data_3A9L
# 
_entry.id   3A9L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3A9L         
RCSB  RCSB028983   
WWPDB D_1000028983 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3A9L 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-30 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fujimoto, Z.' 1 
'Kimura, K.'   2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystal structure of bacteriophage PhiNIT1 zinc peptidase PghP that hydrolyzes gamma-glutamyl linkage of bacterial poly-gamma-glutamate
;
Proteins                   80 722  732  2012 PSFGEY US 0887-3585 0867 ? 22105902 10.1002/prot.23229              
1       'Crystallization and preliminary crystallographic analysis of poly-gamma-glutamate hydrolase from bacteriophage PhiNIT1' 
'Acta Crystallogr.,Sect.F' 65 913  916  2009 ?      DK 1744-3091 ?    ? 19724131 10.1107/S1744309109029881       
2       
;Characterization of poly-gamma-glutamate hydrolase encoded by a bacteriophage genome: possible role in phage infection of Bacillus subtilis encapsulated with poly-gamma-glutamate
;
Appl.Environ.Microbiol.    69 2491 2497 2003 AEMIDF US 0099-2240 2106 ? 12732513 10.1128/AEM.69.5.2491-2497.2003 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fujimoto, Z.' 1 
primary 'Kimura, K.'   2 
1       'Fujimoto, Z.' 3 
1       'Shiga, I.'    4 
1       'Itoh, Y.'     5 
1       'Kimura, K.'   6 
2       'Kimura, K.'   7 
2       'Itoh, Y.'     8 
# 
_cell.entry_id           3A9L 
_cell.length_a           86.809 
_cell.length_b           86.809 
_cell.length_c           85.116 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3A9L 
_symmetry.space_group_name_H-M             'P 32' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                145 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Poly-gamma-glutamate hydrolase' 24033.648 2   ? ? ? ? 
2 non-polymer syn 'ZINC ION'                       65.409    2   ? ? ? ? 
3 non-polymer syn 'PHOSPHATE ION'                  94.971    2   ? ? ? ? 
4 water       nat water                            18.015    227 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAQTDTYPNIEALENAETVGVAYNIEVKRQNPSMIYFSPHAGGIEVGTTELIYRVVELTGGSLYLFQGLLPSGNSRLHVT
STHFDEPMAVCMLSKHTDAVSFHGYKDDYNKNTLVGGLNTELRNLIVSKLNSKGIAAEVATDRFTATDPDNIVNRCASGK
GVQLEISSAQRRAFFQNNDWSKANRGNVTQEFLDYAEAIKEAEAEYYGLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAQTDTYPNIEALENAETVGVAYNIEVKRQNPSMIYFSPHAGGIEVGTTELIYRVVELTGGSLYLFQGLLPSGNSRLHVT
STHFDEPMAVCMLSKHTDAVSFHGYKDDYNKNTLVGGLNTELRNLIVSKLNSKGIAAEVATDRFTATDPDNIVNRCASGK
GVQLEISSAQRRAFFQNNDWSKANRGNVTQEFLDYAEAIKEAEAEYYGLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   GLN n 
1 4   THR n 
1 5   ASP n 
1 6   THR n 
1 7   TYR n 
1 8   PRO n 
1 9   ASN n 
1 10  ILE n 
1 11  GLU n 
1 12  ALA n 
1 13  LEU n 
1 14  GLU n 
1 15  ASN n 
1 16  ALA n 
1 17  GLU n 
1 18  THR n 
1 19  VAL n 
1 20  GLY n 
1 21  VAL n 
1 22  ALA n 
1 23  TYR n 
1 24  ASN n 
1 25  ILE n 
1 26  GLU n 
1 27  VAL n 
1 28  LYS n 
1 29  ARG n 
1 30  GLN n 
1 31  ASN n 
1 32  PRO n 
1 33  SER n 
1 34  MET n 
1 35  ILE n 
1 36  TYR n 
1 37  PHE n 
1 38  SER n 
1 39  PRO n 
1 40  HIS n 
1 41  ALA n 
1 42  GLY n 
1 43  GLY n 
1 44  ILE n 
1 45  GLU n 
1 46  VAL n 
1 47  GLY n 
1 48  THR n 
1 49  THR n 
1 50  GLU n 
1 51  LEU n 
1 52  ILE n 
1 53  TYR n 
1 54  ARG n 
1 55  VAL n 
1 56  VAL n 
1 57  GLU n 
1 58  LEU n 
1 59  THR n 
1 60  GLY n 
1 61  GLY n 
1 62  SER n 
1 63  LEU n 
1 64  TYR n 
1 65  LEU n 
1 66  PHE n 
1 67  GLN n 
1 68  GLY n 
1 69  LEU n 
1 70  LEU n 
1 71  PRO n 
1 72  SER n 
1 73  GLY n 
1 74  ASN n 
1 75  SER n 
1 76  ARG n 
1 77  LEU n 
1 78  HIS n 
1 79  VAL n 
1 80  THR n 
1 81  SER n 
1 82  THR n 
1 83  HIS n 
1 84  PHE n 
1 85  ASP n 
1 86  GLU n 
1 87  PRO n 
1 88  MET n 
1 89  ALA n 
1 90  VAL n 
1 91  CYS n 
1 92  MET n 
1 93  LEU n 
1 94  SER n 
1 95  LYS n 
1 96  HIS n 
1 97  THR n 
1 98  ASP n 
1 99  ALA n 
1 100 VAL n 
1 101 SER n 
1 102 PHE n 
1 103 HIS n 
1 104 GLY n 
1 105 TYR n 
1 106 LYS n 
1 107 ASP n 
1 108 ASP n 
1 109 TYR n 
1 110 ASN n 
1 111 LYS n 
1 112 ASN n 
1 113 THR n 
1 114 LEU n 
1 115 VAL n 
1 116 GLY n 
1 117 GLY n 
1 118 LEU n 
1 119 ASN n 
1 120 THR n 
1 121 GLU n 
1 122 LEU n 
1 123 ARG n 
1 124 ASN n 
1 125 LEU n 
1 126 ILE n 
1 127 VAL n 
1 128 SER n 
1 129 LYS n 
1 130 LEU n 
1 131 ASN n 
1 132 SER n 
1 133 LYS n 
1 134 GLY n 
1 135 ILE n 
1 136 ALA n 
1 137 ALA n 
1 138 GLU n 
1 139 VAL n 
1 140 ALA n 
1 141 THR n 
1 142 ASP n 
1 143 ARG n 
1 144 PHE n 
1 145 THR n 
1 146 ALA n 
1 147 THR n 
1 148 ASP n 
1 149 PRO n 
1 150 ASP n 
1 151 ASN n 
1 152 ILE n 
1 153 VAL n 
1 154 ASN n 
1 155 ARG n 
1 156 CYS n 
1 157 ALA n 
1 158 SER n 
1 159 GLY n 
1 160 LYS n 
1 161 GLY n 
1 162 VAL n 
1 163 GLN n 
1 164 LEU n 
1 165 GLU n 
1 166 ILE n 
1 167 SER n 
1 168 SER n 
1 169 ALA n 
1 170 GLN n 
1 171 ARG n 
1 172 ARG n 
1 173 ALA n 
1 174 PHE n 
1 175 PHE n 
1 176 GLN n 
1 177 ASN n 
1 178 ASN n 
1 179 ASP n 
1 180 TRP n 
1 181 SER n 
1 182 LYS n 
1 183 ALA n 
1 184 ASN n 
1 185 ARG n 
1 186 GLY n 
1 187 ASN n 
1 188 VAL n 
1 189 THR n 
1 190 GLN n 
1 191 GLU n 
1 192 PHE n 
1 193 LEU n 
1 194 ASP n 
1 195 TYR n 
1 196 ALA n 
1 197 GLU n 
1 198 ALA n 
1 199 ILE n 
1 200 LYS n 
1 201 GLU n 
1 202 ALA n 
1 203 GLU n 
1 204 ALA n 
1 205 GLU n 
1 206 TYR n 
1 207 TYR n 
1 208 GLY n 
1 209 LEU n 
1 210 GLU n 
1 211 HIS n 
1 212 HIS n 
1 213 HIS n 
1 214 HIS n 
1 215 HIS n 
1 216 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 pghP 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus phage phiNIT1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     207656 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNAG443 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q852V1_9VIRU 
_struct_ref.pdbx_db_accession          Q852V1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAQTDTYPNIEALENAETVGVAYNIEVKRQNPSMIYFSPHAGGIEVGTTELIYRVVELTGGSLYLFQGLLPSGNSRLHVT
STHFDEPMAVCMLSKHTDAVSFHGYKDDYNKNTLVGGLNTELRNLIVSKLNSKGIAAEVATDRFTATDPDNIVNRCASGK
GVQLEISSAQRRAFFQNNDWSKANRGNVTQEFLDYAEAIKEAEAEYYG
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3A9L A 1 ? 208 ? Q852V1 1 ? 208 ? 1 208 
2 1 3A9L B 1 ? 208 ? Q852V1 1 ? 208 ? 1 208 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3A9L LEU A 209 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 209 1  
1 3A9L GLU A 210 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 210 2  
1 3A9L HIS A 211 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 211 3  
1 3A9L HIS A 212 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 212 4  
1 3A9L HIS A 213 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 213 5  
1 3A9L HIS A 214 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 214 6  
1 3A9L HIS A 215 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 215 7  
1 3A9L HIS A 216 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 216 8  
2 3A9L LEU B 209 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 209 9  
2 3A9L GLU B 210 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 210 10 
2 3A9L HIS B 211 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 211 11 
2 3A9L HIS B 212 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 212 12 
2 3A9L HIS B 213 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 213 13 
2 3A9L HIS B 214 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 214 14 
2 3A9L HIS B 215 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 215 15 
2 3A9L HIS B 216 ? UNP Q852V1 ? ? 'EXPRESSION TAG' 216 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3A9L 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.85 
_exptl_crystal.density_percent_sol   68.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'40%(v/v) PEG 300, 5%(w/v) PEG 1000, 0.1M Tris buffer pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210r' 
_diffrn_detector.pdbx_collection_date   2009-03-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96400 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.96400 
# 
_reflns.entry_id                     3A9L 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             37.04 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   56281 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.130 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.1 
_reflns.pdbx_netI_over_sigmaI        15.19 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.410 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.69 
_reflns_shell.pdbx_redundancy        9.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3A9L 
_refine.ls_number_reflns_obs                     46421 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.04 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    86.54 
_refine.ls_R_factor_obs                          0.28291 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.28118 
_refine.ls_R_factor_R_free                       0.31495 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2473 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.878 
_refine.correlation_coeff_Fo_to_Fc_free          0.853 
_refine.B_iso_mean                               24.364 
_refine.aniso_B[1][1]                            -0.03 
_refine.aniso_B[2][2]                            -0.03 
_refine.aniso_B[3][3]                            0.04 
_refine.aniso_B[1][2]                            -0.01 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.186 
_refine.pdbx_overall_ESU_R_Free                  0.174 
_refine.overall_SU_ML                            0.127 
_refine.overall_SU_B                             4.177 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3A9L 
_refine_analyze.Luzzati_coordinate_error_obs    0.186 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3218 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             227 
_refine_hist.number_atoms_total               3457 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        37.04 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.015  0.022  ? 3286 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.550  1.948  ? 4458 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 6.826  5.000  ? 412  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 39.102 24.878 ? 164  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 14.991 15.000 ? 536  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 16.997 15.000 ? 18   'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.095  0.200  ? 496  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.007  0.021  ? 2530 'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.750  1.500  ? 2048 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1.181  2.000  ? 3290 'X-RAY DIFFRACTION' ? 
r_scbond_it            2.095  3.000  ? 1238 'X-RAY DIFFRACTION' ? 
r_scangle_it           3.016  4.500  ? 1168 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.900 
_refine_ls_shell.d_res_low                        1.950 
_refine_ls_shell.number_reflns_R_work             3275 
_refine_ls_shell.R_factor_R_work                  0.279 
_refine_ls_shell.percent_reflns_obs               83.84 
_refine_ls_shell.R_factor_R_free                  0.352 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             197 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3A9L 
_struct.title                     'Structure of Bacteriophage poly-gamma-glutamate hydrolase' 
_struct.pdbx_descriptor           'Poly-gamma-glutamate hydrolase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3A9L 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'zinc ion binding, open alpha/beta mixed core structure, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 9   ? GLU A 17  ? ASN A 9   GLU A 17  1 ? 9  
HELX_P HELX_P2  2  GLY A 47  ? GLY A 60  ? GLY A 47  GLY A 60  1 ? 14 
HELX_P HELX_P3  3  GLY A 73  ? HIS A 78  ? GLY A 73  HIS A 78  5 ? 6  
HELX_P HELX_P4  4  THR A 80  ? PHE A 84  ? THR A 80  PHE A 84  5 ? 5  
HELX_P HELX_P5  5  GLU A 86  ? LYS A 95  ? GLU A 86  LYS A 95  1 ? 10 
HELX_P HELX_P6  6  ASN A 119 ? LYS A 133 ? ASN A 119 LYS A 133 1 ? 15 
HELX_P HELX_P7  7  ASN A 151 ? CYS A 156 ? ASN A 151 CYS A 156 5 ? 6  
HELX_P HELX_P8  8  SER A 168 ? PHE A 174 ? SER A 168 PHE A 174 1 ? 7  
HELX_P HELX_P9  9  PHE A 175 ? ASP A 179 ? PHE A 175 ASP A 179 5 ? 5  
HELX_P HELX_P10 10 SER A 181 ? ARG A 185 ? SER A 181 ARG A 185 5 ? 5  
HELX_P HELX_P11 11 THR A 189 ? GLU A 210 ? THR A 189 GLU A 210 1 ? 22 
HELX_P HELX_P12 12 ASN B 9   ? GLU B 17  ? ASN B 9   GLU B 17  1 ? 9  
HELX_P HELX_P13 13 GLY B 47  ? GLY B 60  ? GLY B 47  GLY B 60  1 ? 14 
HELX_P HELX_P14 14 GLY B 73  ? HIS B 78  ? GLY B 73  HIS B 78  5 ? 6  
HELX_P HELX_P15 15 THR B 80  ? PHE B 84  ? THR B 80  PHE B 84  5 ? 5  
HELX_P HELX_P16 16 GLU B 86  ? LYS B 95  ? GLU B 86  LYS B 95  1 ? 10 
HELX_P HELX_P17 17 ASN B 119 ? LYS B 133 ? ASN B 119 LYS B 133 1 ? 15 
HELX_P HELX_P18 18 ASN B 151 ? CYS B 156 ? ASN B 151 CYS B 156 5 ? 6  
HELX_P HELX_P19 19 SER B 168 ? ALA B 173 ? SER B 168 ALA B 173 1 ? 6  
HELX_P HELX_P20 20 PHE B 174 ? ASP B 179 ? PHE B 174 ASP B 179 5 ? 6  
HELX_P HELX_P21 21 SER B 181 ? ARG B 185 ? SER B 181 ARG B 185 5 ? 5  
HELX_P HELX_P22 22 THR B 189 ? GLY B 208 ? THR B 189 GLY B 208 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 40  ND1 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 40  A ZN  251 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc2  metalc ? ? A GLU 45  OE1 ? ? ? 1_555 C ZN  . ZN ? ? A GLU 45  A ZN  251 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc3  metalc ? ? A HIS 103 ND1 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 103 A ZN  251 1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc4  metalc ? ? B HIS 40  ND1 ? ? ? 1_555 E ZN  . ZN ? ? B HIS 40  B ZN  251 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc5  metalc ? ? B GLU 45  OE1 ? ? ? 1_555 E ZN  . ZN ? ? B GLU 45  B ZN  251 1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc6  metalc ? ? B GLU 45  OE2 ? ? ? 1_555 E ZN  . ZN ? ? B GLU 45  B ZN  251 1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc7  metalc ? ? B HIS 103 ND1 ? ? ? 1_555 E ZN  . ZN ? ? B HIS 103 B ZN  251 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc8  metalc ? ? C ZN  .   ZN  ? ? ? 1_555 D PO4 . O4 ? ? A ZN  251 A PO4 261 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc9  metalc ? ? C ZN  .   ZN  ? ? ? 1_555 G HOH . O  ? ? A ZN  251 A HOH 294 1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc10 metalc ? ? E ZN  .   ZN  ? ? ? 1_555 H HOH . O  ? ? B ZN  251 B HOH 259 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc11 metalc ? ? A GLU 45  OE2 ? ? ? 1_555 C ZN  . ZN ? ? A GLU 45  A ZN  251 1_555 ? ? ? ? ? ? ? 2.475 ? 
metalc12 metalc ? ? E ZN  .   ZN  ? ? ? 1_555 F PO4 . O4 ? ? B ZN  251 B PO4 261 1_555 ? ? ? ? ? ? ? 2.622 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   14 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
A 2  3  ? anti-parallel 
A 3  4  ? parallel      
A 4  5  ? parallel      
A 5  6  ? parallel      
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? parallel      
A 10 11 ? parallel      
A 11 12 ? parallel      
A 12 13 ? anti-parallel 
A 13 14 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLU A 138 ? VAL A 139 ? GLU A 138 VAL A 139 
A 2  THR A 113 ? GLY A 116 ? THR A 113 GLY A 116 
A 3  VAL A 162 ? SER A 167 ? VAL A 162 SER A 167 
A 4  ASP A 98  ? TYR A 105 ? ASP A 98  TYR A 105 
A 5  MET A 34  ? GLY A 42  ? MET A 34  GLY A 42  
A 6  SER A 62  ? GLY A 68  ? SER A 62  GLY A 68  
A 7  TYR A 23  ? ARG A 29  ? TYR A 23  ARG A 29  
A 8  TYR B 23  ? ARG B 29  ? TYR B 23  ARG B 29  
A 9  SER B 62  ? GLY B 68  ? SER B 62  GLY B 68  
A 10 MET B 34  ? GLY B 42  ? MET B 34  GLY B 42  
A 11 ASP B 98  ? TYR B 105 ? ASP B 98  TYR B 105 
A 12 VAL B 162 ? SER B 167 ? VAL B 162 SER B 167 
A 13 THR B 113 ? GLY B 116 ? THR B 113 GLY B 116 
A 14 GLU B 138 ? VAL B 139 ? GLU B 138 VAL B 139 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O GLU A 138 ? O GLU A 138 N VAL A 115 ? N VAL A 115 
A 2  3  N GLY A 116 ? N GLY A 116 O GLN A 163 ? O GLN A 163 
A 3  4  O ILE A 166 ? O ILE A 166 N HIS A 103 ? N HIS A 103 
A 4  5  O VAL A 100 ? O VAL A 100 N ILE A 35  ? N ILE A 35  
A 5  6  N TYR A 36  ? N TYR A 36  O SER A 62  ? O SER A 62  
A 6  7  O GLN A 67  ? O GLN A 67  N ASN A 24  ? N ASN A 24  
A 7  8  N ILE A 25  ? N ILE A 25  O ARG B 29  ? O ARG B 29  
A 8  9  N LYS B 28  ? N LYS B 28  O LEU B 63  ? O LEU B 63  
A 9  10 O SER B 62  ? O SER B 62  N MET B 34  ? N MET B 34  
A 10 11 N ILE B 35  ? N ILE B 35  O VAL B 100 ? O VAL B 100 
A 11 12 N HIS B 103 ? N HIS B 103 O LEU B 164 ? O LEU B 164 
A 12 13 O GLU B 165 ? O GLU B 165 N LEU B 114 ? N LEU B 114 
A 13 14 N VAL B 115 ? N VAL B 115 O GLU B 138 ? O GLU B 138 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN A 251'  
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PO4 A 261' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN B 251'  
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PO4 B 261' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  HIS A 40  ? HIS A 40  . ? 1_555 ? 
2  AC1 5  GLU A 45  ? GLU A 45  . ? 1_555 ? 
3  AC1 5  HIS A 103 ? HIS A 103 . ? 1_555 ? 
4  AC1 5  PO4 D .   ? PO4 A 261 . ? 1_555 ? 
5  AC1 5  HOH G .   ? HOH A 294 . ? 1_555 ? 
6  AC2 10 HIS A 40  ? HIS A 40  . ? 1_555 ? 
7  AC2 10 GLU A 45  ? GLU A 45  . ? 1_555 ? 
8  AC2 10 HIS A 78  ? HIS A 78  . ? 1_555 ? 
9  AC2 10 THR A 80  ? THR A 80  . ? 1_555 ? 
10 AC2 10 SER A 81  ? SER A 81  . ? 1_555 ? 
11 AC2 10 HIS A 103 ? HIS A 103 . ? 1_555 ? 
12 AC2 10 GLU A 165 ? GLU A 165 . ? 1_555 ? 
13 AC2 10 ZN  C .   ? ZN  A 251 . ? 1_555 ? 
14 AC2 10 HOH G .   ? HOH A 294 . ? 1_555 ? 
15 AC2 10 HOH G .   ? HOH A 302 . ? 1_555 ? 
16 AC3 5  HIS B 40  ? HIS B 40  . ? 1_555 ? 
17 AC3 5  GLU B 45  ? GLU B 45  . ? 1_555 ? 
18 AC3 5  HIS B 103 ? HIS B 103 . ? 1_555 ? 
19 AC3 5  HOH H .   ? HOH B 259 . ? 1_555 ? 
20 AC3 5  PO4 F .   ? PO4 B 261 . ? 1_555 ? 
21 AC4 9  HIS B 40  ? HIS B 40  . ? 1_555 ? 
22 AC4 9  GLU B 45  ? GLU B 45  . ? 1_555 ? 
23 AC4 9  HIS B 78  ? HIS B 78  . ? 1_555 ? 
24 AC4 9  THR B 80  ? THR B 80  . ? 1_555 ? 
25 AC4 9  SER B 81  ? SER B 81  . ? 1_555 ? 
26 AC4 9  HIS B 103 ? HIS B 103 . ? 1_555 ? 
27 AC4 9  GLU B 165 ? GLU B 165 . ? 1_555 ? 
28 AC4 9  ZN  E .   ? ZN  B 251 . ? 1_555 ? 
29 AC4 9  HOH H .   ? HOH B 259 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3A9L 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3A9L 
_atom_sites.fract_transf_matrix[1][1]   0.011520 
_atom_sites.fract_transf_matrix[1][2]   0.006651 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013302 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011749 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 4   ? -17.966 11.047 -17.743 1.00 38.88 ? 4   THR A N   1 
ATOM   2    C  CA  . THR A 1 4   ? -17.046 10.423 -16.761 1.00 38.52 ? 4   THR A CA  1 
ATOM   3    C  C   . THR A 1 4   ? -16.129 11.466 -16.100 1.00 37.88 ? 4   THR A C   1 
ATOM   4    O  O   . THR A 1 4   ? -15.921 12.566 -16.642 1.00 37.99 ? 4   THR A O   1 
ATOM   5    C  CB  . THR A 1 4   ? -16.226 9.292  -17.414 1.00 38.70 ? 4   THR A CB  1 
ATOM   6    O  OG1 . THR A 1 4   ? -15.847 8.338  -16.420 1.00 40.55 ? 4   THR A OG1 1 
ATOM   7    C  CG2 . THR A 1 4   ? -14.956 9.833  -18.124 1.00 38.96 ? 4   THR A CG2 1 
ATOM   8    N  N   . ASP A 1 5   ? -15.584 11.121 -14.933 1.00 36.66 ? 5   ASP A N   1 
ATOM   9    C  CA  . ASP A 1 5   ? -14.764 12.065 -14.162 1.00 35.26 ? 5   ASP A CA  1 
ATOM   10   C  C   . ASP A 1 5   ? -13.470 12.442 -14.869 1.00 34.49 ? 5   ASP A C   1 
ATOM   11   O  O   . ASP A 1 5   ? -13.027 11.733 -15.754 1.00 34.97 ? 5   ASP A O   1 
ATOM   12   C  CB  . ASP A 1 5   ? -14.480 11.503 -12.766 1.00 35.01 ? 5   ASP A CB  1 
ATOM   13   C  CG  . ASP A 1 5   ? -15.739 11.411 -11.912 1.00 33.64 ? 5   ASP A CG  1 
ATOM   14   O  OD1 . ASP A 1 5   ? -16.731 12.095 -12.236 1.00 32.97 ? 5   ASP A OD1 1 
ATOM   15   O  OD2 . ASP A 1 5   ? -15.742 10.654 -10.925 1.00 31.28 ? 5   ASP A OD2 1 
ATOM   16   N  N   . THR A 1 6   ? -12.904 13.592 -14.505 1.00 34.22 ? 6   THR A N   1 
ATOM   17   C  CA  . THR A 1 6   ? -11.539 13.961 -14.898 1.00 32.77 ? 6   THR A CA  1 
ATOM   18   C  C   . THR A 1 6   ? -10.535 13.189 -14.037 1.00 32.51 ? 6   THR A C   1 
ATOM   19   O  O   . THR A 1 6   ? -9.690  12.445 -14.574 1.00 33.21 ? 6   THR A O   1 
ATOM   20   C  CB  . THR A 1 6   ? -11.320 15.506 -14.815 1.00 33.20 ? 6   THR A CB  1 
ATOM   21   O  OG1 . THR A 1 6   ? -12.148 16.138 -15.796 1.00 31.31 ? 6   THR A OG1 1 
ATOM   22   C  CG2 . THR A 1 6   ? -9.865  15.899 -15.076 1.00 33.37 ? 6   THR A CG2 1 
ATOM   23   N  N   . TYR A 1 7   ? -10.645 13.327 -12.714 1.00 29.96 ? 7   TYR A N   1 
ATOM   24   C  CA  . TYR A 1 7   ? -9.723  12.655 -11.795 1.00 28.52 ? 7   TYR A CA  1 
ATOM   25   C  C   . TYR A 1 7   ? -10.288 11.325 -11.294 1.00 26.70 ? 7   TYR A C   1 
ATOM   26   O  O   . TYR A 1 7   ? -11.449 11.261 -10.952 1.00 26.07 ? 7   TYR A O   1 
ATOM   27   C  CB  . TYR A 1 7   ? -9.324  13.571 -10.633 1.00 28.27 ? 7   TYR A CB  1 
ATOM   28   C  CG  . TYR A 1 7   ? -8.843  14.944 -11.071 1.00 28.03 ? 7   TYR A CG  1 
ATOM   29   C  CD1 . TYR A 1 7   ? -7.548  15.134 -11.589 1.00 28.20 ? 7   TYR A CD1 1 
ATOM   30   C  CD2 . TYR A 1 7   ? -9.686  16.052 -10.980 1.00 26.66 ? 7   TYR A CD2 1 
ATOM   31   C  CE1 . TYR A 1 7   ? -7.113  16.399 -12.008 1.00 29.11 ? 7   TYR A CE1 1 
ATOM   32   C  CE2 . TYR A 1 7   ? -9.242  17.347 -11.373 1.00 30.70 ? 7   TYR A CE2 1 
ATOM   33   C  CZ  . TYR A 1 7   ? -7.955  17.503 -11.891 1.00 31.61 ? 7   TYR A CZ  1 
ATOM   34   O  OH  . TYR A 1 7   ? -7.524  18.765 -12.313 1.00 31.14 ? 7   TYR A OH  1 
ATOM   35   N  N   . PRO A 1 8   ? -9.468  10.253 -11.316 1.00 26.11 ? 8   PRO A N   1 
ATOM   36   C  CA  . PRO A 1 8   ? -9.865  8.903  -10.914 1.00 24.91 ? 8   PRO A CA  1 
ATOM   37   C  C   . PRO A 1 8   ? -10.044 8.782  -9.429  1.00 23.72 ? 8   PRO A C   1 
