.854  27.479  1.00 46.46 ? 290 ARG A NE    1 
ATOM   2239 C CZ    . ARG A 1 290 ? -1.789  21.609  27.665  1.00 46.08 ? 290 ARG A CZ    1 
ATOM   2240 N NH1   . ARG A 1 290 ? -2.506  21.038  26.704  1.00 41.98 ? 290 ARG A NH1   1 
ATOM   2241 N NH2   . ARG A 1 290 ? -1.526  20.938  28.799  1.00 43.08 ? 290 ARG A NH2   1 
ATOM   2242 N N     . TYR A 1 291 ? 1.139   26.786  28.823  1.00 48.18 ? 291 TYR A N     1 
ATOM   2243 C CA    . TYR A 1 291 ? 0.763   27.186  30.159  1.00 48.37 ? 291 TYR A CA    1 
ATOM   2244 C C     . TYR A 1 291 ? 0.915   28.704  30.391  1.00 49.81 ? 291 TYR A C     1 
ATOM   2245 O O     . TYR A 1 291 ? 0.127   29.318  31.126  1.00 51.19 ? 291 TYR A O     1 
ATOM   2246 C CB    . TYR A 1 291 ? 1.568   26.391  31.216  1.00 46.48 ? 291 TYR A CB    1 
ATOM   2247 C CG    . TYR A 1 291 ? 1.304   26.897  32.603  1.00 44.32 ? 291 TYR A CG    1 
ATOM   2248 C CD1   . TYR A 1 291 ? 0.070   26.715  33.203  1.00 43.17 ? 291 TYR A CD1   1 
ATOM   2249 C CD2   . TYR A 1 291 ? 2.277   27.627  33.295  1.00 43.88 ? 291 TYR A CD2   1 
ATOM   2250 C CE1   . TYR A 1 291 ? -0.207  27.244  34.444  1.00 41.83 ? 291 TYR A CE1   1 
ATOM   2251 C CE2   . TYR A 1 291 ? 2.015   28.145  34.523  1.00 43.31 ? 291 TYR A CE2   1 
ATOM   2252 C CZ    . TYR A 1 291 ? 0.773   27.957  35.089  1.00 43.14 ? 291 TYR A CZ    1 
ATOM   2253 O OH    . TYR A 1 291 ? 0.510   28.518  36.296  1.00 45.62 ? 291 TYR A OH    1 
ATOM   2254 N N     . LYS A 1 292 ? 1.906   29.321  29.777  1.00 51.45 ? 292 LYS A N     1 
ATOM   2255 C CA    . LYS A 1 292 ? 2.068   30.755  29.975  1.00 54.05 ? 292 LYS A CA    1 
ATOM   2256 C C     . LYS A 1 292 ? 0.973   31.562  29.291  1.00 54.91 ? 292 LYS A C     1 
ATOM   2257 O O     . LYS A 1 292 ? 0.488   32.588  29.820  1.00 54.37 ? 292 LYS A O     1 
ATOM   2258 C CB    . LYS A 1 292 ? 3.415   31.212  29.463  1.00 55.99 ? 292 LYS A CB    1 
ATOM   2259 C CG    . LYS A 1 292 ? 4.513   30.865  30.426  1.00 58.35 ? 292 LYS A CG    1 
ATOM   2260 C CD    . LYS A 1 292 ? 5.673   31.857  30.369  1.00 61.47 ? 292 LYS A CD    1 
ATOM   2261 C CE    . LYS A 1 292 ? 5.316   33.234  30.975  1.00 61.80 ? 292 LYS A CE    1 
ATOM   2262 N NZ    . LYS A 1 292 ? 6.541   34.124  31.059  1.00 61.71 ? 292 LYS A NZ    1 
ATOM   2263 N N     . ARG A 1 293 ? 0.577   31.085  28.117  1.00 54.87 ? 293 ARG A N     1 
ATOM   2264 C CA    . ARG A 1 293 ? -0.446  31.760  27.356  1.00 53.99 ? 293 ARG A CA    1 
ATOM   2265 C C     . ARG A 1 293 ? -1.753  31.624  28.111  1.00 53.80 ? 293 ARG A C     1 
ATOM   2266 O O     . ARG A 1 293 ? -2.522  32.577  28.219  1.00 54.32 ? 293 ARG A O     1 
ATOM   2267 C CB    . ARG A 1 293 ? -0.534  31.128  25.978  1.00 55.76 ? 293 ARG A CB    1 
ATOM   2268 C CG    . ARG A 1 293 ? 0.811   31.103  25.235  1.00 58.37 ? 293 ARG A CG    1 
ATOM   2269 C CD    . ARG A 1 293 ? 0.576   30.788  23.768  1.00 59.36 ? 293 ARG A CD    1 
ATOM   2270 N NE    . ARG A 1 293 ? -0.301  29.637  23.669  1.00 60.57 ? 293 ARG A NE    1 
ATOM   2271 C CZ    . ARG A 1 293 ? 0.105   28.430  23.309  1.00 60.98 ? 293 ARG A CZ    1 
ATOM   2272 N NH1   . ARG A 1 293 ? 1.379   28.248  22.999  1.00 61.48 ? 293 ARG A NH1   1 
ATOM   2273 N NH2   . ARG A 1 293 ? -0.749  27.406  23.304  1.00 61.91 ? 293 ARG A NH2   1 
ATOM   2274 N N     . TRP A 1 294 ? -1.982  30.438  28.667  1.00 51.60 ? 294 TRP A N     1 
ATOM   2275 C CA    . TRP A 1 294 ? -3.189  30.164  29.396  1.00 51.16 ? 294 TRP A CA    1 
ATOM   2276 C C     . TRP A 1 294 ? -3.232  31.057  30.642  1.00 52.88 ? 294 TRP A C     1 
ATOM   2277 O O     . TRP A 1 294 ? -4.273  31.637  31.010  1.00 52.84 ? 294 TRP A O     1 
ATOM   2278 C CB    . TRP A 1 294 ? -3.203  28.670  29.788  1.00 48.67 ? 294 TRP A CB    1 
ATOM   2279 C CG    . TRP A 1 294 ? -4.355  28.287  30.608  1.00 46.99 ? 294 TRP A CG    1 
ATOM   2280 C CD1   . TRP A 1 294 ? -5.616  27.978  30.161  1.00 45.78 ? 294 TRP A CD1   1 
ATOM   2281 C CD2   . TRP A 1 294 ? -4.425  28.283  32.043  1.00 46.30 ? 294 TRP A CD2   1 
ATOM   2282 N NE1   . TRP A 1 294 ? -6.467  27.795  31.236  1.00 45.20 ? 294 TRP A NE1   1 
ATOM   2283 C CE2   . TRP A 1 294 ? -5.759  27.974  32.398  1.00 45.67 ? 294 TRP A CE2   1 
ATOM   2284 C CE3   . TRP A 1 294 ? -3.491  28.508  33.058  1.00 45.30 ? 294 TRP A CE3   1 
ATOM   2285 C CZ2   . TRP A 1 294 ? -6.180  27.887  33.731  1.00 47.57 ? 294 TRP A CZ2   1 
ATOM   2286 C CZ3   . TRP A 1 294 ? -3.903  28.421  34.394  1.00 46.51 ? 294 TRP A CZ3   1 
ATOM   2287 C CH2   . TRP A 1 294 ? -5.239  28.112  34.719  1.00 48.35 ? 294 TRP A CH2   1 
ATOM   2288 N N     . LYS A 1 295 ? -2.084  31.146  31.306  1.00 54.04 ? 295 LYS A N     1 
ATOM   2289 C CA    . LYS A 1 295 ? -1.977  31.918  32.530  1.00 55.61 ? 295 LYS A CA    1 
ATOM   2290 C C     . LYS A 1 295 ? -2.211  33.403  32.220  1.00 55.14 ? 295 LYS A C     1 
ATOM   2291 O O     . LYS A 1 295 ? -2.791  34.124  33.021  1.00 54.51 ? 295 LYS A O     1 
ATOM   2292 C CB    . LYS A 1 295 ? -0.592  31.687  33.167  1.00 57.68 ? 295 LYS A CB    1 
ATOM   2293 C CG    . LYS A 1 295 ? -0.582  31.657  34.686  1.00 59.31 ? 295 LYS A CG    1 
ATOM   2294 C CD    . LYS A 1 295 ? 0.856   31.509  35.166  1.00 61.93 ? 295 LYS A CD    1 
ATOM   2295 C CE    . LYS A 1 295 ? 0.996   31.596  36.692  1.00 64.15 ? 295 LYS A CE    1 
ATOM   2296 N NZ    . LYS A 1 295 ? 2.371   31.134  37.123  1.00 65.23 ? 295 LYS A NZ    1 
ATOM   2297 N N     . ALA A 1 296 ? -1.756  33.860  31.065  1.00 54.47 ? 296 ALA A N     1 
ATOM   2298 C CA    . ALA A 1 296 ? -1.993  35.248  30.703  1.00 55.78 ? 296 ALA A CA    1 
ATOM   2299 C C     . ALA A 1 296 ? -3.514  35.554  30.663  1.00 56.92 ? 296 ALA A C     1 
ATOM   2300 O O     . ALA A 1 296 ? -3.927  36.684  30.957  1.00 57.60 ? 296 ALA A O     1 
ATOM   2301 C CB    . ALA A 1 296 ? -1.369  35.540  29.346  1.00 54.20 ? 296 ALA A CB    1 
ATOM   2302 N N     . GLU A 1 297 ? -4.345  34.564  30.322  1.00 56.67 ? 297 GLU A N     1 
ATOM   2303 C CA    . GLU A 1 297 ? -5.788  34.803  30.212  1.00 58.10 ? 297 GLU A CA    1 
ATOM   2304 C C     . GLU A 1 297 ? -6.591  34.514  31.451  1.00 58.72 ? 297 GLU A C     1 
ATOM   2305 O O     . GLU A 1 297 ? -7.843  34.557  31.420  1.00 59.17 ? 297 GLU A O     1 
ATOM   2306 C CB    . GLU A 1 297 ? -6.409  33.987  29.074  1.00 58.09 ? 297 GLU A CB    1 
ATOM   2307 C CG    . GLU A 1 297 ? -5.774  34.155  27.704  1.00 59.72 ? 297 GLU A CG    1 
ATOM   2308 C CD    . GLU A 1 297 ? -5.564  35.620  27.314  1.00 61.15 ? 297 GLU A CD    1 
ATOM   2309 O OE1   . GLU A 1 297 ? -6.448  36.459  27.616  1.00 60.36 ? 297 GLU A OE1   1 
ATOM   2310 O OE2   . GLU A 1 297 ? -4.511  35.920  26.695  1.00 61.44 ? 297 GLU A OE2   1 
ATOM   2311 N N     . GLN A 1 298 ? -5.910  34.202  32.542  1.00 58.56 ? 298 GLN A N     1 
ATOM   2312 C CA    . GLN A 1 298 ? -6.625  33.912  33.776  1.00 59.03 ? 298 GLN A CA    1 
ATOM   2313 C C     . GLN A 1 298 ? -6.748  35.176  34.618  1.00 60.21 ? 298 GLN A C     1 
ATOM   2314 O O     . GLN A 1 298 ? -5.945  36.102  34.323  1.00 61.61 ? 298 GLN A O     1 
ATOM   2315 C CB    . GLN A 1 298 ? -5.895  32.805  34.550  1.00 59.29 ? 298 GLN A CB    1 
ATOM   2316 C CG    . GLN A 1 298 ? -5.720  31.513  33.748  1.00 57.72 ? 298 GLN A CG    1 
ATOM   2317 C CD    . GLN A 1 298 ? -7.028  31.057  33.114  1.00 57.00 ? 298 GLN A CD    1 
ATOM   2318 O OE1   . GLN A 1 298 ? -8.024  30.842  33.815  1.00 54.16 ? 298 GLN A OE1   1 
ATOM   2319 N NE2   . GLN A 1 298 ? -7.030  30.919  31.778  1.00 54.77 ? 298 GLN A NE2   1 
ATOM   2320 N N     . SER B 1 8   ? 53.995  18.185  -4.627  1.00 70.05 ? 8   SER B N     1 
ATOM   2321 C CA    . SER B 1 8   ? 55.291  17.628  -4.114  1.00 69.50 ? 8   SER B CA    1 
ATOM   2322 C C     . SER B 1 8   ? 55.108  16.368  -3.248  1.00 68.28 ? 8   SER B C     1 
ATOM   2323 O O     . SER B 1 8   ? 56.097  15.841  -2.700  1.00 68.53 ? 8   SER B O     1 
ATOM   2324 C CB    . SER B 1 8   ? 56.029  18.689  -3.303  1.00 70.10 ? 8   SER B CB    1 
ATOM   2325 O OG    . SER B 1 8   ? 55.276  19.023  -2.157  1.00 70.09 ? 8   SER B OG    1 
ATOM   2326 N N     . GLY B 1 9   ? 53.854  15.902  -3.129  1.00 65.92 ? 9   GLY B N     1 
ATOM   2327 C CA    . GLY B 1 9   ? 53.552  14.695  -2.356  1.00 62.86 ? 9   GLY B CA    1 
ATOM   2328 C C     . GLY B 1 9   ? 52.730  14.853  -1.064  1.00 60.18 ? 9   GLY B C     1 
ATOM   2329 O O     . GLY B 1 9   ? 52.531  15.962  -0.564  1.00 60.03 ? 9   GLY B O     1 
ATOM   2330 N N     . LEU B 1 10  ? 52.265  13.729  -0.529  1.00 55.99 ? 10  LEU B N     1 
ATOM   2331 C CA    . LEU B 1 10  ? 51.485  13.704  0.709   1.00 53.07 ? 10  LEU B CA    1 
ATOM   2332 C C     . LEU B 1 10  ? 52.391  13.779  1.938   1.00 50.71 ? 10  LEU B C     1 
ATOM   2333 O O     . LEU B 1 10  ? 53.138  12.839  2.207   1.00 50.27 ? 10  LEU B O     1 
ATOM   2334 C CB    . LEU B 1 10  ? 50.669  12.407  0.761   1.00 51.77 ? 10  LEU B CB    1 
ATOM   2335 C CG    . LEU B 1 10  ? 49.594  12.355  1.835   1.00 52.53 ? 10  LEU B CG    1 
ATOM   2336 C CD1   . LEU B 1 10  ? 48.610  13.505  1.573   1.00 51.11 ? 10  LEU B CD1   1 
ATOM   2337 C CD2   . LEU B 1 10  ? 48.901  11.003  1.803   1.00 51.16 ? 10  LEU B CD2   1 
ATOM   2338 N N     . PRO B 1 11  ? 52.330  14.881  2.714   1.00 49.34 ? 11  PRO B N     1 
ATOM   2339 C CA    . PRO B 1 11  ? 53.203  14.958  3.899   1.00 48.60 ? 11  PRO B CA    1 
ATOM   2340 C C     . PRO B 1 11  ? 52.972  13.768  4.839   1.00 48.71 ? 11  PRO B C     1 
ATOM   2341 O O     . PRO B 1 11  ? 51.813  13.375  5.084   1.00 48.21 ? 11  PRO B O     1 
ATOM   2342 C CB    . PRO B 1 11  ? 52.809  16.275  4.561   1.00 47.77 ? 11  PRO B CB    1 
ATOM   2343 C CG    . PRO B 1 11  ? 52.242  17.086  3.408   1.00 48.35 ? 11  PRO B CG    1 
ATOM   2344 C CD    . PRO B 1 11  ? 51.473  16.072  2.602   1.00 48.47 ? 11  PRO B CD    1 
ATOM   2345 N N     . GLY B 1 12  ? 54.062  13.204  5.360   1.00 45.77 ? 12  GLY B N     1 
ATOM   2346 C CA    . GLY B 1 12  ? 53.933  12.076  6.244   1.00 45.18 ? 12  GLY B CA    1 
ATOM   2347 C C     . GLY B 1 12  ? 53.726  10.748  5.554   1.00 45.27 ? 12  GLY B C     1 
ATOM   2348 O O     . GLY B 1 12  ? 53.611  9.728   6.235   1.00 42.56 ? 12  GLY B O     1 
ATOM   2349 N N     . MET B 1 13  ? 53.659  10.754  4.216   1.00 47.06 ? 13  MET B N     1 
ATOM   2350 C CA    . MET B 1 13  ? 53.515  9.523   3.451   1.00 48.18 ? 13  MET B CA    1 
ATOM   2351 C C     . MET B 1 13  ? 54.759  8.700   3.831   1.00 50.28 ? 13  MET B C     1 
ATOM   2352 O O     . MET B 1 13  ? 55.878  9.231   3.855   1.00 49.19 ? 13  MET B O     1 
ATOM   2353 C CB    . MET B 1 13  ? 53.523  9.825   1.969   1.00 48.75 ? 13  MET B CB    1 
ATOM   2354 C CG    . MET B 1 13  ? 53.337  8.629   1.080   1.00 50.79 ? 13  MET B CG    1 
ATOM   2355 S SD    . MET B 1 13  ? 51.729  7.847   1.305   1.00 52.99 ? 13  MET B SD    1 
ATOM   2356 C CE    . MET B 1 13  ? 50.725  8.705   0.134   1.00 51.56 ? 13  MET B CE    1 
ATOM   2357 N N     . GLN B 1 14  ? 54.565  7.421   4.151   1.00 50.93 ? 14  GLN B N     1 
ATOM   2358 C CA    . GLN B 1 14  ? 55.678  6.572   4.556   1.00 52.51 ? 14  GLN B CA    1 
ATOM   2359 C C     . GLN B 1 14  ? 56.121  5.692   3.423   1.00 52.68 ? 14  GLN B C     1 
ATOM   2360 O O     . GLN B 1 14  ? 55.394  5.510   2.442   1.00 52.38 ? 14  GLN B O     1 
ATOM   2361 C CB    . GLN B 1 14  ? 55.276  5.704   5.735   1.00 52.82 ? 14  GLN B CB    1 
ATOM   2362 C CG    . GLN B 1 14  ? 54.729  6.502   6.908   1.00 55.09 ? 14  GLN B CG    1 
ATOM   2363 C CD    . GLN B 1 14  ? 55.790  7.252   7.675   1.00 56.59 ? 14  GLN B CD    1 
ATOM   2364 O OE1   . GLN B 1 14  ? 55.708  8.493   7.858   1.00 57.40 ? 14  GLN B OE1   1 
ATOM   2365 N NE2   . GLN B 1 14  ? 56.791  6.519   8.153   1.00 56.46 ? 14  GLN B NE2   1 
ATOM   2366 N N     . ASN B 1 15  ? 57.318  5.138   3.592   1.00 52.97 ? 15  ASN B N     1 
ATOM   2367 C CA    . ASN B 1 15  ? 57.952  4.234   2.618   1.00 53.60 ? 15  ASN B CA    1 
ATOM   2368 C C     . ASN B 1 15  ? 57.006  3.127   2.159   1.00 52.91 ? 15  ASN B C     1 
ATOM   2369 O O     . ASN B 1 15  ? 56.542  2.356   3.000   1.00 52.88 ? 15  ASN B O     1 
ATOM   2370 C CB    . ASN B 1 15  ? 59.176  3.615   3.289   1.00 53.60 ? 15  ASN B CB    1 
ATOM   2371 C CG    . ASN B 1 15  ? 60.112  2.920   2.309   1.00 54.62 ? 15  ASN B CG    1 
ATOM   2372 O OD1   . ASN B 1 15  ? 61.346  3.023   2.447   1.00 53.19 ? 15  ASN B OD1   1 
ATOM   2373 N ND2   . ASN B 1 15  ? 59.543  2.204   1.325   1.00 54.50 ? 15  ASN B ND2   1 
ATOM   2374 N N     . LEU B 1 16  ? 56.749  3.033   0.851   1.00 52.34 ? 16  LEU B N     1 
ATOM   2375 C CA    . LEU B 1 16  ? 55.834  2.023   0.304   1.00 53.44 ? 16  LEU B CA    1 
ATOM   2376 C C     . LEU B 1 16  ? 56.191  0.605   0.602   1.00 54.18 ? 16  LEU B C     1 
ATOM   2377 O O     . LEU B 1 16  ? 55.385  -0.304  0.383   1.00 55.24 ? 16  LEU B O     1 
ATOM   2378 C CB    . LEU B 1 16  ? 55.685  2.161   -1.207  1.00 53.58 ? 16  LEU B CB    1 
ATOM   2379 C CG    . LEU B 1 16  ? 54.627  3.176   -1.597  1.00 54.56 ? 16  LEU B CG    1 
ATOM   2380 C CD1   . LEU B 1 16  ? 53.322  2.614   -1.039  1.00 53.31 ? 16  LEU B CD1   1 
ATOM   2381 C CD2   . LEU B 1 16  ? 54.929  4.611   -1.047  1.00 53.41 ? 16  LEU B CD2   1 
ATOM   2382 N N     . LYS B 1 17  ? 57.404  0.411   1.096   1.00 55.22 ? 17  LYS B N     1 
ATOM   2383 C CA    . LYS B 1 17  ? 57.861  -0.916  1.441   1.00 55.66 ? 17  LYS B CA    1 
ATOM   2384 C C     . LYS B 1 17  ? 57.166  -1.317  2.712   1.00 55.39 ? 17  LYS B C     1 
ATOM   2385 O O     . LYS B 1 17  ? 56.972  -2.521  2.972   1.00 56.78 ? 17  LYS B O     1 
ATOM   2386 C CB    . LYS B 1 17  ? 59.379  -0.910  1.678   1.00 58.31 ? 17  LYS B CB    1 
ATOM   2387 C CG    . LYS B 1 17  ? 60.160  -2.115  1.040   1.00 59.98 ? 17  LYS B CG    1 
ATOM   2388 C CD    . LYS B 1 17  ? 59.969  -2.279  -0.515  1.00 61.45 ? 17  LYS B CD    1 
ATOM   2389 C CE    . LYS B 1 17  ? 58.596  -2.917  -0.867  1.00 63.23 ? 17  LYS B CE    1 
ATOM   2390 N NZ    . LYS B 1 17  ? 58.495  -3.527  -2.248  1.00 61.84 ? 17  LYS B NZ    1 
ATOM   2391 N N     . ALA B 1 18  ? 56.795  -0.301  3.508   1.00 53.69 ? 18  ALA B N     1 
ATOM   2392 C CA    . ALA B 1 18  ? 56.128  -0.517  4.786   1.00 50.48 ? 18  ALA B CA    1 
ATOM   2393 C C     . ALA B 1 18  ? 54.712  -0.960  4.538   1.00 49.03 ? 18  ALA B C     1 
ATOM   2394 O O     . ALA B 1 18  ? 53.965  -0.321  3.801   1.00 48.68 ? 18  ALA B O     1 
ATOM   2395 C CB    . ALA B 1 18  ? 56.145  0.738   5.610   1.00 49.67 ? 18  ALA B CB    1 
ATOM   2396 N N     . ASP B 1 19  ? 54.360  -2.080  5.150   1.00 46.94 ? 19  ASP B N     1 
ATOM   2397 C CA    . ASP B 1 19  ? 53.027  -2.621  5.002   1.00 45.57 ? 19  ASP B CA    1 
ATOM   2398 C C     . ASP B 1 19  ? 52.213  -2.326  6.252   1.00 42.16 ? 19  ASP B C     1 
ATOM   2399 O O     . ASP B 1 19  ? 52.429  -2.933  7.299   1.00 41.03 ? 19  ASP B O     1 
ATOM   2400 C CB    . ASP B 1 19  ? 53.088  -4.134  4.781   1.00 46.92 ? 19  ASP B CB    1 
ATOM   2401 C CG    . ASP B 1 19  ? 51.727  -4.731  4.553   1.00 48.24 ? 19  ASP B CG    1 
ATOM   2402 O OD1   . ASP B 1 19  ? 51.663  -5.960  4.377   1.00 49.88 ? 19  ASP B OD1   1 
ATOM   2403 O OD2   . ASP B 1 19  ? 50.725  -3.977  4.553   1.00 46.58 ? 19  ASP B OD2   1 
ATOM   2404 N N     . PRO B 1 20  ? 51.266  -1.375  6.152   1.00 40.05 ? 20  PRO B N     1 
ATOM   2405 C CA    . PRO B 1 20  ? 50.410  -1.019  7.299   1.00 37.91 ? 20  PRO B CA    1 
ATOM   2406 C C     . PRO B 1 20  ? 49.664  -2.179  7.944   1.00 36.55 ? 20  PRO B C     1 
ATOM   2407 O O     . PRO B 1 20  ? 49.324  -2.128  9.124   1.00 36.93 ? 20  PRO B O     1 
ATOM   2408 C CB    . PRO B 1 20  ? 49.469  0.031   6.717   1.00 38.96 ? 20  PRO B CB    1 
ATOM   2409 C CG    . PRO B 1 20  ? 49.370  -0.373  5.238   1.00 40.41 ? 20  PRO B CG    1 
ATOM   2410 C CD    . PRO B 1 20  ? 50.852  -0.655  4.933   1.00 39.20 ? 20  PRO B CD    1 
ATOM   2411 N N     . GLU B 1 21  ? 49.387  -3.227  7.177   1.00 36.25 ? 21  GLU B N     1 
ATOM   2412 C CA    . GLU B 1 21  ? 48.700  -4.420  7.680   1.00 36.99 ? 21  GLU B CA    1 
ATOM   2413 C C     . GLU B 1 21  ? 49.573  -5.218  8.606   1.00 37.70 ? 21  GLU B C     1 
ATOM   2414 O O     . GLU B 1 21  ? 49.066  -5.984  9.424   1.00 37.47 ? 21  GLU B O     1 
ATOM   2415 C CB    . GLU B 1 21  ? 48.219  -5.302  6.525   1.00 39.71 ? 21  GLU B CB    1 
ATOM   2416 C CG    . GLU B 1 21  ? 47.113  -4.573  5.675   1.00 43.68 ? 21  GLU B CG    1 
ATOM   2417 C CD    . GLU B 1 21  ? 46.382  -5.484  4.690   1.00 46.56 ? 21  GLU B CD    1 
ATOM   2418 O OE1   . GLU B 1 21  ? 45.410  -4.996  4.041   1.00 48.56 ? 21  GLU B OE1   1 
ATOM   2419 O OE2   . GLU B 1 21  ? 46.776  -6.678  4.563   1.00 48.02 ? 21  GLU B OE2   1 
ATOM   2420 N N     . GLU B 1 22  ? 50.892  -5.032  8.480   1.00 37.93 ? 22  GLU B N     1 
ATOM   2421 C CA    . GLU B 1 22  ? 51.857  -5.678  9.367   1.00 39.26 ? 22  GLU B CA    1 
ATOM   2422 C C     . GLU B 1 22  ? 52.194  -4.701  10.516  1.00 36.42 ? 22  GLU B C     1 
ATOM   2423 O O     . GLU B 1 22  ? 52.380  -5.102  11.650  1.00 36.70 ? 22  GLU B O     1 
ATOM   2424 C CB    . GLU B 1 22  ? 53.144  -6.024  8.587   1.00 44.40 ? 22  GLU B CB    1 
ATOM   2425 C CG    . GLU B 1 22  ? 52.932  -6.900  7.323   1.00 50.90 ? 22  GLU B CG    1 
ATOM   2426 C CD    . GLU B 1 22  ? 54.239  -7.540  6.810   1.00 56.88 ? 22  GLU B CD    1 
ATOM   2427 O OE1   . GLU B 1 22  ? 54.267  -8.028  5.642   1.00 59.65 ? 22  GLU B OE1   1 
ATOM   2428 O OE2   . GLU B 1 22  ? 55.243  -7.561  7.582   1.00 60.56 ? 22  GLU B OE2   1 
ATOM   2429 N N     . LEU B 1 23  ? 52.255  -3.402  10.238  1.00 36.12 ? 23  LEU B N     1 
ATOM   2430 C CA    . LEU B 1 23  ? 52.573  -2.467  11.312  1.00 33.89 ? 23  LEU B CA    1 
ATOM   2431 C C     . LEU B 1 23  ? 51.468  -2.218  12.313  1.00 32.33 ? 23  LEU B C     1 
ATOM   2432 O O     . LEU B 1 23  ? 51.727  -1.875  13.455  1.00 31.92 ? 23  LEU B O     1 
ATOM   2433 C CB    . LEU B 1 23  ? 53.002  -1.143  10.738  1.00 36.23 ? 23  LEU B CB    1 
ATOM   2434 C CG    . LEU B 1 23  ? 54.153  -1.329  9.771   1.00 37.73 ? 23  LEU B CG    1 
ATOM   2435 C CD1   . LEU B 1 23  ? 54.739  0.060   9.350   1.00 37.66 ? 23  LEU B CD1   1 
ATOM   2436 C CD2   . LEU B 1 23  ? 55.200  -2.173  10.537  1.00 39.96 ? 23  LEU B CD2   1 
ATOM   2437 N N     . PHE B 1 24  ? 50.222  -2.369  11.886  1.00 30.38 ? 24  PHE B N     1 
ATOM   2438 C CA    . PHE B 1 24  ? 49.124  -2.065  12.770  1.00 30.08 ? 24  PHE B CA    1 
ATOM   2439 C C     . PHE B 1 24  ? 48.115  -3.177  12.781  1.00 30.64 ? 24  PHE B C     1 
ATOM   2440 O O     . PHE B 1 24  ? 47.861  -3.763  11.736  1.00 29.74 ? 24  PHE B O     1 
ATOM   2441 C CB    . PHE B 1 24  ? 48.383  -0.832  12.237  1.00 29.07 ? 24  PHE B CB    1 
ATOM   2442 C CG    . PHE B 1 24  ? 49.240  0.384   12.142  1.00 28.31 ? 24  PHE B CG    1 
ATOM   2443 C CD1   . PHE B 1 24  ? 49.367  1.224   13.243  1.00 28.71 ? 24  PHE B CD1   1 
ATOM   2444 C CD2   . PHE B 1 24  ? 49.954  0.662   10.970  1.00 29.69 ? 24  PHE B CD2   1 
ATOM   2445 C CE1   . PHE B 1 24  ? 50.201  2.345   13.184  1.00 32.69 ? 24  PHE B CE1   1 
ATOM   2446 C CE2   . PHE B 1 24  ? 50.788  1.769   10.903  1.00 30.01 ? 24  PHE B CE2   1 
ATOM   2447 C CZ    . PHE B 1 24  ? 50.914  2.610   12.011  1.00 29.25 ? 24  PHE B CZ    1 
ATOM   2448 N N     . THR B 1 25  ? 47.496  -3.376  13.943  1.00 30.48 ? 25  THR B N     1 
ATOM   2449 C CA    . THR B 1 25  ? 46.450  -4.369  14.105  1.00 33.38 ? 25  THR B CA    1 
ATOM   2450 C C     . THR B 1 25  ? 45.185  -3.542  14.055  1.00 34.13 ? 25  THR B C     1 
ATOM   2451 O O     . THR B 1 25  ? 44.947  -2.607  14.846  1.00 34.39 ? 25  THR B O     1 
ATOM   2452 C CB    . THR B 1 25  ? 46.582  -5.106  15.447  1.00 33.69 ? 25  THR B CB    1 
ATOM   2453 O OG1   . THR B 1 25  ? 47.778  -5.916  15.427  1.00 34.40 ? 25  THR B OG1   1 
ATOM   2454 C CG2   . THR B 1 25  ? 45.333  -6.008  15.749  1.00 32.69 ? 25  THR B CG2   1 
ATOM   2455 N N     . LYS B 1 26  ? 44.349  -3.882  13.113  1.00 35.19 ? 26  LYS B N     1 
ATOM   2456 C CA    . LYS B 1 26  ? 43.130  -3.140  12.938  1.00 34.32 ? 26  LYS B CA    1 
ATOM   2457 C C     . LYS B 1 26  ? 42.076  -3.819  13.814  1.00 32.98 ? 26  LYS B C     1 
ATOM   2458 O O     . LYS B 1 26  ? 41.932  -5.020  13.776  1.00 35.80 ? 26  LYS B O     1 
ATOM   2459 C CB    . LYS B 1 26  ? 42.833  -3.158  11.428  1.00 37.02 ? 26  LYS B CB    1 
ATOM   2460 C CG    . LYS B 1 26  ? 41.535  -2.559  10.985  1.00 36.74 ? 26  LYS B CG    1 
ATOM   2461 C CD    . LYS B 1 26  ? 41.632  -2.104  9.538   1.00 40.53 ? 26  LYS B CD    1 
ATOM   2462 C CE    . LYS B 1 26  ? 41.495  -3.195  8.565   1.00 42.87 ? 26  LYS B CE    1 
ATOM   2463 N NZ    . LYS B 1 26  ? 40.066  -3.626  8.422   1.00 44.02 ? 26  LYS B NZ    1 
ATOM   2464 N N     . LEU B 1 27  ? 41.391  -3.071  14.661  1.00 31.74 ? 27  LEU B N     1 
ATOM   2465 C CA    . LEU B 1 27  ? 40.400  -3.653  15.501  1.00 32.09 ? 27  LEU B CA    1 
ATOM   2466 C C     . LEU B 1 27  ? 39.064  -3.176  14.926  1.00 34.97 ? 27  LEU B C     1 
ATOM   2467 O O     . LEU B 1 27  ? 38.958  -3.071  13.694  1.00 36.42 ? 27  LEU B O     1 
ATOM   2468 C CB    . LEU B 1 27  ? 40.583  -3.262  16.963  1.00 31.89 ? 27  LEU B CB    1 
ATOM   2469 C CG    . LEU B 1 27  ? 41.944  -3.680  17.588  1.00 31.09 ? 27  LEU B CG    1 
ATOM   2470 C CD1   . LEU B 1 27  ? 41.947  -3.374  19.082  1.00 30.66 ? 27  LEU B CD1   1 
ATOM   2471 C CD2   . LEU B 1 27  ? 42.104  -5.210  17.378  1.00 31.58 ? 27  LEU B CD2   1 
ATOM   2472 N N     . GLU B 1 28  ? 38.097  -2.827  15.758  1.00 33.70 ? 28  GLU B N     1 
ATOM   2473 C CA    . GLU B 1 28  ? 36.785  -2.419  15.218  1.00 35.93 ? 28  GLU B CA    1 
ATOM   2474 C C     . GLU B 1 28  ? 36.562  -1.106  14.484  1.00 35.23 ? 28  GLU B C     1 
ATOM   2475 O O     . GLU B 1 28  ? 37.171  -0.101  14.767  1.00 28.78 ? 28  GLU B O     1 
ATOM   2476 C CB    . GLU B 1 28  ? 35.707  -2.475  16.320  1.00 36.68 ? 28  GLU B CB    1 
ATOM   2477 C CG    . GLU B 1 28  ? 35.641  -1.311  17.258  1.00 40.85 ? 28  GLU B CG    1 
ATOM   2478 C CD    . GLU B 1 28  ? 36.711  -1.355  18.337  1.00 45.04 ? 28  GLU B CD    1 
ATOM   2479 O OE1   . GLU B 1 28  ? 36.379  -0.884  19.465  1.00 46.17 ? 28  GLU B OE1   1 
ATOM   2480 O OE2   . GLU B 1 28  ? 37.867  -1.852  18.074  1.00 45.49 ? 28  GLU B OE2   1 
ATOM   2481 N N     . LYS B 1 29  ? 35.581  -1.148  13.580  1.00 36.59 ? 29  LYS B N     1 
ATOM   2482 C CA    . LYS B 1 29  ? 35.162  0.012   12.810  1.00 39.22 ? 29  LYS B CA    1 
ATOM   2483 C C     . LYS B 1 29  ? 34.536  0.985   13.780  1.00 40.93 ? 29  LYS B C     1 
ATOM   2484 O O     . LYS B 1 29  ? 33.623  0.630   14.545  1.00 40.74 ? 29  LYS B O     1 
ATOM   2485 C CB    . LYS B 1 29  ? 34.143  -0.392  11.733  1.00 40.71 ? 29  LYS B CB    1 
ATOM   2486 C CG    . LYS B 1 29  ? 33.690  0.778   10.835  1.00 43.95 ? 29  LYS B CG    1 
ATOM   2487 C CD    . LYS B 1 29  ? 32.711  0.353   9.696   1.00 49.71 ? 29  LYS B CD    1 
ATOM   2488 C CE    . LYS B 1 29  ? 33.364  -0.615  8.657   1.00 53.19 ? 29  LYS B CE    1 
ATOM   2489 N NZ    . LYS B 1 29  ? 32.441  -1.234  7.603   1.00 56.14 ? 29  LYS B NZ    1 
ATOM   2490 N N     . ILE B 1 30  ? 35.022  2.225   13.777  1.00 41.88 ? 30  ILE B N     1 
ATOM   2491 C CA    . ILE B 1 30  ? 34.460  3.187   14.688  1.00 43.98 ? 30  ILE B CA    1 
ATOM   2492 C C     . ILE B 1 30  ? 33.764  4.328   13.986  1.00 46.97 ? 30  ILE B C     1 
ATOM   2493 O O     . ILE B 1 30  ? 33.243  5.241   14.667  1.00 47.38 ? 30  ILE B O     1 
ATOM   2494 C CB    . ILE B 1 30  ? 35.521  3.770   15.644  1.00 43.13 ? 30  ILE B CB    1 
ATOM   2495 C CG1   . ILE B 1 30  ? 36.686  4.385   14.872  1.00 43.58 ? 30  ILE B CG1   1 
ATOM   2496 C CG2   . ILE B 1 30  ? 35.976  2.677   16.592  1.00 44.27 ? 30  ILE B CG2   1 
ATOM   2497 C CD1   . ILE B 1 30  ? 37.837  4.793   15.761  1.00 38.39 ? 30  ILE B CD1   1 
ATOM   2498 N N     . GLY B 1 31  ? 33.750  4.274   12.650  1.00 47.29 ? 31  GLY B N     1 
ATOM   2499 C CA    . GLY B 1 31  ? 33.110  5.310   11.868  1.00 49.90 ? 31  GLY B CA    1 
ATOM   2500 C C     . GLY B 1 31  ? 33.232  5.094   10.374  1.00 52.51 ? 31  GLY B C     1 
ATOM   2501 O O     . GLY B 1 31  ? 34.010  4.290   9.871   1.00 51.82 ? 31  GLY B O     1 
ATOM   2502 N N     . LYS B 1 32  ? 32.424  5.828   9.642   1.00 55.62 ? 32  LYS B N     1 
ATOM   2503 C CA    . LYS B 1 32  ? 32.423  5.757   8.205   1.00 59.14 ? 32  LYS B CA    1 
ATOM   2504 C C     . LYS B 1 32  ? 32.100  7.169   7.837   1.00 61.42 ? 32  LYS B C     1 
ATOM   2505 O O     . LYS B 1 32  ? 30.938  7.568   7.845   1.00 61.20 ? 32  LYS B O     1 
ATOM   2506 C CB    . LYS B 1 32  ? 31.339  4.804   7.696   1.00 60.28 ? 32  LYS B CB    1 
ATOM   2507 C CG    . LYS B 1 32  ? 31.023  4.975   6.195   1.00 63.24 ? 32  LYS B CG    1 
ATOM   2508 C CD    . LYS B 1 32  ? 29.858  5.945   5.911   1.00 65.35 ? 32  LYS B CD    1 
ATOM   2509 C CE    . LYS B 1 32  ? 29.474  5.997   4.404   1.00 65.43 ? 32  LYS B CE    1 
ATOM   2510 N NZ    . LYS B 1 32  ? 28.129  6.649   4.152   1.00 64.35 ? 32  LYS B NZ    1 
ATOM   2511 N N     . GLY B 1 33  ? 33.145  7.938   7.561   1.00 64.19 ? 33  GLY B N     1 
ATOM   2512 C CA    . GLY B 1 33  ? 32.953  9.329   7.193   1.00 67.14 ? 33  GLY B CA    1 
ATOM   2513 C C     . GLY B 1 33  ? 32.467  9.480   5.770   1.00 68.57 ? 33  GLY B C     1 
ATOM   2514 O O     . GLY B 1 33  ? 31.694  8.649   5.273   1.00 69.37 ? 33  GLY B O     1 
ATOM   2515 N N     . SER B 1 34  ? 32.932  10.528  5.100   1.00 69.82 ? 34  SER B N     1 
ATOM   2516 C CA    . SER B 1 34  ? 32.505  10.788  3.724   1.00 70.55 ? 34  SER B CA    1 
ATOM   2517 C C     . SER B 1 34  ? 33.323  10.044  2.664   1.00 70.48 ? 34  SER B C     1 
ATOM   2518 O O     . SER B 1 34  ? 32.831  9.796   1.554   1.00 70.46 ? 34  SER B O     1 
ATOM   2519 C CB    . SER B 1 34  ? 32.584  12.294  3.403   1.00 70.82 ? 34  SER B CB    1 
ATOM   2520 O OG    . SER B 1 34  ? 32.684  13.097  4.568   1.00 72.05 ? 34  SER B OG    1 
ATOM   2521 N N     . PHE B 1 35  ? 34.561  9.686   2.997   1.00 69.85 ? 35  PHE B N     1 
ATOM   2522 C CA    . PHE B 1 35  ? 35.422  9.061   2.009   1.00 69.23 ? 35  PHE B CA    1 
ATOM   2523 C C     . PHE B 1 35  ? 35.819  7.622   2.263   1.00 67.51 ? 35  PHE B C     1 
ATOM   2524 O O     . PHE B 1 35  ? 35.744  6.770   1.366   1.00 68.21 ? 35  PHE B O     1 
ATOM   2525 C CB    . PHE B 1 35  ? 36.657  9.947   1.836   1.00 71.41 ? 35  PHE B CB    1 
ATOM   2526 C CG    . PHE B 1 35  ? 36.325  11.333  1.335   1.00 73.94 ? 35  PHE B CG    1 
ATOM   2527 C CD1   . PHE B 1 35  ? 37.217  12.395  1.513   1.00 74.79 ? 35  PHE B CD1   1 
ATOM   2528 C CD2   . PHE B 1 35  ? 35.114  11.575  0.676   1.00 74.71 ? 35  PHE B CD2   1 
ATOM   2529 C CE1   . PHE B 1 35  ? 36.914  13.688  1.044   1.00 75.57 ? 35  PHE B CE1   1 
ATOM   2530 C CE2   . PHE B 1 35  ? 34.789  12.854  0.199   1.00 75.77 ? 35  PHE B CE2   1 
ATOM   2531 C CZ    . PHE B 1 35  ? 35.691  13.918  0.381   1.00 76.26 ? 35  PHE B CZ    1 
ATOM   2532 N N     . GLY B 1 36  ? 36.275  7.342   3.470   1.00 64.21 ? 36  GLY B N     1 
ATOM   2533 C CA    . GLY B 1 36  ? 36.647  5.975   3.762   1.00 59.45 ? 36  GLY B CA    1 
ATOM   2534 C C     . GLY B 1 36  ? 36.002  5.568   5.062   1.00 55.80 ? 36  GLY B C     1 
ATOM   2535 O O     . GLY B 1 36  ? 34.984  6.153   5.468   1.00 56.00 ? 36  GLY B O     1 
ATOM   2536 N N     . GLU B 1 37  ? 36.618  4.588   5.709   1.00 50.51 ? 37  GLU B N     1 
ATOM   2537 C CA    . GLU B 1 37  ? 36.180  4.060   6.980   1.00 46.02 ? 37  GLU B CA    1 
ATOM   2538 C C     . GLU B 1 37  ? 37.233  4.293   8.052   1.00 42.74 ? 37  GLU B C     1 
ATOM   2539 O O     . GLU B 1 37  ? 38.436  4.301   7.748   1.00 40.74 ? 37  GLU B O     1 
ATOM   2540 C CB    . GLU B 1 37  ? 36.002  2.580   6.855   1.00 46.64 ? 37  GLU B CB    1 
ATOM   2541 C CG    . GLU B 1 37  ? 35.511  2.175   5.546   1.00 48.82 ? 37  GLU B CG    1 
ATOM   2542 C CD    . GLU B 1 37  ? 34.588  1.058   5.729   1.00 49.01 ? 37  GLU B CD    1 
ATOM   2543 O OE1   . GLU B 1 37  ? 35.046  -0.108  5.848   1.00 47.32 ? 37  GLU B OE1   1 
ATOM   2544 O OE2   . GLU B 1 37  ? 33.390  1.379   5.805   1.00 51.52 ? 37  GLU B OE2   1 
ATOM   2545 N N     . VAL B 1 38  ? 36.775  4.429   9.296   1.00 38.71 ? 38  VAL B N     1 
ATOM   2546 C CA    . VAL B 1 38  ? 37.657  4.665   10.426  1.00 36.70 ? 38  VAL B CA    1 
ATOM   2547 C C     . VAL B 1 38  ? 37.616  3.535   11.429  1.00 35.77 ? 38  VAL B C     1 
ATOM   2548 O O     . VAL B 1 38  ? 36.537  3.056   11.836  1.00 34.16 ? 38  VAL B O     1 
ATOM   2549 C CB    . VAL B 1 38  ? 37.346  5.989   11.126  1.00 36.49 ? 38  VAL B CB    1 
ATOM   2550 C CG1   . VAL B 1 38  ? 38.489  6.300   12.158  1.00 32.97 ? 38  VAL B CG1   1 
ATOM   2551 C CG2   . VAL B 1 38  ? 37.240  7.081   10.091  1.00 34.88 ? 38  VAL B CG2   1 
ATOM   2552 N N     . PHE B 1 39  ? 38.807  3.084   11.808  1.00 34.18 ? 39  PHE B N     1 
ATOM   2553 C CA    . PHE B 1 39  ? 38.940  1.964   12.742  1.00 33.00 ? 39  PHE B CA    1 
ATOM   2554 C C     . PHE B 1 39  ? 39.815  2.280   13.922  1.00 33.98 ? 39  PHE B C     1 
ATOM   2555 O O     . PHE B 1 39  ? 40.719  3.148   13.845  1.00 32.05 ? 39  PHE B O     1 
ATOM   2556 C CB    . PHE B 1 39  ? 39.609  0.715   12.089  1.00 32.32 ? 39  PHE B CB    1 
ATOM   2557 C CG    . PHE B 1 39  ? 38.915  0.204   10.865  1.00 33.42 ? 39  PHE B CG    1 
ATOM   2558 C CD1   . PHE B 1 39  ? 39.088  0.844   9.626   1.00 33.41 ? 39  PHE B CD1   1 
ATOM   2559 C CD2   . PHE B 1 39  ? 38.067  -0.920  10.944  1.00 32.77 ? 39  PHE B CD2   1 
ATOM   2560 C CE1   . PHE B 1 39  ? 38.429  0.383   8.461   1.00 35.02 ? 39  PHE B CE1   1 
ATOM   2561 C CE2   . PHE B 1 39  ? 37.388  -1.405  9.769   1.00 33.97 ? 39  PHE B CE2   1 
ATOM   2562 C CZ    . PHE B 1 39  ? 37.578  -0.745  8.535   1.00 33.94 ? 39  PHE B CZ    1 
ATOM   2563 N N     . LYS B 1 40  ? 39.512  1.584   15.015  1.00 32.42 ? 40  LYS B N     1 
ATOM   2564 C CA    . LYS B 1 40  ? 40.371  1.634   16.187  1.00 35.39 ? 40  LYS B CA    1 
ATOM   2565 C C     . LYS B 1 40  ? 41.527  0.646   15.818  1.00 33.44 ? 40  LYS B C     1 
ATOM   2566 O O     . LYS B 1 40  ? 41.327  -0.417  15.208  1.00 33.39 ? 40  LYS B O     1 
ATOM   2567 C CB    . LYS B 1 40  ? 39.612  1.141   17.422  1.00 35.29 ? 40  LYS B CB    1 
ATOM   2568 C CG    . LYS B 1 40  ? 40.404  1.238   18.718  1.00 39.51 ? 40  LYS B CG    1 
ATOM   2569 C CD    . LYS B 1 40  ? 39.523  1.044   19.954  1.00 41.08 ? 40  LYS B CD    1 
ATOM   2570 C CE    . LYS B 1 40  ? 40.418  0.640   21.157  1.00 44.77 ? 40  LYS B CE    1 
ATOM   2571 N NZ    . LYS B 1 40  ? 39.628  0.016   22.283  1.00 45.30 ? 40  LYS B NZ    1 
ATOM   2572 N N     . GLY B 1 41  ? 42.752  1.018   16.132  1.00 33.78 ? 41  GLY B N     1 
ATOM   2573 C CA    . GLY B 1 41  ? 43.838  0.132   15.827  1.00 30.15 ? 41  GLY B CA    1 
ATOM   2574 C C     . GLY B 1 41  ? 44.926  0.295   16.863  1.00 31.58 ? 41  GLY B C     1 
ATOM   2575 O O     . GLY B 1 41  ? 44.880  1.238   17.650  1.00 29.49 ? 41  GLY B O     1 
ATOM   2576 N N     . ILE B 1 42  ? 45.904  -0.606  16.800  1.00 29.87 ? 42  ILE B N     1 
ATOM   2577 C CA    . ILE B 1 42  ? 47.034  -0.686  17.713  1.00 30.76 ? 42  ILE B CA    1 
ATOM   2578 C C     . ILE B 1 42  ? 48.281  -0.604  16.842  1.00 31.06 ? 42  ILE B C     1 
ATOM   2579 O O     . ILE B 1 42  ? 48.345  -1.234  15.785  1.00 30.96 ? 42  ILE B O     1 
ATOM   2580 C CB    . ILE B 1 42  ? 47.150  -2.115  18.386  1.00 33.04 ? 42  ILE B CB    1 
ATOM   2581 C CG1   . ILE B 1 42  ? 45.880  -2.524  19.108  1.00 34.52 ? 42  ILE B CG1   1 
ATOM   2582 C CG2   . ILE B 1 42  ? 48.262  -2.139  19.445  1.00 32.98 ? 42  ILE B CG2   1 
ATOM   2583 C CD1   . ILE B 1 42  ? 45.458  -1.547  20.116  1.00 34.92 ? 42  ILE B CD1   1 
ATOM   2584 N N     . ASP B 1 43  ? 49.251  0.186   17.278  1.00 28.82 ? 43  ASP B N     1 
ATOM   2585 C CA    . ASP B 1 43  ? 50.540  0.283   16.605  1.00 29.75 ? 43  ASP B CA    1 
ATOM   2586 C C     . ASP B 1 43  ? 51.236  -0.952  17.212  1.00 30.11 ? 43  ASP B C     1 
ATOM   2587 O O     . ASP B 1 43  ? 51.451  -1.033  18.436  1.00 31.23 ? 43  ASP B O     1 
ATOM   2588 C CB    . ASP B 1 43  ? 51.238  1.553   17.058  1.00 30.70 ? 43  ASP B CB    1 
ATOM   2589 C CG    . ASP B 1 43  ? 52.553  1.697   16.414  1.00 33.84 ? 43  ASP B CG    1 
ATOM   2590 O OD1   . ASP B 1 43  ? 53.286  0.692   16.446  1.00 35.37 ? 43  ASP B OD1   1 
ATOM   2591 O OD2   . ASP B 1 43  ? 52.842  2.775   15.896  1.00 33.69 ? 43  ASP B OD2   1 
ATOM   2592 N N     . ASN B 1 44  ? 51.563  -1.933  16.386  1.00 31.28 ? 44  ASN B N     1 
ATOM   2593 C CA    . ASN B 1 44  ? 52.161  -3.152  16.933  1.00 33.43 ? 44  ASN B CA    1 
ATOM   2594 C C     . ASN B 1 44  ? 53.530  -2.909  17.558  1.00 34.59 ? 44  ASN B C     1 
ATOM   2595 O O     . ASN B 1 44  ? 53.962  -3.654  18.404  1.00 35.39 ? 44  ASN B O     1 
ATOM   2596 C CB    . ASN B 1 44  ? 52.320  -4.254  15.870  1.00 33.05 ? 44  ASN B CB    1 
ATOM   2597 C CG    . ASN B 1 44  ? 50.979  -4.753  15.314  1.00 32.47 ? 44  ASN B CG    1 
ATOM   2598 O OD1   . ASN B 1 44  ? 49.959  -4.789  15.994  1.00 34.22 ? 44  ASN B OD1   1 
ATOM   2599 N ND2   . ASN B 1 44  ? 51.004  -5.144  14.078  1.00 33.60 ? 44  ASN B ND2   1 
ATOM   2600 N N     . ARG B 1 45  ? 54.211  -1.878  17.146  1.00 35.89 ? 45  ARG B N     1 
ATOM   2601 C CA    . ARG B 1 45  ? 55.514  -1.652  17.738  1.00 37.99 ? 45  ARG B CA    1 
ATOM   2602 C C     . ARG B 1 45  ? 55.390  -1.126  19.169  1.00 37.01 ? 45  ARG B C     1 
ATOM   2603 O O     . ARG B 1 45  ? 55.997  -1.654  20.105  1.00 37.33 ? 45  ARG B O     1 
ATOM   2604 C CB    . ARG B 1 45  ? 56.326  -0.658  16.884  1.00 40.96 ? 45  ARG B CB    1 
ATOM   2605 C CG    . ARG B 1 45  ? 57.734  -0.329  17.504  1.00 46.14 ? 45  ARG B CG    1 
ATOM   2606 C CD    . ARG B 1 45  ? 58.599  0.622   16.644  1.00 47.96 ? 45  ARG B CD    1 
ATOM   2607 N NE    . ARG B 1 45  ? 57.982  1.939   16.372  1.00 52.22 ? 45  ARG B NE    1 
ATOM   2608 C CZ    . ARG B 1 45  ? 57.911  2.948   17.242  1.00 54.03 ? 45  ARG B CZ    1 
ATOM   2609 N NH1   . ARG B 1 45  ? 58.420  2.815   18.471  1.00 55.60 ? 45  ARG B NH1   1 
ATOM   2610 N NH2   . ARG B 1 45  ? 57.334  4.103   16.883  1.00 54.36 ? 45  ARG B NH2   1 
ATOM   2611 N N     . THR B 1 46  ? 54.587  -0.088  19.364  1.00 34.83 ? 46  THR B N     1 
ATOM   2612 C CA    . THR B 1 46  ? 54.458  0.493   20.675  1.00 33.58 ? 46  THR B CA    1 
ATOM   2613 C C     . THR B 1 46  ? 53.293  -0.006  21.543  1.00 32.97 ? 46  THR B C     1 
ATOM   2614 O O     . THR B 1 46  ? 53.298  0.197   22.774  1.00 31.73 ? 46  THR B O     1 
ATOM   2615 C CB    . THR B 1 46  ? 54.265  2.011   20.512  1.00 34.73 ? 46  THR B CB    1 
ATOM   2616 O OG1   . THR B 1 46  ? 52.972  2.231   19.883  1.00 33.12 ? 46  THR B OG1   1 
ATOM   2617 C CG2   . THR B 1 46  ? 55.311  2.560   19.634  1.00 35.31 ? 46  THR B CG2   1 
ATOM   2618 N N     . GLN B 1 47  ? 52.311  -0.661  20.918  1.00 31.38 ? 47  GLN B N     1 
ATOM   2619 C CA    . GLN B 1 47  ? 51.062  -1.095  21.595  1.00 30.64 ? 47  GLN B CA    1 
ATOM   2620 C C     . GLN B 1 47  ? 50.167  0.096   21.884  1.00 29.90 ? 47  GLN B C     1 
ATOM   2621 O O     . GLN B 1 47  ? 49.195  0.017   22.680  1.00 30.38 ? 47  GLN B O     1 
ATOM   2622 C CB    . GLN B 1 47  ? 51.294  -1.857  22.928  1.00 33.27 ? 47  GLN B CB    1 
ATOM   2623 C CG    . GLN B 1 47  ? 51.725  -3.378  22.820  1.00 36.25 ? 47  GLN B CG    1 
ATOM   2624 C CD    . GLN B 1 47  ? 50.895  -4.132  21.797  1.00 36.04 ? 47  GLN B CD    1 
ATOM   2625 O OE1   . GLN B 1 47  ? 51.319  -4.280  20.682  1.00 39.51 ? 47  GLN B OE1   1 
ATOM   2626 N NE2   . GLN B 1 47  ? 49.686  -4.564  22.171  1.00 38.66 ? 47  GLN B NE2   1 
ATOM   2627 N N     . LYS B 1 48  ? 50.452  1.243   21.299  1.00 30.24 ? 48  LYS B N     1 
ATOM   2628 C CA    . LYS B 1 48  ? 49.527  2.348   21.587  1.00 28.94 ? 48  LYS B CA    1 
ATOM   2629 C C     . LYS B 1 48  ? 48.316  2.238   20.641  1.00 28.04 ? 48  LYS B C     1 
ATOM   2630 O O     . LYS B 1 48  ? 48.457  1.741   19.517  1.00 28.66 ? 48  LYS B O     1 
ATOM   2631 C CB    . LYS B 1 48  ? 50.206  3.685   21.363  1.00 31.91 ? 48  LYS B CB    1 
ATOM   2632 C CG    . LYS B 1 48  ? 51.182  4.040   22.521  1.00 33.67 ? 48  LYS B CG    1 
ATOM   2633 C CD    . LYS B 1 48  ? 51.763  5.436   22.386  1.00 35.08 ? 48  LYS B CD    1 
ATOM   2634 C CE    . LYS B 1 48  ? 50.715  6.486   22.159  1.00 35.62 ? 48  LYS B CE    1 
ATOM   2635 N NZ    . LYS B 1 48  ? 51.462  7.766   22.339  1.00 41.44 ? 48  LYS B NZ    1 
ATOM   2636 N N     . VAL B 1 49  ? 47.150  2.691   21.093  1.00 28.36 ? 49  VAL B N     1 
ATOM   2637 C CA    . VAL B 1 49  ? 45.938  2.698   20.232  1.00 27.78 ? 49  VAL B CA    1 
ATOM   2638 C C     . VAL B 1 49  ? 45.984  3.902   19.295  1.00 29.75 ? 49  VAL B C     1 
ATOM   2639 O O     . VAL B 1 49  ? 46.463  4.997   19.684  1.00 27.98 ? 49  VAL B O     1 
ATOM   2640 C CB    . VAL B 1 49  ? 44.640  2.843   21.114  1.00 30.96 ? 49  VAL B CB    1 
ATOM   2641 C CG1   . VAL B 1 49  ? 43.375  2.839   20.235  1.00 27.69 ? 49  VAL B CG1   1 
ATOM   2642 C CG2   . VAL B 1 49  ? 44.570  1.734   22.119  1.00 31.86 ? 49  VAL B CG2   1 
ATOM   2643 N N     . VAL B 1 50  ? 45.550  3.719   18.044  1.00 27.18 ? 50  VAL B N     1 
ATOM   2644 C CA    . VAL B 1 50  ? 45.510  4.838   17.141  1.00 28.38 ? 50  VAL B CA    1 
ATOM   2645 C C     . VAL B 1 50  ? 44.164  4.738   16.386  1.00 28.16 ? 50  VAL B C     1 
ATOM   2646 O O     . VAL B 1 50  ? 43.489  3.705   16.449  1.00 27.97 ? 50  VAL B O     1 
ATOM   2647 C CB    . VAL B 1 50  ? 46.684  4.787   16.093  1.00 27.62 ? 50  VAL B CB    1 
ATOM   2648 C CG1   . VAL B 1 50  ? 48.035  4.947   16.799  1.00 28.64 ? 50  VAL B CG1   1 
ATOM   2649 C CG2   . VAL B 1 50  ? 46.684  3.380   15.305  1.00 31.09 ? 50  VAL B CG2   1 
ATOM   2650 N N     . ALA B 1 51  ? 43.786  5.805   15.688  1.00 27.72 ? 51  ALA B N     1 
ATOM   2651 C CA    . ALA B 1 51  ? 42.585  5.762   14.860  1.00 28.36 ? 51  ALA B CA    1 
ATOM   2652 C C     . ALA B 1 51  ? 43.161  5.592   13.438  1.00 29.35 ? 51  ALA B C     1 
ATOM   2653 O O     . ALA B 1 51  ? 44.113  6.262   13.067  1.00 29.77 ? 51  ALA B O     1 
ATOM   2654 C CB    . ALA B 1 51  ? 41.763  7.094   14.977  1.00 29.17 ? 51  ALA B CB    1 
ATOM   2655 N N     . ILE B 1 52  ? 42.618  4.659   12.654  1.00 30.32 ? 52  ILE B N     1 
ATOM   2656 C CA    . ILE B 1 52  ? 43.127  4.413   11.302  1.00 29.83 ? 52  ILE B CA    1 
ATOM   2657 C C     . ILE B 1 52  ? 42.032  4.648   10.300  1.00 31.47 ? 52  ILE B C     1 
ATOM   2658 O O     . ILE B 1 52  ? 41.019  3.910   10.328  1.00 30.91 ? 52  ILE B O     1 
ATOM   2659 C CB    . ILE B 1 52  ? 43.596  2.949   11.129  1.00 30.08 ? 52  ILE B CB    1 
ATOM   2660 C CG1   . ILE B 1 52  ? 44.682  2.622   12.186  1.00 30.82 ? 52  ILE B CG1   1 
ATOM   2661 C CG2   . ILE B 1 52  ? 44.045  2.726   9.655   1.00 30.41 ? 52  ILE B CG2   1 
ATOM   2662 C CD1   . ILE B 1 52  ? 44.857  1.074   12.375  1.00 27.69 ? 52  ILE B CD1   1 
ATOM   2663 N N     . LYS B 1 53  ? 42.228  5.637   9.418   1.00 31.37 ? 53  LYS B N     1 
ATOM   2664 C CA    . LYS B 1 53  ? 41.220  5.947   8.383   1.00 34.81 ? 53  LYS B CA    1 
ATOM   2665 C C     . LYS B 1 53  ? 41.733  5.309   7.096   1.00 35.80 ? 53  LYS B C     1 
ATOM   2666 O O     . LYS B 1 53  ? 42.873  5.578   6.684   1.00 34.52 ? 53  LYS B O     1 
ATOM   2667 C CB    . LYS B 1 53  ? 41.100  7.478   8.255   1.00 38.16 ? 53  LYS B CB    1 
ATOM   2668 C CG    . LYS B 1 53  ? 40.127  8.034   7.201   1.00 42.53 ? 53  LYS B CG    1 
ATOM   2669 C CD    . LYS B 1 53  ? 39.883  9.543   7.492   1.00 45.31 ? 53  LYS B CD    1 
ATOM   2670 C CE    . LYS B 1 53  ? 38.916  10.210  6.545   1.00 47.99 ? 53  LYS B CE    1 
ATOM   2671 N NZ    . LYS B 1 53  ? 38.693  11.644  6.983   1.00 49.65 ? 53  LYS B NZ    1 
ATOM   2672 N N     . ILE B 1 54  ? 40.933  4.425   6.489   1.00 34.32 ? 54  ILE B N     1 
ATOM   2673 C CA    . ILE B 1 54  ? 41.338  3.759   5.270   1.00 34.76 ? 54  ILE B CA    1 
ATOM   2674 C C     . ILE B 1 54  ? 40.464  4.226   4.125   1.00 37.45 ? 54  ILE B C     1 
ATOM   2675 O O     . ILE B 1 54  ? 39.241  4.192   4.212   1.00 35.35 ? 54  ILE B O     1 
ATOM   2676 C CB    . ILE B 1 54  ? 41.277  2.245   5.449   1.00 34.89 ? 54  ILE B CB    1 
ATOM   2677 C CG1   . ILE B 1 54  ? 42.189  1.857   6.642   1.00 33.65 ? 54  ILE B CG1   1 
ATOM   2678 C CG2   . ILE B 1 54  ? 41.671  1.530   4.127   1.00 36.35 ? 54  ILE B CG2   1 
ATOM   2679 C CD1   . ILE B 1 54  ? 42.315  0.289   6.888   1.00 32.57 ? 54  ILE B CD1   1 
ATOM   2680 N N     . ILE B 1 55  ? 41.112  4.750   3.094   1.00 38.42 ? 55  ILE B N     1 
ATOM   2681 C CA    . ILE B 1 55  ? 40.440  5.287   1.903   1.00 43.67 ? 55  ILE B CA    1 
ATOM   2682 C C     . ILE B 1 55  ? 40.879  4.582   0.611   1.00 44.21 ? 55  ILE B C     1 
ATOM   2683 O O     . ILE B 1 55  ? 42.074  4.375   0.370   1.00 41.32 ? 55  ILE B O     1 
ATOM   2684 C CB    . ILE B 1 55  ? 40.750  6.803   1.767   1.00 45.03 ? 55  ILE B CB    1 
ATOM   2685 C CG1   . ILE B 1 55  ? 40.263  7.544   3.018   1.00 46.97 ? 55  ILE B CG1   1 
ATOM   2686 C CG2   . ILE B 1 55  ? 40.050  7.377   0.565   1.00 48.29 ? 55  ILE B CG2   1 
ATOM   2687 C CD1   . ILE B 1 55  ? 40.739  9.002   3.132   1.00 49.16 ? 55  ILE B CD1   1 
ATOM   2688 N N     . ASP B 1 56  ? 39.911  4.193   -0.220  1.00 47.16 ? 56  ASP B N     1 
ATOM   2689 C CA    . ASP B 1 56  ? 40.260  3.535   -1.490  1.00 50.48 ? 56  ASP B CA    1 
ATOM   2690 C C     . ASP B 1 56  ? 40.493  4.601   -2.565  1.00 52.08 ? 56  ASP B C     1 
ATOM   2691 O O     . ASP B 1 56  ? 39.532  5.129   -3.124  1.00 52.83 ? 56  ASP B O     1 
ATOM   2692 C CB    . ASP B 1 56  ? 39.144  2.633   -1.952  1.00 52.37 ? 56  ASP B CB    1 
ATOM   2693 C CG    . ASP B 1 56  ? 39.631  1.608   -2.926  1.00 55.19 ? 56  ASP B CG    1 
ATOM   2694 O OD1   . ASP B 1 56  ? 40.505  1.945   -3.767  1.00 56.19 ? 56  ASP B OD1   1 
ATOM   2695 O OD2   . ASP B 1 56  ? 39.154  0.458   -2.845  1.00 57.21 ? 56  ASP B OD2   1 
ATOM   2696 N N     . LEU B 1 57  ? 41.751  4.922   -2.849  1.00 53.47 ? 57  LEU B N     1 
ATOM   2697 C CA    . LEU B 1 57  ? 42.091  5.957   -3.837  1.00 56.72 ? 57  LEU B CA    1 
ATOM   2698 C C     . LEU B 1 57  ? 41.565  5.672   -5.247  1.00 59.60 ? 57  LEU B C     1 
ATOM   2699 O O     . LEU B 1 57  ? 41.454  6.583   -6.080  1.00 59.58 ? 57  LEU B O     1 
ATOM   2700 C CB    . LEU B 1 57  ? 43.614  6.174   -3.904  1.00 54.63 ? 57  LEU B CB    1 
ATOM   2701 C CG    . LEU B 1 57  ? 44.255  6.778   -2.653  1.00 55.20 ? 57  LEU B CG    1 
ATOM   2702 C CD1   . LEU B 1 57  ? 45.731  7.103   -2.906  1.00 54.67 ? 57  LEU B CD1   1 
ATOM   2703 C CD2   . LEU B 1 57  ? 43.523  8.020   -2.276  1.00 53.94 ? 57  LEU B CD2   1 
ATOM   2704 N N     . GLU B 1 58  ? 41.242  4.413   -5.511  1.00 62.47 ? 58  GLU B N     1 
ATOM   2705 C CA    . GLU B 1 58  ? 40.735  4.040   -6.824  1.00 66.53 ? 58  GLU B CA    1 
ATOM   2706 C C     . GLU B 1 58  ? 39.295  4.502   -6.846  1.00 67.76 ? 58  GLU B C     1 
ATOM   2707 O O     . GLU B 1 58  ? 38.848  5.152   -7.783  1.00 68.65 ? 58  GLU B O     1 
ATOM   2708 C CB    . GLU B 1 58  ? 40.796  2.513   -7.017  1.00 66.92 ? 58  GLU B CB    1 
ATOM   2709 C CG    . GLU B 1 58  ? 41.041  2.066   -8.453  1.00 69.46 ? 58  GLU B CG    1 
ATOM   2710 C CD    . GLU B 1 58  ? 40.910  0.559   -8.628  1.00 70.80 ? 58  GLU B CD    1 
ATOM   2711 O OE1   . GLU B 1 58  ? 41.321  0.020   -9.690  1.00 71.41 ? 58  GLU B OE1   1 
ATOM   2712 O OE2   . GLU B 1 58  ? 40.384  -0.087  -7.699  1.00 71.45 ? 58  GLU B OE2   1 
ATOM   2713 N N     . GLU B 1 59  ? 38.581  4.183   -5.775  1.00 69.75 ? 59  GLU B N     1 
ATOM   2714 C CA    . GLU B 1 59  ? 37.178  4.527   -5.667  1.00 71.33 ? 59  GLU B CA    1 
ATOM   2715 C C     . GLU B 1 59  ? 36.973  5.963   -5.246  1.00 71.96 ? 59  GLU B C     1 
ATOM   2716 O O     . GLU B 1 59  ? 36.065  6.269   -4.480  1.00 71.49 ? 59  GLU B O     1 
ATOM   2717 C CB    . GLU B 1 59  ? 36.501  3.546   -4.706  1.00 72.00 ? 59  GLU B CB    1 
ATOM   2718 C CG    . GLU B 1 59  ? 36.750  2.097   -5.161  1.00 74.21 ? 59  GLU B CG    1 
ATOM   2719 C CD    . GLU B 1 59  ? 36.257  1.019   -4.198  1.00 75.67 ? 59  GLU B CD    1 
ATOM   2720 O OE1   . GLU B 1 59  ? 36.256  1.241   -2.958  1.00 76.47 ? 59  GLU B OE1   1 
ATOM   2721 O OE2   . GLU B 1 59  ? 35.899  -0.074  -4.699  1.00 76.37 ? 59  GLU B OE2   1 
ATOM   2722 N N     . ALA B 1 60  ? 37.824  6.845   -5.767  1.00 72.83 ? 60  ALA B N     1 
ATOM   2723 C CA    . ALA B 1 60  ? 37.726  8.267   -5.445  1.00 73.97 ? 60  ALA B CA    1 
ATOM   2724 C C     . ALA B 1 60  ? 38.579  9.109   -6.382  1.00 74.20 ? 60  ALA B C     1 
ATOM   2725 O O     . ALA B 1 60  ? 39.336  8.577   -7.179  1.00 74.66 ? 60  ALA B O     1 
ATOM   2726 C CB    . ALA B 1 60  ? 38.144  8.510   -3.976  1.00 73.85 ? 60  ALA B CB    1 
ATOM   2727 N N     . GLU B 1 61  ? 38.447  10.427  -6.296  1.00 74.88 ? 61  GLU B N     1 
ATOM   2728 C CA    . GLU B 1 61  ? 39.247  11.292  -7.142  1.00 75.25 ? 61  GLU B CA    1 
ATOM   2729 C C     . GLU B 1 61  ? 39.268  12.783  -6.789  1.00 74.79 ? 61  GLU B C     1 
ATOM   2730 O O     . GLU B 1 61  ? 40.353  13.361  -6.670  1.00 74.95 ? 61  GLU B O     1 
ATOM   2731 C CB    . GLU B 1 61  ? 38.843  11.107  -8.595  1.00 76.56 ? 61  GLU B CB    1 
ATOM   2732 C CG    . GLU B 1 61  ? 37.396  11.388  -8.887  1.00 78.57 ? 61  GLU B CG    1 
ATOM   2733 C CD    . GLU B 1 61  ? 37.160  11.586  -10.367 1.00 79.51 ? 61  GLU B CD    1 
ATOM   2734 O OE1   . GLU B 1 61  ? 36.162  11.029  -10.894 1.00 80.55 ? 61  GLU B OE1   1 
ATOM   2735 O OE2   . GLU B 1 61  ? 37.972  12.305  -11.001 1.00 79.26 ? 61  GLU B OE2   1 
ATOM   2736 N N     . ASP B 1 62  ? 38.103  13.422  -6.645  1.00 73.68 ? 62  ASP B N     1 
ATOM   2737 C CA    . ASP B 1 62  ? 38.086  14.847  -6.291  1.00 72.12 ? 62  ASP B CA    1 
ATOM   2738 C C     . ASP B 1 62  ? 38.375  14.963  -4.804  1.00 69.96 ? 62  ASP B C     1 
ATOM   2739 O O     . ASP B 1 62  ? 38.745  16.030  -4.284  1.00 70.32 ? 62  ASP B O     1 
ATOM   2740 C CB    . ASP B 1 62  ? 36.732  15.487  -6.617  1.00 74.10 ? 62  ASP B CB    1 
ATOM   2741 C CG    . ASP B 1 62  ? 36.766  16.319  -7.905  1.00 75.77 ? 62  ASP B CG    1 
ATOM   2742 O OD1   . ASP B 1 62  ? 35.722  16.345  -8.600  1.00 77.26 ? 62  ASP B OD1   1 
ATOM   2743 O OD2   . ASP B 1 62  ? 37.814  16.952  -8.217  1.00 75.72 ? 62  ASP B OD2   1 
ATOM   2744 N N     . GLU B 1 63  ? 38.212  13.842  -4.122  1.00 66.73 ? 63  GLU B N     1 
ATOM   2745 C CA    . GLU B 1 63  ? 38.482  13.790  -2.715  1.00 63.06 ? 63  GLU B CA    1 
ATOM   2746 C C     . GLU B 1 63  ? 40.008  13.819  -2.534  1.00 59.65 ? 63  GLU B C     1 
ATOM   2747 O O     . GLU B 1 63  ? 40.487  14.491  -1.643  1.00 58.76 ? 63  GLU B O     1 
ATOM   2748 C CB    . GLU B 1 63  ? 37.893  12.519  -2.117  1.00 65.12 ? 63  GLU B CB    1 
ATOM   2749 C CG    . GLU B 1 63  ? 36.456  12.232  -2.533  1.00 68.01 ? 63  GLU B CG    1 
ATOM   2750 C CD    . GLU B 1 63  ? 36.330  11.740  -3.975  1.00 70.62 ? 63  GLU B CD    1 
ATOM   2751 O OE1   . GLU B 1 63  ? 35.210  11.326  -4.365  1.00 71.35 ? 63  GLU B OE1   1 
ATOM   2752 O OE2   . GLU B 1 63  ? 37.344  11.771  -4.724  1.00 71.36 ? 63  GLU B OE2   1 
ATOM   2753 N N     . ILE B 1 64  ? 40.770  13.132  -3.395  1.00 56.29 ? 64  ILE B N     1 
ATOM   2754 C CA    . ILE B 1 64  ? 42.236  13.100  -3.244  1.00 52.69 ? 64  ILE B CA    1 
ATOM   2755 C C     . ILE B 1 64  ? 42.791  14.483  -2.964  1.00 51.04 ? 64  ILE B C     1 
ATOM   2756 O O     . ILE B 1 64  ? 43.486  14.673  -1.975  1.00 49.21 ? 64  ILE B O     1 
ATOM   2757 C CB    . ILE B 1 64  ? 42.956  12.496  -4.474  1.00 52.71 ? 64  ILE B CB    1 
ATOM   2758 C CG1   . ILE B 1 64  ? 42.458  11.066  -4.711  1.00 52.33 ? 64  ILE B CG1   1 
ATOM   2759 C CG2   . ILE B 1 64  ? 44.490  12.435  -4.223  1.00 52.51 ? 64  ILE B CG2   1 
ATOM   2760 C CD1   . ILE B 1 64  ? 43.288  10.277  -5.720  1.00 52.26 ? 64  ILE B CD1   1 
ATOM   2761 N N     . GLU B 1 65  ? 42.475  15.463  -3.802  1.00 50.27 ? 65  GLU B N     1 
ATOM   2762 C CA    . GLU B 1 65  ? 42.943  16.822  -3.514  1.00 51.95 ? 65  GLU B CA    1 
ATOM   2763 C C     . GLU B 1 65  ? 42.601  17.285  -2.081  1.00 50.29 ? 65  GLU B C     1 
ATOM   2764 O O     . GLU B 1 65  ? 43.492  17.722  -1.358  1.00 49.73 ? 65  GLU B O     1 
ATOM   2765 C CB    . GLU B 1 65  ? 42.371  17.846  -4.508  1.00 53.86 ? 65  GLU B CB    1 
ATOM   2766 C CG    . GLU B 1 65  ? 42.995  17.833  -5.907  1.00 58.33 ? 65  GLU B CG    1 
ATOM   2767 C CD    . GLU B 1 65  ? 42.262  16.920  -6.922  1.00 60.94 ? 65  GLU B CD    1 
ATOM   2768 O OE1   . GLU B 1 65  ? 42.486  17.099  -8.152  1.00 62.05 ? 65  GLU B OE1   1 
ATOM   2769 O OE2   . GLU B 1 65  ? 41.477  16.029  -6.503  1.00 61.42 ? 65  GLU B OE2   1 
ATOM   2770 N N     . ASP B 1 66  ? 41.328  17.171  -1.669  1.00 50.00 ? 66  ASP B N     1 
ATOM   2771 C CA    . ASP B 1 66  ? 40.904  17.619  -0.324  1.00 49.24 ? 66  ASP B CA    1 
ATOM   2772 C C     . ASP B 1 66  ? 41.612  16.823  0.766   1.00 46.44 ? 66  ASP B C     1 
ATOM   2773 O O     . ASP B 1 66  ? 42.052  17.366  1.770   1.00 45.30 ? 66  ASP B O     1 
ATOM   2774 C CB    . ASP B 1 66  ? 39.377  17.457  -0.130  1.00 52.10 ? 66  ASP B CB    1 
ATOM   2775 C CG    . ASP B 1 66  ? 38.570  18.010  -1.298  1.00 54.64 ? 66  ASP B CG    1 
ATOM   2776 O OD1   . ASP B 1 66  ? 38.973  19.025  -1.892  1.00 55.09 ? 66  ASP B OD1   1 
ATOM   2777 O OD2   . ASP B 1 66  ? 37.506  17.432  -1.608  1.00 58.72 ? 66  ASP B OD2   1 
ATOM   2778 N N     . ILE B 1 67  ? 41.679  15.522  0.560   1.00 44.45 ? 67  ILE B N     1 
ATOM   2779 C CA    . ILE B 1 67  ? 42.349  14.646  1.485   1.00 45.02 ? 67  ILE B CA    1 
ATOM   2780 C C     . ILE B 1 67  ? 43.800  15.124  1.668   1.00 44.25 ? 67  ILE B C     1 
ATOM   2781 O O     . ILE B 1 67  ? 44.252  15.387  2.774   1.00 43.15 ? 67  ILE B O     1 
ATOM   2782 C CB    . ILE B 1 67  ? 42.399  13.261  0.937   1.00 45.39 ? 67  ILE B CB    1 
ATOM   2783 C CG1   . ILE B 1 67  ? 40.984  12.747  0.727   1.00 45.70 ? 67  ILE B CG1   1 
ATOM   2784 C CG2   . ILE B 1 67  ? 43.201  12.397  1.859   1.00 45.83 ? 67  ILE B CG2   1 
ATOM   2785 C CD1   . ILE B 1 67  ? 40.946  11.348  0.143   1.00 47.96 ? 67  ILE B CD1   1 
ATOM   2786 N N     . GLN B 1 68  ? 44.520  15.253  0.565   1.00 45.16 ? 68  GLN B N     1 
ATOM   2787 C CA    . GLN B 1 68  ? 45.904  15.710  0.645   1.00 46.54 ? 68  GLN B CA    1 
ATOM   2788 C C     . GLN B 1 68  ? 45.987  17.073  1.333   1.00 45.50 ? 68  GLN B C     1 
ATOM   2789 O O     . GLN B 1 68  ? 46.932  17.351  2.068   1.00 44.99 ? 68  GLN B O     1 
ATOM   2790 C CB    . GLN B 1 68  ? 46.513  15.810  -0.764  1.00 48.15 ? 68  GLN B CB    1 
ATOM   2791 C CG    . GLN B 1 68  ? 47.933  16.340  -0.768  1.00 52.36 ? 68  GLN B CG    1 
ATOM   2792 C CD    . GLN B 1 68  ? 48.633  16.109  -2.104  1.00 55.31 ? 68  GLN B CD    1 
ATOM   2793 O OE1   . GLN B 1 68  ? 48.712  14.974  -2.582  1.00 57.82 ? 68  GLN B OE1   1 
ATOM   2794 N NE2   . GLN B 1 68  ? 49.145  17.184  -2.716  1.00 57.59 ? 68  GLN B NE2   1 
ATOM   2795 N N     . GLN B 1 69  ? 44.993  17.933  1.111   1.00 44.18 ? 69  GLN B N     1 
ATOM   2796 C CA    . GLN B 1 69  ? 45.076  19.251  1.728   1.00 44.15 ? 69  GLN B CA    1 
ATOM   2797 C C     . GLN B 1 69  ? 44.788  19.181  3.230   1.00 41.94 ? 69  GLN B C     1 
ATOM   2798 O O     . GLN B 1 69  ? 45.390  19.906  4.032   1.00 41.76 ? 69  GLN B O     1 
ATOM   2799 C CB    . GLN B 1 69  ? 44.133  20.250  1.009   1.00 45.05 ? 69  GLN B CB    1 
ATOM   2800 C CG    . GLN B 1 69  ? 44.274  21.689  1.460   1.00 49.31 ? 69  GLN B CG    1 
ATOM   2801 C CD    . GLN B 1 69  ? 45.728  22.210  1.494   1.00 52.91 ? 69  GLN B CD    1 
ATOM   2802 O OE1   . GLN B 1 69  ? 46.177  22.780  2.513   1.00 55.05 ? 69  GLN B OE1   1 
ATOM   2803 N NE2   . GLN B 1 69  ? 46.460  22.028  0.389   1.00 52.32 ? 69  GLN B NE2   1 
ATOM   2804 N N     . GLU B 1 70  ? 43.902  18.280  3.618   1.00 40.91 ? 70  GLU B N     1 
ATOM   2805 C CA    . GLU B 1 70  ? 43.560  18.173  5.032   1.00 39.48 ? 70  GLU B CA    1 
ATOM   2806 C C     . GLU B 1 70  ? 44.748  17.585  5.779   1.00 37.87 ? 70  GLU B C     1 
ATOM   2807 O O     . GLU B 1 70  ? 45.134  18.052  6.842   1.00 35.98 ? 70  GLU B O     1 
ATOM   2808 C CB    . GLU B 1 70  ? 42.294  17.316  5.181   1.00 40.06 ? 70  GLU B CB    1 
ATOM   2809 C CG    . GLU B 1 70  ? 41.808  17.185  6.609   1.00 43.82 ? 70  GLU B CG    1 
ATOM   2810 C CD    . GLU B 1 70  ? 40.432  16.507  6.678   1.00 47.60 ? 70  GLU B CD    1 
ATOM   2811 O OE1   . GLU B 1 70  ? 39.695  16.490  5.663   1.00 49.31 ? 70  GLU B OE1   1 
ATOM   2812 O OE2   . GLU B 1 70  ? 40.077  16.004  7.756   1.00 50.21 ? 70  GLU B OE2   1 
ATOM   2813 N N     . ILE B 1 71  ? 45.325  16.542  5.209   1.00 38.14 ? 71  ILE B N     1 
ATOM   2814 C CA    . ILE B 1 71  ? 46.514  15.946  5.794   1.00 38.45 ? 71  ILE B CA    1 
ATOM   2815 C C     . ILE B 1 71  ? 47.646  16.970  5.839   1.00 38.85 ? 71  ILE B C     1 
ATOM   2816 O O     . ILE B 1 71  ? 48.415  17.034  6.803   1.00 39.06 ? 71  ILE B O     1 
ATOM   2817 C CB    . ILE B 1 71  ? 46.984  14.775  4.985   1.00 37.29 ? 71  ILE B CB    1 
ATOM   2818 C CG1   . ILE B 1 71  ? 45.958  13.664  5.101   1.00 39.85 ? 71  ILE B CG1   1 
ATOM   2819 C CG2   . ILE B 1 71  ? 48.395  14.325  5.501   1.00 38.54 ? 71  ILE B CG2   1 
ATOM   2820 C CD1   . ILE B 1 71  ? 46.299  12.438  4.286   1.00 42.68 ? 71  ILE B CD1   1 
ATOM   2821 N N     . THR B 1 72  ? 47.763  17.786  4.797   1.00 40.10 ? 72  THR B N     1 
ATOM   2822 C CA    . THR B 1 72  ? 48.822  18.800  4.832   1.00 40.89 ? 72  THR B CA    1 
ATOM   2823 C C     . THR B 1 72  ? 48.622  19.712  6.044   1.00 39.11 ? 72  THR B C     1 
ATOM   2824 O O     . THR B 1 72  ? 49.507  19.867  6.845   1.00 36.89 ? 72  THR B O     1 
ATOM   2825 C CB    . THR B 1 72  ? 48.830  19.686  3.540   1.00 42.70 ? 72  THR B CB    1 
ATOM   2826 O OG1   . THR B 1 72  ? 49.094  18.859  2.409   1.00 43.17 ? 72  THR B OG1   1 
ATOM   2827 C CG2   . THR B 1 72  ? 49.900  20.801  3.640   1.00 42.81 ? 72  THR B CG2   1 
ATOM   2828 N N     . VAL B 1 73  ? 47.447  20.340  6.163   1.00 39.00 ? 73  VAL B N     1 
ATOM   2829 C CA    . VAL B 1 73  ? 47.185  21.219  7.318   1.00 38.36 ? 73  VAL B CA    1 
ATOM   2830 C C     . VAL B 1 73  ? 47.429  20.505  8.658   1.00 37.80 ? 73  VAL B C     1 
ATOM   2831 O O     . VAL B 1 73  ? 48.009  21.104  9.574   1.00 36.51 ? 73  VAL B O     1 
ATOM   2832 C CB    . VAL B 1 73  ? 45.677  21.804  7.292   1.00 40.49 ? 73  VAL B CB    1 
ATOM   2833 C CG1   . VAL B 1 73  ? 45.364  22.477  8.608   1.00 39.97 ? 73  VAL B CG1   1 
ATOM   2834 C CG2   . VAL B 1 73  ? 45.507  22.878  6.152   1.00 38.21 ? 73  VAL B CG2   1 
ATOM   2835 N N     . LEU B 1 74  ? 47.001  19.230  8.798   1.00 37.07 ? 74  LEU B N     1 
ATOM   2836 C CA    . LEU B 1 74  ? 47.238  18.503  10.060  1.00 37.08 ? 74  LEU B CA    1 
ATOM   2837 C C     . LEU B 1 74  ? 48.726  18.315  10.350  1.00 37.70 ? 74  LEU B C     1 
ATOM   2838 O O     . LEU B 1 74  ? 49.147  18.506  11.460  1.00 35.79 ? 74  LEU B O     1 
ATOM   2839 C CB    . LEU B 1 74  ? 46.611  17.098  10.056  1.00 37.92 ? 74  LEU B CB    1 
ATOM   2840 C CG    . LEU B 1 74  ? 45.096  16.982  10.277  1.00 39.13 ? 74  LEU B CG    1 
ATOM   2841 C CD1   . LEU B 1 74  ? 44.612  15.600  9.967   1.00 41.41 ? 74  LEU B CD1   1 
ATOM   2842 C CD2   . LEU B 1 74  ? 44.771  17.390  11.704  1.00 37.97 ? 74  LEU B CD2   1 
ATOM   2843 N N     . SER B 1 75  ? 49.500  17.906  9.352   1.00 38.84 ? 75  SER B N     1 
ATOM   2844 C CA    . SER B 1 75  ? 50.937  17.697  9.542   1.00 40.05 ? 75  SER B CA    1 
ATOM   2845 C C     . SER B 1 75  ? 51.678  18.928  9.996   1.00 40.70 ? 75  SER B C     1 
ATOM   2846 O O     . SER B 1 75  ? 52.728  18.806  10.618  1.00 41.51 ? 75  SER B O     1 
ATOM   2847 C CB    . SER B 1 75  ? 51.603  17.167  8.269   1.00 40.15 ? 75  SER B CB    1 
ATOM   2848 O OG    . SER B 1 75  ? 51.463  18.052  7.161   1.00 39.93 ? 75  SER B OG    1 
ATOM   2849 N N     . GLN B 1 76  ? 51.168  20.111  9.668   1.00 42.09 ? 76  GLN B N     1 
ATOM   2850 C CA    . GLN B 1 76  ? 51.820  21.351  10.103  1.00 42.73 ? 76  GLN B CA    1 
ATOM   2851 C C     . GLN B 1 76  ? 51.480  21.730  11.525  1.00 42.72 ? 76  GLN B C     1 
ATOM   2852 O O     . GLN B 1 76  ? 52.109  22.623  12.100  1.00 42.12 ? 76  GLN B O     1 
ATOM   2853 C CB    . GLN B 1 76  ? 51.448  22.491  9.178   1.00 43.97 ? 76  GLN B CB    1 
ATOM   2854 C CG    . GLN B 1 76  ? 51.742  22.104  7.754   1.00 46.15 ? 76  GLN B CG    1 
ATOM   2855 C CD    . GLN B 1 76  ? 51.329  23.144  6.750   1.00 45.56 ? 76  GLN B CD    1 
ATOM   2856 O OE1   . GLN B 1 76  ? 50.431  23.972  6.998   1.00 45.52 ? 76  GLN B OE1   1 
ATOM   2857 N NE2   . GLN B 1 76  ? 51.947  23.086  5.587   1.00 46.36 ? 76  GLN B NE2   1 
ATOM   2858 N N     . CYS B 1 77  ? 50.473  21.073  12.105  1.00 40.98 ? 77  CYS B N     1 
ATOM   2859 C CA    . CYS B 1 77  ? 50.119  21.397  13.475  1.00 39.72 ? 77  CYS B CA    1 
ATOM   2860 C C     . CYS B 1 77  ? 50.820  20.470  14.468  1.00 39.36 ? 77  CYS B C     1 
ATOM   2861 O O     . CYS B 1 77  ? 50.990  19.270  14.208  1.00 39.50 ? 77  CYS B O     1 
ATOM   2862 C CB    . CYS B 1 77  ? 48.609  21.288  13.692  1.00 38.22 ? 77  CYS B CB    1 
ATOM   2863 S SG    . CYS B 1 77  ? 47.689  22.455  12.746  1.00 39.07 ? 77  CYS B SG    1 
ATOM   2864 N N     . ASP B 1 78  ? 51.251  21.051  15.579  1.00 38.85 ? 78  ASP B N     1 
ATOM   2865 C CA    . ASP B 1 78  ? 51.846  20.299  16.662  1.00 40.88 ? 78  ASP B CA    1 
ATOM   2866 C C     . ASP B 1 78  ? 51.414  20.915  17.983  1.00 40.76 ? 78  ASP B C     1 
ATOM   2867 O O     . ASP B 1 78  ? 52.084  21.776  18.557  1.00 40.74 ? 78  ASP B O     1 
ATOM   2868 C CB    . ASP B 1 78  ? 53.372  20.273  16.581  1.00 44.15 ? 78  ASP B CB    1 
ATOM   2869 C CG    . ASP B 1 78  ? 53.920  19.019  17.210  1.00 46.85 ? 78  ASP B CG    1 
ATOM   2870 O OD1   . ASP B 1 78  ? 53.434  18.680  18.322  1.00 48.09 ? 78  ASP B OD1   1 
ATOM   2871 O OD2   . ASP B 1 78  ? 54.797  18.354  16.599  1.00 51.80 ? 78  ASP B OD2   1 
ATOM   2872 N N     . SER B 1 79  ? 50.243  20.492  18.455  1.00 39.79 ? 79  SER B N     1 
ATOM   2873 C CA    . SER B 1 79  ? 49.681  21.034  19.681  1.00 37.85 ? 79  SER B CA    1 
ATOM   2874 C C     . SER B 1 79  ? 48.902  19.950  20.408  1.00 36.86 ? 79  SER B C     1 
ATOM   2875 O O     . SER B 1 79  ? 48.439  19.023  19.794  1.00 39.02 ? 79  SER B O     1 
ATOM   2876 C CB    . SER B 1 79  ? 48.749  22.167  19.309  1.00 37.53 ? 79  SER B CB    1 
ATOM   2877 O OG    . SER B 1 79  ? 47.928  22.538  20.396  1.00 36.71 ? 79  SER B OG    1 
ATOM   2878 N N     . PRO B 1 80  ? 48.821  20.015  21.728  1.00 36.36 ? 80  PRO B N     1 
ATOM   2879 C CA    . PRO B 1 80  ? 48.046  18.979  22.427  1.00 34.98 ? 80  PRO B CA    1 
ATOM   2880 C C     . PRO B 1 80  ? 46.542  19.241  22.278  1.00 34.62 ? 80  PRO B C     1 
ATOM   2881 O O     . PRO B 1 80  ? 45.735  18.436  22.732  1.00 33.90 ? 80  PRO B O     1 
ATOM   2882 C CB    . PRO B 1 80  ? 48.490  19.110  23.885  1.00 35.49 ? 80  PRO B CB    1 
ATOM   2883 C CG    . PRO B 1 80  ? 49.167  20.470  23.936  1.00 35.76 ? 80  PRO B CG    1 
ATOM   2884 C CD    . PRO B 1 80  ? 49.812  20.627  22.631  1.00 35.87 ? 80  PRO B CD    1 
ATOM   2885 N N     . TYR B 1 81  ? 46.189  20.344  21.640  1.00 34.00 ? 81  TYR B N     1 
ATOM   2886 C CA    . TYR B 1 81  ? 44.757  20.724  21.424  1.00 34.32 ? 81  TYR B CA    1 
ATOM   2887 C C     . TYR B 1 81  ? 44.298  20.455  19.987  1.00 31.94 ? 81  TYR B C     1 
ATOM   2888 O O     . TYR B 1 81  ? 43.163  20.777  19.623  1.00 32.82 ? 81  TYR B O     1 
ATOM   2889 C CB    . TYR B 1 81  ? 44.545  22.225  21.776  1.00 33.06 ? 81  TYR B CB    1 
ATOM   2890 C CG    . TYR B 1 81  ? 45.144  22.574  23.124  1.00 37.59 ? 81  TYR B CG    1 
ATOM   2891 C CD1   . TYR B 1 81  ? 44.669  21.972  24.292  1.00 38.54 ? 81  TYR B CD1   1 
ATOM   2892 C CD2   . TYR B 1 81  ? 46.325  23.332  23.208  1.00 39.54 ? 81  TYR B CD2   1 
ATOM   2893 C CE1   . TYR B 1 81  ? 45.353  22.085  25.485  1.00 41.29 ? 81  TYR B CE1   1 
ATOM   2894 C CE2   . TYR B 1 81  ? 47.028  23.454  24.381  1.00 39.07 ? 81  TYR B CE2   1 
ATOM   2895 C CZ    . TYR B 1 81  ? 46.546  22.829  25.524  1.00 43.32 ? 81  TYR B CZ    1 
ATOM   2896 O OH    . TYR B 1 81  ? 47.248  22.935  26.709  1.00 44.94 ? 81  TYR B OH    1 
ATOM   2897 N N     . VAL B 1 82  ? 45.184  19.938  19.145  1.00 31.59 ? 82  VAL B N     1 
ATOM   2898 C CA    . VAL B 1 82  ? 44.811  19.613  17.783  1.00 31.47 ? 82  VAL B CA    1 
ATOM   2899 C C     . VAL B 1 82  ? 45.105  18.123  17.540  1.00 32.30 ? 82  VAL B C     1 
ATOM   2900 O O     . VAL B 1 82  ? 46.206  17.657  17.816  1.00 30.73 ? 82  VAL B O     1 
ATOM   2901 C CB    . VAL B 1 82  ? 45.584  20.447  16.742  1.00 31.79 ? 82  VAL B CB    1 
ATOM   2902 C CG1   . VAL B 1 82  ? 45.177  20.077  15.326  1.00 30.08 ? 82  VAL B CG1   1 
ATOM   2903 C CG2   . VAL B 1 82  ? 45.313  21.931  16.982  1.00 31.44 ? 82  VAL B CG2   1 
ATOM   2904 N N     . THR B 1 83  ? 44.141  17.386  17.006  1.00 30.74 ? 83  THR B N     1 
ATOM   2905 C CA    . THR B 1 83  ? 44.394  15.957  16.752  1.00 31.49 ? 83  THR B CA    1 
ATOM   2906 C C     . THR B 1 83  ? 45.703  15.694  15.948  1.00 30.67 ? 83  THR B C     1 
ATOM   2907 O O     . THR B 1 83  ? 45.911  16.221  14.838  1.00 28.80 ? 83  THR B O     1 
ATOM   2908 C CB    . THR B 1 83  ? 43.230  15.353  15.925  1.00 32.04 ? 83  THR B CB    1 
ATOM   2909 O OG1   . THR B 1 83  ? 43.184  16.050  14.678  1.00 37.77 ? 83  THR B OG1   1 
ATOM   2910 C CG2   . THR B 1 83  ? 41.945  15.535  16.610  1.00 29.65 ? 83  THR B CG2   1 
ATOM   2911 N N     . LYS B 1 84  ? 46.553  14.846  16.500  1.00 32.49 ? 84  LYS B N     1 
ATOM   2912 C CA    . LYS B 1 84  ? 47.815  14.454  15.842  1.00 35.12 ? 84  LYS B CA    1 
ATOM   2913 C C     . LYS B 1 84  ? 47.647  13.522  14.632  1.00 36.74 ? 84  LYS B C     1 
ATOM   2914 O O     . LYS B 1 84  ? 46.751  12.647  14.562  1.00 35.00 ? 84  LYS B O     1 
ATOM   2915 C CB    . LYS B 1 84  ? 48.774  13.740  16.830  1.00 34.75 ? 84  LYS B CB    1 
ATOM   2916 C CG    . LYS B 1 84  ? 49.217  14.519  18.044  1.00 39.10 ? 84  LYS B CG    1 
ATOM   2917 C CD    . LYS B 1 84  ? 49.997  15.731  17.640  1.00 42.33 ? 84  LYS B CD    1 
ATOM   2918 C CE    . LYS B 1 84  ? 50.627  16.520  18.833  1.00 42.66 ? 84  LYS B CE    1 
ATOM   2919 N NZ    . LYS B 1 84  ? 51.193  15.612  19.870  1.00 44.68 ? 84  LYS B NZ    1 
ATOM   2920 N N     . TYR B 1 85  ? 48.539  13.716  13.664  1.00 38.01 ? 85  TYR B N     1 
ATOM   2921 C CA    . TYR B 1 85  ? 48.601  12.907  12.458  1.00 37.14 ? 85  TYR B CA    1 
ATOM   2922 C C     . TYR B 1 85  ? 49.930  12.172  12.573  1.00 37.38 ? 85  TYR B C     1 
ATOM   2923 O O     . TYR B 1 85  ? 50.960  12.778  12.856  1.00 35.87 ? 85  TYR B O     1 
ATOM   2924 C CB    . TYR B 1 85  ? 48.570  13.813  11.223  1.00 38.83 ? 85  TYR B CB    1 
ATOM   2925 C CG    . TYR B 1 85  ? 49.054  13.158  9.966   1.00 39.05 ? 85  TYR B CG    1 
ATOM   2926 C CD1   . TYR B 1 85  ? 50.135  13.688  9.277   1.00 39.53 ? 85  TYR B CD1   1 
ATOM   2927 C CD2   . TYR B 1 85  ? 48.427  12.012  9.438   1.00 38.98 ? 85  TYR B CD2   1 
ATOM   2928 C CE1   . TYR B 1 85  ? 50.597  13.128  8.088   1.00 39.38 ? 85  TYR B CE1   1 
ATOM   2929 C CE2   . TYR B 1 85  ? 48.869  11.443  8.252   1.00 38.48 ? 85  TYR B CE2   1 
ATOM   2930 C CZ    . TYR B 1 85  ? 49.963  12.020  7.577   1.00 41.24 ? 85  TYR B CZ    1 
ATOM   2931 O OH    . TYR B 1 85  ? 50.378  11.567  6.363   1.00 43.00 ? 85  TYR B OH    1 
ATOM   2932 N N     . TYR B 1 86  ? 49.921  10.861  12.396  1.00 36.91 ? 86  TYR B N     1 
ATOM   2933 C CA    . TYR B 1 86  ? 51.172  10.133  12.544  1.00 38.37 ? 86  TYR B CA    1 
ATOM   2934 C C     . TYR B 1 86  ? 51.693  9.553   11.248  1.00 38.00 ? 86  TYR B C     1 
ATOM   2935 O O     . TYR B 1 86  ? 52.478  8.631   11.300  1.00 41.44 ? 86  TYR B O     1 
ATOM   2936 C CB    . TYR B 1 86  ? 51.003  8.977   13.521  1.00 37.71 ? 86  TYR B CB    1 
ATOM   2937 C CG    . TYR B 1 86  ? 50.634  9.408   14.908  1.00 39.47 ? 86  TYR B CG    1 
ATOM   2938 C CD1   . TYR B 1 86  ? 49.469  8.935   15.519  1.00 38.85 ? 86  TYR B CD1   1 
ATOM   2939 C CD2   . TYR B 1 86  ? 51.451  10.286  15.618  1.00 41.56 ? 86  TYR B CD2   1 
ATOM   2940 C CE1   . TYR B 1 86  ? 49.126  9.327   16.820  1.00 42.84 ? 86  TYR B CE1   1 
ATOM   2941 C CE2   . TYR B 1 86  ? 51.116  10.706  16.919  1.00 44.61 ? 86  TYR B CE2   1 
ATOM   2942 C CZ    . TYR B 1 86  ? 49.961  10.226  17.506  1.00 44.03 ? 86  TYR B CZ    1 
ATOM   2943 O OH    . TYR B 1 86  ? 49.614  10.666  18.750  1.00 47.77 ? 86  TYR B OH    1 
ATOM   2944 N N     . GLY B 1 87  ? 51.223  10.019  10.101  1.00 36.81 ? 87  GLY B N     1 
ATOM   2945 C CA    . GLY B 1 87  ? 51.699  9.468   8.858   1.00 35.22 ? 87  GLY B CA    1 
ATOM   2946 C C     . GLY B 1 87  ? 50.668  8.635   8.101   1.00 36.35 ? 87  GLY B C     1 
ATOM   2947 O O     . GLY B 1 87  ? 49.585  8.231   8.640   1.00 34.37 ? 87  GLY B O     1 
ATOM   2948 N N     . SER B 1 88  ? 50.987  8.402   6.824   1.00 35.44 ? 88  SER B N     1 
ATOM   2949 C CA    . SER B 1 88  ? 50.118  7.643   5.914   1.00 34.98 ? 88  SER B CA    1 
ATOM   2950 C C     . SER B 1 88  ? 50.900  6.549   5.201   1.00 37.29 ? 88  SER B C     1 
ATOM   2951 O O     . SER B 1 88  ? 52.120  6.658   4.985   1.00 33.95 ? 88  SER B O     1 
ATOM   2952 C CB    . SER B 1 88  ? 49.494  8.551   4.875   1.00 34.10 ? 88  SER B CB    1 
ATOM   2953 O OG    . SER B 1 88  ? 48.923  9.726   5.444   1.00 35.84 ? 88  SER B OG    1 
ATOM   2954 N N     . TYR B 1 89  ? 50.158  5.524   4.805   1.00 37.17 ? 89  TYR B N     1 
ATOM   2955 C CA    . TYR B 1 89  ? 50.687  4.356   4.175   1.00 39.67 ? 89  TYR B CA    1 
ATOM   2956 C C     . TYR B 1 89  ? 49.799  3.995   3.003   1.00 42.60 ? 89  TYR B C     1 
ATOM   2957 O O     . TYR B 1 89  ? 48.567  4.178   3.026   1.00 41.94 ? 89  TYR B O     1 
ATOM   2958 C CB    . TYR B 1 89  ? 50.708  3.199   5.172   1.00 38.80 ? 89  TYR B CB    1 
ATOM   2959 C CG    . TYR B 1 89  ? 51.580  3.425   6.387   1.00 41.92 ? 89  TYR B CG    1 
ATOM   2960 C CD1   . TYR B 1 89  ? 52.899  2.956   6.427   1.00 41.64 ? 89  TYR B CD1   1 
ATOM   2961 C CD2   . TYR B 1 89  ? 51.080  4.104   7.512   1.00 41.56 ? 89  TYR B CD2   1 
ATOM   2962 C CE1   . TYR B 1 89  ? 53.709  3.155   7.578   1.00 42.07 ? 89  TYR B CE1   1 
ATOM   2963 C CE2   . TYR B 1 89  ? 51.866  4.322   8.644   1.00 41.44 ? 89  TYR B CE2   1 
ATOM   2964 C CZ    . TYR B 1 89  ? 53.184  3.835   8.672   1.00 41.90 ? 89  TYR B CZ    1 
ATOM   2965 O OH    . TYR B 1 89  ? 53.921  4.003   9.818   1.00 40.90 ? 89  TYR B OH    1 
ATOM   2966 N N     . LEU B 1 90  ? 50.419  3.484   1.954   1.00 43.87 ? 90  LEU B N     1 
ATOM   2967 C CA    . LEU B 1 90  ? 49.662  3.111   0.792   1.00 46.33 ? 90  LEU B CA    1 
ATOM   2968 C C     . LEU B 1 90  ? 49.860  1.615   0.608   1.00 47.79 ? 90  LEU B C     1 
ATOM   2969 O O     . LEU B 1 90  ? 50.986  1.165   0.471   1.00 49.54 ? 90  LEU B O     1 
ATOM   2970 C CB    . LEU B 1 90  ? 50.163  3.897   -0.416  1.00 48.46 ? 90  LEU B CB    1 
ATOM   2971 C CG    . LEU B 1 90  ? 49.393  3.873   -1.742  1.00 50.10 ? 90  LEU B CG    1 
ATOM   2972 C CD1   . LEU B 1 90  ? 47.923  4.253   -1.526  1.00 49.61 ? 90  LEU B CD1   1 
ATOM   2973 C CD2   . LEU B 1 90  ? 50.066  4.874   -2.752  1.00 51.99 ? 90  LEU B CD2   1 
ATOM   2974 N N     . LYS B 1 91  ? 48.776  0.845   0.675   1.00 46.51 ? 91  LYS B N     1 
ATOM   2975 C CA    . LYS B 1 91  ? 48.823  -0.602  0.482   1.00 47.01 ? 91  LYS B CA    1 
ATOM   2976 C C     . LYS B 1 91  ? 47.904  -0.855  -0.737  1.00 47.65 ? 91  LYS B C     1 
ATOM   2977 O O     . LYS B 1 91  ? 46.674  -0.659  -0.661  1.00 46.89 ? 91  LYS B O     1 
ATOM   2978 C CB    . LYS B 1 91  ? 48.266  -1.300  1.729   1.00 47.85 ? 91  LYS B CB    1 
ATOM   2979 C CG    . LYS B 1 91  ? 48.083  -2.803  1.654   1.00 48.86 ? 91  LYS B CG    1 
ATOM   2980 C CD    . LYS B 1 91  ? 49.425  -3.490  1.628   1.00 50.33 ? 91  LYS B CD    1 
ATOM   2981 C CE    . LYS B 1 91  ? 49.293  -4.997  1.873   1.00 50.42 ? 91  LYS B CE    1 
ATOM   2982 N NZ    . LYS B 1 91  ? 50.576  -5.611  1.397   1.00 50.83 ? 91  LYS B NZ    1 
ATOM   2983 N N     . ASP B 1 92  ? 48.477  -1.274  -1.860  1.00 47.76 ? 92  ASP B N     1 
ATOM   2984 C CA    . ASP B 1 92  ? 47.653  -1.475  -3.046  1.00 47.79 ? 92  ASP B CA    1 
ATOM   2985 C C     . ASP B 1 92  ? 46.951  -0.145  -3.347  1.00 46.92 ? 92  ASP B C     1 
ATOM   2986 O O     . ASP B 1 92  ? 47.603  0.913   -3.382  1.00 46.23 ? 92  ASP B O     1 
ATOM   2987 C CB    . ASP B 1 92  ? 46.608  -2.552  -2.790  1.00 51.21 ? 92  ASP B CB    1 
ATOM   2988 C CG    . ASP B 1 92  ? 47.010  -3.872  -3.351  1.00 55.76 ? 92  ASP B CG    1 
ATOM   2989 O OD1   . ASP B 1 92  ? 46.837  -4.056  -4.597  1.00 59.52 ? 92  ASP B OD1   1 
ATOM   2990 O OD2   . ASP B 1 92  ? 47.515  -4.712  -2.558  1.00 57.69 ? 92  ASP B OD2   1 
ATOM   2991 N N     . THR B 1 93  ? 45.626  -0.170  -3.513  1.00 43.86 ? 93  THR B N     1 
ATOM   2992 C CA    . THR B 1 93  ? 44.933  1.068   -3.837  1.00 44.50 ? 93  THR B CA    1 
ATOM   2993 C C     . THR B 1 93  ? 44.376  1.808   -2.631  1.00 43.73 ? 93  THR B C     1 
ATOM   2994 O O     . THR B 1 93  ? 43.713  2.840   -2.783  1.00 42.39 ? 93  THR B O     1 
ATOM   2995 C CB    . THR B 1 93  ? 43.750  0.805   -4.766  1.00 45.95 ? 93  THR B CB    1 
ATOM   2996 O OG1   . THR B 1 93  ? 42.785  0.003   -4.062  1.00 47.39 ? 93  THR B OG1   1 
ATOM   2997 C CG2   . THR B 1 93  ? 44.228  0.078   -6.042  1.00 44.26 ? 93  THR B CG2   1 
ATOM   2998 N N     . LYS B 1 94  ? 44.634  1.274   -1.446  1.00 42.81 ? 94  LYS B N     1 
ATOM   2999 C CA    . LYS B 1 94  ? 44.114  1.878   -0.232  1.00 43.22 ? 94  LYS B CA    1 
ATOM   3000 C C     . LYS B 1 94  ? 45.129  2.656   0.590   1.00 41.92 ? 94  LYS B C     1 
ATOM   3001 O O     . LYS B 1 94  ? 46.228  2.179   0.879   1.00 43.47 ? 94  LYS B O     1 
ATOM   3002 C CB    . LYS B 1 94  ? 43.469  0.799   0.616   1.00 43.61 ? 94  LYS B CB    1 
ATOM   3003 C CG    . LYS B 1 94  ? 42.345  0.096   -0.116  1.00 46.93 ? 94  LYS B CG    1 
ATOM   3004 C CD    . LYS B 1 94  ? 41.291  -0.397  0.828   1.00 49.52 ? 94  LYS B CD    1 
ATOM   3005 C CE    . LYS B 1 94  ? 40.257  -1.230  0.071   1.00 50.63 ? 94  LYS B CE    1 
ATOM   3006 N NZ    . LYS B 1 94  ? 41.027  -2.369  -0.532  1.00 50.84 ? 94  LYS B NZ    1 
ATOM   3007 N N     . LEU B 1 95  ? 44.733  3.872   0.932   1.00 39.70 ? 95  LEU B N     1 
ATOM   3008 C CA    . LEU B 1 95  ? 45.523  4.769   1.759   1.00 37.06 ? 95  LEU B CA    1 
ATOM   3009 C C     . LEU B 1 95  ? 45.112  4.605   3.257   1.00 37.18 ? 95  LEU B C     1 
ATOM   3010 O O     . LEU B 1 95  ? 43.904  4.726   3.566   1.00 34.34 ? 95  LEU B O     1 
ATOM   3011 C CB    . LEU B 1 95  ? 45.243  6.193   1.300   1.00 37.22 ? 95  LEU B CB    1 
ATOM   3012 C CG    . LEU B 1 95  ? 46.096  7.216   2.016   1.00 37.98 ? 95  LEU B CG    1 
ATOM   3013 C CD1   . LEU B 1 95  ? 47.542  7.016   1.592   1.00 40.39 ? 95  LEU B CD1   1 
ATOM   3014 C CD2   . LEU B 1 95  ? 45.604  8.591   1.686   1.00 39.40 ? 95  LEU B CD2   1 
ATOM   3015 N N     . TRP B 1 96  ? 46.085  4.290   4.145   1.00 33.42 ? 96  TRP B N     1 
ATOM   3016 C CA    . TRP B 1 96  ? 45.872  4.142   5.610   1.00 33.38 ? 96  TRP B CA    1 
ATOM   3017 C C     . TRP B 1 96  ? 46.360  5.409   6.308   1.00 34.41 ? 96  TRP B C     1 
ATOM   3018 O O     . TRP B 1 96  ? 47.583  5.670   6.330   1.00 34.81 ? 96  TRP B O     1 
ATOM   3019 C CB    . TRP B 1 96  ? 46.663  2.976   6.199   1.00 32.23 ? 96  TRP B CB    1 
ATOM   3020 C CG    . TRP B 1 96  ? 46.111  1.650   5.898   1.00 33.17 ? 96  TRP B CG    1 
ATOM   3021 C CD1   . TRP B 1 96  ? 45.714  1.201   4.657   1.00 35.23 ? 96  TRP B CD1   1 
ATOM   3022 C CD2   . TRP B 1 96  ? 45.941  0.552   6.794   1.00 32.57 ? 96  TRP B CD2   1 
ATOM   3023 N NE1   . TRP B 1 96  ? 45.321  -0.103  4.732   1.00 31.67 ? 96  TRP B NE1   1 
ATOM   3024 C CE2   . TRP B 1 96  ? 45.449  -0.532  6.027   1.00 33.00 ? 96  TRP B CE2   1 
ATOM   3025 C CE3   . TRP B 1 96  ? 46.174  0.366   8.172   1.00 33.77 ? 96  TRP B CE3   1 
ATOM   3026 C CZ2   . TRP B 1 96  ? 45.185  -1.776  6.579   1.00 32.54 ? 96  TRP B CZ2   1 
ATOM   3027 C CZ3   . TRP B 1 96  ? 45.917  -0.855  8.732   1.00 32.32 ? 96  TRP B CZ3   1 
ATOM   3028 C CH2   . TRP B 1 96  ? 45.419  -1.930  7.936   1.00 34.49 ? 96  TRP B CH2   1 
ATOM   3029 N N     . ILE B 1 97  ? 45.447  6.208   6.860   1.00 31.48 ? 97  ILE B N     1 
ATOM   3030 C CA    . ILE B 1 97  ? 45.856  7.431   7.532   1.00 31.81 ? 97  ILE B CA    1 
ATOM   3031 C C     . ILE B 1 97  ? 45.831  7.145   9.026   1.00 32.65 ? 97  ILE B C     1 
ATOM   3032 O O     . ILE B 1 97  ? 44.816  6.734   9.564   1.00 30.66 ? 97  ILE B O     1 
ATOM   3033 C CB    . ILE B 1 97  ? 44.900  8.621   7.192   1.00 31.27 ? 97  ILE B CB    1 
ATOM   3034 C CG1   . ILE B 1 97  ? 44.782  8.737   5.662   1.00 32.75 ? 97  ILE B CG1   1 
ATOM   3035 C CG2   . ILE B 1 97  ? 45.398  9.928   7.878   1.00 33.75 ? 97  ILE B CG2   1 
ATOM   3036 C CD1   . ILE B 1 97  ? 43.839  9.842   5.188   1.00 38.05 ? 97  ILE B CD1   1 
ATOM   3037 N N     . ILE B 1 98  ? 46.977  7.356   9.682   1.00 31.44 ? 98  ILE B N     1 
ATOM   3038 C CA    . ILE B 1 98  ? 47.148  7.087   11.093  1.00 32.24 ? 98  ILE B CA    1 
ATOM   3039 C C     . ILE B 1 98  ? 47.011  8.353   11.897  1.00 32.75 ? 98  ILE B C     1 
ATOM   3040 O O     . ILE B 1 98  ? 47.760  9.301   11.706  1.00 33.64 ? 98  ILE B O     1 
ATOM   3041 C CB    . ILE B 1 98  ? 48.545  6.462   11.375  1.00 33.03 ? 98  ILE B CB    1 
ATOM   3042 C CG1   . ILE B 1 98  ? 48.852  5.392   10.321  1.00 32.63 ? 98  ILE B CG1   1 
ATOM   3043 C CG2   . ILE B 1 98  ? 48.579  5.911   12.848  1.00 33.45 ? 98  ILE B CG2   1 
ATOM   3044 C CD1   . ILE B 1 98  ? 47.849  4.184   10.339  1.00 36.74 ? 98  ILE B CD1   1 
ATOM   3045 N N     . MET B 1 99  ? 46.053  8.373   12.822  1.00 32.64 ? 99  MET B N     1 
ATOM   3046 C CA    . MET B 1 99  ? 45.823  9.566   13.608  1.00 33.68 ? 99  MET B CA    1 
ATOM   3047 C C     . MET B 1 99  ? 45.635  9.222   15.099  1.00 33.41 ? 99  MET B C     1 
ATOM   3048 O O     . MET B 1 99  ? 45.384  8.060   15.467  1.00 30.73 ? 99  MET B O     1 
ATOM   3049 C CB    . MET B 1 99  ? 44.564  10.279  13.088  1.00 38.99 ? 99  MET B CB    1 
ATOM   3050 C CG    . MET B 1 99  ? 44.704  11.152  11.751  1.00 44.14 ? 99  MET B CG    1 
ATOM   3051 S SD    . MET B 1 99  ? 42.977  10.914  11.109  1.00 56.79 ? 99  MET B SD    1 
ATOM   3052 C CE    . MET B 1 99  ? 42.725  12.357  9.935   1.00 51.00 ? 99  MET B CE    1 
ATOM   3053 N N     . GLU B 1 100 ? 45.751  10.243  15.952  1.00 32.13 ? 100 GLU B N     1 
ATOM   3054 C CA    . GLU B 1 100 ? 45.568  10.119  17.394  1.00 30.86 ? 100 GLU B CA    1 
ATOM   3055 C C     . GLU B 1 100 ? 44.126  9.585   17.669  1.00 31.61 ? 100 GLU B C     1 
ATOM   3056 O O     . GLU B 1 100 ? 43.153  10.061  17.104  1.00 28.89 ? 100 GLU B O     1 
ATOM   3057 C CB    . GLU B 1 100 ? 45.716  11.496  18.023  1.00 32.89 ? 100 GLU B CB    1 
ATOM   3058 C CG    . GLU B 1 100 ? 45.636  11.548  19.564  1.00 33.30 ? 100 GLU B CG    1 
ATOM   3059 C CD    . GLU B 1 100 ? 45.773  12.997  20.085  1.00 34.80 ? 100 GLU B CD    1 
ATOM   3060 O OE1   . GLU B 1 100 ? 45.795  13.199  21.310  1.00 35.75 ? 100 GLU B OE1   1 
ATOM   3061 O OE2   . GLU B 1 100 ? 45.859  13.933  19.247  1.00 35.67 ? 100 GLU B OE2   1 
ATOM   3062 N N     . TYR B 1 101 ? 44.022  8.595   18.522  1.00 31.62 ? 101 TYR B N     1 
ATOM   3063 C CA    . TYR B 1 101 ? 42.728  8.046   18.876  1.00 33.33 ? 101 TYR B CA    1 
ATOM   3064 C C     . TYR B 1 101 ? 42.144  8.818   20.059  1.00 31.46 ? 101 TYR B C     1 
ATOM   3065 O O     . TYR B 1 101 ? 42.801  9.035   21.047  1.00 32.25 ? 101 TYR B O     1 
ATOM   3066 C CB    . TYR B 1 101 ? 42.867  6.554   19.247  1.00 33.26 ? 101 TYR B CB    1 
ATOM   3067 C CG    . TYR B 1 101 ? 41.553  5.921   19.739  1.00 35.68 ? 101 TYR B CG    1 
ATOM   3068 C CD1   . TYR B 1 101 ? 40.551  5.542   18.843  1.00 37.84 ? 101 TYR B CD1   1 