ATOM   38   O  O   . PRO A 1 8   ? -10.672 7.836  -8.940  1.00 23.97 ? 8   PRO A O   1 
ATOM   39   C  CB  . PRO A 1 8   ? -8.689  8.041  -11.358 1.00 24.66 ? 8   PRO A CB  1 
ATOM   40   C  CG  . PRO A 1 8   ? -7.584  8.950  -11.582 1.00 26.04 ? 8   PRO A CG  1 
ATOM   41   C  CD  . PRO A 1 8   ? -8.193  10.224 -12.050 1.00 25.98 ? 8   PRO A CD  1 
ATOM   42   N  N   . ASN A 1 9   ? -9.494  9.748  -8.724  1.00 23.29 ? 9   ASN A N   1 
ATOM   43   C  CA  . ASN A 1 9   ? -9.610  9.812  -7.282  1.00 23.47 ? 9   ASN A CA  1 
ATOM   44   C  C   . ASN A 1 9   ? -9.120  11.179 -6.820  1.00 23.50 ? 9   ASN A C   1 
ATOM   45   O  O   . ASN A 1 9   ? -8.640  11.995 -7.623  1.00 23.95 ? 9   ASN A O   1 
ATOM   46   C  CB  . ASN A 1 9   ? -8.722  8.741  -6.690  1.00 23.67 ? 9   ASN A CB  1 
ATOM   47   C  CG  . ASN A 1 9   ? -7.314  8.834  -7.204  1.00 23.07 ? 9   ASN A CG  1 
ATOM   48   O  OD1 . ASN A 1 9   ? -6.608  9.807  -6.947  1.00 20.89 ? 9   ASN A OD1 1 
ATOM   49   N  ND2 . ASN A 1 9   ? -6.893  7.815  -7.937  1.00 23.62 ? 9   ASN A ND2 1 
ATOM   50   N  N   . ILE A 1 10  ? -9.127  11.389 -5.513  1.00 23.80 ? 10  ILE A N   1 
ATOM   51   C  CA  . ILE A 1 10  ? -8.864  12.720 -4.966  1.00 23.36 ? 10  ILE A CA  1 
ATOM   52   C  C   . ILE A 1 10  ? -7.387  13.095 -4.901  1.00 24.56 ? 10  ILE A C   1 
ATOM   53   O  O   . ILE A 1 10  ? -7.059  14.300 -4.966  1.00 24.43 ? 10  ILE A O   1 
ATOM   54   C  CB  . ILE A 1 10  ? -9.584  12.908 -3.604  1.00 23.62 ? 10  ILE A CB  1 
ATOM   55   C  CG1 . ILE A 1 10  ? -11.100 12.940 -3.828  1.00 22.38 ? 10  ILE A CG1 1 
ATOM   56   C  CG2 . ILE A 1 10  ? -9.088  14.164 -2.856  1.00 21.28 ? 10  ILE A CG2 1 
ATOM   57   C  CD1 . ILE A 1 10  ? -11.687 14.260 -4.398  1.00 19.67 ? 10  ILE A CD1 1 
ATOM   58   N  N   . GLU A 1 11  ? -6.506  12.091 -4.776  1.00 24.94 ? 11  GLU A N   1 
ATOM   59   C  CA  . GLU A 1 11  ? -5.060  12.318 -4.912  1.00 26.65 ? 11  GLU A CA  1 
ATOM   60   C  C   . GLU A 1 11  ? -4.756  12.973 -6.266  1.00 26.44 ? 11  GLU A C   1 
ATOM   61   O  O   . GLU A 1 11  ? -4.184  14.077 -6.328  1.00 27.22 ? 11  GLU A O   1 
ATOM   62   C  CB  . GLU A 1 11  ? -4.282  10.993 -4.796  1.00 26.48 ? 11  GLU A CB  1 
ATOM   63   C  CG  . GLU A 1 11  ? -4.144  10.440 -3.386  1.00 28.40 ? 11  GLU A CG  1 
ATOM   64   C  CD  . GLU A 1 11  ? -5.399  9.754  -2.856  1.00 30.61 ? 11  GLU A CD  1 
ATOM   65   O  OE1 . GLU A 1 11  ? -6.353  9.481  -3.640  1.00 29.56 ? 11  GLU A OE1 1 
ATOM   66   O  OE2 . GLU A 1 11  ? -5.397  9.455  -1.642  1.00 32.02 ? 11  GLU A OE2 1 
ATOM   67   N  N   . ALA A 1 12  ? -5.160  12.304 -7.350  1.00 26.50 ? 12  ALA A N   1 
ATOM   68   C  CA  . ALA A 1 12  ? -4.997  12.848 -8.695  1.00 26.39 ? 12  ALA A CA  1 
ATOM   69   C  C   . ALA A 1 12  ? -5.548  14.270 -8.808  1.00 26.40 ? 12  ALA A C   1 
ATOM   70   O  O   . ALA A 1 12  ? -4.919  15.155 -9.398  1.00 27.10 ? 12  ALA A O   1 
ATOM   71   C  CB  . ALA A 1 12  ? -5.673  11.933 -9.716  1.00 26.01 ? 12  ALA A CB  1 
ATOM   72   N  N   . LEU A 1 13  ? -6.736  14.482 -8.238  1.00 26.00 ? 13  LEU A N   1 
ATOM   73   C  CA  . LEU A 1 13  ? -7.341  15.801 -8.172  1.00 25.12 ? 13  LEU A CA  1 
ATOM   74   C  C   . LEU A 1 13  ? -6.483  16.781 -7.386  1.00 25.03 ? 13  LEU A C   1 
ATOM   75   O  O   . LEU A 1 13  ? -6.174  17.863 -7.869  1.00 26.49 ? 13  LEU A O   1 
ATOM   76   C  CB  . LEU A 1 13  ? -8.749  15.723 -7.547  1.00 25.34 ? 13  LEU A CB  1 
ATOM   77   C  CG  . LEU A 1 13  ? -9.573  17.021 -7.565  1.00 24.31 ? 13  LEU A CG  1 
ATOM   78   C  CD1 . LEU A 1 13  ? -11.035 16.738 -7.480  1.00 26.41 ? 13  LEU A CD1 1 
ATOM   79   C  CD2 . LEU A 1 13  ? -9.216  17.953 -6.456  1.00 23.95 ? 13  LEU A CD2 1 
ATOM   80   N  N   . GLU A 1 14  ? -6.102  16.402 -6.172  1.00 24.89 ? 14  GLU A N   1 
ATOM   81   C  CA  . GLU A 1 14  ? -5.337  17.290 -5.314  1.00 24.88 ? 14  GLU A CA  1 
ATOM   82   C  C   . GLU A 1 14  ? -3.962  17.623 -5.914  1.00 25.67 ? 14  GLU A C   1 
ATOM   83   O  O   . GLU A 1 14  ? -3.463  18.774 -5.814  1.00 24.03 ? 14  GLU A O   1 
ATOM   84   C  CB  . GLU A 1 14  ? -5.227  16.664 -3.922  1.00 25.03 ? 14  GLU A CB  1 
ATOM   85   C  CG  . GLU A 1 14  ? -6.562  16.802 -3.187  1.00 23.94 ? 14  GLU A CG  1 
ATOM   86   C  CD  . GLU A 1 14  ? -6.466  16.682 -1.653  1.00 24.60 ? 14  GLU A CD  1 
ATOM   87   O  OE1 . GLU A 1 14  ? -5.344  16.682 -1.112  1.00 23.82 ? 14  GLU A OE1 1 
ATOM   88   O  OE2 . GLU A 1 14  ? -7.536  16.624 -0.995  1.00 23.80 ? 14  GLU A OE2 1 
ATOM   89   N  N   . ASN A 1 15  ? -3.380  16.615 -6.561  1.00 25.67 ? 15  ASN A N   1 
ATOM   90   C  CA  . ASN A 1 15  ? -2.085  16.738 -7.220  1.00 27.44 ? 15  ASN A CA  1 
ATOM   91   C  C   . ASN A 1 15  ? -2.082  17.808 -8.297  1.00 27.36 ? 15  ASN A C   1 
ATOM   92   O  O   . ASN A 1 15  ? -1.078  18.478 -8.494  1.00 28.84 ? 15  ASN A O   1 
ATOM   93   C  CB  . ASN A 1 15  ? -1.659  15.384 -7.829  1.00 26.85 ? 15  ASN A CB  1 
ATOM   94   C  CG  . ASN A 1 15  ? -0.841  14.541 -6.865  1.00 28.02 ? 15  ASN A CG  1 
ATOM   95   O  OD1 . ASN A 1 15  ? -0.345  15.034 -5.833  1.00 28.14 ? 15  ASN A OD1 1 
ATOM   96   N  ND2 . ASN A 1 15  ? -0.701  13.256 -7.182  1.00 29.37 ? 15  ASN A ND2 1 
ATOM   97   N  N   . ALA A 1 16  ? -3.217  17.987 -8.961  1.00 27.44 ? 16  ALA A N   1 
ATOM   98   C  CA  . ALA A 1 16  ? -3.323  18.881 -10.108 1.00 27.33 ? 16  ALA A CA  1 
ATOM   99   C  C   . ALA A 1 16  ? -3.952  20.237 -9.794  1.00 27.57 ? 16  ALA A C   1 
ATOM   100  O  O   . ALA A 1 16  ? -3.602  21.237 -10.422 1.00 28.73 ? 16  ALA A O   1 
ATOM   101  C  CB  . ALA A 1 16  ? -4.081  18.198 -11.197 1.00 27.08 ? 16  ALA A CB  1 
ATOM   102  N  N   . GLU A 1 17  ? -4.895  20.268 -8.845  1.00 26.63 ? 17  GLU A N   1 
ATOM   103  C  CA  . GLU A 1 17  ? -5.671  21.478 -8.558  1.00 25.66 ? 17  GLU A CA  1 
ATOM   104  C  C   . GLU A 1 17  ? -5.037  22.184 -7.379  1.00 25.15 ? 17  GLU A C   1 
ATOM   105  O  O   . GLU A 1 17  ? -4.280  21.561 -6.654  1.00 25.64 ? 17  GLU A O   1 
ATOM   106  C  CB  . GLU A 1 17  ? -7.112  21.112 -8.234  1.00 25.08 ? 17  GLU A CB  1 
ATOM   107  C  CG  . GLU A 1 17  ? -7.809  20.355 -9.367  1.00 24.71 ? 17  GLU A CG  1 
ATOM   108  C  CD  . GLU A 1 17  ? -8.116  21.249 -10.570 1.00 20.14 ? 17  GLU A CD  1 
ATOM   109  O  OE1 . GLU A 1 17  ? -8.032  22.504 -10.468 1.00 20.13 ? 17  GLU A OE1 1 
ATOM   110  O  OE2 . GLU A 1 17  ? -8.484  20.683 -11.610 1.00 21.43 ? 17  GLU A OE2 1 
ATOM   111  N  N   . THR A 1 18  ? -5.316  23.474 -7.214  1.00 24.81 ? 18  THR A N   1 
ATOM   112  C  CA  . THR A 1 18  ? -4.736  24.304 -6.122  1.00 25.25 ? 18  THR A CA  1 
ATOM   113  C  C   . THR A 1 18  ? -5.772  24.492 -5.016  1.00 24.94 ? 18  THR A C   1 
ATOM   114  O  O   . THR A 1 18  ? -6.858  24.954 -5.267  1.00 24.23 ? 18  THR A O   1 
ATOM   115  C  CB  . THR A 1 18  ? -4.256  25.678 -6.706  1.00 25.24 ? 18  THR A CB  1 
ATOM   116  O  OG1 . THR A 1 18  ? -3.059  25.445 -7.453  1.00 26.24 ? 18  THR A OG1 1 
ATOM   117  C  CG2 . THR A 1 18  ? -3.981  26.768 -5.642  1.00 25.53 ? 18  THR A CG2 1 
ATOM   118  N  N   . VAL A 1 19  ? -5.447  24.106 -3.784  1.00 24.85 ? 19  VAL A N   1 
ATOM   119  C  CA  . VAL A 1 19  ? -6.428  24.270 -2.718  1.00 23.53 ? 19  VAL A CA  1 
ATOM   120  C  C   . VAL A 1 19  ? -6.654  25.752 -2.438  1.00 23.18 ? 19  VAL A C   1 
ATOM   121  O  O   . VAL A 1 19  ? -5.717  26.570 -2.527  1.00 23.24 ? 19  VAL A O   1 
ATOM   122  C  CB  . VAL A 1 19  ? -6.050  23.479 -1.481  1.00 22.31 ? 19  VAL A CB  1 
ATOM   123  C  CG1 . VAL A 1 19  ? -4.766  24.009 -0.874  1.00 23.36 ? 19  VAL A CG1 1 
ATOM   124  C  CG2 . VAL A 1 19  ? -7.201  23.477 -0.467  1.00 21.93 ? 19  VAL A CG2 1 
ATOM   125  N  N   . GLY A 1 20  ? -7.896  26.095 -2.147  1.00 23.14 ? 20  GLY A N   1 
ATOM   126  C  CA  . GLY A 1 20  ? -8.279  27.485 -1.908  1.00 23.34 ? 20  GLY A CA  1 
ATOM   127  C  C   . GLY A 1 20  ? -8.384  28.320 -3.185  1.00 22.36 ? 20  GLY A C   1 
ATOM   128  O  O   . GLY A 1 20  ? -8.713  29.513 -3.108  1.00 21.77 ? 20  GLY A O   1 
ATOM   129  N  N   . VAL A 1 21  ? -8.100  27.705 -4.343  1.00 21.40 ? 21  VAL A N   1 
ATOM   130  C  CA  . VAL A 1 21  ? -8.428  28.308 -5.634  1.00 21.20 ? 21  VAL A CA  1 
ATOM   131  C  C   . VAL A 1 21  ? -9.524  27.521 -6.391  1.00 20.31 ? 21  VAL A C   1 
ATOM   132  O  O   . VAL A 1 21  ? -10.565 28.086 -6.706  1.00 21.54 ? 21  VAL A O   1 
ATOM   133  C  CB  . VAL A 1 21  ? -7.175  28.611 -6.532  1.00 20.92 ? 21  VAL A CB  1 
ATOM   134  C  CG1 . VAL A 1 21  ? -7.616  29.065 -7.915  1.00 20.77 ? 21  VAL A CG1 1 
ATOM   135  C  CG2 . VAL A 1 21  ? -6.274  29.675 -5.896  1.00 23.33 ? 21  VAL A CG2 1 
ATOM   136  N  N   . ALA A 1 22  ? -9.299  26.241 -6.690  1.00 20.55 ? 22  ALA A N   1 
ATOM   137  C  CA  . ALA A 1 22  ? -10.355 25.382 -7.281  1.00 19.66 ? 22  ALA A CA  1 
ATOM   138  C  C   . ALA A 1 22  ? -11.251 24.657 -6.244  1.00 19.83 ? 22  ALA A C   1 
ATOM   139  O  O   . ALA A 1 22  ? -12.407 24.303 -6.540  1.00 19.07 ? 22  ALA A O   1 
ATOM   140  C  CB  . ALA A 1 22  ? -9.755  24.367 -8.247  1.00 20.68 ? 22  ALA A CB  1 
ATOM   141  N  N   . TYR A 1 23  ? -10.718 24.399 -5.043  1.00 18.38 ? 23  TYR A N   1 
ATOM   142  C  CA  . TYR A 1 23  ? -11.483 23.666 -4.063  1.00 18.13 ? 23  TYR A CA  1 
ATOM   143  C  C   . TYR A 1 23  ? -11.037 24.017 -2.624  1.00 17.95 ? 23  TYR A C   1 
ATOM   144  O  O   . TYR A 1 23  ? -9.922  24.486 -2.415  1.00 17.15 ? 23  TYR A O   1 
ATOM   145  C  CB  . TYR A 1 23  ? -11.357 22.141 -4.294  1.00 17.33 ? 23  TYR A CB  1 
ATOM   146  C  CG  . TYR A 1 23  ? -10.049 21.580 -3.801  1.00 19.61 ? 23  TYR A CG  1 
ATOM   147  C  CD1 . TYR A 1 23  ? -8.903  21.627 -4.607  1.00 17.91 ? 23  TYR A CD1 1 
ATOM   148  C  CD2 . TYR A 1 23  ? -9.950  20.995 -2.513  1.00 17.53 ? 23  TYR A CD2 1 
ATOM   149  C  CE1 . TYR A 1 23  ? -7.678  21.083 -4.157  1.00 21.77 ? 23  TYR A CE1 1 
ATOM   150  C  CE2 . TYR A 1 23  ? -8.741  20.490 -2.062  1.00 18.79 ? 23  TYR A CE2 1 
ATOM   151  C  CZ  . TYR A 1 23  ? -7.620  20.532 -2.878  1.00 18.82 ? 23  TYR A CZ  1 
ATOM   152  O  OH  . TYR A 1 23  ? -6.437  20.018 -2.436  1.00 16.35 ? 23  TYR A OH  1 
ATOM   153  N  N   . ASN A 1 24  ? -11.958 23.836 -1.676  1.00 17.60 ? 24  ASN A N   1 
ATOM   154  C  CA  . ASN A 1 24  ? -11.614 23.842 -0.250  1.00 17.51 ? 24  ASN A CA  1 
ATOM   155  C  C   . ASN A 1 24  ? -12.273 22.638 0.469   1.00 17.82 ? 24  ASN A C   1 
ATOM   156  O  O   . ASN A 1 24  ? -13.155 21.975 -0.091  1.00 16.14 ? 24  ASN A O   1 
ATOM   157  C  CB  . ASN A 1 24  ? -11.848 25.228 0.409   1.00 17.59 ? 24  ASN A CB  1 
ATOM   158  C  CG  . ASN A 1 24  ? -13.316 25.548 0.717   1.00 17.72 ? 24  ASN A CG  1 
ATOM   159  O  OD1 . ASN A 1 24  ? -14.164 24.683 0.876   1.00 20.45 ? 24  ASN A OD1 1 
ATOM   160  N  ND2 . ASN A 1 24  ? -13.585 26.820 0.863   1.00 22.22 ? 24  ASN A ND2 1 
ATOM   161  N  N   . ILE A 1 25  ? -11.798 22.337 1.679   1.00 17.30 ? 25  ILE A N   1 
ATOM   162  C  CA  . ILE A 1 25  ? -12.407 21.320 2.513   1.00 16.93 ? 25  ILE A CA  1 
ATOM   163  C  C   . ILE A 1 25  ? -12.777 21.918 3.882   1.00 17.68 ? 25  ILE A C   1 
ATOM   164  O  O   . ILE A 1 25  ? -11.978 22.654 4.514   1.00 17.72 ? 25  ILE A O   1 
ATOM   165  C  CB  . ILE A 1 25  ? -11.472 20.097 2.709   1.00 17.76 ? 25  ILE A CB  1 
ATOM   166  C  CG1 . ILE A 1 25  ? -10.792 19.679 1.377   1.00 16.71 ? 25  ILE A CG1 1 
ATOM   167  C  CG2 . ILE A 1 25  ? -12.268 18.911 3.303   1.00 14.99 ? 25  ILE A CG2 1 
ATOM   168  C  CD1 . ILE A 1 25  ? -9.798  18.531 1.509   1.00 13.57 ? 25  ILE A CD1 1 
ATOM   169  N  N   . GLU A 1 26  ? -13.972 21.566 4.348   1.00 18.34 ? 26  GLU A N   1 
ATOM   170  C  CA  . GLU A 1 26  ? -14.528 22.034 5.625   1.00 17.94 ? 26  GLU A CA  1 
ATOM   171  C  C   . GLU A 1 26  ? -14.952 20.839 6.467   1.00 18.54 ? 26  GLU A C   1 
ATOM   172  O  O   . GLU A 1 26  ? -15.578 19.896 5.958   1.00 18.18 ? 26  GLU A O   1 
ATOM   173  C  CB  . GLU A 1 26  ? -15.750 22.939 5.392   1.00 18.51 ? 26  GLU A CB  1 
ATOM   174  C  CG  . GLU A 1 26  ? -15.510 24.194 4.584   1.00 19.56 ? 26  GLU A CG  1 
ATOM   175  C  CD  . GLU A 1 26  ? -16.628 25.219 4.789   1.00 22.42 ? 26  GLU A CD  1 
ATOM   176  O  OE1 . GLU A 1 26  ? -17.774 24.834 5.115   1.00 24.87 ? 26  GLU A OE1 1 
ATOM   177  O  OE2 . GLU A 1 26  ? -16.361 26.418 4.655   1.00 25.97 ? 26  GLU A OE2 1 
ATOM   178  N  N   . VAL A 1 27  ? -14.646 20.868 7.772   1.00 18.52 ? 27  VAL A N   1 
ATOM   179  C  CA  . VAL A 1 27  ? -14.978 19.731 8.675   1.00 17.85 ? 27  VAL A CA  1 
ATOM   180  C  C   . VAL A 1 27  ? -15.406 20.292 10.034  1.00 18.49 ? 27  VAL A C   1 
ATOM   181  O  O   . VAL A 1 27  ? -14.764 21.175 10.577  1.00 18.45 ? 27  VAL A O   1 
ATOM   182  C  CB  . VAL A 1 27  ? -13.758 18.796 8.912   1.00 18.57 ? 27  VAL A CB  1 
ATOM   183  C  CG1 . VAL A 1 27  ? -14.138 17.585 9.776   1.00 17.90 ? 27  VAL A CG1 1 
ATOM   184  C  CG2 . VAL A 1 27  ? -13.116 18.320 7.620   1.00 19.93 ? 27  VAL A CG2 1 
ATOM   185  N  N   . LYS A 1 28  ? -16.492 19.776 10.590  1.00 18.68 ? 28  LYS A N   1 
ATOM   186  C  CA  . LYS A 1 28  ? -16.743 20.000 11.981  1.00 19.23 ? 28  LYS A CA  1 
ATOM   187  C  C   . LYS A 1 28  ? -17.197 18.686 12.593  1.00 20.07 ? 28  LYS A C   1 
ATOM   188  O  O   . LYS A 1 28  ? -18.290 18.239 12.319  1.00 21.48 ? 28  LYS A O   1 
ATOM   189  C  CB  . LYS A 1 28  ? -17.778 21.143 12.205  1.00 18.26 ? 28  LYS A CB  1 
ATOM   190  C  CG  . LYS A 1 28  ? -17.935 21.493 13.746  1.00 18.17 ? 28  LYS A CG  1 
ATOM   191  C  CD  . LYS A 1 28  ? -18.973 22.570 14.002  1.00 21.99 ? 28  LYS A CD  1 
ATOM   192  C  CE  . LYS A 1 28  ? -18.899 23.087 15.457  1.00 23.88 ? 28  LYS A CE  1 
ATOM   193  N  NZ  . LYS A 1 28  ? -19.865 24.199 15.737  1.00 29.09 ? 28  LYS A NZ  1 
ATOM   194  N  N   . ARG A 1 29  ? -16.329 18.063 13.388  1.00 20.70 ? 29  ARG A N   1 
ATOM   195  C  CA  . ARG A 1 29  ? -16.638 16.836 14.078  1.00 20.93 ? 29  ARG A CA  1 
ATOM   196  C  C   . ARG A 1 29  ? -17.142 17.255 15.467  1.00 20.81 ? 29  ARG A C   1 
ATOM   197  O  O   . ARG A 1 29  ? -16.391 17.874 16.244  1.00 19.46 ? 29  ARG A O   1 
ATOM   198  C  CB  . ARG A 1 29  ? -15.388 15.938 14.174  1.00 20.85 ? 29  ARG A CB  1 
ATOM   199  C  CG  . ARG A 1 29  ? -15.756 14.538 14.654  1.00 22.34 ? 29  ARG A CG  1 
ATOM   200  C  CD  . ARG A 1 29  ? -14.591 13.577 14.869  1.00 22.99 ? 29  ARG A CD  1 
ATOM   201  N  NE  . ARG A 1 29  ? -15.067 12.403 15.600  1.00 22.13 ? 29  ARG A NE  1 
ATOM   202  C  CZ  . ARG A 1 29  ? -14.325 11.604 16.369  1.00 20.63 ? 29  ARG A CZ  1 
ATOM   203  N  NH1 . ARG A 1 29  ? -13.032 11.777 16.472  1.00 21.47 ? 29  ARG A NH1 1 
ATOM   204  N  NH2 . ARG A 1 29  ? -14.892 10.585 17.003  1.00 17.95 ? 29  ARG A NH2 1 
ATOM   205  N  N   . GLN A 1 30  ? -18.404 16.931 15.754  1.00 20.81 ? 30  GLN A N   1 
ATOM   206  C  CA  . GLN A 1 30  ? -19.103 17.430 16.922  1.00 21.16 ? 30  GLN A CA  1 
ATOM   207  C  C   . GLN A 1 30  ? -20.199 16.478 17.392  1.00 21.40 ? 30  GLN A C   1 
ATOM   208  O  O   . GLN A 1 30  ? -20.979 16.810 18.266  1.00 20.49 ? 30  GLN A O   1 
ATOM   209  C  CB  . GLN A 1 30  ? -19.663 18.846 16.653  1.00 21.32 ? 30  GLN A CB  1 
ATOM   210  C  CG  . GLN A 1 30  ? -20.803 18.929 15.619  1.00 22.88 ? 30  GLN A CG  1 
ATOM   211  C  CD  . GLN A 1 30  ? -21.497 20.285 15.602  1.00 23.21 ? 30  GLN A CD  1 
ATOM   212  O  OE1 . GLN A 1 30  ? -21.225 21.164 16.437  1.00 22.60 ? 30  GLN A OE1 1 
ATOM   213  N  NE2 . GLN A 1 30  ? -22.395 20.471 14.645  1.00 20.87 ? 30  GLN A NE2 1 
ATOM   214  N  N   . ASN A 1 31  ? -20.225 15.281 16.823  1.00 20.61 ? 31  ASN A N   1 
ATOM   215  C  CA  . ASN A 1 31  ? -21.226 14.270 17.160  1.00 21.61 ? 31  ASN A CA  1 
ATOM   216  C  C   . ASN A 1 31  ? -20.635 12.860 17.000  1.00 21.33 ? 31  ASN A C   1 
ATOM   217  O  O   . ASN A 1 31  ? -19.968 12.593 15.991  1.00 20.83 ? 31  ASN A O   1 
ATOM   218  C  CB  . ASN A 1 31  ? -22.479 14.463 16.287  1.00 20.89 ? 31  ASN A CB  1 
ATOM   219  C  CG  . ASN A 1 31  ? -23.719 13.744 16.835  1.00 22.63 ? 31  ASN A CG  1 
ATOM   220  O  OD1 . ASN A 1 31  ? -23.995 12.597 16.465  1.00 21.10 ? 31  ASN A OD1 1 
ATOM   221  N  ND2 . ASN A 1 31  ? -24.469 14.415 17.707  1.00 20.89 ? 31  ASN A ND2 1 
ATOM   222  N  N   . PRO A 1 32  ? -20.853 11.962 17.997  1.00 22.62 ? 32  PRO A N   1 
ATOM   223  C  CA  . PRO A 1 32  ? -20.470 10.553 17.907  1.00 23.11 ? 32  PRO A CA  1 
ATOM   224  C  C   . PRO A 1 32  ? -21.275 9.714  16.903  1.00 23.63 ? 32  PRO A C   1 
ATOM   225  O  O   . PRO A 1 32  ? -20.751 8.720  16.369  1.00 24.65 ? 32  PRO A O   1 
ATOM   226  C  CB  . PRO A 1 32  ? -20.755 10.031 19.319  1.00 24.07 ? 32  PRO A CB  1 
ATOM   227  C  CG  . PRO A 1 32  ? -21.777 10.979 19.863  1.00 22.24 ? 32  PRO A CG  1 
ATOM   228  C  CD  . PRO A 1 32  ? -21.372 12.287 19.342  1.00 22.09 ? 32  PRO A CD  1 
ATOM   229  N  N   . SER A 1 33  ? -22.502 10.130 16.622  1.00 23.16 ? 33  SER A N   1 
ATOM   230  C  CA  . SER A 1 33  ? -23.495 9.276  15.949  1.00 23.89 ? 33  SER A CA  1 
ATOM   231  C  C   . SER A 1 33  ? -23.751 9.559  14.484  1.00 22.88 ? 33  SER A C   1 
ATOM   232  O  O   . SER A 1 33  ? -23.966 8.608  13.722  1.00 22.97 ? 33  SER A O   1 
ATOM   233  C  CB  . SER A 1 33  ? -24.833 9.332  16.668  1.00 22.96 ? 33  SER A CB  1 
ATOM   234  O  OG  . SER A 1 33  ? -24.712 8.746  17.945  1.00 26.07 ? 33  SER A OG  1 
ATOM   235  N  N   . MET A 1 34  ? -23.749 10.844 14.106  1.00 22.20 ? 34  MET A N   1 
ATOM   236  C  CA  . MET A 1 34  ? -24.254 11.283 12.804  1.00 20.52 ? 34  MET A CA  1 
ATOM   237  C  C   . MET A 1 34  ? -23.415 12.368 12.116  1.00 19.66 ? 34  MET A C   1 
ATOM   238  O  O   . MET A 1 34  ? -22.996 13.353 12.749  1.00 19.34 ? 34  MET A O   1 
ATOM   239  C  CB  . MET A 1 34  ? -25.707 11.775 12.957  1.00 21.08 ? 34  MET A CB  1 
ATOM   240  C  CG  . MET A 1 34  ? -26.395 12.209 11.672  1.00 19.29 ? 34  MET A CG  1 
ATOM   241  S  SD  . MET A 1 34  ? -26.324 10.983 10.359  1.00 22.76 ? 34  MET A SD  1 
ATOM   242  C  CE  . MET A 1 34  ? -27.700 9.959  10.743  1.00 22.52 ? 34  MET A CE  1 
ATOM   243  N  N   . ILE A 1 35  ? -23.184 12.200 10.808  1.00 18.22 ? 35  ILE A N   1 
ATOM   244  C  CA  . ILE A 1 35  ? -22.406 13.165 10.049  1.00 17.04 ? 35  ILE A CA  1 
ATOM   245  C  C   . ILE A 1 35  ? -23.125 13.446 8.711   1.00 17.60 ? 35  ILE A C   1 
ATOM   246  O  O   . ILE A 1 35  ? -23.486 12.529 7.996   1.00 17.01 ? 35  ILE A O   1 
ATOM   247  C  CB  . ILE A 1 35  ? -20.947 12.663 9.776   1.00 17.15 ? 35  ILE A CB  1 
ATOM   248  C  CG1 . ILE A 1 35  ? -20.178 13.669 8.916   1.00 17.82 ? 35  ILE A CG1 1 
ATOM   249  C  CG2 . ILE A 1 35  ? -20.954 11.238 9.168   1.00 17.09 ? 35  ILE A CG2 1 
ATOM   250  C  CD1 . ILE A 1 35  ? -18.680 13.332 8.674   1.00 20.20 ? 35  ILE A CD1 1 
ATOM   251  N  N   . TYR A 1 36  ? -23.351 14.720 8.425   1.00 17.32 ? 36  TYR A N   1 
ATOM   252  C  CA  . TYR A 1 36  ? -23.987 15.117 7.205   1.00 17.39 ? 36  TYR A CA  1 
ATOM   253  C  C   . TYR A 1 36  ? -22.938 15.715 6.334   1.00 17.34 ? 36  TYR A C   1 
ATOM   254  O  O   . TYR A 1 36  ? -22.169 16.570 6.768   1.00 17.34 ? 36  TYR A O   1 
ATOM   255  C  CB  . TYR A 1 36  ? -25.056 16.151 7.502   1.00 18.20 ? 36  TYR A CB  1 
ATOM   256  C  CG  . TYR A 1 36  ? -26.183 15.615 8.325   1.00 17.40 ? 36  TYR A CG  1 
ATOM   257  C  CD1 . TYR A 1 36  ? -27.118 14.752 7.759   1.00 18.52 ? 36  TYR A CD1 1 
ATOM   258  C  CD2 . TYR A 1 36  ? -26.308 15.939 9.674   1.00 18.82 ? 36  TYR A CD2 1 
ATOM   259  C  CE1 . TYR A 1 36  ? -28.180 14.259 8.497   1.00 18.39 ? 36  TYR A CE1 1 
ATOM   260  C  CE2 . TYR A 1 36  ? -27.376 15.418 10.432  1.00 15.09 ? 36  TYR A CE2 1 
ATOM   261  C  CZ  . TYR A 1 36  ? -28.303 14.595 9.812   1.00 14.90 ? 36  TYR A CZ  1 
ATOM   262  O  OH  . TYR A 1 36  ? -29.357 14.067 10.516  1.00 21.04 ? 36  TYR A OH  1 
ATOM   263  N  N   . PHE A 1 37  ? -22.888 15.268 5.089   1.00 18.48 ? 37  PHE A N   1 
ATOM   264  C  CA  . PHE A 1 37  ? -21.735 15.653 4.274   1.00 17.98 ? 37  PHE A CA  1 
ATOM   265  C  C   . PHE A 1 37  ? -21.975 15.543 2.787   1.00 18.19 ? 37  PHE A C   1 
ATOM   266  O  O   . PHE A 1 37  ? -22.920 14.908 2.334   1.00 18.72 ? 37  PHE A O   1 
ATOM   267  C  CB  . PHE A 1 37  ? -20.495 14.843 4.691   1.00 17.85 ? 37  PHE A CB  1 
ATOM   268  C  CG  . PHE A 1 37  ? -20.439 13.477 4.102   1.00 18.41 ? 37  PHE A CG  1 
ATOM   269  C  CD1 . PHE A 1 37  ? -21.149 12.412 4.677   1.00 19.49 ? 37  PHE A CD1 1 
ATOM   270  C  CD2 . PHE A 1 37  ? -19.696 13.248 2.953   1.00 18.06 ? 37  PHE A CD2 1 
ATOM   271  C  CE1 . PHE A 1 37  ? -21.099 11.135 4.097   1.00 17.89 ? 37  PHE A CE1 1 
ATOM   272  C  CE2 . PHE A 1 37  ? -19.645 11.980 2.363   1.00 20.47 ? 37  PHE A CE2 1 
ATOM   273  C  CZ  . PHE A 1 37  ? -20.352 10.929 2.921   1.00 18.33 ? 37  PHE A CZ  1 
ATOM   274  N  N   . SER A 1 38  ? -21.109 16.195 2.022   1.00 18.03 ? 38  SER A N   1 
ATOM   275  C  CA  . SER A 1 38  ? -21.125 16.050 0.584   1.00 19.08 ? 38  SER A CA  1 
ATOM   276  C  C   . SER A 1 38  ? -19.685 16.054 0.011   1.00 18.67 ? 38  SER A C   1 
ATOM   277  O  O   . SER A 1 38  ? -18.843 16.855 0.426   1.00 17.87 ? 38  SER A O   1 
ATOM   278  C  CB  . SER A 1 38  ? -22.000 17.112 -0.072  1.00 18.05 ? 38  SER A CB  1 
ATOM   279  O  OG  . SER A 1 38  ? -21.861 17.021 -1.480  1.00 21.56 ? 38  SER A OG  1 
ATOM   280  N  N   . PRO A 1 39  ? -19.392 15.114 -0.909  1.00 18.71 ? 39  PRO A N   1 
ATOM   281  C  CA  . PRO A 1 39  ? -18.111 15.175 -1.618  1.00 19.37 ? 39  PRO A CA  1 
ATOM   282  C  C   . PRO A 1 39  ? -18.149 16.132 -2.816  1.00 18.99 ? 39  PRO A C   1 
ATOM   283  O  O   . PRO A 1 39  ? -17.102 16.411 -3.433  1.00 18.93 ? 39  PRO A O   1 
ATOM   284  C  CB  . PRO A 1 39  ? -17.905 13.735 -2.096  1.00 18.47 ? 39  PRO A CB  1 
ATOM   285  C  CG  . PRO A 1 39  ? -19.282 13.158 -2.250  1.00 20.85 ? 39  PRO A CG  1 
ATOM   286  C  CD  . PRO A 1 39  ? -20.143 13.865 -1.187  1.00 19.62 ? 39  PRO A CD  1 
ATOM   287  N  N   . HIS A 1 40  ? -19.363 16.579 -3.141  1.00 19.52 ? 40  HIS A N   1 