ATOM   3069 C CD2   . TYR B 1 101 ? 41.318  5.723   21.105  1.00 36.83 ? 101 TYR B CD2   1 
ATOM   3070 C CE1   . TYR B 1 101 ? 39.337  4.976   19.305  1.00 37.88 ? 101 TYR B CE1   1 
ATOM   3071 C CE2   . TYR B 1 101 ? 40.121  5.161   21.563  1.00 36.23 ? 101 TYR B CE2   1 
ATOM   3072 C CZ    . TYR B 1 101 ? 39.157  4.793   20.657  1.00 36.81 ? 101 TYR B CZ    1 
ATOM   3073 O OH    . TYR B 1 101 ? 38.003  4.193   21.104  1.00 40.58 ? 101 TYR B OH    1 
ATOM   3074 N N     . LEU B 1 102 ? 40.860  9.139   19.992  1.00 32.41 ? 102 LEU B N     1 
ATOM   3075 C CA    . LEU B 1 102 ? 40.214  9.891   21.060  1.00 31.29 ? 102 LEU B CA    1 
ATOM   3076 C C     . LEU B 1 102 ? 38.856  9.250   21.143  1.00 31.37 ? 102 LEU B C     1 
ATOM   3077 O O     . LEU B 1 102 ? 38.003  9.510   20.305  1.00 29.12 ? 102 LEU B O     1 
ATOM   3078 C CB    . LEU B 1 102 ? 40.075  11.337  20.627  1.00 31.99 ? 102 LEU B CB    1 
ATOM   3079 C CG    . LEU B 1 102 ? 41.399  12.075  20.465  1.00 32.46 ? 102 LEU B CG    1 
ATOM   3080 C CD1   . LEU B 1 102 ? 41.117  13.363  19.738  1.00 30.72 ? 102 LEU B CD1   1 
ATOM   3081 C CD2   . LEU B 1 102 ? 42.051  12.294  21.822  1.00 29.82 ? 102 LEU B CD2   1 
ATOM   3082 N N     . GLY B 1 103 ? 38.701  8.360   22.094  1.00 34.02 ? 103 GLY B N     1 
ATOM   3083 C CA    . GLY B 1 103 ? 37.453  7.624   22.173  1.00 38.24 ? 103 GLY B CA    1 
ATOM   3084 C C     . GLY B 1 103 ? 36.444  8.170   23.151  1.00 39.27 ? 103 GLY B C     1 
ATOM   3085 O O     . GLY B 1 103 ? 35.458  7.488   23.429  1.00 39.95 ? 103 GLY B O     1 
ATOM   3086 N N     . GLY B 1 104 ? 36.652  9.403   23.629  1.00 37.43 ? 104 GLY B N     1 
ATOM   3087 C CA    . GLY B 1 104 ? 35.694  9.991   24.564  1.00 36.91 ? 104 GLY B CA    1 
ATOM   3088 C C     . GLY B 1 104 ? 34.389  10.464  23.924  1.00 37.56 ? 104 GLY B C     1 
ATOM   3089 O O     . GLY B 1 104 ? 33.398  10.657  24.634  1.00 37.62 ? 104 GLY B O     1 
ATOM   3090 N N     . GLY B 1 105 ? 34.407  10.631  22.597  1.00 36.15 ? 105 GLY B N     1 
ATOM   3091 C CA    . GLY B 1 105 ? 33.287  11.120  21.815  1.00 35.38 ? 105 GLY B CA    1 
ATOM   3092 C C     . GLY B 1 105 ? 33.481  12.617  21.514  1.00 33.26 ? 105 GLY B C     1 
ATOM   3093 O O     . GLY B 1 105 ? 34.363  13.234  22.072  1.00 34.79 ? 105 GLY B O     1 
ATOM   3094 N N     . SER B 1 106 ? 32.666  13.187  20.649  1.00 32.77 ? 106 SER B N     1 
ATOM   3095 C CA    . SER B 1 106 ? 32.735  14.620  20.334  1.00 31.42 ? 106 SER B CA    1 
ATOM   3096 C C     . SER B 1 106 ? 31.918  15.447  21.348  1.00 31.64 ? 106 SER B C     1 
ATOM   3097 O O     . SER B 1 106 ? 31.042  14.912  22.075  1.00 30.75 ? 106 SER B O     1 
ATOM   3098 C CB    . SER B 1 106 ? 32.156  14.863  18.938  1.00 33.68 ? 106 SER B CB    1 
ATOM   3099 O OG    . SER B 1 106 ? 30.724  14.711  18.919  1.00 34.48 ? 106 SER B OG    1 
ATOM   3100 N N     . ALA B 1 107 ? 32.155  16.758  21.393  1.00 27.38 ? 107 ALA B N     1 
ATOM   3101 C CA    . ALA B 1 107 ? 31.363  17.533  22.308  1.00 29.11 ? 107 ALA B CA    1 
ATOM   3102 C C     . ALA B 1 107 ? 29.856  17.349  22.007  1.00 28.44 ? 107 ALA B C     1 
ATOM   3103 O O     . ALA B 1 107 ? 29.047  17.378  22.952  1.00 30.90 ? 107 ALA B O     1 
ATOM   3104 C CB    . ALA B 1 107 ? 31.730  19.035  22.209  1.00 25.82 ? 107 ALA B CB    1 
ATOM   3105 N N     . LEU B 1 108 ? 29.496  17.244  20.724  1.00 29.02 ? 108 LEU B N     1 
ATOM   3106 C CA    . LEU B 1 108 ? 28.085  17.053  20.290  1.00 31.23 ? 108 LEU B CA    1 
ATOM   3107 C C     . LEU B 1 108 ? 27.543  15.722  20.876  1.00 34.77 ? 108 LEU B C     1 
ATOM   3108 O O     . LEU B 1 108 ? 26.424  15.688  21.410  1.00 33.75 ? 108 LEU B O     1 
ATOM   3109 C CB    . LEU B 1 108 ? 27.984  16.988  18.787  1.00 31.57 ? 108 LEU B CB    1 
ATOM   3110 C CG    . LEU B 1 108 ? 26.520  17.007  18.321  1.00 35.14 ? 108 LEU B CG    1 
ATOM   3111 C CD1   . LEU B 1 108 ? 25.812  18.229  18.948  1.00 36.07 ? 108 LEU B CD1   1 
ATOM   3112 C CD2   . LEU B 1 108 ? 26.430  17.031  16.810  1.00 34.85 ? 108 LEU B CD2   1 
ATOM   3113 N N     . ASP B 1 109 ? 28.338  14.645  20.795  1.00 35.88 ? 109 ASP B N     1 
ATOM   3114 C CA    . ASP B 1 109 ? 27.899  13.362  21.352  1.00 37.98 ? 109 ASP B CA    1 
ATOM   3115 C C     . ASP B 1 109 ? 27.558  13.540  22.807  1.00 38.57 ? 109 ASP B C     1 
ATOM   3116 O O     . ASP B 1 109 ? 26.538  13.046  23.279  1.00 39.96 ? 109 ASP B O     1 
ATOM   3117 C CB    . ASP B 1 109 ? 29.004  12.309  21.271  1.00 36.79 ? 109 ASP B CB    1 
ATOM   3118 C CG    . ASP B 1 109 ? 29.316  11.929  19.876  1.00 37.01 ? 109 ASP B CG    1 
ATOM   3119 O OD1   . ASP B 1 109 ? 30.425  11.430  19.631  1.00 35.70 ? 109 ASP B OD1   1 
ATOM   3120 O OD2   . ASP B 1 109 ? 28.442  12.136  18.996  1.00 39.76 ? 109 ASP B OD2   1 
ATOM   3121 N N     . LEU B 1 110 ? 28.391  14.284  23.529  1.00 39.82 ? 110 LEU B N     1 
ATOM   3122 C CA    . LEU B 1 110 ? 28.181  14.433  24.954  1.00 39.41 ? 110 LEU B CA    1 
ATOM   3123 C C     . LEU B 1 110 ? 26.975  15.267  25.379  1.00 39.76 ? 110 LEU B C     1 
ATOM   3124 O O     . LEU B 1 110 ? 26.666  15.310  26.547  1.00 39.45 ? 110 LEU B O     1 
ATOM   3125 C CB    . LEU B 1 110 ? 29.427  15.017  25.638  1.00 40.38 ? 110 LEU B CB    1 
ATOM   3126 C CG    . LEU B 1 110 ? 30.766  14.323  25.388  1.00 40.36 ? 110 LEU B CG    1 
ATOM   3127 C CD1   . LEU B 1 110 ? 31.811  15.173  25.961  1.00 40.77 ? 110 LEU B CD1   1 
ATOM   3128 C CD2   . LEU B 1 110 ? 30.822  12.895  25.969  1.00 39.98 ? 110 LEU B CD2   1 
ATOM   3129 N N     . LEU B 1 111 ? 26.349  15.981  24.457  1.00 40.96 ? 111 LEU B N     1 
ATOM   3130 C CA    . LEU B 1 111 ? 25.174  16.744  24.802  1.00 41.85 ? 111 LEU B CA    1 
ATOM   3131 C C     . LEU B 1 111 ? 23.982  15.776  24.714  1.00 44.18 ? 111 LEU B C     1 
ATOM   3132 O O     . LEU B 1 111 ? 22.915  16.040  25.310  1.00 42.75 ? 111 LEU B O     1 
ATOM   3133 C CB    . LEU B 1 111 ? 24.957  17.891  23.798  1.00 40.76 ? 111 LEU B CB    1 
ATOM   3134 C CG    . LEU B 1 111 ? 25.798  19.164  24.001  1.00 39.71 ? 111 LEU B CG    1 
ATOM   3135 C CD1   . LEU B 1 111 ? 25.781  20.091  22.801  1.00 39.40 ? 111 LEU B CD1   1 
ATOM   3136 C CD2   . LEU B 1 111 ? 25.257  19.874  25.181  1.00 39.15 ? 111 LEU B CD2   1 
ATOM   3137 N N     . GLU B 1 112 ? 24.169  14.669  23.989  1.00 44.58 ? 112 GLU B N     1 
ATOM   3138 C CA    . GLU B 1 112 ? 23.073  13.699  23.780  1.00 46.36 ? 112 GLU B CA    1 
ATOM   3139 C C     . GLU B 1 112 ? 22.259  13.273  25.001  1.00 44.56 ? 112 GLU B C     1 
ATOM   3140 O O     . GLU B 1 112 ? 21.035  13.357  24.962  1.00 45.37 ? 112 GLU B O     1 
ATOM   3141 C CB    . GLU B 1 112 ? 23.558  12.435  23.044  1.00 48.31 ? 112 GLU B CB    1 
ATOM   3142 C CG    . GLU B 1 112 ? 23.598  12.542  21.488  1.00 51.77 ? 112 GLU B CG    1 
ATOM   3143 C CD    . GLU B 1 112 ? 22.243  12.903  20.880  1.00 54.54 ? 112 GLU B CD    1 
ATOM   3144 O OE1   . GLU B 1 112 ? 21.873  14.102  20.888  1.00 56.12 ? 112 GLU B OE1   1 
ATOM   3145 O OE2   . GLU B 1 112 ? 21.528  11.985  20.413  1.00 56.15 ? 112 GLU B OE2   1 
ATOM   3146 N N     . PRO B 1 113 ? 22.911  12.845  26.096  1.00 44.72 ? 113 PRO B N     1 
ATOM   3147 C CA    . PRO B 1 113 ? 22.178  12.418  27.297  1.00 43.92 ? 113 PRO B CA    1 
ATOM   3148 C C     . PRO B 1 113 ? 21.478  13.530  28.123  1.00 45.42 ? 113 PRO B C     1 
ATOM   3149 O O     . PRO B 1 113 ? 20.668  13.226  29.017  1.00 44.81 ? 113 PRO B O     1 
ATOM   3150 C CB    . PRO B 1 113 ? 23.244  11.725  28.139  1.00 44.40 ? 113 PRO B CB    1 
ATOM   3151 C CG    . PRO B 1 113 ? 24.416  11.498  27.197  1.00 43.45 ? 113 PRO B CG    1 
ATOM   3152 C CD    . PRO B 1 113 ? 24.365  12.665  26.282  1.00 43.28 ? 113 PRO B CD    1 
ATOM   3153 N N     . GLY B 1 114 ? 21.809  14.793  27.858  1.00 44.06 ? 114 GLY B N     1 
ATOM   3154 C CA    . GLY B 1 114 ? 21.208  15.879  28.593  1.00 43.46 ? 114 GLY B CA    1 
ATOM   3155 C C     . GLY B 1 114 ? 22.030  17.134  28.474  1.00 43.13 ? 114 GLY B C     1 
ATOM   3156 O O     . GLY B 1 114 ? 23.035  17.130  27.751  1.00 44.13 ? 114 GLY B O     1 
ATOM   3157 N N     . PRO B 1 115 ? 21.634  18.230  29.144  1.00 42.60 ? 115 PRO B N     1 
ATOM   3158 C CA    . PRO B 1 115 ? 22.384  19.484  29.062  1.00 41.62 ? 115 PRO B CA    1 
ATOM   3159 C C     . PRO B 1 115 ? 23.666  19.456  29.880  1.00 40.22 ? 115 PRO B C     1 
ATOM   3160 O O     . PRO B 1 115 ? 23.837  18.601  30.745  1.00 40.83 ? 115 PRO B O     1 
ATOM   3161 C CB    . PRO B 1 115 ? 21.384  20.518  29.594  1.00 42.75 ? 115 PRO B CB    1 
ATOM   3162 C CG    . PRO B 1 115 ? 20.746  19.778  30.649  1.00 44.13 ? 115 PRO B CG    1 
ATOM   3163 C CD    . PRO B 1 115 ? 20.419  18.438  29.957  1.00 43.19 ? 115 PRO B CD    1 
ATOM   3164 N N     . LEU B 1 116 ? 24.564  20.384  29.559  1.00 35.80 ? 116 LEU B N     1 
ATOM   3165 C CA    . LEU B 1 116 ? 25.819  20.537  30.252  1.00 36.51 ? 116 LEU B CA    1 
ATOM   3166 C C     . LEU B 1 116 ? 25.645  21.595  31.337  1.00 34.90 ? 116 LEU B C     1 
ATOM   3167 O O     . LEU B 1 116 ? 24.796  22.451  31.198  1.00 34.31 ? 116 LEU B O     1 
ATOM   3168 C CB    . LEU B 1 116 ? 26.902  21.056  29.296  1.00 33.23 ? 116 LEU B CB    1 
ATOM   3169 C CG    . LEU B 1 116 ? 27.305  20.210  28.090  1.00 39.42 ? 116 LEU B CG    1 
ATOM   3170 C CD1   . LEU B 1 116 ? 28.609  20.776  27.480  1.00 38.62 ? 116 LEU B CD1   1 
ATOM   3171 C CD2   . LEU B 1 116 ? 27.542  18.772  28.497  1.00 37.72 ? 116 LEU B CD2   1 
ATOM   3172 N N     . ASP B 1 117 ? 26.420  21.544  32.412  1.00 33.07 ? 117 ASP B N     1 
ATOM   3173 C CA    . ASP B 1 117 ? 26.311  22.651  33.358  1.00 34.90 ? 117 ASP B CA    1 
ATOM   3174 C C     . ASP B 1 117 ? 27.366  23.724  32.947  1.00 33.40 ? 117 ASP B C     1 
ATOM   3175 O O     . ASP B 1 117 ? 28.190  23.441  32.082  1.00 31.83 ? 117 ASP B O     1 
ATOM   3176 C CB    . ASP B 1 117 ? 26.471  22.190  34.836  1.00 37.68 ? 117 ASP B CB    1 
ATOM   3177 C CG    . ASP B 1 117 ? 27.840  21.606  35.146  1.00 41.26 ? 117 ASP B CG    1 
ATOM   3178 O OD1   . ASP B 1 117 ? 27.879  20.715  36.038  1.00 44.45 ? 117 ASP B OD1   1 
ATOM   3179 O OD2   . ASP B 1 117 ? 28.849  22.012  34.528  1.00 41.01 ? 117 ASP B OD2   1 
ATOM   3180 N N     . GLU B 1 118 ? 27.333  24.927  33.545  1.00 32.49 ? 118 GLU B N     1 
ATOM   3181 C CA    . GLU B 1 118 ? 28.268  25.974  33.121  1.00 31.11 ? 118 GLU B CA    1 
ATOM   3182 C C     . GLU B 1 118 ? 29.714  25.646  33.352  1.00 30.34 ? 118 GLU B C     1 
ATOM   3183 O O     . GLU B 1 118 ? 30.569  26.117  32.600  1.00 30.86 ? 118 GLU B O     1 
ATOM   3184 C CB    . GLU B 1 118 ? 27.888  27.335  33.731  1.00 30.52 ? 118 GLU B CB    1 
ATOM   3185 C CG    . GLU B 1 118 ? 26.442  27.803  33.231  1.00 32.03 ? 118 GLU B CG    1 
ATOM   3186 C CD    . GLU B 1 118 ? 26.217  29.293  33.410  1.00 33.03 ? 118 GLU B CD    1 
ATOM   3187 O OE1   . GLU B 1 118 ? 27.212  30.014  33.683  1.00 31.50 ? 118 GLU B OE1   1 
ATOM   3188 O OE2   . GLU B 1 118 ? 25.062  29.737  33.278  1.00 32.69 ? 118 GLU B OE2   1 
ATOM   3189 N N     . THR B 1 119 ? 30.006  24.806  34.348  1.00 31.18 ? 119 THR B N     1 
ATOM   3190 C CA    . THR B 1 119 ? 31.397  24.396  34.605  1.00 33.18 ? 119 THR B CA    1 
ATOM   3191 C C     . THR B 1 119 ? 31.886  23.521  33.437  1.00 32.53 ? 119 THR B C     1 
ATOM   3192 O O     . THR B 1 119 ? 33.067  23.623  32.997  1.00 31.44 ? 119 THR B O     1 
ATOM   3193 C CB    . THR B 1 119 ? 31.531  23.544  35.925  1.00 35.85 ? 119 THR B CB    1 
ATOM   3194 O OG1   . THR B 1 119 ? 31.031  24.308  37.049  1.00 38.12 ? 119 THR B OG1   1 
ATOM   3195 C CG2   . THR B 1 119 ? 33.000  23.157  36.166  1.00 36.24 ? 119 THR B CG2   1 
ATOM   3196 N N     . GLN B 1 120 ? 31.023  22.607  32.967  1.00 31.15 ? 120 GLN B N     1 
ATOM   3197 C CA    . GLN B 1 120 ? 31.402  21.744  31.828  1.00 30.70 ? 120 GLN B CA    1 
ATOM   3198 C C     . GLN B 1 120 ? 31.580  22.570  30.540  1.00 29.37 ? 120 GLN B C     1 
ATOM   3199 O O     . GLN B 1 120 ? 32.552  22.393  29.813  1.00 27.91 ? 120 GLN B O     1 
ATOM   3200 C CB    . GLN B 1 120 ? 30.341  20.649  31.595  1.00 32.75 ? 120 GLN B CB    1 
ATOM   3201 C CG    . GLN B 1 120 ? 30.348  19.682  32.762  1.00 32.08 ? 120 GLN B CG    1 
ATOM   3202 C CD    . GLN B 1 120 ? 29.219  18.751  32.755  1.00 33.08 ? 120 GLN B CD    1 
ATOM   3203 O OE1   . GLN B 1 120 ? 28.133  19.077  32.290  1.00 30.97 ? 120 GLN B OE1   1 
ATOM   3204 N NE2   . GLN B 1 120 ? 29.452  17.550  33.287  1.00 33.26 ? 120 GLN B NE2   1 
ATOM   3205 N N     . ILE B 1 121 ? 30.638  23.458  30.295  1.00 26.46 ? 121 ILE B N     1 
ATOM   3206 C CA    . ILE B 1 121 ? 30.657  24.336  29.137  1.00 27.35 ? 121 ILE B CA    1 
ATOM   3207 C C     . ILE B 1 121 ? 31.983  25.177  29.168  1.00 28.23 ? 121 ILE B C     1 
ATOM   3208 O O     . ILE B 1 121 ? 32.702  25.278  28.184  1.00 26.46 ? 121 ILE B O     1 
ATOM   3209 C CB    . ILE B 1 121 ? 29.420  25.294  29.219  1.00 29.70 ? 121 ILE B CB    1 
ATOM   3210 C CG1   . ILE B 1 121 ? 28.107  24.525  28.929  1.00 28.15 ? 121 ILE B CG1   1 
ATOM   3211 C CG2   . ILE B 1 121 ? 29.546  26.516  28.206  1.00 31.03 ? 121 ILE B CG2   1 
ATOM   3212 C CD1   . ILE B 1 121 ? 26.862  25.371  29.267  1.00 26.13 ? 121 ILE B CD1   1 
ATOM   3213 N N     . ALA B 1 122 ? 32.288  25.745  30.315  1.00 29.40 ? 122 ALA B N     1 
ATOM   3214 C CA    . ALA B 1 122 ? 33.484  26.599  30.464  1.00 31.12 ? 122 ALA B CA    1 
ATOM   3215 C C     . ALA B 1 122 ? 34.743  25.826  30.275  1.00 32.08 ? 122 ALA B C     1 
ATOM   3216 O O     . ALA B 1 122 ? 35.713  26.322  29.655  1.00 32.11 ? 122 ALA B O     1 
ATOM   3217 C CB    . ALA B 1 122 ? 33.500  27.281  31.830  1.00 29.59 ? 122 ALA B CB    1 
ATOM   3218 N N     . THR B 1 123 ? 34.746  24.594  30.792  1.00 30.02 ? 123 THR B N     1 
ATOM   3219 C CA    . THR B 1 123 ? 35.930  23.769  30.653  1.00 30.14 ? 123 THR B CA    1 
ATOM   3220 C C     . THR B 1 123 ? 36.177  23.412  29.187  1.00 29.98 ? 123 THR B C     1 
ATOM   3221 O O     . THR B 1 123 ? 37.322  23.464  28.699  1.00 29.06 ? 123 THR B O     1 
ATOM   3222 C CB    . THR B 1 123 ? 35.804  22.481  31.523  1.00 30.40 ? 123 THR B CB    1 
ATOM   3223 O OG1   . THR B 1 123 ? 35.601  22.875  32.892  1.00 32.64 ? 123 THR B OG1   1 
ATOM   3224 C CG2   . THR B 1 123 ? 37.036  21.598  31.415  1.00 30.29 ? 123 THR B CG2   1 
ATOM   3225 N N     . ILE B 1 124 ? 35.109  23.063  28.459  1.00 27.61 ? 124 ILE B N     1 
ATOM   3226 C CA    . ILE B 1 124 ? 35.260  22.683  27.082  1.00 26.36 ? 124 ILE B CA    1 
ATOM   3227 C C     . ILE B 1 124 ? 35.650  23.877  26.249  1.00 27.56 ? 124 ILE B C     1 
ATOM   3228 O O     . ILE B 1 124 ? 36.571  23.804  25.426  1.00 28.94 ? 124 ILE B O     1 
ATOM   3229 C CB    . ILE B 1 124 ? 33.962  22.060  26.520  1.00 26.44 ? 124 ILE B CB    1 
ATOM   3230 C CG1   . ILE B 1 124 ? 33.748  20.656  27.191  1.00 28.75 ? 124 ILE B CG1   1 
ATOM   3231 C CG2   . ILE B 1 124 ? 34.120  21.877  24.963  1.00 24.11 ? 124 ILE B CG2   1 
ATOM   3232 C CD1   . ILE B 1 124 ? 32.236  20.125  27.204  1.00 28.96 ? 124 ILE B CD1   1 
ATOM   3233 N N     . LEU B 1 125 ? 34.971  24.986  26.479  1.00 26.62 ? 125 LEU B N     1 
ATOM   3234 C CA    . LEU B 1 125 ? 35.288  26.186  25.715  1.00 26.28 ? 125 LEU B CA    1 
ATOM   3235 C C     . LEU B 1 125 ? 36.736  26.620  25.982  1.00 26.65 ? 125 LEU B C     1 
ATOM   3236 O O     . LEU B 1 125 ? 37.409  27.035  25.060  1.00 26.12 ? 125 LEU B O     1 
ATOM   3237 C CB    . LEU B 1 125 ? 34.368  27.312  26.096  1.00 25.38 ? 125 LEU B CB    1 
ATOM   3238 C CG    . LEU B 1 125 ? 32.910  27.217  25.537  1.00 26.95 ? 125 LEU B CG    1 
ATOM   3239 C CD1   . LEU B 1 125 ? 32.023  28.274  26.129  1.00 25.46 ? 125 LEU B CD1   1 
ATOM   3240 C CD2   . LEU B 1 125 ? 32.936  27.364  24.040  1.00 26.06 ? 125 LEU B CD2   1 
ATOM   3241 N N     . ARG B 1 126 ? 37.184  26.527  27.224  1.00 27.55 ? 126 ARG B N     1 
ATOM   3242 C CA    . ARG B 1 126 ? 38.570  26.940  27.532  1.00 29.48 ? 126 ARG B CA    1 
ATOM   3243 C C     . ARG B 1 126 ? 39.554  26.146  26.685  1.00 30.09 ? 126 ARG B C     1 
ATOM   3244 O O     . ARG B 1 126 ? 40.498  26.714  26.090  1.00 29.87 ? 126 ARG B O     1 
ATOM   3245 C CB    . ARG B 1 126 ? 38.897  26.740  29.003  1.00 29.04 ? 126 ARG B CB    1 
ATOM   3246 C CG    . ARG B 1 126 ? 40.329  27.297  29.378  1.00 30.12 ? 126 ARG B CG    1 
ATOM   3247 C CD    . ARG B 1 126 ? 40.557  27.068  30.868  1.00 29.95 ? 126 ARG B CD    1 
ATOM   3248 N NE    . ARG B 1 126 ? 40.586  25.627  31.008  1.00 32.09 ? 126 ARG B NE    1 
ATOM   3249 C CZ    . ARG B 1 126 ? 40.615  24.935  32.138  1.00 33.91 ? 126 ARG B CZ    1 
ATOM   3250 N NH1   . ARG B 1 126 ? 40.609  25.529  33.295  1.00 34.85 ? 126 ARG B NH1   1 
ATOM   3251 N NH2   . ARG B 1 126 ? 40.699  23.592  32.075  1.00 37.28 ? 126 ARG B NH2   1 
ATOM   3252 N N     . GLU B 1 127 ? 39.345  24.816  26.605  1.00 28.61 ? 127 GLU B N     1 
ATOM   3253 C CA    . GLU B 1 127 ? 40.215  24.005  25.787  1.00 27.81 ? 127 GLU B CA    1 
ATOM   3254 C C     . GLU B 1 127 ? 40.157  24.284  24.276  1.00 28.23 ? 127 GLU B C     1 
ATOM   3255 O O     . GLU B 1 127 ? 41.207  24.273  23.577  1.00 28.82 ? 127 GLU B O     1 
ATOM   3256 C CB    . GLU B 1 127 ? 39.981  22.488  26.046  1.00 28.70 ? 127 GLU B CB    1 
ATOM   3257 C CG    . GLU B 1 127 ? 40.209  22.049  27.472  1.00 29.27 ? 127 GLU B CG    1 
ATOM   3258 C CD    . GLU B 1 127 ? 41.616  22.336  28.011  1.00 33.36 ? 127 GLU B CD    1 
ATOM   3259 O OE1   . GLU B 1 127 ? 41.666  23.243  28.904  1.00 30.96 ? 127 GLU B OE1   1 
ATOM   3260 O OE2   . GLU B 1 127 ? 42.606  21.670  27.528  1.00 31.30 ? 127 GLU B OE2   1 
ATOM   3261 N N     . ILE B 1 128 ? 38.960  24.561  23.761  1.00 25.78 ? 128 ILE B N     1 
ATOM   3262 C CA    . ILE B 1 128 ? 38.835  24.871  22.357  1.00 26.36 ? 128 ILE B CA    1 
ATOM   3263 C C     . ILE B 1 128 ? 39.611  26.164  22.127  1.00 28.62 ? 128 ILE B C     1 
ATOM   3264 O O     . ILE B 1 128 ? 40.343  26.268  21.127  1.00 29.40 ? 128 ILE B O     1 
ATOM   3265 C CB    . ILE B 1 128 ? 37.346  25.108  21.958  1.00 23.71 ? 128 ILE B CB    1 
ATOM   3266 C CG1   . ILE B 1 128 ? 36.583  23.790  22.120  1.00 25.37 ? 128 ILE B CG1   1 
ATOM   3267 C CG2   . ILE B 1 128 ? 37.251  25.666  20.506  1.00 25.92 ? 128 ILE B CG2   1 
ATOM   3268 C CD1   . ILE B 1 128 ? 35.019  23.939  22.031  1.00 22.04 ? 128 ILE B CD1   1 
ATOM   3269 N N     . LEU B 1 129 ? 39.454  27.121  23.060  1.00 29.86 ? 129 LEU B N     1 
ATOM   3270 C CA    . LEU B 1 129 ? 40.159  28.430  22.978  1.00 29.39 ? 129 LEU B CA    1 
ATOM   3271 C C     . LEU B 1 129 ? 41.686  28.228  22.935  1.00 31.02 ? 129 LEU B C     1 
ATOM   3272 O O     . LEU B 1 129 ? 42.370  28.958  22.246  1.00 31.49 ? 129 LEU B O     1 
ATOM   3273 C CB    . LEU B 1 129 ? 39.792  29.345  24.168  1.00 28.70 ? 129 LEU B CB    1 
ATOM   3274 C CG    . LEU B 1 129 ? 38.444  30.138  24.077  1.00 28.49 ? 129 LEU B CG    1 
ATOM   3275 C CD1   . LEU B 1 129 ? 38.024  30.722  25.438  1.00 27.41 ? 129 LEU B CD1   1 
ATOM   3276 C CD2   . LEU B 1 129 ? 38.546  31.221  23.010  1.00 29.05 ? 129 LEU B CD2   1 
ATOM   3277 N N     . LYS B 1 130 ? 42.224  27.252  23.667  1.00 33.47 ? 130 LYS B N     1 
ATOM   3278 C CA    . LYS B 1 130 ? 43.658  26.995  23.618  1.00 33.69 ? 130 LYS B CA    1 
ATOM   3279 C C     . LYS B 1 130 ? 44.036  26.522  22.235  1.00 34.98 ? 130 LYS B C     1 
ATOM   3280 O O     . LYS B 1 130 ? 45.089  26.881  21.747  1.00 35.93 ? 130 LYS B O     1 
ATOM   3281 C CB    . LYS B 1 130 ? 44.086  25.925  24.621  1.00 34.72 ? 130 LYS B CB    1 
ATOM   3282 C CG    . LYS B 1 130 ? 44.218  26.432  26.056  1.00 36.93 ? 130 LYS B CG    1 
ATOM   3283 C CD    . LYS B 1 130 ? 44.247  25.222  27.053  1.00 41.45 ? 130 LYS B CD    1 
ATOM   3284 C CE    . LYS B 1 130 ? 44.171  25.637  28.528  1.00 42.58 ? 130 LYS B CE    1 
ATOM   3285 N NZ    . LYS B 1 130 ? 43.964  24.443  29.429  1.00 42.56 ? 130 LYS B NZ    1 
ATOM   3286 N N     . GLY B 1 131 ? 43.196  25.695  21.598  1.00 33.81 ? 131 GLY B N     1 
ATOM   3287 C CA    . GLY B 1 131 ? 43.492  25.240  20.259  1.00 30.33 ? 131 GLY B CA    1 
ATOM   3288 C C     . GLY B 1 131 ? 43.345  26.385  19.247  1.00 31.12 ? 131 GLY B C     1 
ATOM   3289 O O     . GLY B 1 131 ? 44.115  26.449  18.290  1.00 30.50 ? 131 GLY B O     1 
ATOM   3290 N N     . LEU B 1 132 ? 42.371  27.281  19.424  1.00 29.68 ? 132 LEU B N     1 
ATOM   3291 C CA    . LEU B 1 132 ? 42.205  28.379  18.467  1.00 28.71 ? 132 LEU B CA    1 
ATOM   3292 C C     . LEU B 1 132 ? 43.376  29.307  18.622  1.00 30.70 ? 132 LEU B C     1 
ATOM   3293 O O     . LEU B 1 132 ? 43.878  29.814  17.617  1.00 30.64 ? 132 LEU B O     1 
ATOM   3294 C CB    . LEU B 1 132 ? 40.958  29.178  18.718  1.00 28.25 ? 132 LEU B CB    1 
ATOM   3295 C CG    . LEU B 1 132 ? 39.727  28.361  18.247  1.00 27.96 ? 132 LEU B CG    1 
ATOM   3296 C CD1   . LEU B 1 132 ? 38.499  29.164  18.397  1.00 29.89 ? 132 LEU B CD1   1 
ATOM   3297 C CD2   . LEU B 1 132 ? 39.928  27.928  16.813  1.00 28.92 ? 132 LEU B CD2   1 
ATOM   3298 N N     . ASP B 1 133 ? 43.790  29.537  19.868  1.00 31.32 ? 133 ASP B N     1 
ATOM   3299 C CA    . ASP B 1 133 ? 44.950  30.403  20.120  1.00 33.77 ? 133 ASP B CA    1 
ATOM   3300 C C     . ASP B 1 133 ? 46.163  29.794  19.405  1.00 34.98 ? 133 ASP B C     1 
ATOM   3301 O O     . ASP B 1 133 ? 46.916  30.496  18.725  1.00 35.27 ? 133 ASP B O     1 
ATOM   3302 C CB    . ASP B 1 133 ? 45.206  30.525  21.625  1.00 35.00 ? 133 ASP B CB    1 
ATOM   3303 C CG    . ASP B 1 133 ? 46.375  31.526  21.944  1.00 39.42 ? 133 ASP B CG    1 
ATOM   3304 O OD1   . ASP B 1 133 ? 46.327  32.700  21.498  1.00 36.97 ? 133 ASP B OD1   1 
ATOM   3305 O OD2   . ASP B 1 133 ? 47.320  31.106  22.622  1.00 40.84 ? 133 ASP B OD2   1 
ATOM   3306 N N     . TYR B 1 134 ? 46.386  28.492  19.567  1.00 33.13 ? 134 TYR B N     1 
ATOM   3307 C CA    . TYR B 1 134 ? 47.482  27.847  18.865  1.00 32.33 ? 134 TYR B CA    1 
ATOM   3308 C C     . TYR B 1 134 ? 47.386  28.058  17.327  1.00 34.29 ? 134 TYR B C     1 
ATOM   3309 O O     . TYR B 1 134 ? 48.364  28.511  16.672  1.00 33.51 ? 134 TYR B O     1 
ATOM   3310 C CB    . TYR B 1 134 ? 47.533  26.320  19.155  1.00 31.06 ? 134 TYR B CB    1 
ATOM   3311 C CG    . TYR B 1 134 ? 48.513  25.629  18.229  1.00 33.38 ? 134 TYR B CG    1 
ATOM   3312 C CD1   . TYR B 1 134 ? 49.911  25.752  18.430  1.00 33.34 ? 134 TYR B CD1   1 
ATOM   3313 C CD2   . TYR B 1 134 ? 48.076  24.925  17.107  1.00 30.96 ? 134 TYR B CD2   1 
ATOM   3314 C CE1   . TYR B 1 134 ? 50.822  25.187  17.510  1.00 32.41 ? 134 TYR B CE1   1 
ATOM   3315 C CE2   . TYR B 1 134 ? 48.974  24.328  16.200  1.00 30.77 ? 134 TYR B CE2   1 
ATOM   3316 C CZ    . TYR B 1 134 ? 50.365  24.479  16.422  1.00 33.61 ? 134 TYR B CZ    1 
ATOM   3317 O OH    . TYR B 1 134 ? 51.248  23.901  15.535  1.00 33.81 ? 134 TYR B OH    1 
ATOM   3318 N N     . LEU B 1 135 ? 46.214  27.774  16.740  1.00 32.23 ? 135 LEU B N     1 
ATOM   3319 C CA    . LEU B 1 135 ? 46.049  27.905  15.315  1.00 30.43 ? 135 LEU B CA    1 
ATOM   3320 C C     . LEU B 1 135 ? 46.240  29.333  14.784  1.00 30.46 ? 135 LEU B C     1 
ATOM   3321 O O     . LEU B 1 135 ? 46.917  29.554  13.780  1.00 29.04 ? 135 LEU B O     1 
ATOM   3322 C CB    . LEU B 1 135 ? 44.659  27.394  14.877  1.00 30.95 ? 135 LEU B CB    1 
ATOM   3323 C CG    . LEU B 1 135 ? 44.462  25.854  14.990  1.00 28.72 ? 135 LEU B CG    1 
ATOM   3324 C CD1   . LEU B 1 135 ? 42.988  25.504  14.646  1.00 31.25 ? 135 LEU B CD1   1 
ATOM   3325 C CD2   . LEU B 1 135 ? 45.404  25.117  14.023  1.00 26.27 ? 135 LEU B CD2   1 
ATOM   3326 N N     . HIS B 1 136 ? 45.640  30.279  15.476  1.00 30.90 ? 136 HIS B N     1 
ATOM   3327 C CA    . HIS B 1 136 ? 45.680  31.670  15.067  1.00 33.98 ? 136 HIS B CA    1 
ATOM   3328 C C     . HIS B 1 136 ? 47.103  32.233  15.187  1.00 36.00 ? 136 HIS B C     1 
ATOM   3329 O O     . HIS B 1 136 ? 47.469  33.089  14.388  1.00 36.67 ? 136 HIS B O     1 
ATOM   3330 C CB    . HIS B 1 136 ? 44.668  32.463  15.891  1.00 31.96 ? 136 HIS B CB    1 
ATOM   3331 C CG    . HIS B 1 136 ? 43.235  32.043  15.648  1.00 30.74 ? 136 HIS B CG    1 
ATOM   3332 N ND1   . HIS B 1 136 ? 42.178  32.525  16.383  1.00 33.51 ? 136 HIS B ND1   1 
ATOM   3333 C CD2   . HIS B 1 136 ? 42.700  31.184  14.750  1.00 30.96 ? 136 HIS B CD2   1 
ATOM   3334 C CE1   . HIS B 1 136 ? 41.049  31.994  15.942  1.00 31.33 ? 136 HIS B CE1   1 
ATOM   3335 N NE2   . HIS B 1 136 ? 41.337  31.179  14.949  1.00 31.38 ? 136 HIS B NE2   1 
ATOM   3336 N N     . SER B 1 137 ? 47.877  31.709  16.144  1.00 36.95 ? 137 SER B N     1 
ATOM   3337 C CA    . SER B 1 137 ? 49.273  32.129  16.374  1.00 39.86 ? 137 SER B CA    1 
ATOM   3338 C C     . SER B 1 137 ? 50.151  31.607  15.261  1.00 41.65 ? 137 SER B C     1 
ATOM   3339 O O     . SER B 1 137 ? 51.290  32.067  15.133  1.00 42.65 ? 137 SER B O     1 
ATOM   3340 C CB    . SER B 1 137 ? 49.845  31.557  17.672  1.00 38.73 ? 137 SER B CB    1 
ATOM   3341 O OG    . SER B 1 137 ? 50.180  30.163  17.546  1.00 40.15 ? 137 SER B OG    1 
ATOM   3342 N N     . GLU B 1 138 ? 49.645  30.597  14.528  1.00 41.49 ? 138 GLU B N     1 
ATOM   3343 C CA    . GLU B 1 138 ? 50.334  29.946  13.406  1.00 41.35 ? 138 GLU B CA    1 
ATOM   3344 C C     . GLU B 1 138 ? 49.724  30.378  12.092  1.00 41.47 ? 138 GLU B C     1 
ATOM   3345 O O     . GLU B 1 138 ? 49.965  29.756  11.069  1.00 42.65 ? 138 GLU B O     1 
ATOM   3346 C CB    . GLU B 1 138 ? 50.219  28.411  13.492  1.00 41.41 ? 138 GLU B CB    1 
ATOM   3347 C CG    . GLU B 1 138 ? 50.979  27.754  14.647  1.00 40.68 ? 138 GLU B CG    1 
ATOM   3348 C CD    . GLU B 1 138 ? 52.506  27.680  14.407  1.00 43.23 ? 138 GLU B CD    1 
ATOM   3349 O OE1   . GLU B 1 138 ? 52.912  27.187  13.349  1.00 43.06 ? 138 GLU B OE1   1 
ATOM   3350 O OE2   . GLU B 1 138 ? 53.294  28.094  15.279  1.00 45.12 ? 138 GLU B OE2   1 
ATOM   3351 N N     . LYS B 1 139 ? 48.931  31.442  12.129  1.00 41.87 ? 139 LYS B N     1 
ATOM   3352 C CA    . LYS B 1 139 ? 48.247  31.981  10.962  1.00 42.08 ? 139 LYS B CA    1 
ATOM   3353 C C     . LYS B 1 139 ? 47.310  30.973  10.240  1.00 42.29 ? 139 LYS B C     1 
ATOM   3354 O O     . LYS B 1 139 ? 47.176  31.011  9.012   1.00 40.52 ? 139 LYS B O     1 
ATOM   3355 C CB    . LYS B 1 139 ? 49.274  32.583  9.985   1.00 44.80 ? 139 LYS B CB    1 
ATOM   3356 C CG    . LYS B 1 139 ? 49.997  33.857  10.499  1.00 45.83 ? 139 LYS B CG    1 
ATOM   3357 C CD    . LYS B 1 139 ? 49.182  35.151  10.196  1.00 49.39 ? 139 LYS B CD    1 
ATOM   3358 C CE    . LYS B 1 139 ? 49.903  36.489  10.582  1.00 49.37 ? 139 LYS B CE    1 
ATOM   3359 N NZ    . LYS B 1 139 ? 50.130  36.683  12.072  1.00 48.48 ? 139 LYS B NZ    1 
ATOM   3360 N N     . LYS B 1 140 ? 46.654  30.081  10.999  1.00 40.42 ? 140 LYS B N     1 
ATOM   3361 C CA    . LYS B 1 140 ? 45.707  29.154  10.389  1.00 39.80 ? 140 LYS B CA    1 
ATOM   3362 C C     . LYS B 1 140 ? 44.283  29.494  10.857  1.00 39.83 ? 140 LYS B C     1 
ATOM   3363 O O     . LYS B 1 140 ? 44.117  30.081  11.909  1.00 38.59 ? 140 LYS B O     1 
ATOM   3364 C CB    . LYS B 1 140 ? 46.057  27.716  10.746  1.00 40.06 ? 140 LYS B CB    1 
ATOM   3365 C CG    . LYS B 1 140 ? 47.434  27.293  10.195  1.00 41.46 ? 140 LYS B CG    1 
ATOM   3366 C CD    . LYS B 1 140 ? 47.662  25.776  10.198  1.00 44.34 ? 140 LYS B CD    1 
ATOM   3367 C CE    . LYS B 1 140 ? 49.033  25.370  9.540   1.00 46.15 ? 140 LYS B CE    1 
ATOM   3368 N NZ    . LYS B 1 140 ? 50.270  25.553  10.437  1.00 47.63 ? 140 LYS B NZ    1 
ATOM   3369 N N     . ILE B 1 141 ? 43.271  29.174  10.053  1.00 38.71 ? 141 ILE B N     1 
ATOM   3370 C CA    . ILE B 1 141 ? 41.882  29.436  10.431  1.00 39.66 ? 141 ILE B CA    1 
ATOM   3371 C C     . ILE B 1 141 ? 41.214  28.049  10.336  1.00 40.13 ? 141 ILE B C     1 
ATOM   3372 O O     . ILE B 1 141 ? 41.314  27.378  9.296   1.00 40.09 ? 141 ILE B O     1 
ATOM   3373 C CB    . ILE B 1 141 ? 41.146  30.323  9.421   1.00 40.08 ? 141 ILE B CB    1 
ATOM   3374 C CG1   . ILE B 1 141 ? 41.974  31.580  9.070   1.00 42.01 ? 141 ILE B CG1   1 
ATOM   3375 C CG2   . ILE B 1 141 ? 39.792  30.773  10.027  1.00 40.63 ? 141 ILE B CG2   1 
ATOM   3376 C CD1   . ILE B 1 141 ? 41.401  32.386  7.931   1.00 39.80 ? 141 ILE B CD1   1 
ATOM   3377 N N     . HIS B 1 142 ? 40.482  27.632  11.359  1.00 37.97 ? 142 HIS B N     1 
ATOM   3378 C CA    . HIS B 1 142 ? 39.876  26.301  11.260  1.00 36.14 ? 142 HIS B CA    1 
ATOM   3379 C C     . HIS B 1 142 ? 38.693  26.368  10.264  1.00 34.97 ? 142 HIS B C     1 
ATOM   3380 O O     . HIS B 1 142 ? 38.578  25.605  9.310   1.00 36.58 ? 142 HIS B O     1 
ATOM   3381 C CB    . HIS B 1 142 ? 39.474  25.838  12.696  1.00 35.17 ? 142 HIS B CB    1 
ATOM   3382 C CG    . HIS B 1 142 ? 38.963  24.420  12.769  1.00 32.14 ? 142 HIS B CG    1 
ATOM   3383 N ND1   . HIS B 1 142 ? 37.727  24.052  12.286  1.00 31.91 ? 142 HIS B ND1   1 
ATOM   3384 C CD2   . HIS B 1 142 ? 39.514  23.306  13.304  1.00 34.68 ? 142 HIS B CD2   1 
ATOM   3385 C CE1   . HIS B 1 142 ? 37.534  22.765  12.523  1.00 32.45 ? 142 HIS B CE1   1 
ATOM   3386 N NE2   . HIS B 1 142 ? 38.606  22.287  13.141  1.00 33.54 ? 142 HIS B NE2   1 
ATOM   3387 N N     . ARG B 1 143 ? 37.822  27.335  10.436  1.00 36.93 ? 143 ARG B N     1 
ATOM   3388 C CA    . ARG B 1 143 ? 36.691  27.467  9.521   1.00 37.95 ? 143 ARG B CA    1 
ATOM   3389 C C     . ARG B 1 143 ? 35.545  26.485  9.687   1.00 37.00 ? 143 ARG B C     1 
ATOM   3390 O O     . ARG B 1 143 ? 34.521  26.665  9.028   1.00 37.17 ? 143 ARG B O     1 
ATOM   3391 C CB    . ARG B 1 143 ? 37.155  27.429  8.057   1.00 43.21 ? 143 ARG B CB    1 
ATOM   3392 C CG    . ARG B 1 143 ? 38.050  28.605  7.675   1.00 44.52 ? 143 ARG B CG    1 
ATOM   3393 C CD    . ARG B 1 143 ? 38.625  28.276  6.354   1.00 48.48 ? 143 ARG B CD    1 
ATOM   3394 N NE    . ARG B 1 143 ? 38.473  29.363  5.413   1.00 52.18 ? 143 ARG B NE    1 
ATOM   3395 C CZ    . ARG B 1 143 ? 38.862  29.278  4.139   1.00 52.15 ? 143 ARG B CZ    1 
ATOM   3396 N NH1   . ARG B 1 143 ? 38.687  30.327  3.331   1.00 50.32 ? 143 ARG B NH1   1 
ATOM   3397 N NH2   . ARG B 1 143 ? 39.414  28.130  3.683   1.00 49.47 ? 143 ARG B NH2   1 
ATOM   3398 N N     . ASP B 1 144 ? 35.683  25.473  10.537  1.00 33.49 ? 144 ASP B N     1 
ATOM   3399 C CA    . ASP B 1 144 ? 34.526  24.582  10.781  1.00 34.12 ? 144 ASP B CA    1 
ATOM   3400 C C     . ASP B 1 144 ? 34.428  24.241  12.273  1.00 31.28 ? 144 ASP B C     1 
ATOM   3401 O O     . ASP B 1 144 ? 34.315  23.067  12.675  1.00 31.34 ? 144 ASP B O     1 
ATOM   3402 C CB    . ASP B 1 144 ? 34.611  23.305  9.929   1.00 34.70 ? 144 ASP B CB    1 
ATOM   3403 C CG    . ASP B 1 144 ? 33.232  22.627  9.723   1.00 37.33 ? 144 ASP B CG    1 
ATOM   3404 O OD1   . ASP B 1 144 ? 32.178  23.250  9.910   1.00 36.45 ? 144 ASP B OD1   1 
ATOM   3405 O OD2   . ASP B 1 144 ? 33.225  21.446  9.361   1.00 38.65 ? 144 ASP B OD2   1 
ATOM   3406 N N     . ILE B 1 145 ? 34.464  25.280  13.116  1.00 29.25 ? 145 ILE B N     1 
ATOM   3407 C CA    . ILE B 1 145 ? 34.407  25.065  14.557  1.00 26.16 ? 145 ILE B CA    1 
ATOM   3408 C C     . ILE B 1 145 ? 32.911  24.836  14.938  1.00 25.49 ? 145 ILE B C     1 
ATOM   3409 O O     . ILE B 1 145 ? 32.069  25.655  14.608  1.00 23.07 ? 145 ILE B O     1 
ATOM   3410 C CB    . ILE B 1 145 ? 34.906  26.303  15.326  1.00 27.55 ? 145 ILE B CB    1 
ATOM   3411 C CG1   . ILE B 1 145 ? 36.439  26.528  15.056  1.00 27.77 ? 145 ILE B CG1   1 
ATOM   3412 C CG2   . ILE B 1 145 ? 34.520  26.140  16.818  1.00 27.08 ? 145 ILE B CG2   1 
ATOM   3413 C CD1   . ILE B 1 145 ? 37.422  25.440  15.658  1.00 25.62 ? 145 ILE B CD1   1 
ATOM   3414 N N     . LYS B 1 146 ? 32.653  23.732  15.628  1.00 28.16 ? 146 LYS B N     1 
ATOM   3415 C CA    . LYS B 1 146 ? 31.312  23.354  16.095  1.00 30.67 ? 146 LYS B CA    1 
ATOM   3416 C C     . LYS B 1 146 ? 31.550  22.153  16.981  1.00 29.20 ? 146 LYS B C     1 
ATOM   3417 O O     . LYS B 1 146 ? 32.595  21.483  16.896  1.00 30.26 ? 146 LYS B O     1 
ATOM   3418 C CB    . LYS B 1 146 ? 30.379  23.069  14.889  1.00 29.96 ? 146 LYS B CB    1 
ATOM   3419 C CG    . LYS B 1 146 ? 30.803  21.861  14.013  1.00 33.20 ? 146 LYS B CG    1 
ATOM   3420 C CD    . LYS B 1 146 ? 29.807  21.772  12.792  1.00 34.89 ? 146 LYS B CD    1 
ATOM   3421 C CE    . LYS B 1 146 ? 30.044  20.560  11.901  1.00 36.05 ? 146 LYS B CE    1 
ATOM   3422 N NZ    . LYS B 1 146 ? 29.181  20.585  10.646  1.00 33.11 ? 146 LYS B NZ    1 
ATOM   3423 N N     . ALA B 1 147 ? 30.601  21.880  17.864  1.00 30.23 ? 147 ALA B N     1 
ATOM   3424 C CA    . ALA B 1 147 ? 30.735  20.821  18.827  1.00 28.26 ? 147 ALA B CA    1 
ATOM   3425 C C     . ALA B 1 147 ? 30.974  19.496  18.173  1.00 28.44 ? 147 ALA B C     1 
ATOM   3426 O O     . ALA B 1 147 ? 31.673  18.699  18.752  1.00 27.39 ? 147 ALA B O     1 
ATOM   3427 C CB    . ALA B 1 147 ? 29.495  20.785  19.752  1.00 27.96 ? 147 ALA B CB    1 
ATOM   3428 N N     . ALA B 1 148 ? 30.454  19.257  16.966  1.00 27.89 ? 148 ALA B N     1 
ATOM   3429 C CA    . ALA B 1 148 ? 30.693  17.910  16.328  1.00 29.58 ? 148 ALA B CA    1 
ATOM   3430 C C     . ALA B 1 148 ? 32.201  17.765  16.041  1.00 30.74 ? 148 ALA B C     1 
ATOM   3431 O O     . ALA B 1 148 ? 32.691  16.662  15.984  1.00 29.25 ? 148 ALA B O     1 
ATOM   3432 C CB    . ALA B 1 148 ? 29.911  17.757  14.980  1.00 30.27 ? 148 ALA B CB    1 
ATOM   3433 N N     . ASN B 1 149 ? 32.908  18.891  15.928  1.00 27.79 ? 149 ASN B N     1 
ATOM   3434 C CA    . ASN B 1 149 ? 34.365  18.845  15.602  1.00 30.93 ? 149 ASN B CA    1 
ATOM   3435 C C     . ASN B 1 149 ? 35.325  19.027  16.777  1.00 29.46 ? 149 ASN B C     1 
ATOM   3436 O O     . ASN B 1 149 ? 36.541  19.251  16.624  1.00 30.32 ? 149 ASN B O     1 
ATOM   3437 C CB    . ASN B 1 149 ? 34.655  19.820  14.457  1.00 31.06 ? 149 ASN B CB    1 
ATOM   3438 C CG    . ASN B 1 149 ? 34.055  19.333  13.124  1.00 32.68 ? 149 ASN B CG    1 
ATOM   3439 O OD1   . ASN B 1 149 ? 33.857  18.132  12.935  1.00 34.29 ? 149 ASN B OD1   1 
ATOM   3440 N ND2   . ASN B 1 149 ? 33.788  20.239  12.214  1.00 30.24 ? 149 ASN B ND2   1 
ATOM   3441 N N     . VAL B 1 150 ? 34.780  18.893  17.971  1.00 28.14 ? 150 VAL B N     1 
ATOM   3442 C CA    . VAL B 1 150 ? 35.610  18.980  19.154  1.00 30.34 ? 150 VAL B CA    1 
ATOM   3443 C C     . VAL B 1 150 ? 35.581  17.588  19.754  1.00 30.50 ? 150 VAL B C     1 
ATOM   3444 O O     . VAL B 1 150 ? 34.564  17.161  20.269  1.00 31.63 ? 150 VAL B O     1 
ATOM   3445 C CB    . VAL B 1 150 ? 35.043  20.004  20.100  1.00 30.03 ? 150 VAL B CB    1 
ATOM   3446 C CG1   . VAL B 1 150 ? 35.773  19.983  21.460  1.00 28.92 ? 150 VAL B CG1   1 
ATOM   3447 C CG2   . VAL B 1 150 ? 35.185  21.393  19.410  1.00 25.44 ? 150 VAL B CG2   1 
ATOM   3448 N N     . LEU B 1 151 ? 36.684  16.872  19.690  1.00 30.77 ? 151 LEU B N     1 
ATOM   3449 C CA    . LEU B 1 151 ? 36.750  15.503  20.225  1.00 31.74 ? 151 LEU B CA    1 
ATOM   3450 C C     . LEU B 1 151 ? 37.478  15.405  21.557  1.00 33.60 ? 151 LEU B C     1 
ATOM   3451 O O     . LEU B 1 151 ? 38.386  16.215  21.879  1.00 33.65 ? 151 LEU B O     1 
ATOM   3452 C CB    . LEU B 1 151 ? 37.443  14.571  19.193  1.00 30.43 ? 151 LEU B CB    1 
ATOM   3453 C CG    . LEU B 1 151 ? 36.825  14.614  17.801  1.00 33.26 ? 151 LEU B CG    1 
ATOM   3454 C CD1   . LEU B 1 151 ? 37.578  13.607  16.867  1.00 34.39 ? 151 LEU B CD1   1 
ATOM   3455 C CD2   . LEU B 1 151 ? 35.314  14.285  17.874  1.00 33.85 ? 151 LEU B CD2   1 
ATOM   3456 N N     . LEU B 1 152 ? 37.116  14.382  22.325  1.00 31.11 ? 152 LEU B N     1 
ATOM   3457 C CA    . LEU B 1 152 ? 37.696  14.203  23.628  1.00 31.47 ? 152 LEU B CA    1 
ATOM   3458 C C     . LEU B 1 152 ? 38.307  12.823  23.804  1.00 34.11 ? 152 LEU B C     1 
ATOM   3459 O O     . LEU B 1 152 ? 37.864  11.852  23.196  1.00 30.01 ? 152 LEU B O     1 
ATOM   3460 C CB    . LEU B 1 152 ? 36.644  14.428  24.715  1.00 33.02 ? 152 LEU B CB    1 
ATOM   3461 C CG    . LEU B 1 152 ? 36.225  15.883  24.943  1.00 32.74 ? 152 LEU B CG    1 
ATOM   3462 C CD1   . LEU B 1 152 ? 35.193  16.202  23.890  1.00 31.84 ? 152 LEU B CD1   1 
ATOM   3463 C CD2   . LEU B 1 152 ? 35.711  16.106  26.376  1.00 31.04 ? 152 LEU B CD2   1 
ATOM   3464 N N     . SER B 1 153 ? 39.345  12.760  24.619  1.00 34.54 ? 153 SER B N     1 
ATOM   3465 C CA    . SER B 1 153 ? 39.988  11.480  24.911  1.00 35.74 ? 153 SER B CA    1 
ATOM   3466 C C     . SER B 1 153 ? 39.162  10.858  26.066  1.00 37.19 ? 153 SER B C     1 
ATOM   3467 O O     . SER B 1 153 ? 38.378  11.539  26.719  1.00 36.22 ? 153 SER B O     1 
ATOM   3468 C CB    . SER B 1 153 ? 41.392  11.735  25.427  1.00 31.58 ? 153 SER B CB    1 
ATOM   3469 O OG    . SER B 1 153 ? 41.297  12.034  26.786  1.00 34.41 ? 153 SER B OG    1 
ATOM   3470 N N     . GLU B 1 154 ? 39.349  9.579   26.361  1.00 39.52 ? 154 GLU B N     1 
ATOM   3471 C CA    . GLU B 1 154 ? 38.588  9.010   27.475  1.00 42.55 ? 154 GLU B CA    1 
ATOM   3472 C C     . GLU B 1 154 ? 38.985  9.629   28.806  1.00 41.98 ? 154 GLU B C     1 
ATOM   3473 O O     . GLU B 1 154 ? 38.245  9.512   29.767  1.00 42.41 ? 154 GLU B O     1 
ATOM   3474 C CB    . GLU B 1 154 ? 38.721  7.471   27.521  1.00 44.63 ? 154 GLU B CB    1 
ATOM   3475 C CG    . GLU B 1 154 ? 37.974  6.805   26.402  1.00 48.60 ? 154 GLU B CG    1 
ATOM   3476 C CD    . GLU B 1 154 ? 38.487  5.389   26.113  1.00 53.98 ? 154 GLU B CD    1 
ATOM   3477 O OE1   . GLU B 1 154 ? 38.777  5.104   24.922  1.00 54.32 ? 154 GLU B OE1   1 
ATOM   3478 O OE2   . GLU B 1 154 ? 38.612  4.580   27.074  1.00 54.48 ? 154 GLU B OE2   1 
ATOM   3479 N N     . HIS B 1 155 ? 40.125  10.306  28.881  1.00 41.15 ? 155 HIS B N     1 
ATOM   3480 C CA    . HIS B 1 155 ? 40.476  10.938  30.129  1.00 41.01 ? 155 HIS B CA    1 
ATOM   3481 C C     . HIS B 1 155 ? 40.072  12.420  30.183  1.00 40.12 ? 155 HIS B C     1 
ATOM   3482 O O     . HIS B 1 155 ? 40.494  13.146  31.090  1.00 37.87 ? 155 HIS B O     1 
ATOM   3483 C CB    . HIS B 1 155 ? 41.966  10.801  30.416  1.00 46.21 ? 155 HIS B CB    1 
ATOM   3484 C CG    . HIS B 1 155 ? 42.392  9.400   30.713  1.00 50.89 ? 155 HIS B CG    1 
ATOM   3485 N ND1   . HIS B 1 155 ? 41.498  8.415   31.078  1.00 53.45 ? 155 HIS B ND1   1 
ATOM   3486 C CD2   . HIS B 1 155 ? 43.619  8.821   30.725  1.00 53.52 ? 155 HIS B CD2   1 
ATOM   3487 C CE1   . HIS B 1 155 ? 42.154  7.286   31.299  1.00 54.76 ? 155 HIS B CE1   1 
ATOM   3488 N NE2   . HIS B 1 155 ? 43.441  7.506   31.092  1.00 54.88 ? 155 HIS B NE2   1 
ATOM   3489 N N     . GLY B 1 156 ? 39.234  12.853  29.230  1.00 38.08 ? 156 GLY B N     1 
ATOM   3490 C CA    . GLY B 1 156 ? 38.779  14.231  29.234  1.00 37.25 ? 156 GLY B CA    1 
ATOM   3491 C C     . GLY B 1 156 ? 39.565  15.308  28.483  1.00 38.67 ? 156 GLY B C     1 
ATOM   3492 O O     . GLY B 1 156 ? 39.149  16.482  28.515  1.00 38.70 ? 156 GLY B O     1 
ATOM   3493 N N     . GLU B 1 157 ? 40.687  14.979  27.837  1.00 36.37 ? 157 GLU B N     1 
ATOM   3494 C CA    . GLU B 1 157 ? 41.364  16.028  27.063  1.00 37.10 ? 157 GLU B CA    1 
ATOM   3495 C C     . GLU B 1 157 ? 40.492  16.399  25.849  1.00 34.13 ? 157 GLU B C     1 
ATOM   3496 O O     . GLU B 1 157 ? 39.785  15.562  25.289  1.00 34.45 ? 157 GLU B O     1 
ATOM   3497 C CB    . GLU B 1 157 ? 42.765  15.570  26.639  1.00 38.78 ? 157 GLU B CB    1 
ATOM   3498 C CG    . GLU B 1 157 ? 43.638  15.367  27.849  1.00 40.87 ? 157 GLU B CG    1 
ATOM   3499 C CD    . GLU B 1 157 ? 44.120  13.942  27.923  1.00 46.29 ? 157 GLU B CD    1 
ATOM   3500 O OE1   . GLU B 1 157 ? 44.561  13.474  26.862  1.00 48.34 ? 157 GLU B OE1   1 
ATOM   3501 O OE2   . GLU B 1 157 ? 44.075  13.300  29.012  1.00 48.14 ? 157 GLU B OE2   1 
ATOM   3502 N N     . VAL B 1 158 ? 40.534  17.666  25.472  1.00 32.82 ? 158 VAL B N     1 
ATOM   3503 C CA    . VAL B 1 158 ? 39.749  18.233  24.394  1.00 32.06 ? 158 VAL B CA    1 
ATOM   3504 C C     . VAL B 1 158 ? 40.576  18.735  23.213  1.00 33.94 ? 158 VAL B C     1 
ATOM   3505 O O     . VAL B 1 158 ? 41.400  19.621  23.358  1.00 36.08 ? 158 VAL B O     1 
ATOM   3506 C CB    . VAL B 1 158 ? 38.937  19.412  24.921  1.00 30.67 ? 158 VAL B CB    1 
ATOM   3507 C CG1   . VAL B 1 158 ? 38.028  19.983  23.790  1.00 32.63 ? 158 VAL B CG1   1 
ATOM   3508 C CG2   . VAL B 1 158 ? 38.074  18.973  26.135  1.00 30.72 ? 158 VAL B CG2   1 
ATOM   3509 N N     . LYS B 1 159 ? 40.317  18.219  22.031  1.00 33.91 ? 159 LYS B N     1 
ATOM   3510 C CA    . LYS B 1 159 ? 41.079  18.645  20.864  1.00 33.71 ? 159 LYS B CA    1 
ATOM   3511 C C     . LYS B 1 159 ? 40.228  18.970  19.678  1.00 33.90 ? 159 LYS B C     1 
ATOM   3512 O O     . LYS B 1 159 ? 39.112  18.440  19.537  1.00 32.85 ? 159 LYS B O     1 
ATOM   3513 C CB    . LYS B 1 159 ? 42.111  17.580  20.435  1.00 33.22 ? 159 LYS B CB    1 
ATOM   3514 C CG    . LYS B 1 159 ? 43.251  17.352  21.432  1.00 34.75 ? 159 LYS B CG    1 
ATOM   3515 C CD    . LYS B 1 159 ? 43.156  15.942  21.943  1.00 32.73 ? 159 LYS B CD    1 
ATOM   3516 C CE    . LYS B 1 159 ? 44.133  15.613  23.044  1.00 30.66 ? 159 LYS B CE    1 
ATOM   3517 N NZ    . LYS B 1 159 ? 45.533  15.517  22.580  1.00 28.27 ? 159 LYS B NZ    1 
ATOM   3518 N N     . LEU B 1 160 ? 40.767  19.857  18.830  1.00 31.25 ? 160 LEU B N     1 
ATOM   3519 C CA    . LEU B 1 160 ? 40.119  20.238  17.593  1.00 33.47 ? 160 LEU B CA    1 
ATOM   3520 C C     . LEU B 1 160 ? 40.361  19.138  16.551  1.00 30.76 ? 160 LEU B C     1 
ATOM   3521 O O     . LEU B 1 160 ? 41.414  18.565  16.496  1.00 31.17 ? 160 LEU B O     1 
ATOM   3522 C CB    . LEU B 1 160 ? 40.638  21.632  17.071  1.00 31.22 ? 160 LEU B CB    1 
ATOM   3523 C CG    . LEU B 1 160 ? 40.538  22.758  18.124  1.00 34.90 ? 160 LEU B CG    1 
ATOM   3524 C CD1   . LEU B 1 160 ? 41.099  24.072  17.565  1.00 33.97 ? 160 LEU B CD1   1 
ATOM   3525 C CD2   . LEU B 1 160 ? 39.066  22.977  18.517  1.00 34.40 ? 160 LEU B CD2   1 
ATOM   3526 N N     . ALA B 1 161 ? 39.352  18.861  15.743  1.00 31.42 ? 161 ALA B N     1 
ATOM   3527 C CA    . ALA B 1 161 ? 39.442  17.875  14.669  1.00 31.49 ? 161 ALA B CA    1 
ATOM   3528 C C     . ALA B 1 161 ? 38.745  18.438  13.425  1.00 33.20 ? 161 ALA B C     1 
ATOM   3529 O O     . ALA B 1 161 ? 38.192  19.555  13.461  1.00 32.57 ? 161 ALA B O     1 
ATOM   3530 C CB    . ALA B 1 161 ? 38.773  16.525  15.108  1.00 33.35 ? 161 ALA B CB    1 
ATOM   3531 N N     . ASP B 1 162 ? 38.779  17.672  12.331  1.00 33.68 ? 162 ASP B N     1 
ATOM   3532 C CA    . ASP B 1 162 ? 38.148  18.001  11.068  1.00 36.57 ? 162 ASP B CA    1 
ATOM   3533 C C     . ASP B 1 162 ? 38.550  19.345  10.414  1.00 38.30 ? 162 ASP B C     1 
ATOM   3534 O O     . ASP B 1 162 ? 37.763  20.271  10.298  1.00 37.28 ? 162 ASP B O     1 
ATOM   3535 C CB    . ASP B 1 162 ? 36.617  17.872  11.226  1.00 41.29 ? 162 ASP B CB    1 
ATOM   3536 C CG    . ASP B 1 162 ? 35.853  17.923  9.863   1.00 47.11 ? 162 ASP B CG    1 
ATOM   3537 O OD1   . ASP B 1 162 ? 36.147  18.835  9.054   1.00 50.95 ? 162 ASP B OD1   1 
ATOM   3538 O OD2   . ASP B 1 162 ? 34.955  17.074  9.599   1.00 48.14 ? 162 ASP B OD2   1 
ATOM   3539 N N     . PHE B 1 163 ? 39.783  19.361  9.906   1.00 38.19 ? 163 PHE B N     1 
ATOM   3540 C CA    . PHE B 1 163 ? 40.418  20.498  9.223   1.00 40.41 ? 163 PHE B CA    1 
ATOM   3541 C C     . PHE B 1 163 ? 40.144  20.555  7.701   1.00 42.92 ? 163 PHE B C     1 
ATOM   3542 O O     . PHE B 1 163 ? 40.844  21.237  6.919   1.00 42.56 ? 163 PHE B O     1 
ATOM   3543 C CB    . PHE B 1 163 ? 41.930  20.401  9.524   1.00 37.04 ? 163 PHE B CB    1 
ATOM   3544 C CG    . PHE B 1 163 ? 42.282  20.890  10.896  1.00 34.85 ? 163 PHE B CG    1 
ATOM   3545 C CD1   . PHE B 1 163 ? 42.833  22.155  11.066  1.00 35.77 ? 163 PHE B CD1   1 
ATOM   3546 C CD2   . PHE B 1 163 ? 41.933  20.146  12.041  1.00 34.88 ? 163 PHE B CD2   1 
ATOM   3547 C CE1   . PHE B 1 163 ? 43.023  22.684  12.367  1.00 34.68 ? 163 PHE B CE1   1 
ATOM   3548 C CE2   . PHE B 1 163 ? 42.116  20.652  13.352  1.00 33.89 ? 163 PHE B CE2   1 
ATOM   3549 C CZ    . PHE B 1 163 ? 42.667  21.939  13.522  1.00 33.43 ? 163 PHE B CZ    1 
ATOM   3550 N N     . GLY B 1 164 ? 39.070  19.885  7.294   1.00 44.10 ? 164 GLY B N     1 
ATOM   3551 C CA    . GLY B 1 164 ? 38.712  19.809  5.887   1.00 44.69 ? 164 GLY B CA    1 
ATOM   3552 C C     . GLY B 1 164 ? 38.557  21.129  5.161   1.00 46.01 ? 164 GLY B C     1 
ATOM   3553 O O     . GLY B 1 164 ? 38.749  21.196  3.947   1.00 46.99 ? 164 GLY B O     1 
ATOM   3554 N N     . VAL B 1 165 ? 38.188  22.195  5.857   1.00 45.77 ? 165 VAL B N     1 
ATOM   3555 C CA    . VAL B 1 165 ? 38.075  23.420  5.136   1.00 44.92 ? 165 VAL B CA    1 
ATOM   3556 C C     . VAL B 1 165 ? 38.977  24.464  5.727   1.00 45.53 ? 165 VAL B C     1 
ATOM   3557 O O     . VAL B 1 165 ? 38.837  25.652  5.407   1.00 44.74 ? 165 VAL B O     1 
ATOM   3558 C CB    . VAL B 1 165 ? 36.610  23.911  5.074   1.00 45.30 ? 165 VAL B CB    1 
ATOM   3559 C CG1   . VAL B 1 165 ? 35.782  22.887  4.294   1.00 45.12 ? 165 VAL B CG1   1 
ATOM   3560 C CG2   . VAL B 1 165 ? 36.012  24.113  6.486   1.00 45.29 ? 165 VAL B CG2   1 
ATOM   3561 N N     . ALA B 1 166 ? 39.941  24.029  6.541   1.00 45.96 ? 166 ALA B N     1 
ATOM   3562 C CA    . ALA B 1 166 ? 40.854  24.992  7.190   1.00 47.38 ? 166 ALA B CA    1 
ATOM   3563 C C     . ALA B 1 166 ? 41.584  25.875  6.168   1.00 50.26 ? 166 ALA B C     1 
ATOM   3564 O O     . ALA B 1 166 ? 41.900  25.411  5.057   1.00 49.78 ? 166 ALA B O     1 
ATOM   3565 C CB    . ALA B 1 166 ? 41.854  24.260  8.035   1.00 47.29 ? 166 ALA B CB    1 
ATOM   3566 N N     . GLY B 1 167 ? 41.834  27.140  6.539   1.00 52.03 ? 167 GLY B N     1 
ATOM   3567 C CA    . GLY B 1 167 ? 42.527  28.074  5.657   1.00 54.46 ? 167 GLY B CA    1 
ATOM   3568 C C     . GLY B 1 167 ? 43.890  28.544  6.183   1.00 56.99 ? 167 GLY B C     1 
ATOM   3569 O O     . GLY B 1 167 ? 44.176  28.442  7.396   1.00 55.81 ? 167 GLY B O     1 
ATOM   3570 N N     . GLN B 1 168 ? 44.750  29.028  5.283   1.00 58.53 ? 168 GLN B N     1 
ATOM   3571 C CA    . GLN B 1 168 ? 46.065  29.535  5.703   1.00 61.56 ? 168 GLN B CA    1 
ATOM   3572 C C     . GLN B 1 168 ? 46.175  31.010  5.331   1.00 64.11 ? 168 GLN B C     1 
ATOM   3573 O O     . GLN B 1 168 ? 46.048  31.377  4.153   1.00 63.63 ? 168 GLN B O     1 
ATOM   3574 C CB    . GLN B 1 168 ? 47.223  28.781  5.024   1.00 60.96 ? 168 GLN B CB    1 
ATOM   3575 C CG    . GLN B 1 168 ? 47.227  27.294  5.229   1.00 61.11 ? 168 GLN B CG    1 
ATOM   3576 C CD    . GLN B 1 168 ? 48.271  26.849  6.235   1.00 60.71 ? 168 GLN B CD    1 
ATOM   3577 O OE1   . GLN B 1 168 ? 48.844  27.675  6.977   1.00 58.31 ? 168 GLN B OE1   1 
ATOM   3578 N NE2   . GLN B 1 168 ? 48.524  25.537  6.270   1.00 59.29 ? 168 GLN B NE2   1 
ATOM   3579 N N     . LEU B 1 169 ? 46.391  31.847  6.346   1.00 67.40 ? 169 LEU B N     1 
ATOM   3580 C CA    . LEU B 1 169 ? 46.574  33.284  6.166   1.00 70.94 ? 169 LEU B CA    1 
ATOM   3581 C C     . LEU B 1 169 ? 48.074  33.543  6.047   1.00 75.26 ? 169 LEU B C     1 
ATOM   3582 O O     . LEU B 1 169 ? 48.669  34.219  6.896   1.00 76.25 ? 169 LEU B O     1 
ATOM   3583 C CB    . LEU B 1 169 ? 46.051  34.041  7.375   1.00 68.75 ? 169 LEU B CB    1 
ATOM   3584 C CG    . LEU B 1 169 ? 44.551  34.230  7.520   1.00 67.19 ? 169 LEU B CG    1 
ATOM   3585 C CD1   . LEU B 1 169 ? 44.270  34.767  8.921   1.00 66.41 ? 169 LEU B CD1   1 
ATOM   3586 C CD2   . LEU B 1 169 ? 44.037  35.150  6.435   1.00 64.65 ? 169 LEU B CD2   1 
ATOM   3587 N N     . THR B 1 170 ? 48.686  33.003  5.001   1.00 79.11 ? 170 THR B N     1 
ATOM   3588 C CA    . THR B 1 170 ? 50.122  33.161  4.798   1.00 83.21 ? 170 THR B CA    1 
ATOM   3589 C C     . THR B 1 170 ? 50.570  34.560  4.353   1.00 85.36 ? 170 THR B C     1 
ATOM   3590 O O     . THR B 1 170 ? 49.794  35.516  4.344   1.00 86.10 ? 170 THR B O     1 
ATOM   3591 C CB    . THR B 1 170 ? 50.648  32.147  3.762   1.00 83.56 ? 170 THR B CB    1 
ATOM   3592 O OG1   . THR B 1 170 ? 50.400  32.649  2.439   1.00 84.16 ? 170 THR B OG1   1 
ATOM   3593 C CG2   . THR B 1 170 ? 49.949  30.791  3.937   1.00 83.80 ? 170 THR B CG2   1 
ATOM   3594 N N     . ASP B 1 171 ? 51.841  34.636  3.973   1.00 87.63 ? 171 ASP B N     1 
ATOM   3595 C CA    . ASP B 1 171 ? 52.529  35.852  3.544   1.00 89.83 ? 171 ASP B CA    1 
ATOM   3596 C C     . ASP B 1 171 ? 51.878  36.728  2.451   1.00 91.12 ? 171 ASP B C     1 
ATOM   3597 O O     . ASP B 1 171 ? 51.678  37.941  2.636   1.00 90.91 ? 171 ASP B O     1 
ATOM   3598 C CB    . ASP B 1 171 ? 53.949  35.457  3.113   1.00 90.44 ? 171 ASP B CB    1 
ATOM   3599 C CG    . ASP B 1 171 ? 54.358  34.070  3.639   1.00 91.21 ? 171 ASP B CG    1 
ATOM   3600 O OD1   . ASP B 1 171 ? 54.221  33.819  4.862   1.00 90.73 ? 171 ASP B OD1   1 
ATOM   3601 O OD2   . ASP B 1 171 ? 54.817  33.232  2.824   1.00 91.67 ? 171 ASP B OD2   1 
ATOM   3602 N N     . THR B 1 172 ? 51.563  36.111  1.313   1.00 92.57 ? 172 THR B N     1 
ATOM   3603 C CA    . THR B 1 172 ? 50.964  36.809  0.174   1.00 93.45 ? 172 THR B CA    1 
ATOM   3604 C C     . THR B 1 172 ? 49.427  36.759  0.147   1.00 93.63 ? 172 THR B C     1 
ATOM   3605 O O     . THR B 1 172 ? 48.809  37.089  -0.867  1.00 94.02 ? 172 THR B O     1 
ATOM   3606 C CB    . THR B 1 172 ? 51.507  36.217  -1.149  1.00 93.69 ? 172 THR B CB    1 
ATOM   3607 O OG1   . THR B 1 172 ? 51.411  34.785  -1.098  1.00 93.90 ? 172 THR B OG1   1 
ATOM   3608 C CG2   . THR B 1 172 ? 52.975  36.609  -1.358  1.00 93.77 ? 172 THR B CG2   1 
ATOM   3609 N N     . GLN B 1 173 ? 48.821  36.349  1.260   1.00 93.52 ? 173 GLN B N     1 
ATOM   3610 C CA    . GLN B 1 173 ? 47.359  36.248  1.386   1.00 93.13 ? 173 GLN B CA    1 
ATOM   3611 C C     . GLN B 1 173 ? 46.942  36.425  2.857   1.00 92.25 ? 173 GLN B C     1 
ATOM   3612 O O     . GLN B 1 173 ? 46.691  35.455  3.572   1.00 92.30 ? 173 GLN B O     1 
ATOM   3613 C CB    . GLN B 1 173 ? 46.886  34.895  0.838   1.00 93.67 ? 173 GLN B CB    1 
ATOM   3614 C CG    . GLN B 1 173 ? 47.992  33.834  0.786   1.00 94.58 ? 173 GLN B CG    1 
ATOM   3615 C CD    . GLN B 1 173 ? 47.562  32.545  0.087   1.00 95.18 ? 173 GLN B CD    1 
ATOM   3616 O OE1   . GLN B 1 173 ? 47.182  32.551  -1.091  1.00 94.46 ? 173 GLN B OE1   1 
ATOM   3617 N NE2   . GLN B 1 173 ? 47.628  31.428  0.817   1.00 95.81 ? 173 GLN B NE2   1 
ATOM   3618 N N     . ILE B 1 174 ? 46.870  37.686  3.283   1.00 91.01 ? 174 ILE B N     1 
ATOM   3619 C CA    . ILE B 1 174 ? 46.529  38.056  4.656   1.00 89.74 ? 174 ILE B CA    1 
ATOM   3620 C C     . ILE B 1 174 ? 45.052  37.922  5.054   1.00 88.54 ? 174 ILE B C     1 
ATOM   3621 O O     . ILE B 1 174 ? 44.692  38.182  6.206   1.00 88.59 ? 174 ILE B O     1 
ATOM   3622 C CB    . ILE B 1 174 ? 46.987  39.497  4.945   1.00 90.16 ? 174 ILE B CB    1 
ATOM   3623 C CG1   . ILE B 1 174 ? 46.056  40.495  4.240   1.00 89.87 ? 174 ILE B CG1   1 
ATOM   3624 C CG2   . ILE B 1 174 ? 48.422  39.686  4.450   1.00 90.04 ? 174 ILE B CG2   1 
ATOM   3625 C CD1   . ILE B 1 174 ? 46.393  41.944  4.511   1.00 90.02 ? 174 ILE B CD1   1 
ATOM   3626 N N     . LYS B 1 175 ? 44.201  37.541  4.104   1.00 86.65 ? 175 LYS B N     1 
ATOM   3627 C CA    . LYS B 1 175 ? 42.773  37.346  4.379   1.00 84.50 ? 175 LYS B CA    1 
ATOM   3628 C C     . LYS B 1 175 ? 42.262  36.289  3.412   1.00 82.40 ? 175 LYS B C     1 
ATOM   3629 O O     . LYS B 1 175 ? 42.816  36.132  2.328   1.00 82.40 ? 175 LYS B O     1 
ATOM   3630 C CB    . LYS B 1 175 ? 41.967  38.645  4.189   1.00 84.94 ? 175 LYS B CB    1 
ATOM   3631 C CG    . LYS B 1 175 ? 42.460  39.835  5.009   1.00 85.93 ? 175 LYS B CG    1 
ATOM   3632 C CD    . LYS B 1 175 ? 41.323  40.656  5.597   1.00 86.50 ? 175 LYS B CD    1 
ATOM   3633 C CE    . LYS B 1 175 ? 40.815  40.032  6.897   1.00 87.58 ? 175 LYS B CE    1 
ATOM   3634 N NZ    . LYS B 1 175 ? 39.684  40.797  7.519   1.00 87.89 ? 175 LYS B NZ    1 
ATOM   3635 N N     . ARG B 1 176 ? 41.231  35.551  3.812   1.00 79.80 ? 176 ARG B N     1 
ATOM   3636 C CA    . ARG B 1 176 ? 40.655  34.528  2.952   1.00 77.16 ? 176 ARG B CA    1 
ATOM   3637 C C     . ARG B 1 176 ? 39.322  35.053  2.430   1.00 75.38 ? 176 ARG B C     1 
ATOM   3638 O O     . ARG B 1 176 ? 38.836  36.083  2.895   1.00 76.18 ? 176 ARG B O     1 
ATOM   3639 C CB    . ARG B 1 176 ? 40.441  33.231  3.725   1.00 77.32 ? 176 ARG B CB    1 
ATOM   3640 C CG    . ARG B 1 176 ? 41.689  32.709  4.417   1.00 77.61 ? 176 ARG B CG    1 
ATOM   3641 C CD    . ARG B 1 176 ? 42.873  32.615  3.492   1.00 77.38 ? 176 ARG B CD    1 
ATOM   3642 N NE    . ARG B 1 176 ? 42.569  31.829  2.306   1.00 79.08 ? 176 ARG B NE    1 
ATOM   3643 C CZ    . ARG B 1 176 ? 43.471  31.449  1.402   1.00 79.60 ? 176 ARG B CZ    1 
ATOM   3644 N NH1   . ARG B 1 176 ? 44.754  31.777  1.547   1.00 79.81 ? 176 ARG B NH1   1 
ATOM   3645 N NH2   . ARG B 1 176 ? 43.088  30.753  0.341   1.00 79.03 ? 176 ARG B NH2   1 
ATOM   3646 N N     . ASN B 1 177 ? 38.722  34.349  1.480   1.00 72.41 ? 177 ASN B N     1 
ATOM   3647 C CA    . ASN B 1 177 ? 37.462  34.789  0.906   1.00 70.02 ? 177 ASN B CA    1 
ATOM   3648 C C     . ASN B 1 177 ? 36.525  33.627  0.586   1.00 67.78 ? 177 ASN B C     1 
ATOM   3649 O O     . ASN B 1 177 ? 35.346  33.817  0.298   1.00 67.42 ? 177 ASN B O     1 
ATOM   3650 C CB    . ASN B 1 177 ? 37.749  35.583  -0.379  1.00 70.44 ? 177 ASN B CB    1 
ATOM   3651 C CG    . ASN B 1 177 ? 38.270  36.985  -0.100  1.00 70.62 ? 177 ASN B CG    1 
ATOM   3652 O OD1   . ASN B 1 177 ? 37.507  37.867  0.312   1.00 70.06 ? 177 ASN B OD1   1 
ATOM   3653 N ND2   . ASN B 1 177 ? 39.587  37.198  -0.318  1.00 70.44 ? 177 ASN B ND2   1 
HETATM 3654 N N     . TPO B 1 178 ? 37.048  32.416  0.636   1.00 65.38 ? 178 TPO B N     1 
HETATM 3655 C CA    . TPO B 1 178 ? 36.235  31.255  0.311   1.00 63.84 ? 178 TPO B CA    1 
HETATM 3656 C CB    . TPO B 1 178 ? 37.121  29.976  0.278   1.00 64.31 ? 178 TPO B CB    1 
HETATM 3657 C CG2   . TPO B 1 178 ? 36.379  28.777  -0.310  1.00 65.16 ? 178 TPO B CG2   1 
HETATM 3658 O OG1   . TPO B 1 178 ? 38.234  30.231  -0.572  1.00 66.32 ? 178 TPO B OG1   1 
HETATM 3659 P P     . TPO B 1 178 ? 39.720  29.972  -0.041  1.00 67.68 ? 178 TPO B P     1 
HETATM 3660 O O1P   . TPO B 1 178 ? 40.005  30.900  1.112   1.00 67.46 ? 178 TPO B O1P   1 
HETATM 3661 O O2P   . TPO B 1 178 ? 40.716  30.178  -1.149  1.00 67.58 ? 178 TPO B O2P   1 
HETATM 3662 O O3P   . TPO B 1 178 ? 39.752  28.536  0.420   1.00 68.78 ? 178 TPO B O3P   1 
HETATM 3663 C C     . TPO B 1 178 ? 35.004  31.058  1.215   1.00 61.55 ? 178 TPO B C     1 
HETATM 3664 O O     . TPO B 1 178 ? 35.052  31.192  2.426   1.00 60.47 ? 178 TPO B O     1 
ATOM   3665 N N     . PHE B 1 179 ? 33.888  30.794  0.560   1.00 60.39 ? 179 PHE B N     1 
ATOM   3666 C CA    . PHE B 1 179 ? 32.592  30.529  1.175   1.00 59.16 ? 179 PHE B CA    1 
ATOM   3667 C C     . PHE B 1 179 ? 32.690  29.059  1.631   1.00 58.07 ? 179 PHE B C     1 
ATOM   3668 O O     . PHE B 1 179 ? 32.460  28.137  0.829   1.00 57.18 ? 179 PHE B O     1 
ATOM   3669 C CB    . PHE B 1 179 ? 31.544  30.697  0.071   1.00 60.52 ? 179 PHE B CB    1 
ATOM   3670 C CG    . PHE B 1 179 ? 30.120  30.762  0.546   1.00 60.70 ? 179 PHE B CG    1 
ATOM   3671 C CD1   . PHE B 1 179 ? 29.098  30.833  -0.387  1.00 61.45 ? 179 PHE B CD1   1 
ATOM   3672 C CD2   . PHE B 1 179 ? 29.801  30.807  1.889   1.00 61.52 ? 179 PHE B CD2   1 
ATOM   3673 C CE1   . PHE B 1 179 ? 27.765  30.955  0.019   1.00 62.34 ? 179 PHE B CE1   1 
ATOM   3674 C CE2   . PHE B 1 179 ? 28.468  30.931  2.302   1.00 62.28 ? 179 PHE B CE2   1 
ATOM   3675 C CZ    . PHE B 1 179 ? 27.459  31.006  1.367   1.00 61.81 ? 179 PHE B CZ    1 
ATOM   3676 N N     . VAL B 1 180 ? 33.079  28.856  2.892   1.00 55.92 ? 180 VAL B N     1 
ATOM   3677 C CA    . VAL B 1 180 ? 33.245  27.517  3.487   1.00 54.89 ? 180 VAL B CA    1 
ATOM   3678 C C     . VAL B 1 180 ? 32.806  27.401  4.986   1.00 52.74 ? 180 VAL B C     1 
ATOM   3679 O O     . VAL B 1 180 ? 32.768  28.389  5.700   1.00 52.55 ? 180 VAL B O     1 
ATOM   3680 C CB    . VAL B 1 180 ? 34.724  27.076  3.380   1.00 56.76 ? 180 VAL B CB    1 
ATOM   3681 C CG1   . VAL B 1 180 ? 35.528  27.567  4.582   1.00 56.93 ? 180 VAL B CG1   1 
ATOM   3682 C CG2   . VAL B 1 180 ? 34.780  25.580  3.273   1.00 59.13 ? 180 VAL B CG2   1 
ATOM   3683 N N     . GLY B 1 181 ? 32.503  26.182  5.445   1.00 50.95 ? 181 GLY B N     1 
ATOM   3684 C CA    . GLY B 1 181 ? 32.048  25.920  6.815   1.00 46.94 ? 181 GLY B CA    1 
ATOM   3685 C C     . GLY B 1 181 ? 30.613  25.341  6.822   1.00 46.65 ? 181 GLY B C     1 
ATOM   3686 O O     . GLY B 1 181 ? 30.107  24.868  5.797   1.00 46.58 ? 181 GLY B O     1 
ATOM   3687 N N     . THR B 1 182 ? 29.956  25.351  7.981   1.00 44.96 ? 182 THR B N     1 
ATOM   3688 C CA    . THR B 1 182 ? 28.566  24.851  8.131   1.00 42.89 ? 182 THR B CA    1 
ATOM   3689 C C     . THR B 1 182 ? 27.769  26.110  8.429   1.00 42.03 ? 182 THR B C     1 
ATOM   3690 O O     . THR B 1 182 ? 28.014  26.774  9.442   1.00 41.54 ? 182 THR B O     1 
ATOM   3691 C CB    . THR B 1 182 ? 28.446  23.868  9.312   1.00 42.32 ? 182 THR B CB    1 
ATOM   3692 O OG1   . THR B 1 182 ? 29.470  22.858  9.180   1.00 40.81 ? 182 THR B OG1   1 
ATOM   3693 C CG2   . THR B 1 182 ? 27.031  23.184  9.326   1.00 41.93 ? 182 THR B CG2   1 
ATOM   3694 N N     . PRO B 1 183 ? 26.799  26.435  7.552   1.00 40.30 ? 183 PRO B N     1 
ATOM   3695 C CA    . PRO B 1 183 ? 25.925  27.607  7.615   1.00 38.21 ? 183 PRO B CA    1 
ATOM   3696 C C     . PRO B 1 183 ? 25.531  28.067  8.998   1.00 36.86 ? 183 PRO B C     1 
ATOM   3697 O O     . PRO B 1 183 ? 25.746  29.252  9.315   1.00 35.86 ? 183 PRO B O     1 
ATOM   3698 C CB    . PRO B 1 183 ? 24.695  27.206  6.755   1.00 40.13 ? 183 PRO B CB    1 
ATOM   3699 C CG    . PRO B 1 183 ? 25.248  26.247  5.831   1.00 41.13 ? 183 PRO B CG    1 
ATOM   3700 C CD    . PRO B 1 183 ? 26.180  25.402  6.702   1.00 40.26 ? 183 PRO B CD    1 
ATOM   3701 N N     . PHE B 1 184 ? 24.945  27.188  9.828   1.00 32.03 ? 184 PHE B N     1 
ATOM   3702 C CA    . PHE B 1 184 ? 24.561  27.679  11.145  1.00 31.94 ? 184 PHE B CA    1 
ATOM   3703 C C     . PHE B 1 184 ? 25.768  28.302  11.956  1.00 30.46 ? 184 PHE B C     1 
ATOM   3704 O O     . PHE B 1 184 ? 25.563  29.188  12.751  1.00 28.68 ? 184 PHE B O     1 
ATOM   3705 C CB    . PHE B 1 184 ? 23.950  26.610  12.021  1.00 34.95 ? 184 PHE B CB    1 
ATOM   3706 C CG    . PHE B 1 184 ? 22.653  26.048  11.482  1.00 40.05 ? 184 PHE B CG    1 
ATOM   3707 C CD1   . PHE B 1 184 ? 22.566  24.709  11.158  1.00 44.07 ? 184 PHE B CD1   1 
ATOM   3708 C CD2   . PHE B 1 184 ? 21.587  26.859  11.212  1.00 41.84 ? 184 PHE B CD2   1 
ATOM   3709 C CE1   . PHE B 1 184 ? 21.416  24.173  10.545  1.00 44.83 ? 184 PHE B CE1   1 
ATOM   3710 C CE2   . PHE B 1 184 ? 20.439  26.318  10.603  1.00 45.07 ? 184 PHE B CE2   1 
ATOM   3711 C CZ    . PHE B 1 184 ? 20.380  24.978  10.273  1.00 43.36 ? 184 PHE B CZ    1 
ATOM   3712 N N     . TRP B 1 185 ? 26.972  27.813  11.727  1.00 30.26 ? 185 TRP B N     1 
ATOM   3713 C CA    . TRP B 1 185 ? 28.135  28.320  12.504  1.00 29.35 ? 185 TRP B CA    1 
ATOM   3714 C C     . TRP B 1 185 ? 28.989  29.333  11.762  1.00 30.49 ? 185 TRP B C     1 
ATOM   3715 O O     . TRP B 1 185 ? 30.051  29.814  12.316  1.00 27.56 ? 185 TRP B O     1 
ATOM   3716 C CB    . TRP B 1 185 ? 29.038  27.128  12.863  1.00 29.90 ? 185 TRP B CB    1 
ATOM   3717 C CG    . TRP B 1 185 ? 28.473  26.148  13.893  1.00 29.76 ? 185 TRP B CG    1 
ATOM   3718 C CD1   . TRP B 1 185 ? 28.649  26.184  15.268  1.00 31.66 ? 185 TRP B CD1   1 
ATOM   3719 C CD2   . TRP B 1 185 ? 27.607  25.028  13.634  1.00 31.62 ? 185 TRP B CD2   1 
ATOM   3720 N NE1   . TRP B 1 185 ? 27.932  25.157  15.875  1.00 30.36 ? 185 TRP B NE1   1 
ATOM   3721 C CE2   . TRP B 1 185 ? 27.280  24.442  14.892  1.00 31.29 ? 185 TRP B CE2   1 
ATOM   3722 C CE3   . TRP B 1 185 ? 27.064  24.465  12.456  1.00 32.27 ? 185 TRP B CE3   1 
ATOM   3723 C CZ2   . TRP B 1 185 ? 26.407  23.329  15.013  1.00 29.99 ? 185 TRP B CZ2   1 
ATOM   3724 C CZ3   . TRP B 1 185 ? 26.180  23.326  12.581  1.00 33.28 ? 185 TRP B CZ3   1 
ATOM   3725 C CH2   . TRP B 1 185 ? 25.869  22.791  13.857  1.00 31.29 ? 185 TRP B CH2   1 
ATOM   3726 N N     . MET B 1 186 ? 28.603  29.680  10.531  1.00 28.99 ? 186 MET B N     1 
ATOM   3727 C CA    . MET B 1 186 ? 29.434  30.574  9.766   1.00 31.48 ? 186 MET B CA    1 
ATOM   3728 C C     . MET B 1 186 ? 29.342  32.047  10.097  1.00 30.00 ? 186 MET B C     1 
ATOM   3729 O O     . MET B 1 186 ? 28.265  32.584  10.349  1.00 30.06 ? 186 MET B O     1 
ATOM   3730 C CB    . MET B 1 186 ? 29.192  30.371  8.254   1.00 35.22 ? 186 MET B CB    1 
ATOM   3731 C CG    . MET B 1 186 ? 29.585  29.048  7.703   1.00 40.38 ? 186 MET B CG    1 
ATOM   3732 S SD    . MET B 1 186 ? 28.859  28.877  6.006   1.00 43.28 ? 186 MET B SD    1 
ATOM   3733 C CE    . MET B 1 186 ? 29.499  30.301  5.235   1.00 40.41 ? 186 MET B CE    1 
ATOM   3734 N N     . ALA B 1 187 ? 30.500  32.723  10.114  1.00 28.44 ? 187 ALA B N     1 
ATOM   3735 C CA    . ALA B 1 187 ? 30.508  34.142  10.403  1.00 27.31 ? 187 ALA B CA    1 
ATOM   3736 C C     . ALA B 1 187 ? 29.876  34.932  9.276   1.00 29.48 ? 187 ALA B C     1 
ATOM   3737 O O     . ALA B 1 187 ? 29.949  34.547  8.121   1.00 30.87 ? 187 ALA B O     1 
ATOM   3738 C CB    . ALA B 1 187 ? 31.994  34.665  10.613  1.00 26.39 ? 187 ALA B CB    1 
ATOM   3739 N N     . PRO B 1 188 ? 29.287  36.095  9.593   1.00 32.21 ? 188 PRO B N     1 
ATOM   3740 C CA    . PRO B 1 188 ? 28.673  36.895  8.510   1.00 32.44 ? 188 PRO B CA    1 
ATOM   3741 C C     . PRO B 1 188 ? 29.670  37.245  7.395   1.00 34.97 ? 188 PRO B C     1 
ATOM   3742 O O     . PRO B 1 188 ? 29.360  37.072  6.216   1.00 32.29 ? 188 PRO B O     1 
ATOM   3743 C CB    . PRO B 1 188 ? 28.183  38.153  9.226   1.00 32.74 ? 188 PRO B CB    1 
ATOM   3744 C CG    . PRO B 1 188 ? 29.008  38.160  10.575  1.00 33.51 ? 188 PRO B CG    1 
ATOM   3745 C CD    . PRO B 1 188 ? 29.082  36.708  10.915  1.00 30.87 ? 188 PRO B CD    1 
ATOM   3746 N N     . GLU B 1 189 ? 30.876  37.724  7.752   1.00 33.43 ? 189 GLU B N     1 
ATOM   3747 C CA    . GLU B 1 189 ? 31.819  38.071  6.694   1.00 35.01 ? 189 GLU B CA    1 
ATOM   3748 C C     . GLU B 1 189 ? 32.203  36.899  5.808   1.00 35.74 ? 189 GLU B C     1 
ATOM   3749 O O     . GLU B 1 189 ? 32.617  37.110  4.639   1.00 35.93 ? 189 GLU B O     1 
ATOM   3750 C CB    . GLU B 1 189 ? 33.094  38.717  7.267   1.00 35.60 ? 189 GLU B CB    1 
ATOM   3751 C CG    . GLU B 1 189 ? 33.986  37.748  8.007   1.00 35.39 ? 189 GLU B CG    1 
ATOM   3752 C CD    . GLU B 1 189 ? 33.550  37.514  9.444   1.00 34.06 ? 189 GLU B CD    1 
ATOM   3753 O OE1   . GLU B 1 189 ? 32.364  37.790  9.791   1.00 33.89 ? 189 GLU B OE1   1 
ATOM   3754 O OE2   . GLU B 1 189 ? 34.378  37.029  10.223  1.00 30.77 ? 189 GLU B OE2   1 
ATOM   3755 N N     . VAL B 1 190 ? 32.099  35.658  6.316   1.00 35.54 ? 190 VAL B N     1 
ATOM   3756 C CA    . VAL B 1 190 ? 32.460  34.504  5.472   1.00 36.90 ? 190 VAL B CA    1 
ATOM   3757 C C     . VAL B 1 190 ? 31.379  34.248  4.379   1.00 40.47 ? 190 VAL B C     1 
ATOM   3758 O O     . VAL B 1 190 ? 31.659  33.995  3.196   1.00 38.05 ? 190 VAL B O     1 
ATOM   3759 C CB    . VAL B 1 190 ? 32.607  33.219  6.327   1.00 39.05 ? 190 VAL B CB    1 
ATOM   3760 C CG1   . VAL B 1 190 ? 32.550  31.992  5.442   1.00 37.90 ? 190 VAL B CG1   1 
ATOM   3761 C CG2   . VAL B 1 190 ? 33.967  33.201  7.056   1.00 38.41 ? 190 VAL B CG2   1 
ATOM   3762 N N     . ILE B 1 191 ? 30.132  34.296  4.820   1.00 43.77 ? 191 ILE B N     1 
ATOM   3763 C CA    . ILE B 1 191 ? 28.993  34.106  3.947   1.00 46.42 ? 191 ILE B CA    1 
ATOM   3764 C C     . ILE B 1 191 ? 29.077  35.092  2.782   1.00 50.46 ? 191 ILE B C     1 
ATOM   3765 O O     . ILE B 1 191 ? 29.021  34.683  1.620   1.00 51.49 ? 191 ILE B O     1 
ATOM   3766 C CB    . ILE B 1 191 ? 27.677  34.320  4.753   1.00 44.02 ? 191 ILE B CB    1 
ATOM   3767 C CG1   . ILE B 1 191 ? 27.453  33.098  5.641   1.00 42.65 ? 191 ILE B CG1   1 
ATOM   3768 C CG2   . ILE B 1 191 ? 26.473  34.622  3.819   1.00 42.95 ? 191 ILE B CG2   1 
ATOM   3769 C CD1   . ILE B 1 191 ? 26.541  33.356  6.813   1.00 40.14 ? 191 ILE B CD1   1 
ATOM   3770 N N     . LYS B 1 192 ? 29.232  36.378  3.091   1.00 53.81 ? 192 LYS B N     1 
ATOM   3771 C CA    . LYS B 1 192 ? 29.278  37.397  2.060   1.00 58.30 ? 192 LYS B CA    1 
ATOM   3772 C C     . LYS B 1 192 ? 30.684  37.653  1.495   1.00 60.20 ? 192 LYS B C     1 
ATOM   3773 O O     . LYS B 1 192 ? 30.978  38.730  0.983   1.00 61.24 ? 192 LYS B O     1 
ATOM   3774 C CB    . LYS B 1 192 ? 28.655  38.698  2.591   1.00 58.74 ? 192 LYS B CB    1 
ATOM   3775 C CG    . LYS B 1 192 ? 29.296  39.321  3.799   1.00 61.01 ? 192 LYS B CG    1 
ATOM   3776 C CD    . LYS B 1 192 ? 28.279  40.253  4.491   1.00 61.35 ? 192 LYS B CD    1 
ATOM   3777 C CE    . LYS B 1 192 ? 28.927  41.249  5.468   1.00 64.00 ? 192 LYS B CE    1 
ATOM   3778 N NZ    . LYS B 1 192 ? 29.602  40.719  6.716   1.00 64.18 ? 192 LYS B NZ    1 
ATOM   3779 N N     . GLN B 1 193 ? 31.512  36.617  1.548   1.00 61.95 ? 193 GLN B N     1 
ATOM   3780 C CA    . GLN B 1 193 ? 32.915  36.655  1.128   1.00 62.20 ? 193 GLN B CA    1 
ATOM   3781 C C     . GLN B 1 193 ? 33.657  37.952  1.242   1.00 61.12 ? 193 GLN B C     1 
ATOM   3782 O O     . GLN B 1 193 ? 34.321  38.369  0.312   1.00 60.81 ? 193 GLN B O     1 
ATOM   3783 C CB    . GLN B 1 193 ? 33.142  36.143  -0.296  1.00 65.40 ? 193 GLN B CB    1 
ATOM   3784 C CG    . GLN B 1 193 ? 34.689  36.040  -0.612  1.00 67.34 ? 193 GLN B CG    1 
ATOM   3785 C CD    . GLN B 1 193 ? 35.119  36.478  -2.037  1.00 68.63 ? 193 GLN B CD    1 
ATOM   3786 O OE1   . GLN B 1 193 ? 35.393  37.666  -2.287  1.00 68.61 ? 193 GLN B OE1   1 
ATOM   3787 N NE2   . GLN B 1 193 ? 35.186  35.512  -2.965  1.00 68.23 ? 193 GLN B NE2   1 
ATOM   3788 N N     . SER B 1 194 ? 33.533  38.631  2.362   1.00 61.42 ? 194 SER B N     1 
ATOM   3789 C CA    . SER B 1 194 ? 34.355  39.815  2.548   1.00 61.64 ? 194 SER B CA    1 
ATOM   3790 C C     . SER B 1 194 ? 35.707  39.135  2.871   1.00 61.66 ? 194 SER B C     1 
ATOM   3791 O O     . SER B 1 194 ? 35.753  37.918  3.148   1.00 62.37 ? 194 SER B O     1 
ATOM   3792 C CB    . SER B 1 194 ? 33.870  40.650  3.760   1.00 61.99 ? 194 SER B CB    1 
ATOM   3793 O OG    . SER B 1 194 ? 32.737  41.465  3.476   1.00 60.94 ? 194 SER B OG    1 
ATOM   3794 N N     . ALA B 1 195 ? 36.811  39.868  2.812   1.00 60.81 ? 195 ALA B N     1 
ATOM   3795 C CA    . ALA B 1 195 ? 38.083  39.243  3.147   1.00 59.08 ? 195 ALA B CA    1 
ATOM   3796 C C     . ALA B 1 195 ? 37.921  39.013  4.656   1.00 57.77 ? 195 ALA B C     1 
ATOM   3797 O O     . ALA B 1 195 ? 37.440  39.898  5.382   1.00 59.09 ? 195 ALA B O     1 
ATOM   3798 C CB    . ALA B 1 195 ? 39.242  40.211  2.864   1.00 60.27 ? 195 ALA B CB    1 
ATOM   3799 N N     . TYR B 1 196 ? 38.291  37.838  5.144   1.00 54.13 ? 196 TYR B N     1 
ATOM   3800 C CA    . TYR B 1 196 ? 38.136  37.584  6.561   1.00 49.64 ? 196 TYR B CA    1 
ATOM   3801 C C     . TYR B 1 196 ? 39.365  36.861  7.088   1.00 49.23 ? 196 TYR B C     1 
ATOM   3802 O O     . TYR B 1 196 ? 40.219  36.434  6.303   1.00 48.76 ? 196 TYR B O     1 
ATOM   3803 C CB    . TYR B 1 196 ? 36.867  36.772  6.786   1.00 46.43 ? 196 TYR B CB    1 
ATOM   3804 C CG    . TYR B 1 196 ? 36.874  35.441  6.131   1.00 43.64 ? 196 TYR B CG    1 
ATOM   3805 C CD1   . TYR B 1 196 ? 37.598  34.387  6.679   1.00 42.86 ? 196 TYR B CD1   1 
ATOM   3806 C CD2   . TYR B 1 196 ? 36.126  35.205  4.955   1.00 43.59 ? 196 TYR B CD2   1 
ATOM   3807 C CE1   . TYR B 1 196 ? 37.593  33.129  6.109   1.00 40.61 ? 196 TYR B CE1   1 
ATOM   3808 C CE2   . TYR B 1 196 ? 36.111  33.931  4.356   1.00 41.32 ? 196 TYR B CE2   1 
ATOM   3809 C CZ    . TYR B 1 196 ? 36.847  32.900  4.949   1.00 41.05 ? 196 TYR B CZ    1 
ATOM   3810 O OH    . TYR B 1 196 ? 36.841  31.622  4.447   1.00 39.72 ? 196 TYR B OH    1 
ATOM   3811 N N     . ASP B 1 197 ? 39.443  36.699  8.413   1.00 48.69 ? 197 ASP B N     1 
ATOM   3812 C CA    . ASP B 1 197 ? 40.610  36.056  9.053   1.00 46.22 ? 197 ASP B CA    1 
ATOM   3813 C C     . ASP B 1 197 ? 40.250  35.157  10.253  1.00 44.82 ? 197 ASP B C     1 
ATOM   3814 O O     . ASP B 1 197 ? 39.146  34.582  10.305  1.00 44.81 ? 197 ASP B O     1 
ATOM   3815 C CB    . ASP B 1 197 ? 41.566  37.148  9.512   1.00 48.54 ? 197 ASP B CB    1 
ATOM   3816 C CG    . ASP B 1 197 ? 40.887  38.140  10.446  1.00 50.62 ? 197 ASP B CG    1 
ATOM   3817 O OD1   . ASP B 1 197 ? 39.706  37.896  10.813  1.00 49.56 ? 197 ASP B OD1   1 
ATOM   3818 O OD2   . ASP B 1 197 ? 41.524  39.166  10.813  1.00 53.80 ? 197 ASP B OD2   1 
ATOM   3819 N N     . SER B 1 198 ? 41.184  35.017  11.200  1.00 38.48 ? 198 SER B N     1 
ATOM   3820 C CA    . SER B 1 198 ? 40.963  34.196  12.387  1.00 36.31 ? 198 SER B CA    1 
ATOM   3821 C C     . SER B 1 198 ? 39.669  34.602  13.091  1.00 32.25 ? 198 SER B C     1 
ATOM   3822 O O     . SER B 1 198 ? 39.069  33.807  13.797  1.00 32.44 ? 198 SER B O     1 
ATOM   3823 C CB    . SER B 1 198 ? 42.146  34.345  13.384  1.00 35.29 ? 198 SER B CB    1 
ATOM   3824 O OG    . SER B 1 198 ? 42.245  35.690  13.810  1.00 36.45 ? 198 SER B OG    1 
ATOM   3825 N N     . LYS B 1 199 ? 39.254  35.841  12.917  1.00 29.71 ? 199 LYS B N     1 
ATOM   3826 C CA    . LYS B 1 199 ? 38.040  36.288  13.589  1.00 31.40 ? 199 LYS B CA    1 
ATOM   3827 C C     . LYS B 1 199 ? 36.779  35.469  13.227  1.00 29.72 ? 199 LYS B C     1 
ATOM   3828 O O     . LYS B 1 199 ? 35.807  35.454  13.983  1.00 28.49 ? 199 LYS B O     1 
ATOM   3829 C CB    . LYS B 1 199 ? 37.797  37.769  13.313  1.00 30.61 ? 199 LYS B CB    1 
ATOM   3830 C CG    . LYS B 1 199 ? 38.970  38.613  13.849  1.00 32.77 ? 199 LYS B CG    1 
ATOM   3831 C CD    . LYS B 1 199 ? 39.115  38.561  15.381  1.00 32.43 ? 199 LYS B CD    1 
ATOM   3832 C CE    . LYS B 1 199 ? 40.410  39.408  15.821  1.00 33.79 ? 199 LYS B CE    1 
ATOM   3833 N NZ    . LYS B 1 199 ? 40.528  39.467  17.290  1.00 29.98 ? 199 LYS B NZ    1 
ATOM   3834 N N     . ALA B 1 200 ? 36.803  34.851  12.063  1.00 30.46 ? 200 ALA B N     1 
ATOM   3835 C CA    . ALA B 1 200 ? 35.678  33.993  11.604  1.00 30.17 ? 200 ALA B CA    1 
ATOM   3836 C C     . ALA B 1 200 ? 35.538  32.819  12.584  1.00 31.58 ? 200 ALA B C     1 
ATOM   3837 O O     . ALA B 1 200 ? 34.418  32.410  12.938  1.00 32.03 ? 200 ALA B O     1 
ATOM   3838 C CB    . ALA B 1 200 ? 35.960  33.496  10.178  1.00 29.61 ? 200 ALA B CB    1 
ATOM   3839 N N     . ASP B 1 201 ? 36.665  32.285  13.051  1.00 29.35 ? 201 ASP B N     1 
ATOM   3840 C CA    . ASP B 1 201 ? 36.634  31.218  14.039  1.00 29.56 ? 201 ASP B CA    1 
ATOM   3841 C C     . ASP B 1 201 ? 36.107  31.705  15.363  1.00 30.65 ? 201 ASP B C     1 
ATOM   3842 O O     . ASP B 1 201 ? 35.521  30.917  16.124  1.00 30.50 ? 201 ASP B O     1 
ATOM   3843 C CB    . ASP B 1 201 ? 38.000  30.610  14.340  1.00 30.31 ? 201 ASP B CB    1 
ATOM   3844 C CG    . ASP B 1 201 ? 38.496  29.666  13.271  1.00 33.91 ? 201 ASP B CG    1 
ATOM   3845 O OD1   . ASP B 1 201 ? 37.676  29.077  12.476  1.00 34.54 ? 201 ASP B OD1   1 
ATOM   3846 O OD2   . ASP B 1 201 ? 39.737  29.484  13.256  1.00 29.69 ? 201 ASP B OD2   1 
ATOM   3847 N N     . ILE B 1 202 ? 36.311  32.990  15.676  1.00 28.39 ? 202 ILE B N     1 
ATOM   3848 C CA    . ILE B 1 202 ? 35.833  33.497  16.938  1.00 28.40 ? 202 ILE B CA    1 
ATOM   3849 C C     . ILE B 1 202 ? 34.289  33.528  16.932  1.00 28.99 ? 202 ILE B C     1 
ATOM   3850 O O     . ILE B 1 202 ? 33.640  33.222  17.919  1.00 28.90 ? 202 ILE B O     1 
ATOM   3851 C CB    . ILE B 1 202 ? 36.358  34.930  17.211  1.00 27.77 ? 202 ILE B CB    1 
ATOM   3852 C CG1   . ILE B 1 202 ? 37.916  34.926  17.295  1.00 26.79 ? 202 ILE B CG1   1 
ATOM   3853 C CG2   . ILE B 1 202 ? 35.815  35.372  18.520  1.00 24.40 ? 202 ILE B CG2   1 
ATOM   3854 C CD1   . ILE B 1 202 ? 38.437  33.850  18.244  1.00 25.95 ? 202 ILE B CD1   1 
ATOM   3855 N N     . TRP B 1 203 ? 33.744  33.960  15.819  1.00 29.88 ? 203 TRP B N     1 
ATOM   3856 C CA    . TRP B 1 203 ? 32.290  33.955  15.667  1.00 29.68 ? 203 TRP B CA    1 
ATOM   3857 C C     . TRP B 1 203 ? 31.785  32.485  15.771  1.00 28.13 ? 203 TRP B C     1 
ATOM   3858 O O     . TRP B 1 203 ? 30.816  32.182  16.497  1.00 29.82 ? 203 TRP B O     1 
ATOM   3859 C CB    . TRP B 1 203 ? 31.927  34.543  14.316  1.00 28.62 ? 203 TRP B CB    1 
ATOM   3860 C CG    . TRP B 1 203 ? 30.421  34.345  13.992  1.00 26.66 ? 203 TRP B CG    1 
ATOM   3861 C CD1   . TRP B 1 203 ? 29.845  33.187  13.594  1.00 26.09 ? 203 TRP B CD1   1 
ATOM   3862 C CD2   . TRP B 1 203 ? 29.355  35.318  14.094  1.00 27.36 ? 203 TRP B CD2   1 
ATOM   3863 N NE1   . TRP B 1 203 ? 28.494  33.367  13.437  1.00 26.84 ? 203 TRP B NE1   1 
ATOM   3864 C CE2   . TRP B 1 203 ? 28.161  34.655  13.737  1.00 26.99 ? 203 TRP B CE2   1 
ATOM   3865 C CE3   . TRP B 1 203 ? 29.298  36.679  14.447  1.00 26.60 ? 203 TRP B CE3   1 
ATOM   3866 C CZ2   . TRP B 1 203 ? 26.910  35.293  13.724  1.00 27.96 ? 203 TRP B CZ2   1 
ATOM   3867 C CZ3   . TRP B 1 203 ? 28.057  37.336  14.431  1.00 29.10 ? 203 TRP B CZ3   1 
ATOM   3868 C CH2   . TRP B 1 203 ? 26.857  36.623  14.068  1.00 28.62 ? 203 TRP B CH2   1 
ATOM   3869 N N     . SER B 1 204 ? 32.442  31.563  15.087  1.00 29.12 ? 204 SER B N     1 
ATOM   3870 C CA    . SER B 1 204 ? 31.986  30.144  15.133  1.00 27.75 ? 204 SER B CA    1 
ATOM   3871 C C     . SER B 1 204 ? 32.063  29.632  16.548  1.00 30.40 ? 204 SER B C     1 
ATOM   3872 O O     . SER B 1 204 ? 31.208  28.826  16.954  1.00 28.06 ? 204 SER B O     1 
ATOM   3873 C CB    . SER B 1 204 ? 32.764  29.221  14.202  1.00 28.53 ? 204 SER B CB    1 
ATOM   3874 O OG    . SER B 1 204 ? 32.631  29.665  12.885  1.00 27.61 ? 204 SER B OG    1 
ATOM   3875 N N     . LEU B 1 205 ? 33.071  30.099  17.315  1.00 26.82 ? 205 LEU B N     1 
ATOM   3876 C CA    . LEU B 1 205 ? 33.178  29.719  18.712  1.00 26.86 ? 205 LEU B CA    1 
ATOM   3877 C C     . LEU B 1 205 ? 32.003  30.248  19.504  1.00 24.67 ? 205 LEU B C     1 
ATOM   3878 O O     . LEU B 1 205 ? 31.511  29.572  20.410  1.00 26.38 ? 205 LEU B O     1 
ATOM   3879 C CB    . LEU B 1 205 ? 34.483  30.228  19.386  1.00 26.65 ? 205 LEU B CB    1 
ATOM   3880 C CG    . LEU B 1 205 ? 34.490  29.905  20.921  1.00 28.93 ? 205 LEU B CG    1 
ATOM   3881 C CD1   . LEU B 1 205 ? 35.027  28.447  21.114  1.00 29.10 ? 205 LEU B CD1   1 
ATOM   3882 C CD2   . LEU B 1 205 ? 35.351  30.781  21.687  1.00 30.57 ? 205 LEU B CD2   1 
ATOM   3883 N N     . GLY B 1 206 ? 31.528  31.450  19.224  1.00 25.92 ? 206 GLY B N     1 
ATOM   3884 C CA    . GLY B 1 206 ? 30.368  31.916  19.984  1.00 25.16 ? 206 GLY B CA    1 
ATOM   3885 C C     . GLY B 1 206 ? 29.088  31.099  19.661  1.00 27.21 ? 206 GLY B C     1 
ATOM   3886 O O     . GLY B 1 206 ? 28.180  30.943  20.514  1.00 26.48 ? 206 GLY B O     1 
ATOM   3887 N N     . ILE B 1 207 ? 28.969  30.682  18.411  1.00 27.17 ? 207 ILE B N     1 
ATOM   3888 C CA    . ILE B 1 207 ? 27.796  29.878  17.966  1.00 28.70 ? 207 ILE B CA    1 
ATOM   3889 C C     . ILE B 1 207 ? 27.944  28.540  18.703  1.00 29.27 ? 207 ILE B C     1 
ATOM   3890 O O     . ILE B 1 207 ? 26.957  27.998  19.191  1.00 30.67 ? 207 ILE B O     1 
ATOM   3891 C CB    . ILE B 1 207 ? 27.775  29.627  16.415  1.00 27.75 ? 207 ILE B CB    1 
ATOM   3892 C CG1   . ILE B 1 207 ? 27.574  30.964  15.648  1.00 23.92 ? 207 ILE B CG1   1 
ATOM   3893 C CG2   . ILE B 1 207 ? 26.639  28.600  16.011  1.00 27.08 ? 207 ILE B CG2   1 
ATOM   3894 C CD1   . ILE B 1 207 ? 26.289  31.761  16.125  1.00 26.02 ? 207 ILE B CD1   1 
ATOM   3895 N N     . THR B 1 208 ? 29.182  28.050  18.833  1.00 28.39 ? 208 THR B N     1 
ATOM   3896 C CA    . THR B 1 208 ? 29.439  26.790  19.549  1.00 26.62 ? 208 THR B CA    1 
ATOM   3897 C C     . THR B 1 208 ? 29.135  26.876  21.072  1.00 26.29 ? 208 THR B C     1 
ATOM   3898 O O     . THR B 1 208 ? 28.667  25.906  21.706  1.00 23.92 ? 208 THR B O     1 
ATOM   3899 C CB    . THR B 1 208 ? 30.896  26.395  19.344  1.00 27.45 ? 208 THR B CB    1 