ATOM   288  C  CA  . HIS A 1 40  ? -19.667 17.400 -4.331  1.00 19.81 ? 40  HIS A CA  1 
ATOM   289  C  C   . HIS A 1 40  ? -20.320 18.752 -3.957  1.00 19.77 ? 40  HIS A C   1 
ATOM   290  O  O   . HIS A 1 40  ? -21.327 19.200 -4.565  1.00 19.81 ? 40  HIS A O   1 
ATOM   291  C  CB  . HIS A 1 40  ? -20.479 16.568 -5.360  1.00 20.25 ? 40  HIS A CB  1 
ATOM   292  C  CG  . HIS A 1 40  ? -19.882 15.212 -5.643  1.00 20.96 ? 40  HIS A CG  1 
ATOM   293  N  ND1 . HIS A 1 40  ? -20.636 14.111 -5.986  1.00 21.68 ? 40  HIS A ND1 1 
ATOM   294  C  CD2 . HIS A 1 40  ? -18.598 14.779 -5.601  1.00 22.85 ? 40  HIS A CD2 1 
ATOM   295  C  CE1 . HIS A 1 40  ? -19.854 13.058 -6.131  1.00 18.69 ? 40  HIS A CE1 1 
ATOM   296  N  NE2 . HIS A 1 40  ? -18.610 13.436 -5.891  1.00 22.37 ? 40  HIS A NE2 1 
ATOM   297  N  N   . ALA A 1 41  ? -19.733 19.414 -2.953  1.00 19.45 ? 41  ALA A N   1 
ATOM   298  C  CA  . ALA A 1 41  ? -20.278 20.673 -2.439  1.00 19.27 ? 41  ALA A CA  1 
ATOM   299  C  C   . ALA A 1 41  ? -19.732 21.927 -3.151  1.00 19.55 ? 41  ALA A C   1 
ATOM   300  O  O   . ALA A 1 41  ? -19.016 21.818 -4.135  1.00 18.94 ? 41  ALA A O   1 
ATOM   301  C  CB  . ALA A 1 41  ? -20.071 20.772 -0.934  1.00 17.89 ? 41  ALA A CB  1 
ATOM   302  N  N   . GLY A 1 42  ? -20.105 23.106 -2.645  1.00 19.94 ? 42  GLY A N   1 
ATOM   303  C  CA  . GLY A 1 42  ? -19.784 24.380 -3.303  1.00 20.34 ? 42  GLY A CA  1 
ATOM   304  C  C   . GLY A 1 42  ? -20.461 24.360 -4.651  1.00 21.15 ? 42  GLY A C   1 
ATOM   305  O  O   . GLY A 1 42  ? -21.621 23.975 -4.739  1.00 21.04 ? 42  GLY A O   1 
ATOM   306  N  N   . GLY A 1 43  ? -19.717 24.751 -5.683  1.00 21.79 ? 43  GLY A N   1 
ATOM   307  C  CA  . GLY A 1 43  ? -20.154 24.757 -7.089  1.00 22.51 ? 43  GLY A CA  1 
ATOM   308  C  C   . GLY A 1 43  ? -20.264 23.423 -7.848  1.00 22.74 ? 43  GLY A C   1 
ATOM   309  O  O   . GLY A 1 43  ? -20.898 23.374 -8.901  1.00 22.63 ? 43  GLY A O   1 
ATOM   310  N  N   . ILE A 1 44  ? -19.679 22.334 -7.338  1.00 23.21 ? 44  ILE A N   1 
ATOM   311  C  CA  . ILE A 1 44  ? -19.788 21.016 -8.030  1.00 23.14 ? 44  ILE A CA  1 
ATOM   312  C  C   . ILE A 1 44  ? -21.264 20.566 -8.180  1.00 23.67 ? 44  ILE A C   1 
ATOM   313  O  O   . ILE A 1 44  ? -21.748 20.291 -9.309  1.00 22.91 ? 44  ILE A O   1 
ATOM   314  C  CB  . ILE A 1 44  ? -18.922 19.896 -7.367  1.00 23.00 ? 44  ILE A CB  1 
ATOM   315  C  CG1 . ILE A 1 44  ? -17.523 20.402 -7.002  1.00 22.47 ? 44  ILE A CG1 1 
ATOM   316  C  CG2 . ILE A 1 44  ? -18.845 18.646 -8.275  1.00 23.68 ? 44  ILE A CG2 1 
ATOM   317  C  CD1 . ILE A 1 44  ? -16.792 19.568 -5.947  1.00 18.30 ? 44  ILE A CD1 1 
ATOM   318  N  N   . GLU A 1 45  ? -21.977 20.473 -7.057  1.00 22.58 ? 45  GLU A N   1 
ATOM   319  C  CA  . GLU A 1 45  ? -23.423 20.261 -7.076  1.00 22.07 ? 45  GLU A CA  1 
ATOM   320  C  C   . GLU A 1 45  ? -24.119 21.300 -6.211  1.00 21.97 ? 45  GLU A C   1 
ATOM   321  O  O   . GLU A 1 45  ? -24.236 21.118 -4.970  1.00 21.71 ? 45  GLU A O   1 
ATOM   322  C  CB  . GLU A 1 45  ? -23.781 18.854 -6.618  1.00 21.56 ? 45  GLU A CB  1 
ATOM   323  C  CG  . GLU A 1 45  ? -23.557 17.855 -7.755  1.00 21.32 ? 45  GLU A CG  1 
ATOM   324  C  CD  . GLU A 1 45  ? -23.223 16.463 -7.294  1.00 20.70 ? 45  GLU A CD  1 
ATOM   325  O  OE1 . GLU A 1 45  ? -23.619 16.068 -6.177  1.00 22.05 ? 45  GLU A OE1 1 
ATOM   326  O  OE2 . GLU A 1 45  ? -22.583 15.726 -8.088  1.00 22.16 ? 45  GLU A OE2 1 
ATOM   327  N  N   . VAL A 1 46  ? -24.574 22.369 -6.866  1.00 21.06 ? 46  VAL A N   1 
ATOM   328  C  CA  . VAL A 1 46  ? -25.013 23.601 -6.177  1.00 20.70 ? 46  VAL A CA  1 
ATOM   329  C  C   . VAL A 1 46  ? -26.199 23.374 -5.286  1.00 21.13 ? 46  VAL A C   1 
ATOM   330  O  O   . VAL A 1 46  ? -27.186 22.742 -5.696  1.00 20.25 ? 46  VAL A O   1 
ATOM   331  C  CB  . VAL A 1 46  ? -25.233 24.782 -7.151  1.00 20.85 ? 46  VAL A CB  1 
ATOM   332  C  CG1 . VAL A 1 46  ? -25.814 26.012 -6.433  1.00 19.64 ? 46  VAL A CG1 1 
ATOM   333  C  CG2 . VAL A 1 46  ? -23.904 25.163 -7.817  1.00 20.16 ? 46  VAL A CG2 1 
ATOM   334  N  N   . GLY A 1 47  ? -26.059 23.853 -4.045  1.00 20.92 ? 47  GLY A N   1 
ATOM   335  C  CA  . GLY A 1 47  ? -27.074 23.749 -3.007  1.00 22.08 ? 47  GLY A CA  1 
ATOM   336  C  C   . GLY A 1 47  ? -26.804 22.759 -1.885  1.00 21.56 ? 47  GLY A C   1 
ATOM   337  O  O   . GLY A 1 47  ? -27.459 22.805 -0.831  1.00 22.12 ? 47  GLY A O   1 
ATOM   338  N  N   . THR A 1 48  ? -25.898 21.814 -2.122  1.00 21.26 ? 48  THR A N   1 
ATOM   339  C  CA  . THR A 1 48  ? -25.508 20.852 -1.088  1.00 21.57 ? 48  THR A CA  1 
ATOM   340  C  C   . THR A 1 48  ? -24.858 21.527 0.132   1.00 20.41 ? 48  THR A C   1 
ATOM   341  O  O   . THR A 1 48  ? -25.128 21.159 1.280   1.00 21.31 ? 48  THR A O   1 
ATOM   342  C  CB  . THR A 1 48  ? -24.535 19.785 -1.655  1.00 20.92 ? 48  THR A CB  1 
ATOM   343  O  OG1 . THR A 1 48  ? -23.558 20.441 -2.453  1.00 22.44 ? 48  THR A OG1 1 
ATOM   344  C  CG2 . THR A 1 48  ? -25.279 18.795 -2.543  1.00 22.47 ? 48  THR A CG2 1 
ATOM   345  N  N   . THR A 1 49  ? -23.975 22.485 -0.113  1.00 19.85 ? 49  THR A N   1 
ATOM   346  C  CA  . THR A 1 49  ? -23.350 23.229 0.985   1.00 19.61 ? 49  THR A CA  1 
ATOM   347  C  C   . THR A 1 49  ? -24.377 23.837 1.918   1.00 20.18 ? 49  THR A C   1 
ATOM   348  O  O   . THR A 1 49  ? -24.280 23.669 3.130   1.00 20.70 ? 49  THR A O   1 
ATOM   349  C  CB  . THR A 1 49  ? -22.446 24.369 0.452   1.00 19.14 ? 49  THR A CB  1 
ATOM   350  O  OG1 . THR A 1 49  ? -21.295 23.807 -0.165  1.00 18.24 ? 49  THR A OG1 1 
ATOM   351  C  CG2 . THR A 1 49  ? -21.990 25.300 1.584   1.00 18.68 ? 49  THR A CG2 1 
ATOM   352  N  N   . GLU A 1 50  ? -25.383 24.505 1.340   1.00 21.55 ? 50  GLU A N   1 
ATOM   353  C  CA  . GLU A 1 50  ? -26.335 25.332 2.122   1.00 20.56 ? 50  GLU A CA  1 
ATOM   354  C  C   . GLU A 1 50  ? -27.320 24.433 2.847   1.00 20.60 ? 50  GLU A C   1 
ATOM   355  O  O   . GLU A 1 50  ? -27.713 24.706 3.982   1.00 18.95 ? 50  GLU A O   1 
ATOM   356  C  CB  . GLU A 1 50  ? -27.077 26.326 1.215   1.00 21.34 ? 50  GLU A CB  1 
ATOM   357  C  CG  . GLU A 1 50  ? -26.156 27.431 0.591   1.00 21.71 ? 50  GLU A CG  1 
ATOM   358  C  CD  . GLU A 1 50  ? -25.289 26.994 -0.591  1.00 22.37 ? 50  GLU A CD  1 
ATOM   359  O  OE1 . GLU A 1 50  ? -25.652 26.068 -1.342  1.00 22.81 ? 50  GLU A OE1 1 
ATOM   360  O  OE2 . GLU A 1 50  ? -24.204 27.611 -0.785  1.00 25.23 ? 50  GLU A OE2 1 
ATOM   361  N  N   . LEU A 1 51  ? -27.721 23.358 2.177   1.00 19.65 ? 51  LEU A N   1 
ATOM   362  C  CA  . LEU A 1 51  ? -28.608 22.406 2.823   1.00 20.54 ? 51  LEU A CA  1 
ATOM   363  C  C   . LEU A 1 51  ? -27.884 21.706 3.945   1.00 19.65 ? 51  LEU A C   1 
ATOM   364  O  O   . LEU A 1 51  ? -28.474 21.465 4.967   1.00 21.31 ? 51  LEU A O   1 
ATOM   365  C  CB  . LEU A 1 51  ? -29.212 21.411 1.823   1.00 19.43 ? 51  LEU A CB  1 
ATOM   366  C  CG  . LEU A 1 51  ? -30.021 20.254 2.424   1.00 18.68 ? 51  LEU A CG  1 
ATOM   367  C  CD1 . LEU A 1 51  ? -31.296 20.767 3.155   1.00 23.01 ? 51  LEU A CD1 1 
ATOM   368  C  CD2 . LEU A 1 51  ? -30.341 19.212 1.387   1.00 14.18 ? 51  LEU A CD2 1 
ATOM   369  N  N   . ILE A 1 52  ? -26.610 21.367 3.759   1.00 20.25 ? 52  ILE A N   1 
ATOM   370  C  CA  . ILE A 1 52  ? -25.879 20.691 4.838   1.00 19.62 ? 52  ILE A CA  1 
ATOM   371  C  C   . ILE A 1 52  ? -25.708 21.625 6.044   1.00 20.53 ? 52  ILE A C   1 
ATOM   372  O  O   . ILE A 1 52  ? -25.828 21.189 7.195   1.00 20.68 ? 52  ILE A O   1 
ATOM   373  C  CB  . ILE A 1 52  ? -24.556 20.123 4.362   1.00 19.05 ? 52  ILE A CB  1 
ATOM   374  C  CG1 . ILE A 1 52  ? -24.820 18.781 3.662   1.00 17.85 ? 52  ILE A CG1 1 
ATOM   375  C  CG2 . ILE A 1 52  ? -23.573 19.973 5.530   1.00 20.00 ? 52  ILE A CG2 1 
ATOM   376  C  CD1 . ILE A 1 52  ? -23.776 18.386 2.692   1.00 18.79 ? 52  ILE A CD1 1 
ATOM   377  N  N   . TYR A 1 53  ? -25.438 22.896 5.770   1.00 21.25 ? 53  TYR A N   1 
ATOM   378  C  CA  . TYR A 1 53  ? -25.291 23.904 6.840   1.00 23.28 ? 53  TYR A CA  1 
ATOM   379  C  C   . TYR A 1 53  ? -26.516 23.961 7.733   1.00 22.68 ? 53  TYR A C   1 
ATOM   380  O  O   . TYR A 1 53  ? -26.397 23.948 8.962   1.00 23.01 ? 53  TYR A O   1 
ATOM   381  C  CB  . TYR A 1 53  ? -25.058 25.278 6.240   1.00 23.92 ? 53  TYR A CB  1 
ATOM   382  C  CG  . TYR A 1 53  ? -23.614 25.581 5.959   1.00 27.51 ? 53  TYR A CG  1 
ATOM   383  C  CD1 . TYR A 1 53  ? -22.771 24.625 5.400   1.00 32.63 ? 53  TYR A CD1 1 
ATOM   384  C  CD2 . TYR A 1 53  ? -23.099 26.821 6.241   1.00 31.16 ? 53  TYR A CD2 1 
ATOM   385  C  CE1 . TYR A 1 53  ? -21.453 24.908 5.149   1.00 32.42 ? 53  TYR A CE1 1 
ATOM   386  C  CE2 . TYR A 1 53  ? -21.784 27.120 5.989   1.00 34.33 ? 53  TYR A CE2 1 
ATOM   387  C  CZ  . TYR A 1 53  ? -20.965 26.159 5.448   1.00 32.92 ? 53  TYR A CZ  1 
ATOM   388  O  OH  . TYR A 1 53  ? -19.656 26.475 5.211   1.00 32.73 ? 53  TYR A OH  1 
ATOM   389  N  N   . ARG A 1 54  ? -27.683 24.037 7.098   1.00 22.11 ? 54  ARG A N   1 
ATOM   390  C  CA  . ARG A 1 54  ? -28.971 24.122 7.763   1.00 21.25 ? 54  ARG A CA  1 
ATOM   391  C  C   . ARG A 1 54  ? -29.290 22.817 8.522   1.00 21.10 ? 54  ARG A C   1 
ATOM   392  O  O   . ARG A 1 54  ? -29.787 22.854 9.661   1.00 20.31 ? 54  ARG A O   1 
ATOM   393  C  CB  . ARG A 1 54  ? -30.066 24.437 6.715   1.00 22.86 ? 54  ARG A CB  1 
ATOM   394  C  CG  . ARG A 1 54  ? -31.491 24.757 7.265   1.00 23.93 ? 54  ARG A CG  1 
ATOM   395  C  CD  . ARG A 1 54  ? -31.475 26.047 8.114   1.00 27.32 ? 54  ARG A CD  1 
ATOM   396  N  NE  . ARG A 1 54  ? -32.755 26.259 8.772   1.00 27.71 ? 54  ARG A NE  1 
ATOM   397  C  CZ  . ARG A 1 54  ? -32.907 26.950 9.896   1.00 30.18 ? 54  ARG A CZ  1 
ATOM   398  N  NH1 . ARG A 1 54  ? -31.848 27.499 10.490  1.00 27.16 ? 54  ARG A NH1 1 
ATOM   399  N  NH2 . ARG A 1 54  ? -34.116 27.091 10.426  1.00 27.98 ? 54  ARG A NH2 1 
ATOM   400  N  N   . VAL A 1 55  ? -29.031 21.663 7.893   1.00 19.65 ? 55  VAL A N   1 
ATOM   401  C  CA  . VAL A 1 55  ? -29.255 20.389 8.586   1.00 19.48 ? 55  VAL A CA  1 
ATOM   402  C  C   . VAL A 1 55  ? -28.372 20.240 9.833   1.00 19.64 ? 55  VAL A C   1 
ATOM   403  O  O   . VAL A 1 55  ? -28.785 19.683 10.870  1.00 20.73 ? 55  VAL A O   1 
ATOM   404  C  CB  . VAL A 1 55  ? -29.081 19.146 7.651   1.00 18.55 ? 55  VAL A CB  1 
ATOM   405  C  CG1 . VAL A 1 55  ? -29.203 17.854 8.457   1.00 18.39 ? 55  VAL A CG1 1 
ATOM   406  C  CG2 . VAL A 1 55  ? -30.166 19.141 6.592   1.00 16.61 ? 55  VAL A CG2 1 
ATOM   407  N  N   . VAL A 1 56  ? -27.144 20.707 9.715   1.00 19.71 ? 56  VAL A N   1 
ATOM   408  C  CA  . VAL A 1 56  ? -26.206 20.669 10.825  1.00 20.28 ? 56  VAL A CA  1 
ATOM   409  C  C   . VAL A 1 56  ? -26.612 21.670 11.913  1.00 20.52 ? 56  VAL A C   1 
ATOM   410  O  O   . VAL A 1 56  ? -26.521 21.364 13.120  1.00 20.06 ? 56  VAL A O   1 
ATOM   411  C  CB  . VAL A 1 56  ? -24.766 20.897 10.304  1.00 20.47 ? 56  VAL A CB  1 
ATOM   412  C  CG1 . VAL A 1 56  ? -23.786 21.275 11.444  1.00 20.69 ? 56  VAL A CG1 1 
ATOM   413  C  CG2 . VAL A 1 56  ? -24.299 19.638 9.600   1.00 19.20 ? 56  VAL A CG2 1 
ATOM   414  N  N   . GLU A 1 57  ? -27.039 22.860 11.487  1.00 21.23 ? 57  GLU A N   1 
ATOM   415  C  CA  . GLU A 1 57  ? -27.492 23.904 12.423  1.00 22.65 ? 57  GLU A CA  1 
ATOM   416  C  C   . GLU A 1 57  ? -28.748 23.416 13.164  1.00 22.72 ? 57  GLU A C   1 
ATOM   417  O  O   . GLU A 1 57  ? -28.882 23.630 14.368  1.00 22.07 ? 57  GLU A O   1 
ATOM   418  C  CB  . GLU A 1 57  ? -27.741 25.219 11.695  1.00 23.38 ? 57  GLU A CB  1 
ATOM   419  C  CG  . GLU A 1 57  ? -26.481 25.991 11.340  1.00 27.37 ? 57  GLU A CG  1 
ATOM   420  C  CD  . GLU A 1 57  ? -26.630 26.761 10.026  1.00 32.96 ? 57  GLU A CD  1 
ATOM   421  O  OE1 . GLU A 1 57  ? -27.787 27.135 9.696   1.00 35.04 ? 57  GLU A OE1 1 
ATOM   422  O  OE2 . GLU A 1 57  ? -25.603 26.946 9.310   1.00 34.01 ? 57  GLU A OE2 1 
ATOM   423  N  N   . LEU A 1 58  ? -29.614 22.694 12.453  1.00 21.70 ? 58  LEU A N   1 
ATOM   424  C  CA  . LEU A 1 58  ? -30.794 22.042 13.087  1.00 22.96 ? 58  LEU A CA  1 
ATOM   425  C  C   . LEU A 1 58  ? -30.544 20.830 13.982  1.00 23.24 ? 58  LEU A C   1 
ATOM   426  O  O   . LEU A 1 58  ? -31.337 20.560 14.884  1.00 24.40 ? 58  LEU A O   1 
ATOM   427  C  CB  . LEU A 1 58  ? -31.812 21.627 12.028  1.00 21.54 ? 58  LEU A CB  1 
ATOM   428  C  CG  . LEU A 1 58  ? -32.534 22.701 11.237  1.00 23.18 ? 58  LEU A CG  1 
ATOM   429  C  CD1 . LEU A 1 58  ? -33.441 22.011 10.246  1.00 22.36 ? 58  LEU A CD1 1 
ATOM   430  C  CD2 . LEU A 1 58  ? -33.280 23.631 12.142  1.00 21.89 ? 58  LEU A CD2 1 
ATOM   431  N  N   . THR A 1 59  ? -29.477 20.075 13.717  1.00 23.70 ? 59  THR A N   1 
ATOM   432  C  CA  . THR A 1 59  ? -29.255 18.769 14.373  1.00 22.78 ? 59  THR A CA  1 
ATOM   433  C  C   . THR A 1 59  ? -28.102 18.728 15.367  1.00 22.38 ? 59  THR A C   1 
ATOM   434  O  O   . THR A 1 59  ? -28.134 17.959 16.329  1.00 22.28 ? 59  THR A O   1 
ATOM   435  C  CB  . THR A 1 59  ? -29.010 17.640 13.328  1.00 22.48 ? 59  THR A CB  1 
ATOM   436  O  OG1 . THR A 1 59  ? -27.906 18.002 12.491  1.00 24.16 ? 59  THR A OG1 1 
ATOM   437  C  CG2 . THR A 1 59  ? -30.243 17.438 12.419  1.00 21.70 ? 59  THR A CG2 1 
ATOM   438  N  N   . GLY A 1 60  ? -27.075 19.531 15.116  1.00 22.59 ? 60  GLY A N   1 
ATOM   439  C  CA  . GLY A 1 60  ? -25.791 19.383 15.818  1.00 22.15 ? 60  GLY A CA  1 
ATOM   440  C  C   . GLY A 1 60  ? -24.999 18.179 15.305  1.00 21.56 ? 60  GLY A C   1 
ATOM   441  O  O   . GLY A 1 60  ? -24.101 17.679 15.973  1.00 19.75 ? 60  GLY A O   1 
ATOM   442  N  N   . GLY A 1 61  ? -25.365 17.685 14.114  1.00 22.49 ? 61  GLY A N   1 
ATOM   443  C  CA  . GLY A 1 61  ? -24.611 16.632 13.445  1.00 21.75 ? 61  GLY A CA  1 
ATOM   444  C  C   . GLY A 1 61  ? -23.242 17.163 13.076  1.00 21.39 ? 61  GLY A C   1 
ATOM   445  O  O   . GLY A 1 61  ? -23.063 18.370 13.032  1.00 21.15 ? 61  GLY A O   1 
ATOM   446  N  N   . SER A 1 62  ? -22.259 16.274 12.885  1.00 20.88 ? 62  SER A N   1 
ATOM   447  C  CA  . SER A 1 62  ? -20.978 16.683 12.313  1.00 19.51 ? 62  SER A CA  1 
ATOM   448  C  C   . SER A 1 62  ? -21.200 17.019 10.822  1.00 18.98 ? 62  SER A C   1 
ATOM   449  O  O   . SER A 1 62  ? -22.230 16.638 10.228  1.00 18.74 ? 62  SER A O   1 
ATOM   450  C  CB  . SER A 1 62  ? -19.904 15.594 12.431  1.00 20.05 ? 62  SER A CB  1 
ATOM   451  O  OG  . SER A 1 62  ? -19.662 15.150 13.752  1.00 19.61 ? 62  SER A OG  1 
ATOM   452  N  N   . LEU A 1 63  ? -20.239 17.747 10.255  1.00 18.12 ? 63  LEU A N   1 
ATOM   453  C  CA  . LEU A 1 63  ? -20.281 18.268 8.897   1.00 17.36 ? 63  LEU A CA  1 
ATOM   454  C  C   . LEU A 1 63  ? -18.966 17.957 8.207   1.00 17.23 ? 63  LEU A C   1 
ATOM   455  O  O   . LEU A 1 63  ? -17.894 18.015 8.823   1.00 18.14 ? 63  LEU A O   1 
ATOM   456  C  CB  . LEU A 1 63  ? -20.485 19.799 8.938   1.00 17.69 ? 63  LEU A CB  1 
ATOM   457  C  CG  . LEU A 1 63  ? -20.323 20.719 7.718   1.00 17.70 ? 63  LEU A CG  1 
ATOM   458  C  CD1 . LEU A 1 63  ? -21.170 22.003 7.845   1.00 16.41 ? 63  LEU A CD1 1 
ATOM   459  C  CD2 . LEU A 1 63  ? -18.856 21.062 7.406   1.00 17.30 ? 63  LEU A CD2 1 
ATOM   460  N  N   . TYR A 1 64  ? -19.048 17.634 6.916   1.00 16.11 ? 64  TYR A N   1 
ATOM   461  C  CA  . TYR A 1 64  ? -17.861 17.583 6.061   1.00 15.78 ? 64  TYR A CA  1 
ATOM   462  C  C   . TYR A 1 64  ? -18.311 18.031 4.706   1.00 14.61 ? 64  TYR A C   1 
ATOM   463  O  O   . TYR A 1 64  ? -19.363 17.574 4.267   1.00 15.18 ? 64  TYR A O   1 
ATOM   464  C  CB  . TYR A 1 64  ? -17.326 16.165 5.943   1.00 14.61 ? 64  TYR A CB  1 
ATOM   465  C  CG  . TYR A 1 64  ? -16.260 16.037 4.873   1.00 18.60 ? 64  TYR A CG  1 
ATOM   466  C  CD1 . TYR A 1 64  ? -16.612 15.806 3.532   1.00 19.20 ? 64  TYR A CD1 1 
ATOM   467  C  CD2 . TYR A 1 64  ? -14.924 16.146 5.188   1.00 15.38 ? 64  TYR A CD2 1 
ATOM   468  C  CE1 . TYR A 1 64  ? -15.669 15.688 2.571   1.00 22.03 ? 64  TYR A CE1 1 
ATOM   469  C  CE2 . TYR A 1 64  ? -13.958 16.013 4.219   1.00 15.64 ? 64  TYR A CE2 1 
ATOM   470  C  CZ  . TYR A 1 64  ? -14.339 15.798 2.923   1.00 18.00 ? 64  TYR A CZ  1 
ATOM   471  O  OH  . TYR A 1 64  ? -13.407 15.694 1.945   1.00 19.85 ? 64  TYR A OH  1 
ATOM   472  N  N   . LEU A 1 65  ? -17.523 18.893 4.050   1.00 15.02 ? 65  LEU A N   1 
ATOM   473  C  CA  . LEU A 1 65  ? -17.818 19.367 2.678   1.00 15.98 ? 65  LEU A CA  1 
ATOM   474  C  C   . LEU A 1 65  ? -16.570 19.476 1.829   1.00 16.28 ? 65  LEU A C   1 
ATOM   475  O  O   . LEU A 1 65  ? -15.655 20.228 2.171   1.00 17.65 ? 65  LEU A O   1 
ATOM   476  C  CB  . LEU A 1 65  ? -18.413 20.770 2.730   1.00 15.93 ? 65  LEU A CB  1 
ATOM   477  C  CG  . LEU A 1 65  ? -19.686 21.080 3.457   1.00 16.25 ? 65  LEU A CG  1 
ATOM   478  C  CD1 . LEU A 1 65  ? -19.841 22.567 3.427   1.00 19.07 ? 65  LEU A CD1 1 
ATOM   479  C  CD2 . LEU A 1 65  ? -20.880 20.387 2.760   1.00 14.40 ? 65  LEU A CD2 1 
ATOM   480  N  N   . PHE A 1 66  ? -16.519 18.747 0.723   1.00 16.75 ? 66  PHE A N   1 
ATOM   481  C  CA  . PHE A 1 66  ? -15.456 18.957 -0.278  1.00 17.10 ? 66  PHE A CA  1 
ATOM   482  C  C   . PHE A 1 66  ? -16.077 19.848 -1.313  1.00 18.10 ? 66  PHE A C   1 
ATOM   483  O  O   . PHE A 1 66  ? -17.026 19.434 -1.987  1.00 18.04 ? 66  PHE A O   1 
ATOM   484  C  CB  . PHE A 1 66  ? -14.984 17.625 -0.906  1.00 16.15 ? 66  PHE A CB  1 
ATOM   485  C  CG  . PHE A 1 66  ? -13.832 17.776 -1.865  1.00 16.45 ? 66  PHE A CG  1 
ATOM   486  C  CD1 . PHE A 1 66  ? -14.079 18.016 -3.231  1.00 18.73 ? 66  PHE A CD1 1 
ATOM   487  C  CD2 . PHE A 1 66  ? -12.510 17.643 -1.440  1.00 16.89 ? 66  PHE A CD2 1 
ATOM   488  C  CE1 . PHE A 1 66  ? -13.026 18.176 -4.135  1.00 17.86 ? 66  PHE A CE1 1 
ATOM   489  C  CE2 . PHE A 1 66  ? -11.459 17.794 -2.342  1.00 18.87 ? 66  PHE A CE2 1 
ATOM   490  C  CZ  . PHE A 1 66  ? -11.721 18.056 -3.696  1.00 18.96 ? 66  PHE A CZ  1 
ATOM   491  N  N   . GLN A 1 67  ? -15.584 21.091 -1.393  1.00 19.52 ? 67  GLN A N   1 
ATOM   492  C  CA  . GLN A 1 67  ? -16.302 22.161 -2.116  1.00 20.17 ? 67  GLN A CA  1 
ATOM   493  C  C   . GLN A 1 67  ? -15.557 22.621 -3.357  1.00 20.42 ? 67  GLN A C   1 
ATOM   494  O  O   . GLN A 1 67  ? -14.376 22.944 -3.255  1.00 18.93 ? 67  GLN A O   1 
ATOM   495  C  CB  . GLN A 1 67  ? -16.467 23.395 -1.201  1.00 21.20 ? 67  GLN A CB  1 
ATOM   496  C  CG  . GLN A 1 67  ? -17.409 23.239 0.010   1.00 21.53 ? 67  GLN A CG  1 
ATOM   497  C  CD  . GLN A 1 67  ? -17.894 24.593 0.535   1.00 22.48 ? 67  GLN A CD  1 
ATOM   498  O  OE1 . GLN A 1 67  ? -19.066 24.927 0.405   1.00 24.68 ? 67  GLN A OE1 1 
ATOM   499  N  NE2 . GLN A 1 67  ? -16.984 25.397 1.051   1.00 20.99 ? 67  GLN A NE2 1 
ATOM   500  N  N   . GLY A 1 68  ? -16.252 22.667 -4.507  1.00 20.28 ? 68  GLY A N   1 
ATOM   501  C  CA  . GLY A 1 68  ? -15.768 23.416 -5.675  1.00 21.23 ? 68  GLY A CA  1 
ATOM   502  C  C   . GLY A 1 68  ? -15.911 24.922 -5.500  1.00 21.84 ? 68  GLY A C   1 
ATOM   503  O  O   . GLY A 1 68  ? -16.933 25.398 -4.997  1.00 22.08 ? 68  GLY A O   1 
ATOM   504  N  N   . LEU A 1 69  ? -14.891 25.663 -5.918  1.00 22.50 ? 69  LEU A N   1 
ATOM   505  C  CA  . LEU A 1 69  ? -14.812 27.121 -5.740  1.00 23.19 ? 69  LEU A CA  1 
ATOM   506  C  C   . LEU A 1 69  ? -14.720 27.905 -7.034  1.00 23.37 ? 69  LEU A C   1 
ATOM   507  O  O   . LEU A 1 69  ? -14.701 29.151 -7.016  1.00 23.55 ? 69  LEU A O   1 
ATOM   508  C  CB  . LEU A 1 69  ? -13.585 27.508 -4.900  1.00 23.78 ? 69  LEU A CB  1 
ATOM   509  C  CG  . LEU A 1 69  ? -13.387 26.869 -3.523  1.00 24.06 ? 69  LEU A CG  1 
ATOM   510  C  CD1 . LEU A 1 69  ? -12.172 27.460 -2.810  1.00 23.56 ? 69  LEU A CD1 1 
ATOM   511  C  CD2 . LEU A 1 69  ? -14.618 27.089 -2.717  1.00 24.26 ? 69  LEU A CD2 1 
ATOM   512  N  N   . LEU A 1 70  ? -14.674 27.194 -8.149  1.00 23.71 ? 70  LEU A N   1 
ATOM   513  C  CA  . LEU A 1 70  ? -14.464 27.848 -9.417  1.00 24.31 ? 70  LEU A CA  1 
ATOM   514  C  C   . LEU A 1 70  ? -15.735 28.592 -9.744  1.00 25.31 ? 70  LEU A C   1 
ATOM   515  O  O   . LEU A 1 70  ? -16.826 28.166 -9.372  1.00 24.64 ? 70  LEU A O   1 
ATOM   516  C  CB  . LEU A 1 70  ? -14.092 26.857 -10.525 1.00 24.14 ? 70  LEU A CB  1 
ATOM   517  C  CG  . LEU A 1 70  ? -12.786 26.104 -10.257 1.00 23.00 ? 70  LEU A CG  1 
ATOM   518  C  CD1 . LEU A 1 70  ? -12.852 24.666 -10.779 1.00 26.56 ? 70  LEU A CD1 1 
ATOM   519  C  CD2 . LEU A 1 70  ? -11.595 26.853 -10.818 1.00 22.26 ? 70  LEU A CD2 1 
ATOM   520  N  N   . PRO A 1 71  ? -15.600 29.747 -10.382 1.00 26.37 ? 71  PRO A N   1 
ATOM   521  C  CA  . PRO A 1 71  ? -16.826 30.412 -10.805 1.00 27.23 ? 71  PRO A CA  1 
ATOM   522  C  C   . PRO A 1 71  ? -17.622 29.571 -11.848 1.00 27.44 ? 71  PRO A C   1 
ATOM   523  O  O   . PRO A 1 71  ? -18.862 29.737 -11.988 1.00 27.57 ? 71  PRO A O   1 
ATOM   524  C  CB  . PRO A 1 71  ? -16.306 31.730 -11.403 1.00 28.08 ? 71  PRO A CB  1 
ATOM   525  C  CG  . PRO A 1 71  ? -14.919 31.910 -10.804 1.00 28.57 ? 71  PRO A CG  1 
ATOM   526  C  CD  . PRO A 1 71  ? -14.399 30.507 -10.750 1.00 26.99 ? 71  PRO A CD  1 
ATOM   527  N  N   . SER A 1 72  ? -16.933 28.666 -12.559 1.00 25.88 ? 72  SER A N   1 
ATOM   528  C  CA  . SER A 1 72  ? -17.601 27.763 -13.525 1.00 24.97 ? 72  SER A CA  1 
ATOM   529  C  C   . SER A 1 72  ? -16.752 26.537 -13.809 1.00 25.02 ? 72  SER A C   1 
ATOM   530  O  O   . SER A 1 72  ? -15.516 26.574 -13.673 0.50 24.40 ? 72  SER A O   1 
ATOM   531  C  CB  . SER A 1 72  ? -17.902 28.492 -14.852 1.00 25.44 ? 72  SER A CB  1 
ATOM   532  O  OG  . SER A 1 72  ? -16.701 28.792 -15.583 1.00 26.05 ? 72  SER A OG  1 
ATOM   533  N  N   . GLY A 1 73  ? -17.408 25.447 -14.201 1.00 23.70 ? 73  GLY A N   1 
ATOM   534  C  CA  . GLY A 1 73  ? -16.687 24.237 -14.565 1.00 24.71 ? 73  GLY A CA  1 
ATOM   535  C  C   . GLY A 1 73  ? -16.113 23.459 -13.393 1.00 24.54 ? 73  GLY A C   1 
ATOM   536  O  O   . GLY A 1 73  ? -15.026 22.864 -13.486 1.00 24.86 ? 73  GLY A O   1 