ATOM   3900 O OG1   . THR B 1 208 ? 31.115  26.241  17.931  1.00 29.73 ? 208 THR B OG1   1 
ATOM   3901 C CG2   . THR B 1 208 ? 31.232  25.066  20.027  1.00 26.33 ? 208 THR B CG2   1 
ATOM   3902 N N     . ALA B 1 209 ? 29.357  28.064  21.640  1.00 24.70 ? 209 ALA B N     1 
ATOM   3903 C CA    . ALA B 1 209 ? 29.074  28.279  23.047  1.00 24.96 ? 209 ALA B CA    1 
ATOM   3904 C C     . ALA B 1 209 ? 27.539  28.175  23.174  1.00 25.20 ? 209 ALA B C     1 
ATOM   3905 O O     . ALA B 1 209 ? 27.069  27.581  24.134  1.00 24.44 ? 209 ALA B O     1 
ATOM   3906 C CB    . ALA B 1 209 ? 29.515  29.656  23.495  1.00 23.82 ? 209 ALA B CB    1 
ATOM   3907 N N     . ILE B 1 210 ? 26.788  28.815  22.278  1.00 26.24 ? 210 ILE B N     1 
ATOM   3908 C CA    . ILE B 1 210 ? 25.298  28.693  22.374  1.00 27.75 ? 210 ILE B CA    1 
ATOM   3909 C C     . ILE B 1 210 ? 24.906  27.177  22.265  1.00 26.69 ? 210 ILE B C     1 
ATOM   3910 O O     . ILE B 1 210 ? 24.089  26.647  23.066  1.00 28.14 ? 210 ILE B O     1 
ATOM   3911 C CB    . ILE B 1 210 ? 24.623  29.523  21.287  1.00 26.02 ? 210 ILE B CB    1 
ATOM   3912 C CG1   . ILE B 1 210 ? 24.826  30.995  21.650  1.00 29.66 ? 210 ILE B CG1   1 
ATOM   3913 C CG2   . ILE B 1 210 ? 23.072  29.273  21.212  1.00 29.91 ? 210 ILE B CG2   1 
ATOM   3914 C CD1   . ILE B 1 210 ? 24.250  32.012  20.664  1.00 30.33 ? 210 ILE B CD1   1 
ATOM   3915 N N     . GLU B 1 211 ? 25.550  26.494  21.327  1.00 28.35 ? 211 GLU B N     1 
ATOM   3916 C CA    . GLU B 1 211 ? 25.300  25.068  21.081  1.00 30.73 ? 211 GLU B CA    1 
ATOM   3917 C C     . GLU B 1 211 ? 25.576  24.246  22.330  1.00 30.32 ? 211 GLU B C     1 
ATOM   3918 O O     . GLU B 1 211 ? 24.780  23.356  22.688  1.00 29.75 ? 211 GLU B O     1 
ATOM   3919 C CB    . GLU B 1 211 ? 26.129  24.568  19.841  1.00 30.97 ? 211 GLU B CB    1 
ATOM   3920 C CG    . GLU B 1 211 ? 26.108  23.065  19.634  1.00 32.13 ? 211 GLU B CG    1 
ATOM   3921 C CD    . GLU B 1 211 ? 27.006  22.611  18.494  1.00 36.36 ? 211 GLU B CD    1 
ATOM   3922 O OE1   . GLU B 1 211 ? 28.076  23.279  18.246  1.00 34.44 ? 211 GLU B OE1   1 
ATOM   3923 O OE2   . GLU B 1 211 ? 26.661  21.577  17.846  1.00 33.16 ? 211 GLU B OE2   1 
ATOM   3924 N N     . LEU B 1 212 ? 26.692  24.504  23.028  1.00 27.71 ? 212 LEU B N     1 
ATOM   3925 C CA    . LEU B 1 212 ? 26.943  23.734  24.248  1.00 27.26 ? 212 LEU B CA    1 
ATOM   3926 C C     . LEU B 1 212 ? 25.930  24.061  25.387  1.00 28.30 ? 212 LEU B C     1 
ATOM   3927 O O     . LEU B 1 212 ? 25.729  23.250  26.249  1.00 28.52 ? 212 LEU B O     1 
ATOM   3928 C CB    . LEU B 1 212 ? 28.336  24.009  24.811  1.00 27.28 ? 212 LEU B CB    1 
ATOM   3929 C CG    . LEU B 1 212 ? 29.477  23.625  23.884  1.00 27.37 ? 212 LEU B CG    1 
ATOM   3930 C CD1   . LEU B 1 212 ? 30.807  24.228  24.406  1.00 30.03 ? 212 LEU B CD1   1 
ATOM   3931 C CD2   . LEU B 1 212 ? 29.517  22.038  23.827  1.00 28.92 ? 212 LEU B CD2   1 
ATOM   3932 N N     . ALA B 1 213 ? 25.352  25.260  25.392  1.00 26.25 ? 213 ALA B N     1 
ATOM   3933 C CA    . ALA B 1 213 ? 24.441  25.653  26.455  1.00 28.46 ? 213 ALA B CA    1 
ATOM   3934 C C     . ALA B 1 213 ? 23.005  25.244  26.148  1.00 31.83 ? 213 ALA B C     1 
ATOM   3935 O O     . ALA B 1 213 ? 22.240  24.953  27.063  1.00 33.33 ? 213 ALA B O     1 
ATOM   3936 C CB    . ALA B 1 213 ? 24.497  27.179  26.626  1.00 30.12 ? 213 ALA B CB    1 
ATOM   3937 N N     . ARG B 1 214 ? 22.650  25.197  24.871  1.00 32.60 ? 214 ARG B N     1 
ATOM   3938 C CA    . ARG B 1 214 ? 21.263  24.894  24.513  1.00 37.04 ? 214 ARG B CA    1 
ATOM   3939 C C     . ARG B 1 214 ? 21.114  23.645  23.761  1.00 37.12 ? 214 ARG B C     1 
ATOM   3940 O O     . ARG B 1 214 ? 19.995  23.179  23.585  1.00 37.76 ? 214 ARG B O     1 
ATOM   3941 C CB    . ARG B 1 214 ? 20.644  26.058  23.709  1.00 39.34 ? 214 ARG B CB    1 
ATOM   3942 C CG    . ARG B 1 214 ? 20.296  27.225  24.614  1.00 47.52 ? 214 ARG B CG    1 
ATOM   3943 C CD    . ARG B 1 214 ? 20.089  28.550  23.871  1.00 53.57 ? 214 ARG B CD    1 
ATOM   3944 N NE    . ARG B 1 214 ? 19.177  28.460  22.735  1.00 58.78 ? 214 ARG B NE    1 
ATOM   3945 C CZ    . ARG B 1 214 ? 17.929  27.983  22.795  1.00 61.27 ? 214 ARG B CZ    1 
ATOM   3946 N NH1   . ARG B 1 214 ? 17.424  27.538  23.955  1.00 61.40 ? 214 ARG B NH1   1 
ATOM   3947 N NH2   . ARG B 1 214 ? 17.182  27.950  21.684  1.00 62.65 ? 214 ARG B NH2   1 
ATOM   3948 N N     . GLY B 1 215 ? 22.227  23.111  23.276  1.00 35.97 ? 215 GLY B N     1 
ATOM   3949 C CA    . GLY B 1 215 ? 22.185  21.857  22.546  1.00 34.79 ? 215 GLY B CA    1 
ATOM   3950 C C     . GLY B 1 215 ? 22.222  21.968  21.041  1.00 34.98 ? 215 GLY B C     1 
ATOM   3951 O O     . GLY B 1 215 ? 22.618  21.031  20.340  1.00 33.15 ? 215 GLY B O     1 
ATOM   3952 N N     . GLU B 1 216 ? 21.782  23.114  20.549  1.00 35.05 ? 216 GLU B N     1 
ATOM   3953 C CA    . GLU B 1 216 ? 21.723  23.377  19.115  1.00 36.59 ? 216 GLU B CA    1 
ATOM   3954 C C     . GLU B 1 216 ? 22.130  24.833  18.868  1.00 33.84 ? 216 GLU B C     1 
ATOM   3955 O O     . GLU B 1 216 ? 22.031  25.681  19.757  1.00 34.45 ? 216 GLU B O     1 
ATOM   3956 C CB    . GLU B 1 216 ? 20.276  23.199  18.577  1.00 40.27 ? 216 GLU B CB    1 
ATOM   3957 C CG    . GLU B 1 216 ? 19.611  21.768  18.745  1.00 46.23 ? 216 GLU B CG    1 
ATOM   3958 C CD    . GLU B 1 216 ? 19.943  20.730  17.618  1.00 51.29 ? 216 GLU B CD    1 
ATOM   3959 O OE1   . GLU B 1 216 ? 20.149  21.126  16.435  1.00 54.13 ? 216 GLU B OE1   1 
ATOM   3960 O OE2   . GLU B 1 216 ? 19.964  19.491  17.902  1.00 54.60 ? 216 GLU B OE2   1 
ATOM   3961 N N     . PRO B 1 217 ? 22.601  25.131  17.658  1.00 32.94 ? 217 PRO B N     1 
ATOM   3962 C CA    . PRO B 1 217 ? 22.991  26.513  17.328  1.00 32.80 ? 217 PRO B CA    1 
ATOM   3963 C C     . PRO B 1 217 ? 21.753  27.290  17.007  1.00 32.95 ? 217 PRO B C     1 
ATOM   3964 O O     . PRO B 1 217 ? 20.680  26.735  16.840  1.00 34.59 ? 217 PRO B O     1 
ATOM   3965 C CB    . PRO B 1 217 ? 23.818  26.354  16.065  1.00 32.43 ? 217 PRO B CB    1 
ATOM   3966 C CG    . PRO B 1 217 ? 23.197  25.078  15.432  1.00 34.40 ? 217 PRO B CG    1 
ATOM   3967 C CD    . PRO B 1 217 ? 23.002  24.182  16.600  1.00 31.37 ? 217 PRO B CD    1 
ATOM   3968 N N     . PRO B 1 218 ? 21.872  28.606  16.927  1.00 34.30 ? 218 PRO B N     1 
ATOM   3969 C CA    . PRO B 1 218 ? 20.684  29.412  16.574  1.00 33.90 ? 218 PRO B CA    1 
ATOM   3970 C C     . PRO B 1 218 ? 20.179  29.037  15.154  1.00 32.47 ? 218 PRO B C     1 
ATOM   3971 O O     . PRO B 1 218 ? 20.982  28.651  14.286  1.00 30.19 ? 218 PRO B O     1 
ATOM   3972 C CB    . PRO B 1 218 ? 21.226  30.832  16.560  1.00 33.66 ? 218 PRO B CB    1 
ATOM   3973 C CG    . PRO B 1 218 ? 22.363  30.786  17.577  1.00 33.79 ? 218 PRO B CG    1 
ATOM   3974 C CD    . PRO B 1 218 ? 22.993  29.438  17.401  1.00 32.55 ? 218 PRO B CD    1 
ATOM   3975 N N     . HIS B 1 219 ? 18.866  29.179  14.914  1.00 34.28 ? 219 HIS B N     1 
ATOM   3976 C CA    . HIS B 1 219 ? 18.279  28.910  13.579  1.00 33.94 ? 219 HIS B CA    1 
ATOM   3977 C C     . HIS B 1 219 ? 18.269  27.427  13.196  1.00 32.68 ? 219 HIS B C     1 
ATOM   3978 O O     . HIS B 1 219 ? 18.053  27.102  12.021  1.00 32.34 ? 219 HIS B O     1 
ATOM   3979 C CB    . HIS B 1 219 ? 19.090  29.651  12.476  1.00 35.12 ? 219 HIS B CB    1 
ATOM   3980 C CG    . HIS B 1 219 ? 19.252  31.139  12.708  1.00 37.22 ? 219 HIS B CG    1 
ATOM   3981 N ND1   . HIS B 1 219 ? 18.209  31.946  13.110  1.00 36.89 ? 219 HIS B ND1   1 
ATOM   3982 C CD2   . HIS B 1 219 ? 20.316  31.964  12.538  1.00 37.63 ? 219 HIS B CD2   1 
ATOM   3983 C CE1   . HIS B 1 219 ? 18.614  33.204  13.180  1.00 38.07 ? 219 HIS B CE1   1 
ATOM   3984 N NE2   . HIS B 1 219 ? 19.893  33.245  12.836  1.00 40.08 ? 219 HIS B NE2   1 
ATOM   3985 N N     . SER B 1 220 ? 18.516  26.541  14.148  1.00 31.98 ? 220 SER B N     1 
ATOM   3986 C CA    . SER B 1 220 ? 18.658  25.140  13.812  1.00 34.61 ? 220 SER B CA    1 
ATOM   3987 C C     . SER B 1 220 ? 17.461  24.443  13.169  1.00 37.68 ? 220 SER B C     1 
ATOM   3988 O O     . SER B 1 220 ? 17.618  23.369  12.583  1.00 37.75 ? 220 SER B O     1 
ATOM   3989 C CB    . SER B 1 220 ? 19.084  24.325  15.034  1.00 34.75 ? 220 SER B CB    1 
ATOM   3990 O OG    . SER B 1 220 ? 18.165  24.352  16.114  1.00 33.96 ? 220 SER B OG    1 
ATOM   3991 N N     . GLU B 1 221 ? 16.286  25.027  13.317  1.00 39.38 ? 221 GLU B N     1 
ATOM   3992 C CA    . GLU B 1 221 ? 15.112  24.408  12.733  1.00 44.33 ? 221 GLU B CA    1 
ATOM   3993 C C     . GLU B 1 221 ? 14.780  24.985  11.344  1.00 43.11 ? 221 GLU B C     1 
ATOM   3994 O O     . GLU B 1 221 ? 13.825  24.550  10.682  1.00 43.00 ? 221 GLU B O     1 
ATOM   3995 C CB    . GLU B 1 221 ? 13.929  24.520  13.714  1.00 46.18 ? 221 GLU B CB    1 
ATOM   3996 C CG    . GLU B 1 221 ? 14.144  23.785  15.087  1.00 52.29 ? 221 GLU B CG    1 
ATOM   3997 C CD    . GLU B 1 221 ? 14.982  22.466  15.019  1.00 55.70 ? 221 GLU B CD    1 
ATOM   3998 O OE1   . GLU B 1 221 ? 16.122  22.415  15.587  1.00 55.07 ? 221 GLU B OE1   1 
ATOM   3999 O OE2   . GLU B 1 221 ? 14.505  21.460  14.411  1.00 58.96 ? 221 GLU B OE2   1 
ATOM   4000 N N     . LEU B 1 222 ? 15.582  25.950  10.909  1.00 40.49 ? 222 LEU B N     1 
ATOM   4001 C CA    . LEU B 1 222 ? 15.413  26.553  9.604   1.00 38.84 ? 222 LEU B CA    1 
ATOM   4002 C C     . LEU B 1 222 ? 16.280  25.837  8.584   1.00 39.62 ? 222 LEU B C     1 
ATOM   4003 O O     . LEU B 1 222 ? 17.289  25.181  8.926   1.00 39.09 ? 222 LEU B O     1 
ATOM   4004 C CB    . LEU B 1 222 ? 15.802  28.019  9.641   1.00 39.21 ? 222 LEU B CB    1 
ATOM   4005 C CG    . LEU B 1 222 ? 14.924  28.887  10.507  1.00 39.75 ? 222 LEU B CG    1 
ATOM   4006 C CD1   . LEU B 1 222 ? 15.435  30.312  10.448  1.00 39.27 ? 222 LEU B CD1   1 
ATOM   4007 C CD2   . LEU B 1 222 ? 13.485  28.821  9.992   1.00 41.61 ? 222 LEU B CD2   1 
ATOM   4008 N N     . HIS B 1 223 ? 15.883  25.943  7.319   1.00 38.56 ? 223 HIS B N     1 
ATOM   4009 C CA    . HIS B 1 223 ? 16.631  25.294  6.260   1.00 37.38 ? 223 HIS B CA    1 
ATOM   4010 C C     . HIS B 1 223 ? 17.957  26.057  6.143   1.00 36.85 ? 223 HIS B C     1 
ATOM   4011 O O     . HIS B 1 223 ? 17.978  27.274  6.195   1.00 32.78 ? 223 HIS B O     1 
ATOM   4012 C CB    . HIS B 1 223 ? 15.892  25.389  4.914   1.00 37.62 ? 223 HIS B CB    1 
ATOM   4013 C CG    . HIS B 1 223 ? 16.635  24.743  3.799   1.00 39.77 ? 223 HIS B CG    1 
ATOM   4014 N ND1   . HIS B 1 223 ? 16.418  23.429  3.418   1.00 43.43 ? 223 HIS B ND1   1 
ATOM   4015 C CD2   . HIS B 1 223 ? 17.714  25.167  3.097   1.00 40.36 ? 223 HIS B CD2   1 
ATOM   4016 C CE1   . HIS B 1 223 ? 17.337  23.073  2.539   1.00 41.81 ? 223 HIS B CE1   1 
ATOM   4017 N NE2   . HIS B 1 223 ? 18.142  24.108  2.331   1.00 42.20 ? 223 HIS B NE2   1 
ATOM   4018 N N     . PRO B 1 224 ? 19.065  25.337  5.985   1.00 37.42 ? 224 PRO B N     1 
ATOM   4019 C CA    . PRO B 1 224 ? 20.393  25.990  5.861   1.00 39.24 ? 224 PRO B CA    1 
ATOM   4020 C C     . PRO B 1 224 ? 20.442  27.155  4.873   1.00 38.77 ? 224 PRO B C     1 
ATOM   4021 O O     . PRO B 1 224 ? 20.993  28.201  5.200   1.00 40.14 ? 224 PRO B O     1 
ATOM   4022 C CB    . PRO B 1 224 ? 21.356  24.849  5.504   1.00 37.88 ? 224 PRO B CB    1 
ATOM   4023 C CG    . PRO B 1 224 ? 20.450  23.575  5.352   1.00 40.89 ? 224 PRO B CG    1 
ATOM   4024 C CD    . PRO B 1 224 ? 19.148  23.876  6.101   1.00 38.66 ? 224 PRO B CD    1 
ATOM   4025 N N     . MET B 1 225 ? 19.845  27.012  3.688   1.00 39.98 ? 225 MET B N     1 
ATOM   4026 C CA    . MET B 1 225 ? 19.801  28.115  2.702   1.00 41.76 ? 225 MET B CA    1 
ATOM   4027 C C     . MET B 1 225 ? 19.168  29.410  3.234   1.00 39.40 ? 225 MET B C     1 
ATOM   4028 O O     . MET B 1 225 ? 19.599  30.496  2.862   1.00 38.72 ? 225 MET B O     1 
ATOM   4029 C CB    . MET B 1 225 ? 19.048  27.674  1.412   1.00 45.67 ? 225 MET B CB    1 
ATOM   4030 C CG    . MET B 1 225 ? 19.925  27.155  0.276   1.00 51.44 ? 225 MET B CG    1 
ATOM   4031 S SD    . MET B 1 225 ? 18.999  27.249  -1.329  1.00 59.24 ? 225 MET B SD    1 
ATOM   4032 C CE    . MET B 1 225 ? 18.938  25.500  -1.788  1.00 58.06 ? 225 MET B CE    1 
ATOM   4033 N N     . LYS B 1 226 ? 18.135  29.316  4.088   1.00 38.98 ? 226 LYS B N     1 
ATOM   4034 C CA    . LYS B 1 226 ? 17.506  30.526  4.662   1.00 38.24 ? 226 LYS B CA    1 
ATOM   4035 C C     . LYS B 1 226 ? 18.509  31.165  5.611   1.00 38.89 ? 226 LYS B C     1 
ATOM   4036 O O     . LYS B 1 226 ? 18.625  32.392  5.704   1.00 36.78 ? 226 LYS B O     1 
ATOM   4037 C CB    . LYS B 1 226 ? 16.234  30.179  5.484   1.00 38.97 ? 226 LYS B CB    1 
ATOM   4038 C CG    . LYS B 1 226 ? 14.907  30.069  4.684   1.00 41.19 ? 226 LYS B CG    1 
ATOM   4039 C CD    . LYS B 1 226 ? 13.685  29.666  5.588   1.00 43.94 ? 226 LYS B CD    1 
ATOM   4040 C CE    . LYS B 1 226 ? 12.293  29.787  4.854   1.00 47.13 ? 226 LYS B CE    1 
ATOM   4041 N NZ    . LYS B 1 226 ? 11.054  29.699  5.804   1.00 47.72 ? 226 LYS B NZ    1 
ATOM   4042 N N     . VAL B 1 227 ? 19.241  30.310  6.323   1.00 40.60 ? 227 VAL B N     1 
ATOM   4043 C CA    . VAL B 1 227 ? 20.222  30.816  7.294   1.00 43.73 ? 227 VAL B CA    1 
ATOM   4044 C C     . VAL B 1 227 ? 21.267  31.662  6.574   1.00 43.67 ? 227 VAL B C     1 
ATOM   4045 O O     . VAL B 1 227 ? 21.706  32.668  7.079   1.00 44.17 ? 227 VAL B O     1 
ATOM   4046 C CB    . VAL B 1 227 ? 20.911  29.643  8.060   1.00 44.28 ? 227 VAL B CB    1 
ATOM   4047 C CG1   . VAL B 1 227 ? 21.780  30.177  9.192   1.00 45.24 ? 227 VAL B CG1   1 
ATOM   4048 C CG2   . VAL B 1 227 ? 19.841  28.747  8.681   1.00 45.57 ? 227 VAL B CG2   1 
ATOM   4049 N N     . LEU B 1 228 ? 21.655  31.229  5.387   1.00 45.04 ? 228 LEU B N     1 
ATOM   4050 C CA    . LEU B 1 228 ? 22.635  31.949  4.598   1.00 45.09 ? 228 LEU B CA    1 
ATOM   4051 C C     . LEU B 1 228 ? 22.297  33.427  4.461   1.00 45.16 ? 228 LEU B C     1 
ATOM   4052 O O     . LEU B 1 228 ? 23.207  34.248  4.453   1.00 46.20 ? 228 LEU B O     1 
ATOM   4053 C CB    . LEU B 1 228 ? 22.734  31.301  3.225   1.00 46.53 ? 228 LEU B CB    1 
ATOM   4054 C CG    . LEU B 1 228 ? 24.133  30.977  2.754   1.00 48.01 ? 228 LEU B CG    1 
ATOM   4055 C CD1   . LEU B 1 228 ? 24.831  30.091  3.780   1.00 50.90 ? 228 LEU B CD1   1 
ATOM   4056 C CD2   . LEU B 1 228 ? 24.062  30.313  1.420   1.00 50.03 ? 228 LEU B CD2   1 
ATOM   4057 N N     . PHE B 1 229 ? 21.015  33.809  4.357   1.00 42.86 ? 229 PHE B N     1 
ATOM   4058 C CA    . PHE B 1 229 ? 20.704  35.246  4.224   1.00 40.52 ? 229 PHE B CA    1 
ATOM   4059 C C     . PHE B 1 229 ? 20.391  35.888  5.576   1.00 39.08 ? 229 PHE B C     1 
ATOM   4060 O O     . PHE B 1 229 ? 20.597  37.099  5.776   1.00 38.51 ? 229 PHE B O     1 
ATOM   4061 C CB    . PHE B 1 229 ? 19.563  35.504  3.182   1.00 42.22 ? 229 PHE B CB    1 
ATOM   4062 C CG    . PHE B 1 229 ? 18.179  35.221  3.698   1.00 42.97 ? 229 PHE B CG    1 
ATOM   4063 C CD1   . PHE B 1 229 ? 17.551  36.102  4.564   1.00 44.86 ? 229 PHE B CD1   1 
ATOM   4064 C CD2   . PHE B 1 229 ? 17.521  34.052  3.349   1.00 45.36 ? 229 PHE B CD2   1 
ATOM   4065 C CE1   . PHE B 1 229 ? 16.292  35.836  5.092   1.00 45.71 ? 229 PHE B CE1   1 
ATOM   4066 C CE2   . PHE B 1 229 ? 16.257  33.763  3.873   1.00 46.05 ? 229 PHE B CE2   1 
ATOM   4067 C CZ    . PHE B 1 229 ? 15.648  34.661  4.751   1.00 45.41 ? 229 PHE B CZ    1 
ATOM   4068 N N     . LEU B 1 230 ? 19.896  35.093  6.508   1.00 35.71 ? 230 LEU B N     1 
ATOM   4069 C CA    . LEU B 1 230 ? 19.602  35.622  7.842   1.00 38.53 ? 230 LEU B CA    1 
ATOM   4070 C C     . LEU B 1 230 ? 20.886  36.118  8.596   1.00 38.12 ? 230 LEU B C     1 
ATOM   4071 O O     . LEU B 1 230 ? 20.903  37.237  9.135   1.00 38.39 ? 230 LEU B O     1 
ATOM   4072 C CB    . LEU B 1 230 ? 18.901  34.544  8.707   1.00 39.80 ? 230 LEU B CB    1 
ATOM   4073 C CG    . LEU B 1 230 ? 17.480  34.154  8.203   1.00 41.04 ? 230 LEU B CG    1 
ATOM   4074 C CD1   . LEU B 1 230 ? 16.845  33.073  9.053   1.00 41.14 ? 230 LEU B CD1   1 
ATOM   4075 C CD2   . LEU B 1 230 ? 16.651  35.410  8.222   1.00 40.84 ? 230 LEU B CD2   1 
ATOM   4076 N N     . ILE B 1 231 ? 21.940  35.303  8.604   1.00 36.61 ? 231 ILE B N     1 
ATOM   4077 C CA    . ILE B 1 231 ? 23.150  35.684  9.361   1.00 36.36 ? 231 ILE B CA    1 
ATOM   4078 C C     . ILE B 1 231 ? 23.684  37.046  8.971   1.00 37.18 ? 231 ILE B C     1 
ATOM   4079 O O     . ILE B 1 231 ? 23.868  37.862  9.828   1.00 36.87 ? 231 ILE B O     1 
ATOM   4080 C CB    . ILE B 1 231 ? 24.235  34.609  9.272   1.00 35.39 ? 231 ILE B CB    1 
ATOM   4081 C CG1   . ILE B 1 231 ? 23.697  33.327  9.924   1.00 34.27 ? 231 ILE B CG1   1 
ATOM   4082 C CG2   . ILE B 1 231 ? 25.562  35.070  10.019  1.00 32.59 ? 231 ILE B CG2   1 
ATOM   4083 C CD1   . ILE B 1 231 ? 24.362  32.079  9.444   1.00 34.41 ? 231 ILE B CD1   1 
ATOM   4084 N N     . PRO B 1 232 ? 23.901  37.326  7.670   1.00 38.79 ? 232 PRO B N     1 
ATOM   4085 C CA    . PRO B 1 232 ? 24.426  38.673  7.376   1.00 40.81 ? 232 PRO B CA    1 
ATOM   4086 C C     . PRO B 1 232 ? 23.392  39.737  7.702   1.00 42.69 ? 232 PRO B C     1 
ATOM   4087 O O     . PRO B 1 232 ? 23.716  40.800  8.204   1.00 43.44 ? 232 PRO B O     1 
ATOM   4088 C CB    . PRO B 1 232 ? 24.717  38.625  5.860   1.00 39.77 ? 232 PRO B CB    1 
ATOM   4089 C CG    . PRO B 1 232 ? 24.921  37.183  5.559   1.00 39.97 ? 232 PRO B CG    1 
ATOM   4090 C CD    . PRO B 1 232 ? 23.958  36.448  6.475   1.00 38.82 ? 232 PRO B CD    1 
ATOM   4091 N N     . LYS B 1 233 ? 22.127  39.432  7.415   1.00 44.07 ? 233 LYS B N     1 
ATOM   4092 C CA    . LYS B 1 233 ? 21.048  40.376  7.665   1.00 46.15 ? 233 LYS B CA    1 
ATOM   4093 C C     . LYS B 1 233 ? 20.701  40.707  9.104   1.00 45.99 ? 233 LYS B C     1 
ATOM   4094 O O     . LYS B 1 233 ? 20.678  41.902  9.480   1.00 47.04 ? 233 LYS B O     1 
ATOM   4095 C CB    . LYS B 1 233 ? 19.757  39.912  6.970   1.00 47.58 ? 233 LYS B CB    1 
ATOM   4096 C CG    . LYS B 1 233 ? 18.610  40.901  7.143   1.00 50.23 ? 233 LYS B CG    1 
ATOM   4097 C CD    . LYS B 1 233 ? 17.230  40.249  6.999   1.00 51.13 ? 233 LYS B CD    1 
ATOM   4098 C CE    . LYS B 1 233 ? 16.924  39.837  5.559   1.00 52.17 ? 233 LYS B CE    1 
ATOM   4099 N NZ    . LYS B 1 233 ? 16.461  40.979  4.692   1.00 51.59 ? 233 LYS B NZ    1 
ATOM   4100 N N     . ASN B 1 234 ? 20.431  39.682  9.919   1.00 44.76 ? 234 ASN B N     1 
ATOM   4101 C CA    . ASN B 1 234 ? 19.991  39.944  11.307  1.00 44.90 ? 234 ASN B CA    1 
ATOM   4102 C C     . ASN B 1 234 ? 21.035  40.360  12.334  1.00 43.81 ? 234 ASN B C     1 
ATOM   4103 O O     . ASN B 1 234 ? 22.241  40.222  12.115  1.00 42.98 ? 234 ASN B O     1 
ATOM   4104 C CB    . ASN B 1 234 ? 19.274  38.736  11.921  1.00 45.08 ? 234 ASN B CB    1 
ATOM   4105 C CG    . ASN B 1 234 ? 18.085  38.258  11.105  1.00 47.57 ? 234 ASN B CG    1 
ATOM   4106 O OD1   . ASN B 1 234 ? 17.538  39.000  10.290  1.00 50.27 ? 234 ASN B OD1   1 
ATOM   4107 N ND2   . ASN B 1 234 ? 17.691  37.015  11.319  1.00 45.72 ? 234 ASN B ND2   1 
ATOM   4108 N N     . ASN B 1 235 ? 20.526  40.881  13.450  1.00 44.23 ? 235 ASN B N     1 
ATOM   4109 C CA    . ASN B 1 235 ? 21.362  41.230  14.610  1.00 42.86 ? 235 ASN B CA    1 
ATOM   4110 C C     . ASN B 1 235 ? 21.991  39.912  15.012  1.00 41.55 ? 235 ASN B C     1 
ATOM   4111 O O     . ASN B 1 235 ? 21.396  38.832  14.821  1.00 40.69 ? 235 ASN B O     1 
ATOM   4112 C CB    . ASN B 1 235 ? 20.543  41.686  15.801  1.00 43.01 ? 235 ASN B CB    1 
ATOM   4113 C CG    . ASN B 1 235 ? 19.848  43.003  15.574  1.00 47.08 ? 235 ASN B CG    1 
ATOM   4114 O OD1   . ASN B 1 235 ? 20.418  43.932  14.986  1.00 47.12 ? 235 ASN B OD1   1 
ATOM   4115 N ND2   . ASN B 1 235 ? 18.593  43.100  16.061  1.00 46.84 ? 235 ASN B ND2   1 
ATOM   4116 N N     . PRO B 1 236 ? 23.213  39.958  15.576  1.00 40.02 ? 236 PRO B N     1 
ATOM   4117 C CA    . PRO B 1 236 ? 23.826  38.675  15.969  1.00 38.08 ? 236 PRO B CA    1 
ATOM   4118 C C     . PRO B 1 236 ? 22.979  37.924  17.000  1.00 35.98 ? 236 PRO B C     1 
ATOM   4119 O O     . PRO B 1 236 ? 22.200  38.520  17.735  1.00 34.69 ? 236 PRO B O     1 
ATOM   4120 C CB    . PRO B 1 236 ? 25.226  39.089  16.527  1.00 37.57 ? 236 PRO B CB    1 
ATOM   4121 C CG    . PRO B 1 236 ? 25.016  40.505  16.967  1.00 37.91 ? 236 PRO B CG    1 
ATOM   4122 C CD    . PRO B 1 236 ? 24.039  41.118  15.972  1.00 39.55 ? 236 PRO B CD    1 
ATOM   4123 N N     . PRO B 1 237 ? 23.091  36.588  17.029  1.00 33.56 ? 237 PRO B N     1 
ATOM   4124 C CA    . PRO B 1 237 ? 22.300  35.864  18.022  1.00 35.47 ? 237 PRO B CA    1 
ATOM   4125 C C     . PRO B 1 237 ? 22.848  36.181  19.446  1.00 36.42 ? 237 PRO B C     1 
ATOM   4126 O O     . PRO B 1 237 ? 24.016  36.548  19.604  1.00 34.24 ? 237 PRO B O     1 
ATOM   4127 C CB    . PRO B 1 237 ? 22.539  34.389  17.674  1.00 35.97 ? 237 PRO B CB    1 
ATOM   4128 C CG    . PRO B 1 237 ? 23.550  34.338  16.550  1.00 32.31 ? 237 PRO B CG    1 
ATOM   4129 C CD    . PRO B 1 237 ? 23.638  35.721  15.974  1.00 33.59 ? 237 PRO B CD    1 
ATOM   4130 N N     . THR B 1 238 ? 22.006  36.051  20.449  1.00 36.54 ? 238 THR B N     1 
ATOM   4131 C CA    . THR B 1 238 ? 22.433  36.208  21.842  1.00 39.59 ? 238 THR B CA    1 
ATOM   4132 C C     . THR B 1 238 ? 21.921  34.942  22.561  1.00 41.44 ? 238 THR B C     1 
ATOM   4133 O O     . THR B 1 238 ? 21.026  34.272  22.080  1.00 41.39 ? 238 THR B O     1 
ATOM   4134 C CB    . THR B 1 238 ? 21.780  37.390  22.547  1.00 39.09 ? 238 THR B CB    1 
ATOM   4135 O OG1   . THR B 1 238 ? 20.368  37.200  22.527  1.00 41.88 ? 238 THR B OG1   1 
ATOM   4136 C CG2   . THR B 1 238 ? 22.197  38.745  21.898  1.00 41.07 ? 238 THR B CG2   1 
ATOM   4137 N N     . LEU B 1 239 ? 22.476  34.645  23.724  1.00 42.18 ? 239 LEU B N     1 
ATOM   4138 C CA    . LEU B 1 239 ? 22.074  33.502  24.510  1.00 43.20 ? 239 LEU B CA    1 
ATOM   4139 C C     . LEU B 1 239 ? 20.973  33.970  25.445  1.00 44.65 ? 239 LEU B C     1 
ATOM   4140 O O     . LEU B 1 239 ? 21.161  34.891  26.271  1.00 43.00 ? 239 LEU B O     1 
ATOM   4141 C CB    . LEU B 1 239 ? 23.262  32.993  25.336  1.00 41.82 ? 239 LEU B CB    1 
ATOM   4142 C CG    . LEU B 1 239 ? 22.984  31.856  26.300  1.00 41.79 ? 239 LEU B CG    1 
ATOM   4143 C CD1   . LEU B 1 239 ? 22.403  30.657  25.535  1.00 40.01 ? 239 LEU B CD1   1 
ATOM   4144 C CD2   . LEU B 1 239 ? 24.299  31.467  27.022  1.00 42.14 ? 239 LEU B CD2   1 
ATOM   4145 N N     . GLU B 1 240 ? 19.823  33.338  25.329  1.00 46.80 ? 240 GLU B N     1 
ATOM   4146 C CA    . GLU B 1 240 ? 18.710  33.742  26.167  1.00 50.45 ? 240 GLU B CA    1 
ATOM   4147 C C     . GLU B 1 240 ? 18.431  32.581  27.128  1.00 49.27 ? 240 GLU B C     1 
ATOM   4148 O O     . GLU B 1 240 ? 18.812  31.448  26.857  1.00 49.55 ? 240 GLU B O     1 
ATOM   4149 C CB    . GLU B 1 240 ? 17.483  34.031  25.294  1.00 54.47 ? 240 GLU B CB    1 
ATOM   4150 C CG    . GLU B 1 240 ? 16.703  32.760  24.908  1.00 60.40 ? 240 GLU B CG    1 
ATOM   4151 C CD    . GLU B 1 240 ? 15.432  33.075  24.114  1.00 63.37 ? 240 GLU B CD    1 
ATOM   4152 O OE1   . GLU B 1 240 ? 15.580  33.632  23.006  1.00 66.17 ? 240 GLU B OE1   1 
ATOM   4153 O OE2   . GLU B 1 240 ? 14.304  32.778  24.592  1.00 64.93 ? 240 GLU B OE2   1 
ATOM   4154 N N     . GLY B 1 241 ? 17.785  32.869  28.248  1.00 49.42 ? 241 GLY B N     1 
ATOM   4155 C CA    . GLY B 1 241 ? 17.484  31.824  29.213  1.00 49.14 ? 241 GLY B CA    1 
ATOM   4156 C C     . GLY B 1 241 ? 18.212  32.004  30.528  1.00 48.82 ? 241 GLY B C     1 
ATOM   4157 O O     . GLY B 1 241 ? 18.881  33.016  30.767  1.00 47.25 ? 241 GLY B O     1 
ATOM   4158 N N     . ASN B 1 242 ? 18.074  31.014  31.389  1.00 47.18 ? 242 ASN B N     1 
ATOM   4159 C CA    . ASN B 1 242 ? 18.713  31.050  32.678  1.00 48.77 ? 242 ASN B CA    1 
ATOM   4160 C C     . ASN B 1 242 ? 20.193  30.637  32.623  1.00 45.72 ? 242 ASN B C     1 
ATOM   4161 O O     . ASN B 1 242 ? 20.537  29.464  32.839  1.00 48.10 ? 242 ASN B O     1 
ATOM   4162 C CB    . ASN B 1 242 ? 17.959  30.155  33.672  1.00 51.26 ? 242 ASN B CB    1 
ATOM   4163 C CG    . ASN B 1 242 ? 18.703  30.025  34.984  1.00 54.93 ? 242 ASN B CG    1 
ATOM   4164 O OD1   . ASN B 1 242 ? 19.518  30.893  35.320  1.00 57.01 ? 242 ASN B OD1   1 
ATOM   4165 N ND2   . ASN B 1 242 ? 18.434  28.960  35.731  1.00 55.09 ? 242 ASN B ND2   1 
ATOM   4166 N N     . TYR B 1 243 ? 21.059  31.585  32.293  1.00 40.69 ? 243 TYR B N     1 
ATOM   4167 C CA    . TYR B 1 243 ? 22.489  31.343  32.252  1.00 37.10 ? 243 TYR B CA    1 
ATOM   4168 C C     . TYR B 1 243 ? 23.058  32.538  32.954  1.00 35.69 ? 243 TYR B C     1 
ATOM   4169 O O     . TYR B 1 243 ? 22.458  33.631  32.907  1.00 36.96 ? 243 TYR B O     1 
ATOM   4170 C CB    . TYR B 1 243 ? 23.040  31.312  30.806  1.00 37.46 ? 243 TYR B CB    1 
ATOM   4171 C CG    . TYR B 1 243 ? 22.428  30.187  29.992  1.00 37.36 ? 243 TYR B CG    1 
ATOM   4172 C CD1   . TYR B 1 243 ? 21.298  30.430  29.214  1.00 37.91 ? 243 TYR B CD1   1 
ATOM   4173 C CD2   . TYR B 1 243 ? 22.889  28.860  30.118  1.00 37.09 ? 243 TYR B CD2   1 
ATOM   4174 C CE1   . TYR B 1 243 ? 20.611  29.395  28.586  1.00 36.89 ? 243 TYR B CE1   1 
ATOM   4175 C CE2   . TYR B 1 243 ? 22.219  27.805  29.486  1.00 36.73 ? 243 TYR B CE2   1 
ATOM   4176 C CZ    . TYR B 1 243 ? 21.075  28.099  28.718  1.00 38.98 ? 243 TYR B CZ    1 
ATOM   4177 O OH    . TYR B 1 243 ? 20.390  27.134  28.022  1.00 40.01 ? 243 TYR B OH    1 
ATOM   4178 N N     . SER B 1 244 ? 24.193  32.352  33.620  1.00 31.34 ? 244 SER B N     1 
ATOM   4179 C CA    . SER B 1 244 ? 24.816  33.464  34.301  1.00 33.28 ? 244 SER B CA    1 
ATOM   4180 C C     . SER B 1 244 ? 25.101  34.600  33.310  1.00 33.55 ? 244 SER B C     1 
ATOM   4181 O O     . SER B 1 244 ? 25.186  34.384  32.088  1.00 33.30 ? 244 SER B O     1 
ATOM   4182 C CB    . SER B 1 244 ? 26.134  33.005  34.962  1.00 32.70 ? 244 SER B CB    1 
ATOM   4183 O OG    . SER B 1 244 ? 27.133  32.621  34.019  1.00 32.04 ? 244 SER B OG    1 
ATOM   4184 N N     . LYS B 1 245 ? 25.313  35.811  33.819  1.00 33.31 ? 245 LYS B N     1 
ATOM   4185 C CA    . LYS B 1 245 ? 25.601  36.922  32.923  1.00 32.47 ? 245 LYS B CA    1 
ATOM   4186 C C     . LYS B 1 245 ? 26.942  36.786  32.242  1.00 31.81 ? 245 LYS B C     1 
ATOM   4187 O O     . LYS B 1 245 ? 27.055  37.076  31.087  1.00 31.33 ? 245 LYS B O     1 
ATOM   4188 C CB    . LYS B 1 245 ? 25.524  38.276  33.669  1.00 35.53 ? 245 LYS B CB    1 
ATOM   4189 C CG    . LYS B 1 245 ? 25.023  39.419  32.767  1.00 41.81 ? 245 LYS B CG    1 
ATOM   4190 C CD    . LYS B 1 245 ? 24.829  40.752  33.576  1.00 47.16 ? 245 LYS B CD    1 
ATOM   4191 C CE    . LYS B 1 245 ? 23.710  41.672  32.982  1.00 51.32 ? 245 LYS B CE    1 
ATOM   4192 N NZ    . LYS B 1 245 ? 23.426  42.948  33.791  1.00 52.60 ? 245 LYS B NZ    1 
ATOM   4193 N N     . PRO B 1 246 ? 27.990  36.344  32.950  1.00 32.00 ? 246 PRO B N     1 
ATOM   4194 C CA    . PRO B 1 246 ? 29.287  36.208  32.284  1.00 32.11 ? 246 PRO B CA    1 
ATOM   4195 C C     . PRO B 1 246 ? 29.208  35.275  31.060  1.00 34.07 ? 246 PRO B C     1 
ATOM   4196 O O     . PRO B 1 246 ? 29.891  35.522  30.088  1.00 33.26 ? 246 PRO B O     1 
ATOM   4197 C CB    . PRO B 1 246 ? 30.158  35.633  33.353  1.00 30.91 ? 246 PRO B CB    1 
ATOM   4198 C CG    . PRO B 1 246 ? 29.608  36.212  34.569  1.00 30.67 ? 246 PRO B CG    1 
ATOM   4199 C CD    . PRO B 1 246 ? 28.126  36.103  34.387  1.00 32.36 ? 246 PRO B CD    1 
ATOM   4200 N N     . LEU B 1 247 ? 28.390  34.205  31.119  1.00 33.80 ? 247 LEU B N     1 
ATOM   4201 C CA    . LEU B 1 247 ? 28.279  33.320  29.954  1.00 32.63 ? 247 LEU B CA    1 
ATOM   4202 C C     . LEU B 1 247 ? 27.605  34.073  28.809  1.00 31.26 ? 247 LEU B C     1 
ATOM   4203 O O     . LEU B 1 247 ? 28.091  34.005  27.680  1.00 31.99 ? 247 LEU B O     1 
ATOM   4204 C CB    . LEU B 1 247 ? 27.466  32.045  30.258  1.00 31.54 ? 247 LEU B CB    1 
ATOM   4205 C CG    . LEU B 1 247 ? 27.192  31.177  28.998  1.00 32.23 ? 247 LEU B CG    1 
ATOM   4206 C CD1   . LEU B 1 247 ? 28.493  30.825  28.268  1.00 32.19 ? 247 LEU B CD1   1 
ATOM   4207 C CD2   . LEU B 1 247 ? 26.398  29.898  29.447  1.00 32.22 ? 247 LEU B CD2   1 
ATOM   4208 N N     . LYS B 1 248 ? 26.496  34.769  29.091  1.00 32.42 ? 248 LYS B N     1 
ATOM   4209 C CA    . LYS B 1 248 ? 25.784  35.556  28.073  1.00 30.60 ? 248 LYS B CA    1 
ATOM   4210 C C     . LYS B 1 248 ? 26.724  36.623  27.457  1.00 31.71 ? 248 LYS B C     1 
ATOM   4211 O O     . LYS B 1 248 ? 26.726  36.895  26.213  1.00 30.44 ? 248 LYS B O     1 
ATOM   4212 C CB    . LYS B 1 248 ? 24.563  36.226  28.700  1.00 32.00 ? 248 LYS B CB    1 
ATOM   4213 C CG    . LYS B 1 248 ? 23.399  35.279  29.006  1.00 30.77 ? 248 LYS B CG    1 
ATOM   4214 C CD    . LYS B 1 248 ? 22.335  36.004  29.800  1.00 30.70 ? 248 LYS B CD    1 
ATOM   4215 C CE    . LYS B 1 248 ? 21.277  35.022  30.252  1.00 33.35 ? 248 LYS B CE    1 
ATOM   4216 N NZ    . LYS B 1 248 ? 20.013  35.736  30.532  1.00 35.38 ? 248 LYS B NZ    1 
ATOM   4217 N N     . GLU B 1 249 ? 27.566  37.198  28.310  1.00 31.38 ? 249 GLU B N     1 
ATOM   4218 C CA    . GLU B 1 249 ? 28.528  38.221  27.836  1.00 32.44 ? 249 GLU B CA    1 
ATOM   4219 C C     . GLU B 1 249 ? 29.636  37.631  27.014  1.00 31.57 ? 249 GLU B C     1 
ATOM   4220 O O     . GLU B 1 249 ? 30.070  38.238  26.022  1.00 33.21 ? 249 GLU B O     1 
ATOM   4221 C CB    . GLU B 1 249 ? 29.059  39.028  29.018  1.00 36.31 ? 249 GLU B CB    1 
ATOM   4222 C CG    . GLU B 1 249 ? 27.968  39.886  29.619  1.00 38.97 ? 249 GLU B CG    1 
ATOM   4223 C CD    . GLU B 1 249 ? 28.444  40.836  30.743  1.00 45.25 ? 249 GLU B CD    1 
ATOM   4224 O OE1   . GLU B 1 249 ? 29.263  40.408  31.599  1.00 46.03 ? 249 GLU B OE1   1 
ATOM   4225 O OE2   . GLU B 1 249 ? 27.946  41.992  30.778  1.00 47.44 ? 249 GLU B OE2   1 
ATOM   4226 N N     . PHE B 1 250 ? 30.047  36.399  27.345  1.00 30.27 ? 250 PHE B N     1 
ATOM   4227 C CA    . PHE B 1 250 ? 31.066  35.722  26.581  1.00 28.41 ? 250 PHE B CA    1 
ATOM   4228 C C     . PHE B 1 250 ? 30.519  35.498  25.151  1.00 28.37 ? 250 PHE B C     1 
ATOM   4229 O O     . PHE B 1 250 ? 31.180  35.707  24.162  1.00 26.56 ? 250 PHE B O     1 
ATOM   4230 C CB    . PHE B 1 250 ? 31.379  34.393  27.284  1.00 29.61 ? 250 PHE B CB    1 
ATOM   4231 C CG    . PHE B 1 250 ? 32.346  33.538  26.559  1.00 27.58 ? 250 PHE B CG    1 
ATOM   4232 C CD1   . PHE B 1 250 ? 31.932  32.724  25.482  1.00 27.68 ? 250 PHE B CD1   1 
ATOM   4233 C CD2   . PHE B 1 250 ? 33.691  33.552  26.906  1.00 27.63 ? 250 PHE B CD2   1 
ATOM   4234 C CE1   . PHE B 1 250 ? 32.866  31.963  24.776  1.00 25.49 ? 250 PHE B CE1   1 
ATOM   4235 C CE2   . PHE B 1 250 ? 34.603  32.802  26.219  1.00 27.49 ? 250 PHE B CE2   1 
ATOM   4236 C CZ    . PHE B 1 250 ? 34.213  32.008  25.152  1.00 30.47 ? 250 PHE B CZ    1 
ATOM   4237 N N     . VAL B 1 251 ? 29.262  35.064  25.048  1.00 29.83 ? 251 VAL B N     1 
ATOM   4238 C CA    . VAL B 1 251 ? 28.649  34.830  23.747  1.00 27.77 ? 251 VAL B CA    1 
ATOM   4239 C C     . VAL B 1 251 ? 28.599  36.161  23.005  1.00 28.71 ? 251 VAL B C     1 
ATOM   4240 O O     . VAL B 1 251 ? 28.984  36.269  21.840  1.00 29.27 ? 251 VAL B O     1 
ATOM   4241 C CB    . VAL B 1 251 ? 27.198  34.226  23.931  1.00 27.85 ? 251 VAL B CB    1 
ATOM   4242 C CG1   . VAL B 1 251 ? 26.421  34.243  22.602  1.00 25.27 ? 251 VAL B CG1   1 
ATOM   4243 C CG2   . VAL B 1 251 ? 27.353  32.765  24.429  1.00 27.58 ? 251 VAL B CG2   1 
ATOM   4244 N N     . GLU B 1 252 ? 28.138  37.174  23.699  1.00 29.41 ? 252 GLU B N     1 
ATOM   4245 C CA    . GLU B 1 252 ? 28.031  38.508  23.107  1.00 31.45 ? 252 GLU B CA    1 
ATOM   4246 C C     . GLU B 1 252 ? 29.411  38.925  22.543  1.00 29.08 ? 252 GLU B C     1 
ATOM   4247 O O     . GLU B 1 252 ? 29.519  39.357  21.389  1.00 29.83 ? 252 GLU B O     1 
ATOM   4248 C CB    . GLU B 1 252 ? 27.578  39.462  24.195  1.00 35.01 ? 252 GLU B CB    1 
ATOM   4249 C CG    . GLU B 1 252 ? 26.324  40.198  23.889  1.00 44.66 ? 252 GLU B CG    1 
ATOM   4250 C CD    . GLU B 1 252 ? 26.492  41.667  24.241  1.00 49.66 ? 252 GLU B CD    1 
ATOM   4251 O OE1   . GLU B 1 252 ? 26.478  42.007  25.456  1.00 51.53 ? 252 GLU B OE1   1 
ATOM   4252 O OE2   . GLU B 1 252 ? 26.673  42.473  23.301  1.00 54.03 ? 252 GLU B OE2   1 
ATOM   4253 N N     . ALA B 1 253 ? 30.481  38.737  23.314  1.00 28.39 ? 253 ALA B N     1 
ATOM   4254 C CA    . ALA B 1 253 ? 31.798  39.153  22.831  1.00 27.81 ? 253 ALA B CA    1 
ATOM   4255 C C     . ALA B 1 253 ? 32.181  38.513  21.528  1.00 28.44 ? 253 ALA B C     1 
ATOM   4256 O O     . ALA B 1 253 ? 32.728  39.192  20.635  1.00 30.12 ? 253 ALA B O     1 
ATOM   4257 C CB    . ALA B 1 253 ? 32.901  38.928  23.898  1.00 28.50 ? 253 ALA B CB    1 
ATOM   4258 N N     . CYS B 1 254 ? 31.933  37.199  21.395  1.00 26.74 ? 254 CYS B N     1 
ATOM   4259 C CA    . CYS B 1 254 ? 32.238  36.490  20.184  1.00 27.19 ? 254 CYS B CA    1 
ATOM   4260 C C     . CYS B 1 254 ? 31.356  36.859  19.009  1.00 27.68 ? 254 CYS B C     1 
ATOM   4261 O O     . CYS B 1 254 ? 31.811  36.969  17.885  1.00 27.17 ? 254 CYS B O     1 
ATOM   4262 C CB    . CYS B 1 254 ? 32.095  34.953  20.389  1.00 29.00 ? 254 CYS B CB    1 
ATOM   4263 S SG    . CYS B 1 254 ? 33.276  34.218  21.543  1.00 31.18 ? 254 CYS B SG    1 
ATOM   4264 N N     . LEU B 1 255 ? 30.058  36.982  19.264  1.00 27.99 ? 255 LEU B N     1 
ATOM   4265 C CA    . LEU B 1 255 ? 29.116  37.220  18.169  1.00 28.18 ? 255 LEU B CA    1 
ATOM   4266 C C     . LEU B 1 255 ? 28.857  38.689  17.871  1.00 30.58 ? 255 LEU B C     1 
ATOM   4267 O O     . LEU B 1 255 ? 27.757  39.218  18.129  1.00 34.51 ? 255 LEU B O     1 
ATOM   4268 C CB    . LEU B 1 255 ? 27.783  36.507  18.488  1.00 27.02 ? 255 LEU B CB    1 
ATOM   4269 C CG    . LEU B 1 255 ? 27.960  34.999  18.735  1.00 23.72 ? 255 LEU B CG    1 
ATOM   4270 C CD1   . LEU B 1 255 ? 26.522  34.341  19.002  1.00 26.29 ? 255 LEU B CD1   1 
ATOM   4271 C CD2   . LEU B 1 255 ? 28.589  34.399  17.506  1.00 24.18 ? 255 LEU B CD2   1 
ATOM   4272 N N     . ASN B 1 256 ? 29.879  39.357  17.361  1.00 29.37 ? 256 ASN B N     1 
ATOM   4273 C CA    . ASN B 1 256 ? 29.724  40.780  17.022  1.00 31.45 ? 256 ASN B CA    1 
ATOM   4274 C C     . ASN B 1 256 ? 29.665  40.748  15.521  1.00 30.65 ? 256 ASN B C     1 
ATOM   4275 O O     . ASN B 1 256 ? 30.426  40.058  14.924  1.00 32.25 ? 256 ASN B O     1 
ATOM   4276 C CB    . ASN B 1 256 ? 30.961  41.571  17.445  1.00 29.54 ? 256 ASN B CB    1 
ATOM   4277 C CG    . ASN B 1 256 ? 30.722  43.083  17.396  1.00 31.73 ? 256 ASN B CG    1 
ATOM   4278 O OD1   . ASN B 1 256 ? 30.447  43.658  16.330  1.00 31.46 ? 256 ASN B OD1   1 
ATOM   4279 N ND2   . ASN B 1 256 ? 30.798  43.714  18.545  1.00 32.10 ? 256 ASN B ND2   1 
ATOM   4280 N N     . LYS B 1 257 ? 28.756  41.480  14.881  1.00 34.29 ? 257 LYS B N     1 
ATOM   4281 C CA    . LYS B 1 257 ? 28.757  41.417  13.412  1.00 34.19 ? 257 LYS B CA    1 
ATOM   4282 C C     . LYS B 1 257 ? 30.071  41.874  12.769  1.00 34.59 ? 257 LYS B C     1 
ATOM   4283 O O     . LYS B 1 257 ? 30.421  41.420  11.692  1.00 35.55 ? 257 LYS B O     1 
ATOM   4284 C CB    . LYS B 1 257 ? 27.590  42.227  12.851  1.00 36.77 ? 257 LYS B CB    1 
ATOM   4285 C CG    . LYS B 1 257 ? 26.196  41.726  13.358  1.00 38.08 ? 257 LYS B CG    1 
ATOM   4286 C CD    . LYS B 1 257 ? 25.824  40.361  12.727  1.00 38.92 ? 257 LYS B CD    1 
ATOM   4287 C CE    . LYS B 1 257 ? 25.660  40.441  11.195  1.00 41.79 ? 257 LYS B CE    1 
ATOM   4288 N NZ    . LYS B 1 257 ? 24.533  41.265  10.754  1.00 44.02 ? 257 LYS B NZ    1 
ATOM   4289 N N     . GLU B 1 258 ? 30.795  42.768  13.424  1.00 34.28 ? 258 GLU B N     1 
ATOM   4290 C CA    . GLU B 1 258 ? 32.065  43.314  12.895  1.00 34.12 ? 258 GLU B CA    1 
ATOM   4291 C C     . GLU B 1 258 ? 33.216  42.384  13.313  1.00 32.54 ? 258 GLU B C     1 
ATOM   4292 O O     . GLU B 1 258 ? 33.524  42.279  14.495  1.00 32.83 ? 258 GLU B O     1 
ATOM   4293 C CB    . GLU B 1 258 ? 32.285  44.725  13.471  1.00 35.52 ? 258 GLU B CB    1 
ATOM   4294 C CG    . GLU B 1 258 ? 33.695  45.282  13.146  1.00 36.37 ? 258 GLU B CG    1 
ATOM   4295 C CD    . GLU B 1 258 ? 33.994  45.155  11.703  1.00 40.91 ? 258 GLU B CD    1 
ATOM   4296 O OE1   . GLU B 1 258 ? 35.052  44.528  11.326  1.00 38.11 ? 258 GLU B OE1   1 
ATOM   4297 O OE2   . GLU B 1 258 ? 33.125  45.679  10.938  1.00 44.19 ? 258 GLU B OE2   1 
ATOM   4298 N N     . PRO B 1 259 ? 33.872  41.729  12.359  1.00 32.75 ? 259 PRO B N     1 
ATOM   4299 C CA    . PRO B 1 259 ? 34.942  40.835  12.812  1.00 34.16 ? 259 PRO B CA    1 
ATOM   4300 C C     . PRO B 1 259 ? 36.039  41.482  13.652  1.00 34.60 ? 259 PRO B C     1 
ATOM   4301 O O     . PRO B 1 259 ? 36.545  40.892  14.610  1.00 33.37 ? 259 PRO B O     1 
ATOM   4302 C CB    . PRO B 1 259 ? 35.452  40.201  11.512  1.00 31.90 ? 259 PRO B CB    1 
ATOM   4303 C CG    . PRO B 1 259 ? 34.982  41.105  10.457  1.00 33.23 ? 259 PRO B CG    1 
ATOM   4304 C CD    . PRO B 1 259 ? 33.708  41.662  10.894  1.00 32.83 ? 259 PRO B CD    1 
ATOM   4305 N N     . SER B 1 260 ? 36.363  42.724  13.348  1.00 34.54 ? 260 SER B N     1 
ATOM   4306 C CA    . SER B 1 260 ? 37.450  43.371  14.087  1.00 34.91 ? 260 SER B CA    1 
ATOM   4307 C C     . SER B 1 260 ? 37.098  43.655  15.530  1.00 32.90 ? 260 SER B C     1 
ATOM   4308 O O     . SER B 1 260 ? 37.975  43.933  16.340  1.00 33.53 ? 260 SER B O     1 
ATOM   4309 C CB    . SER B 1 260 ? 37.839  44.695  13.382  1.00 35.92 ? 260 SER B CB    1 
ATOM   4310 O OG    . SER B 1 260 ? 38.238  44.402  12.078  1.00 36.55 ? 260 SER B OG    1 
ATOM   4311 N N     . PHE B 1 261 ? 35.800  43.673  15.847  1.00 32.41 ? 261 PHE B N     1 
ATOM   4312 C CA    . PHE B 1 261 ? 35.366  43.931  17.204  1.00 29.95 ? 261 PHE B CA    1 
ATOM   4313 C C     . PHE B 1 261 ? 35.373  42.682  18.108  1.00 30.15 ? 261 PHE B C     1 
ATOM   4314 O O     . PHE B 1 261 ? 35.100  42.752  19.292  1.00 31.59 ? 261 PHE B O     1 
ATOM   4315 C CB    . PHE B 1 261 ? 33.992  44.589  17.153  1.00 33.40 ? 261 PHE B CB    1 