ATOM   537  N  N   . ASN A 1 74  ? -16.856 23.453 -12.295 1.00 25.37 ? 74  ASN A N   1 
ATOM   538  C  CA  . ASN A 1 74  ? -16.521 22.655 -11.111 1.00 25.42 ? 74  ASN A CA  1 
ATOM   539  C  C   . ASN A 1 74  ? -16.782 21.174 -11.344 1.00 25.05 ? 74  ASN A C   1 
ATOM   540  O  O   . ASN A 1 74  ? -16.427 20.336 -10.511 1.00 23.99 ? 74  ASN A O   1 
ATOM   541  C  CB  . ASN A 1 74  ? -17.291 23.145 -9.884  1.00 25.51 ? 74  ASN A CB  1 
ATOM   542  C  CG  . ASN A 1 74  ? -16.729 24.444 -9.318  1.00 26.61 ? 74  ASN A CG  1 
ATOM   543  O  OD1 . ASN A 1 74  ? -15.770 24.444 -8.550  1.00 24.93 ? 74  ASN A OD1 1 
ATOM   544  N  ND2 . ASN A 1 74  ? -17.345 25.563 -9.693  1.00 27.96 ? 74  ASN A ND2 1 
ATOM   545  N  N   . SER A 1 75  ? -17.401 20.826 -12.482 1.00 24.46 ? 75  SER A N   1 
ATOM   546  C  CA  . SER A 1 75  ? -17.649 19.415 -12.760 1.00 24.49 ? 75  SER A CA  1 
ATOM   547  C  C   . SER A 1 75  ? -16.362 18.619 -12.875 1.00 24.04 ? 75  SER A C   1 
ATOM   548  O  O   . SER A 1 75  ? -16.370 17.406 -12.688 1.00 23.97 ? 75  SER A O   1 
ATOM   549  C  CB  . SER A 1 75  ? -18.492 19.212 -14.018 1.00 24.35 ? 75  SER A CB  1 
ATOM   550  O  OG  . SER A 1 75  ? -17.843 19.831 -15.091 1.00 27.20 ? 75  SER A OG  1 
ATOM   551  N  N   . ARG A 1 76  ? -15.265 19.297 -13.202 1.00 22.66 ? 76  ARG A N   1 
ATOM   552  C  CA  . ARG A 1 76  ? -13.949 18.649 -13.272 1.00 23.02 ? 76  ARG A CA  1 
ATOM   553  C  C   . ARG A 1 76  ? -13.438 18.248 -11.886 1.00 23.36 ? 76  ARG A C   1 
ATOM   554  O  O   . ARG A 1 76  ? -12.522 17.441 -11.757 1.00 23.19 ? 76  ARG A O   1 
ATOM   555  C  CB  . ARG A 1 76  ? -12.919 19.523 -14.027 1.00 22.53 ? 76  ARG A CB  1 
ATOM   556  C  CG  . ARG A 1 76  ? -12.277 20.652 -13.282 1.00 22.91 ? 76  ARG A CG  1 
ATOM   557  C  CD  . ARG A 1 76  ? -11.073 21.191 -14.080 1.00 23.32 ? 76  ARG A CD  1 
ATOM   558  N  NE  . ARG A 1 76  ? -10.282 22.156 -13.308 1.00 24.69 ? 76  ARG A NE  1 
ATOM   559  C  CZ  . ARG A 1 76  ? -10.394 23.487 -13.402 1.00 26.85 ? 76  ARG A CZ  1 
ATOM   560  N  NH1 . ARG A 1 76  ? -11.266 24.045 -14.242 1.00 26.00 ? 76  ARG A NH1 1 
ATOM   561  N  NH2 . ARG A 1 76  ? -9.612  24.273 -12.659 1.00 26.79 ? 76  ARG A NH2 1 
ATOM   562  N  N   . LEU A 1 77  ? -14.055 18.827 -10.852 1.00 23.70 ? 77  LEU A N   1 
ATOM   563  C  CA  . LEU A 1 77  ? -13.682 18.520 -9.485  1.00 23.70 ? 77  LEU A CA  1 
ATOM   564  C  C   . LEU A 1 77  ? -14.541 17.360 -8.944  1.00 24.12 ? 77  LEU A C   1 
ATOM   565  O  O   . LEU A 1 77  ? -14.444 16.978 -7.757  1.00 23.03 ? 77  LEU A O   1 
ATOM   566  C  CB  . LEU A 1 77  ? -13.830 19.773 -8.629  1.00 23.51 ? 77  LEU A CB  1 
ATOM   567  C  CG  . LEU A 1 77  ? -13.087 21.012 -9.106  1.00 24.95 ? 77  LEU A CG  1 
ATOM   568  C  CD1 . LEU A 1 77  ? -13.607 22.219 -8.356  1.00 27.01 ? 77  LEU A CD1 1 
ATOM   569  C  CD2 . LEU A 1 77  ? -11.562 20.858 -8.930  1.00 22.13 ? 77  LEU A CD2 1 
ATOM   570  N  N   . HIS A 1 78  ? -15.363 16.790 -9.828  1.00 24.11 ? 78  HIS A N   1 
ATOM   571  C  CA  . HIS A 1 78  ? -16.265 15.710 -9.451  1.00 24.88 ? 78  HIS A CA  1 
ATOM   572  C  C   . HIS A 1 78  ? -15.551 14.379 -9.450  1.00 25.21 ? 78  HIS A C   1 
ATOM   573  O  O   . HIS A 1 78  ? -15.072 13.924 -10.494 1.00 25.89 ? 78  HIS A O   1 
ATOM   574  C  CB  . HIS A 1 78  ? -17.511 15.683 -10.357 1.00 24.13 ? 78  HIS A CB  1 
ATOM   575  C  CG  . HIS A 1 78  ? -18.476 14.584 -10.030 1.00 25.98 ? 78  HIS A CG  1 
ATOM   576  N  ND1 . HIS A 1 78  ? -18.404 13.333 -10.610 1.00 25.85 ? 78  HIS A ND1 1 
ATOM   577  C  CD2 . HIS A 1 78  ? -19.544 14.551 -9.199  1.00 27.41 ? 78  HIS A CD2 1 
ATOM   578  C  CE1 . HIS A 1 78  ? -19.377 12.575 -10.143 1.00 28.10 ? 78  HIS A CE1 1 
ATOM   579  N  NE2 . HIS A 1 78  ? -20.087 13.291 -9.287  1.00 28.62 ? 78  HIS A NE2 1 
ATOM   580  N  N   . VAL A 1 79  ? -15.478 13.767 -8.265  1.00 24.24 ? 79  VAL A N   1 
ATOM   581  C  CA  . VAL A 1 79  ? -15.049 12.395 -8.131  1.00 24.04 ? 79  VAL A CA  1 
ATOM   582  C  C   . VAL A 1 79  ? -16.223 11.598 -7.559  1.00 23.79 ? 79  VAL A C   1 
ATOM   583  O  O   . VAL A 1 79  ? -16.657 11.790 -6.416  1.00 22.98 ? 79  VAL A O   1 
ATOM   584  C  CB  . VAL A 1 79  ? -13.718 12.270 -7.334  1.00 24.42 ? 79  VAL A CB  1 
ATOM   585  C  CG1 . VAL A 1 79  ? -13.389 10.833 -7.014  1.00 23.12 ? 79  VAL A CG1 1 
ATOM   586  C  CG2 . VAL A 1 79  ? -12.540 12.878 -8.173  1.00 25.32 ? 79  VAL A CG2 1 
ATOM   587  N  N   . THR A 1 80  ? -16.771 10.729 -8.390  1.00 22.74 ? 80  THR A N   1 
ATOM   588  C  CA  . THR A 1 80  ? -17.906 9.932  -7.990  1.00 22.75 ? 80  THR A CA  1 
ATOM   589  C  C   . THR A 1 80  ? -17.726 9.301  -6.592  1.00 21.76 ? 80  THR A C   1 
ATOM   590  O  O   . THR A 1 80  ? -16.605 8.949  -6.203  1.00 21.02 ? 80  THR A O   1 
ATOM   591  C  CB  . THR A 1 80  ? -18.179 8.863  -9.048  1.00 23.22 ? 80  THR A CB  1 
ATOM   592  O  OG1 . THR A 1 80  ? -19.552 8.459  -8.971  1.00 23.02 ? 80  THR A OG1 1 
ATOM   593  C  CG2 . THR A 1 80  ? -17.219 7.673  -8.881  1.00 25.03 ? 80  THR A CG2 1 
ATOM   594  N  N   . SER A 1 81  ? -18.826 9.160  -5.848  1.00 21.74 ? 81  SER A N   1 
ATOM   595  C  CA  . SER A 1 81  ? -18.800 8.655  -4.444  1.00 20.77 ? 81  SER A CA  1 
ATOM   596  C  C   . SER A 1 81  ? -18.161 7.283  -4.222  1.00 21.80 ? 81  SER A C   1 
ATOM   597  O  O   . SER A 1 81  ? -17.540 7.038  -3.175  1.00 21.82 ? 81  SER A O   1 
ATOM   598  C  CB  . SER A 1 81  ? -20.211 8.637  -3.830  1.00 21.03 ? 81  SER A CB  1 
ATOM   599  O  OG  . SER A 1 81  ? -20.951 9.792  -4.170  1.00 18.58 ? 81  SER A OG  1 
ATOM   600  N  N   . THR A 1 82  ? -18.320 6.365  -5.180  1.00 21.28 ? 82  THR A N   1 
ATOM   601  C  CA  . THR A 1 82  ? -17.631 5.082  -5.061  1.00 21.92 ? 82  THR A CA  1 
ATOM   602  C  C   . THR A 1 82  ? -16.084 5.197  -5.140  1.00 21.53 ? 82  THR A C   1 
ATOM   603  O  O   . THR A 1 82  ? -15.401 4.231  -4.844  1.00 21.03 ? 82  THR A O   1 
ATOM   604  C  CB  . THR A 1 82  ? -18.055 4.114  -6.163  1.00 21.39 ? 82  THR A CB  1 
ATOM   605  O  OG1 . THR A 1 82  ? -17.750 4.715  -7.422  1.00 23.73 ? 82  THR A OG1 1 
ATOM   606  C  CG2 . THR A 1 82  ? -19.554 3.770  -6.073  1.00 22.37 ? 82  THR A CG2 1 
ATOM   607  N  N   . HIS A 1 83  ? -15.559 6.346  -5.575  1.00 22.16 ? 83  HIS A N   1 
ATOM   608  C  CA  . HIS A 1 83  ? -14.109 6.543  -5.834  1.00 23.68 ? 83  HIS A CA  1 
ATOM   609  C  C   . HIS A 1 83  ? -13.542 7.626  -4.923  1.00 23.20 ? 83  HIS A C   1 
ATOM   610  O  O   . HIS A 1 83  ? -12.341 7.947  -4.949  1.00 22.44 ? 83  HIS A O   1 
ATOM   611  C  CB  . HIS A 1 83  ? -13.865 6.936  -7.298  1.00 24.16 ? 83  HIS A CB  1 
ATOM   612  C  CG  . HIS A 1 83  ? -14.195 5.851  -8.269  1.00 27.19 ? 83  HIS A CG  1 
ATOM   613  N  ND1 . HIS A 1 83  ? -13.894 5.935  -9.607  1.00 31.03 ? 83  HIS A ND1 1 
ATOM   614  C  CD2 . HIS A 1 83  ? -14.770 4.639  -8.089  1.00 30.41 ? 83  HIS A CD2 1 
ATOM   615  C  CE1 . HIS A 1 83  ? -14.276 4.827  -10.213 1.00 30.69 ? 83  HIS A CE1 1 
ATOM   616  N  NE2 . HIS A 1 83  ? -14.808 4.021  -9.312  1.00 31.81 ? 83  HIS A NE2 1 
ATOM   617  N  N   . PHE A 1 84  ? -14.427 8.163  -4.100  1.00 23.08 ? 84  PHE A N   1 
ATOM   618  C  CA  . PHE A 1 84  ? -14.105 9.371  -3.367  1.00 22.82 ? 84  PHE A CA  1 
ATOM   619  C  C   . PHE A 1 84  ? -13.396 8.950  -2.125  1.00 22.15 ? 84  PHE A C   1 
ATOM   620  O  O   . PHE A 1 84  ? -13.931 8.229  -1.272  1.00 20.28 ? 84  PHE A O   1 
ATOM   621  C  CB  . PHE A 1 84  ? -15.342 10.210 -3.064  1.00 22.72 ? 84  PHE A CB  1 
ATOM   622  C  CG  . PHE A 1 84  ? -15.026 11.520 -2.371  1.00 20.19 ? 84  PHE A CG  1 
ATOM   623  C  CD1 . PHE A 1 84  ? -14.926 11.575 -0.990  1.00 21.03 ? 84  PHE A CD1 1 
ATOM   624  C  CD2 . PHE A 1 84  ? -14.834 12.678 -3.104  1.00 20.76 ? 84  PHE A CD2 1 
ATOM   625  C  CE1 . PHE A 1 84  ? -14.649 12.756 -0.351  1.00 20.98 ? 84  PHE A CE1 1 
ATOM   626  C  CE2 . PHE A 1 84  ? -14.547 13.869 -2.471  1.00 21.33 ? 84  PHE A CE2 1 
ATOM   627  C  CZ  . PHE A 1 84  ? -14.477 13.913 -1.104  1.00 23.80 ? 84  PHE A CZ  1 
ATOM   628  N  N   . ASP A 1 85  ? -12.164 9.410  -2.051  1.00 22.17 ? 85  ASP A N   1 
ATOM   629  C  CA  . ASP A 1 85  ? -11.236 8.883  -1.072  1.00 22.68 ? 85  ASP A CA  1 
ATOM   630  C  C   . ASP A 1 85  ? -10.469 9.984  -0.324  1.00 22.38 ? 85  ASP A C   1 
ATOM   631  O  O   . ASP A 1 85  ? -9.427  9.723  0.237   1.00 23.15 ? 85  ASP A O   1 
ATOM   632  C  CB  . ASP A 1 85  ? -10.284 7.864  -1.748  1.00 23.09 ? 85  ASP A CB  1 
ATOM   633  C  CG  . ASP A 1 85  ? -9.224  8.516  -2.636  1.00 23.75 ? 85  ASP A CG  1 
ATOM   634  O  OD1 . ASP A 1 85  ? -9.470  9.592  -3.177  1.00 27.29 ? 85  ASP A OD1 1 
ATOM   635  O  OD2 . ASP A 1 85  ? -8.141  7.915  -2.816  1.00 26.34 ? 85  ASP A OD2 1 
ATOM   636  N  N   . GLU A 1 86  ? -11.005 11.200 -0.284  1.00 22.73 ? 86  GLU A N   1 
ATOM   637  C  CA  . GLU A 1 86  ? -10.314 12.273 0.422   1.00 21.50 ? 86  GLU A CA  1 
ATOM   638  C  C   . GLU A 1 86  ? -10.015 11.763 1.846   1.00 20.87 ? 86  GLU A C   1 
ATOM   639  O  O   . GLU A 1 86  ? -10.931 11.321 2.563   1.00 20.39 ? 86  GLU A O   1 
ATOM   640  C  CB  . GLU A 1 86  ? -11.160 13.540 0.397   1.00 21.08 ? 86  GLU A CB  1 
ATOM   641  C  CG  . GLU A 1 86  ? -10.442 14.820 0.784   1.00 21.24 ? 86  GLU A CG  1 
ATOM   642  C  CD  . GLU A 1 86  ? -10.285 14.912 2.267   1.00 18.96 ? 86  GLU A CD  1 
ATOM   643  O  OE1 . GLU A 1 86  ? -11.318 14.813 2.960   1.00 17.28 ? 86  GLU A OE1 1 
ATOM   644  O  OE2 . GLU A 1 86  ? -9.123  14.975 2.732   1.00 18.41 ? 86  GLU A OE2 1 
ATOM   645  N  N   . PRO A 1 87  ? -8.738  11.789 2.260   1.00 20.36 ? 87  PRO A N   1 
ATOM   646  C  CA  . PRO A 1 87  ? -8.439  11.108 3.512   1.00 20.22 ? 87  PRO A CA  1 
ATOM   647  C  C   . PRO A 1 87  ? -9.162  11.653 4.756   1.00 19.92 ? 87  PRO A C   1 
ATOM   648  O  O   . PRO A 1 87  ? -9.482  10.888 5.667   1.00 19.78 ? 87  PRO A O   1 
ATOM   649  C  CB  . PRO A 1 87  ? -6.910  11.264 3.639   1.00 19.76 ? 87  PRO A CB  1 
ATOM   650  C  CG  . PRO A 1 87  ? -6.564  12.364 2.756   1.00 20.15 ? 87  PRO A CG  1 
ATOM   651  C  CD  . PRO A 1 87  ? -7.496  12.179 1.584   1.00 21.03 ? 87  PRO A CD  1 
ATOM   652  N  N   . MET A 1 88  ? -9.447  12.950 4.787   1.00 19.36 ? 88  MET A N   1 
ATOM   653  C  CA  . MET A 1 88  ? -10.094 13.482 5.972   1.00 19.28 ? 88  MET A CA  1 
ATOM   654  C  C   . MET A 1 88  ? -11.541 13.003 6.064   1.00 19.10 ? 88  MET A C   1 
ATOM   655  O  O   . MET A 1 88  ? -11.989 12.646 7.153   1.00 18.56 ? 88  MET A O   1 
ATOM   656  C  CB  . MET A 1 88  ? -9.947  14.988 6.054   1.00 18.80 ? 88  MET A CB  1 
ATOM   657  C  CG  . MET A 1 88  ? -8.540  15.412 6.331   1.00 18.15 ? 88  MET A CG  1 
ATOM   658  S  SD  . MET A 1 88  ? -8.542  17.127 6.824   1.00 21.09 ? 88  MET A SD  1 
ATOM   659  C  CE  . MET A 1 88  ? -9.088  17.871 5.279   1.00 21.51 ? 88  MET A CE  1 
ATOM   660  N  N   . ALA A 1 89  ? -12.232 12.980 4.914   1.00 17.66 ? 89  ALA A N   1 
ATOM   661  C  CA  . ALA A 1 89  ? -13.553 12.391 4.739   1.00 17.86 ? 89  ALA A CA  1 
ATOM   662  C  C   . ALA A 1 89  ? -13.637 10.946 5.269   1.00 18.37 ? 89  ALA A C   1 
ATOM   663  O  O   . ALA A 1 89  ? -14.469 10.643 6.111   1.00 18.29 ? 89  ALA A O   1 
ATOM   664  C  CB  . ALA A 1 89  ? -13.954 12.430 3.251   1.00 17.18 ? 89  ALA A CB  1 
ATOM   665  N  N   . VAL A 1 90  ? -12.742 10.091 4.782   1.00 17.28 ? 90  VAL A N   1 
ATOM   666  C  CA  . VAL A 1 90  ? -12.645 8.692  5.177   1.00 18.66 ? 90  VAL A CA  1 
ATOM   667  C  C   . VAL A 1 90  ? -12.373 8.539  6.671   1.00 17.82 ? 90  VAL A C   1 
ATOM   668  O  O   . VAL A 1 90  ? -12.889 7.618  7.306   1.00 18.51 ? 90  VAL A O   1 
ATOM   669  C  CB  . VAL A 1 90  ? -11.505 7.990  4.407   1.00 18.40 ? 90  VAL A CB  1 
ATOM   670  C  CG1 . VAL A 1 90  ? -11.406 6.525  4.767   1.00 19.52 ? 90  VAL A CG1 1 
ATOM   671  C  CG2 . VAL A 1 90  ? -11.680 8.169  2.893   1.00 19.55 ? 90  VAL A CG2 1 
ATOM   672  N  N   . CYS A 1 91  ? -11.546 9.419  7.221   1.00 18.30 ? 91  CYS A N   1 
ATOM   673  C  CA  . CYS A 1 91  ? -11.315 9.404  8.652   1.00 19.44 ? 91  CYS A CA  1 
ATOM   674  C  C   . CYS A 1 91  ? -12.637 9.790  9.354   1.00 18.85 ? 91  CYS A C   1 
ATOM   675  O  O   . CYS A 1 91  ? -13.101 9.096  10.240  1.00 20.37 ? 91  CYS A O   1 
ATOM   676  C  CB  . CYS A 1 91  ? -10.138 10.311 9.010   1.00 18.37 ? 91  CYS A CB  1 
ATOM   677  S  SG  . CYS A 1 91  ? -9.568  10.169 10.695  1.00 27.75 ? 91  CYS A SG  1 
ATOM   678  N  N   . MET A 1 92  ? -13.263 10.879 8.937   1.00 19.03 ? 92  MET A N   1 
ATOM   679  C  CA  . MET A 1 92  ? -14.533 11.309 9.527   1.00 18.88 ? 92  MET A CA  1 
ATOM   680  C  C   . MET A 1 92  ? -15.603 10.220 9.432   1.00 19.83 ? 92  MET A C   1 
ATOM   681  O  O   . MET A 1 92  ? -16.201 9.837  10.430  1.00 20.34 ? 92  MET A O   1 
ATOM   682  C  CB  . MET A 1 92  ? -15.025 12.603 8.863   1.00 18.17 ? 92  MET A CB  1 
ATOM   683  C  CG  . MET A 1 92  ? -14.257 13.815 9.300   1.00 20.19 ? 92  MET A CG  1 
ATOM   684  S  SD  . MET A 1 92  ? -14.689 14.218 11.015  1.00 20.95 ? 92  MET A SD  1 
ATOM   685  C  CE  . MET A 1 92  ? -16.319 14.893 10.856  1.00 18.77 ? 92  MET A CE  1 
ATOM   686  N  N   . LEU A 1 93  ? -15.810 9.669  8.238   1.00 20.16 ? 93  LEU A N   1 
ATOM   687  C  CA  . LEU A 1 93  ? -16.847 8.634  8.108   1.00 20.31 ? 93  LEU A CA  1 
ATOM   688  C  C   . LEU A 1 93  ? -16.685 7.523  9.141   1.00 20.43 ? 93  LEU A C   1 
ATOM   689  O  O   . LEU A 1 93  ? -17.665 7.141  9.795   1.00 20.21 ? 93  LEU A O   1 
ATOM   690  C  CB  . LEU A 1 93  ? -16.920 8.069  6.680   1.00 19.05 ? 93  LEU A CB  1 
ATOM   691  C  CG  . LEU A 1 93  ? -17.887 8.819  5.734   1.00 17.71 ? 93  LEU A CG  1 
ATOM   692  C  CD1 . LEU A 1 93  ? -19.280 8.459  6.132   1.00 18.81 ? 93  LEU A CD1 1 
ATOM   693  C  CD2 . LEU A 1 93  ? -17.696 10.340 5.794   1.00 18.91 ? 93  LEU A CD2 1 
ATOM   694  N  N   . SER A 1 94  ? -15.452 7.043  9.307   1.00 21.26 ? 94  SER A N   1 
ATOM   695  C  CA  . SER A 1 94  ? -15.137 5.916  10.173  1.00 21.94 ? 94  SER A CA  1 
ATOM   696  C  C   . SER A 1 94  ? -15.360 6.200  11.645  1.00 22.63 ? 94  SER A C   1 
ATOM   697  O  O   . SER A 1 94  ? -15.404 5.258  12.456  1.00 22.61 ? 94  SER A O   1 
ATOM   698  C  CB  . SER A 1 94  ? -13.677 5.497  9.995   1.00 20.91 ? 94  SER A CB  1 
ATOM   699  O  OG  . SER A 1 94  ? -12.845 6.470  10.629  1.00 24.90 ? 94  SER A OG  1 
ATOM   700  N  N   . LYS A 1 95  ? -15.460 7.485  11.983  1.00 22.93 ? 95  LYS A N   1 
ATOM   701  C  CA  . LYS A 1 95  ? -15.660 7.944  13.369  1.00 23.61 ? 95  LYS A CA  1 
ATOM   702  C  C   . LYS A 1 95  ? -17.140 8.195  13.719  1.00 23.60 ? 95  LYS A C   1 
ATOM   703  O  O   . LYS A 1 95  ? -17.489 8.630  14.831  1.00 24.37 ? 95  LYS A O   1 
ATOM   704  C  CB  . LYS A 1 95  ? -14.808 9.197  13.622  1.00 24.25 ? 95  LYS A CB  1 
ATOM   705  C  CG  . LYS A 1 95  ? -13.305 9.026  13.402  1.00 24.75 ? 95  LYS A CG  1 
ATOM   706  C  CD  . LYS A 1 95  ? -12.731 7.872  14.220  1.00 27.97 ? 95  LYS A CD  1 
ATOM   707  C  CE  . LYS A 1 95  ? -11.202 7.966  14.326  1.00 26.18 ? 95  LYS A CE  1 
ATOM   708  N  NZ  . LYS A 1 95  ? -10.561 8.357  13.042  1.00 26.83 ? 95  LYS A NZ  1 
ATOM   709  N  N   . HIS A 1 96  ? -18.020 7.892  12.767  1.00 23.34 ? 96  HIS A N   1 
ATOM   710  C  CA  . HIS A 1 96  ? -19.452 8.067  12.987  1.00 23.00 ? 96  HIS A CA  1 
ATOM   711  C  C   . HIS A 1 96  ? -20.232 6.805  12.683  1.00 23.49 ? 96  HIS A C   1 
ATOM   712  O  O   . HIS A 1 96  ? -20.014 6.144  11.663  1.00 22.42 ? 96  HIS A O   1 
ATOM   713  C  CB  . HIS A 1 96  ? -20.012 9.194  12.130  1.00 22.34 ? 96  HIS A CB  1 
ATOM   714  C  CG  . HIS A 1 96  ? -19.392 10.513 12.409  1.00 21.46 ? 96  HIS A CG  1 
ATOM   715  N  ND1 . HIS A 1 96  ? -18.164 10.874 11.912  1.00 20.27 ? 96  HIS A ND1 1 
ATOM   716  C  CD2 . HIS A 1 96  ? -19.830 11.565 13.138  1.00 19.77 ? 96  HIS A CD2 1 
ATOM   717  C  CE1 . HIS A 1 96  ? -17.869 12.093 12.327  1.00 20.73 ? 96  HIS A CE1 1 
ATOM   718  N  NE2 . HIS A 1 96  ? -18.857 12.525 13.085  1.00 19.23 ? 96  HIS A NE2 1 
ATOM   719  N  N   . THR A 1 97  ? -21.180 6.504  13.561  1.00 22.77 ? 97  THR A N   1 
ATOM   720  C  CA  . THR A 1 97  ? -22.083 5.382  13.329  1.00 23.22 ? 97  THR A CA  1 
ATOM   721  C  C   . THR A 1 97  ? -22.853 5.491  12.035  1.00 22.97 ? 97  THR A C   1 
ATOM   722  O  O   . THR A 1 97  ? -22.934 4.523  11.282  1.00 23.34 ? 97  THR A O   1 
ATOM   723  C  CB  . THR A 1 97  ? -23.101 5.258  14.450  1.00 22.94 ? 97  THR A CB  1 
ATOM   724  O  OG1 . THR A 1 97  ? -22.397 5.301  15.693  1.00 22.14 ? 97  THR A OG1 1 
ATOM   725  C  CG2 . THR A 1 97  ? -23.897 3.902  14.336  1.00 23.39 ? 97  THR A CG2 1 
ATOM   726  N  N   . ASP A 1 98  ? -23.438 6.668  11.817  1.00 22.14 ? 98  ASP A N   1 
ATOM   727  C  CA  . ASP A 1 98  ? -24.354 6.898  10.734  1.00 21.73 ? 98  ASP A CA  1 
ATOM   728  C  C   . ASP A 1 98  ? -23.823 8.011  9.857   1.00 20.66 ? 98  ASP A C   1 
ATOM   729  O  O   . ASP A 1 98  ? -23.004 8.814  10.299  1.00 20.03 ? 98  ASP A O   1 
ATOM   730  C  CB  . ASP A 1 98  ? -25.741 7.247  11.281  1.00 21.16 ? 98  ASP A CB  1 
ATOM   731  C  CG  . ASP A 1 98  ? -26.374 6.093  12.038  1.00 22.84 ? 98  ASP A CG  1 
ATOM   732  O  OD1 . ASP A 1 98  ? -26.490 4.986  11.470  1.00 27.03 ? 98  ASP A OD1 1 
ATOM   733  O  OD2 . ASP A 1 98  ? -26.756 6.267  13.209  1.00 24.23 ? 98  ASP A OD2 1 
ATOM   734  N  N   . ALA A 1 99  ? -24.299 8.056  8.612   1.00 20.44 ? 99  ALA A N   1 
ATOM   735  C  CA  . ALA A 1 99  ? -23.922 9.103  7.678   1.00 19.71 ? 99  ALA A CA  1 
ATOM   736  C  C   . ALA A 1 99  ? -25.041 9.340  6.687   1.00 19.29 ? 99  ALA A C   1 
ATOM   737  O  O   . ALA A 1 99  ? -25.668 8.388  6.204   1.00 18.90 ? 99  ALA A O   1 
ATOM   738  C  CB  . ALA A 1 99  ? -22.624 8.729  6.931   1.00 19.17 ? 99  ALA A CB  1 
ATOM   739  N  N   . VAL A 1 100 ? -25.319 10.610 6.445   1.00 19.73 ? 100 VAL A N   1 
ATOM   740  C  CA  . VAL A 1 100 ? -26.246 11.030 5.383   1.00 18.08 ? 100 VAL A CA  1 
ATOM   741  C  C   . VAL A 1 100 ? -25.514 11.920 4.368   1.00 18.23 ? 100 VAL A C   1 
ATOM   742  O  O   . VAL A 1 100 ? -24.979 12.981 4.720   1.00 17.99 ? 100 VAL A O   1 
ATOM   743  C  CB  . VAL A 1 100 ? -27.468 11.757 5.980   1.00 19.11 ? 100 VAL A CB  1 
ATOM   744  C  CG1 . VAL A 1 100 ? -28.357 12.308 4.890   1.00 18.16 ? 100 VAL A CG1 1 
ATOM   745  C  CG2 . VAL A 1 100 ? -28.281 10.821 6.850   1.00 15.62 ? 100 VAL A CG2 1 
ATOM   746  N  N   . SER A 1 101 ? -25.510 11.522 3.095   1.00 17.86 ? 101 SER A N   1 
ATOM   747  C  CA  . SER A 1 101 ? -24.749 12.283 2.077   1.00 17.19 ? 101 SER A CA  1 
ATOM   748  C  C   . SER A 1 101 ? -25.712 13.087 1.213   1.00 17.52 ? 101 SER A C   1 
ATOM   749  O  O   . SER A 1 101 ? -26.818 12.663 1.006   1.00 17.35 ? 101 SER A O   1 
ATOM   750  C  CB  . SER A 1 101 ? -23.936 11.361 1.198   1.00 17.09 ? 101 SER A CB  1 
ATOM   751  O  OG  . SER A 1 101 ? -24.761 10.460 0.482   1.00 16.82 ? 101 SER A OG  1 
ATOM   752  N  N   . PHE A 1 102 ? -25.291 14.243 0.723   1.00 17.66 ? 102 PHE A N   1 
ATOM   753  C  CA  . PHE A 1 102 ? -26.181 15.071 -0.084  1.00 18.88 ? 102 PHE A CA  1 
ATOM   754  C  C   . PHE A 1 102 ? -25.607 15.336 -1.487  1.00 18.90 ? 102 PHE A C   1 
ATOM   755  O  O   . PHE A 1 102 ? -24.513 15.875 -1.626  1.00 19.31 ? 102 PHE A O   1 
ATOM   756  C  CB  . PHE A 1 102 ? -26.481 16.397 0.623   1.00 18.79 ? 102 PHE A CB  1 
ATOM   757  C  CG  . PHE A 1 102 ? -27.175 16.240 1.956   1.00 20.62 ? 102 PHE A CG  1 
ATOM   758  C  CD1 . PHE A 1 102 ? -26.453 15.917 3.114   1.00 24.09 ? 102 PHE A CD1 1 
ATOM   759  C  CD2 . PHE A 1 102 ? -28.545 16.400 2.048   1.00 24.18 ? 102 PHE A CD2 1 
ATOM   760  C  CE1 . PHE A 1 102 ? -27.107 15.766 4.365   1.00 22.98 ? 102 PHE A CE1 1 
ATOM   761  C  CE2 . PHE A 1 102 ? -29.203 16.271 3.282   1.00 24.59 ? 102 PHE A CE2 1 
ATOM   762  C  CZ  . PHE A 1 102 ? -28.481 15.934 4.429   1.00 23.48 ? 102 PHE A CZ  1 
ATOM   763  N  N   . HIS A 1 103 ? -26.397 15.012 -2.508  1.00 19.59 ? 103 HIS A N   1 
ATOM   764  C  CA  . HIS A 1 103 ? -25.958 15.049 -3.913  1.00 19.15 ? 103 HIS A CA  1 
ATOM   765  C  C   . HIS A 1 103 ? -26.874 15.802 -4.811  1.00 18.69 ? 103 HIS A C   1 
ATOM   766  O  O   . HIS A 1 103 ? -28.066 15.988 -4.520  1.00 19.04 ? 103 HIS A O   1 
ATOM   767  C  CB  . HIS A 1 103 ? -25.772 13.638 -4.468  1.00 18.61 ? 103 HIS A CB  1 
ATOM   768  C  CG  . HIS A 1 103 ? -24.547 12.953 -3.948  1.00 17.08 ? 103 HIS A CG  1 
ATOM   769  N  ND1 . HIS A 1 103 ? -23.344 12.992 -4.610  1.00 16.51 ? 103 HIS A ND1 1 
ATOM   770  C  CD2 . HIS A 1 103 ? -24.337 12.232 -2.817  1.00 14.14 ? 103 HIS A CD2 1 
ATOM   771  C  CE1 . HIS A 1 103 ? -22.442 12.324 -3.910  1.00 19.86 ? 103 HIS A CE1 1 
ATOM   772  N  NE2 . HIS A 1 103 ? -23.021 11.849 -2.823  1.00 16.90 ? 103 HIS A NE2 1 
ATOM   773  N  N   . GLY A 1 104 ? -26.314 16.267 -5.922  1.00 19.70 ? 104 GLY A N   1 
ATOM   774  C  CA  . GLY A 1 104 ? -27.131 16.942 -6.941  1.00 19.89 ? 104 GLY A CA  1 
ATOM   775  C  C   . GLY A 1 104 ? -27.112 16.181 -8.268  1.00 21.21 ? 104 GLY A C   1 
ATOM   776  O  O   . GLY A 1 104 ? -26.051 15.773 -8.733  1.00 20.26 ? 104 GLY A O   1 
ATOM   777  N  N   . TYR A 1 105 ? -28.276 15.962 -8.877  1.00 22.57 ? 105 TYR A N   1 
ATOM   778  C  CA  . TYR A 1 105 ? -28.272 15.335 -10.203 1.00 23.57 ? 105 TYR A CA  1 
ATOM   779  C  C   . TYR A 1 105 ? -29.023 16.248 -11.158 1.00 24.04 ? 105 TYR A C   1 
ATOM   780  O  O   . TYR A 1 105 ? -29.820 17.073 -10.712 1.00 24.10 ? 105 TYR A O   1 
ATOM   781  C  CB  . TYR A 1 105 ? -28.810 13.871 -10.176 1.00 23.45 ? 105 TYR A CB  1 
ATOM   782  C  CG  . TYR A 1 105 ? -30.315 13.742 -10.066 1.00 22.80 ? 105 TYR A CG  1 
ATOM   783  C  CD1 . TYR A 1 105 ? -31.117 13.692 -11.209 1.00 23.03 ? 105 TYR A CD1 1 
ATOM   784  C  CD2 . TYR A 1 105 ? -30.946 13.673 -8.815  1.00 25.03 ? 105 TYR A CD2 1 
ATOM   785  C  CE1 . TYR A 1 105 ? -32.518 13.580 -11.106 1.00 25.66 ? 105 TYR A CE1 1 
ATOM   786  C  CE2 . TYR A 1 105 ? -32.345 13.551 -8.704  1.00 23.37 ? 105 TYR A CE2 1 
ATOM   787  C  CZ  . TYR A 1 105 ? -33.118 13.505 -9.851  1.00 23.02 ? 105 TYR A CZ  1 
ATOM   788  O  OH  . TYR A 1 105 ? -34.487 13.397 -9.744  1.00 22.14 ? 105 TYR A OH  1 
ATOM   789  N  N   . LYS A 1 106 ? -28.735 16.123 -12.456 1.00 25.10 ? 106 LYS A N   1 
ATOM   790  C  CA  . LYS A 1 106 ? -29.322 16.974 -13.478 1.00 25.53 ? 106 LYS A CA  1 
ATOM   791  C  C   . LYS A 1 106 ? -30.744 16.553 -13.852 1.00 25.91 ? 106 LYS A C   1 
ATOM   792  O  O   . LYS A 1 106 ? -30.999 15.442 -14.337 1.00 24.29 ? 106 LYS A O   1 
ATOM   793  C  CB  . LYS A 1 106 ? -28.425 17.026 -14.727 1.00 25.95 ? 106 LYS A CB  1 
ATOM   794  C  CG  . LYS A 1 106 ? -28.621 18.281 -15.604 1.00 27.22 ? 106 LYS A CG  1 
ATOM   795  C  CD  . LYS A 1 106 ? -27.312 18.643 -16.308 1.00 28.96 ? 106 LYS A CD  1 
ATOM   796  C  CE  . LYS A 1 106 ? -27.310 20.062 -16.835 1.00 30.55 ? 106 LYS A CE  1 
ATOM   797  N  NZ  . LYS A 1 106 ? -28.390 20.282 -17.832 1.00 33.82 ? 106 LYS A NZ  1 
ATOM   798  N  N   . ASP A 1 107 ? -31.675 17.435 -13.545 1.00 25.76 ? 107 ASP A N   1 
ATOM   799  C  CA  . ASP A 1 107 ? -33.009 17.353 -14.110 1.00 26.19 ? 107 ASP A CA  1 
ATOM   800  C  C   . ASP A 1 107 ? -33.577 18.698 -13.800 1.00 27.23 ? 107 ASP A C   1 
ATOM   801  O  O   . ASP A 1 107 ? -34.066 18.925 -12.705 1.00 26.07 ? 107 ASP A O   1 
ATOM   802  C  CB  . ASP A 1 107 ? -33.872 16.244 -13.498 1.00 25.60 ? 107 ASP A CB  1 
ATOM   803  C  CG  . ASP A 1 107 ? -35.217 16.101 -14.202 1.00 24.91 ? 107 ASP A CG  1 
ATOM   804  O  OD1 . ASP A 1 107 ? -35.458 16.838 -15.202 1.00 21.08 ? 107 ASP A OD1 1 
ATOM   805  O  OD2 . ASP A 1 107 ? -36.034 15.267 -13.760 1.00 23.68 ? 107 ASP A OD2 1 
ATOM   806  N  N   . ASP A 1 108 ? -33.471 19.601 -14.763 1.00 28.16 ? 108 ASP A N   1 
ATOM   807  C  CA  . ASP A 1 108 ? -34.008 20.944 -14.605 1.00 30.14 ? 108 ASP A CA  1 
ATOM   808  C  C   . ASP A 1 108 ? -35.523 20.951 -14.769 1.00 30.38 ? 108 ASP A C   1 
ATOM   809  O  O   . ASP A 1 108 ? -36.171 21.991 -14.601 1.00 30.35 ? 108 ASP A O   1 
ATOM   810  C  CB  . ASP A 1 108 ? -33.401 21.869 -15.663 1.00 30.89 ? 108 ASP A CB  1 
ATOM   811  C  CG  . ASP A 1 108 ? -31.941 22.191 -15.402 1.00 31.86 ? 108 ASP A CG  1 
ATOM   812  O  OD1 . ASP A 1 108 ? -31.590 22.539 -14.258 1.00 32.85 ? 108 ASP A OD1 1 
ATOM   813  O  OD2 . ASP A 1 108 ? -31.150 22.142 -16.370 1.00 33.29 ? 108 ASP A OD2 1 
ATOM   814  N  N   . TYR A 1 109 ? -36.085 19.800 -15.114 1.00 29.98 ? 109 TYR A N   1 
ATOM   815  C  CA  . TYR A 1 109 ? -37.494 19.744 -15.496 1.00 30.15 ? 109 TYR A CA  1 
ATOM   816  C  C   . TYR A 1 109 ? -38.432 19.099 -14.461 1.00 29.86 ? 109 TYR A C   1 
ATOM   817  O  O   . TYR A 1 109 ? -39.655 19.200 -14.571 1.00 28.73 ? 109 TYR A O   1 
ATOM   818  C  CB  . TYR A 1 109 ? -37.630 19.120 -16.887 1.00 30.60 ? 109 TYR A CB  1 
ATOM   819  C  CG  . TYR A 1 109 ? -37.094 20.039 -17.963 1.00 32.30 ? 109 TYR A CG  1 
ATOM   820  C  CD1 . TYR A 1 109 ? -37.877 21.077 -18.472 1.00 33.55 ? 109 TYR A CD1 1 
ATOM   821  C  CD2 . TYR A 1 109 ? -35.796 19.880 -18.466 1.00 32.56 ? 109 TYR A CD2 1 
ATOM   822  C  CE1 . TYR A 1 109 ? -37.381 21.945 -19.447 1.00 34.96 ? 109 TYR A CE1 1 
ATOM   823  C  CE2 . TYR A 1 109 ? -35.291 20.745 -19.453 1.00 36.00 ? 109 TYR A CE2 1 
ATOM   824  C  CZ  . TYR A 1 109 ? -36.089 21.772 -19.928 1.00 35.41 ? 109 TYR A CZ  1 
ATOM   825  O  OH  . TYR A 1 109 ? -35.610 22.620 -20.888 1.00 38.21 ? 109 TYR A OH  1 
ATOM   826  N  N   . ASN A 1 110 ? -37.858 18.450 -13.451 1.00 29.03 ? 110 ASN A N   1 
ATOM   827  C  CA  . ASN A 1 110 ? -38.663 17.837 -12.388 1.00 28.44 ? 110 ASN A CA  1 
ATOM   828  C  C   . ASN A 1 110 ? -37.996 18.004 -11.073 1.00 27.91 ? 110 ASN A C   1 
ATOM   829  O  O   . ASN A 1 110 ? -36.816 17.709 -10.948 1.00 27.57 ? 110 ASN A O   1 
ATOM   830  C  CB  . ASN A 1 110 ? -38.814 16.330 -12.576 1.00 29.04 ? 110 ASN A CB  1 
ATOM   831  C  CG  . ASN A 1 110 ? -39.331 15.983 -13.906 1.00 30.66 ? 110 ASN A CG  1 
ATOM   832  O  OD1 . ASN A 1 110 ? -40.531 16.035 -14.134 1.00 35.92 ? 110 ASN A OD1 1 
ATOM   833  N  ND2 . ASN A 1 110 ? -38.435 15.643 -14.818 1.00 29.30 ? 110 ASN A ND2 1 
ATOM   834  N  N   . LYS A 1 111 ? -38.792 18.419 -10.094 1.00 26.83 ? 111 LYS A N   1 
ATOM   835  C  CA  . LYS A 1 111 ? -38.399 18.392 -8.693  1.00 26.25 ? 111 LYS A CA  1 
ATOM   836  C  C   . LYS A 1 111 ? -38.575 16.999 -8.099  1.00 25.64 ? 111 LYS A C   1 
ATOM   837  O  O   . LYS A 1 111 ? -39.705 16.483 -7.985  1.00 24.26 ? 111 LYS A O   1 
ATOM   838  C  CB  . LYS A 1 111 ? -39.206 19.425 -7.908  1.00 26.50 ? 111 LYS A CB  1 
ATOM   839  C  CG  . LYS A 1 111 ? -38.900 20.860 -8.321  1.00 24.44 ? 111 LYS A CG  1 
ATOM   840  C  CD  . LYS A 1 111 ? -39.134 21.837 -7.161  1.00 26.66 ? 111 LYS A CD  1 
ATOM   841  C  CE  . LYS A 1 111 ? -40.581 21.772 -6.663  1.00 29.43 ? 111 LYS A CE  1 
ATOM   842  N  NZ  . LYS A 1 111 ? -40.916 22.989 -5.861  1.00 31.28 ? 111 LYS A NZ  1 
ATOM   843  N  N   . ASN A 1 112 ? -37.447 16.398 -7.721  1.00 24.35 ? 112 ASN A N   1 
ATOM   844  C  CA  . ASN A 1 112 ? -37.448 15.091 -7.128  1.00 24.00 ? 112 ASN A CA  1 
ATOM   845  C  C   . ASN A 1 112 ? -36.212 14.825 -6.294  1.00 23.61 ? 112 ASN A C   1 
ATOM   846  O  O   . ASN A 1 112 ? -35.143 15.398 -6.546  1.00 24.32 ? 112 ASN A O   1 
ATOM   847  C  CB  . ASN A 1 112 ? -37.581 14.022 -8.222  1.00 24.64 ? 112 ASN A CB  1 
ATOM   848  C  CG  . ASN A 1 112 ? -38.205 12.777 -7.710  1.00 23.18 ? 112 ASN A CG  1 
ATOM   849  O  OD1 . ASN A 1 112 ? -38.579 12.702 -6.559  1.00 27.72 ? 112 ASN A OD1 1 
ATOM   850  N  ND2 . ASN A 1 112 ? -38.332 11.777 -8.566  1.00 25.61 ? 112 ASN A ND2 1 
ATOM   851  N  N   . THR A 1 113 ? -36.375 13.934 -5.322  1.00 23.49 ? 113 THR A N   1 
ATOM   852  C  CA  . THR A 1 113 ? -35.286 13.400 -4.528  1.00 23.53 ? 113 THR A CA  1 
ATOM   853  C  C   . THR A 1 113 ? -35.333 11.864 -4.532  1.00 23.46 ? 113 THR A C   1 
ATOM   854  O  O   . THR A 1 113 ? -36.372 11.277 -4.231  1.00 23.22 ? 113 THR A O   1 
ATOM   855  C  CB  . THR A 1 113 ? -35.334 13.925 -3.075  1.00 22.98 ? 113 THR A CB  1 
ATOM   856  O  OG1 . THR A 1 113 ? -35.198 15.362 -3.086  1.00 23.32 ? 113 THR A OG1 1 
ATOM   857  C  CG2 . THR A 1 113 ? -34.210 13.303 -2.251  1.00 24.57 ? 113 THR A CG2 1 
ATOM   858  N  N   . LEU A 1 114 ? -34.187 11.258 -4.871  1.00 23.33 ? 114 LEU A N   1 
ATOM   859  C  CA  . LEU A 1 114 ? -34.011 9.817  -4.996  1.00 23.26 ? 114 LEU A CA  1 
ATOM   860  C  C   . LEU A 1 114 ? -33.080 9.364  -3.883  1.00 24.40 ? 114 LEU A C   1 
ATOM   861  O  O   . LEU A 1 114 ? -31.880 9.706  -3.865  1.00 23.21 ? 114 LEU A O   1 
ATOM   862  C  CB  . LEU A 1 114 ? -33.451 9.441  -6.387  1.00 23.59 ? 114 LEU A CB  1 
ATOM   863  C  CG  . LEU A 1 114 ? -34.133 10.082 -7.615  1.00 24.46 ? 114 LEU A CG  1 
ATOM   864  C  CD1 . LEU A 1 114 ? -33.328 9.849  -8.884  1.00 26.54 ? 114 LEU A CD1 1 
ATOM   865  C  CD2 . LEU A 1 114 ? -35.566 9.557  -7.781  1.00 24.05 ? 114 LEU A CD2 1 
ATOM   866  N  N   . VAL A 1 115 ? -33.653 8.617  -2.939  1.00 23.04 ? 115 VAL A N   1 
ATOM   867  C  CA  . VAL A 1 115 ? -32.967 8.288  -1.691  1.00 23.11 ? 115 VAL A CA  1 
ATOM   868  C  C   . VAL A 1 115 ? -32.533 6.819  -1.695  1.00 23.44 ? 115 VAL A C   1 
ATOM   869  O  O   . VAL A 1 115 ? -33.353 5.922  -1.895  1.00 23.95 ? 115 VAL A O   1 
ATOM   870  C  CB  . VAL A 1 115 ? -33.883 8.557  -0.475  1.00 22.87 ? 115 VAL A CB  1 
ATOM   871  C  CG1 . VAL A 1 115 ? -33.090 8.515  0.834   1.00 22.30 ? 115 VAL A CG1 1 
ATOM   872  C  CG2 . VAL A 1 115 ? -34.587 9.904  -0.619  1.00 23.02 ? 115 VAL A CG2 1 
ATOM   873  N  N   . GLY A 1 116 ? -31.250 6.581  -1.459  1.00 21.95 ? 116 GLY A N   1 
ATOM   874  C  CA  . GLY A 1 116 ? -30.760 5.217  -1.349  1.00 22.04 ? 116 GLY A CA  1 
ATOM   875  C  C   . GLY A 1 116 ? -29.764 5.091  -0.234  1.00 20.94 ? 116 GLY A C   1 
ATOM   876  O  O   . GLY A 1 116 ? -29.778 5.874  0.720   1.00 20.60 ? 116 GLY A O   1 
ATOM   877  N  N   . GLY A 1 117 ? -28.864 4.130  -0.369  1.00 20.87 ? 117 GLY A N   1 
ATOM   878  C  CA  . GLY A 1 117 ? -27.908 3.843  0.675   1.00 20.81 ? 117 GLY A CA  1 
ATOM   879  C  C   . GLY A 1 117 ? -28.328 2.550  1.366   1.00 21.05 ? 117 GLY A C   1 
ATOM   880  O  O   . GLY A 1 117 ? -29.424 2.037  1.106   1.00 19.93 ? 117 GLY A O   1 
ATOM   881  N  N   . LEU A 1 118 ? -27.469 2.023  2.242   1.00 20.81 ? 118 LEU A N   1 
ATOM   882  C  CA  . LEU A 1 118 ? -27.761 0.745  2.930   1.00 21.38 ? 118 LEU A CA  1 
ATOM   883  C  C   . LEU A 1 118 ? -28.508 0.921  4.244   1.00 21.88 ? 118 LEU A C   1 
ATOM   884  O  O   . LEU A 1 118 ? -29.064 -0.043 4.768   1.00 22.57 ? 118 LEU A O   1 
ATOM   885  C  CB  . LEU A 1 118 ? -26.475 -0.091 3.140   1.00 21.37 ? 118 LEU A CB  1 
ATOM   886  C  CG  . LEU A 1 118 ? -25.876 -0.698 1.857   1.00 20.27 ? 118 LEU A CG  1 
ATOM   887  C  CD1 . LEU A 1 118 ? -24.477 -1.187 2.117   1.00 21.15 ? 118 LEU A CD1 1 
ATOM   888  C  CD2 . LEU A 1 118 ? -26.789 -1.803 1.223   1.00 23.21 ? 118 LEU A CD2 1 
ATOM   889  N  N   . ASN A 1 119 ? -28.556 2.140  4.788   1.00 21.92 ? 119 ASN A N   1 
ATOM   890  C  CA  . ASN A 1 119 ? -29.382 2.359  5.980   1.00 21.11 ? 119 ASN A CA  1 
ATOM   891  C  C   . ASN A 1 119 ? -30.875 2.481  5.628   1.00 20.49 ? 119 ASN A C   1 
ATOM   892  O  O   . ASN A 1 119 ? -31.374 3.572  5.445   1.00 20.10 ? 119 ASN A O   1 
ATOM   893  C  CB  . ASN A 1 119 ? -28.901 3.572  6.784   1.00 21.10 ? 119 ASN A CB  1 
ATOM   894  C  CG  . ASN A 1 119 ? -29.587 3.677  8.142   1.00 21.86 ? 119 ASN A CG  1 
ATOM   895  O  OD1 . ASN A 1 119 ? -30.612 3.039  8.387   1.00 20.72 ? 119 ASN A OD1 1 
ATOM   896  N  ND2 . ASN A 1 119 ? -29.022 4.484  9.028   1.00 17.93 ? 119 ASN A ND2 1 
ATOM   897  N  N   . THR A 1 120 ? -31.567 1.342  5.547   1.00 19.96 ? 120 THR A N   1 
ATOM   898  C  CA  . THR A 1 120 ? -32.896 1.265  4.930   1.00 20.69 ? 120 THR A CA  1 
ATOM   899  C  C   . THR A 1 120 ? -33.890 2.000  5.766   1.00 21.30 ? 120 THR A C   1 
ATOM   900  O  O   . THR A 1 120 ? -34.751 2.704  5.219   1.00 20.76 ? 120 THR A O   1 
ATOM   901  C  CB  . THR A 1 120 ? -33.442 -0.178 4.830   1.00 21.20 ? 120 THR A CB  1 
ATOM   902  O  OG1 . THR A 1 120 ? -32.408 -1.064 4.399   1.00 19.93 ? 120 THR A OG1 1 
ATOM   903  C  CG2 . THR A 1 120 ? -34.600 -0.234 3.835   1.00 21.57 ? 120 THR A CG2 1 
ATOM   904  N  N   . GLU A 1 121 ? -33.763 1.813  7.081   1.00 21.70 ? 121 GLU A N   1 
ATOM   905  C  CA  . GLU A 1 121 ? -34.645 2.446  8.046   1.00 22.96 ? 121 GLU A CA  1 
ATOM   906  C  C   . GLU A 1 121 ? -34.606 3.964  8.026   1.00 22.19 ? 121 GLU A C   1 
ATOM   907  O  O   . GLU A 1 121 ? -35.650 4.569  7.934   1.00 23.69 ? 121 GLU A O   1 
ATOM   908  C  CB  . GLU A 1 121 ? -34.386 1.951  9.448   1.00 23.71 ? 121 GLU A CB  1 
ATOM   909  C  CG  . GLU A 1 121 ? -35.409 2.506  10.428  1.00 26.69 ? 121 GLU A CG  1 
ATOM   910  C  CD  . GLU A 1 121 ? -35.030 2.255  11.862  1.00 32.08 ? 121 GLU A CD  1 
ATOM   911  O  OE1 . GLU A 1 121 ? -34.150 1.387  12.111  1.00 34.41 ? 121 GLU A OE1 1 
ATOM   912  O  OE2 . GLU A 1 121 ? -35.625 2.936  12.732  1.00 33.90 ? 121 GLU A OE2 1 
ATOM   913  N  N   . LEU A 1 122 ? -33.417 4.558  8.124   1.00 21.80 ? 122 LEU A N   1 
ATOM   914  C  CA  . LEU A 1 122 ? -33.228 5.990  7.939   1.00 21.19 ? 122 LEU A CA  1 
ATOM   915  C  C   . LEU A 1 122 ? -33.530 6.453  6.510   1.00 21.77 ? 122 LEU A C   1 
ATOM   916  O  O   . LEU A 1 122 ? -34.116 7.523  6.333   1.00 22.92 ? 122 LEU A O   1 
ATOM   917  C  CB  . LEU A 1 122 ? -31.821 6.413  8.334   1.00 20.24 ? 122 LEU A CB  1 
ATOM   918  C  CG  . LEU A 1 122 ? -31.546 7.932  8.459   1.00 17.80 ? 122 LEU A CG  1 
ATOM   919  C  CD1 . LEU A 1 122 ? -32.535 8.620  9.424   1.00 14.87 ? 122 LEU A CD1 1 
ATOM   920  C  CD2 . LEU A 1 122 ? -30.103 8.128  8.885   1.00 19.63 ? 122 LEU A CD2 1 
ATOM   921  N  N   . ARG A 1 123 ? -33.109 5.678  5.501   1.00 22.06 ? 123 ARG A N   1 
ATOM   922  C  CA  . ARG A 1 123 ? -33.563 5.889  4.098   1.00 22.06 ? 123 ARG A CA  1 
ATOM   923  C  C   . ARG A 1 123 ? -35.092 6.069  3.967   1.00 23.32 ? 123 ARG A C   1 
ATOM   924  O  O   . ARG A 1 123 ? -35.543 7.084  3.404   1.00 24.32 ? 123 ARG A O   1 
ATOM   925  C  CB  . ARG A 1 123 ? -33.075 4.769  3.151   1.00 22.06 ? 123 ARG A CB  1 
ATOM   926  C  CG  . ARG A 1 123 ? -33.540 4.942  1.705   1.00 19.77 ? 123 ARG A CG  1 
ATOM   927  C  CD  . ARG A 1 123 ? -33.570 3.623  0.952   1.00 20.23 ? 123 ARG A CD  1 
ATOM   928  N  NE  . ARG A 1 123 ? -34.712 2.801  1.371   1.00 17.50 ? 123 ARG A NE  1 
ATOM   929  C  CZ  . ARG A 1 123 ? -35.076 1.676  0.777   1.00 17.73 ? 123 ARG A CZ  1 
ATOM   930  N  NH1 . ARG A 1 123 ? -34.364 1.231  -0.235  1.00 21.24 ? 123 ARG A NH1 1 
ATOM   931  N  NH2 . ARG A 1 123 ? -36.128 0.976  1.227   1.00 19.35 ? 123 ARG A NH2 1 
ATOM   932  N  N   . ASN A 1 124 ? -35.870 5.087  4.445   1.00 23.11 ? 124 ASN A N   1 
ATOM   933  C  CA  . ASN A 1 124 ? -37.334 5.157  4.414   1.00 23.25 ? 124 ASN A CA  1 
ATOM   934  C  C   . ASN A 1 124 ? -37.892 6.373  5.179   1.00 23.78 ? 124 ASN A C   1 
ATOM   935  O  O   . ASN A 1 124 ? -38.848 7.025  4.740   1.00 23.26 ? 124 ASN A O   1 
ATOM   936  C  CB  . ASN A 1 124 ? -37.981 3.870  4.947   1.00 23.45 ? 124 ASN A CB  1 
ATOM   937  C  CG  . ASN A 1 124 ? -37.678 2.633  4.081   1.00 23.71 ? 124 ASN A CG  1 
ATOM   938  O  OD1 . ASN A 1 124 ? -37.310 2.752  2.913   1.00 28.37 ? 124 ASN A OD1 1 
ATOM   939  N  ND2 . ASN A 1 124 ? -37.845 1.449  4.657   1.00 20.92 ? 124 ASN A ND2 1 
ATOM   940  N  N   . LEU A 1 125 ? -37.295 6.657  6.328   1.00 23.39 ? 125 LEU A N   1 
ATOM   941  C  CA  . LEU A 1 125 ? -37.738 7.772  7.194   1.00 23.94 ? 125 LEU A CA  1 
ATOM   942  C  C   . LEU A 1 125 ? -37.619 9.138  6.537   1.00 23.35 ? 125 LEU A C   1 
ATOM   943  O  O   . LEU A 1 125 ? -38.537 9.941  6.604   1.00 21.96 ? 125 LEU A O   1 
ATOM   944  C  CB  . LEU A 1 125 ? -37.028 7.695  8.545   1.00 22.81 ? 125 LEU A CB  1 
ATOM   945  C  CG  . LEU A 1 125 ? -37.572 6.480  9.328   1.00 25.44 ? 125 LEU A CG  1 
ATOM   946  C  CD1 . LEU A 1 125 ? -36.709 6.083  10.537  1.00 25.10 ? 125 LEU A CD1 1 
ATOM   947  C  CD2 . LEU A 1 125 ? -39.019 6.731  9.756   1.00 25.86 ? 125 LEU A CD2 1 
ATOM   948  N  N   . ILE A 1 126 ? -36.497 9.364  5.857   1.00 23.53 ? 126 ILE A N   1 
ATOM   949  C  CA  . ILE A 1 126 ? -36.229 10.623 5.146   1.00 22.60 ? 126 ILE A CA  1 
ATOM   950  C  C   . ILE A 1 126 ? -37.203 10.801 3.976   1.00 22.78 ? 126 ILE A C   1 
ATOM   951  O  O   . ILE A 1 126 ? -37.623 11.905 3.645   1.00 21.62 ? 126 ILE A O   1 
ATOM   952  C  CB  . ILE A 1 126 ? -34.759 10.662 4.663   1.00 22.60 ? 126 ILE A CB  1 
ATOM   953  C  CG1 . ILE A 1 126 ? -33.856 10.776 5.874   1.00 22.65 ? 126 ILE A CG1 1 
ATOM   954  C  CG2 . ILE A 1 126 ? -34.518 11.808 3.674   1.00 21.74 ? 126 ILE A CG2 1 
ATOM   955  C  CD1 . ILE A 1 126 ? -32.340 10.622 5.620   1.00 26.20 ? 126 ILE A CD1 1 
ATOM   956  N  N   . VAL A 1 127 ? -37.558 9.677  3.378   1.00 21.96 ? 127 VAL A N   1 
ATOM   957  C  CA  . VAL A 1 127 ? -38.435 9.638  2.241   1.00 22.83 ? 127 VAL A CA  1 
ATOM   958  C  C   . VAL A 1 127 ? -39.776 10.090 2.777   1.00 21.86 ? 127 VAL A C   1 
ATOM   959  O  O   . VAL A 1 127 ? -40.356 11.032 2.293   1.00 20.82 ? 127 VAL A O   1 
ATOM   960  C  CB  . VAL A 1 127 ? -38.413 8.190  1.670   1.00 22.14 ? 127 VAL A CB  1 
ATOM   961  C  CG1 . VAL A 1 127 ? -39.793 7.680  1.241   1.00 23.59 ? 127 VAL A CG1 1 
ATOM   962  C  CG2 . VAL A 1 127 ? -37.347 8.090  0.551   1.00 20.42 ? 127 VAL A CG2 1 
ATOM   963  N  N   . SER A 1 128 ? -40.169 9.467  3.877   1.00 23.97 ? 128 SER A N   1 
ATOM   964  C  CA  . SER A 1 128 ? -41.462 9.683  4.468   1.00 25.06 ? 128 SER A CA  1 
ATOM   965  C  C   . SER A 1 128 ? -41.630 11.092 5.036   1.00 25.32 ? 128 SER A C   1 
ATOM   966  O  O   . SER A 1 128 ? -42.713 11.670 4.897   1.00 25.35 ? 128 SER A O   1 
ATOM   967  C  CB  . SER A 1 128 ? -41.756 8.593  5.476   1.00 25.75 ? 128 SER A CB  1 
ATOM   968  O  OG  . SER A 1 128 ? -42.981 8.818  6.126   1.00 27.91 ? 128 SER A OG  1 
ATOM   969  N  N   . LYS A 1 129 ? -40.571 11.669 5.616   1.00 25.49 ? 129 LYS A N   1 
ATOM   970  C  CA  . LYS A 1 129 ? -40.635 13.072 6.090   1.00 25.18 ? 129 LYS A CA  1 
ATOM   971  C  C   . LYS A 1 129 ? -40.705 14.071 4.947   1.00 25.58 ? 129 LYS A C   1 
ATOM   972  O  O   . LYS A 1 129 ? -41.500 15.026 4.982   1.00 25.64 ? 129 LYS A O   1 
ATOM   973  C  CB  . LYS A 1 129 ? -39.456 13.444 7.001   1.00 24.13 ? 129 LYS A CB  1 
ATOM   974  C  CG  . LYS A 1 129 ? -39.363 12.754 8.374   1.00 22.98 ? 129 LYS A CG  1 
ATOM   975  C  CD  . LYS A 1 129 ? -40.716 12.556 9.030   1.00 25.29 ? 129 LYS A CD  1 
ATOM   976  C  CE  . LYS A 1 129 ? -40.606 12.394 10.545  1.00 25.04 ? 129 LYS A CE  1 
ATOM   977  N  NZ  . LYS A 1 129 ? -41.940 12.024 11.042  1.00 27.84 ? 129 LYS A NZ  1 
ATOM   978  N  N   . LEU A 1 130 ? -39.911 13.857 3.907   1.00 25.99 ? 130 LEU A N   1 
ATOM   979  C  CA  . LEU A 1 130 ? -39.916 14.819 2.821   1.00 25.75 ? 130 LEU A CA  1 
ATOM   980  C  C   . LEU A 1 130 ? -41.320 14.935 2.239   1.00 26.36 ? 130 LEU A C   1 
ATOM   981  O  O   . LEU A 1 130 ? -41.872 16.044 2.131   1.00 24.64 ? 130 LEU A O   1 
ATOM   982  C  CB  . LEU A 1 130 ? -38.871 14.484 1.745   1.00 25.95 ? 130 LEU A CB  1 
ATOM   983  C  CG  . LEU A 1 130 ? -37.418 14.525 2.206   1.00 26.19 ? 130 LEU A CG  1 
ATOM   984  C  CD1 . LEU A 1 130 ? -36.595 13.918 1.112   1.00 24.88 ? 130 LEU A CD1 1 
ATOM   985  C  CD2 . LEU A 1 130 ? -36.951 15.958 2.556   1.00 24.58 ? 130 LEU A CD2 1 
ATOM   986  N  N   . ASN A 1 131 ? -41.911 13.777 1.912   1.00 26.82 ? 131 ASN A N   1 
ATOM   987  C  CA  . ASN A 1 131 ? -43.286 13.735 1.435   1.00 26.97 ? 131 ASN A CA  1 
ATOM   988  C  C   . ASN A 1 131 ? -44.249 14.499 2.317   1.00 27.67 ? 131 ASN A C   1 
ATOM   989  O  O   . ASN A 1 131 ? -45.159 15.155 1.827   1.00 27.64 ? 131 ASN A O   1 
ATOM   990  C  CB  . ASN A 1 131 ? -43.797 12.305 1.344   1.00 27.81 ? 131 ASN A CB  1 
ATOM   991  C  CG  . ASN A 1 131 ? -43.063 11.471 0.321   1.00 28.16 ? 131 ASN A CG  1 
ATOM   992  O  OD1 . ASN A 1 131 ? -43.253 10.267 0.282   1.00 30.03 ? 131 ASN A OD1 1 
ATOM   993  N  ND2 . ASN A 1 131 ? -42.223 12.096 -0.504  1.00 26.33 ? 131 ASN A ND2 1 
ATOM   994  N  N   . SER A 1 132 ? -44.084 14.377 3.625   1.00 28.11 ? 132 SER A N   1 
ATOM   995  C  CA  . SER A 1 132 ? -45.084 14.923 4.536   1.00 29.06 ? 132 SER A CA  1 
ATOM   996  C  C   . SER A 1 132 ? -44.941 16.431 4.596   1.00 28.94 ? 132 SER A C   1 
ATOM   997  O  O   . SER A 1 132 ? -45.802 17.108 5.157   1.00 30.46 ? 132 SER A O   1 
ATOM   998  C  CB  . SER A 1 132 ? -44.927 14.340 5.927   1.00 28.33 ? 132 SER A CB  1 
ATOM   999  O  OG  . SER A 1 132 ? -43.897 15.039 6.609   1.00 30.63 ? 132 SER A OG  1 
ATOM   1000 N  N   . LYS A 1 133 ? -43.831 16.945 4.061   1.00 29.26 ? 133 LYS A N   1 
ATOM   1001 C  CA  . LYS A 1 133 ? -43.654 18.387 3.852   1.00 28.56 ? 133 LYS A CA  1 
ATOM   1002 C  C   . LYS A 1 133 ? -44.009 18.739 2.408   1.00 28.49 ? 133 LYS A C   1 
ATOM   1003 O  O   . LYS A 1 133 ? -43.744 19.851 1.940   1.00 29.06 ? 133 LYS A O   1 
ATOM   1004 C  CB  . LYS A 1 133 ? -42.234 18.855 4.192   1.00 28.86 ? 133 LYS A CB  1 
ATOM   1005 C  CG  . LYS A 1 133 ? -41.723 18.487 5.600   1.00 29.22 ? 133 LYS A CG  1 
ATOM   1006 C  CD  . LYS A 1 133 ? -42.463 19.216 6.699   1.00 29.17 ? 133 LYS A CD  1 
ATOM   1007 C  CE  . LYS A 1 133 ? -41.469 19.898 7.610   1.00 30.09 ? 133 LYS A CE  1 
ATOM   1008 N  NZ  . LYS A 1 133 ? -41.875 19.872 9.044   1.00 30.08 ? 133 LYS A NZ  1 
ATOM   1009 N  N   . GLY A 1 134 ? -44.605 17.787 1.700   1.00 27.31 ? 134 GLY A N   1 
ATOM   1010 C  CA  . GLY A 1 134 ? -45.050 18.036 0.320   1.00 26.85 ? 134 GLY A CA  1 
ATOM   1011 C  C   . GLY A 1 134 ? -43.899 18.082 -0.659  1.00 26.67 ? 134 GLY A C   1 
ATOM   1012 O  O   . GLY A 1 134 ? -44.011 18.697 -1.723  1.00 26.80 ? 134 GLY A O   1 
ATOM   1013 N  N   . ILE A 1 135 ? -42.783 17.452 -0.283  1.00 25.96 ? 135 ILE A N   1 
ATOM   1014 C  CA  . ILE A 1 135 ? -41.569 17.449 -1.090  1.00 25.40 ? 135 ILE A CA  1 
ATOM   1015 C  C   . ILE A 1 135 ? -41.422 16.083 -1.721  1.00 25.26 ? 135 ILE A C   1 
ATOM   1016 O  O   . ILE A 1 135 ? -41.439 15.063 -1.028  1.00 25.34 ? 135 ILE A O   1 
ATOM   1017 C  CB  . ILE A 1 135 ? -40.318 17.766 -0.241  1.00 25.31 ? 135 ILE A CB  1 
ATOM   1018 C  CG1 . ILE A 1 135 ? -40.366 19.228 0.217   1.00 26.50 ? 135 ILE A CG1 1 
ATOM   1019 C  CG2 . ILE A 1 135 ? -39.045 17.527 -1.050  1.00 24.20 ? 135 ILE A CG2 1 
ATOM   1020 C  CD1 . ILE A 1 135 ? -39.804 19.430 1.611   1.00 24.43 ? 135 ILE A CD1 1 
ATOM   1021 N  N   . ALA A 1 136 ? -41.311 16.097 -3.043  1.00 25.26 ? 136 ALA A N   1 
ATOM   1022 C  CA  . ALA A 1 136 ? -41.224 14.915 -3.869  1.00 25.77 ? 136 ALA A CA  1 
ATOM   1023 C  C   . ALA A 1 136 ? -40.006 14.116 -3.459  1.00 25.48 ? 136 ALA A C   1 
ATOM   1024 O  O   . ALA A 1 136 ? -38.904 14.656 -3.370  1.00 27.20 ? 136 ALA A O   1 
ATOM   1025 C  CB  . ALA A 1 136 ? -41.139 15.318 -5.326  1.00 25.61 ? 136 ALA A CB  1 
ATOM   1026 N  N   . ALA A 1 137 ? -40.217 12.842 -3.168  1.00 25.05 ? 137 ALA A N   1 
ATOM   1027 C  CA  . ALA A 1 137 ? -39.150 11.968 -2.722  1.00 24.12 ? 137 ALA A CA  1 
ATOM   1028 C  C   . ALA A 1 137 ? -39.525 10.502 -2.877  1.00 24.00 ? 137 ALA A C   1 
ATOM   1029 O  O   . ALA A 1 137 ? -40.654 10.090 -2.568  1.00 24.96 ? 137 ALA A O   1 
ATOM   1030 C  CB  . ALA A 1 137 ? -38.764 12.298 -1.276  1.00 23.39 ? 137 ALA A CB  1 
ATOM   1031 N  N   . GLU A 1 138 ? -38.586 9.708  -3.376  1.00 23.91 ? 138 GLU A N   1 
ATOM   1032 C  CA  . GLU A 1 138 ? -38.816 8.260  -3.496  1.00 23.58 ? 138 GLU A CA  1 
ATOM   1033 C  C   . GLU A 1 138 ? -37.550 7.448  -3.262  1.00 23.28 ? 138 GLU A C   1 
ATOM   1034 O  O   . GLU A 1 138 ? -36.431 7.977  -3.367  1.00 23.51 ? 138 GLU A O   1 
ATOM   1035 C  CB  . GLU A 1 138 ? -39.395 7.915  -4.875  1.00 24.14 ? 138 GLU A CB  1 