ATOM   4316 C CG    . PHE B 1 261 ? 33.996  45.930  16.488  1.00 34.92 ? 261 PHE B CG    1 
ATOM   4317 C CD1   . PHE B 1 261 ? 35.213  46.509  16.048  1.00 35.69 ? 261 PHE B CD1   1 
ATOM   4318 C CD2   . PHE B 1 261 ? 32.817  46.645  16.336  1.00 34.98 ? 261 PHE B CD2   1 
ATOM   4319 C CE1   . PHE B 1 261 ? 35.246  47.828  15.466  1.00 37.63 ? 261 PHE B CE1   1 
ATOM   4320 C CE2   . PHE B 1 261 ? 32.829  47.946  15.753  1.00 37.11 ? 261 PHE B CE2   1 
ATOM   4321 C CZ    . PHE B 1 261 ? 34.074  48.538  15.321  1.00 36.86 ? 261 PHE B CZ    1 
ATOM   4322 N N     . ARG B 1 262 ? 35.697  41.536  17.544  1.00 31.28 ? 262 ARG B N     1 
ATOM   4323 C CA    . ARG B 1 262 ? 35.768  40.274  18.311  1.00 29.66 ? 262 ARG B CA    1 
ATOM   4324 C C     . ARG B 1 262 ? 37.189  40.129  18.919  1.00 31.93 ? 262 ARG B C     1 
ATOM   4325 O O     . ARG B 1 262 ? 38.189  40.446  18.281  1.00 30.98 ? 262 ARG B O     1 
ATOM   4326 C CB    . ARG B 1 262 ? 35.525  39.092  17.400  1.00 28.78 ? 262 ARG B CB    1 
ATOM   4327 C CG    . ARG B 1 262 ? 34.101  39.122  16.704  1.00 29.94 ? 262 ARG B CG    1 
ATOM   4328 C CD    . ARG B 1 262 ? 33.897  37.881  15.758  1.00 29.94 ? 262 ARG B CD    1 
ATOM   4329 N NE    . ARG B 1 262 ? 32.891  38.233  14.744  1.00 27.37 ? 262 ARG B NE    1 
ATOM   4330 C CZ    . ARG B 1 262 ? 32.994  37.906  13.459  1.00 26.04 ? 262 ARG B CZ    1 
ATOM   4331 N NH1   . ARG B 1 262 ? 34.006  37.183  12.976  1.00 27.79 ? 262 ARG B NH1   1 
ATOM   4332 N NH2   . ARG B 1 262 ? 32.122  38.416  12.623  1.00 26.82 ? 262 ARG B NH2   1 
ATOM   4333 N N     . PRO B 1 263 ? 37.247  39.672  20.176  1.00 32.59 ? 263 PRO B N     1 
ATOM   4334 C CA    . PRO B 1 263 ? 38.514  39.473  20.880  1.00 32.36 ? 263 PRO B CA    1 
ATOM   4335 C C     . PRO B 1 263 ? 39.248  38.277  20.318  1.00 33.39 ? 263 PRO B C     1 
ATOM   4336 O O     . PRO B 1 263 ? 38.651  37.401  19.638  1.00 34.13 ? 263 PRO B O     1 
ATOM   4337 C CB    . PRO B 1 263 ? 38.069  39.253  22.315  1.00 29.14 ? 263 PRO B CB    1 
ATOM   4338 C CG    . PRO B 1 263 ? 36.678  38.557  22.158  1.00 33.21 ? 263 PRO B CG    1 
ATOM   4339 C CD    . PRO B 1 263 ? 36.061  39.318  21.010  1.00 31.33 ? 263 PRO B CD    1 
ATOM   4340 N N     . THR B 1 264 ? 40.549  38.212  20.584  1.00 29.89 ? 264 THR B N     1 
ATOM   4341 C CA    . THR B 1 264 ? 41.308  37.058  20.174  1.00 26.42 ? 264 THR B CA    1 
ATOM   4342 C C     . THR B 1 264 ? 40.979  35.901  21.143  1.00 25.17 ? 264 THR B C     1 
ATOM   4343 O O     . THR B 1 264 ? 40.437  36.082  22.200  1.00 27.73 ? 264 THR B O     1 
ATOM   4344 C CB    . THR B 1 264 ? 42.865  37.291  20.369  1.00 28.21 ? 264 THR B CB    1 
ATOM   4345 O OG1   . THR B 1 264 ? 43.098  37.677  21.742  1.00 24.65 ? 264 THR B OG1   1 
ATOM   4346 C CG2   . THR B 1 264 ? 43.419  38.356  19.391  1.00 26.60 ? 264 THR B CG2   1 
ATOM   4347 N N     . ALA B 1 265 ? 41.388  34.710  20.795  1.00 27.30 ? 265 ALA B N     1 
ATOM   4348 C CA    . ALA B 1 265 ? 41.205  33.535  21.645  1.00 26.70 ? 265 ALA B CA    1 
ATOM   4349 C C     . ALA B 1 265 ? 42.029  33.710  22.944  1.00 29.80 ? 265 ALA B C     1 
ATOM   4350 O O     . ALA B 1 265 ? 41.554  33.388  24.054  1.00 30.57 ? 265 ALA B O     1 
ATOM   4351 C CB    . ALA B 1 265 ? 41.629  32.286  20.878  1.00 23.84 ? 265 ALA B CB    1 
ATOM   4352 N N     . LYS B 1 266 ? 43.246  34.223  22.829  1.00 31.24 ? 266 LYS B N     1 
ATOM   4353 C CA    . LYS B 1 266 ? 44.091  34.520  24.015  1.00 32.91 ? 266 LYS B CA    1 
ATOM   4354 C C     . LYS B 1 266 ? 43.334  35.365  25.041  1.00 30.86 ? 266 LYS B C     1 
ATOM   4355 O O     . LYS B 1 266 ? 43.316  35.093  26.238  1.00 32.80 ? 266 LYS B O     1 
ATOM   4356 C CB    . LYS B 1 266 ? 45.336  35.302  23.560  1.00 36.55 ? 266 LYS B CB    1 
ATOM   4357 C CG    . LYS B 1 266 ? 46.502  35.366  24.577  1.00 43.04 ? 266 LYS B CG    1 
ATOM   4358 C CD    . LYS B 1 266 ? 47.720  36.170  24.015  1.00 45.36 ? 266 LYS B CD    1 
ATOM   4359 C CE    . LYS B 1 266 ? 48.720  35.338  23.179  1.00 48.25 ? 266 LYS B CE    1 
ATOM   4360 N NZ    . LYS B 1 266 ? 48.146  34.571  22.021  1.00 51.16 ? 266 LYS B NZ    1 
ATOM   4361 N N     . GLU B 1 267 ? 42.680  36.398  24.586  1.00 29.03 ? 267 GLU B N     1 
ATOM   4362 C CA    . GLU B 1 267 ? 41.910  37.254  25.481  1.00 28.73 ? 267 GLU B CA    1 
ATOM   4363 C C     . GLU B 1 267 ? 40.647  36.606  26.060  1.00 30.19 ? 267 GLU B C     1 
ATOM   4364 O O     . GLU B 1 267 ? 40.325  36.818  27.213  1.00 29.36 ? 267 GLU B O     1 
ATOM   4365 C CB    . GLU B 1 267 ? 41.584  38.557  24.780  1.00 32.23 ? 267 GLU B CB    1 
ATOM   4366 C CG    . GLU B 1 267 ? 42.762  39.585  24.811  1.00 34.51 ? 267 GLU B CG    1 
ATOM   4367 C CD    . GLU B 1 267 ? 43.171  40.000  26.244  1.00 39.91 ? 267 GLU B CD    1 
ATOM   4368 O OE1   . GLU B 1 267 ? 42.337  40.630  26.977  1.00 42.76 ? 267 GLU B OE1   1 
ATOM   4369 O OE2   . GLU B 1 267 ? 44.328  39.705  26.628  1.00 38.58 ? 267 GLU B OE2   1 
ATOM   4370 N N     . LEU B 1 268 ? 39.943  35.793  25.259  1.00 31.34 ? 268 LEU B N     1 
ATOM   4371 C CA    . LEU B 1 268 ? 38.737  35.081  25.747  1.00 30.04 ? 268 LEU B CA    1 
ATOM   4372 C C     . LEU B 1 268 ? 39.143  34.110  26.851  1.00 28.97 ? 268 LEU B C     1 
ATOM   4373 O O     . LEU B 1 268 ? 38.354  33.795  27.744  1.00 30.54 ? 268 LEU B O     1 
ATOM   4374 C CB    . LEU B 1 268 ? 38.073  34.350  24.564  1.00 27.46 ? 268 LEU B CB    1 
ATOM   4375 C CG    . LEU B 1 268 ? 37.382  35.407  23.676  1.00 28.31 ? 268 LEU B CG    1 
ATOM   4376 C CD1   . LEU B 1 268 ? 37.024  34.816  22.279  1.00 30.73 ? 268 LEU B CD1   1 
ATOM   4377 C CD2   . LEU B 1 268 ? 36.099  35.929  24.417  1.00 29.54 ? 268 LEU B CD2   1 
ATOM   4378 N N     . LEU B 1 269 ? 40.377  33.639  26.803  1.00 30.89 ? 269 LEU B N     1 
ATOM   4379 C CA    . LEU B 1 269 ? 40.872  32.734  27.840  1.00 32.70 ? 269 LEU B CA    1 
ATOM   4380 C C     . LEU B 1 269 ? 40.876  33.399  29.224  1.00 34.76 ? 269 LEU B C     1 
ATOM   4381 O O     . LEU B 1 269 ? 40.835  32.717  30.242  1.00 35.35 ? 269 LEU B O     1 
ATOM   4382 C CB    . LEU B 1 269 ? 42.276  32.189  27.456  1.00 33.72 ? 269 LEU B CB    1 
ATOM   4383 C CG    . LEU B 1 269 ? 42.383  31.067  26.435  1.00 33.81 ? 269 LEU B CG    1 
ATOM   4384 C CD1   . LEU B 1 269 ? 43.838  30.859  25.985  1.00 37.19 ? 269 LEU B CD1   1 
ATOM   4385 C CD2   . LEU B 1 269 ? 41.856  29.788  27.086  1.00 37.33 ? 269 LEU B CD2   1 
ATOM   4386 N N     . LYS B 1 270 ? 40.872  34.735  29.255  1.00 35.28 ? 270 LYS B N     1 
ATOM   4387 C CA    . LYS B 1 270 ? 40.857  35.525  30.495  1.00 35.50 ? 270 LYS B CA    1 
ATOM   4388 C C     . LYS B 1 270 ? 39.473  36.071  30.786  1.00 35.68 ? 270 LYS B C     1 
ATOM   4389 O O     . LYS B 1 270 ? 39.247  36.785  31.737  1.00 34.35 ? 270 LYS B O     1 
ATOM   4390 C CB    . LYS B 1 270 ? 41.891  36.665  30.361  1.00 38.30 ? 270 LYS B CB    1 
ATOM   4391 C CG    . LYS B 1 270 ? 43.291  36.062  29.980  1.00 38.65 ? 270 LYS B CG    1 
ATOM   4392 C CD    . LYS B 1 270 ? 44.401  37.001  29.376  1.00 43.18 ? 270 LYS B CD    1 
ATOM   4393 C CE    . LYS B 1 270 ? 45.796  36.325  29.616  1.00 45.36 ? 270 LYS B CE    1 
ATOM   4394 N NZ    . LYS B 1 270 ? 46.853  36.391  28.532  1.00 44.91 ? 270 LYS B NZ    1 
ATOM   4395 N N     . HIS B 1 271 ? 38.504  35.697  29.952  1.00 35.40 ? 271 HIS B N     1 
ATOM   4396 C CA    . HIS B 1 271 ? 37.170  36.178  30.154  1.00 33.46 ? 271 HIS B CA    1 
ATOM   4397 C C     . HIS B 1 271 ? 36.731  35.682  31.494  1.00 35.10 ? 271 HIS B C     1 
ATOM   4398 O O     . HIS B 1 271 ? 37.074  34.548  31.841  1.00 36.15 ? 271 HIS B O     1 
ATOM   4399 C CB    . HIS B 1 271 ? 36.234  35.633  29.079  1.00 33.37 ? 271 HIS B CB    1 
ATOM   4400 C CG    . HIS B 1 271 ? 34.954  36.384  29.001  1.00 32.01 ? 271 HIS B CG    1 
ATOM   4401 N ND1   . HIS B 1 271 ? 33.880  36.107  29.821  1.00 32.35 ? 271 HIS B ND1   1 
ATOM   4402 C CD2   . HIS B 1 271 ? 34.608  37.473  28.266  1.00 33.08 ? 271 HIS B CD2   1 
ATOM   4403 C CE1   . HIS B 1 271 ? 32.923  36.989  29.593  1.00 34.45 ? 271 HIS B CE1   1 
ATOM   4404 N NE2   . HIS B 1 271 ? 33.339  37.831  28.655  1.00 32.40 ? 271 HIS B NE2   1 
ATOM   4405 N N     . LYS B 1 272 ? 36.012  36.511  32.265  1.00 33.95 ? 272 LYS B N     1 
ATOM   4406 C CA    . LYS B 1 272 ? 35.546  36.063  33.571  1.00 35.98 ? 272 LYS B CA    1 
ATOM   4407 C C     . LYS B 1 272 ? 34.648  34.804  33.541  1.00 35.20 ? 272 LYS B C     1 
ATOM   4408 O O     . LYS B 1 272 ? 34.638  34.063  34.504  1.00 32.52 ? 272 LYS B O     1 
ATOM   4409 C CB    . LYS B 1 272 ? 34.887  37.186  34.362  1.00 37.74 ? 272 LYS B CB    1 
ATOM   4410 C CG    . LYS B 1 272 ? 33.452  37.517  34.146  1.00 44.25 ? 272 LYS B CG    1 
ATOM   4411 C CD    . LYS B 1 272 ? 32.816  37.889  35.513  1.00 47.65 ? 272 LYS B CD    1 
ATOM   4412 C CE    . LYS B 1 272 ? 32.603  39.425  35.722  1.00 51.23 ? 272 LYS B CE    1 
ATOM   4413 N NZ    . LYS B 1 272 ? 31.287  39.992  35.153  1.00 52.76 ? 272 LYS B NZ    1 
ATOM   4414 N N     . PHE B 1 273 ? 33.901  34.551  32.456  1.00 34.10 ? 273 PHE B N     1 
ATOM   4415 C CA    . PHE B 1 273 ? 33.114  33.308  32.428  1.00 32.52 ? 273 PHE B CA    1 
ATOM   4416 C C     . PHE B 1 273 ? 34.066  32.079  32.510  1.00 31.93 ? 273 PHE B C     1 
ATOM   4417 O O     . PHE B 1 273 ? 33.771  31.108  33.170  1.00 29.87 ? 273 PHE B O     1 
ATOM   4418 C CB    . PHE B 1 273 ? 32.303  33.169  31.128  1.00 33.22 ? 273 PHE B CB    1 
ATOM   4419 C CG    . PHE B 1 273 ? 31.613  31.802  31.003  1.00 31.11 ? 273 PHE B CG    1 
ATOM   4420 C CD1   . PHE B 1 273 ? 30.677  31.417  31.939  1.00 30.08 ? 273 PHE B CD1   1 
ATOM   4421 C CD2   . PHE B 1 273 ? 31.992  30.893  30.035  1.00 30.36 ? 273 PHE B CD2   1 
ATOM   4422 C CE1   . PHE B 1 273 ? 30.127  30.122  31.927  1.00 30.58 ? 273 PHE B CE1   1 
ATOM   4423 C CE2   . PHE B 1 273 ? 31.423  29.578  30.021  1.00 29.43 ? 273 PHE B CE2   1 
ATOM   4424 C CZ    . PHE B 1 273 ? 30.502  29.231  30.990  1.00 27.99 ? 273 PHE B CZ    1 
ATOM   4425 N N     . ILE B 1 274 ? 35.210  32.142  31.822  1.00 31.13 ? 274 ILE B N     1 
ATOM   4426 C CA    . ILE B 1 274 ? 36.145  31.038  31.831  1.00 32.25 ? 274 ILE B CA    1 
ATOM   4427 C C     . ILE B 1 274 ? 36.903  30.894  33.192  1.00 34.51 ? 274 ILE B C     1 
ATOM   4428 O O     . ILE B 1 274 ? 37.070  29.758  33.756  1.00 32.20 ? 274 ILE B O     1 
ATOM   4429 C CB    . ILE B 1 274 ? 37.171  31.212  30.656  1.00 32.82 ? 274 ILE B CB    1 
ATOM   4430 C CG1   . ILE B 1 274 ? 36.477  31.090  29.272  1.00 32.60 ? 274 ILE B CG1   1 
ATOM   4431 C CG2   . ILE B 1 274 ? 38.274  30.190  30.752  1.00 32.99 ? 274 ILE B CG2   1 
ATOM   4432 C CD1   . ILE B 1 274 ? 35.930  29.664  28.886  1.00 31.61 ? 274 ILE B CD1   1 
ATOM   4433 N N     . LEU B 1 275 ? 37.375  32.039  33.701  1.00 33.69 ? 275 LEU B N     1 
ATOM   4434 C CA    . LEU B 1 275 ? 38.155  32.073  34.928  1.00 35.59 ? 275 LEU B CA    1 
ATOM   4435 C C     . LEU B 1 275 ? 37.352  31.604  36.106  1.00 35.24 ? 275 LEU B C     1 
ATOM   4436 O O     . LEU B 1 275 ? 37.894  30.935  36.977  1.00 35.83 ? 275 LEU B O     1 
ATOM   4437 C CB    . LEU B 1 275 ? 38.661  33.506  35.221  1.00 36.51 ? 275 LEU B CB    1 
ATOM   4438 C CG    . LEU B 1 275 ? 39.678  33.940  34.183  1.00 36.65 ? 275 LEU B CG    1 
ATOM   4439 C CD1   . LEU B 1 275 ? 40.457  35.138  34.666  1.00 40.00 ? 275 LEU B CD1   1 
ATOM   4440 C CD2   . LEU B 1 275 ? 40.626  32.745  33.965  1.00 38.74 ? 275 LEU B CD2   1 
ATOM   4441 N N     . ARG B 1 276 ? 36.065  31.942  36.101  1.00 33.95 ? 276 ARG B N     1 
ATOM   4442 C CA    . ARG B 1 276 ? 35.164  31.602  37.178  1.00 34.27 ? 276 ARG B CA    1 
ATOM   4443 C C     . ARG B 1 276 ? 34.547  30.189  37.155  1.00 33.24 ? 276 ARG B C     1 
ATOM   4444 O O     . ARG B 1 276 ? 34.109  29.684  38.204  1.00 32.56 ? 276 ARG B O     1 
ATOM   4445 C CB    . ARG B 1 276 ? 33.979  32.566  37.202  1.00 37.02 ? 276 ARG B CB    1 
ATOM   4446 C CG    . ARG B 1 276 ? 34.196  33.944  37.788  1.00 42.91 ? 276 ARG B CG    1 
ATOM   4447 C CD    . ARG B 1 276 ? 32.818  34.528  38.165  1.00 47.09 ? 276 ARG B CD    1 
ATOM   4448 N NE    . ARG B 1 276 ? 32.905  35.970  38.426  1.00 52.52 ? 276 ARG B NE    1 
ATOM   4449 C CZ    . ARG B 1 276 ? 31.863  36.803  38.477  1.00 52.49 ? 276 ARG B CZ    1 
ATOM   4450 N NH1   . ARG B 1 276 ? 30.617  36.362  38.297  1.00 51.43 ? 276 ARG B NH1   1 
ATOM   4451 N NH2   . ARG B 1 276 ? 32.081  38.095  38.654  1.00 54.47 ? 276 ARG B NH2   1 
ATOM   4452 N N     . ASN B 1 277 ? 34.440  29.585  35.982  1.00 32.52 ? 277 ASN B N     1 
ATOM   4453 C CA    . ASN B 1 277 ? 33.763  28.281  35.897  1.00 33.73 ? 277 ASN B CA    1 
ATOM   4454 C C     . ASN B 1 277 ? 34.564  27.114  35.410  1.00 33.17 ? 277 ASN B C     1 
ATOM   4455 O O     . ASN B 1 277 ? 34.250  25.959  35.718  1.00 31.96 ? 277 ASN B O     1 
ATOM   4456 C CB    . ASN B 1 277 ? 32.517  28.413  35.002  1.00 33.05 ? 277 ASN B CB    1 
ATOM   4457 C CG    . ASN B 1 277 ? 31.582  29.528  35.447  1.00 36.05 ? 277 ASN B CG    1 
ATOM   4458 O OD1   . ASN B 1 277 ? 31.683  30.681  34.968  1.00 36.40 ? 277 ASN B OD1   1 
ATOM   4459 N ND2   . ASN B 1 277 ? 30.682  29.211  36.381  1.00 34.43 ? 277 ASN B ND2   1 
ATOM   4460 N N     . ALA B 1 278 ? 35.601  27.401  34.634  1.00 35.53 ? 278 ALA B N     1 
ATOM   4461 C CA    . ALA B 1 278 ? 36.393  26.352  34.047  1.00 35.46 ? 278 ALA B CA    1 
ATOM   4462 C C     . ALA B 1 278 ? 37.170  25.571  35.105  1.00 38.84 ? 278 ALA B C     1 
ATOM   4463 O O     . ALA B 1 278 ? 37.695  26.148  36.031  1.00 36.29 ? 278 ALA B O     1 
ATOM   4464 C CB    . ALA B 1 278 ? 37.326  26.941  33.023  1.00 35.77 ? 278 ALA B CB    1 
ATOM   4465 N N     . LYS B 1 279 ? 37.261  24.253  34.937  1.00 39.75 ? 279 LYS B N     1 
ATOM   4466 C CA    . LYS B 1 279 ? 37.984  23.433  35.886  1.00 42.78 ? 279 LYS B CA    1 
ATOM   4467 C C     . LYS B 1 279 ? 38.895  22.482  35.166  1.00 43.75 ? 279 LYS B C     1 
ATOM   4468 O O     . LYS B 1 279 ? 39.025  22.532  33.962  1.00 44.37 ? 279 LYS B O     1 
ATOM   4469 C CB    . LYS B 1 279 ? 37.014  22.593  36.750  1.00 44.26 ? 279 LYS B CB    1 
ATOM   4470 C CG    . LYS B 1 279 ? 36.682  23.163  38.120  1.00 46.46 ? 279 LYS B CG    1 
ATOM   4471 C CD    . LYS B 1 279 ? 35.220  23.578  38.233  1.00 47.78 ? 279 LYS B CD    1 
ATOM   4472 C CE    . LYS B 1 279 ? 34.730  23.676  39.690  1.00 50.56 ? 279 LYS B CE    1 
ATOM   4473 N NZ    . LYS B 1 279 ? 35.089  24.955  40.413  1.00 51.38 ? 279 LYS B NZ    1 
ATOM   4474 N N     . LYS B 1 280 ? 39.496  21.586  35.937  1.00 44.04 ? 280 LYS B N     1 
ATOM   4475 C CA    . LYS B 1 280 ? 40.414  20.563  35.444  1.00 44.63 ? 280 LYS B CA    1 
ATOM   4476 C C     . LYS B 1 280 ? 39.700  19.713  34.366  1.00 42.52 ? 280 LYS B C     1 
ATOM   4477 O O     . LYS B 1 280 ? 38.552  19.321  34.561  1.00 42.02 ? 280 LYS B O     1 
ATOM   4478 C CB    . LYS B 1 280 ? 40.785  19.700  36.655  1.00 48.06 ? 280 LYS B CB    1 
ATOM   4479 C CG    . LYS B 1 280 ? 42.148  19.030  36.690  1.00 53.45 ? 280 LYS B CG    1 
ATOM   4480 C CD    . LYS B 1 280 ? 42.129  17.961  37.850  1.00 55.91 ? 280 LYS B CD    1 
ATOM   4481 C CE    . LYS B 1 280 ? 43.471  17.157  38.025  1.00 57.89 ? 280 LYS B CE    1 
ATOM   4482 N NZ    . LYS B 1 280 ? 43.792  16.127  36.961  1.00 56.27 ? 280 LYS B NZ    1 
ATOM   4483 N N     . THR B 1 281 ? 40.368  19.427  33.243  1.00 41.74 ? 281 THR B N     1 
ATOM   4484 C CA    . THR B 1 281 ? 39.747  18.612  32.190  1.00 41.97 ? 281 THR B CA    1 
ATOM   4485 C C     . THR B 1 281 ? 39.360  17.193  32.662  1.00 42.37 ? 281 THR B C     1 
ATOM   4486 O O     . THR B 1 281 ? 38.424  16.584  32.134  1.00 41.55 ? 281 THR B O     1 
ATOM   4487 C CB    . THR B 1 281 ? 40.671  18.459  30.969  1.00 40.62 ? 281 THR B CB    1 
ATOM   4488 O OG1   . THR B 1 281 ? 41.981  18.136  31.417  1.00 40.61 ? 281 THR B OG1   1 
ATOM   4489 C CG2   . THR B 1 281 ? 40.726  19.746  30.177  1.00 39.95 ? 281 THR B CG2   1 
ATOM   4490 N N     . SER B 1 282 ? 40.056  16.674  33.666  1.00 41.68 ? 282 SER B N     1 
ATOM   4491 C CA    . SER B 1 282 ? 39.722  15.334  34.127  1.00 42.57 ? 282 SER B CA    1 
ATOM   4492 C C     . SER B 1 282 ? 38.302  15.230  34.704  1.00 42.13 ? 282 SER B C     1 
ATOM   4493 O O     . SER B 1 282 ? 37.710  14.171  34.669  1.00 41.21 ? 282 SER B O     1 
ATOM   4494 C CB    . SER B 1 282 ? 40.802  14.811  35.098  1.00 42.42 ? 282 SER B CB    1 
ATOM   4495 O OG    . SER B 1 282 ? 40.769  15.512  36.323  1.00 45.38 ? 282 SER B OG    1 
ATOM   4496 N N     . TYR B 1 283 ? 37.720  16.327  35.188  1.00 43.38 ? 283 TYR B N     1 
ATOM   4497 C CA    . TYR B 1 283 ? 36.343  16.246  35.684  1.00 43.26 ? 283 TYR B CA    1 
ATOM   4498 C C     . TYR B 1 283 ? 35.397  15.969  34.518  1.00 42.55 ? 283 TYR B C     1 
ATOM   4499 O O     . TYR B 1 283 ? 34.208  15.702  34.744  1.00 43.72 ? 283 TYR B O     1 
ATOM   4500 C CB    . TYR B 1 283 ? 35.889  17.549  36.385  1.00 47.30 ? 283 TYR B CB    1 
ATOM   4501 C CG    . TYR B 1 283 ? 36.658  17.876  37.664  1.00 51.82 ? 283 TYR B CG    1 
ATOM   4502 C CD1   . TYR B 1 283 ? 37.265  19.127  37.837  1.00 53.85 ? 283 TYR B CD1   1 
ATOM   4503 C CD2   . TYR B 1 283 ? 36.810  16.933  38.680  1.00 52.38 ? 283 TYR B CD2   1 
ATOM   4504 C CE1   . TYR B 1 283 ? 38.015  19.426  38.995  1.00 55.57 ? 283 TYR B CE1   1 
ATOM   4505 C CE2   . TYR B 1 283 ? 37.548  17.229  39.832  1.00 55.36 ? 283 TYR B CE2   1 
ATOM   4506 C CZ    . TYR B 1 283 ? 38.147  18.473  39.979  1.00 55.12 ? 283 TYR B CZ    1 
ATOM   4507 O OH    . TYR B 1 283 ? 38.889  18.764  41.105  1.00 55.95 ? 283 TYR B OH    1 
ATOM   4508 N N     . LEU B 1 284 ? 35.889  16.065  33.275  1.00 39.10 ? 284 LEU B N     1 
ATOM   4509 C CA    . LEU B 1 284 ? 35.035  15.773  32.127  1.00 37.43 ? 284 LEU B CA    1 
ATOM   4510 C C     . LEU B 1 284 ? 34.828  14.259  31.957  1.00 37.17 ? 284 LEU B C     1 
ATOM   4511 O O     . LEU B 1 284 ? 33.975  13.847  31.159  1.00 33.87 ? 284 LEU B O     1 
ATOM   4512 C CB    . LEU B 1 284 ? 35.609  16.362  30.818  1.00 37.56 ? 284 LEU B CB    1 
ATOM   4513 C CG    . LEU B 1 284 ? 35.643  17.911  30.737  1.00 36.16 ? 284 LEU B CG    1 
ATOM   4514 C CD1   . LEU B 1 284 ? 36.297  18.394  29.397  1.00 33.53 ? 284 LEU B CD1   1 
ATOM   4515 C CD2   . LEU B 1 284 ? 34.187  18.429  30.833  1.00 35.85 ? 284 LEU B CD2   1 
ATOM   4516 N N     . THR B 1 285 ? 35.572  13.441  32.714  1.00 37.25 ? 285 THR B N     1 
ATOM   4517 C CA    . THR B 1 285 ? 35.366  11.998  32.582  1.00 39.80 ? 285 THR B CA    1 
ATOM   4518 C C     . THR B 1 285 ? 33.947  11.657  33.033  1.00 40.98 ? 285 THR B C     1 
ATOM   4519 O O     . THR B 1 285 ? 33.370  10.646  32.578  1.00 42.44 ? 285 THR B O     1 
ATOM   4520 C CB    . THR B 1 285 ? 36.338  11.169  33.404  1.00 40.04 ? 285 THR B CB    1 
ATOM   4521 O OG1   . THR B 1 285 ? 36.272  11.588  34.765  1.00 41.77 ? 285 THR B OG1   1 
ATOM   4522 C CG2   . THR B 1 285 ? 37.757  11.347  32.889  1.00 39.45 ? 285 THR B CG2   1 
ATOM   4523 N N     . GLU B 1 286 ? 33.348  12.487  33.885  1.00 40.90 ? 286 GLU B N     1 
ATOM   4524 C CA    . GLU B 1 286 ? 31.994  12.163  34.317  1.00 42.82 ? 286 GLU B CA    1 
ATOM   4525 C C     . GLU B 1 286 ? 31.028  12.380  33.166  1.00 41.08 ? 286 GLU B C     1 
ATOM   4526 O O     . GLU B 1 286 ? 30.074  11.637  33.011  1.00 40.89 ? 286 GLU B O     1 
ATOM   4527 C CB    . GLU B 1 286 ? 31.575  12.983  35.545  1.00 47.08 ? 286 GLU B CB    1 
ATOM   4528 C CG    . GLU B 1 286 ? 30.136  12.641  36.020  1.00 54.39 ? 286 GLU B CG    1 
ATOM   4529 C CD    . GLU B 1 286 ? 29.843  11.093  36.222  1.00 57.38 ? 286 GLU B CD    1 
ATOM   4530 O OE1   . GLU B 1 286 ? 29.278  10.426  35.289  1.00 57.78 ? 286 GLU B OE1   1 
ATOM   4531 O OE2   . GLU B 1 286 ? 30.172  10.554  37.320  1.00 58.71 ? 286 GLU B OE2   1 
ATOM   4532 N N     . LEU B 1 287 ? 31.279  13.396  32.346  1.00 40.23 ? 287 LEU B N     1 
ATOM   4533 C CA    . LEU B 1 287 ? 30.440  13.660  31.174  1.00 39.97 ? 287 LEU B CA    1 
ATOM   4534 C C     . LEU B 1 287 ? 30.654  12.532  30.133  1.00 39.97 ? 287 LEU B C     1 
ATOM   4535 O O     . LEU B 1 287 ? 29.701  12.093  29.477  1.00 37.91 ? 287 LEU B O     1 
ATOM   4536 C CB    . LEU B 1 287 ? 30.810  15.021  30.560  1.00 40.58 ? 287 LEU B CB    1 
ATOM   4537 C CG    . LEU B 1 287 ? 29.877  15.654  29.517  1.00 43.28 ? 287 LEU B CG    1 
ATOM   4538 C CD1   . LEU B 1 287 ? 28.443  15.830  30.118  1.00 41.43 ? 287 LEU B CD1   1 
ATOM   4539 C CD2   . LEU B 1 287 ? 30.472  17.041  29.084  1.00 41.25 ? 287 LEU B CD2   1 
ATOM   4540 N N     . ILE B 1 288 ? 31.912  12.091  29.988  1.00 38.06 ? 288 ILE B N     1 
ATOM   4541 C CA    . ILE B 1 288 ? 32.257  11.032  29.066  1.00 40.81 ? 288 ILE B CA    1 
ATOM   4542 C C     . ILE B 1 288 ? 31.594  9.714   29.571  1.00 41.52 ? 288 ILE B C     1 
ATOM   4543 O O     . ILE B 1 288 ? 31.004  8.971   28.780  1.00 40.15 ? 288 ILE B O     1 
ATOM   4544 C CB    . ILE B 1 288 ? 33.788  10.893  28.986  1.00 42.12 ? 288 ILE B CB    1 
ATOM   4545 C CG1   . ILE B 1 288 ? 34.378  12.096  28.204  1.00 42.43 ? 288 ILE B CG1   1 
ATOM   4546 C CG2   . ILE B 1 288 ? 34.171  9.584   28.291  1.00 41.30 ? 288 ILE B CG2   1 
ATOM   4547 C CD1   . ILE B 1 288 ? 35.870  12.279  28.390  1.00 43.84 ? 288 ILE B CD1   1 
ATOM   4548 N N     . ASP B 1 289 ? 31.685  9.451   30.878  1.00 42.97 ? 289 ASP B N     1 
ATOM   4549 C CA    . ASP B 1 289 ? 31.053  8.261   31.471  1.00 45.74 ? 289 ASP B CA    1 
ATOM   4550 C C     . ASP B 1 289 ? 29.524  8.372   31.295  1.00 46.70 ? 289 ASP B C     1 
ATOM   4551 O O     . ASP B 1 289 ? 28.858  7.377   31.047  1.00 48.27 ? 289 ASP B O     1 
ATOM   4552 C CB    . ASP B 1 289 ? 31.347  8.159   32.973  1.00 46.66 ? 289 ASP B CB    1 
ATOM   4553 C CG    . ASP B 1 289 ? 32.805  7.921   33.277  1.00 49.64 ? 289 ASP B CG    1 
ATOM   4554 O OD1   . ASP B 1 289 ? 33.568  7.531   32.361  1.00 50.75 ? 289 ASP B OD1   1 
ATOM   4555 O OD2   . ASP B 1 289 ? 33.183  8.132   34.458  1.00 53.07 ? 289 ASP B OD2   1 
ATOM   4556 N N     . ARG B 1 290 ? 28.968  9.578   31.426  1.00 46.23 ? 290 ARG B N     1 
ATOM   4557 C CA    . ARG B 1 290 ? 27.529  9.749   31.276  1.00 44.66 ? 290 ARG B CA    1 
ATOM   4558 C C     . ARG B 1 290 ? 27.135  9.281   29.885  1.00 46.30 ? 290 ARG B C     1 
ATOM   4559 O O     . ARG B 1 290 ? 26.139  8.566   29.687  1.00 44.32 ? 290 ARG B O     1 
ATOM   4560 C CB    . ARG B 1 290 ? 27.121  11.226  31.468  1.00 43.63 ? 290 ARG B CB    1 
ATOM   4561 C CG    . ARG B 1 290 ? 25.601  11.448  31.546  1.00 42.50 ? 290 ARG B CG    1 
ATOM   4562 C CD    . ARG B 1 290 ? 25.097  12.937  31.631  1.00 42.72 ? 290 ARG B CD    1 
ATOM   4563 N NE    . ARG B 1 290 ? 25.311  13.704  30.404  1.00 41.62 ? 290 ARG B NE    1 
ATOM   4564 C CZ    . ARG B 1 290 ? 24.682  14.830  30.079  1.00 44.02 ? 290 ARG B CZ    1 
ATOM   4565 N NH1   . ARG B 1 290 ? 23.761  15.329  30.886  1.00 46.21 ? 290 ARG B NH1   1 
ATOM   4566 N NH2   . ARG B 1 290 ? 25.011  15.502  28.970  1.00 43.43 ? 290 ARG B NH2   1 
ATOM   4567 N N     . TYR B 1 291 ? 27.923  9.701   28.900  1.00 45.65 ? 291 TYR B N     1 
ATOM   4568 C CA    . TYR B 1 291 ? 27.644  9.358   27.523  1.00 45.08 ? 291 TYR B CA    1 
ATOM   4569 C C     . TYR B 1 291 ? 27.808  7.863   27.272  1.00 46.52 ? 291 TYR B C     1 
ATOM   4570 O O     . TYR B 1 291 ? 27.056  7.277   26.498  1.00 43.63 ? 291 TYR B O     1 
ATOM   4571 C CB    . TYR B 1 291 ? 28.584  10.131  26.583  1.00 44.90 ? 291 TYR B CB    1 
ATOM   4572 C CG    . TYR B 1 291 ? 28.325  9.829   25.142  1.00 44.11 ? 291 TYR B CG    1 
ATOM   4573 C CD1   . TYR B 1 291 ? 27.067  10.081  24.588  1.00 44.05 ? 291 TYR B CD1   1 
ATOM   4574 C CD2   . TYR B 1 291 ? 29.296  9.249   24.344  1.00 45.01 ? 291 TYR B CD2   1 
ATOM   4575 C CE1   . TYR B 1 291 ? 26.775  9.759   23.276  1.00 45.50 ? 291 TYR B CE1   1 
ATOM   4576 C CE2   . TYR B 1 291 ? 29.016  8.922   23.022  1.00 46.21 ? 291 TYR B CE2   1 
ATOM   4577 C CZ    . TYR B 1 291 ? 27.757  9.181   22.504  1.00 44.57 ? 291 TYR B CZ    1 
ATOM   4578 O OH    . TYR B 1 291 ? 27.454  8.893   21.215  1.00 47.67 ? 291 TYR B OH    1 
ATOM   4579 N N     . LYS B 1 292 ? 28.817  7.277   27.908  1.00 47.90 ? 292 LYS B N     1 
ATOM   4580 C CA    . LYS B 1 292 ? 29.115  5.862   27.749  1.00 51.30 ? 292 LYS B CA    1 
ATOM   4581 C C     . LYS B 1 292 ? 27.918  5.084   28.303  1.00 52.46 ? 292 LYS B C     1 
ATOM   4582 O O     . LYS B 1 292 ? 27.451  4.134   27.680  1.00 53.69 ? 292 LYS B O     1 
ATOM   4583 C CB    . LYS B 1 292 ? 30.387  5.527   28.520  1.00 52.83 ? 292 LYS B CB    1 
ATOM   4584 C CG    . LYS B 1 292 ? 31.470  4.844   27.733  1.00 56.26 ? 292 LYS B CG    1 
ATOM   4585 C CD    . LYS B 1 292 ? 31.235  3.316   27.698  1.00 59.68 ? 292 LYS B CD    1 
ATOM   4586 C CE    . LYS B 1 292 ? 32.570  2.543   27.807  1.00 61.01 ? 292 LYS B CE    1 
ATOM   4587 N NZ    . LYS B 1 292 ? 32.395  1.163   28.403  1.00 62.07 ? 292 LYS B NZ    1 
ATOM   4588 N N     . ARG B 1 293 ? 27.387  5.509   29.446  1.00 53.49 ? 293 ARG B N     1 
ATOM   4589 C CA    . ARG B 1 293 ? 26.244  4.797   29.997  1.00 53.90 ? 293 ARG B CA    1 
ATOM   4590 C C     . ARG B 1 293 ? 25.072  4.984   29.083  1.00 54.80 ? 293 ARG B C     1 
ATOM   4591 O O     . ARG B 1 293 ? 24.453  4.019   28.653  1.00 55.80 ? 293 ARG B O     1 
ATOM   4592 C CB    . ARG B 1 293 ? 25.897  5.285   31.409  1.00 53.75 ? 293 ARG B CB    1 
ATOM   4593 C CG    . ARG B 1 293 ? 26.878  4.834   32.499  1.00 52.60 ? 293 ARG B CG    1 
ATOM   4594 C CD    . ARG B 1 293 ? 26.380  5.190   33.895  1.00 53.69 ? 293 ARG B CD    1 
ATOM   4595 N NE    . ARG B 1 293 ? 25.969  6.590   33.978  1.00 53.13 ? 293 ARG B NE    1 
ATOM   4596 C CZ    . ARG B 1 293 ? 26.743  7.582   34.399  1.00 51.57 ? 293 ARG B CZ    1 
ATOM   4597 N NH1   . ARG B 1 293 ? 27.988  7.341   34.804  1.00 51.22 ? 293 ARG B NH1   1 
ATOM   4598 N NH2   . ARG B 1 293 ? 26.276  8.824   34.369  1.00 50.90 ? 293 ARG B NH2   1 
ATOM   4599 N N     . TRP B 1 294 ? 24.770  6.234   28.763  1.00 55.37 ? 294 TRP B N     1 
ATOM   4600 C CA    . TRP B 1 294 ? 23.643  6.532   27.901  1.00 55.76 ? 294 TRP B CA    1 
ATOM   4601 C C     . TRP B 1 294 ? 23.689  5.675   26.633  1.00 58.49 ? 294 TRP B C     1 
ATOM   4602 O O     . TRP B 1 294 ? 22.760  4.929   26.356  1.00 57.99 ? 294 TRP B O     1 
ATOM   4603 C CB    . TRP B 1 294 ? 23.644  8.015   27.562  1.00 52.48 ? 294 TRP B CB    1 
ATOM   4604 C CG    . TRP B 1 294 ? 22.481  8.471   26.773  1.00 49.81 ? 294 TRP B CG    1 
ATOM   4605 C CD1   . TRP B 1 294 ? 21.268  8.904   27.252  1.00 49.42 ? 294 TRP B CD1   1 
ATOM   4606 C CD2   . TRP B 1 294 ? 22.415  8.576   25.355  1.00 50.05 ? 294 TRP B CD2   1 
ATOM   4607 N NE1   . TRP B 1 294 ? 20.453  9.276   26.205  1.00 49.81 ? 294 TRP B NE1   1 
ATOM   4608 C CE2   . TRP B 1 294 ? 21.129  9.081   25.029  1.00 49.01 ? 294 TRP B CE2   1 
ATOM   4609 C CE3   . TRP B 1 294 ? 23.318  8.295   24.317  1.00 48.71 ? 294 TRP B CE3   1 
ATOM   4610 C CZ2   . TRP B 1 294 ? 20.731  9.304   23.720  1.00 48.82 ? 294 TRP B CZ2   1 
ATOM   4611 C CZ3   . TRP B 1 294 ? 22.918  8.522   23.007  1.00 49.19 ? 294 TRP B CZ3   1 
ATOM   4612 C CH2   . TRP B 1 294 ? 21.631  9.023   22.720  1.00 47.88 ? 294 TRP B CH2   1 
ATOM   4613 N N     . LYS B 1 295 ? 24.785  5.759   25.880  1.00 61.65 ? 295 LYS B N     1 
ATOM   4614 C CA    . LYS B 1 295 ? 24.961  4.993   24.639  1.00 64.77 ? 295 LYS B CA    1 
ATOM   4615 C C     . LYS B 1 295 ? 24.668  3.502   24.869  1.00 67.14 ? 295 LYS B C     1 
ATOM   4616 O O     . LYS B 1 295 ? 24.331  2.777   23.922  1.00 67.71 ? 295 LYS B O     1 
ATOM   4617 C CB    . LYS B 1 295 ? 26.404  5.160   24.124  1.00 65.56 ? 295 LYS B CB    1 
ATOM   4618 C CG    . LYS B 1 295 ? 26.698  4.601   22.729  1.00 66.00 ? 295 LYS B CG    1 
ATOM   4619 C CD    . LYS B 1 295 ? 26.060  5.448   21.631  1.00 65.65 ? 295 LYS B CD    1 
ATOM   4620 C CE    . LYS B 1 295 ? 26.583  5.051   20.252  1.00 66.60 ? 295 LYS B CE    1 
ATOM   4621 N NZ    . LYS B 1 295 ? 26.306  3.616   19.916  1.00 66.10 ? 295 LYS B NZ    1 
ATOM   4622 N N     . ALA B 1 296 ? 24.813  3.057   26.122  1.00 68.84 ? 296 ALA B N     1 
ATOM   4623 C CA    . ALA B 1 296 ? 24.553  1.666   26.503  1.00 70.85 ? 296 ALA B CA    1 
ATOM   4624 C C     . ALA B 1 296 ? 23.066  1.390   26.727  1.00 71.68 ? 296 ALA B C     1 
ATOM   4625 O O     . ALA B 1 296 ? 22.704  0.573   27.556  1.00 72.53 ? 296 ALA B O     1 
ATOM   4626 C CB    . ALA B 1 296 ? 25.347  1.303   27.778  1.00 70.11 ? 296 ALA B CB    1 
ATOM   4627 N N     . GLU B 1 297 ? 22.202  2.071   25.991  1.00 73.66 ? 297 GLU B N     1 
ATOM   4628 C CA    . GLU B 1 297 ? 20.760  1.860   26.118  1.00 75.43 ? 297 GLU B CA    1 
ATOM   4629 C C     . GLU B 1 297 ? 20.069  2.403   24.888  1.00 76.08 ? 297 GLU B C     1 
ATOM   4630 O O     . GLU B 1 297 ? 19.044  3.089   24.976  1.00 76.46 ? 297 GLU B O     1 
ATOM   4631 C CB    . GLU B 1 297 ? 20.223  2.563   27.355  1.00 76.34 ? 297 GLU B CB    1 
ATOM   4632 C CG    . GLU B 1 297 ? 20.592  1.883   28.634  1.00 79.27 ? 297 GLU B CG    1 
ATOM   4633 C CD    . GLU B 1 297 ? 20.256  2.724   29.830  1.00 81.37 ? 297 GLU B CD    1 
ATOM   4634 O OE1   . GLU B 1 297 ? 20.889  3.796   29.976  1.00 81.68 ? 297 GLU B OE1   1 
ATOM   4635 O OE2   . GLU B 1 297 ? 19.356  2.319   30.619  1.00 83.76 ? 297 GLU B OE2   1 
ATOM   4636 N N     . GLN B 1 298 ? 20.653  2.101   23.737  1.00 76.70 ? 298 GLN B N     1 
ATOM   4637 C CA    . GLN B 1 298 ? 20.128  2.564   22.470  1.00 77.34 ? 298 GLN B CA    1 
ATOM   4638 C C     . GLN B 1 298 ? 20.237  1.422   21.442  1.00 78.04 ? 298 GLN B C     1 
ATOM   4639 O O     . GLN B 1 298 ? 19.230  1.130   20.747  1.00 78.20 ? 298 GLN B O     1 
ATOM   4640 C CB    . GLN B 1 298 ? 20.925  3.791   21.988  1.00 77.66 ? 298 GLN B CB    1 
ATOM   4641 C CG    . GLN B 1 298 ? 21.249  4.871   23.057  1.00 78.23 ? 298 GLN B CG    1 
ATOM   4642 C CD    . GLN B 1 298 ? 20.023  5.654   23.572  1.00 78.26 ? 298 GLN B CD    1 
ATOM   4643 O OE1   . GLN B 1 298 ? 19.200  6.149   22.786  1.00 77.67 ? 298 GLN B OE1   1 
ATOM   4644 N NE2   . GLN B 1 298 ? 19.919  5.786   24.898  1.00 77.69 ? 298 GLN B NE2   1 
HETATM 4645 P PB    . ATP C 2 .   ? 5.028   23.776  49.087  1.00 69.14 ? 400 ATP A PB    1 
HETATM 4646 O O1B   . ATP C 2 .   ? 5.761   23.272  50.296  1.00 69.36 ? 400 ATP A O1B   1 
HETATM 4647 O O2B   . ATP C 2 .   ? 5.050   23.097  47.825  1.00 69.75 ? 400 ATP A O2B   1 
HETATM 4648 O O3B   . ATP C 2 .   ? 3.445   24.069  49.536  1.00 70.62 ? 400 ATP A O3B   1 
HETATM 4649 P PA    . ATP C 2 .   ? 6.441   26.270  48.386  1.00 69.59 ? 400 ATP A PA    1 
HETATM 4650 O O1A   . ATP C 2 .   ? 6.348   27.533  49.128  1.00 68.81 ? 400 ATP A O1A   1 
HETATM 4651 O O2A   . ATP C 2 .   ? 7.764   25.548  48.486  1.00 69.71 ? 400 ATP A O2A   1 
HETATM 4652 O O3A   . ATP C 2 .   ? 5.188   25.361  48.862  1.00 69.76 ? 400 ATP A O3A   1 
HETATM 4653 O "O5'" . ATP C 2 .   ? 6.232   26.340  46.786  1.00 66.73 ? 400 ATP A "O5'" 1 
HETATM 4654 C "C5'" . ATP C 2 .   ? 5.150   25.969  45.876  1.00 64.83 ? 400 ATP A "C5'" 1 
HETATM 4655 C "C4'" . ATP C 2 .   ? 5.531   26.750  44.594  1.00 62.25 ? 400 ATP A "C4'" 1 
HETATM 4656 O "O4'" . ATP C 2 .   ? 6.557   27.707  44.663  1.00 59.18 ? 400 ATP A "O4'" 1 
HETATM 4657 C "C3'" . ATP C 2 .   ? 6.039   25.815  43.424  1.00 61.19 ? 400 ATP A "C3'" 1 
HETATM 4658 O "O3'" . ATP C 2 .   ? 5.181   24.725  43.121  1.00 63.02 ? 400 ATP A "O3'" 1 
HETATM 4659 C "C2'" . ATP C 2 .   ? 6.277   26.963  42.466  1.00 59.15 ? 400 ATP A "C2'" 1 
HETATM 4660 O "O2'" . ATP C 2 .   ? 5.102   27.540  41.906  1.00 59.93 ? 400 ATP A "O2'" 1 
HETATM 4661 C "C1'" . ATP C 2 .   ? 7.184   27.948  43.350  1.00 55.16 ? 400 ATP A "C1'" 1 
HETATM 4662 N N9    . ATP C 2 .   ? 8.635   27.384  43.484  1.00 51.15 ? 400 ATP A N9    1 
HETATM 4663 C C8    . ATP C 2 .   ? 9.238   26.692  44.565  1.00 49.31 ? 400 ATP A C8    1 
HETATM 4664 N N7    . ATP C 2 .   ? 10.472  26.320  44.418  1.00 47.03 ? 400 ATP A N7    1 
HETATM 4665 C C5    . ATP C 2 .   ? 10.770  26.785  43.169  1.00 47.93 ? 400 ATP A C5    1 
HETATM 4666 C C6    . ATP C 2 .   ? 11.967  26.738  42.372  1.00 47.38 ? 400 ATP A C6    1 
HETATM 4667 N N6    . ATP C 2 .   ? 13.064  26.141  42.845  1.00 47.91 ? 400 ATP A N6    1 
HETATM 4668 N N1    . ATP C 2 .   ? 11.948  27.336  41.123  1.00 46.30 ? 400 ATP A N1    1 
HETATM 4669 C C2    . ATP C 2 .   ? 10.832  27.948  40.644  1.00 47.19 ? 400 ATP A C2    1 
HETATM 4670 N N3    . ATP C 2 .   ? 9.648   28.036  41.309  1.00 49.08 ? 400 ATP A N3    1 
HETATM 4671 C C4    . ATP C 2 .   ? 9.669   27.441  42.567  1.00 48.48 ? 400 ATP A C4    1 
HETATM 4672 P PB    . ATP D 2 .   ? 33.900  13.491  9.093   1.00 83.75 ? 400 ATP B PB    1 
HETATM 4673 O O1B   . ATP D 2 .   ? 34.911  14.428  8.529   1.00 84.04 ? 400 ATP B O1B   1 
HETATM 4674 O O2B   . ATP D 2 .   ? 33.501  13.544  10.483  1.00 83.35 ? 400 ATP B O2B   1 
HETATM 4675 O O3B   . ATP D 2 .   ? 32.520  13.549  8.121   1.00 84.09 ? 400 ATP B O3B   1 
HETATM 4676 P PA    . ATP D 2 .   ? 35.396  10.908  9.040   1.00 80.47 ? 400 ATP B PA    1 
HETATM 4677 O O1A   . ATP D 2 .   ? 35.514  9.978   7.923   1.00 79.95 ? 400 ATP B O1A   1 
HETATM 4678 O O2A   . ATP D 2 .   ? 36.658  11.592  9.445   1.00 79.99 ? 400 ATP B O2A   1 
HETATM 4679 O O3A   . ATP D 2 .   ? 34.202  11.963  8.644   1.00 82.16 ? 400 ATP B O3A   1 
HETATM 4680 O "O5'" . ATP D 2 .   ? 34.867  10.266  10.441  1.00 77.93 ? 400 ATP B "O5'" 1 
HETATM 4681 C "C5'" . ATP D 2 .   ? 33.581  10.332  11.183  1.00 75.06 ? 400 ATP B "C5'" 1 
HETATM 4682 C "C4'" . ATP D 2 .   ? 33.842  9.422   12.406  1.00 72.62 ? 400 ATP B "C4'" 1 
HETATM 4683 O "O4'" . ATP D 2 .   ? 35.047  8.758   12.481  1.00 69.87 ? 400 ATP B "O4'" 1 
HETATM 4684 C "C3'" . ATP D 2 .   ? 33.743  10.195  13.815  1.00 72.33 ? 400 ATP B "C3'" 1 
HETATM 4685 O "O3'" . ATP D 2 .   ? 32.551  10.962  14.052  1.00 74.72 ? 400 ATP B "O3'" 1 
HETATM 4686 C "C2'" . ATP D 2 .   ? 34.096  9.025   14.669  1.00 70.78 ? 400 ATP B "C2'" 1 
HETATM 4687 O "O2'" . ATP D 2 .   ? 33.041  8.113   14.972  1.00 71.94 ? 400 ATP B "O2'" 1 
HETATM 4688 C "C1'" . ATP D 2 .   ? 35.349  8.414   13.872  1.00 67.37 ? 400 ATP B "C1'" 1 
HETATM 4689 N N9    . ATP D 2 .   ? 36.733  9.089   14.113  1.00 62.52 ? 400 ATP B N9    1 
HETATM 4690 C C8    . ATP D 2 .   ? 37.502  9.900   13.238  1.00 60.77 ? 400 ATP B C8    1 
HETATM 4691 N N7    . ATP D 2 .   ? 38.649  10.331  13.703  1.00 58.69 ? 400 ATP B N7    1 
HETATM 4692 C C5    . ATP D 2 .   ? 38.693  9.787   14.968  1.00 57.13 ? 400 ATP B C5    1 
HETATM 4693 C C6    . ATP D 2 .   ? 39.655  9.834   16.006  1.00 55.31 ? 400 ATP B C6    1 
HETATM 4694 N N6    . ATP D 2 .   ? 40.797  10.507  15.831  1.00 54.02 ? 400 ATP B N6    1 
HETATM 4695 N N1    . ATP D 2 .   ? 39.384  9.148   17.191  1.00 53.85 ? 400 ATP B N1    1 
HETATM 4696 C C2    . ATP D 2 .   ? 38.236  8.454   17.369  1.00 55.58 ? 400 ATP B C2    1 
HETATM 4697 N N3    . ATP D 2 .   ? 37.249  8.344   16.440  1.00 56.45 ? 400 ATP B N3    1 
HETATM 4698 C C4    . ATP D 2 .   ? 37.525  9.029   15.258  1.00 59.03 ? 400 ATP B C4    1 
HETATM 4699 O O     . HOH E 3 .   ? 29.919  20.636  58.550  1.00 63.40 ? 304 HOH A O     1 
HETATM 4700 O O     . HOH E 3 .   ? 24.851  14.752  62.287  1.00 60.82 ? 305 HOH A O     1 
HETATM 4701 O O     . HOH E 3 .   ? 23.854  31.417  48.120  1.00 39.66 ? 306 HOH A O     1 
HETATM 4702 O O     . HOH E 3 .   ? 25.139  25.648  50.067  1.00 62.15 ? 307 HOH A O     1 
HETATM 4703 O O     . HOH E 3 .   ? 22.219  21.195  45.904  1.00 38.55 ? 308 HOH A O     1 
HETATM 4704 O O     . HOH E 3 .   ? 23.162  17.209  57.355  1.00 59.43 ? 309 HOH A O     1 
HETATM 4705 O O     . HOH E 3 .   ? 18.436  37.733  62.583  1.00 51.84 ? 310 HOH A O     1 
HETATM 4706 O O     . HOH E 3 .   ? 32.382  39.486  52.539  1.00 63.50 ? 311 HOH A O     1 
HETATM 4707 O O     . HOH E 3 .   ? 35.014  39.472  53.640  1.00 67.48 ? 312 HOH A O     1 
HETATM 4708 O O     . HOH E 3 .   ? 24.011  30.611  42.839  1.00 61.07 ? 313 HOH A O     1 
HETATM 4709 O O     . HOH E 3 .   ? 13.812  44.303  41.461  1.00 56.89 ? 314 HOH A O     1 
HETATM 4710 O O     . HOH E 3 .   ? 20.041  19.396  45.510  1.00 37.16 ? 315 HOH A O     1 
HETATM 4711 O O     . HOH E 3 .   ? 26.664  29.769  49.419  1.00 61.75 ? 316 HOH A O     1 
HETATM 4712 O O     . HOH E 3 .   ? 3.083   40.935  49.121  1.00 40.13 ? 317 HOH A O     1 
HETATM 4713 O O     . HOH E 3 .   ? -1.177  35.202  41.251  1.00 61.68 ? 318 HOH A O     1 
HETATM 4714 O O     . HOH E 3 .   ? -4.916  38.383  46.635  1.00 47.48 ? 319 HOH A O     1 
HETATM 4715 O O     . HOH E 3 .   ? 25.356  21.040  50.266  1.00 59.29 ? 320 HOH A O     1 
HETATM 4716 O O     . HOH E 3 .   ? 30.171  30.160  48.800  1.00 55.62 ? 321 HOH A O     1 
HETATM 4717 O O     . HOH E 3 .   ? -8.796  16.838  44.565  1.00 54.71 ? 322 HOH A O     1 
HETATM 4718 O O     . HOH E 3 .   ? -5.437  18.922  37.254  1.00 43.12 ? 323 HOH A O     1 
HETATM 4719 O O     . HOH E 3 .   ? -2.876  29.226  46.724  1.00 68.01 ? 324 HOH A O     1 
HETATM 4720 O O     . HOH E 3 .   ? 2.075   17.616  49.483  1.00 48.78 ? 325 HOH A O     1 
HETATM 4721 O O     . HOH E 3 .   ? -8.496  28.510  26.215  1.00 69.13 ? 326 HOH A O     1 
HETATM 4722 O O     . HOH E 3 .   ? 6.911   34.036  34.817  1.00 65.40 ? 327 HOH A O     1 
HETATM 4723 O O     . HOH E 3 .   ? 0.337   25.655  43.394  1.00 58.41 ? 328 HOH A O     1 
HETATM 4724 O O     . HOH E 3 .   ? 23.451  32.033  45.046  1.00 44.08 ? 329 HOH A O     1 
HETATM 4725 O O     . HOH E 3 .   ? 22.341  29.692  40.260  1.00 64.96 ? 330 HOH A O     1 
HETATM 4726 O O     . HOH E 3 .   ? 21.196  27.314  39.234  1.00 42.96 ? 331 HOH A O     1 
HETATM 4727 O O     . HOH E 3 .   ? 15.034  30.759  33.573  1.00 47.01 ? 332 HOH A O     1 
HETATM 4728 O O     . HOH E 3 .   ? 18.117  25.203  35.976  1.00 58.10 ? 333 HOH A O     1 
HETATM 4729 O O     . HOH E 3 .   ? -1.573  20.907  67.773  1.00 71.54 ? 334 HOH A O     1 
HETATM 4730 O O     . HOH E 3 .   ? 22.157  35.667  56.423  1.00 38.62 ? 335 HOH A O     1 