ATOM   1036 C  CG  . GLU A 1 138 ? -38.435 8.237  -5.991  1.00 24.98 ? 138 GLU A CG  1 
ATOM   1037 C  CD  . GLU A 1 138 ? -39.102 8.254  -7.331  1.00 28.28 ? 138 GLU A CD  1 
ATOM   1038 O  OE1 . GLU A 1 138 ? -39.355 7.164  -7.894  1.00 33.47 ? 138 GLU A OE1 1 
ATOM   1039 O  OE2 . GLU A 1 138 ? -39.373 9.358  -7.811  1.00 29.92 ? 138 GLU A OE2 1 
ATOM   1040 N  N   . VAL A 1 139 ? -37.728 6.160  -2.962  1.00 23.82 ? 139 VAL A N   1 
ATOM   1041 C  CA  . VAL A 1 139 ? -36.597 5.193  -2.930  1.00 23.72 ? 139 VAL A CA  1 
ATOM   1042 C  C   . VAL A 1 139 ? -36.000 5.080  -4.327  1.00 23.28 ? 139 VAL A C   1 
ATOM   1043 O  O   . VAL A 1 139 ? -36.708 4.891  -5.301  1.00 21.75 ? 139 VAL A O   1 
ATOM   1044 C  CB  . VAL A 1 139 ? -36.986 3.792  -2.347  1.00 23.76 ? 139 VAL A CB  1 
ATOM   1045 C  CG1 . VAL A 1 139 ? -35.843 2.735  -2.561  1.00 25.33 ? 139 VAL A CG1 1 
ATOM   1046 C  CG2 . VAL A 1 139 ? -37.302 3.910  -0.899  1.00 22.10 ? 139 VAL A CG2 1 
ATOM   1047 N  N   . ALA A 1 140 ? -34.687 5.280  -4.403  1.00 23.32 ? 140 ALA A N   1 
ATOM   1048 C  CA  . ALA A 1 140 ? -33.935 5.144  -5.639  1.00 24.12 ? 140 ALA A CA  1 
ATOM   1049 C  C   . ALA A 1 140 ? -34.002 3.705  -6.196  1.00 25.27 ? 140 ALA A C   1 
ATOM   1050 O  O   . ALA A 1 140 ? -33.907 2.731  -5.439  1.00 23.55 ? 140 ALA A O   1 
ATOM   1051 C  CB  . ALA A 1 140 ? -32.518 5.520  -5.386  1.00 23.55 ? 140 ALA A CB  1 
ATOM   1052 N  N   . THR A 1 141 ? -34.078 3.602  -7.525  1.00 27.18 ? 141 THR A N   1 
ATOM   1053 C  CA  . THR A 1 141 ? -34.262 2.313  -8.237  1.00 28.74 ? 141 THR A CA  1 
ATOM   1054 C  C   . THR A 1 141 ? -33.409 2.017  -9.488  1.00 30.28 ? 141 THR A C   1 
ATOM   1055 O  O   . THR A 1 141 ? -32.622 1.080  -9.460  1.00 31.24 ? 141 THR A O   1 
ATOM   1056 C  CB  . THR A 1 141 ? -35.710 2.078  -8.628  1.00 28.82 ? 141 THR A CB  1 
ATOM   1057 O  OG1 . THR A 1 141 ? -36.182 3.222  -9.368  1.00 29.58 ? 141 THR A OG1 1 
ATOM   1058 C  CG2 . THR A 1 141 ? -36.569 1.804  -7.378  1.00 27.29 ? 141 THR A CG2 1 
ATOM   1059 N  N   . ASP A 1 142 ? -33.584 2.729  -10.603 1.00 31.98 ? 142 ASP A N   1 
ATOM   1060 C  CA  . ASP A 1 142 ? -32.683 2.435  -11.742 1.00 32.60 ? 142 ASP A CA  1 
ATOM   1061 C  C   . ASP A 1 142 ? -31.218 2.827  -11.454 1.00 32.36 ? 142 ASP A C   1 
ATOM   1062 O  O   . ASP A 1 142 ? -30.289 2.088  -11.786 1.00 33.15 ? 142 ASP A O   1 
ATOM   1063 C  CB  . ASP A 1 142 ? -33.152 2.950  -13.140 1.00 32.97 ? 142 ASP A CB  1 
ATOM   1064 C  CG  . ASP A 1 142 ? -34.430 3.805  -13.117 1.00 35.24 ? 142 ASP A CG  1 
ATOM   1065 O  OD1 . ASP A 1 142 ? -34.481 4.872  -12.449 1.00 35.21 ? 142 ASP A OD1 1 
ATOM   1066 O  OD2 . ASP A 1 142 ? -35.378 3.425  -13.850 1.00 36.17 ? 142 ASP A OD2 1 
ATOM   1067 N  N   . ARG A 1 143 ? -31.055 3.973  -10.792 1.00 32.42 ? 143 ARG A N   1 
ATOM   1068 C  CA  . ARG A 1 143 ? -29.791 4.652  -10.571 1.00 31.67 ? 143 ARG A CA  1 
ATOM   1069 C  C   . ARG A 1 143 ? -29.754 5.148  -9.128  1.00 31.33 ? 143 ARG A C   1 
ATOM   1070 O  O   . ARG A 1 143 ? -30.804 5.248  -8.458  1.00 31.72 ? 143 ARG A O   1 
ATOM   1071 C  CB  . ARG A 1 143 ? -29.704 5.869  -11.496 1.00 32.48 ? 143 ARG A CB  1 
ATOM   1072 C  CG  . ARG A 1 143 ? -30.868 6.827  -11.295 1.00 33.38 ? 143 ARG A CG  1 
ATOM   1073 C  CD  . ARG A 1 143 ? -30.827 8.074  -12.145 1.00 35.66 ? 143 ARG A CD  1 
ATOM   1074 N  NE  . ARG A 1 143 ? -32.114 8.771  -12.064 1.00 36.29 ? 143 ARG A NE  1 
ATOM   1075 C  CZ  . ARG A 1 143 ? -32.402 9.930  -12.657 1.00 38.47 ? 143 ARG A CZ  1 
ATOM   1076 N  NH1 . ARG A 1 143 ? -31.487 10.575 -13.382 1.00 37.85 ? 143 ARG A NH1 1 
ATOM   1077 N  NH2 . ARG A 1 143 ? -33.616 10.456 -12.516 1.00 39.81 ? 143 ARG A NH2 1 
ATOM   1078 N  N   . PHE A 1 144 ? -28.556 5.466  -8.654  1.00 29.94 ? 144 PHE A N   1 
ATOM   1079 C  CA  . PHE A 1 144 ? -28.366 6.115  -7.340  1.00 29.56 ? 144 PHE A CA  1 
ATOM   1080 C  C   . PHE A 1 144 ? -28.837 5.285  -6.147  1.00 27.78 ? 144 PHE A C   1 
ATOM   1081 O  O   . PHE A 1 144 ? -29.192 5.836  -5.101  1.00 28.02 ? 144 PHE A O   1 
ATOM   1082 C  CB  . PHE A 1 144 ? -29.073 7.467  -7.309  1.00 29.91 ? 144 PHE A CB  1 
ATOM   1083 C  CG  . PHE A 1 144 ? -28.617 8.422  -8.380  1.00 31.59 ? 144 PHE A CG  1 
ATOM   1084 C  CD1 . PHE A 1 144 ? -27.272 8.529  -8.720  1.00 34.65 ? 144 PHE A CD1 1 
ATOM   1085 C  CD2 . PHE A 1 144 ? -29.530 9.219  -9.034  1.00 31.90 ? 144 PHE A CD2 1 
ATOM   1086 C  CE1 . PHE A 1 144 ? -26.856 9.426  -9.721  1.00 35.08 ? 144 PHE A CE1 1 
ATOM   1087 C  CE2 . PHE A 1 144 ? -29.130 10.110 -10.041 1.00 32.47 ? 144 PHE A CE2 1 
ATOM   1088 C  CZ  . PHE A 1 144 ? -27.793 10.223 -10.371 1.00 33.38 ? 144 PHE A CZ  1 
ATOM   1089 N  N   . THR A 1 145 ? -28.866 3.970  -6.301  1.00 25.84 ? 145 THR A N   1 
ATOM   1090 C  CA  . THR A 1 145 ? -29.372 3.118  -5.220  1.00 24.32 ? 145 THR A CA  1 
ATOM   1091 C  C   . THR A 1 145 ? -28.353 2.996  -4.095  1.00 22.75 ? 145 THR A C   1 
ATOM   1092 O  O   . THR A 1 145 ? -28.719 2.730  -2.946  1.00 21.43 ? 145 THR A O   1 
ATOM   1093 C  CB  . THR A 1 145 ? -29.764 1.686  -5.676  1.00 23.95 ? 145 THR A CB  1 
ATOM   1094 O  OG1 . THR A 1 145 ? -28.592 0.967  -6.046  1.00 23.96 ? 145 THR A OG1 1 
ATOM   1095 C  CG2 . THR A 1 145 ? -30.750 1.702  -6.830  1.00 25.51 ? 145 THR A CG2 1 
ATOM   1096 N  N   . ALA A 1 146 ? -27.076 3.170  -4.440  1.00 22.20 ? 146 ALA A N   1 
ATOM   1097 C  CA  . ALA A 1 146 ? -25.973 3.078  -3.456  1.00 21.31 ? 146 ALA A CA  1 
ATOM   1098 C  C   . ALA A 1 146 ? -26.071 1.934  -2.440  1.00 20.70 ? 146 ALA A C   1 
ATOM   1099 O  O   . ALA A 1 146 ? -26.154 2.168  -1.234  1.00 20.75 ? 146 ALA A O   1 
ATOM   1100 C  CB  . ALA A 1 146 ? -25.825 4.424  -2.732  1.00 21.90 ? 146 ALA A CB  1 
ATOM   1101 N  N   . THR A 1 147 ? -26.095 0.685  -2.899  1.00 20.94 ? 147 THR A N   1 
ATOM   1102 C  CA  . THR A 1 147 ? -26.141 -0.435 -1.962  1.00 21.16 ? 147 THR A CA  1 
ATOM   1103 C  C   . THR A 1 147 ? -24.829 -1.214 -1.964  1.00 21.12 ? 147 THR A C   1 
ATOM   1104 O  O   . THR A 1 147 ? -24.771 -2.312 -1.471  1.00 22.86 ? 147 THR A O   1 
ATOM   1105 C  CB  . THR A 1 147 ? -27.318 -1.410 -2.231  1.00 21.07 ? 147 THR A CB  1 
ATOM   1106 O  OG1 . THR A 1 147 ? -27.171 -1.998 -3.538  1.00 21.05 ? 147 THR A OG1 1 
ATOM   1107 C  CG2 . THR A 1 147 ? -28.675 -0.676 -2.077  1.00 22.32 ? 147 THR A CG2 1 
ATOM   1108 N  N   . ASP A 1 148 ? -23.790 -0.614 -2.535  1.00 21.30 ? 148 ASP A N   1 
ATOM   1109 C  CA  . ASP A 1 148 ? -22.454 -1.208 -2.636  1.00 20.11 ? 148 ASP A CA  1 
ATOM   1110 C  C   . ASP A 1 148 ? -21.643 -0.744 -1.470  1.00 19.29 ? 148 ASP A C   1 
ATOM   1111 O  O   . ASP A 1 148 ? -22.039 0.211  -0.831  1.00 18.88 ? 148 ASP A O   1 
ATOM   1112 C  CB  . ASP A 1 148 ? -21.793 -0.737 -3.932  1.00 19.64 ? 148 ASP A CB  1 
ATOM   1113 C  CG  . ASP A 1 148 ? -21.693 0.751  -4.001  1.00 18.98 ? 148 ASP A CG  1 
ATOM   1114 O  OD1 . ASP A 1 148 ? -22.678 1.440  -4.400  1.00 18.53 ? 148 ASP A OD1 1 
ATOM   1115 O  OD2 . ASP A 1 148 ? -20.618 1.244  -3.651  1.00 21.41 ? 148 ASP A OD2 1 
ATOM   1116 N  N   . PRO A 1 149 ? -20.471 -1.384 -1.201  1.00 20.14 ? 149 PRO A N   1 
ATOM   1117 C  CA  . PRO A 1 149 ? -19.677 -1.025 -0.011  1.00 20.00 ? 149 PRO A CA  1 
ATOM   1118 C  C   . PRO A 1 149 ? -18.599 0.040  -0.234  1.00 21.02 ? 149 PRO A C   1 
ATOM   1119 O  O   . PRO A 1 149 ? -17.938 0.470  0.731   1.00 21.29 ? 149 PRO A O   1 
ATOM   1120 C  CB  . PRO A 1 149 ? -18.998 -2.346 0.342   1.00 20.32 ? 149 PRO A CB  1 
ATOM   1121 C  CG  . PRO A 1 149 ? -18.640 -2.898 -1.027  1.00 20.87 ? 149 PRO A CG  1 
ATOM   1122 C  CD  . PRO A 1 149 ? -19.951 -2.619 -1.821  1.00 20.32 ? 149 PRO A CD  1 
ATOM   1123 N  N   . ASP A 1 150 ? -18.417 0.439  -1.482  1.00 21.00 ? 150 ASP A N   1 
ATOM   1124 C  CA  . ASP A 1 150 ? -17.511 1.527  -1.864  1.00 20.84 ? 150 ASP A CA  1 
ATOM   1125 C  C   . ASP A 1 150 ? -18.091 2.918  -1.657  1.00 20.47 ? 150 ASP A C   1 
ATOM   1126 O  O   . ASP A 1 150 ? -17.374 3.812  -1.230  1.00 20.58 ? 150 ASP A O   1 
ATOM   1127 C  CB  . ASP A 1 150 ? -17.148 1.426  -3.323  1.00 20.45 ? 150 ASP A CB  1 
ATOM   1128 C  CG  . ASP A 1 150 ? -16.377 0.159  -3.651  1.00 21.98 ? 150 ASP A CG  1 
ATOM   1129 O  OD1 . ASP A 1 150 ? -15.681 -0.381 -2.762  1.00 21.74 ? 150 ASP A OD1 1 
ATOM   1130 O  OD2 . ASP A 1 150 ? -16.452 -0.268 -4.829  1.00 19.50 ? 150 ASP A OD2 1 
ATOM   1131 N  N   . ASN A 1 151 ? -19.355 3.121  -2.017  1.00 19.67 ? 151 ASN A N   1 
ATOM   1132 C  CA  . ASN A 1 151 ? -19.944 4.454  -1.889  1.00 19.76 ? 151 ASN A CA  1 
ATOM   1133 C  C   . ASN A 1 151 ? -19.573 5.122  -0.548  1.00 19.98 ? 151 ASN A C   1 
ATOM   1134 O  O   . ASN A 1 151 ? -19.966 4.649  0.524   1.00 20.12 ? 151 ASN A O   1 
ATOM   1135 C  CB  . ASN A 1 151 ? -21.465 4.408  -2.082  1.00 18.43 ? 151 ASN A CB  1 
ATOM   1136 C  CG  . ASN A 1 151 ? -22.082 5.810  -2.216  1.00 21.46 ? 151 ASN A CG  1 
ATOM   1137 O  OD1 . ASN A 1 151 ? -21.900 6.672  -1.343  1.00 22.53 ? 151 ASN A OD1 1 
ATOM   1138 N  ND2 . ASN A 1 151 ? -22.821 6.039  -3.306  1.00 18.28 ? 151 ASN A ND2 1 
ATOM   1139 N  N   . ILE A 1 152 ? -18.820 6.212  -0.601  1.00 19.88 ? 152 ILE A N   1 
ATOM   1140 C  CA  . ILE A 1 152 ? -18.408 6.892  0.651   1.00 20.69 ? 152 ILE A CA  1 
ATOM   1141 C  C   . ILE A 1 152 ? -19.438 6.877  1.817   1.00 20.22 ? 152 ILE A C   1 
ATOM   1142 O  O   . ILE A 1 152 ? -19.057 6.615  2.965   1.00 22.02 ? 152 ILE A O   1 
ATOM   1143 C  CB  . ILE A 1 152 ? -17.868 8.329  0.418   1.00 20.25 ? 152 ILE A CB  1 
ATOM   1144 C  CG1 . ILE A 1 152 ? -17.361 8.951  1.735   1.00 20.07 ? 152 ILE A CG1 1 
ATOM   1145 C  CG2 . ILE A 1 152 ? -18.921 9.239  -0.231  1.00 20.16 ? 152 ILE A CG2 1 
ATOM   1146 C  CD1 . ILE A 1 152 ? -16.146 8.245  2.363   1.00 22.05 ? 152 ILE A CD1 1 
ATOM   1147 N  N   . VAL A 1 153 ? -20.716 7.129  1.531   1.00 20.84 ? 153 VAL A N   1 
ATOM   1148 C  CA  . VAL A 1 153 ? -21.764 7.133  2.568   1.00 19.69 ? 153 VAL A CA  1 
ATOM   1149 C  C   . VAL A 1 153 ? -21.904 5.826  3.376   1.00 20.17 ? 153 VAL A C   1 
ATOM   1150 O  O   . VAL A 1 153 ? -22.206 5.880  4.569   1.00 18.06 ? 153 VAL A O   1 
ATOM   1151 C  CB  . VAL A 1 153 ? -23.169 7.609  2.046   1.00 21.32 ? 153 VAL A CB  1 
ATOM   1152 C  CG1 . VAL A 1 153 ? -23.957 6.442  1.551   1.00 22.33 ? 153 VAL A CG1 1 
ATOM   1153 C  CG2 . VAL A 1 153 ? -23.943 8.289  3.180   1.00 16.04 ? 153 VAL A CG2 1 
ATOM   1154 N  N   . ASN A 1 154 ? -21.632 4.668  2.761   1.00 19.95 ? 154 ASN A N   1 
ATOM   1155 C  CA  . ASN A 1 154 ? -21.684 3.373  3.488   1.00 20.59 ? 154 ASN A CA  1 
ATOM   1156 C  C   . ASN A 1 154 ? -20.348 3.002  4.154   1.00 20.70 ? 154 ASN A C   1 
ATOM   1157 O  O   . ASN A 1 154 ? -20.145 1.837  4.605   1.00 20.62 ? 154 ASN A O   1 
ATOM   1158 C  CB  . ASN A 1 154 ? -22.087 2.240  2.533   1.00 20.57 ? 154 ASN A CB  1 
ATOM   1159 C  CG  . ASN A 1 154 ? -23.449 2.471  1.879   1.00 20.40 ? 154 ASN A CG  1 
ATOM   1160 O  OD1 . ASN A 1 154 ? -24.398 3.000  2.504   1.00 19.58 ? 154 ASN A OD1 1 
ATOM   1161 N  ND2 . ASN A 1 154 ? -23.536 2.121  0.578   1.00 21.16 ? 154 ASN A ND2 1 
ATOM   1162 N  N   . ARG A 1 155 ? -19.435 3.972  4.215   1.00 20.52 ? 155 ARG A N   1 
ATOM   1163 C  CA  . ARG A 1 155 ? -18.165 3.727  4.872   1.00 20.92 ? 155 ARG A CA  1 
ATOM   1164 C  C   . ARG A 1 155 ? -18.116 4.450  6.224   1.00 21.61 ? 155 ARG A C   1 
ATOM   1165 O  O   . ARG A 1 155 ? -17.038 4.652  6.788   1.00 22.14 ? 155 ARG A O   1 
ATOM   1166 C  CB  . ARG A 1 155 ? -16.992 4.116  3.984   1.00 20.40 ? 155 ARG A CB  1 
ATOM   1167 C  CG  . ARG A 1 155 ? -17.012 3.417  2.625   1.00 20.87 ? 155 ARG A CG  1 
ATOM   1168 C  CD  . ARG A 1 155 ? -15.832 3.865  1.824   1.00 20.95 ? 155 ARG A CD  1 
ATOM   1169 N  NE  . ARG A 1 155 ? -14.577 3.490  2.475   1.00 19.95 ? 155 ARG A NE  1 
ATOM   1170 C  CZ  . ARG A 1 155 ? -13.384 3.931  2.090   1.00 19.48 ? 155 ARG A CZ  1 
ATOM   1171 N  NH1 . ARG A 1 155 ? -13.268 4.744  1.040   1.00 19.42 ? 155 ARG A NH1 1 
ATOM   1172 N  NH2 . ARG A 1 155 ? -12.299 3.529  2.739   1.00 23.19 ? 155 ARG A NH2 1 
ATOM   1173 N  N   . CYS A 1 156 ? -19.286 4.816  6.740   1.00 21.57 ? 156 CYS A N   1 
ATOM   1174 C  CA  . CYS A 1 156 ? -19.417 5.130  8.176   1.00 22.08 ? 156 CYS A CA  1 
ATOM   1175 C  C   . CYS A 1 156 ? -19.168 3.830  8.971   1.00 22.26 ? 156 CYS A C   1 
ATOM   1176 O  O   . CYS A 1 156 ? -18.945 2.759  8.386   1.00 21.68 ? 156 CYS A O   1 
ATOM   1177 C  CB  . CYS A 1 156 ? -20.770 5.772  8.495   1.00 21.87 ? 156 CYS A CB  1 
ATOM   1178 S  SG  . CYS A 1 156 ? -22.156 4.746  7.965   1.00 23.48 ? 156 CYS A SG  1 
ATOM   1179 N  N   . ALA A 1 157 ? -19.142 3.946  10.294  1.00 22.52 ? 157 ALA A N   1 
ATOM   1180 C  CA  . ALA A 1 157 ? -18.797 2.831  11.145  1.00 22.99 ? 157 ALA A CA  1 
ATOM   1181 C  C   . ALA A 1 157 ? -19.787 1.674  11.021  1.00 22.97 ? 157 ALA A C   1 
ATOM   1182 O  O   . ALA A 1 157 ? -19.393 0.507  11.043  1.00 22.24 ? 157 ALA A O   1 
ATOM   1183 C  CB  . ALA A 1 157 ? -18.649 3.275  12.594  1.00 22.97 ? 157 ALA A CB  1 
ATOM   1184 N  N   . SER A 1 158 ? -21.064 2.007  10.864  1.00 22.80 ? 158 SER A N   1 
ATOM   1185 C  CA  . SER A 1 158 ? -22.100 0.991  10.783  1.00 23.12 ? 158 SER A CA  1 
ATOM   1186 C  C   . SER A 1 158 ? -22.027 0.296  9.414   1.00 23.36 ? 158 SER A C   1 
ATOM   1187 O  O   . SER A 1 158 ? -22.508 -0.836 9.262   1.00 24.95 ? 158 SER A O   1 
ATOM   1188 C  CB  . SER A 1 158 ? -23.481 1.588  11.063  1.00 22.06 ? 158 SER A CB  1 
ATOM   1189 O  OG  . SER A 1 158 ? -23.882 2.457  9.994   1.00 22.44 ? 158 SER A OG  1 
ATOM   1190 N  N   . GLY A 1 159 ? -21.369 0.940  8.449   1.00 23.24 ? 159 GLY A N   1 
ATOM   1191 C  CA  . GLY A 1 159 ? -21.319 0.446  7.069   1.00 23.49 ? 159 GLY A CA  1 
ATOM   1192 C  C   . GLY A 1 159 ? -22.630 0.621  6.288   1.00 23.65 ? 159 GLY A C   1 
ATOM   1193 O  O   . GLY A 1 159 ? -22.817 0.011  5.230   1.00 24.27 ? 159 GLY A O   1 
ATOM   1194 N  N   . LYS A 1 160 ? -23.546 1.431  6.815   1.00 23.30 ? 160 LYS A N   1 
ATOM   1195 C  CA  . LYS A 1 160 ? -24.877 1.608  6.233   1.00 23.07 ? 160 LYS A CA  1 
ATOM   1196 C  C   . LYS A 1 160 ? -25.253 3.088  6.259   1.00 22.59 ? 160 LYS A C   1 
ATOM   1197 O  O   . LYS A 1 160 ? -25.593 3.629  7.321   1.00 22.95 ? 160 LYS A O   1 
ATOM   1198 C  CB  . LYS A 1 160 ? -25.916 0.821  7.035   1.00 23.36 ? 160 LYS A CB  1 
ATOM   1199 C  CG  . LYS A 1 160 ? -25.700 -0.660 7.158   1.00 26.03 ? 160 LYS A CG  1 
ATOM   1200 C  CD  . LYS A 1 160 ? -26.796 -1.292 8.020   1.00 30.28 ? 160 LYS A CD  1 
ATOM   1201 C  CE  . LYS A 1 160 ? -26.947 -0.605 9.379   1.00 33.28 ? 160 LYS A CE  1 
ATOM   1202 N  NZ  . LYS A 1 160 ? -28.108 0.356  9.452   1.00 36.72 ? 160 LYS A NZ  1 
ATOM   1203 N  N   . GLY A 1 161 ? -25.194 3.746  5.099   1.00 21.11 ? 161 GLY A N   1 
ATOM   1204 C  CA  . GLY A 1 161 ? -25.420 5.176  5.010   1.00 19.63 ? 161 GLY A CA  1 
ATOM   1205 C  C   . GLY A 1 161 ? -26.693 5.487  4.229   1.00 19.26 ? 161 GLY A C   1 
ATOM   1206 O  O   . GLY A 1 161 ? -27.371 4.570  3.799   1.00 17.85 ? 161 GLY A O   1 
ATOM   1207 N  N   . VAL A 1 162 ? -27.030 6.774  4.077   1.00 17.89 ? 162 VAL A N   1 
ATOM   1208 C  CA  . VAL A 1 162 ? -28.231 7.164  3.320   1.00 19.00 ? 162 VAL A CA  1 
ATOM   1209 C  C   . VAL A 1 162 ? -27.827 8.251  2.351   1.00 17.73 ? 162 VAL A C   1 
ATOM   1210 O  O   . VAL A 1 162 ? -27.374 9.326  2.754   1.00 18.78 ? 162 VAL A O   1 
ATOM   1211 C  CB  . VAL A 1 162 ? -29.356 7.744  4.218   1.00 18.16 ? 162 VAL A CB  1 
ATOM   1212 C  CG1 . VAL A 1 162 ? -30.448 8.424  3.382   1.00 20.18 ? 162 VAL A CG1 1 
ATOM   1213 C  CG2 . VAL A 1 162 ? -29.948 6.684  5.125   1.00 21.21 ? 162 VAL A CG2 1 
ATOM   1214 N  N   . GLN A 1 163 ? -28.038 7.992  1.077   1.00 17.52 ? 163 GLN A N   1 
ATOM   1215 C  CA  . GLN A 1 163 ? -27.676 8.930  0.056   1.00 16.93 ? 163 GLN A CA  1 
ATOM   1216 C  C   . GLN A 1 163 ? -28.920 9.687  -0.465  1.00 17.78 ? 163 GLN A C   1 
ATOM   1217 O  O   . GLN A 1 163 ? -29.934 9.059  -0.841  1.00 17.81 ? 163 GLN A O   1 
ATOM   1218 C  CB  . GLN A 1 163 ? -26.981 8.184  -1.103  1.00 16.20 ? 163 GLN A CB  1 
ATOM   1219 C  CG  . GLN A 1 163 ? -26.592 9.135  -2.211  1.00 18.77 ? 163 GLN A CG  1 
ATOM   1220 C  CD  . GLN A 1 163 ? -25.964 8.446  -3.408  1.00 21.95 ? 163 GLN A CD  1 
ATOM   1221 O  OE1 . GLN A 1 163 ? -24.766 8.496  -3.571  1.00 22.58 ? 163 GLN A OE1 1 
ATOM   1222 N  NE2 . GLN A 1 163 ? -26.794 7.823  -4.269  1.00 23.28 ? 163 GLN A NE2 1 
ATOM   1223 N  N   . LEU A 1 164 ? -28.845 11.018 -0.518  1.00 17.19 ? 164 LEU A N   1 
ATOM   1224 C  CA  . LEU A 1 164 ? -29.890 11.785 -1.193  1.00 17.06 ? 164 LEU A CA  1 
ATOM   1225 C  C   . LEU A 1 164 ? -29.380 12.365 -2.498  1.00 16.86 ? 164 LEU A C   1 
ATOM   1226 O  O   . LEU A 1 164 ? -28.364 13.012 -2.532  1.00 16.71 ? 164 LEU A O   1 
ATOM   1227 C  CB  . LEU A 1 164 ? -30.456 12.927 -0.324  1.00 17.70 ? 164 LEU A CB  1 
ATOM   1228 C  CG  . LEU A 1 164 ? -31.278 12.596 0.936   1.00 18.65 ? 164 LEU A CG  1 
ATOM   1229 C  CD1 . LEU A 1 164 ? -30.415 11.990 2.025   1.00 16.72 ? 164 LEU A CD1 1 
ATOM   1230 C  CD2 . LEU A 1 164 ? -31.965 13.864 1.470   1.00 19.51 ? 164 LEU A CD2 1 
ATOM   1231 N  N   . GLU A 1 165 ? -30.100 12.141 -3.581  1.00 17.48 ? 165 GLU A N   1 
ATOM   1232 C  CA  . GLU A 1 165 ? -29.675 12.715 -4.857  1.00 18.57 ? 165 GLU A CA  1 
ATOM   1233 C  C   . GLU A 1 165 ? -30.780 13.670 -5.277  1.00 19.52 ? 165 GLU A C   1 
ATOM   1234 O  O   . GLU A 1 165 ? -31.890 13.228 -5.605  1.00 18.37 ? 165 GLU A O   1 
ATOM   1235 C  CB  . GLU A 1 165 ? -29.423 11.593 -5.875  1.00 18.44 ? 165 GLU A CB  1 
ATOM   1236 C  CG  . GLU A 1 165 ? -28.062 10.822 -5.693  1.00 18.82 ? 165 GLU A CG  1 
ATOM   1237 C  CD  . GLU A 1 165 ? -26.934 11.318 -6.590  1.00 18.87 ? 165 GLU A CD  1 
ATOM   1238 O  OE1 . GLU A 1 165 ? -27.138 12.255 -7.357  1.00 21.83 ? 165 GLU A OE1 1 
ATOM   1239 O  OE2 . GLU A 1 165 ? -25.817 10.786 -6.512  1.00 22.94 ? 165 GLU A OE2 1 
ATOM   1240 N  N   . ILE A 1 166 ? -30.479 14.980 -5.223  1.00 19.98 ? 166 ILE A N   1 
ATOM   1241 C  CA  . ILE A 1 166 ? -31.476 16.009 -5.382  1.00 20.18 ? 166 ILE A CA  1 
ATOM   1242 C  C   . ILE A 1 166 ? -31.378 16.660 -6.765  1.00 20.60 ? 166 ILE A C   1 
ATOM   1243 O  O   . ILE A 1 166 ? -30.314 17.124 -7.171  1.00 20.70 ? 166 ILE A O   1 
ATOM   1244 C  CB  . ILE A 1 166 ? -31.328 17.076 -4.255  1.00 20.13 ? 166 ILE A CB  1 
ATOM   1245 C  CG1 . ILE A 1 166 ? -30.969 16.388 -2.920  1.00 20.14 ? 166 ILE A CG1 1 
ATOM   1246 C  CG2 . ILE A 1 166 ? -32.602 17.880 -4.103  1.00 19.06 ? 166 ILE A CG2 1 
ATOM   1247 C  CD1 . ILE A 1 166 ? -30.832 17.383 -1.797  1.00 25.42 ? 166 ILE A CD1 1 
ATOM   1248 N  N   . SER A 1 167 ? -32.497 16.691 -7.472  1.00 21.27 ? 167 SER A N   1 
ATOM   1249 C  CA  . SER A 1 167 ? -32.532 17.166 -8.861  1.00 22.07 ? 167 SER A CA  1 
ATOM   1250 C  C   . SER A 1 167 ? -32.221 18.660 -8.920  1.00 22.44 ? 167 SER A C   1 
ATOM   1251 O  O   . SER A 1 167 ? -32.461 19.387 -7.953  1.00 21.98 ? 167 SER A O   1 
ATOM   1252 C  CB  . SER A 1 167 ? -33.901 16.912 -9.487  1.00 21.84 ? 167 SER A CB  1 
ATOM   1253 O  OG  . SER A 1 167 ? -34.854 17.810 -8.940  1.00 22.46 ? 167 SER A OG  1 
ATOM   1254 N  N   . SER A 1 168 ? -31.696 19.094 -10.061 1.00 22.83 ? 168 SER A N   1 
ATOM   1255 C  CA  . SER A 1 168 ? -31.274 20.467 -10.246 1.00 24.10 ? 168 SER A CA  1 
ATOM   1256 C  C   . SER A 1 168 ? -32.457 21.419 -10.124 1.00 23.84 ? 168 SER A C   1 
ATOM   1257 O  O   . SER A 1 168 ? -32.288 22.540 -9.633  1.00 24.18 ? 168 SER A O   1 
ATOM   1258 C  CB  . SER A 1 168 ? -30.549 20.663 -11.589 1.00 25.01 ? 168 SER A CB  1 
ATOM   1259 O  OG  . SER A 1 168 ? -31.321 20.183 -12.677 1.00 26.26 ? 168 SER A OG  1 
ATOM   1260 N  N   . ALA A 1 169 ? -33.635 20.978 -10.573 1.00 23.82 ? 169 ALA A N   1 
ATOM   1261 C  CA  . ALA A 1 169 ? -34.872 21.752 -10.421 1.00 24.25 ? 169 ALA A CA  1 
ATOM   1262 C  C   . ALA A 1 169 ? -35.180 21.970 -8.951  1.00 25.01 ? 169 ALA A C   1 
ATOM   1263 O  O   . ALA A 1 169 ? -35.617 23.067 -8.536  1.00 25.22 ? 169 ALA A O   1 
ATOM   1264 C  CB  . ALA A 1 169 ? -36.019 21.044 -11.063 1.00 24.50 ? 169 ALA A CB  1 
ATOM   1265 N  N   . GLN A 1 170 ? -34.964 20.924 -8.153  1.00 25.35 ? 170 GLN A N   1 
ATOM   1266 C  CA  . GLN A 1 170 ? -35.374 20.978 -6.757  1.00 24.66 ? 170 GLN A CA  1 
ATOM   1267 C  C   . GLN A 1 170 ? -34.485 21.930 -5.962  1.00 25.33 ? 170 GLN A C   1 
ATOM   1268 O  O   . GLN A 1 170 ? -34.978 22.730 -5.129  1.00 26.03 ? 170 GLN A O   1 
ATOM   1269 C  CB  . GLN A 1 170 ? -35.389 19.585 -6.115  1.00 24.30 ? 170 GLN A CB  1 
ATOM   1270 C  CG  . GLN A 1 170 ? -35.606 19.636 -4.571  1.00 22.80 ? 170 GLN A CG  1 
ATOM   1271 C  CD  . GLN A 1 170 ? -36.962 20.181 -4.160  1.00 21.97 ? 170 GLN A CD  1 
ATOM   1272 O  OE1 . GLN A 1 170 ? -37.944 19.448 -4.094  1.00 21.69 ? 170 GLN A OE1 1 
ATOM   1273 N  NE2 . GLN A 1 170 ? -37.019 21.463 -3.849  1.00 23.43 ? 170 GLN A NE2 1 
ATOM   1274 N  N   . ARG A 1 171 ? -33.179 21.797 -6.193  1.00 25.00 ? 171 ARG A N   1 
ATOM   1275 C  CA  . ARG A 1 171 ? -32.160 22.669 -5.626  1.00 24.45 ? 171 ARG A CA  1 
ATOM   1276 C  C   . ARG A 1 171 ? -32.305 24.130 -6.086  1.00 25.15 ? 171 ARG A C   1 
ATOM   1277 O  O   . ARG A 1 171 ? -32.061 25.039 -5.293  1.00 25.85 ? 171 ARG A O   1 
ATOM   1278 C  CB  . ARG A 1 171 ? -30.768 22.129 -5.935  1.00 24.77 ? 171 ARG A CB  1 
ATOM   1279 C  CG  . ARG A 1 171 ? -30.537 20.704 -5.442  1.00 24.66 ? 171 ARG A CG  1 
ATOM   1280 C  CD  . ARG A 1 171 ? -29.145 20.169 -5.807  1.00 23.40 ? 171 ARG A CD  1 
ATOM   1281 N  NE  . ARG A 1 171 ? -29.062 19.673 -7.168  1.00 22.10 ? 171 ARG A NE  1 
ATOM   1282 C  CZ  . ARG A 1 171 ? -28.210 20.133 -8.088  1.00 24.45 ? 171 ARG A CZ  1 
ATOM   1283 N  NH1 . ARG A 1 171 ? -27.318 21.100 -7.802  1.00 22.93 ? 171 ARG A NH1 1 
ATOM   1284 N  NH2 . ARG A 1 171 ? -28.223 19.604 -9.294  1.00 20.92 ? 171 ARG A NH2 1 