HETATM 4731 O O     . HOH E 3 .   ? 27.608  46.618  46.670  1.00 62.75 ? 336 HOH A O     1 
HETATM 4732 O O     . HOH E 3 .   ? -4.160  -6.195  49.452  1.00 47.40 ? 337 HOH A O     1 
HETATM 4733 O O     . HOH E 3 .   ? -2.194  -5.447  50.496  1.00 63.78 ? 338 HOH A O     1 
HETATM 4734 O O     . HOH E 3 .   ? 4.405   15.944  60.709  1.00 77.01 ? 339 HOH A O     1 
HETATM 4735 O O     . HOH E 3 .   ? 10.587  12.904  17.308  1.00 61.65 ? 340 HOH A O     1 
HETATM 4736 O O     . HOH E 3 .   ? 9.780   9.466   13.867  1.00 61.32 ? 341 HOH A O     1 
HETATM 4737 O O     . HOH E 3 .   ? 14.181  43.997  56.074  1.00 57.56 ? 342 HOH A O     1 
HETATM 4738 O O     . HOH E 3 .   ? 6.468   21.839  17.186  1.00 56.97 ? 343 HOH A O     1 
HETATM 4739 O O     . HOH E 3 .   ? 26.725  17.793  47.813  1.00 62.95 ? 344 HOH A O     1 
HETATM 4740 O O     . HOH E 3 .   ? 28.787  22.450  50.311  1.00 72.90 ? 345 HOH A O     1 
HETATM 4741 O O     . HOH E 3 .   ? 24.427  17.415  39.616  1.00 59.72 ? 346 HOH A O     1 
HETATM 4742 O O     . HOH E 3 .   ? 24.198  12.433  40.163  1.00 45.20 ? 347 HOH A O     1 
HETATM 4743 O O     . HOH E 3 .   ? 20.879  18.234  43.272  1.00 34.97 ? 348 HOH A O     1 
HETATM 4744 O O     . HOH E 3 .   ? 16.355  41.736  47.162  1.00 39.06 ? 349 HOH A O     1 
HETATM 4745 O O     . HOH E 3 .   ? 11.565  40.057  53.217  1.00 60.62 ? 350 HOH A O     1 
HETATM 4746 O O     . HOH E 3 .   ? 19.601  7.641   34.562  1.00 53.63 ? 351 HOH A O     1 
HETATM 4747 O O     . HOH E 3 .   ? 17.629  17.667  34.318  1.00 56.60 ? 352 HOH A O     1 
HETATM 4748 O O     . HOH E 3 .   ? 21.740  9.738   38.655  1.00 47.08 ? 353 HOH A O     1 
HETATM 4749 O O     . HOH E 3 .   ? 35.871  30.387  48.431  1.00 79.72 ? 354 HOH A O     1 
HETATM 4750 O O     . HOH E 3 .   ? 22.485  42.693  61.405  1.00 62.19 ? 355 HOH A O     1 
HETATM 4751 O O     . HOH E 3 .   ? 8.009   37.309  51.507  1.00 44.21 ? 356 HOH A O     1 
HETATM 4752 O O     . HOH E 3 .   ? 2.917   22.810  41.785  1.00 46.99 ? 357 HOH A O     1 
HETATM 4753 O O     . HOH E 3 .   ? -1.671  27.338  38.302  1.00 64.03 ? 358 HOH A O     1 
HETATM 4754 O O     . HOH E 3 .   ? -7.512  27.628  37.358  1.00 62.37 ? 359 HOH A O     1 
HETATM 4755 O O     . HOH E 3 .   ? 0.493   23.472  29.327  1.00 41.48 ? 360 HOH A O     1 
HETATM 4756 O O     . HOH E 3 .   ? -1.085  18.064  24.856  1.00 56.40 ? 361 HOH A O     1 
HETATM 4757 O O     . HOH E 3 .   ? -5.306  15.221  54.571  1.00 74.91 ? 362 HOH A O     1 
HETATM 4758 O O     . HOH E 3 .   ? -8.056  21.330  43.102  1.00 56.50 ? 363 HOH A O     1 
HETATM 4759 O O     . HOH E 3 .   ? -3.843  21.110  36.968  1.00 38.11 ? 364 HOH A O     1 
HETATM 4760 O O     . HOH E 3 .   ? -7.939  32.125  41.686  1.00 52.05 ? 365 HOH A O     1 
HETATM 4761 O O     . HOH E 3 .   ? 16.796  44.101  38.567  1.00 61.65 ? 366 HOH A O     1 
HETATM 4762 O O     . HOH E 3 .   ? 6.500   40.684  41.607  1.00 46.35 ? 367 HOH A O     1 
HETATM 4763 O O     . HOH E 3 .   ? 17.669  40.120  35.162  1.00 64.57 ? 368 HOH A O     1 
HETATM 4764 O O     . HOH E 3 .   ? 15.332  37.466  34.029  1.00 69.95 ? 369 HOH A O     1 
HETATM 4765 O O     . HOH E 3 .   ? 17.175  35.716  33.034  1.00 52.09 ? 370 HOH A O     1 
HETATM 4766 O O     . HOH E 3 .   ? 15.964  33.039  33.456  1.00 36.36 ? 371 HOH A O     1 
HETATM 4767 O O     . HOH E 3 .   ? -5.357  31.685  37.664  1.00 57.97 ? 372 HOH A O     1 
HETATM 4768 O O     . HOH E 3 .   ? 0.658   23.310  43.238  1.00 50.94 ? 373 HOH A O     1 
HETATM 4769 O O     . HOH E 3 .   ? 2.019   33.942  31.789  1.00 45.15 ? 374 HOH A O     1 
HETATM 4770 O O     . HOH E 3 .   ? -5.599  33.744  55.138  1.00 64.46 ? 375 HOH A O     1 
HETATM 4771 O O     . HOH E 3 .   ? 2.441   23.905  45.849  1.00 59.72 ? 376 HOH A O     1 
HETATM 4772 O O     . HOH E 3 .   ? 3.290   20.083  47.553  1.00 46.54 ? 377 HOH A O     1 
HETATM 4773 O O     . HOH E 3 .   ? 4.914   19.619  51.015  1.00 52.47 ? 378 HOH A O     1 
HETATM 4774 O O     . HOH E 3 .   ? 11.075  23.825  46.358  1.00 62.23 ? 379 HOH A O     1 
HETATM 4775 O O     . HOH E 3 .   ? 7.600   23.463  47.160  1.00 44.44 ? 380 HOH A O     1 
HETATM 4776 O O     . HOH E 3 .   ? 10.452  40.919  31.977  1.00 73.40 ? 381 HOH A O     1 
HETATM 4777 O O     . HOH E 3 .   ? 0.677   20.545  47.025  1.00 53.59 ? 382 HOH A O     1 
HETATM 4778 O O     . HOH E 3 .   ? 14.004  7.026   23.617  1.00 91.05 ? 383 HOH A O     1 
HETATM 4779 O O     . HOH E 3 .   ? 1.933   10.216  18.568  1.00 74.75 ? 384 HOH A O     1 
HETATM 4780 O O     . HOH E 3 .   ? 4.886   4.515   19.660  1.00 75.66 ? 385 HOH A O     1 
HETATM 4781 O O     . HOH E 3 .   ? -0.679  6.641   21.141  1.00 73.23 ? 386 HOH A O     1 
HETATM 4782 O O     . HOH E 3 .   ? -1.271  21.167  44.565  1.00 43.74 ? 387 HOH A O     1 
HETATM 4783 O O     . HOH E 3 .   ? 9.525   -2.395  33.715  1.00 40.29 ? 388 HOH A O     1 
HETATM 4784 O O     . HOH E 3 .   ? -1.842  18.502  44.011  1.00 27.27 ? 389 HOH A O     1 
HETATM 4785 O O     . HOH E 3 .   ? -2.260  17.694  46.852  1.00 36.87 ? 390 HOH A O     1 
HETATM 4786 O O     . HOH E 3 .   ? -4.560  17.077  47.450  1.00 43.31 ? 391 HOH A O     1 
HETATM 4787 O O     . HOH E 3 .   ? 9.514   43.463  38.889  1.00 52.89 ? 392 HOH A O     1 
HETATM 4788 O O     . HOH E 3 .   ? 19.234  28.827  39.000  1.00 33.99 ? 393 HOH A O     1 
HETATM 4789 O O     . HOH E 3 .   ? 24.464  25.196  40.119  1.00 53.58 ? 394 HOH A O     1 
HETATM 4790 O O     . HOH E 3 .   ? 14.359  27.855  34.112  1.00 40.51 ? 395 HOH A O     1 
HETATM 4791 O O     . HOH E 3 .   ? 20.018  21.289  34.232  1.00 67.66 ? 396 HOH A O     1 
HETATM 4792 O O     . HOH E 3 .   ? 2.045   10.718  49.393  1.00 36.22 ? 397 HOH A O     1 
HETATM 4793 O O     . HOH E 3 .   ? 2.425   33.998  23.109  1.00 60.38 ? 398 HOH A O     1 
HETATM 4794 O O     . HOH E 3 .   ? 2.435   31.741  19.835  1.00 70.56 ? 399 HOH A O     1 
HETATM 4795 O O     . HOH E 3 .   ? 17.490  23.705  32.157  1.00 58.60 ? 401 HOH A O     1 
HETATM 4796 O O     . HOH E 3 .   ? -17.207 13.536  51.374  1.00 70.37 ? 402 HOH A O     1 
HETATM 4797 O O     . HOH E 3 .   ? -10.864 -8.708  46.651  1.00 64.36 ? 403 HOH A O     1 
HETATM 4798 O O     . HOH E 3 .   ? -13.973 2.076   45.894  1.00 55.14 ? 404 HOH A O     1 
HETATM 4799 O O     . HOH E 3 .   ? -13.597 -3.801  40.366  1.00 53.95 ? 405 HOH A O     1 
HETATM 4800 O O     . HOH E 3 .   ? -16.017 1.960   39.567  1.00 65.35 ? 406 HOH A O     1 
HETATM 4801 O O     . HOH E 3 .   ? -12.819 -7.593  35.707  1.00 61.94 ? 407 HOH A O     1 
HETATM 4802 O O     . HOH E 3 .   ? -20.293 3.122   39.838  1.00 70.00 ? 408 HOH A O     1 
HETATM 4803 O O     . HOH E 3 .   ? 2.162   -5.738  36.302  1.00 55.18 ? 409 HOH A O     1 
HETATM 4804 O O     . HOH E 3 .   ? -4.796  -2.063  33.748  1.00 41.08 ? 410 HOH A O     1 
HETATM 4805 O O     . HOH E 3 .   ? -7.407  -0.478  32.576  1.00 61.94 ? 411 HOH A O     1 
HETATM 4806 O O     . HOH E 3 .   ? 4.947   -4.509  29.588  1.00 43.53 ? 412 HOH A O     1 
HETATM 4807 O O     . HOH E 3 .   ? 12.778  21.619  46.084  1.00 52.04 ? 413 HOH A O     1 
HETATM 4808 O O     . HOH E 3 .   ? 8.912   35.763  68.326  1.00 66.54 ? 414 HOH A O     1 
HETATM 4809 O O     . HOH E 3 .   ? 10.521  -6.035  42.711  1.00 36.68 ? 415 HOH A O     1 
HETATM 4810 O O     . HOH E 3 .   ? 14.038  -3.144  26.024  1.00 60.78 ? 416 HOH A O     1 
HETATM 4811 O O     . HOH E 3 .   ? 13.785  11.361  20.969  1.00 48.15 ? 417 HOH A O     1 
HETATM 4812 O O     . HOH E 3 .   ? -9.633  37.034  36.588  1.00 53.92 ? 418 HOH A O     1 
HETATM 4813 O O     . HOH E 3 .   ? 9.341   33.532  67.894  1.00 67.32 ? 419 HOH A O     1 
HETATM 4814 O O     . HOH E 3 .   ? 30.062  15.524  49.720  1.00 72.82 ? 420 HOH A O     1 
HETATM 4815 O O     . HOH E 3 .   ? 8.117   24.678  65.813  1.00 57.84 ? 421 HOH A O     1 
HETATM 4816 O O     . HOH E 3 .   ? 8.346   19.658  67.389  1.00 65.45 ? 422 HOH A O     1 
HETATM 4817 O O     . HOH E 3 .   ? 21.773  11.896  38.991  1.00 28.73 ? 423 HOH A O     1 
HETATM 4818 O O     . HOH E 3 .   ? 25.140  12.166  45.153  1.00 50.07 ? 424 HOH A O     1 
HETATM 4819 O O     . HOH E 3 .   ? 28.372  8.559   43.898  1.00 59.43 ? 425 HOH A O     1 
HETATM 4820 O O     . HOH E 3 .   ? 19.122  8.239   37.659  1.00 43.95 ? 426 HOH A O     1 
HETATM 4821 O O     . HOH E 3 .   ? 22.781  11.027  55.195  1.00 70.64 ? 427 HOH A O     1 
HETATM 4822 O O     . HOH E 3 .   ? 15.185  16.352  33.351  1.00 36.84 ? 428 HOH A O     1 
HETATM 4823 O O     . HOH E 3 .   ? 24.296  3.044   42.568  1.00 57.40 ? 429 HOH A O     1 
HETATM 4824 O O     . HOH E 3 .   ? 19.431  20.057  39.512  1.00 41.60 ? 430 HOH A O     1 
HETATM 4825 O O     . HOH E 3 .   ? -4.052  16.396  40.428  1.00 29.28 ? 431 HOH A O     1 
HETATM 4826 O O     . HOH E 3 .   ? -6.559  16.055  44.793  1.00 50.70 ? 432 HOH A O     1 
HETATM 4827 O O     . HOH E 3 .   ? -4.490  17.927  42.870  1.00 40.08 ? 433 HOH A O     1 
HETATM 4828 O O     . HOH E 3 .   ? 39.259  36.482  45.550  1.00 57.40 ? 434 HOH A O     1 
HETATM 4829 O O     . HOH E 3 .   ? -6.688  18.566  33.862  1.00 56.64 ? 435 HOH A O     1 
HETATM 4830 O O     . HOH E 3 .   ? -5.658  15.827  32.002  1.00 36.66 ? 436 HOH A O     1 
HETATM 4831 O O     . HOH E 3 .   ? 13.611  42.573  49.863  1.00 50.67 ? 437 HOH A O     1 
HETATM 4832 O O     . HOH E 3 .   ? 19.515  41.224  60.128  1.00 65.18 ? 438 HOH A O     1 
HETATM 4833 O O     . HOH E 3 .   ? 40.365  39.334  48.581  1.00 79.14 ? 439 HOH A O     1 
HETATM 4834 O O     . HOH E 3 .   ? -7.216  25.333  27.311  1.00 55.20 ? 440 HOH A O     1 
HETATM 4835 O O     . HOH E 3 .   ? 20.907  38.682  34.183  1.00 69.77 ? 441 HOH A O     1 
HETATM 4836 O O     . HOH E 3 .   ? -2.307  36.175  52.337  1.00 60.73 ? 442 HOH A O     1 
HETATM 4837 O O     . HOH E 3 .   ? 5.687   -12.087 49.242  1.00 78.88 ? 443 HOH A O     1 
HETATM 4838 O O     . HOH E 3 .   ? 2.760   21.453  68.422  1.00 65.45 ? 444 HOH A O     1 
HETATM 4839 O O     . HOH E 3 .   ? 14.737  13.466  70.174  1.00 70.51 ? 445 HOH A O     1 
HETATM 4840 O O     . HOH E 3 .   ? 15.377  4.588   23.690  1.00 62.50 ? 446 HOH A O     1 
HETATM 4841 O O     . HOH E 3 .   ? 13.437  13.929  38.002  1.00 42.02 ? 447 HOH A O     1 
HETATM 4842 O O     . HOH E 3 .   ? 2.603   12.332  47.337  1.00 41.33 ? 448 HOH A O     1 
HETATM 4843 O O     . HOH E 3 .   ? -3.455  14.562  30.566  1.00 29.21 ? 449 HOH A O     1 
HETATM 4844 O O     . HOH E 3 .   ? -7.479  16.938  50.808  1.00 63.61 ? 450 HOH A O     1 
HETATM 4845 O O     . HOH E 3 .   ? 0.020   16.940  42.399  1.00 27.38 ? 451 HOH A O     1 
HETATM 4846 O O     . HOH E 3 .   ? -3.884  12.040  28.145  1.00 38.68 ? 452 HOH A O     1 
HETATM 4847 O O     . HOH E 3 .   ? -8.189  13.924  31.220  1.00 62.15 ? 453 HOH A O     1 
HETATM 4848 O O     . HOH E 3 .   ? 12.728  -3.797  58.652  1.00 59.31 ? 454 HOH A O     1 
HETATM 4849 O O     . HOH E 3 .   ? -8.517  -1.218  30.144  1.00 47.31 ? 455 HOH A O     1 
HETATM 4850 O O     . HOH E 3 .   ? -6.411  0.063   25.925  1.00 48.47 ? 456 HOH A O     1 
HETATM 4851 O O     . HOH E 3 .   ? -7.972  32.139  26.084  1.00 41.51 ? 458 HOH A O     1 
HETATM 4852 O O     . HOH E 3 .   ? -8.302  9.996   38.235  1.00 41.00 ? 459 HOH A O     1 
HETATM 4853 O O     . HOH E 3 .   ? -10.367 11.267  40.306  1.00 42.22 ? 460 HOH A O     1 
HETATM 4854 O O     . HOH E 3 .   ? 1.573   11.324  21.986  1.00 49.41 ? 461 HOH A O     1 
HETATM 4855 O O     . HOH E 3 .   ? -1.520  10.434  22.937  1.00 37.66 ? 462 HOH A O     1 
HETATM 4856 O O     . HOH E 3 .   ? -3.762  8.219   24.676  1.00 35.46 ? 463 HOH A O     1 
HETATM 4857 O O     . HOH E 3 .   ? 2.437   3.140   24.357  1.00 33.95 ? 464 HOH A O     1 
HETATM 4858 O O     . HOH E 3 .   ? 1.120   6.150   22.967  1.00 45.48 ? 465 HOH A O     1 
HETATM 4859 O O     . HOH E 3 .   ? 2.436   1.052   21.860  1.00 25.40 ? 466 HOH A O     1 
HETATM 4860 O O     . HOH E 3 .   ? 32.368  31.277  48.609  1.00 63.31 ? 467 HOH A O     1 
HETATM 4861 O O     . HOH E 3 .   ? 22.755  46.434  44.532  1.00 69.71 ? 468 HOH A O     1 
HETATM 4862 O O     . HOH E 3 .   ? 14.508  5.079   29.348  1.00 48.69 ? 469 HOH A O     1 
HETATM 4863 O O     . HOH E 3 .   ? 28.056  41.346  46.448  1.00 58.04 ? 470 HOH A O     1 
HETATM 4864 O O     . HOH E 3 .   ? 13.660  7.193   26.592  1.00 43.00 ? 471 HOH A O     1 
HETATM 4865 O O     . HOH E 3 .   ? -20.556 6.690   41.996  1.00 58.26 ? 472 HOH A O     1 
HETATM 4866 O O     . HOH E 3 .   ? 20.355  -3.279  32.346  1.00 64.64 ? 473 HOH A O     1 
HETATM 4867 O O     . HOH E 3 .   ? 6.409   16.116  23.809  1.00 62.48 ? 474 HOH A O     1 
HETATM 4868 O O     . HOH E 3 .   ? 16.228  2.531   29.039  1.00 50.48 ? 475 HOH A O     1 
HETATM 4869 O O     . HOH E 3 .   ? 6.178   9.268   47.312  1.00 28.55 ? 476 HOH A O     1 
HETATM 4870 O O     . HOH E 3 .   ? 23.466  1.861   51.826  1.00 68.30 ? 477 HOH A O     1 
HETATM 4871 O O     . HOH E 3 .   ? 16.328  2.518   40.696  1.00 37.43 ? 478 HOH A O     1 
HETATM 4872 O O     . HOH E 3 .   ? 16.193  3.764   49.117  1.00 49.49 ? 479 HOH A O     1 
HETATM 4873 O O     . HOH E 3 .   ? 14.563  0.821   49.232  1.00 42.72 ? 480 HOH A O     1 
HETATM 4874 O O     . HOH E 3 .   ? 13.926  2.401   42.769  1.00 35.58 ? 481 HOH A O     1 
HETATM 4875 O O     . HOH E 3 .   ? 13.004  0.236   44.321  1.00 26.69 ? 482 HOH A O     1 
HETATM 4876 O O     . HOH E 3 .   ? 4.130   8.762   50.822  1.00 41.39 ? 483 HOH A O     1 
HETATM 4877 O O     . HOH E 3 .   ? 3.710   6.374   49.455  1.00 27.87 ? 484 HOH A O     1 
HETATM 4878 O O     . HOH E 3 .   ? -2.541  6.079   46.818  1.00 31.48 ? 485 HOH A O     1 
HETATM 4879 O O     . HOH E 3 .   ? -5.060  4.940   45.517  1.00 24.35 ? 486 HOH A O     1 
HETATM 4880 O O     . HOH E 3 .   ? -5.703  7.484   45.206  1.00 34.80 ? 487 HOH A O     1 
HETATM 4881 O O     . HOH E 3 .   ? -6.871  2.838   45.937  1.00 34.85 ? 488 HOH A O     1 
HETATM 4882 O O     . HOH E 3 .   ? 4.752   33.563  25.864  1.00 54.97 ? 489 HOH A O     1 
HETATM 4883 O O     . HOH E 3 .   ? 6.849   30.925  20.587  1.00 62.74 ? 490 HOH A O     1 
HETATM 4884 O O     . HOH E 3 .   ? 9.569   -2.156  61.173  1.00 61.63 ? 491 HOH A O     1 
HETATM 4885 O O     . HOH E 3 .   ? -11.397 15.282  48.344  1.00 41.74 ? 492 HOH A O     1 
HETATM 4886 O O     . HOH E 3 .   ? 7.637   0.272   50.785  1.00 35.15 ? 493 HOH A O     1 
HETATM 4887 O O     . HOH E 3 .   ? -11.098 7.212   41.043  1.00 47.15 ? 494 HOH A O     1 
HETATM 4888 O O     . HOH E 3 .   ? -8.537  6.714   38.699  1.00 42.37 ? 495 HOH A O     1 
HETATM 4889 O O     . HOH E 3 .   ? -13.295 10.488  43.146  1.00 44.76 ? 496 HOH A O     1 
HETATM 4890 O O     . HOH E 3 .   ? -13.286 6.060   44.228  1.00 52.15 ? 497 HOH A O     1 
HETATM 4891 O O     . HOH E 3 .   ? -8.175  5.989   36.057  1.00 45.77 ? 498 HOH A O     1 
HETATM 4892 O O     . HOH E 3 .   ? -8.897  1.875   44.302  1.00 40.92 ? 499 HOH A O     1 
HETATM 4893 O O     . HOH E 3 .   ? -5.890  0.413   46.570  1.00 31.60 ? 500 HOH A O     1 
HETATM 4894 O O     . HOH E 3 .   ? -3.723  0.427   34.646  1.00 33.25 ? 501 HOH A O     1 
HETATM 4895 O O     . HOH E 3 .   ? -6.824  -3.410  40.308  1.00 39.66 ? 502 HOH A O     1 
HETATM 4896 O O     . HOH E 3 .   ? -14.330 -0.444  48.626  1.00 46.23 ? 503 HOH A O     1 
HETATM 4897 O O     . HOH E 3 .   ? -11.596 -3.119  45.091  1.00 38.04 ? 504 HOH A O     1 
HETATM 4898 O O     . HOH E 3 .   ? -3.050  -3.629  51.588  1.00 41.10 ? 505 HOH A O     1 
HETATM 4899 O O     . HOH E 3 .   ? -1.904  -5.889  43.669  1.00 34.12 ? 506 HOH A O     1 
HETATM 4900 O O     . HOH E 3 .   ? -7.323  9.973   25.619  1.00 56.55 ? 507 HOH A O     1 
HETATM 4901 O O     . HOH E 3 .   ? -9.958  8.502   27.231  1.00 41.79 ? 508 HOH A O     1 
HETATM 4902 O O     . HOH E 3 .   ? -9.196  1.952   39.381  1.00 44.74 ? 509 HOH A O     1 
HETATM 4903 O O     . HOH E 3 .   ? -10.787 1.891   30.455  1.00 41.60 ? 510 HOH A O     1 
HETATM 4904 O O     . HOH E 3 .   ? -5.244  19.973  46.227  1.00 67.59 ? 511 HOH A O     1 
HETATM 4905 O O     . HOH E 3 .   ? -16.603 11.378  50.522  1.00 34.18 ? 512 HOH A O     1 
HETATM 4906 O O     . HOH E 3 .   ? -16.945 3.906   50.984  1.00 53.51 ? 513 HOH A O     1 
HETATM 4907 O O     . HOH E 3 .   ? -7.805  -9.771  43.879  1.00 56.86 ? 514 HOH A O     1 
HETATM 4908 O O     . HOH E 3 .   ? -9.892  -11.124 46.545  1.00 61.59 ? 515 HOH A O     1 
HETATM 4909 O O     . HOH E 3 .   ? -6.065  -6.409  41.495  1.00 63.05 ? 516 HOH A O     1 
HETATM 4910 O O     . HOH E 3 .   ? -6.327  -6.508  46.868  1.00 51.26 ? 517 HOH A O     1 
HETATM 4911 O O     . HOH E 3 .   ? -4.125  -3.240  30.044  1.00 54.67 ? 518 HOH A O     1 
HETATM 4912 O O     . HOH E 3 .   ? 0.381   -5.305  39.882  1.00 43.40 ? 519 HOH A O     1 
HETATM 4913 O O     . HOH E 3 .   ? -5.462  -2.181  26.739  1.00 47.24 ? 520 HOH A O     1 
HETATM 4914 O O     . HOH E 3 .   ? 1.786   -4.346  34.076  1.00 38.77 ? 521 HOH A O     1 
HETATM 4915 O O     . HOH E 3 .   ? 4.309   -4.143  32.923  1.00 40.04 ? 522 HOH A O     1 
HETATM 4916 O O     . HOH E 3 .   ? 4.310   -5.027  39.936  1.00 33.08 ? 523 HOH A O     1 
HETATM 4917 O O     . HOH E 3 .   ? 4.717   -5.954  36.537  1.00 49.90 ? 524 HOH A O     1 
HETATM 4918 O O     . HOH E 3 .   ? 7.116   -4.806  36.951  1.00 41.01 ? 525 HOH A O     1 
HETATM 4919 O O     . HOH E 3 .   ? 8.981   -3.976  35.529  1.00 49.48 ? 526 HOH A O     1 
HETATM 4920 O O     . HOH E 3 .   ? 8.945   -3.962  31.550  1.00 47.03 ? 527 HOH A O     1 
HETATM 4921 O O     . HOH E 3 .   ? 6.654   -5.764  33.300  1.00 67.18 ? 528 HOH A O     1 
HETATM 4922 O O     . HOH E 3 .   ? 7.607   -3.193  29.317  1.00 37.58 ? 529 HOH A O     1 
HETATM 4923 O O     . HOH E 3 .   ? 9.062   -5.232  27.911  1.00 45.76 ? 530 HOH A O     1 
HETATM 4924 O O     . HOH E 3 .   ? 3.612   -4.418  53.334  1.00 50.75 ? 531 HOH A O     1 
HETATM 4925 O O     . HOH E 3 .   ? 7.346   -2.987  52.548  1.00 57.97 ? 532 HOH A O     1 
HETATM 4926 O O     . HOH E 3 .   ? 8.046   -11.063 49.604  1.00 38.69 ? 533 HOH A O     1 
HETATM 4927 O O     . HOH E 3 .   ? 17.145  -2.155  39.023  1.00 30.71 ? 534 HOH A O     1 
HETATM 4928 O O     . HOH E 3 .   ? 15.683  -4.983  39.887  1.00 38.40 ? 535 HOH A O     1 
HETATM 4929 O O     . HOH E 3 .   ? 13.012  -4.223  39.725  1.00 27.97 ? 536 HOH A O     1 
HETATM 4930 O O     . HOH E 3 .   ? 11.778  -5.718  37.729  1.00 40.56 ? 537 HOH A O     1 
HETATM 4931 O O     . HOH E 3 .   ? 14.018  -7.559  35.722  1.00 47.25 ? 538 HOH A O     1 
HETATM 4932 O O     . HOH E 3 .   ? 16.837  -6.392  34.399  1.00 55.31 ? 539 HOH A O     1 
HETATM 4933 O O     . HOH E 3 .   ? 19.813  -5.129  36.836  1.00 50.87 ? 540 HOH A O     1 
HETATM 4934 O O     . HOH E 3 .   ? 14.947  -4.249  28.759  1.00 54.24 ? 541 HOH A O     1 
HETATM 4935 O O     . HOH E 3 .   ? 18.147  -2.419  36.464  1.00 50.54 ? 542 HOH A O     1 
HETATM 4936 O O     . HOH E 3 .   ? 16.946  -6.094  37.445  1.00 54.22 ? 543 HOH A O     1 
HETATM 4937 O O     . HOH E 3 .   ? 8.161   -7.541  23.860  1.00 58.80 ? 544 HOH A O     1 
HETATM 4938 O O     . HOH E 3 .   ? 7.252   7.182   18.443  1.00 60.35 ? 545 HOH A O     1 
HETATM 4939 O O     . HOH E 3 .   ? 4.715   13.387  19.558  1.00 57.74 ? 546 HOH A O     1 
HETATM 4940 O O     . HOH E 3 .   ? 11.045  18.526  15.349  1.00 66.42 ? 547 HOH A O     1 
HETATM 4941 O O     . HOH E 3 .   ? 17.324  8.289   28.134  1.00 49.11 ? 548 HOH A O     1 
HETATM 4942 O O     . HOH E 3 .   ? 12.482  8.192   17.267  1.00 73.79 ? 549 HOH A O     1 
HETATM 4943 O O     . HOH E 3 .   ? -3.067  23.973  40.388  1.00 55.34 ? 550 HOH A O     1 
HETATM 4944 O O     . HOH E 3 .   ? 13.166  -0.658  63.509  1.00 59.39 ? 551 HOH A O     1 
HETATM 4945 O O     . HOH E 3 .   ? 11.201  9.168   65.675  1.00 64.20 ? 552 HOH A O     1 
HETATM 4946 O O     . HOH F 3 .   ? 32.868  42.038  20.508  1.00 33.58 ? 304 HOH B O     1 
HETATM 4947 O O     . HOH F 3 .   ? 30.836  43.204  21.764  1.00 57.49 ? 305 HOH B O     1 
HETATM 4948 O O     . HOH F 3 .   ? 39.904  22.552  39.274  1.00 47.26 ? 306 HOH B O     1 
HETATM 4949 O O     . HOH F 3 .   ? 20.861  12.476  14.637  1.00 68.36 ? 307 HOH B O     1 
HETATM 4950 O O     . HOH F 3 .   ? 28.953  18.230  7.726   1.00 65.77 ? 308 HOH B O     1 
HETATM 4951 O O     . HOH F 3 .   ? 37.064  4.581   0.489   1.00 49.20 ? 309 HOH B O     1 
HETATM 4952 O O     . HOH F 3 .   ? 39.584  -2.137  5.370   1.00 49.32 ? 310 HOH B O     1 
HETATM 4953 O O     . HOH F 3 .   ? 22.029  45.663  35.142  1.00 76.14 ? 311 HOH B O     1 
HETATM 4954 O O     . HOH F 3 .   ? 47.179  19.743  -1.325  1.00 65.91 ? 312 HOH B O     1 
HETATM 4955 O O     . HOH F 3 .   ? 50.451  24.704  3.134   1.00 62.51 ? 313 HOH B O     1 
HETATM 4956 O O     . HOH F 3 .   ? 53.298  25.523  8.825   1.00 64.09 ? 314 HOH B O     1 
HETATM 4957 O O     . HOH F 3 .   ? 50.061  -5.743  18.812  1.00 46.53 ? 315 HOH B O     1 
HETATM 4958 O O     . HOH F 3 .   ? 56.758  -2.198  22.907  1.00 49.57 ? 316 HOH B O     1 
HETATM 4959 O O     . HOH F 3 .   ? 62.796  -1.318  9.744   1.00 59.32 ? 317 HOH B O     1 
HETATM 4960 O O     . HOH F 3 .   ? 58.195  1.831   9.257   1.00 52.61 ? 318 HOH B O     1 
HETATM 4961 O O     . HOH F 3 .   ? 64.473  -1.913  8.238   1.00 69.32 ? 319 HOH B O     1 
HETATM 4962 O O     . HOH F 3 .   ? 46.975  20.153  -5.337  1.00 81.27 ? 320 HOH B O     1 
HETATM 4963 O O     . HOH F 3 .   ? 50.476  27.720  -6.332  1.00 55.78 ? 321 HOH B O     1 
HETATM 4964 O O     . HOH F 3 .   ? 65.628  -3.744  10.308  1.00 62.44 ? 322 HOH B O     1 
HETATM 4965 O O     . HOH F 3 .   ? 51.500  6.402   18.435  1.00 55.29 ? 323 HOH B O     1 
HETATM 4966 O O     . HOH F 3 .   ? 56.404  -3.280  7.140   1.00 50.47 ? 324 HOH B O     1 
HETATM 4967 O O     . HOH F 3 .   ? 54.398  12.265  10.102  1.00 51.36 ? 325 HOH B O     1 
HETATM 4968 O O     . HOH F 3 .   ? 56.614  15.411  -9.073  1.00 61.83 ? 326 HOH B O     1 
HETATM 4969 O O     . HOH F 3 .   ? 52.154  15.395  11.964  1.00 48.14 ? 327 HOH B O     1 
HETATM 4970 O O     . HOH F 3 .   ? 53.119  2.234   2.752   1.00 53.41 ? 328 HOH B O     1 
HETATM 4971 O O     . HOH F 3 .   ? 31.861  39.671  32.193  1.00 59.93 ? 329 HOH B O     1 
HETATM 4972 O O     . HOH F 3 .   ? 29.330  34.380  37.743  1.00 31.35 ? 330 HOH B O     1 
HETATM 4973 O O     . HOH F 3 .   ? 30.482  32.152  39.679  1.00 48.15 ? 331 HOH B O     1 
HETATM 4974 O O     . HOH F 3 .   ? 29.659  32.758  35.301  1.00 36.65 ? 332 HOH B O     1 
HETATM 4975 O O     . HOH F 3 .   ? 35.212  39.255  31.347  1.00 37.59 ? 333 HOH B O     1 
HETATM 4976 O O     . HOH F 3 .   ? 35.661  36.886  39.228  1.00 52.44 ? 334 HOH B O     1 
HETATM 4977 O O     . HOH F 3 .   ? 56.045  -5.152  16.585  1.00 55.89 ? 335 HOH B O     1 
HETATM 4978 O O     . HOH F 3 .   ? 39.319  -0.237  -5.678  1.00 59.79 ? 336 HOH B O     1 
HETATM 4979 O O     . HOH F 3 .   ? 37.100  39.987  29.194  1.00 46.63 ? 337 HOH B O     1 
HETATM 4980 O O     . HOH F 3 .   ? 28.367  29.595  36.378  1.00 40.45 ? 338 HOH B O     1 
HETATM 4981 O O     . HOH F 3 .   ? 28.428  24.652  37.115  1.00 42.30 ? 339 HOH B O     1 
HETATM 4982 O O     . HOH F 3 .   ? 25.174  25.324  35.703  1.00 48.54 ? 340 HOH B O     1 
HETATM 4983 O O     . HOH F 3 .   ? 23.115  38.767  25.851  1.00 50.63 ? 341 HOH B O     1 
HETATM 4984 O O     . HOH F 3 .   ? 23.691  16.098  20.646  1.00 43.33 ? 342 HOH B O     1 
HETATM 4985 O O     . HOH F 3 .   ? 17.744  36.251  28.870  1.00 58.94 ? 343 HOH B O     1 
HETATM 4986 O O     . HOH F 3 .   ? 24.406  36.640  24.682  1.00 36.35 ? 344 HOH B O     1 
HETATM 4987 O O     . HOH F 3 .   ? 30.787  9.182   43.540  1.00 73.81 ? 345 HOH B O     1 
HETATM 4988 O O     . HOH F 3 .   ? 21.509  21.271  26.151  1.00 44.42 ? 346 HOH B O     1 
HETATM 4989 O O     . HOH F 3 .   ? 23.784  22.156  27.633  1.00 31.06 ? 347 HOH B O     1 
HETATM 4990 O O     . HOH F 3 .   ? 53.794  24.719  15.745  1.00 49.76 ? 348 HOH B O     1 
HETATM 4991 O O     . HOH F 3 .   ? 25.374  18.282  35.770  1.00 79.07 ? 349 HOH B O     1 
HETATM 4992 O O     . HOH F 3 .   ? 22.146  16.548  33.148  1.00 55.73 ? 350 HOH B O     1 
HETATM 4993 O O     . HOH F 3 .   ? 57.471  13.743  13.408  1.00 73.31 ? 351 HOH B O     1 
HETATM 4994 O O     . HOH F 3 .   ? 53.198  26.493  20.377  1.00 62.57 ? 352 HOH B O     1 
HETATM 4995 O O     . HOH F 3 .   ? 49.583  24.329  21.775  1.00 32.15 ? 353 HOH B O     1 
HETATM 4996 O O     . HOH F 3 .   ? 48.779  18.659  16.862  1.00 33.46 ? 354 HOH B O     1 
HETATM 4997 O O     . HOH F 3 .   ? 47.977  17.599  13.978  1.00 39.71 ? 355 HOH B O     1 
HETATM 4998 O O     . HOH F 3 .   ? 13.023  26.632  6.770   1.00 41.77 ? 356 HOH B O     1 
HETATM 4999 O O     . HOH F 3 .   ? 47.216  16.496  20.298  1.00 36.89 ? 357 HOH B O     1 
HETATM 5000 O O     . HOH F 3 .   ? 44.568  18.319  25.335  1.00 41.02 ? 358 HOH B O     1 
HETATM 5001 O O     . HOH F 3 .   ? 47.719  27.478  22.888  1.00 39.91 ? 359 HOH B O     1 
HETATM 5002 O O     . HOH F 3 .   ? 46.839  7.552   19.481  1.00 34.02 ? 360 HOH B O     1 
HETATM 5003 O O     . HOH F 3 .   ? 45.096  8.595   22.753  1.00 39.75 ? 361 HOH B O     1 
HETATM 5004 O O     . HOH F 3 .   ? 51.203  23.659  24.428  1.00 60.89 ? 362 HOH B O     1 
HETATM 5005 O O     . HOH F 3 .   ? 15.352  24.062  24.121  1.00 74.89 ? 363 HOH B O     1 
HETATM 5006 O O     . HOH F 3 .   ? 17.312  31.816  20.755  1.00 69.50 ? 364 HOH B O     1 
HETATM 5007 O O     . HOH F 3 .   ? 19.535  29.965  20.248  1.00 43.13 ? 365 HOH B O     1 
HETATM 5008 O O     . HOH F 3 .   ? 39.327  10.528  36.471  1.00 71.06 ? 366 HOH B O     1 
HETATM 5009 O O     . HOH F 3 .   ? 34.320  9.947   35.955  1.00 43.89 ? 367 HOH B O     1 
HETATM 5010 O O     . HOH F 3 .   ? 43.048  8.780   26.835  1.00 53.08 ? 368 HOH B O     1 
HETATM 5011 O O     . HOH F 3 .   ? 42.704  20.180  40.693  1.00 57.58 ? 369 HOH B O     1 
HETATM 5012 O O     . HOH F 3 .   ? 41.473  24.857  36.026  1.00 45.84 ? 370 HOH B O     1 
HETATM 5013 O O     . HOH F 3 .   ? 43.295  21.006  33.114  1.00 43.91 ? 371 HOH B O     1 
HETATM 5014 O O     . HOH F 3 .   ? 43.030  26.714  35.779  1.00 64.92 ? 372 HOH B O     1 
HETATM 5015 O O     . HOH F 3 .   ? 33.568  19.528  34.864  1.00 43.14 ? 373 HOH B O     1 
HETATM 5016 O O     . HOH F 3 .   ? 35.880  20.689  34.275  1.00 41.38 ? 374 HOH B O     1 
HETATM 5017 O O     . HOH F 3 .   ? 43.549  32.835  31.399  1.00 66.43 ? 375 HOH B O     1 
HETATM 5018 O O     . HOH F 3 .   ? 50.346  16.088  14.168  1.00 37.21 ? 376 HOH B O     1 
HETATM 5019 O O     . HOH F 3 .   ? 52.933  8.354   19.230  1.00 57.57 ? 377 HOH B O     1 
HETATM 5020 O O     . HOH F 3 .   ? 50.669  29.246  21.037  1.00 67.72 ? 378 HOH B O     1 
HETATM 5021 O O     . HOH F 3 .   ? 59.175  13.451  9.395   1.00 57.39 ? 379 HOH B O     1 
HETATM 5022 O O     . HOH F 3 .   ? 62.821  12.158  10.981  1.00 67.88 ? 380 HOH B O     1 
HETATM 5023 O O     . HOH F 3 .   ? 50.226  15.507  23.849  1.00 63.25 ? 381 HOH B O     1 
HETATM 5024 O O     . HOH F 3 .   ? 49.116  13.730  22.055  1.00 55.48 ? 382 HOH B O     1 
HETATM 5025 O O     . HOH F 3 .   ? 45.456  32.619  30.123  1.00 47.21 ? 383 HOH B O     1 
HETATM 5026 O O     . HOH F 3 .   ? 44.624  28.949  30.038  1.00 47.34 ? 384 HOH B O     1 
HETATM 5027 O O     . HOH F 3 .   ? 41.866  30.268  30.990  1.00 39.31 ? 385 HOH B O     1 
HETATM 5028 O O     . HOH F 3 .   ? 43.857  35.593  33.976  1.00 65.02 ? 386 HOH B O     1 
HETATM 5029 O O     . HOH F 3 .   ? 17.880  2.047   32.966  1.00 49.92 ? 387 HOH B O     1 
HETATM 5030 O O     . HOH F 3 .   ? 46.781  36.021  19.270  1.00 46.44 ? 388 HOH B O     1 
HETATM 5031 O O     . HOH F 3 .   ? 19.324  34.898  19.431  1.00 52.16 ? 389 HOH B O     1 
HETATM 5032 O O     . HOH F 3 .   ? 29.175  45.620  15.382  1.00 44.58 ? 390 HOH B O     1 
HETATM 5033 O O     . HOH F 3 .   ? 30.073  46.613  18.814  1.00 48.03 ? 391 HOH B O     1 
HETATM 5034 O O     . HOH F 3 .   ? 23.276  44.373  13.344  1.00 64.70 ? 392 HOH B O     1 
HETATM 5035 O O     . HOH F 3 .   ? 33.146  42.242  7.333   1.00 58.58 ? 393 HOH B O     1 
HETATM 5036 O O     . HOH F 3 .   ? 30.607  43.051  4.374   1.00 72.50 ? 394 HOH B O     1 
HETATM 5037 O O     . HOH F 3 .   ? 23.714  43.675  7.671   1.00 64.27 ? 395 HOH B O     1 
HETATM 5038 O O     . HOH F 3 .   ? 22.266  41.328  4.064   1.00 65.56 ? 396 HOH B O     1 
HETATM 5039 O O     . HOH F 3 .   ? 44.852  34.277  20.065  1.00 37.93 ? 397 HOH B O     1 
HETATM 5040 O O     . HOH F 3 .   ? 42.688  34.474  18.119  1.00 27.44 ? 398 HOH B O     1 
HETATM 5041 O O     . HOH F 3 .   ? 40.929  28.831  33.771  1.00 52.82 ? 399 HOH B O     1 
HETATM 5042 O O     . HOH F 3 .   ? 65.087  0.790   4.782   1.00 62.39 ? 401 HOH B O     1 
HETATM 5043 O O     . HOH F 3 .   ? 42.846  30.855  40.746  1.00 65.88 ? 402 HOH B O     1 
HETATM 5044 O O     . HOH F 3 .   ? 42.636  30.487  36.362  1.00 63.64 ? 403 HOH B O     1 
HETATM 5045 O O     . HOH F 3 .   ? 45.558  38.756  22.321  1.00 32.92 ? 404 HOH B O     1 
HETATM 5046 O O     . HOH F 3 .   ? 44.198  41.238  21.904  1.00 34.25 ? 405 HOH B O     1 
HETATM 5047 O O     . HOH F 3 .   ? 47.581  38.273  20.779  1.00 44.73 ? 406 HOH B O     1 
HETATM 5048 O O     . HOH F 3 .   ? 32.569  40.429  27.786  1.00 35.46 ? 407 HOH B O     1 
HETATM 5049 O O     . HOH F 3 .   ? 30.468  41.024  25.954  1.00 37.72 ? 408 HOH B O     1 
HETATM 5050 O O     . HOH F 3 .   ? 39.129  42.927  18.814  1.00 35.40 ? 409 HOH B O     1 
HETATM 5051 O O     . HOH F 3 .   ? 41.491  40.817  21.645  1.00 29.11 ? 410 HOH B O     1 
HETATM 5052 O O     . HOH F 3 .   ? 17.868  3.309   21.630  1.00 54.39 ? 411 HOH B O     1 
HETATM 5053 O O     . HOH F 3 .   ? 17.862  10.341  18.525  1.00 61.42 ? 412 HOH B O     1 
HETATM 5054 O O     . HOH F 3 .   ? 51.769  4.969   15.132  1.00 39.99 ? 413 HOH B O     1 
HETATM 5055 O O     . HOH F 3 .   ? 53.254  33.045  19.494  1.00 78.41 ? 414 HOH B O     1 
HETATM 5056 O O     . HOH F 3 .   ? 51.308  -1.860  -1.560  1.00 49.35 ? 415 HOH B O     1 
HETATM 5057 O O     . HOH F 3 .   ? 44.183  -1.924  3.091   1.00 55.88 ? 416 HOH B O     1 
HETATM 5058 O O     . HOH F 3 .   ? 47.757  -1.721  23.649  1.00 50.94 ? 417 HOH B O     1 
HETATM 5059 O O     . HOH F 3 .   ? 34.369  10.777  18.350  1.00 46.16 ? 418 HOH B O     1 
HETATM 5060 O O     . HOH F 3 .   ? 21.212  18.864  25.203  1.00 60.76 ? 419 HOH B O     1 
HETATM 5061 O O     . HOH F 3 .   ? 53.779  21.174  4.904   1.00 43.80 ? 420 HOH B O     1 
HETATM 5062 O O     . HOH F 3 .   ? 60.752  -1.050  15.087  1.00 55.55 ? 421 HOH B O     1 
HETATM 5063 O O     . HOH F 3 .   ? 44.116  -5.830  8.272   1.00 52.15 ? 422 HOH B O     1 
HETATM 5064 O O     . HOH F 3 .   ? 62.619  -10.777 13.849  1.00 79.56 ? 423 HOH B O     1 
HETATM 5065 O O     . HOH F 3 .   ? 36.602  4.096   19.413  1.00 51.94 ? 424 HOH B O     1 
HETATM 5066 O O     . HOH F 3 .   ? 34.971  5.455   19.325  1.00 47.96 ? 425 HOH B O     1 
HETATM 5067 O O     . HOH F 3 .   ? 31.990  3.406   17.758  1.00 67.13 ? 426 HOH B O     1 
HETATM 5068 O O     . HOH F 3 .   ? 29.273  4.743   21.627  1.00 59.71 ? 427 HOH B O     1 
HETATM 5069 O O     . HOH F 3 .   ? 35.033  2.469   26.416  1.00 56.85 ? 428 HOH B O     1 
HETATM 5070 O O     . HOH F 3 .   ? 34.779  3.155   1.992   1.00 53.44 ? 429 HOH B O     1 
HETATM 5071 O O     . HOH F 3 .   ? 41.180  12.758  5.748   1.00 60.29 ? 430 HOH B O     1 
HETATM 5072 O O     . HOH F 3 .   ? 31.269  4.095   32.371  1.00 63.45 ? 431 HOH B O     1 
HETATM 5073 O O     . HOH F 3 .   ? 41.754  31.272  45.013  1.00 74.35 ? 432 HOH B O     1 
HETATM 5074 O O     . HOH F 3 .   ? 43.490  25.549  45.632  1.00 56.53 ? 433 HOH B O     1 
HETATM 5075 O O     . HOH F 3 .   ? 34.967  12.643  14.468  1.00 47.04 ? 434 HOH B O     1 
HETATM 5076 O O     . HOH F 3 .   ? 16.549  -0.625  14.060  1.00 67.09 ? 435 HOH B O     1 
HETATM 5077 O O     . HOH F 3 .   ? 41.238  17.101  9.863   1.00 44.02 ? 436 HOH B O     1 
HETATM 5078 O O     . HOH F 3 .   ? 40.905  15.554  12.340  1.00 36.54 ? 437 HOH B O     1 
HETATM 5079 O O     . HOH F 3 .   ? 39.934  12.633  13.492  1.00 39.21 ? 438 HOH B O     1 
HETATM 5080 O O     . HOH F 3 .   ? 28.559  9.686   16.813  1.00 57.70 ? 439 HOH B O     1 
HETATM 5081 O O     . HOH F 3 .   ? 28.816  40.003  35.249  1.00 54.19 ? 440 HOH B O     1 
HETATM 5082 O O     . HOH F 3 .   ? 37.278  14.313  11.007  1.00 70.07 ? 441 HOH B O     1 
HETATM 5083 O O     . HOH F 3 .   ? 51.294  33.148  20.869  1.00 54.53 ? 442 HOH B O     1 
HETATM 5084 O O     . HOH F 3 .   ? 47.066  17.730  30.733  1.00 69.72 ? 443 HOH B O     1 
HETATM 5085 O O     . HOH F 3 .   ? 36.363  17.044  5.741   1.00 62.82 ? 444 HOH B O     1 
HETATM 5086 O O     . HOH F 3 .   ? 20.537  9.837   10.007  1.00 62.35 ? 445 HOH B O     1 
HETATM 5087 O O     . HOH F 3 .   ? 15.083  21.960  7.450   1.00 61.98 ? 446 HOH B O     1 
HETATM 5088 O O     . HOH F 3 .   ? 24.949  13.313  15.592  1.00 69.29 ? 447 HOH B O     1 
HETATM 5089 O O     . HOH F 3 .   ? 26.717  43.333  18.850  1.00 50.58 ? 448 HOH B O     1 
HETATM 5090 O O     . HOH F 3 .   ? 26.321  46.068  22.976  1.00 55.44 ? 449 HOH B O     1 
HETATM 5091 O O     . HOH F 3 .   ? 22.368  17.580  15.863  1.00 66.17 ? 450 HOH B O     1 
HETATM 5092 O O     . HOH F 3 .   ? 32.933  17.139  10.895  1.00 54.99 ? 451 HOH B O     1 
HETATM 5093 O O     . HOH F 3 .   ? 19.855  36.474  14.757  1.00 60.93 ? 452 HOH B O     1 
HETATM 5094 O O     . HOH F 3 .   ? 14.560  31.057  17.590  1.00 67.22 ? 453 HOH B O     1 
HETATM 5095 O O     . HOH F 3 .   ? 31.458  19.645  8.778   1.00 52.21 ? 454 HOH B O     1 
HETATM 5096 O O     . HOH F 3 .   ? 58.046  -3.870  20.068  1.00 56.00 ? 455 HOH B O     1 
HETATM 5097 O O     . HOH F 3 .   ? 55.367  2.739   14.733  1.00 48.44 ? 456 HOH B O     1 
HETATM 5098 O O     . HOH F 3 .   ? 48.421  30.162  27.832  1.00 45.10 ? 457 HOH B O     1 
HETATM 5099 O O     . HOH F 3 .   ? 37.206  20.250  -4.434  1.00 69.92 ? 458 HOH B O     1 
HETATM 5100 O O     . HOH F 3 .   ? 44.923  -2.899  0.191   1.00 47.30 ? 459 HOH B O     1 
HETATM 5101 O O     . HOH F 3 .   ? 38.431  15.481  -12.785 1.00 62.38 ? 460 HOH B O     1 
HETATM 5102 O O     . HOH F 3 .   ? 27.121  16.435  13.432  1.00 43.87 ? 461 HOH B O     1 
HETATM 5103 O O     . HOH F 3 .   ? 53.005  29.280  17.270  1.00 61.96 ? 462 HOH B O     1 
HETATM 5104 O O     . HOH F 3 .   ? 26.695  20.185  7.098   1.00 52.72 ? 463 HOH B O     1 
HETATM 5105 O O     . HOH F 3 .   ? 35.705  7.051   34.169  1.00 52.17 ? 464 HOH B O     1 
HETATM 5106 O O     . HOH F 3 .   ? 26.989  1.200   22.867  1.00 57.43 ? 465 HOH B O     1 
HETATM 5107 O O     . HOH F 3 .   ? 18.047  8.276   15.113  1.00 73.03 ? 466 HOH B O     1 
HETATM 5108 O O     . HOH F 3 .   ? 55.440  9.545   13.454  1.00 64.34 ? 467 HOH B O     1 
HETATM 5109 O O     . HOH F 3 .   ? 53.166  6.799   16.538  1.00 63.38 ? 468 HOH B O     1 
HETATM 5110 O O     . HOH F 3 .   ? 32.116  7.687   21.325  1.00 63.33 ? 469 HOH B O     1 
HETATM 5111 O O     . HOH F 3 .   ? 52.781  4.595   18.700  1.00 38.19 ? 470 HOH B O     1 
HETATM 5112 O O     . HOH F 3 .   ? 20.307  24.213  30.916  1.00 58.80 ? 471 HOH B O     1 
HETATM 5113 O O     . HOH F 3 .   ? 55.025  -5.411  21.505  1.00 65.30 ? 472 HOH B O     1 
HETATM 5114 O O     . HOH F 3 .   ? 49.313  -4.343  24.847  1.00 57.12 ? 473 HOH B O     1 
HETATM 5115 O O     . HOH F 3 .   ? 42.892  4.336   24.303  1.00 51.61 ? 474 HOH B O     1 
HETATM 5116 O O     . HOH F 3 .   ? 52.782  5.765   12.149  1.00 48.34 ? 475 HOH B O     1 
HETATM 5117 O O     . HOH F 3 .   ? 27.097  5.093   6.438   1.00 55.86 ? 476 HOH B O     1 
HETATM 5118 O O     . HOH F 3 .   ? 41.006  8.013   24.316  1.00 39.17 ? 477 HOH B O     1 
HETATM 5119 O O     . HOH F 3 .   ? 40.742  24.756  -7.784  1.00 74.78 ? 478 HOH B O     1 
HETATM 5120 O O     . HOH F 3 .   ? 42.573  24.731  -0.632  1.00 67.24 ? 479 HOH B O     1 
HETATM 5121 O O     . HOH F 3 .   ? 38.360  22.573  8.579   1.00 31.48 ? 480 HOH B O     1 
HETATM 5122 O O     . HOH F 3 .   ? 42.558  19.508  26.412  1.00 42.82 ? 481 HOH B O     1 
HETATM 5123 O O     . HOH F 3 .   ? 43.987  18.314  30.230  1.00 52.90 ? 482 HOH B O     1 
HETATM 5124 O O     . HOH F 3 .   ? 41.891  15.119  31.298  1.00 41.32 ? 483 HOH B O     1 
HETATM 5125 O O     . HOH F 3 .   ? 51.306  -4.160  -1.865  1.00 63.92 ? 484 HOH B O     1 
HETATM 5126 O O     . HOH F 3 .   ? 32.626  7.514   24.474  1.00 52.36 ? 485 HOH B O     1 
HETATM 5127 O O     . HOH F 3 .   ? 30.916  14.240  16.169  1.00 57.60 ? 486 HOH B O     1 
HETATM 5128 O O     . HOH F 3 .   ? 24.396  20.842  10.755  1.00 47.41 ? 487 HOH B O     1 
HETATM 5129 O O     . HOH F 3 .   ? 26.601  19.793  11.458  1.00 31.88 ? 488 HOH B O     1 
HETATM 5130 O O     . HOH F 3 .   ? 26.462  19.119  13.984  1.00 40.67 ? 489 HOH B O     1 
HETATM 5131 O O     . HOH F 3 .   ? 23.572  19.731  15.098  1.00 57.67 ? 490 HOH B O     1 
HETATM 5132 O O     . HOH F 3 .   ? 21.816  21.763  13.591  1.00 40.75 ? 491 HOH B O     1 
HETATM 5133 O O     . HOH F 3 .   ? 24.112  21.040  17.552  1.00 33.21 ? 492 HOH B O     1 
HETATM 5134 O O     . HOH F 3 .   ? 28.252  20.421  15.901  1.00 27.08 ? 493 HOH B O     1 
HETATM 5135 O O     . HOH F 3 .   ? 25.337  8.795   20.021  1.00 55.86 ? 494 HOH B O     1 
HETATM 5136 O O     . HOH F 3 .   ? 27.308  12.835  28.569  1.00 35.93 ? 495 HOH B O     1 
HETATM 5137 O O     . HOH F 3 .   ? 24.244  22.728  7.080   1.00 55.78 ? 496 HOH B O     1 
HETATM 5138 O O     . HOH F 3 .   ? 27.725  14.907  33.332  1.00 48.97 ? 497 HOH B O     1 
HETATM 5139 O O     . HOH F 3 .   ? 32.009  16.995  34.108  1.00 42.37 ? 498 HOH B O     1 
HETATM 5140 O O     . HOH F 3 .   ? 31.262  25.341  11.589  1.00 41.63 ? 499 HOH B O     1 
HETATM 5141 O O     . HOH F 3 .   ? 34.902  28.037  12.190  1.00 27.68 ? 500 HOH B O     1 
HETATM 5142 O O     . HOH F 3 .   ? 31.319  27.160  9.777   1.00 34.53 ? 501 HOH B O     1 
HETATM 5143 O O     . HOH F 3 .   ? 23.266  3.012   19.017  1.00 53.65 ? 502 HOH B O     1 
HETATM 5144 O O     . HOH F 3 .   ? 20.075  26.740  32.432  1.00 50.87 ? 503 HOH B O     1 
HETATM 5145 O O     . HOH F 3 .   ? 54.854  34.927  11.013  1.00 59.17 ? 504 HOH B O     1 
HETATM 5146 O O     . HOH F 3 .   ? 41.974  36.767  16.650  1.00 34.34 ? 505 HOH B O     1 
HETATM 5147 O O     . HOH F 3 .   ? 20.736  37.550  26.719  1.00 51.87 ? 506 HOH B O     1 
HETATM 5148 O O     . HOH F 3 .   ? 28.487  26.956  1.628   1.00 57.64 ? 507 HOH B O     1 
HETATM 5149 O O     . HOH F 3 .   ? 33.412  29.050  8.422   1.00 43.28 ? 508 HOH B O     1 
HETATM 5150 O O     . HOH F 3 .   ? 32.899  31.301  10.189  1.00 36.03 ? 509 HOH B O     1 
HETATM 5151 O O     . HOH F 3 .   ? 23.798  32.725  13.375  1.00 32.94 ? 510 HOH B O     1 
HETATM 5152 O O     . HOH F 3 .   ? 23.103  30.148  13.421  1.00 38.68 ? 511 HOH B O     1 
HETATM 5153 O O     . HOH F 3 .   ? 26.418  31.827  12.310  1.00 29.86 ? 512 HOH B O     1 
HETATM 5154 O O     . HOH F 3 .   ? 22.365  34.798  12.863  1.00 39.02 ? 513 HOH B O     1 
HETATM 5155 O O     . HOH F 3 .   ? 35.441  20.835  7.832   1.00 50.90 ? 514 HOH B O     1 
HETATM 5156 O O     . HOH F 3 .   ? 41.497  12.023  33.852  1.00 47.30 ? 515 HOH B O     1 
HETATM 5157 O O     . HOH F 3 .   ? 52.106  38.744  -5.070  1.00 63.32 ? 516 HOH B O     1 
HETATM 5158 O O     . HOH F 3 .   ? 17.372  23.104  9.824   1.00 38.41 ? 517 HOH B O     1 
HETATM 5159 O O     . HOH F 3 .   ? 23.742  24.768  8.986   1.00 55.68 ? 518 HOH B O     1 
HETATM 5160 O O     . HOH F 3 .   ? 19.376  38.442  18.619  1.00 56.61 ? 519 HOH B O     1 
HETATM 5161 O O     . HOH F 3 .   ? 15.159  27.794  14.779  1.00 41.39 ? 520 HOH B O     1 
HETATM 5162 O O     . HOH F 3 .   ? 14.895  35.359  12.155  1.00 64.03 ? 521 HOH B O     1 
HETATM 5163 O O     . HOH F 3 .   ? 15.062  22.834  19.182  1.00 68.44 ? 522 HOH B O     1 
HETATM 5164 O O     . HOH F 3 .   ? 17.321  41.001  13.444  1.00 49.87 ? 523 HOH B O     1 
HETATM 5165 O O     . HOH F 3 .   ? 17.363  40.925  17.517  1.00 61.49 ? 524 HOH B O     1 
HETATM 5166 O O     . HOH F 3 .   ? 59.332  16.475  -3.386  1.00 68.69 ? 525 HOH B O     1 
HETATM 5167 O O     . HOH F 3 .   ? 57.470  8.838   0.118   1.00 63.05 ? 526 HOH B O     1 
HETATM 5168 O O     . HOH F 3 .   ? 27.289  43.217  16.235  1.00 41.24 ? 527 HOH B O     1 
HETATM 5169 O O     . HOH F 3 .   ? 25.774  39.105  20.224  1.00 38.26 ? 528 HOH B O     1 
HETATM 5170 O O     . HOH F 3 .   ? 21.823  41.041  19.034  1.00 45.90 ? 529 HOH B O     1 
HETATM 5171 O O     . HOH F 3 .   ? 13.921  37.914  22.974  1.00 71.16 ? 530 HOH B O     1 
HETATM 5172 O O     . HOH F 3 .   ? 18.262  40.696  24.282  1.00 73.09 ? 531 HOH B O     1 
HETATM 5173 O O     . HOH F 3 .   ? 13.040  37.175  28.367  1.00 65.60 ? 532 HOH B O     1 
HETATM 5174 O O     . HOH F 3 .   ? 55.439  21.197  9.313   1.00 56.50 ? 533 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   ?   ?   ?   A . n 
A 1 5   PRO 5   5   ?   ?   ?   A . n 
A 1 6   VAL 6   6   ?   ?   ?   A . n 
A 1 7   GLN 7   7   ?   ?   ?   A . n 
A 1 8   SER 8   8   ?   ?   ?   A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  MET 13  13  13  MET MET A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  PHE 24  24  24  PHE PHE A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  GLN 47  47  47  GLN GLN A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  ASP 62  62  62  ASP ASP A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  CYS 77  77  77  CYS CYS A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  TYR 81  81  81  TYR TYR A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TRP 96  96  96  TRP TRP A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  MET 99  99  99  MET MET A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 HIS 136 136 136 HIS HIS A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 LYS 139 139 139 LYS LYS A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 HIS 142 142 142 HIS HIS A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 HIS 155 155 155 HIS HIS A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 ASP 162 162 162 ASP ASP A . n 
A 1 163 PHE 163 163 163 PHE PHE A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 GLN 168 168 168 GLN GLN A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 THR 172 172 172 THR THR A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 ARG 176 176 176 ARG ARG A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 TPO 178 178 178 TPO THR A . n 
A 1 179 PHE 179 179 179 PHE PHE A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 GLY 181 181 181 GLY GLY A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 PRO 183 183 183 PRO PRO A . n 
A 1 184 PHE 184 184 184 PHE PHE A . n 
A 1 185 TRP 185 185 185 TRP TRP A . n 
A 1 186 MET 186 186 186 MET MET A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 GLU 189 189 189 GLU GLU A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 GLN 193 193 193 GLN GLN A . n 
A 1 194 SER 194 194 194 SER SER A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 TYR 196 196 196 TYR TYR A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 ASP 201 201 201 ASP ASP A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 TRP 203 203 203 TRP TRP A . n 
A 1 204 SER 204 204 204 SER SER A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 GLY 206 206 206 GLY GLY A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 THR 208 208 208 THR THR A . n 
A 1 209 ALA 209 209 209 ALA ALA A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 GLU 216 216 216 GLU GLU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 PRO 218 218 218 PRO PRO A . n 
A 1 219 HIS 219 219 219 HIS HIS A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 MET 225 225 225 MET MET A . n 
A 1 226 LYS 226 226 226 LYS LYS A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 PHE 229 229 229 PHE PHE A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 ILE 231 231 231 ILE ILE A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 LEU 239 239 239 LEU LEU A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 TYR 243 243 243 TYR TYR A . n 
A 1 244 SER 244 244 244 SER SER A . n 
A 1 245 LYS 245 245 245 LYS LYS A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 PHE 250 250 250 PHE PHE A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 GLU 252 252 252 GLU GLU A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 LEU 255 255 255 LEU LEU A . n 
A 1 256 ASN 256 256 256 ASN ASN A . n 
A 1 257 LYS 257 257 257 LYS LYS A . n 
A 1 258 GLU 258 258 258 GLU GLU A . n 
A 1 259 PRO 259 259 259 PRO PRO A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 PHE 261 261 261 PHE PHE A . n 
A 1 262 ARG 262 262 262 ARG ARG A . n 
A 1 263 PRO 263 263 263 PRO PRO A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 ALA 265 265 265 ALA ALA A . n 
A 1 266 LYS 266 266 266 LYS LYS A . n 
A 1 267 GLU 267 267 267 GLU GLU A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 HIS 271 271 271 HIS HIS A . n 
A 1 272 LYS 272 272 272 LYS LYS A . n 
A 1 273 PHE 273 273 273 PHE PHE A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 ASN 277 277 277 ASN ASN A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 LYS 280 280 280 LYS LYS A . n 
A 1 281 THR 281 281 281 THR THR A . n 
A 1 282 SER 282 282 282 SER SER A . n 
A 1 283 TYR 283 283 283 TYR TYR A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 THR 285 285 285 THR THR A . n 
A 1 286 GLU 286 286 286 GLU GLU A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 ILE 288 288 288 ILE ILE A . n 
A 1 289 ASP 289 289 289 ASP ASP A . n 
A 1 290 ARG 290 290 290 ARG ARG A . n 
A 1 291 TYR 291 291 291 TYR TYR A . n 
A 1 292 LYS 292 292 292 LYS LYS A . n 
A 1 293 ARG 293 293 293 ARG ARG A . n 
A 1 294 TRP 294 294 294 TRP TRP A . n 
A 1 295 LYS 295 295 295 LYS LYS A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 SER 299 299 ?   ?   ?   A . n 
A 1 300 HIS 300 300 ?   ?   ?   A . n 
A 1 301 ASP 301 301 ?   ?   ?   A . n 
A 1 302 ASP 302 302 ?   ?   ?   A . n 
A 1 303 SER 303 303 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   ?   ?   ?   B . n 
B 1 3   HIS 3   3   ?   ?   ?   B . n 
B 1 4   SER 4   4   ?   ?   ?   B . n 
B 1 5   PRO 5   5   ?   ?   ?   B . n 
B 1 6   VAL 6   6   ?   ?   ?   B . n 
B 1 7   GLN 7   7   ?   ?   ?   B . n 
B 1 8   SER 8   8   8   SER SER B . n 
B 1 9   GLY 9   9   9   GLY GLY B . n 
B 1 10  LEU 10  10  10  LEU LEU B . n 
B 1 11  PRO 11  11  11  PRO PRO B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  MET 13  13  13  MET MET B . n 
B 1 14  GLN 14  14  14  GLN GLN B . n 
B 1 15  ASN 15  15  15  ASN ASN B . n 
B 1 16  LEU 16  16  16  LEU LEU B . n 
B 1 17  LYS 17  17  17  LYS LYS B . n 
B 1 18  ALA 18  18  18  ALA ALA B . n 
B 1 19  ASP 19  19  19  ASP ASP B . n 
B 1 20  PRO 20  20  20  PRO PRO B . n 
B 1 21  GLU 21  21  21  GLU GLU B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  PHE 24  24  24  PHE PHE B . n 
B 1 25  THR 25  25  25  THR THR B . n 
B 1 26  LYS 26  26  26  LYS LYS B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  GLU 28  28  28  GLU GLU B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  ILE 30  30  30  ILE ILE B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  LYS 32  32  32  LYS LYS B . n 
B 1 33  GLY 33  33  33  GLY GLY B . n 
B 1 34  SER 34  34  34  SER SER B . n 
B 1 35  PHE 35  35  35  PHE PHE B . n 
B 1 36  GLY 36  36  36  GLY GLY B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  VAL 38  38  38  VAL VAL B . n 
B 1 39  PHE 39  39  39  PHE PHE B . n 
B 1 40  LYS 40  40  40  LYS LYS B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  ILE 42  42  42  ILE ILE B . n 
B 1 43  ASP 43  43  43  ASP ASP B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  THR 46  46  46  THR THR B . n 
B 1 47  GLN 47  47  47  GLN GLN B . n 
B 1 48  LYS 48  48  48  LYS LYS B . n 
B 1 49  VAL 49  49  49  VAL VAL B . n 
B 1 50  VAL 50  50  50  VAL VAL B . n 
B 1 51  ALA 51  51  51  ALA ALA B . n 
B 1 52  ILE 52  52  52  ILE ILE B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ILE 54  54  54  ILE ILE B . n 
B 1 55  ILE 55  55  55  ILE ILE B . n 
B 1 56  ASP 56  56  56  ASP ASP B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  GLU 58  58  58  GLU GLU B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  ALA 60  60  60  ALA ALA B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  ASP 62  62  62  ASP ASP B . n 
B 1 63  GLU 63  63  63  GLU GLU B . n 
B 1 64  ILE 64  64  64  ILE ILE B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  ASP 66  66  66  ASP ASP B . n 
B 1 67  ILE 67  67  67  ILE ILE B . n 
B 1 68  GLN 68  68  68  GLN GLN B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  GLU 70  70  70  GLU GLU B . n 
B 1 71  ILE 71  71  71  ILE ILE B . n 
B 1 72  THR 72  72  72  THR THR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  GLN 76  76  76  GLN GLN B . n 
B 1 77  CYS 77  77  77  CYS CYS B . n 
B 1 78  ASP 78  78  78  ASP ASP B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  TYR 81  81  81  TYR TYR B . n 
B 1 82  VAL 82  82  82  VAL VAL B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  TYR 85  85  85  TYR TYR B . n 
B 1 86  TYR 86  86  86  TYR TYR B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  SER 88  88  88  SER SER B . n 
B 1 89  TYR 89  89  89  TYR TYR B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  ASP 92  92  92  ASP ASP B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  TRP 96  96  96  TRP TRP B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  ILE 98  98  98  ILE ILE B . n 
B 1 99  MET 99  99  99  MET MET B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 TYR 101 101 101 TYR TYR B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 GLY 103 103 103 GLY GLY B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 SER 106 106 106 SER SER B . n 
B 1 107 ALA 107 107 107 ALA ALA B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 ASP 109 109 109 ASP ASP B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 GLY 114 114 114 GLY GLY B . n 
B 1 115 PRO 115 115 115 PRO PRO B . n 
B 1 116 LEU 116 116 116 LEU LEU B . n 
B 1 117 ASP 117 117 117 ASP ASP B . n 
B 1 118 GLU 118 118 118 GLU GLU B . n 
B 1 119 THR 119 119 119 THR THR B . n 
B 1 120 GLN 120 120 120 GLN GLN B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 THR 123 123 123 THR THR B . n 
B 1 124 ILE 124 124 124 ILE ILE B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 ARG 126 126 126 ARG ARG B . n 
B 1 127 GLU 127 127 127 GLU GLU B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 LEU 129 129 129 LEU LEU B . n 
B 1 130 LYS 130 130 130 LYS LYS B . n 
B 1 131 GLY 131 131 131 GLY GLY B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 TYR 134 134 134 TYR TYR B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 HIS 136 136 136 HIS HIS B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 GLU 138 138 138 GLU GLU B . n 
B 1 139 LYS 139 139 139 LYS LYS B . n 
B 1 140 LYS 140 140 140 LYS LYS B . n 
B 1 141 ILE 141 141 141 ILE ILE B . n 
B 1 142 HIS 142 142 142 HIS HIS B . n 
B 1 143 ARG 143 143 143 ARG ARG B . n 
B 1 144 ASP 144 144 144 ASP ASP B . n 
B 1 145 ILE 145 145 145 ILE ILE B . n 
B 1 146 LYS 146 146 146 LYS LYS B . n 
B 1 147 ALA 147 147 147 ALA ALA B . n 
B 1 148 ALA 148 148 148 ALA ALA B . n 
B 1 149 ASN 149 149 149 ASN ASN B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 LEU 151 151 151 LEU LEU B . n 
B 1 152 LEU 152 152 152 LEU LEU B . n 
B 1 153 SER 153 153 153 SER SER B . n 
B 1 154 GLU 154 154 154 GLU GLU B . n 
B 1 155 HIS 155 155 155 HIS HIS B . n 
B 1 156 GLY 156 156 156 GLY GLY B . n 
B 1 157 GLU 157 157 157 GLU GLU B . n 
B 1 158 VAL 158 158 158 VAL VAL B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
B 1 160 LEU 160 160 160 LEU LEU B . n 
B 1 161 ALA 161 161 161 ALA ALA B . n 
B 1 162 ASP 162 162 162 ASP ASP B . n 
B 1 163 PHE 163 163 163 PHE PHE B . n 
B 1 164 GLY 164 164 164 GLY GLY B . n 
B 1 165 VAL 165 165 165 VAL VAL B . n 
B 1 166 ALA 166 166 166 ALA ALA B . n 
B 1 167 GLY 167 167 167 GLY GLY B . n 
B 1 168 GLN 168 168 168 GLN GLN B . n 
B 1 169 LEU 169 169 169 LEU LEU B . n 
B 1 170 THR 170 170 170 THR THR B . n 
B 1 171 ASP 171 171 171 ASP ASP B . n 
B 1 172 THR 172 172 172 THR THR B . n 
B 1 173 GLN 173 173 173 GLN GLN B . n 
B 1 174 ILE 174 174 174 ILE ILE B . n 
B 1 175 LYS 175 175 175 LYS LYS B . n 
B 1 176 ARG 176 176 176 ARG ARG B . n 
B 1 177 ASN 177 177 177 ASN ASN B . n 
B 1 178 TPO 178 178 178 TPO THR B . n 
B 1 179 PHE 179 179 179 PHE PHE B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 GLY 181 181 181 GLY GLY B . n 
B 1 182 THR 182 182 182 THR THR B . n 
B 1 183 PRO 183 183 183 PRO PRO B . n 
B 1 184 PHE 184 184 184 PHE PHE B . n 
B 1 185 TRP 185 185 185 TRP TRP B . n 
B 1 186 MET 186 186 186 MET MET B . n 
B 1 187 ALA 187 187 187 ALA ALA B . n 
B 1 188 PRO 188 188 188 PRO PRO B . n 
B 1 189 GLU 189 189 189 GLU GLU B . n 
B 1 190 VAL 190 190 190 VAL VAL B . n 
B 1 191 ILE 191 191 191 ILE ILE B . n 
B 1 192 LYS 192 192 192 LYS LYS B . n 
B 1 193 GLN 193 193 193 GLN GLN B . n 
B 1 194 SER 194 194 194 SER SER B . n 
B 1 195 ALA 195 195 195 ALA ALA B . n 
B 1 196 TYR 196 196 196 TYR TYR B . n 
B 1 197 ASP 197 197 197 ASP ASP B . n 
B 1 198 SER 198 198 198 SER SER B . n 
B 1 199 LYS 199 199 199 LYS LYS B . n 
B 1 200 ALA 200 200 200 ALA ALA B . n 
B 1 201 ASP 201 201 201 ASP ASP B . n 
B 1 202 ILE 202 202 202 ILE ILE B . n 
B 1 203 TRP 203 203 203 TRP TRP B . n 
B 1 204 SER 204 204 204 SER SER B . n 
B 1 205 LEU 205 205 205 LEU LEU B . n 
B 1 206 GLY 206 206 206 GLY GLY B . n 
B 1 207 ILE 207 207 207 ILE ILE B . n 
B 1 208 THR 208 208 208 THR THR B . n 
B 1 209 ALA 209 209 209 ALA ALA B . n 
B 1 210 ILE 210 210 210 ILE ILE B . n 
B 1 211 GLU 211 211 211 GLU GLU B . n 
B 1 212 LEU 212 212 212 LEU LEU B . n 
B 1 213 ALA 213 213 213 ALA ALA B . n 
B 1 214 ARG 214 214 214 ARG ARG B . n 
B 1 215 GLY 215 215 215 GLY GLY B . n 
B 1 216 GLU 216 216 216 GLU GLU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 PRO 218 218 218 PRO PRO B . n 
B 1 219 HIS 219 219 219 HIS HIS B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 GLU 221 221 221 GLU GLU B . n 
B 1 222 LEU 222 222 222 LEU LEU B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 PRO 224 224 224 PRO PRO B . n 
B 1 225 MET 225 225 225 MET MET B . n 
B 1 226 LYS 226 226 226 LYS LYS B . n 
B 1 227 VAL 227 227 227 VAL VAL B . n 
B 1 228 LEU 228 228 228 LEU LEU B . n 
B 1 229 PHE 229 229 229 PHE PHE B . n 
B 1 230 LEU 230 230 230 LEU LEU B . n 
B 1 231 ILE 231 231 231 ILE ILE B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 LYS 233 233 233 LYS LYS B . n 
B 1 234 ASN 234 234 234 ASN ASN B . n 
B 1 235 ASN 235 235 235 ASN ASN B . n 
B 1 236 PRO 236 236 236 PRO PRO B . n 
B 1 237 PRO 237 237 237 PRO PRO B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 LEU 239 239 239 LEU LEU B . n 
B 1 240 GLU 240 240 240 GLU GLU B . n 
B 1 241 GLY 241 241 241 GLY GLY B . n 
B 1 242 ASN 242 242 242 ASN ASN B . n 
B 1 243 TYR 243 243 243 TYR TYR B . n 
B 1 244 SER 244 244 244 SER SER B . n 
B 1 245 LYS 245 245 245 LYS LYS B . n 
B 1 246 PRO 246 246 246 PRO PRO B . n 
B 1 247 LEU 247 247 247 LEU LEU B . n 
B 1 248 LYS 248 248 248 LYS LYS B . n 
B 1 249 GLU 249 249 249 GLU GLU B . n 
B 1 250 PHE 250 250 250 PHE PHE B . n 
B 1 251 VAL 251 251 251 VAL VAL B . n 
B 1 252 GLU 252 252 252 GLU GLU B . n 
B 1 253 ALA 253 253 253 ALA ALA B . n 
B 1 254 CYS 254 254 254 CYS CYS B . n 
B 1 255 LEU 255 255 255 LEU LEU B . n 
B 1 256 ASN 256 256 256 ASN ASN B . n 
B 1 257 LYS 257 257 257 LYS LYS B . n 
B 1 258 GLU 258 258 258 GLU GLU B . n 
B 1 259 PRO 259 259 259 PRO PRO B . n 
B 1 260 SER 260 260 260 SER SER B . n 
B 1 261 PHE 261 261 261 PHE PHE B . n 
B 1 262 ARG 262 262 262 ARG ARG B . n 
B 1 263 PRO 263 263 263 PRO PRO B . n 
B 1 264 THR 264 264 264 THR THR B . n 
B 1 265 ALA 265 265 265 ALA ALA B . n 
B 1 266 LYS 266 266 266 LYS LYS B . n 
B 1 267 GLU 267 267 267 GLU GLU B . n 
B 1 268 LEU 268 268 268 LEU LEU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 LYS 270 270 270 LYS LYS B . n 
B 1 271 HIS 271 271 271 HIS HIS B . n 
B 1 272 LYS 272 272 272 LYS LYS B . n 
B 1 273 PHE 273 273 273 PHE PHE B . n 
B 1 274 ILE 274 274 274 ILE ILE B . n 
B 1 275 LEU 275 275 275 LEU LEU B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 ASN 277 277 277 ASN ASN B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 LYS 279 279 279 LYS LYS B . n 
B 1 280 LYS 280 280 280 LYS LYS B . n 
B 1 281 THR 281 281 281 THR THR B . n 
B 1 282 SER 282 282 282 SER SER B . n 
B 1 283 TYR 283 283 283 TYR TYR B . n 
B 1 284 LEU 284 284 284 LEU LEU B . n 
B 1 285 THR 285 285 285 THR THR B . n 
B 1 286 GLU 286 286 286 GLU GLU B . n 
B 1 287 LEU 287 287 287 LEU LEU B . n 
B 1 288 ILE 288 288 288 ILE ILE B . n 
B 1 289 ASP 289 289 289 ASP ASP B . n 
B 1 290 ARG 290 290 290 ARG ARG B . n 
B 1 291 TYR 291 291 291 TYR TYR B . n 
B 1 292 LYS 292 292 292 LYS LYS B . n 
B 1 293 ARG 293 293 293 ARG ARG B . n 
B 1 294 TRP 294 294 294 TRP TRP B . n 
B 1 295 LYS 295 295 295 LYS LYS B . n 
B 1 296 ALA 296 296 296 ALA ALA B . n 
B 1 297 GLU 297 297 297 GLU GLU B . n 
B 1 298 GLN 298 298 298 GLN GLN B . n 
B 1 299 SER 299 299 ?   ?   ?   B . n 
B 1 300 HIS 300 300 ?   ?   ?   B . n 
B 1 301 ASP 301 301 ?   ?   ?   B . n 
B 1 302 ASP 302 302 ?   ?   ?   B . n 
B 1 303 SER 303 303 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A TPO 178 A TPO 178 ? THR PHOSPHOTHREONINE 
2 B TPO 178 B TPO 178 ? THR PHOSPHOTHREONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 author_defined_assembly   ?    monomeric 1 
3 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
3 1 A,C,E 
3 2 B,D,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 1310  ? 
3 MORE         -13   ? 
3 'SSA (A^2)'  27690 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000  
2 'crystal symmetry operation' 1_556 x,y,z+1 1.0000000000 0.0000000000 0.0000000000 -3.6998317927 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 61.3705757567 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-02-02 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' . ? 1 
CNS      refinement        . ? 2 
HKL-2000 'data reduction'  . ? 3 
HKL-2000 'data scaling'    . ? 4 
CNS      phasing           . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O B HOH 424 ? ? O B HOH 425 ? ? 2.12 
2 1 O A HOH 353 ? ? O A HOH 423 ? ? 2.18 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              143 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              143 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              143 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                116.98 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.32 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 59  ? ? -68.43  9.63    
2  1 GLU A 61  ? ? -145.44 -83.91  
3  1 ASP A 92  ? ? 57.51   -112.59 
4  1 ARG A 143 ? ? 77.62   -11.47  
5  1 ASP A 144 ? ? -141.74 51.98   
6  1 GLN A 173 ? ? -154.85 76.78   
7  1 ASP A 197 ? ? -154.58 -147.26 
8  1 LEU B 27  ? ? -107.97 -139.97 
9  1 GLU B 59  ? ? -80.60  38.28   
10 1 GLU B 61  ? ? -167.28 -52.62  
11 1 ASP B 92  ? ? 57.27   -128.45 
12 1 ARG B 143 ? ? 75.79   -7.51   
13 1 ASP B 162 ? ? 56.48   71.80   
14 1 GLN B 173 ? ? -152.64 81.11   
15 1 ASN B 177 ? ? -143.25 -11.74  
16 1 GLN B 193 ? ? 29.40   45.97   
17 1 ASP B 197 ? ? -142.26 -152.02 
18 1 ALA B 296 ? ? -81.54  32.35   
19 1 GLU B 297 ? ? -161.51 43.99   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     81 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.073 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 A ATP 400 ? PG  ? C ATP 1 PG  
2 1 N 1 A ATP 400 ? O1G ? C ATP 1 O1G 
3 1 N 1 A ATP 400 ? O2G ? C ATP 1 O2G 
4 1 N 1 A ATP 400 ? O3G ? C ATP 1 O3G 
5 1 N 1 B ATP 400 ? PG  ? D ATP 1 PG  
6 1 N 1 B ATP 400 ? O1G ? D ATP 1 O1G 
7 1 N 1 B ATP 400 ? O2G ? D ATP 1 O2G 
8 1 N 1 B ATP 400 ? O3G ? D ATP 1 O3G 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A SER 4   ? A SER 4   
5  1 Y 1 A PRO 5   ? A PRO 5   
6  1 Y 1 A VAL 6   ? A VAL 6   
7  1 Y 1 A GLN 7   ? A GLN 7   
8  1 Y 1 A SER 8   ? A SER 8   
9  1 Y 1 A SER 299 ? A SER 299 
10 1 Y 1 A HIS 300 ? A HIS 300 
11 1 Y 1 A ASP 301 ? A ASP 301 
12 1 Y 1 A ASP 302 ? A ASP 302 
13 1 Y 1 A SER 303 ? A SER 303 
14 1 Y 1 B MET 1   ? B MET 1   
15 1 Y 1 B ALA 2   ? B ALA 2   
16 1 Y 1 B HIS 3   ? B HIS 3   
17 1 Y 1 B SER 4   ? B SER 4   
18 1 Y 1 B PRO 5   ? B PRO 5   
19 1 Y 1 B VAL 6   ? B VAL 6   
20 1 Y 1 B GLN 7   ? B GLN 7   
21 1 Y 1 B SER 299 ? B SER 299 
22 1 Y 1 B HIS 300 ? B HIS 300 
23 1 Y 1 B ASP 301 ? B ASP 301 
24 1 Y 1 B ASP 302 ? B ASP 302 
25 1 Y 1 B SER 303 ? B SER 303 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-5'-TRIPHOSPHATE" ATP 
3 water                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ATP 1   400 400 ATP ATP A . 
D 2 ATP 1   400 400 ATP ATP B . 
E 3 HOH 1   304 1   HOH HOH A . 
E 3 HOH 2   305 2   HOH HOH A . 
E 3 HOH 3   306 3   HOH HOH A . 
E 3 HOH 4   307 4   HOH HOH A . 
E 3 HOH 5   308 5   HOH HOH A . 
E 3 HOH 6   309 309 HOH HOH A . 
E 3 HOH 7   310 310 HOH HOH A . 
E 3 HOH 8   311 311 HOH HOH A . 
E 3 HOH 9   312 312 HOH HOH A . 
E 3 HOH 10  313 313 HOH HOH A . 
E 3 HOH 11  314 314 HOH HOH A . 
E 3 HOH 12  315 6   HOH HOH A . 
E 3 HOH 13  316 7   HOH HOH A . 
E 3 HOH 14  317 317 HOH HOH A . 
E 3 HOH 15  318 318 HOH HOH A . 
E 3 HOH 16  319 319 HOH HOH A . 
E 3 HOH 17  320 8   HOH HOH A . 
E 3 HOH 18  321 9   HOH HOH A . 
E 3 HOH 19  322 322 HOH HOH A . 
E 3 HOH 20  323 323 HOH HOH A . 
E 3 HOH 21  324 324 HOH HOH A . 
E 3 HOH 22  325 325 HOH HOH A . 
E 3 HOH 23  326 413 HOH HOH A . 
E 3 HOH 24  327 327 HOH HOH A . 
E 3 HOH 25  328 328 HOH HOH A . 
E 3 HOH 26  329 329 HOH HOH A . 
E 3 HOH 27  330 330 HOH HOH A . 
E 3 HOH 28  331 331 HOH HOH A . 
E 3 HOH 29  332 332 HOH HOH A . 
E 3 HOH 30  333 333 HOH HOH A . 
E 3 HOH 31  334 334 HOH HOH A . 
E 3 HOH 32  335 10  HOH HOH A . 
E 3 HOH 33  336 11  HOH HOH A . 
E 3 HOH 34  337 337 HOH HOH A . 
E 3 HOH 35  338 338 HOH HOH A . 
E 3 HOH 36  339 339 HOH HOH A . 
E 3 HOH 37  340 340 HOH HOH A . 
E 3 HOH 38  341 341 HOH HOH A . 
E 3 HOH 39  342 12  HOH HOH A . 
E 3 HOH 40  343 343 HOH HOH A . 
E 3 HOH 41  344 344 HOH HOH A . 
E 3 HOH 42  345 345 HOH HOH A . 
E 3 HOH 43  346 346 HOH HOH A . 
E 3 HOH 44  347 347 HOH HOH A . 
E 3 HOH 45  348 348 HOH HOH A . 
E 3 HOH 46  349 13  HOH HOH A . 
E 3 HOH 47  350 16  HOH HOH A . 
E 3 HOH 48  351 351 HOH HOH A . 
E 3 HOH 49  352 352 HOH HOH A . 
E 3 HOH 50  353 353 HOH HOH A . 
E 3 HOH 51  354 354 HOH HOH A . 
E 3 HOH 52  355 355 HOH HOH A . 
E 3 HOH 53  356 17  HOH HOH A . 
E 3 HOH 54  357 357 HOH HOH A . 
E 3 HOH 55  358 358 HOH HOH A . 
E 3 HOH 56  359 359 HOH HOH A . 
E 3 HOH 57  360 360 HOH HOH A . 
E 3 HOH 58  361 361 HOH HOH A . 
E 3 HOH 59  362 419 HOH HOH A . 
E 3 HOH 60  363 363 HOH HOH A . 
E 3 HOH 61  364 364 HOH HOH A . 
E 3 HOH 62  365 365 HOH HOH A . 
E 3 HOH 63  366 18  HOH HOH A . 
E 3 HOH 64  367 19  HOH HOH A . 
E 3 HOH 65  368 21  HOH HOH A . 
E 3 HOH 66  369 22  HOH HOH A . 
E 3 HOH 67  370 23  HOH HOH A . 
E 3 HOH 68  371 24  HOH HOH A . 
E 3 HOH 69  372 25  HOH HOH A . 
E 3 HOH 70  373 26  HOH HOH A . 
E 3 HOH 71  374 27  HOH HOH A . 
E 3 HOH 72  375 28  HOH HOH A . 
E 3 HOH 73  376 42  HOH HOH A . 
E 3 HOH 74  377 43  HOH HOH A . 
E 3 HOH 75  378 44  HOH HOH A . 
E 3 HOH 76  379 45  HOH HOH A . 
E 3 HOH 77  380 46  HOH HOH A . 
E 3 HOH 78  381 47  HOH HOH A . 
E 3 HOH 79  382 48  HOH HOH A . 
E 3 HOH 80  383 383 HOH HOH A . 
E 3 HOH 81  384 384 HOH HOH A . 
E 3 HOH 82  385 385 HOH HOH A . 
E 3 HOH 83  386 386 HOH HOH A . 
E 3 HOH 84  387 49  HOH HOH A . 
E 3 HOH 85  388 388 HOH HOH A . 
E 3 HOH 86  389 50  HOH HOH A . 
E 3 HOH 87  390 51  HOH HOH A . 
E 3 HOH 88  391 52  HOH HOH A . 
E 3 HOH 89  392 53  HOH HOH A . 
E 3 HOH 90  393 64  HOH HOH A . 
E 3 HOH 91  394 65  HOH HOH A . 
E 3 HOH 92  395 66  HOH HOH A . 
E 3 HOH 93  396 70  HOH HOH A . 
E 3 HOH 94  397 397 HOH HOH A . 
E 3 HOH 95  398 398 HOH HOH A . 
E 3 HOH 96  399 399 HOH HOH A . 
E 3 HOH 97  401 71  HOH HOH A . 
E 3 HOH 98  402 402 HOH HOH A . 
E 3 HOH 99  403 403 HOH HOH A . 
E 3 HOH 100 404 404 HOH HOH A . 
E 3 HOH 101 405 405 HOH HOH A . 
E 3 HOH 102 406 406 HOH HOH A . 
E 3 HOH 103 407 407 HOH HOH A . 
E 3 HOH 104 408 408 HOH HOH A . 
E 3 HOH 105 409 409 HOH HOH A . 
E 3 HOH 106 410 410 HOH HOH A . 
E 3 HOH 107 411 411 HOH HOH A . 
E 3 HOH 108 412 412 HOH HOH A . 
E 3 HOH 109 413 72  HOH HOH A . 
E 3 HOH 110 414 73  HOH HOH A . 
E 3 HOH 111 415 415 HOH HOH A . 
E 3 HOH 112 416 416 HOH HOH A . 
E 3 HOH 113 417 417 HOH HOH A . 
E 3 HOH 114 418 418 HOH HOH A . 
E 3 HOH 115 419 74  HOH HOH A . 
E 3 HOH 116 420 75  HOH HOH A . 
E 3 HOH 117 421 76  HOH HOH A . 
E 3 HOH 118 422 77  HOH HOH A . 
E 3 HOH 119 423 78  HOH HOH A . 
E 3 HOH 120 424 79  HOH HOH A . 
E 3 HOH 121 425 81  HOH HOH A . 
E 3 HOH 122 426 82  HOH HOH A . 
E 3 HOH 123 427 83  HOH HOH A . 
E 3 HOH 124 428 84  HOH HOH A . 
E 3 HOH 125 429 85  HOH HOH A . 
E 3 HOH 126 430 86  HOH HOH A . 
E 3 HOH 127 431 89  HOH HOH A . 
E 3 HOH 128 432 90  HOH HOH A . 
E 3 HOH 129 433 91  HOH HOH A . 
E 3 HOH 130 434 434 HOH HOH A . 
E 3 HOH 131 435 92  HOH HOH A . 
E 3 HOH 132 436 93  HOH HOH A . 
E 3 HOH 133 437 437 HOH HOH A . 
E 3 HOH 134 438 438 HOH HOH A . 
E 3 HOH 135 439 439 HOH HOH A . 
E 3 HOH 136 440 94  HOH HOH A . 
E 3 HOH 137 441 441 HOH HOH A . 
E 3 HOH 138 442 442 HOH HOH A . 
E 3 HOH 139 443 276 HOH HOH A . 
E 3 HOH 140 444 444 HOH HOH A . 
E 3 HOH 141 445 445 HOH HOH A . 
E 3 HOH 142 446 446 HOH HOH A . 
E 3 HOH 143 447 447 HOH HOH A . 
E 3 HOH 144 448 96  HOH HOH A . 
E 3 HOH 145 449 97  HOH HOH A . 
E 3 HOH 146 450 450 HOH HOH A . 
E 3 HOH 147 451 451 HOH HOH A . 
E 3 HOH 148 452 98  HOH HOH A . 
E 3 HOH 149 453 99  HOH HOH A . 
E 3 HOH 150 454 454 HOH HOH A . 
E 3 HOH 151 455 455 HOH HOH A . 
E 3 HOH 152 456 456 HOH HOH A . 
E 3 HOH 153 458 101 HOH HOH A . 
E 3 HOH 154 459 102 HOH HOH A . 
E 3 HOH 155 460 103 HOH HOH A . 
E 3 HOH 156 461 115 HOH HOH A . 
E 3 HOH 157 462 116 HOH HOH A . 
E 3 HOH 158 463 117 HOH HOH A . 
E 3 HOH 159 464 118 HOH HOH A . 
E 3 HOH 160 465 119 HOH HOH A . 
E 3 HOH 161 466 120 HOH HOH A . 
E 3 HOH 162 467 467 HOH HOH A . 
E 3 HOH 163 468 468 HOH HOH A . 
E 3 HOH 164 469 121 HOH HOH A . 
E 3 HOH 165 470 470 HOH HOH A . 
E 3 HOH 166 471 122 HOH HOH A . 
E 3 HOH 167 472 472 HOH HOH A . 
E 3 HOH 168 473 473 HOH HOH A . 
E 3 HOH 169 474 474 HOH HOH A . 
E 3 HOH 170 475 123 HOH HOH A . 
E 3 HOH 171 476 125 HOH HOH A . 
E 3 HOH 172 477 126 HOH HOH A . 
E 3 HOH 173 478 127 HOH HOH A . 
E 3 HOH 174 479 128 HOH HOH A . 
E 3 HOH 175 480 129 HOH HOH A . 
E 3 HOH 176 481 130 HOH HOH A . 
E 3 HOH 177 482 131 HOH HOH A . 
E 3 HOH 178 483 132 HOH HOH A . 
E 3 HOH 179 484 133 HOH HOH A . 
E 3 HOH 180 485 134 HOH HOH A . 
E 3 HOH 181 486 135 HOH HOH A . 
E 3 HOH 182 487 136 HOH HOH A . 
E 3 HOH 183 488 137 HOH HOH A . 
E 3 HOH 184 489 139 HOH HOH A . 
E 3 HOH 185 490 142 HOH HOH A . 
E 3 HOH 186 491 143 HOH HOH A . 
E 3 HOH 187 492 144 HOH HOH A . 
E 3 HOH 188 493 145 HOH HOH A . 
E 3 HOH 189 494 146 HOH HOH A . 
E 3 HOH 190 495 147 HOH HOH A . 
E 3 HOH 191 496 148 HOH HOH A . 
E 3 HOH 192 497 149 HOH HOH A . 
E 3 HOH 193 498 150 HOH HOH A . 
E 3 HOH 194 499 151 HOH HOH A . 
E 3 HOH 195 500 152 HOH HOH A . 
E 3 HOH 196 501 153 HOH HOH A . 
E 3 HOH 197 502 154 HOH HOH A . 
E 3 HOH 198 503 155 HOH HOH A . 
E 3 HOH 199 504 156 HOH HOH A . 
E 3 HOH 200 505 157 HOH HOH A . 
E 3 HOH 201 506 158 HOH HOH A . 
E 3 HOH 202 507 159 HOH HOH A . 
E 3 HOH 203 508 160 HOH HOH A . 
E 3 HOH 204 509 161 HOH HOH A . 
E 3 HOH 205 510 162 HOH HOH A . 
E 3 HOH 206 511 163 HOH HOH A . 
E 3 HOH 207 512 164 HOH HOH A . 
E 3 HOH 208 513 165 HOH HOH A . 
E 3 HOH 209 514 166 HOH HOH A . 
E 3 HOH 210 515 167 HOH HOH A . 
E 3 HOH 211 516 168 HOH HOH A . 
E 3 HOH 212 517 169 HOH HOH A . 
E 3 HOH 213 518 170 HOH HOH A . 
E 3 HOH 214 519 171 HOH HOH A . 
E 3 HOH 215 520 172 HOH HOH A . 
E 3 HOH 216 521 173 HOH HOH A . 
E 3 HOH 217 522 174 HOH HOH A . 
E 3 HOH 218 523 175 HOH HOH A . 
E 3 HOH 219 524 176 HOH HOH A . 
E 3 HOH 220 525 177 HOH HOH A . 
E 3 HOH 221 526 178 HOH HOH A . 
E 3 HOH 222 527 179 HOH HOH A . 
E 3 HOH 223 528 180 HOH HOH A . 
E 3 HOH 224 529 181 HOH HOH A . 
E 3 HOH 225 530 182 HOH HOH A . 
E 3 HOH 226 531 200 HOH HOH A . 
E 3 HOH 227 532 201 HOH HOH A . 
E 3 HOH 228 533 202 HOH HOH A . 
E 3 HOH 229 534 203 HOH HOH A . 
E 3 HOH 230 535 204 HOH HOH A . 
E 3 HOH 231 536 205 HOH HOH A . 
E 3 HOH 232 537 206 HOH HOH A . 
E 3 HOH 233 538 207 HOH HOH A . 
E 3 HOH 234 539 208 HOH HOH A . 
E 3 HOH 235 540 209 HOH HOH A . 
E 3 HOH 236 541 210 HOH HOH A . 
E 3 HOH 237 542 211 HOH HOH A . 
E 3 HOH 238 543 212 HOH HOH A . 
E 3 HOH 239 544 213 HOH HOH A . 
E 3 HOH 240 545 214 HOH HOH A . 
E 3 HOH 241 546 215 HOH HOH A . 
E 3 HOH 242 547 218 HOH HOH A . 
E 3 HOH 243 548 219 HOH HOH A . 
E 3 HOH 244 549 220 HOH HOH A . 
E 3 HOH 245 550 221 HOH HOH A . 
E 3 HOH 246 551 289 HOH HOH A . 
E 3 HOH 247 552 400 HOH HOH A . 
F 3 HOH 1   304 304 HOH HOH B . 
F 3 HOH 2   305 305 HOH HOH B . 
F 3 HOH 3   306 306 HOH HOH B . 
F 3 HOH 4   307 307 HOH HOH B . 
F 3 HOH 5   308 308 HOH HOH B . 
F 3 HOH 6   309 14  HOH HOH B . 
F 3 HOH 7   310 15  HOH HOH B . 
F 3 HOH 8   311 20  HOH HOH B . 
F 3 HOH 9   312 29  HOH HOH B . 
F 3 HOH 10  313 30  HOH HOH B . 
F 3 HOH 11  314 31  HOH HOH B . 
F 3 HOH 12  315 315 HOH HOH B . 
F 3 HOH 13  316 316 HOH HOH B . 
F 3 HOH 14  317 32  HOH HOH B . 
F 3 HOH 15  318 33  HOH HOH B . 
F 3 HOH 16  319 34  HOH HOH B . 
F 3 HOH 17  320 320 HOH HOH B . 
F 3 HOH 18  321 321 HOH HOH B . 
F 3 HOH 19  322 35  HOH HOH B . 
F 3 HOH 20  323 36  HOH HOH B . 
F 3 HOH 21  324 37  HOH HOH B . 
F 3 HOH 22  325 38  HOH HOH B . 
F 3 HOH 23  326 326 HOH HOH B . 
F 3 HOH 24  327 40  HOH HOH B . 
F 3 HOH 25  328 41  HOH HOH B . 
F 3 HOH 26  329 54  HOH HOH B . 
F 3 HOH 27  330 55  HOH HOH B . 
F 3 HOH 28  331 56  HOH HOH B . 
F 3 HOH 29  332 57  HOH HOH B . 
F 3 HOH 30  333 58  HOH HOH B . 
F 3 HOH 31  334 59  HOH HOH B . 
F 3 HOH 32  335 335 HOH HOH B . 
F 3 HOH 33  336 336 HOH HOH B . 
F 3 HOH 34  337 60  HOH HOH B . 
F 3 HOH 35  338 61  HOH HOH B . 
F 3 HOH 36  339 62  HOH HOH B . 
F 3 HOH 37  340 63  HOH HOH B . 
F 3 HOH 38  341 67  HOH HOH B . 
F 3 HOH 39  342 342 HOH HOH B . 
F 3 HOH 40  343 68  HOH HOH B . 
F 3 HOH 41  344 69  HOH HOH B . 
F 3 HOH 42  345 80  HOH HOH B . 
F 3 HOH 43  346 87  HOH HOH B . 
F 3 HOH 44  347 88  HOH HOH B . 
F 3 HOH 45  348 104 HOH HOH B . 
F 3 HOH 46  349 349 HOH HOH B . 
F 3 HOH 47  350 350 HOH HOH B . 
F 3 HOH 48  351 105 HOH HOH B . 
F 3 HOH 49  352 106 HOH HOH B . 
F 3 HOH 50  353 107 HOH HOH B . 
F 3 HOH 51  354 108 HOH HOH B . 
F 3 HOH 52  355 109 HOH HOH B . 
F 3 HOH 53  356 356 HOH HOH B . 
F 3 HOH 54  357 110 HOH HOH B . 
F 3 HOH 55  358 111 HOH HOH B . 
F 3 HOH 56  359 112 HOH HOH B . 
F 3 HOH 57  360 113 HOH HOH B . 
F 3 HOH 58  361 114 HOH HOH B . 
F 3 HOH 59  362 362 HOH HOH B . 
F 3 HOH 60  363 138 HOH HOH B . 
F 3 HOH 61  364 140 HOH HOH B . 
F 3 HOH 62  365 141 HOH HOH B . 
F 3 HOH 63  366 366 HOH HOH B . 
F 3 HOH 64  367 367 HOH HOH B . 
F 3 HOH 65  368 368 HOH HOH B . 
F 3 HOH 66  369 369 HOH HOH B . 
F 3 HOH 67  370 370 HOH HOH B . 
F 3 HOH 68  371 371 HOH HOH B . 
F 3 HOH 69  372 372 HOH HOH B . 
F 3 HOH 70  373 373 HOH HOH B . 
F 3 HOH 71  374 374 HOH HOH B . 
F 3 HOH 72  375 375 HOH HOH B . 
F 3 HOH 73  376 376 HOH HOH B . 
F 3 HOH 74  377 377 HOH HOH B . 
F 3 HOH 75  378 378 HOH HOH B . 
F 3 HOH 76  379 379 HOH HOH B . 
F 3 HOH 77  380 380 HOH HOH B . 
F 3 HOH 78  381 381 HOH HOH B . 
F 3 HOH 79  382 382 HOH HOH B . 
F 3 HOH 80  383 183 HOH HOH B . 
F 3 HOH 81  384 184 HOH HOH B . 
F 3 HOH 82  385 185 HOH HOH B . 
F 3 HOH 83  386 186 HOH HOH B . 
F 3 HOH 84  387 387 HOH HOH B . 
F 3 HOH 85  388 187 HOH HOH B . 
F 3 HOH 86  389 389 HOH HOH B . 
F 3 HOH 87  390 390 HOH HOH B . 
F 3 HOH 88  391 391 HOH HOH B . 
F 3 HOH 89  392 392 HOH HOH B . 
F 3 HOH 90  393 393 HOH HOH B . 
F 3 HOH 91  394 394 HOH HOH B . 
F 3 HOH 92  395 395 HOH HOH B . 
F 3 HOH 93  396 396 HOH HOH B . 
F 3 HOH 94  397 188 HOH HOH B . 
F 3 HOH 95  398 189 HOH HOH B . 
F 3 HOH 96  399 190 HOH HOH B . 
F 3 HOH 97  401 401 HOH HOH B . 
F 3 HOH 98  402 191 HOH HOH B . 
F 3 HOH 99  403 192 HOH HOH B . 
F 3 HOH 100 404 193 HOH HOH B . 
F 3 HOH 101 405 194 HOH HOH B . 
F 3 HOH 102 406 195 HOH HOH B . 
F 3 HOH 103 407 196 HOH HOH B . 
F 3 HOH 104 408 197 HOH HOH B . 
F 3 HOH 105 409 198 HOH HOH B . 
F 3 HOH 106 410 199 HOH HOH B . 
F 3 HOH 107 411 216 HOH HOH B . 
F 3 HOH 108 412 217 HOH HOH B . 
F 3 HOH 109 413 39  HOH HOH B . 
F 3 HOH 110 414 414 HOH HOH B . 
F 3 HOH 111 415 222 HOH HOH B . 
F 3 HOH 112 416 223 HOH HOH B . 
F 3 HOH 113 417 224 HOH HOH B . 
F 3 HOH 114 418 225 HOH HOH B . 
F 3 HOH 115 419 124 HOH HOH B . 
F 3 HOH 116 420 420 HOH HOH B . 
F 3 HOH 117 421 421 HOH HOH B . 
F 3 HOH 118 422 422 HOH HOH B . 
F 3 HOH 119 423 423 HOH HOH B . 
F 3 HOH 120 424 424 HOH HOH B . 
F 3 HOH 121 425 425 HOH HOH B . 
F 3 HOH 122 426 426 HOH HOH B . 
F 3 HOH 123 427 427 HOH HOH B . 
F 3 HOH 124 428 428 HOH HOH B . 
F 3 HOH 125 429 429 HOH HOH B . 
F 3 HOH 126 430 430 HOH HOH B . 
F 3 HOH 127 431 431 HOH HOH B . 
F 3 HOH 128 432 432 HOH HOH B . 
F 3 HOH 129 433 433 HOH HOH B . 
F 3 HOH 130 434 226 HOH HOH B . 
F 3 HOH 131 435 435 HOH HOH B . 
F 3 HOH 132 436 436 HOH HOH B . 
F 3 HOH 133 437 227 HOH HOH B . 
F 3 HOH 134 438 228 HOH HOH B . 
F 3 HOH 135 439 229 HOH HOH B . 
F 3 HOH 136 440 440 HOH HOH B . 
F 3 HOH 137 441 230 HOH HOH B . 
F 3 HOH 138 442 231 HOH HOH B . 
F 3 HOH 139 443 95  HOH HOH B . 
F 3 HOH 140 444 232 HOH HOH B . 
F 3 HOH 141 445 233 HOH HOH B . 
F 3 HOH 142 446 234 HOH HOH B . 
F 3 HOH 143 447 235 HOH HOH B . 
F 3 HOH 144 448 448 HOH HOH B . 
F 3 HOH 145 449 449 HOH HOH B . 
F 3 HOH 146 450 236 HOH HOH B . 
F 3 HOH 147 451 237 HOH HOH B . 
F 3 HOH 148 452 452 HOH HOH B . 
F 3 HOH 149 453 453 HOH HOH B . 
F 3 HOH 150 454 238 HOH HOH B . 
F 3 HOH 151 455 239 HOH HOH B . 
F 3 HOH 152 456 240 HOH HOH B . 
F 3 HOH 153 457 100 HOH HOH B . 
F 3 HOH 154 458 458 HOH HOH B . 
F 3 HOH 155 459 459 HOH HOH B . 
F 3 HOH 156 460 460 HOH HOH B . 
F 3 HOH 157 461 461 HOH HOH B . 
F 3 HOH 158 462 462 HOH HOH B . 
F 3 HOH 159 463 463 HOH HOH B . 
F 3 HOH 160 464 464 HOH HOH B . 
F 3 HOH 161 465 465 HOH HOH B . 
F 3 HOH 162 466 466 HOH HOH B . 
F 3 HOH 163 467 241 HOH HOH B . 
F 3 HOH 164 468 242 HOH HOH B . 
F 3 HOH 165 469 469 HOH HOH B . 
F 3 HOH 166 470 243 HOH HOH B . 
F 3 HOH 167 471 471 HOH HOH B . 
F 3 HOH 168 472 244 HOH HOH B . 
F 3 HOH 169 473 245 HOH HOH B . 
F 3 HOH 170 474 246 HOH HOH B . 
F 3 HOH 171 475 475 HOH HOH B . 
F 3 HOH 172 476 476 HOH HOH B . 
F 3 HOH 173 477 247 HOH HOH B . 
F 3 HOH 174 478 248 HOH HOH B . 
F 3 HOH 175 479 249 HOH HOH B . 
F 3 HOH 176 480 250 HOH HOH B . 
F 3 HOH 177 481 251 HOH HOH B . 
F 3 HOH 178 482 252 HOH HOH B . 
F 3 HOH 179 483 253 HOH HOH B . 
F 3 HOH 180 484 254 HOH HOH B . 
F 3 HOH 181 485 255 HOH HOH B . 
F 3 HOH 182 486 256 HOH HOH B . 
F 3 HOH 183 487 257 HOH HOH B . 
F 3 HOH 184 488 258 HOH HOH B . 
F 3 HOH 185 489 259 HOH HOH B . 
F 3 HOH 186 490 260 HOH HOH B . 
F 3 HOH 187 491 261 HOH HOH B . 
F 3 HOH 188 492 262 HOH HOH B . 
F 3 HOH 189 493 263 HOH HOH B . 
F 3 HOH 190 494 264 HOH HOH B . 
F 3 HOH 191 495 265 HOH HOH B . 
F 3 HOH 192 496 266 HOH HOH B . 
F 3 HOH 193 497 267 HOH HOH B . 
F 3 HOH 194 498 268 HOH HOH B . 
F 3 HOH 195 499 269 HOH HOH B . 
F 3 HOH 196 500 270 HOH HOH B . 
F 3 HOH 197 501 271 HOH HOH B . 
F 3 HOH 198 502 272 HOH HOH B . 
F 3 HOH 199 503 273 HOH HOH B . 
F 3 HOH 200 504 274 HOH HOH B . 
F 3 HOH 201 505 275 HOH HOH B . 
F 3 HOH 202 506 443 HOH HOH B . 
F 3 HOH 203 507 277 HOH HOH B . 
F 3 HOH 204 508 278 HOH HOH B . 
F 3 HOH 205 509 279 HOH HOH B . 
F 3 HOH 206 510 280 HOH HOH B . 
F 3 HOH 207 511 281 HOH HOH B . 
F 3 HOH 208 512 282 HOH HOH B . 
F 3 HOH 209 513 283 HOH HOH B . 
F 3 HOH 210 514 284 HOH HOH B . 
F 3 HOH 211 515 285 HOH HOH B . 
F 3 HOH 212 516 286 HOH HOH B . 
F 3 HOH 213 517 287 HOH HOH B . 
F 3 HOH 214 518 288 HOH HOH B . 
F 3 HOH 215 519 290 HOH HOH B . 
F 3 HOH 216 520 291 HOH HOH B . 
F 3 HOH 217 521 292 HOH HOH B . 
F 3 HOH 218 522 293 HOH HOH B . 
F 3 HOH 219 523 294 HOH HOH B . 
F 3 HOH 220 524 295 HOH HOH B . 
F 3 HOH 221 525 296 HOH HOH B . 
F 3 HOH 222 526 297 HOH HOH B . 
F 3 HOH 223 527 298 HOH HOH B . 
F 3 HOH 224 528 299 HOH HOH B . 
F 3 HOH 225 529 300 HOH HOH B . 
F 3 HOH 226 530 301 HOH HOH B . 
F 3 HOH 227 531 302 HOH HOH B . 
F 3 HOH 228 532 303 HOH HOH B . 
F 3 HOH 229 533 457 HOH HOH B . 
#