ATOM   1285 N  N   . ARG A 1 172 ? -32.732 24.365 -7.331  1.00 24.39 ? 172 ARG A N   1 
ATOM   1286 C  CA  . ARG A 1 172 ? -33.065 25.719 -7.747  1.00 25.06 ? 172 ARG A CA  1 
ATOM   1287 C  C   . ARG A 1 172 ? -34.249 26.269 -6.947  1.00 24.81 ? 172 ARG A C   1 
ATOM   1288 O  O   . ARG A 1 172 ? -34.266 27.455 -6.656  1.00 24.28 ? 172 ARG A O   1 
ATOM   1289 C  CB  . ARG A 1 172 ? -33.293 25.872 -9.270  1.00 25.36 ? 172 ARG A CB  1 
ATOM   1290 C  CG  . ARG A 1 172 ? -32.026 26.147 -10.070 1.00 26.44 ? 172 ARG A CG  1 
ATOM   1291 C  CD  . ARG A 1 172 ? -32.318 26.424 -11.533 1.00 26.76 ? 172 ARG A CD  1 
ATOM   1292 N  NE  . ARG A 1 172 ? -31.508 25.640 -12.475 1.00 29.43 ? 172 ARG A NE  1 
ATOM   1293 C  CZ  . ARG A 1 172 ? -30.274 25.925 -12.902 1.00 30.67 ? 172 ARG A CZ  1 
ATOM   1294 N  NH1 . ARG A 1 172 ? -29.597 26.990 -12.466 1.00 31.23 ? 172 ARG A NH1 1 
ATOM   1295 N  NH2 . ARG A 1 172 ? -29.698 25.114 -13.774 1.00 30.53 ? 172 ARG A NH2 1 
ATOM   1296 N  N   . ALA A 1 173 ? -35.179 25.395 -6.529  1.00 24.58 ? 173 ALA A N   1 
ATOM   1297 C  CA  . ALA A 1 173 ? -36.341 25.823 -5.761  1.00 24.47 ? 173 ALA A CA  1 
ATOM   1298 C  C   . ALA A 1 173 ? -36.038 26.071 -4.268  1.00 24.45 ? 173 ALA A C   1 
ATOM   1299 O  O   . ALA A 1 173 ? -36.842 26.676 -3.583  1.00 23.61 ? 173 ALA A O   1 
ATOM   1300 C  CB  . ALA A 1 173 ? -37.542 24.859 -5.958  1.00 25.11 ? 173 ALA A CB  1 
ATOM   1301 N  N   . PHE A 1 174 ? -34.882 25.608 -3.778  1.00 24.37 ? 174 PHE A N   1 
ATOM   1302 C  CA  . PHE A 1 174 ? -34.347 26.057 -2.459  1.00 24.59 ? 174 PHE A CA  1 
ATOM   1303 C  C   . PHE A 1 174 ? -34.066 27.587 -2.388  1.00 24.48 ? 174 PHE A C   1 
ATOM   1304 O  O   . PHE A 1 174 ? -33.976 28.145 -1.287  1.00 23.73 ? 174 PHE A O   1 
ATOM   1305 C  CB  . PHE A 1 174 ? -32.993 25.385 -2.116  1.00 24.57 ? 174 PHE A CB  1 
ATOM   1306 C  CG  . PHE A 1 174 ? -33.034 23.874 -1.871  1.00 24.47 ? 174 PHE A CG  1 
ATOM   1307 C  CD1 . PHE A 1 174 ? -34.196 23.198 -1.518  1.00 24.88 ? 174 PHE A CD1 1 
ATOM   1308 C  CD2 . PHE A 1 174 ? -31.846 23.136 -1.976  1.00 24.47 ? 174 PHE A CD2 1 
ATOM   1309 C  CE1 . PHE A 1 174 ? -34.188 21.813 -1.284  1.00 25.35 ? 174 PHE A CE1 1 
ATOM   1310 C  CE2 . PHE A 1 174 ? -31.831 21.741 -1.747  1.00 24.93 ? 174 PHE A CE2 1 
ATOM   1311 C  CZ  . PHE A 1 174 ? -32.998 21.078 -1.409  1.00 21.71 ? 174 PHE A CZ  1 
ATOM   1312 N  N   . PHE A 1 175 ? -33.864 28.252 -3.525  1.00 23.42 ? 175 PHE A N   1 
ATOM   1313 C  CA  . PHE A 1 175 ? -33.368 29.648 -3.497  1.00 24.85 ? 175 PHE A CA  1 
ATOM   1314 C  C   . PHE A 1 175 ? -34.375 30.640 -4.043  1.00 24.36 ? 175 PHE A C   1 
ATOM   1315 O  O   . PHE A 1 175 ? -35.109 30.341 -4.963  1.00 25.00 ? 175 PHE A O   1 
ATOM   1316 C  CB  . PHE A 1 175 ? -32.016 29.810 -4.231  1.00 23.92 ? 175 PHE A CB  1 
ATOM   1317 C  CG  . PHE A 1 175 ? -30.939 28.898 -3.722  1.00 26.16 ? 175 PHE A CG  1 
ATOM   1318 C  CD1 . PHE A 1 175 ? -30.334 29.125 -2.492  1.00 27.45 ? 175 PHE A CD1 1 
ATOM   1319 C  CD2 . PHE A 1 175 ? -30.548 27.793 -4.466  1.00 26.85 ? 175 PHE A CD2 1 
ATOM   1320 C  CE1 . PHE A 1 175 ? -29.345 28.262 -2.006  1.00 30.02 ? 175 PHE A CE1 1 
ATOM   1321 C  CE2 . PHE A 1 175 ? -29.556 26.924 -3.990  1.00 29.26 ? 175 PHE A CE2 1 
ATOM   1322 C  CZ  . PHE A 1 175 ? -28.955 27.160 -2.759  1.00 27.38 ? 175 PHE A CZ  1 
ATOM   1323 N  N   . GLN A 1 176 ? -34.388 31.820 -3.446  1.00 25.58 ? 176 GLN A N   1 
ATOM   1324 C  CA  . GLN A 1 176 ? -35.243 32.933 -3.829  1.00 25.39 ? 176 GLN A CA  1 
ATOM   1325 C  C   . GLN A 1 176 ? -35.096 33.289 -5.294  1.00 26.65 ? 176 GLN A C   1 
ATOM   1326 O  O   . GLN A 1 176 ? -33.962 33.485 -5.761  1.00 26.72 ? 176 GLN A O   1 
ATOM   1327 C  CB  . GLN A 1 176 ? -34.864 34.131 -2.937  1.00 26.17 ? 176 GLN A CB  1 
ATOM   1328 C  CG  . GLN A 1 176 ? -35.281 33.931 -1.494  1.00 24.04 ? 176 GLN A CG  1 
ATOM   1329 C  CD  . GLN A 1 176 ? -36.739 34.136 -1.334  1.00 25.48 ? 176 GLN A CD  1 
ATOM   1330 O  OE1 . GLN A 1 176 ? -37.296 35.062 -1.925  1.00 28.63 ? 176 GLN A OE1 1 
ATOM   1331 N  NE2 . GLN A 1 176 ? -37.397 33.252 -0.601  1.00 27.53 ? 176 GLN A NE2 1 
ATOM   1332 N  N   . ASN A 1 177 ? -36.215 33.348 -6.037  1.00 28.03 ? 177 ASN A N   1 
ATOM   1333 C  CA  . ASN A 1 177 ? -36.186 33.631 -7.493  1.00 29.16 ? 177 ASN A CA  1 
ATOM   1334 C  C   . ASN A 1 177 ? -35.887 32.396 -8.360  1.00 30.31 ? 177 ASN A C   1 
ATOM   1335 O  O   . ASN A 1 177 ? -35.702 32.516 -9.577  1.00 31.20 ? 177 ASN A O   1 
ATOM   1336 C  CB  . ASN A 1 177 ? -35.130 34.722 -7.797  1.00 29.11 ? 177 ASN A CB  1 
ATOM   1337 C  CG  . ASN A 1 177 ? -35.630 35.795 -8.729  1.00 29.86 ? 177 ASN A CG  1 
ATOM   1338 O  OD1 . ASN A 1 177 ? -36.833 35.937 -8.943  1.00 30.36 ? 177 ASN A OD1 1 
ATOM   1339 N  ND2 . ASN A 1 177 ? -34.703 36.611 -9.248  1.00 29.22 ? 177 ASN A ND2 1 
ATOM   1340 N  N   . ASN A 1 178 ? -35.846 31.211 -7.741  1.00 31.50 ? 178 ASN A N   1 
ATOM   1341 C  CA  . ASN A 1 178 ? -35.328 29.983 -8.381  1.00 32.53 ? 178 ASN A CA  1 
ATOM   1342 C  C   . ASN A 1 178 ? -33.915 30.158 -8.966  1.00 32.34 ? 178 ASN A C   1 
ATOM   1343 O  O   . ASN A 1 178 ? -33.529 29.495 -9.937  1.00 33.90 ? 178 ASN A O   1 
ATOM   1344 C  CB  . ASN A 1 178 ? -36.296 29.445 -9.460  1.00 32.78 ? 178 ASN A CB  1 
ATOM   1345 C  CG  . ASN A 1 178 ? -37.607 28.932 -8.881  1.00 34.30 ? 178 ASN A CG  1 
ATOM   1346 O  OD1 . ASN A 1 178 ? -37.688 28.534 -7.716  1.00 40.17 ? 178 ASN A OD1 1 
ATOM   1347 N  ND2 . ASN A 1 178 ? -38.640 28.919 -9.707  1.00 35.68 ? 178 ASN A ND2 1 
ATOM   1348 N  N   . ASP A 1 179 ? -33.140 31.046 -8.369  1.00 31.45 ? 179 ASP A N   1 
ATOM   1349 C  CA  . ASP A 1 179 ? -31.869 31.425 -8.939  1.00 30.49 ? 179 ASP A CA  1 
ATOM   1350 C  C   . ASP A 1 179 ? -30.727 30.916 -8.070  1.00 29.49 ? 179 ASP A C   1 
ATOM   1351 O  O   . ASP A 1 179 ? -30.559 31.368 -6.948  1.00 27.52 ? 179 ASP A O   1 
ATOM   1352 C  CB  . ASP A 1 179 ? -31.801 32.948 -9.040  1.00 30.40 ? 179 ASP A CB  1 
ATOM   1353 C  CG  . ASP A 1 179 ? -30.449 33.422 -9.499  1.00 31.82 ? 179 ASP A CG  1 
ATOM   1354 O  OD1 . ASP A 1 179 ? -29.870 32.704 -10.329 1.00 33.81 ? 179 ASP A OD1 1 
ATOM   1355 O  OD2 . ASP A 1 179 ? -29.971 34.481 -9.033  1.00 33.13 ? 179 ASP A OD2 1 
ATOM   1356 N  N   . TRP A 1 180 ? -29.932 29.981 -8.575  1.00 29.96 ? 180 TRP A N   1 
ATOM   1357 C  CA  . TRP A 1 180 ? -28.911 29.436 -7.688  1.00 30.58 ? 180 TRP A CA  1 
ATOM   1358 C  C   . TRP A 1 180 ? -27.529 30.094 -7.782  1.00 31.02 ? 180 TRP A C   1 
ATOM   1359 O  O   . TRP A 1 180 ? -26.542 29.511 -7.347  1.00 30.63 ? 180 TRP A O   1 
ATOM   1360 C  CB  . TRP A 1 180 ? -28.843 27.888 -7.723  1.00 30.25 ? 180 TRP A CB  1 
ATOM   1361 C  CG  . TRP A 1 180 ? -28.286 27.246 -8.945  1.00 30.72 ? 180 TRP A CG  1 
ATOM   1362 C  CD1 . TRP A 1 180 ? -27.545 27.835 -9.938  1.00 31.53 ? 180 TRP A CD1 1 
ATOM   1363 C  CD2 . TRP A 1 180 ? -28.365 25.856 -9.272  1.00 32.26 ? 180 TRP A CD2 1 
ATOM   1364 N  NE1 . TRP A 1 180 ? -27.180 26.890 -10.873 1.00 34.25 ? 180 TRP A NE1 1 
ATOM   1365 C  CE2 . TRP A 1 180 ? -27.675 25.671 -10.492 1.00 31.66 ? 180 TRP A CE2 1 
ATOM   1366 C  CE3 . TRP A 1 180 ? -28.967 24.741 -8.651  1.00 32.17 ? 180 TRP A CE3 1 
ATOM   1367 C  CZ2 . TRP A 1 180 ? -27.573 24.426 -11.112 1.00 33.39 ? 180 TRP A CZ2 1 
ATOM   1368 C  CZ3 . TRP A 1 180 ? -28.863 23.488 -9.274  1.00 33.96 ? 180 TRP A CZ3 1 
ATOM   1369 C  CH2 . TRP A 1 180 ? -28.173 23.349 -10.497 1.00 32.82 ? 180 TRP A CH2 1 
ATOM   1370 N  N   . SER A 1 181 ? -27.451 31.326 -8.286  1.00 31.71 ? 181 SER A N   1 
ATOM   1371 C  CA  . SER A 1 181 ? -26.126 31.975 -8.395  1.00 32.27 ? 181 SER A CA  1 
ATOM   1372 C  C   . SER A 1 181 ? -25.495 32.176 -7.016  1.00 32.68 ? 181 SER A C   1 
ATOM   1373 O  O   . SER A 1 181 ? -26.209 32.395 -6.009  1.00 32.45 ? 181 SER A O   1 
ATOM   1374 C  CB  . SER A 1 181 ? -26.173 33.272 -9.216  1.00 32.32 ? 181 SER A CB  1 
ATOM   1375 O  OG  . SER A 1 181 ? -26.943 34.286 -8.590  1.00 32.69 ? 181 SER A OG  1 
ATOM   1376 N  N   . LYS A 1 182 ? -24.163 32.073 -6.958  1.00 33.23 ? 182 LYS A N   1 
ATOM   1377 C  CA  . LYS A 1 182 ? -23.471 32.110 -5.664  1.00 33.33 ? 182 LYS A CA  1 
ATOM   1378 C  C   . LYS A 1 182 ? -23.916 33.328 -4.883  1.00 33.03 ? 182 LYS A C   1 
ATOM   1379 O  O   . LYS A 1 182 ? -24.175 33.246 -3.674  1.00 32.48 ? 182 LYS A O   1 
ATOM   1380 C  CB  . LYS A 1 182 ? -21.936 32.095 -5.818  1.00 33.37 ? 182 LYS A CB  1 
ATOM   1381 C  CG  . LYS A 1 182 ? -21.178 31.430 -4.639  1.00 33.01 ? 182 LYS A CG  1 
ATOM   1382 C  CD  . LYS A 1 182 ? -20.953 32.364 -3.422  1.00 33.63 ? 182 LYS A CD  1 
ATOM   1383 C  CE  . LYS A 1 182 ? -20.897 31.593 -2.094  1.00 34.06 ? 182 LYS A CE  1 
ATOM   1384 N  NZ  . LYS A 1 182 ? -19.812 30.568 -2.064  1.00 37.65 ? 182 LYS A NZ  1 
ATOM   1385 N  N   . ALA A 1 183 ? -24.034 34.445 -5.605  1.00 32.89 ? 183 ALA A N   1 
ATOM   1386 C  CA  . ALA A 1 183 ? -24.316 35.746 -5.018  1.00 32.57 ? 183 ALA A CA  1 
ATOM   1387 C  C   . ALA A 1 183 ? -25.630 35.704 -4.267  1.00 32.21 ? 183 ALA A C   1 
ATOM   1388 O  O   . ALA A 1 183 ? -25.862 36.448 -3.314  1.00 32.66 ? 183 ALA A O   1 
ATOM   1389 C  CB  . ALA A 1 183 ? -24.365 36.790 -6.127  1.00 32.96 ? 183 ALA A CB  1 
ATOM   1390 N  N   . ASN A 1 184 ? -26.478 34.793 -4.711  1.00 32.60 ? 184 ASN A N   1 
ATOM   1391 C  CA  . ASN A 1 184 ? -27.822 34.652 -4.207  1.00 32.03 ? 184 ASN A CA  1 
ATOM   1392 C  C   . ASN A 1 184 ? -28.078 33.409 -3.362  1.00 31.53 ? 184 ASN A C   1 
ATOM   1393 O  O   . ASN A 1 184 ? -29.212 33.134 -3.004  1.00 31.98 ? 184 ASN A O   1 
ATOM   1394 C  CB  . ASN A 1 184 ? -28.794 34.649 -5.382  1.00 32.30 ? 184 ASN A CB  1 
ATOM   1395 C  CG  . ASN A 1 184 ? -30.213 34.872 -4.937  1.00 32.63 ? 184 ASN A CG  1 
ATOM   1396 O  OD1 . ASN A 1 184 ? -30.503 35.848 -4.243  1.00 33.74 ? 184 ASN A OD1 1 
ATOM   1397 N  ND2 . ASN A 1 184 ? -31.101 33.957 -5.299  1.00 32.44 ? 184 ASN A ND2 1 
ATOM   1398 N  N   . ARG A 1 185 ? -27.042 32.651 -3.034  1.00 30.69 ? 185 ARG A N   1 
ATOM   1399 C  CA  . ARG A 1 185 ? -27.249 31.418 -2.261  1.00 30.50 ? 185 ARG A CA  1 
ATOM   1400 C  C   . ARG A 1 185 ? -27.522 31.648 -0.771  1.00 30.24 ? 185 ARG A C   1 
ATOM   1401 O  O   . ARG A 1 185 ? -27.842 30.711 -0.033  1.00 30.54 ? 185 ARG A O   1 
ATOM   1402 C  CB  . ARG A 1 185 ? -26.093 30.429 -2.498  1.00 29.31 ? 185 ARG A CB  1 
ATOM   1403 C  CG  . ARG A 1 185 ? -26.270 29.698 -3.806  1.00 30.20 ? 185 ARG A CG  1 
ATOM   1404 C  CD  . ARG A 1 185 ? -24.997 29.035 -4.234  1.00 25.42 ? 185 ARG A CD  1 
ATOM   1405 N  NE  . ARG A 1 185 ? -24.806 29.120 -5.675  1.00 25.17 ? 185 ARG A NE  1 
ATOM   1406 C  CZ  . ARG A 1 185 ? -23.662 28.837 -6.289  1.00 21.05 ? 185 ARG A CZ  1 
ATOM   1407 N  NH1 . ARG A 1 185 ? -22.599 28.411 -5.594  1.00 20.71 ? 185 ARG A NH1 1 
ATOM   1408 N  NH2 . ARG A 1 185 ? -23.586 28.974 -7.589  1.00 23.96 ? 185 ARG A NH2 1 
ATOM   1409 N  N   . GLY A 1 186 ? -27.414 32.905 -0.336  1.00 30.20 ? 186 GLY A N   1 
ATOM   1410 C  CA  . GLY A 1 186 ? -27.826 33.266 0.999   1.00 29.44 ? 186 GLY A CA  1 
ATOM   1411 C  C   . GLY A 1 186 ? -29.313 33.488 1.166   1.00 29.37 ? 186 GLY A C   1 
ATOM   1412 O  O   . GLY A 1 186 ? -29.778 33.711 2.281   1.00 29.63 ? 186 GLY A O   1 
ATOM   1413 N  N   . ASN A 1 187 ? -30.058 33.394 0.066   1.00 29.31 ? 187 ASN A N   1 
ATOM   1414 C  CA  . ASN A 1 187 ? -31.450 33.810 0.001   1.00 28.85 ? 187 ASN A CA  1 
ATOM   1415 C  C   . ASN A 1 187 ? -32.320 32.595 -0.328  1.00 28.66 ? 187 ASN A C   1 
ATOM   1416 O  O   . ASN A 1 187 ? -32.551 32.282 -1.501  1.00 28.47 ? 187 ASN A O   1 
ATOM   1417 C  CB  . ASN A 1 187 ? -31.638 34.917 -1.070  1.00 28.73 ? 187 ASN A CB  1 
ATOM   1418 C  CG  . ASN A 1 187 ? -30.722 36.123 -0.850  1.00 29.58 ? 187 ASN A CG  1 
ATOM   1419 O  OD1 . ASN A 1 187 ? -30.440 36.492 0.280   1.00 26.36 ? 187 ASN A OD1 1 
ATOM   1420 N  ND2 . ASN A 1 187 ? -30.237 36.723 -1.949  1.00 27.33 ? 187 ASN A ND2 1 
ATOM   1421 N  N   . VAL A 1 188 ? -32.802 31.921 0.716   1.00 27.43 ? 188 VAL A N   1 
ATOM   1422 C  CA  . VAL A 1 188 ? -33.391 30.601 0.562   1.00 27.47 ? 188 VAL A CA  1 
ATOM   1423 C  C   . VAL A 1 188 ? -34.900 30.663 0.770   1.00 27.94 ? 188 VAL A C   1 
ATOM   1424 O  O   . VAL A 1 188 ? -35.420 31.610 1.371   1.00 28.25 ? 188 VAL A O   1 
ATOM   1425 C  CB  . VAL A 1 188 ? -32.684 29.579 1.481   1.00 27.65 ? 188 VAL A CB  1 
ATOM   1426 C  CG1 . VAL A 1 188 ? -31.161 29.621 1.211   1.00 25.39 ? 188 VAL A CG1 1 
ATOM   1427 C  CG2 . VAL A 1 188 ? -32.966 29.884 2.945   1.00 26.98 ? 188 VAL A CG2 1 
ATOM   1428 N  N   . THR A 1 189 ? -35.607 29.682 0.235   1.00 27.47 ? 189 THR A N   1 
ATOM   1429 C  CA  . THR A 1 189 ? -37.064 29.717 0.205   1.00 26.43 ? 189 THR A CA  1 
ATOM   1430 C  C   . THR A 1 189 ? -37.610 28.880 1.342   1.00 26.78 ? 189 THR A C   1 
ATOM   1431 O  O   . THR A 1 189 ? -36.857 28.223 2.072   1.00 27.15 ? 189 THR A O   1 
ATOM   1432 C  CB  . THR A 1 189 ? -37.618 29.080 -1.073  1.00 26.56 ? 189 THR A CB  1 
ATOM   1433 O  OG1 . THR A 1 189 ? -37.215 27.699 -1.098  1.00 24.98 ? 189 THR A OG1 1 
ATOM   1434 C  CG2 . THR A 1 189 ? -37.132 29.793 -2.315  1.00 25.93 ? 189 THR A CG2 1 
ATOM   1435 N  N   . GLN A 1 190 ? -38.927 28.876 1.463   1.00 26.27 ? 190 GLN A N   1 
ATOM   1436 C  CA  . GLN A 1 190 ? -39.608 28.070 2.478   1.00 26.39 ? 190 GLN A CA  1 
ATOM   1437 C  C   . GLN A 1 190 ? -39.397 26.582 2.207   1.00 26.08 ? 190 GLN A C   1 
ATOM   1438 O  O   . GLN A 1 190 ? -39.160 25.836 3.138   1.00 26.09 ? 190 GLN A O   1 
ATOM   1439 C  CB  . GLN A 1 190 ? -41.088 28.406 2.519   1.00 26.39 ? 190 GLN A CB  1 
ATOM   1440 C  CG  . GLN A 1 190 ? -42.035 27.244 2.739   1.00 26.05 ? 190 GLN A CG  1 
ATOM   1441 C  CD  . GLN A 1 190 ? -43.464 27.731 2.658   1.00 28.31 ? 190 GLN A CD  1 
ATOM   1442 O  OE1 . GLN A 1 190 ? -44.099 27.632 1.613   1.00 22.60 ? 190 GLN A OE1 1 
ATOM   1443 N  NE2 . GLN A 1 190 ? -43.952 28.350 3.744   1.00 29.96 ? 190 GLN A NE2 1 
ATOM   1444 N  N   . GLU A 1 191 ? -39.420 26.186 0.934   1.00 26.07 ? 191 GLU A N   1 
ATOM   1445 C  CA  . GLU A 1 191 ? -39.143 24.791 0.550   1.00 26.13 ? 191 GLU A CA  1 
ATOM   1446 C  C   . GLU A 1 191 ? -37.780 24.340 1.056   1.00 25.01 ? 191 GLU A C   1 
ATOM   1447 O  O   . GLU A 1 191 ? -37.678 23.260 1.614   1.00 23.81 ? 191 GLU A O   1 
ATOM   1448 C  CB  . GLU A 1 191 ? -39.261 24.567 -0.961  1.00 26.62 ? 191 GLU A CB  1 
ATOM   1449 C  CG  . GLU A 1 191 ? -39.341 23.072 -1.374  1.00 28.80 ? 191 GLU A CG  1 
ATOM   1450 C  CD  . GLU A 1 191 ? -40.196 22.828 -2.606  1.00 32.97 ? 191 GLU A CD  1 
ATOM   1451 O  OE1 . GLU A 1 191 ? -41.393 23.195 -2.597  1.00 34.06 ? 191 GLU A OE1 1 
ATOM   1452 O  OE2 . GLU A 1 191 ? -39.686 22.260 -3.591  1.00 35.74 ? 191 GLU A OE2 1 
ATOM   1453 N  N   . PHE A 1 192 ? -36.755 25.183 0.890   1.00 24.46 ? 192 PHE A N   1 
ATOM   1454 C  CA  . PHE A 1 192 ? -35.445 24.911 1.513   1.00 23.95 ? 192 PHE A CA  1 
ATOM   1455 C  C   . PHE A 1 192 ? -35.563 24.548 2.981   1.00 22.80 ? 192 PHE A C   1 
ATOM   1456 O  O   . PHE A 1 192 ? -35.095 23.482 3.406   1.00 24.32 ? 192 PHE A O   1 
ATOM   1457 C  CB  . PHE A 1 192 ? -34.429 26.066 1.332   1.00 22.84 ? 192 PHE A CB  1 
ATOM   1458 C  CG  . PHE A 1 192 ? -33.114 25.816 2.026   1.00 23.48 ? 192 PHE A CG  1 
ATOM   1459 C  CD1 . PHE A 1 192 ? -32.125 25.041 1.429   1.00 21.35 ? 192 PHE A CD1 1 
ATOM   1460 C  CD2 . PHE A 1 192 ? -32.876 26.343 3.300   1.00 24.44 ? 192 PHE A CD2 1 
ATOM   1461 C  CE1 . PHE A 1 192 ? -30.904 24.796 2.081   1.00 23.56 ? 192 PHE A CE1 1 
ATOM   1462 C  CE2 . PHE A 1 192 ? -31.678 26.102 3.974   1.00 24.35 ? 192 PHE A CE2 1 
ATOM   1463 C  CZ  . PHE A 1 192 ? -30.676 25.341 3.374   1.00 24.51 ? 192 PHE A CZ  1 
ATOM   1464 N  N   . LEU A 1 193 ? -36.183 25.433 3.758   1.00 23.28 ? 193 LEU A N   1 
ATOM   1465 C  CA  . LEU A 1 193 ? -36.360 25.234 5.219   1.00 21.38 ? 193 LEU A CA  1 
ATOM   1466 C  C   . LEU A 1 193 ? -37.104 23.936 5.581   1.00 22.08 ? 193 LEU A C   1 
ATOM   1467 O  O   . LEU A 1 193 ? -36.666 23.166 6.454   1.00 21.10 ? 193 LEU A O   1 
ATOM   1468 C  CB  . LEU A 1 193 ? -37.034 26.452 5.847   1.00 20.68 ? 193 LEU A CB  1 
ATOM   1469 C  CG  . LEU A 1 193 ? -36.385 27.846 5.614   1.00 18.12 ? 193 LEU A CG  1 
ATOM   1470 C  CD1 . LEU A 1 193 ? -37.202 28.967 6.202   1.00 19.25 ? 193 LEU A CD1 1 
ATOM   1471 C  CD2 . LEU A 1 193 ? -34.958 27.922 6.168   1.00 18.07 ? 193 LEU A CD2 1 
ATOM   1472 N  N   . ASP A 1 194 ? -38.234 23.708 4.918   1.00 22.67 ? 194 ASP A N   1 
ATOM   1473 C  CA  . ASP A 1 194 ? -38.993 22.453 5.067   1.00 22.48 ? 194 ASP A CA  1 
ATOM   1474 C  C   . ASP A 1 194 ? -38.160 21.196 4.738   1.00 22.02 ? 194 ASP A C   1 
ATOM   1475 O  O   . ASP A 1 194 ? -38.285 20.139 5.396   1.00 21.35 ? 194 ASP A O   1 
ATOM   1476 C  CB  . ASP A 1 194 ? -40.248 22.511 4.192   1.00 23.28 ? 194 ASP A CB  1 
ATOM   1477 C  CG  . ASP A 1 194 ? -41.268 23.555 4.665   1.00 24.19 ? 194 ASP A CG  1 
ATOM   1478 O  OD1 . ASP A 1 194 ? -41.209 23.990 5.823   1.00 27.42 ? 194 ASP A OD1 1 
ATOM   1479 O  OD2 . ASP A 1 194 ? -42.171 23.920 3.879   1.00 27.13 ? 194 ASP A OD2 1 
ATOM   1480 N  N   . TYR A 1 195 ? -37.323 21.293 3.706   1.00 22.02 ? 195 TYR A N   1 
ATOM   1481 C  CA  . TYR A 1 195 ? -36.500 20.158 3.292   1.00 21.07 ? 195 TYR A CA  1 
ATOM   1482 C  C   . TYR A 1 195 ? -35.557 19.851 4.457   1.00 20.65 ? 195 TYR A C   1 
ATOM   1483 O  O   . TYR A 1 195 ? -35.562 18.741 4.998   1.00 19.99 ? 195 TYR A O   1 
ATOM   1484 C  CB  . TYR A 1 195 ? -35.733 20.497 2.000   1.00 21.33 ? 195 TYR A CB  1 
ATOM   1485 C  CG  . TYR A 1 195 ? -35.235 19.300 1.202   1.00 20.31 ? 195 TYR A CG  1 
ATOM   1486 C  CD1 . TYR A 1 195 ? -34.148 18.544 1.648   1.00 21.58 ? 195 TYR A CD1 1 
ATOM   1487 C  CD2 . TYR A 1 195 ? -35.822 18.957 0.003   1.00 20.61 ? 195 TYR A CD2 1 
ATOM   1488 C  CE1 . TYR A 1 195 ? -33.686 17.463 0.939   1.00 23.41 ? 195 TYR A CE1 1 
ATOM   1489 C  CE2 . TYR A 1 195 ? -35.354 17.867 -0.737  1.00 21.81 ? 195 TYR A CE2 1 
ATOM   1490 C  CZ  . TYR A 1 195 ? -34.287 17.130 -0.259  1.00 22.61 ? 195 TYR A CZ  1 
ATOM   1491 O  OH  . TYR A 1 195 ? -33.797 16.059 -0.963  1.00 23.39 ? 195 TYR A OH  1 
ATOM   1492 N  N   . ALA A 1 196 ? -34.800 20.857 4.888   1.00 20.37 ? 196 ALA A N   1 
ATOM   1493 C  CA  . ALA A 1 196 ? -33.858 20.661 5.955   1.00 20.31 ? 196 ALA A CA  1 
ATOM   1494 C  C   . ALA A 1 196 ? -34.512 20.160 7.276   1.00 20.31 ? 196 ALA A C   1 
ATOM   1495 O  O   . ALA A 1 196 ? -33.964 19.270 7.940   1.00 20.59 ? 196 ALA A O   1 
ATOM   1496 C  CB  . ALA A 1 196 ? -33.013 21.903 6.155   1.00 21.39 ? 196 ALA A CB  1 
ATOM   1497 N  N   . GLU A 1 197 ? -35.710 20.656 7.599   1.00 21.47 ? 197 GLU A N   1 
ATOM   1498 C  CA  . GLU A 1 197 ? -36.479 20.204 8.778   1.00 21.66 ? 197 GLU A CA  1 
ATOM   1499 C  C   . GLU A 1 197 ? -36.918 18.745 8.641   1.00 21.72 ? 197 GLU A C   1 
ATOM   1500 O  O   . GLU A 1 197 ? -36.870 17.980 9.601   1.00 19.89 ? 197 GLU A O   1 
ATOM   1501 C  CB  . GLU A 1 197 ? -37.694 21.098 9.005   1.00 21.53 ? 197 GLU A CB  1 
ATOM   1502 C  CG  . GLU A 1 197 ? -38.744 20.543 10.007  1.00 25.35 ? 197 GLU A CG  1 
ATOM   1503 C  CD  . GLU A 1 197 ? -38.315 20.684 11.483  1.00 26.37 ? 197 GLU A CD  1 
ATOM   1504 O  OE1 . GLU A 1 197 ? -37.320 21.384 11.764  1.00 25.59 ? 197 GLU A OE1 1 
ATOM   1505 O  OE2 . GLU A 1 197 ? -38.950 20.067 12.360  1.00 27.62 ? 197 GLU A OE2 1 
ATOM   1506 N  N   . ALA A 1 198 ? -37.338 18.362 7.438   1.00 21.55 ? 198 ALA A N   1 
ATOM   1507 C  CA  . ALA A 1 198 ? -37.653 16.947 7.162   1.00 22.49 ? 198 ALA A CA  1 
ATOM   1508 C  C   . ALA A 1 198 ? -36.513 16.000 7.532   1.00 22.72 ? 198 ALA A C   1 
ATOM   1509 O  O   . ALA A 1 198 ? -36.742 14.950 8.092   1.00 23.30 ? 198 ALA A O   1 
ATOM   1510 C  CB  . ALA A 1 198 ? -38.044 16.755 5.713   1.00 21.50 ? 198 ALA A CB  1 
ATOM   1511 N  N   . ILE A 1 199 ? -35.287 16.389 7.220   1.00 23.31 ? 199 ILE A N   1 
ATOM   1512 C  CA  . ILE A 1 199 ? -34.125 15.581 7.518   1.00 23.50 ? 199 ILE A CA  1 
ATOM   1513 C  C   . ILE A 1 199 ? -33.912 15.500 9.038   1.00 23.48 ? 199 ILE A C   1 
ATOM   1514 O  O   . ILE A 1 199 ? -33.625 14.415 9.598   1.00 20.97 ? 199 ILE A O   1 
ATOM   1515 C  CB  . ILE A 1 199 ? -32.872 16.159 6.821   1.00 24.53 ? 199 ILE A CB  1 
ATOM   1516 C  CG1 . ILE A 1 199 ? -33.139 16.398 5.317   1.00 25.46 ? 199 ILE A CG1 1 
ATOM   1517 C  CG2 . ILE A 1 199 ? -31.653 15.272 7.101   1.00 24.53 ? 199 ILE A CG2 1 
ATOM   1518 C  CD1 . ILE A 1 199 ? -33.762 15.223 4.572   1.00 31.09 ? 199 ILE A CD1 1 
ATOM   1519 N  N   . LYS A 1 200 ? -34.084 16.639 9.710   1.00 23.09 ? 200 LYS A N   1 
ATOM   1520 C  CA  . LYS A 1 200 ? -33.916 16.652 11.180  1.00 24.79 ? 200 LYS A CA  1 
ATOM   1521 C  C   . LYS A 1 200 ? -34.958 15.725 11.861  1.00 23.89 ? 200 LYS A C   1 
ATOM   1522 O  O   . LYS A 1 200 ? -34.626 14.952 12.750  1.00 25.19 ? 200 LYS A O   1 
ATOM   1523 C  CB  . LYS A 1 200 ? -33.980 18.072 11.732  1.00 24.29 ? 200 LYS A CB  1 
ATOM   1524 C  CG  . LYS A 1 200 ? -33.819 18.173 13.264  1.00 27.66 ? 200 LYS A CG  1 
ATOM   1525 C  CD  . LYS A 1 200 ? -34.227 19.534 13.810  1.00 32.20 ? 200 LYS A CD  1 
ATOM   1526 C  CE  . LYS A 1 200 ? -35.676 19.944 13.514  1.00 34.12 ? 200 LYS A CE  1 
ATOM   1527 N  NZ  . LYS A 1 200 ? -36.764 19.393 14.405  1.00 33.52 ? 200 LYS A NZ  1 
ATOM   1528 N  N   . GLU A 1 201 ? -36.202 15.808 11.423  1.00 24.33 ? 201 GLU A N   1 
ATOM   1529 C  CA  . GLU A 1 201 ? -37.300 14.984 11.957  1.00 24.12 ? 201 GLU A CA  1 
ATOM   1530 C  C   . GLU A 1 201 ? -37.056 13.504 11.814  1.00 23.52 ? 201 GLU A C   1 
ATOM   1531 O  O   . GLU A 1 201 ? -37.319 12.737 12.754  1.00 23.44 ? 201 GLU A O   1 
ATOM   1532 C  CB  . GLU A 1 201 ? -38.623 15.352 11.262  1.00 24.67 ? 201 GLU A CB  1 
ATOM   1533 C  CG  . GLU A 1 201 ? -39.188 16.706 11.704  1.00 26.74 ? 201 GLU A CG  1 
ATOM   1534 C  CD  . GLU A 1 201 ? -40.486 17.075 11.006  1.00 29.13 ? 201 GLU A CD  1 
ATOM   1535 O  OE1 . GLU A 1 201 ? -41.225 16.169 10.573  1.00 30.55 ? 201 GLU A OE1 1 
ATOM   1536 O  OE2 . GLU A 1 201 ? -40.788 18.288 10.901  1.00 34.73 ? 201 GLU A OE2 1 
ATOM   1537 N  N   . ALA A 1 202 ? -36.558 13.113 10.643  1.00 23.93 ? 202 ALA A N   1 
ATOM   1538 C  CA  . ALA A 1 202 ? -36.267 11.724 10.314  1.00 24.17 ? 202 ALA A CA  1 
ATOM   1539 C  C   . ALA A 1 202 ? -35.093 11.224 11.141  1.00 25.35 ? 202 ALA A C   1 
ATOM   1540 O  O   . ALA A 1 202 ? -35.148 10.101 11.656  1.00 25.53 ? 202 ALA A O   1 
ATOM   1541 C  CB  . ALA A 1 202 ? -35.983 11.575 8.828   1.00 24.20 ? 202 ALA A CB  1 
ATOM   1542 N  N   . GLU A 1 203 ? -34.064 12.069 11.315  1.00 26.18 ? 203 GLU A N   1 
ATOM   1543 C  CA  . GLU A 1 203 ? -32.944 11.733 12.210  1.00 26.99 ? 203 GLU A CA  1 
ATOM   1544 C  C   . GLU A 1 203 ? -33.446 11.531 13.645  1.00 27.14 ? 203 GLU A C   1 
ATOM   1545 O  O   . GLU A 1 203 ? -33.011 10.583 14.326  1.00 27.52 ? 203 GLU A O   1 
ATOM   1546 C  CB  . GLU A 1 203 ? -31.811 12.795 12.180  1.00 27.99 ? 203 GLU A CB  1 
ATOM   1547 C  CG  . GLU A 1 203 ? -30.501 12.292 12.828  1.00 29.96 ? 203 GLU A CG  1 
ATOM   1548 C  CD  . GLU A 1 203 ? -29.591 13.366 13.472  1.00 34.01 ? 203 GLU A CD  1 
ATOM   1549 O  OE1 . GLU A 1 203 ? -29.286 14.401 12.850  1.00 34.46 ? 203 GLU A OE1 1 
ATOM   1550 O  OE2 . GLU A 1 203 ? -29.121 13.140 14.611  1.00 37.47 ? 203 GLU A OE2 1 
ATOM   1551 N  N   . ALA A 1 204 ? -34.362 12.408 14.083  1.00 26.28 ? 204 ALA A N   1 
ATOM   1552 C  CA  . ALA A 1 204 ? -34.960 12.360 15.435  1.00 26.83 ? 204 ALA A CA  1 
ATOM   1553 C  C   . ALA A 1 204 ? -35.719 11.070 15.728  1.00 26.99 ? 204 ALA A C   1 
ATOM   1554 O  O   . ALA A 1 204 ? -35.393 10.357 16.676  1.00 27.68 ? 204 ALA A O   1 
ATOM   1555 C  CB  . ALA A 1 204 ? -35.857 13.625 15.696  1.00 25.91 ? 204 ALA A CB  1 
ATOM   1556 N  N   . GLU A 1 205 ? -36.711 10.758 14.896  1.00 27.88 ? 205 GLU A N   1 
ATOM   1557 C  CA  . GLU A 1 205 ? -37.465 9.499  14.990  1.00 28.76 ? 205 GLU A CA  1 
ATOM   1558 C  C   . GLU A 1 205 ? -36.526 8.273  14.957  1.00 29.63 ? 205 GLU A C   1 
ATOM   1559 O  O   . GLU A 1 205 ? -36.644 7.365  15.793  1.00 29.59 ? 205 GLU A O   1 
ATOM   1560 C  CB  . GLU A 1 205 ? -38.513 9.433  13.862  1.00 28.78 ? 205 GLU A CB  1 
ATOM   1561 C  CG  . GLU A 1 205 ? -39.632 8.412  14.083  1.00 29.59 ? 205 GLU A CG  1 
ATOM   1562 C  CD  . GLU A 1 205 ? -40.517 8.238  12.860  1.00 31.65 ? 205 GLU A CD  1 
ATOM   1563 O  OE1 . GLU A 1 205 ? -40.999 9.258  12.316  1.00 29.99 ? 205 GLU A OE1 1 
ATOM   1564 O  OE2 . GLU A 1 205 ? -40.734 7.068  12.443  1.00 32.95 ? 205 GLU A OE2 1 
ATOM   1565 N  N   . TYR A 1 206 ? -35.588 8.260  14.011  1.00 30.25 ? 206 TYR A N   1 
ATOM   1566 C  CA  . TYR A 1 206 ? -34.555 7.210  13.929  1.00 31.26 ? 206 TYR A CA  1 
ATOM   1567 C  C   . TYR A 1 206 ? -33.886 6.973  15.257  1.00 31.89 ? 206 TYR A C   1 
ATOM   1568 O  O   . TYR A 1 206 ? -33.833 5.835  15.754  1.00 32.27 ? 206 TYR A O   1 
ATOM   1569 C  CB  . TYR A 1 206 ? -33.473 7.576  12.887  1.00 31.30 ? 206 TYR A CB  1 
ATOM   1570 C  CG  . TYR A 1 206 ? -32.391 6.534  12.718  1.00 32.39 ? 206 TYR A CG  1 
ATOM   1571 C  CD1 . TYR A 1 206 ? -32.702 5.249  12.253  1.00 33.03 ? 206 TYR A CD1 1 
ATOM   1572 C  CD2 . TYR A 1 206 ? -31.062 6.820  13.021  1.00 32.62 ? 206 TYR A CD2 1 
ATOM   1573 C  CE1 . TYR A 1 206 ? -31.720 4.276  12.099  1.00 33.51 ? 206 TYR A CE1 1 
ATOM   1574 C  CE2 . TYR A 1 206 ? -30.064 5.847  12.862  1.00 36.21 ? 206 TYR A CE2 1 
ATOM   1575 C  CZ  . TYR A 1 206 ? -30.412 4.577  12.386  1.00 34.12 ? 206 TYR A CZ  1 
ATOM   1576 O  OH  . TYR A 1 206 ? -29.453 3.600  12.224  1.00 36.83 ? 206 TYR A OH  1 
ATOM   1577 N  N   . TYR A 1 207 ? -33.358 8.042  15.839  1.00 32.85 ? 207 TYR A N   1 
ATOM   1578 C  CA  . TYR A 1 207 ? -32.696 7.916  17.125  1.00 33.67 ? 207 TYR A CA  1 
ATOM   1579 C  C   . TYR A 1 207 ? -33.712 7.681  18.254  1.00 34.76 ? 207 TYR A C   1 
ATOM   1580 O  O   . TYR A 1 207 ? -33.346 7.215  19.343  1.00 34.63 ? 207 TYR A O   1 
ATOM   1581 C  CB  . TYR A 1 207 ? -31.722 9.086  17.365  1.00 33.78 ? 207 TYR A CB  1 
ATOM   1582 C  CG  . TYR A 1 207 ? -30.474 8.930  16.513  1.00 34.13 ? 207 TYR A CG  1 
ATOM   1583 C  CD1 . TYR A 1 207 ? -29.666 7.809  16.658  1.00 34.70 ? 207 TYR A CD1 1 
ATOM   1584 C  CD2 . TYR A 1 207 ? -30.117 9.878  15.548  1.00 35.99 ? 207 TYR A CD2 1 
ATOM   1585 C  CE1 . TYR A 1 207 ? -28.536 7.620  15.873  1.00 34.29 ? 207 TYR A CE1 1 
ATOM   1586 C  CE2 . TYR A 1 207 ? -28.977 9.700  14.751  1.00 34.30 ? 207 TYR A CE2 1 
ATOM   1587 C  CZ  . TYR A 1 207 ? -28.193 8.562  14.931  1.00 34.47 ? 207 TYR A CZ  1 
ATOM   1588 O  OH  . TYR A 1 207 ? -27.065 8.331  14.187  1.00 33.52 ? 207 TYR A OH  1 
ATOM   1589 N  N   . GLY A 1 208 ? -34.984 7.966  17.960  1.00 35.39 ? 208 GLY A N   1 
ATOM   1590 C  CA  . GLY A 1 208 ? -36.099 7.756  18.879  1.00 36.33 ? 208 GLY A CA  1 
ATOM   1591 C  C   . GLY A 1 208 ? -36.577 6.314  18.873  1.00 37.25 ? 208 GLY A C   1 
ATOM   1592 O  O   . GLY A 1 208 ? -36.890 5.759  19.937  1.00 37.57 ? 208 GLY A O   1 
ATOM   1593 N  N   . LEU A 1 209 ? -36.636 5.708  17.682  1.00 37.25 ? 209 LEU A N   1 
ATOM   1594 C  CA  . LEU A 1 209 ? -36.922 4.288  17.544  1.00 37.41 ? 209 LEU A CA  1 
ATOM   1595 C  C   . LEU A 1 209 ? -35.773 3.448  18.131  1.00 37.76 ? 209 LEU A C   1 
ATOM   1596 O  O   . LEU A 1 209 ? -36.009 2.554  18.944  1.00 37.68 ? 209 LEU A O   1 
ATOM   1597 C  CB  . LEU A 1 209 ? -37.203 3.911  16.079  1.00 37.28 ? 209 LEU A CB  1 
ATOM   1598 C  CG  . LEU A 1 209 ? -38.384 4.493  15.276  1.00 37.66 ? 209 LEU A CG  1 
ATOM   1599 C  CD1 . LEU A 1 209 ? -38.307 4.075  13.803  1.00 38.07 ? 209 LEU A CD1 1 
ATOM   1600 C  CD2 . LEU A 1 209 ? -39.778 4.127  15.840  1.00 37.73 ? 209 LEU A CD2 1 
ATOM   1601 N  N   . GLU A 1 210 ? -34.532 3.760  17.759  1.00 37.62 ? 210 GLU A N   1 
ATOM   1602 C  CA  . GLU A 1 210 ? -33.375 2.979  18.235  1.00 38.57 ? 210 GLU A CA  1 
ATOM   1603 C  C   . GLU A 1 210 ? -33.238 2.932  19.764  1.00 37.77 ? 210 GLU A C   1 
ATOM   1604 O  O   . GLU A 1 210 ? -33.431 3.940  20.444  1.00 37.16 ? 210 GLU A O   1 
ATOM   1605 C  CB  . GLU A 1 210 ? -32.074 3.494  17.629  1.00 39.06 ? 210 GLU A CB  1 
ATOM   1606 C  CG  . GLU A 1 210 ? -31.862 3.078  16.194  1.00 41.27 ? 210 GLU A CG  1 
ATOM   1607 C  CD  . GLU A 1 210 ? -30.446 3.326  15.743  1.00 45.00 ? 210 GLU A CD  1 
ATOM   1608 O  OE1 . GLU A 1 210 ? -29.932 4.444  16.000  1.00 47.90 ? 210 GLU A OE1 1 
ATOM   1609 O  OE2 . GLU A 1 210 ? -29.851 2.407  15.130  1.00 45.41 ? 210 GLU A OE2 1 
ATOM   1610 N  N   . THR B 1 4   ? 1.309   17.597 33.849  1.00 29.41 ? 4   THR B N   1 
ATOM   1611 C  CA  . THR B 1 4   ? 1.252   16.163 33.470  1.00 29.40 ? 4   THR B CA  1 
ATOM   1612 C  C   . THR B 1 4   ? -0.141  15.820 32.951  1.00 28.43 ? 4   THR B C   1 
ATOM   1613 O  O   . THR B 1 4   ? -1.133  15.766 33.719  1.00 27.86 ? 4   THR B O   1 
ATOM   1614 C  CB  . THR B 1 4   ? 1.562   15.250 34.636  1.00 30.00 ? 4   THR B CB  1 
ATOM   1615 O  OG1 . THR B 1 4   ? 2.293   15.974 35.624  1.00 32.28 ? 4   THR B OG1 1 
ATOM   1616 C  CG2 . THR B 1 4   ? 2.389   14.055 34.151  1.00 30.59 ? 4   THR B CG2 1 
ATOM   1617 N  N   . ASP B 1 5   ? -0.186  15.556 31.648  1.00 27.00 ? 5   ASP B N   1 
ATOM   1618 C  CA  . ASP B 1 5   ? -1.435  15.513 30.909  1.00 25.54 ? 5   ASP B CA  1 
ATOM   1619 C  C   . ASP B 1 5   ? -2.231  14.317 31.371  1.00 24.93 ? 5   ASP B C   1 
ATOM   1620 O  O   . ASP B 1 5   ? -1.645  13.272 31.578  1.00 24.95 ? 5   ASP B O   1 
ATOM   1621 C  CB  . ASP B 1 5   ? -1.187  15.361 29.402  1.00 23.79 ? 5   ASP B CB  1 
ATOM   1622 C  CG  . ASP B 1 5   ? -0.595  16.603 28.758  1.00 23.15 ? 5   ASP B CG  1 
ATOM   1623 O  OD1 . ASP B 1 5   ? -0.574  17.654 29.432  1.00 19.62 ? 5   ASP B OD1 1 
ATOM   1624 O  OD2 . ASP B 1 5   ? -0.120  16.520 27.567  1.00 20.84 ? 5   ASP B OD2 1 
ATOM   1625 N  N   . THR B 1 6   ? -3.553  14.486 31.518  1.00 24.29 ? 6   THR B N   1 
ATOM   1626 C  CA  . THR B 1 6   ? -4.469  13.365 31.755  1.00 25.21 ? 6   THR B CA  1 
ATOM   1627 C  C   . THR B 1 6   ? -4.171  12.207 30.766  1.00 25.95 ? 6   THR B C   1 
ATOM   1628 O  O   . THR B 1 6   ? -3.956  11.084 31.219  1.00 26.91 ? 6   THR B O   1 
ATOM   1629 C  CB  . THR B 1 6   ? -5.953  13.844 31.760  1.00 24.41 ? 6   THR B CB  1 
ATOM   1630 O  OG1 . THR B 1 6   ? -6.076  14.960 32.645  1.00 26.89 ? 6   THR B OG1 1 
ATOM   1631 C  CG2 . THR B 1 6   ? -6.886  12.810 32.255  1.00 22.55 ? 6   THR B CG2 1 
ATOM   1632 N  N   . TYR B 1 7   ? -4.076  12.485 29.451  1.00 25.83 ? 7   TYR B N   1 
ATOM   1633 C  CA  . TYR B 1 7   ? -3.861  11.437 28.402  1.00 25.65 ? 7   TYR B CA  1 
ATOM   1634 C  C   . TYR B 1 7   ? -2.530  11.489 27.638  1.00 24.91 ? 7   TYR B C   1 
ATOM   1635 O  O   . TYR B 1 7   ? -2.105  12.570 27.263  1.00 24.46 ? 7   TYR B O   1 
ATOM   1636 C  CB  . TYR B 1 7   ? -4.941  11.577 27.348  1.00 25.39 ? 7   TYR B CB  1 
ATOM   1637 C  CG  . TYR B 1 7   ? -6.338  11.519 27.883  1.00 27.72 ? 7   TYR B CG  1 
ATOM   1638 C  CD1 . TYR B 1 7   ? -6.974  10.290 28.043  1.00 27.25 ? 7   TYR B CD1 1 
ATOM   1639 C  CD2 . TYR B 1 7   ? -7.040  12.696 28.209  1.00 24.92 ? 7   TYR B CD2 1 
ATOM   1640 C  CE1 . TYR B 1 7   ? -8.253  10.205 28.503  1.00 24.93 ? 7   TYR B CE1 1 
ATOM   1641 C  CE2 . TYR B 1 7   ? -8.316  12.626 28.677  1.00 23.82 ? 7   TYR B CE2 1 
ATOM   1642 C  CZ  . TYR B 1 7   ? -8.915  11.367 28.846  1.00 24.43 ? 7   TYR B CZ  1 
ATOM   1643 O  OH  . TYR B 1 7   ? -10.210 11.271 29.260  1.00 17.83 ? 7   TYR B OH  1 
ATOM   1644 N  N   . PRO B 1 8   ? -1.893  10.319 27.339  1.00 25.11 ? 8   PRO B N   1 
ATOM   1645 C  CA  . PRO B 1 8   ? -0.558  10.413 26.683  1.00 24.14 ? 8   PRO B CA  1 
ATOM   1646 C  C   . PRO B 1 8   ? -0.600  10.877 25.217  1.00 23.67 ? 8   PRO B C   1 
ATOM   1647 O  O   . PRO B 1 8   ? 0.414   11.306 24.684  1.00 23.19 ? 8   PRO B O   1 
ATOM   1648 C  CB  . PRO B 1 8   ? -0.028  8.981  26.721  1.00 23.85 ? 8   PRO B CB  1 
ATOM   1649 C  CG  . PRO B 1 8   ? -1.279  8.103  26.793  1.00 24.31 ? 8   PRO B CG  1 
ATOM   1650 C  CD  . PRO B 1 8   ? -2.369  8.922  27.455  1.00 24.28 ? 8   PRO B CD  1 
ATOM   1651 N  N   . ASN B 1 9   ? -1.756  10.741 24.588  1.00 24.53 ? 9   ASN B N   1 
ATOM   1652 C  CA  . ASN B 1 9   ? -1.930  11.020 23.151  1.00 25.17 ? 9   ASN B CA  1 
ATOM   1653 C  C   . ASN B 1 9   ? -3.417  11.282 22.860  1.00 25.04 ? 9   ASN B C   1 
ATOM   1654 O  O   . ASN B 1 9   ? -4.253  11.157 23.766  1.00 25.97 ? 9   ASN B O   1 
ATOM   1655 C  CB  . ASN B 1 9   ? -1.402  9.844  22.305  1.00 25.02 ? 9   ASN B CB  1 
ATOM   1656 C  CG  . ASN B 1 9   ? -2.092  8.499  22.636  1.00 25.73 ? 9   ASN B CG  1 
ATOM   1657 O  OD1 . ASN B 1 9   ? -3.328  8.399  22.674  1.00 27.61 ? 9   ASN B OD1 1 
ATOM   1658 N  ND2 . ASN B 1 9   ? -1.290  7.456  22.827  1.00 24.50 ? 9   ASN B ND2 1 
ATOM   1659 N  N   . ILE B 1 10  ? -3.746  11.633 21.611  1.00 25.19 ? 10  ILE B N   1 
ATOM   1660 C  CA  . ILE B 1 10  ? -5.138  11.974 21.242  1.00 24.59 ? 10  ILE B CA  1 
ATOM   1661 C  C   . ILE B 1 10  ? -6.023  10.751 21.106  1.00 24.85 ? 10  ILE B C   1 
ATOM   1662 O  O   . ILE B 1 10  ? -7.218  10.847 21.307  1.00 25.45 ? 10  ILE B O   1 
ATOM   1663 C  CB  . ILE B 1 10  ? -5.249  12.926 19.993  1.00 25.02 ? 10  ILE B CB  1 
ATOM   1664 C  CG1 . ILE B 1 10  ? -4.685  14.327 20.309  1.00 22.18 ? 10  ILE B CG1 1 
ATOM   1665 C  CG2 . ILE B 1 10  ? -6.741  13.074 19.541  1.00 23.68 ? 10  ILE B CG2 1 
ATOM   1666 C  CD1 . ILE B 1 10  ? -5.589  15.180 21.259  1.00 25.08 ? 10  ILE B CD1 1 
ATOM   1667 N  N   . GLU B 1 11  ? -5.452  9.603  20.761  1.00 26.33 ? 11  GLU B N   1 
ATOM   1668 C  CA  . GLU B 1 11  ? -6.224  8.368  20.726  1.00 27.44 ? 11  GLU B CA  1 
ATOM   1669 C  C   . GLU B 1 11  ? -6.833  8.006  22.076  1.00 28.10 ? 11  GLU B C   1 
ATOM   1670 O  O   . GLU B 1 11  ? -7.971  7.520  22.129  1.00 29.33 ? 11  GLU B O   1 
ATOM   1671 C  CB  . GLU B 1 11  ? -5.394  7.192  20.206  1.00 28.02 ? 11  GLU B CB  1 
ATOM   1672 C  CG  . GLU B 1 11  ? -5.107  7.275  18.743  1.00 27.59 ? 11  GLU B CG  1 
ATOM   1673 C  CD  . GLU B 1 11  ? -3.910  8.150  18.438  1.00 26.75 ? 11  GLU B CD  1 
ATOM   1674 O  OE1 . GLU B 1 11  ? -3.193  8.565  19.368  1.00 22.94 ? 11  GLU B OE1 1 
ATOM   1675 O  OE2 . GLU B 1 11  ? -3.681  8.408  17.255  1.00 28.02 ? 11  GLU B OE2 1 
ATOM   1676 N  N   . ALA B 1 12  ? -6.077  8.258  23.144  1.00 28.19 ? 12  ALA B N   1 
ATOM   1677 C  CA  . ALA B 1 12  ? -6.431  7.921  24.534  1.00 27.40 ? 12  ALA B CA  1 
ATOM   1678 C  C   . ALA B 1 12  ? -7.572  8.813  24.999  1.00 26.81 ? 12  ALA B C   1 
ATOM   1679 O  O   . ALA B 1 12  ? -8.568  8.345  25.549  1.00 26.49 ? 12  ALA B O   1 
ATOM   1680 C  CB  . ALA B 1 12  ? -5.200  8.126  25.438  1.00 27.65 ? 12  ALA B CB  1 
ATOM   1681 N  N   . LEU B 1 13  ? -7.438  10.103 24.724  1.00 25.94 ? 13  LEU B N   1 
ATOM   1682 C  CA  . LEU B 1 13  ? -8.494  11.073 24.976  1.00 25.18 ? 13  LEU B CA  1 
ATOM   1683 C  C   . LEU B 1 13  ? -9.771  10.661 24.306  1.00 25.35 ? 13  LEU B C   1 
ATOM   1684 O  O   . LEU B 1 13  ? -10.814 10.642 24.961  1.00 23.74 ? 13  LEU B O   1 
ATOM   1685 C  CB  . LEU B 1 13  ? -8.079  12.453 24.464  1.00 24.77 ? 13  LEU B CB  1 
ATOM   1686 C  CG  . LEU B 1 13  ? -8.911  13.687 24.788  1.00 25.16 ? 13  LEU B CG  1 
ATOM   1687 C  CD1 . LEU B 1 13  ? -8.025  14.938 24.667  1.00 26.64 ? 13  LEU B CD1 1 
ATOM   1688 C  CD2 . LEU B 1 13  ? -10.185 13.830 23.916  1.00 23.68 ? 13  LEU B CD2 1 
ATOM   1689 N  N   . GLU B 1 14  ? -9.667  10.364 22.996  1.00 24.85 ? 14  GLU B N   1 
ATOM   1690 C  CA  . GLU B 1 14  ? -10.810 10.035 22.113  1.00 25.39 ? 14  GLU B CA  1 
ATOM   1691 C  C   . GLU B 1 14  ? -11.515 8.739  22.544  1.00 25.55 ? 14  GLU B C   1 
ATOM   1692 O  O   . GLU B 1 14  ? -12.757 8.672  22.572  1.00 26.32 ? 14  GLU B O   1 
ATOM   1693 C  CB  . GLU B 1 14  ? -10.406 10.021 20.618  1.00 23.49 ? 14  GLU B CB  1 
ATOM   1694 C  CG  . GLU B 1 14  ? -10.110 11.424 20.024  1.00 25.58 ? 14  GLU B CG  1 
ATOM   1695 C  CD  . GLU B 1 14  ? -10.156 11.517 18.480  1.00 27.33 ? 14  GLU B CD  1 
ATOM   1696 O  OE1 . GLU B 1 14  ? -10.401 10.507 17.789  1.00 26.98 ? 14  GLU B OE1 1 
ATOM   1697 O  OE2 . GLU B 1 14  ? -9.953  12.639 17.944  1.00 27.41 ? 14  GLU B OE2 1 
ATOM   1698 N  N   . ASN B 1 15  ? -10.745 7.719  22.920  1.00 26.51 ? 15  ASN B N   1 
ATOM   1699 C  CA  . ASN B 1 15  ? -11.361 6.535  23.558  1.00 27.14 ? 15  ASN B CA  1 
ATOM   1700 C  C   . ASN B 1 15  ? -12.023 6.781  24.948  1.00 27.00 ? 15  ASN B C   1 
ATOM   1701 O  O   . ASN B 1 15  ? -12.740 5.907  25.474  1.00 26.79 ? 15  ASN B O   1 
ATOM   1702 C  CB  . ASN B 1 15  ? -10.403 5.335  23.588  1.00 27.27 ? 15  ASN B CB  1 
ATOM   1703 C  CG  . ASN B 1 15  ? -9.786  5.023  22.220  1.00 29.68 ? 15  ASN B CG  1 
ATOM   1704 O  OD1 . ASN B 1 15  ? -10.373 5.276  21.160  1.00 31.96 ? 15  ASN B OD1 1 
ATOM   1705 N  ND2 . ASN B 1 15  ? -8.597  4.462  22.249  1.00 31.66 ? 15  ASN B ND2 1 
ATOM   1706 N  N   . ALA B 1 16  ? -11.835 7.958  25.550  1.00 26.88 ? 16  ALA B N   1 
ATOM   1707 C  CA  . ALA B 1 16  ? -12.506 8.211  26.840  1.00 25.66 ? 16  ALA B CA  1 
ATOM   1708 C  C   . ALA B 1 16  ? -13.592 9.297  26.781  1.00 26.11 ? 16  ALA B C   1 
ATOM   1709 O  O   . ALA B 1 16  ? -14.538 9.325  27.606  1.00 24.15 ? 16  ALA B O   1 
ATOM   1710 C  CB  . ALA B 1 16  ? -11.496 8.526  27.888  1.00 26.37 ? 16  ALA B CB  1 
ATOM   1711 N  N   . GLU B 1 17  ? -13.468 10.185 25.798  1.00 24.98 ? 17  GLU B N   1 
ATOM   1712 C  CA  . GLU B 1 17  ? -14.302 11.398 25.764  1.00 24.97 ? 17  GLU B CA  1 
ATOM   1713 C  C   . GLU B 1 17  ? -15.408 11.351 24.721  1.00 23.68 ? 17  GLU B C   1 
ATOM   1714 O  O   . GLU B 1 17  ? -15.344 10.602 23.751  1.00 24.38 ? 17  GLU B O   1 
ATOM   1715 C  CB  . GLU B 1 17  ? -13.437 12.647 25.535  1.00 24.23 ? 17  GLU B CB  1 
ATOM   1716 C  CG  . GLU B 1 17  ? -12.395 12.895 26.598  1.00 25.17 ? 17  GLU B CG  1 
ATOM   1717 C  CD  . GLU B 1 17  ? -12.919 13.465 27.939  1.00 25.06 ? 17  GLU B CD  1 
ATOM   1718 O  OE1 . GLU B 1 17  ? -14.103 13.827 28.098  1.00 23.47 ? 17  GLU B OE1 1 
ATOM   1719 O  OE2 . GLU B 1 17  ? -12.089 13.561 28.857  1.00 29.91 ? 17  GLU B OE2 1 
ATOM   1720 N  N   . THR B 1 18  ? -16.425 12.169 24.903  1.00 24.30 ? 18  THR B N   1 
ATOM   1721 C  CA  . THR B 1 18  ? -17.484 12.219 23.921  1.00 24.47 ? 18  THR B CA  1 
ATOM   1722 C  C   . THR B 1 18  ? -17.330 13.460 23.083  1.00 23.37 ? 18  THR B C   1 
ATOM   1723 O  O   . THR B 1 18  ? -17.295 14.562 23.610  1.00 22.12 ? 18  THR B O   1 
ATOM   1724 C  CB  . THR B 1 18  ? -18.862 12.216 24.555  1.00 24.95 ? 18  THR B CB  1 
ATOM   1725 O  OG1 . THR B 1 18  ? -18.872 11.287 25.640  1.00 27.34 ? 18  THR B OG1 1 
ATOM   1726 C  CG2 . THR B 1 18  ? -19.929 11.799 23.493  1.00 26.87 ? 18  THR B CG2 1 
ATOM   1727 N  N   . VAL B 1 19  ? -17.245 13.282 21.772  1.00 22.21 ? 19  VAL B N   1 
ATOM   1728 C  CA  . VAL B 1 19  ? -17.104 14.447 20.907  1.00 22.29 ? 19  VAL B CA  1 
ATOM   1729 C  C   . VAL B 1 19  ? -18.441 15.198 20.858  1.00 21.72 ? 19  VAL B C   1 
ATOM   1730 O  O   . VAL B 1 19  ? -19.514 14.560 20.881  1.00 22.99 ? 19  VAL B O   1 
ATOM   1731 C  CB  . VAL B 1 19  ? -16.542 14.072 19.502  1.00 22.38 ? 19  VAL B CB  1 
ATOM   1732 C  CG1 . VAL B 1 19  ? -17.422 12.967 18.819  1.00 23.15 ? 19  VAL B CG1 1 
ATOM   1733 C  CG2 . VAL B 1 19  ? -16.340 15.350 18.636  1.00 21.00 ? 19  VAL B CG2 1 
ATOM   1734 N  N   . GLY B 1 20  ? -18.385 16.525 20.832  1.00 20.27 ? 20  GLY B N   1 
ATOM   1735 C  CA  . GLY B 1 20  ? -19.590 17.336 20.833  1.00 20.33 ? 20  GLY B CA  1 
ATOM   1736 C  C   . GLY B 1 20  ? -20.057 17.643 22.250  1.00 20.83 ? 20  GLY B C   1 
ATOM   1737 O  O   . GLY B 1 20  ? -20.895 18.496 22.448  1.00 21.35 ? 20  GLY B O   1 
ATOM   1738 N  N   . VAL B 1 21  ? -19.533 16.921 23.231  1.00 21.66 ? 21  VAL B N   1 
ATOM   1739 C  CA  . VAL B 1 21  ? -19.809 17.262 24.636  1.00 22.34 ? 21  VAL B CA  1 
ATOM   1740 C  C   . VAL B 1 21  ? -18.514 17.804 25.291  1.00 21.44 ? 21  VAL B C   1 
ATOM   1741 O  O   . VAL B 1 21  ? -18.487 18.906 25.865  1.00 22.04 ? 21  VAL B O   1 
ATOM   1742 C  CB  . VAL B 1 21  ? -20.411 16.065 25.429  1.00 21.66 ? 21  VAL B CB  1 
ATOM   1743 C  CG1 . VAL B 1 21  ? -20.628 16.436 26.947  1.00 23.62 ? 21  VAL B CG1 1 
ATOM   1744 C  CG2 . VAL B 1 21  ? -21.729 15.608 24.831  1.00 23.41 ? 21  VAL B CG2 1 
ATOM   1745 N  N   . ALA B 1 22  ? -17.437 17.036 25.166  1.00 22.62 ? 22  ALA B N   1 
ATOM   1746 C  CA  . ALA B 1 22  ? -16.157 17.372 25.793  1.00 20.10 ? 22  ALA B CA  1 
ATOM   1747 C  C   . ALA B 1 22  ? -15.266 18.114 24.845  1.00 20.52 ? 22  ALA B C   1 
ATOM   1748 O  O   . ALA B 1 22  ? -14.443 18.947 25.265  1.00 17.97 ? 22  ALA B O   1 
ATOM   1749 C  CB  . ALA B 1 22  ? -15.457 16.135 26.235  1.00 21.58 ? 22  ALA B CB  1 
ATOM   1750 N  N   . TYR B 1 23  ? -15.387 17.797 23.551  1.00 18.75 ? 23  TYR B N   1 
ATOM   1751 C  CA  . TYR B 1 23  ? -14.420 18.341 22.601  1.00 19.51 ? 23  TYR B CA  1 
ATOM   1752 C  C   . TYR B 1 23  ? -14.987 18.306 21.176  1.00 18.63 ? 23  TYR B C   1 
ATOM   1753 O  O   . TYR B 1 23  ? -15.837 17.485 20.873  1.00 19.57 ? 23  TYR B O   1 
ATOM   1754 C  CB  . TYR B 1 23  ? -13.076 17.553 22.667  1.00 18.01 ? 23  TYR B CB  1 
ATOM   1755 C  CG  . TYR B 1 23  ? -13.070 16.245 21.865  1.00 20.14 ? 23  TYR B CG  1 
ATOM   1756 C  CD1 . TYR B 1 23  ? -12.694 16.211 20.502  1.00 18.59 ? 23  TYR B CD1 1 
ATOM   1757 C  CD2 . TYR B 1 23  ? -13.466 15.046 22.460  1.00 17.57 ? 23  TYR B CD2 1 
ATOM   1758 C  CE1 . TYR B 1 23  ? -12.723 14.979 19.770  1.00 18.62 ? 23  TYR B CE1 1 
ATOM   1759 C  CE2 . TYR B 1 23  ? -13.488 13.853 21.766  1.00 20.80 ? 23  TYR B CE2 1 
ATOM   1760 C  CZ  . TYR B 1 23  ? -13.096 13.807 20.430  1.00 19.41 ? 23  TYR B CZ  1 
ATOM   1761 O  OH  . TYR B 1 23  ? -13.159 12.589 19.770  1.00 19.74 ? 23  TYR B OH  1 
ATOM   1762 N  N   . ASN B 1 24  ? -14.533 19.223 20.330  1.00 18.99 ? 24  ASN B N   1 
ATOM   1763 C  CA  . ASN B 1 24  ? -14.868 19.159 18.894  1.00 18.24 ? 24  ASN B CA  1 
ATOM   1764 C  C   . ASN B 1 24  ? -13.613 19.535 18.108  1.00 18.68 ? 24  ASN B C   1 
ATOM   1765 O  O   . ASN B 1 24  ? -12.604 19.954 18.711  1.00 18.48 ? 24  ASN B O   1 
ATOM   1766 C  CB  . ASN B 1 24  ? -16.162 19.955 18.517  1.00 18.39 ? 24  ASN B CB  1 
ATOM   1767 C  CG  . ASN B 1 24  ? -15.967 21.478 18.456  1.00 16.05 ? 24  ASN B CG  1 
ATOM   1768 O  OD1 . ASN B 1 24  ? -14.837 21.988 18.405  1.00 16.04 ? 24  ASN B OD1 1 
ATOM   1769 N  ND2 . ASN B 1 24  ? -17.089 22.209 18.428  1.00 17.41 ? 24  ASN B ND2 1 
ATOM   1770 N  N   . ILE B 1 25  ? -13.668 19.339 16.787  1.00 17.81 ? 25  ILE B N   1 
ATOM   1771 C  CA  . ILE B 1 25  ? -12.564 19.608 15.886  1.00 17.41 ? 25  ILE B CA  1 
ATOM   1772 C  C   . ILE B 1 25  ? -13.200 20.356 14.710  1.00 18.34 ? 25  ILE B C   1 
ATOM   1773 O  O   . ILE B 1 25  ? -14.233 19.911 14.174  1.00 18.63 ? 25  ILE B O   1 
ATOM   1774 C  CB  . ILE B 1 25  ? -11.874 18.312 15.359  1.00 16.84 ? 25  ILE B CB  1 
ATOM   1775 C  CG1 . ILE B 1 25  ? -11.572 17.333 16.519  1.00 16.67 ? 25  ILE B CG1 1 
ATOM   1776 C  CG2 . ILE B 1 25  ? -10.633 18.709 14.513  1.00 14.04 ? 25  ILE B CG2 1 
ATOM   1777 C  CD1 . ILE B 1 25  ? -10.727 16.075 16.225  1.00 14.07 ? 25  ILE B CD1 1 
ATOM   1778 N  N   . GLU B 1 26  ? -12.597 21.488 14.363  1.00 18.39 ? 26  GLU B N   1 
ATOM   1779 C  CA  . GLU B 1 26  ? -12.975 22.313 13.199  1.00 19.19 ? 26  GLU B CA  1 
ATOM   1780 C  C   . GLU B 1 26  ? -11.792 22.464 12.284  1.00 18.83 ? 26  GLU B C   1 
ATOM   1781 O  O   . GLU B 1 26  ? -10.692 22.764 12.725  1.00 19.58 ? 26  GLU B O   1 
ATOM   1782 C  CB  . GLU B 1 26  ? -13.350 23.730 13.632  1.00 19.02 ? 26  GLU B CB  1 
ATOM   1783 C  CG  . GLU B 1 26  ? -14.438 23.825 14.632  1.00 21.88 ? 26  GLU B CG  1 
ATOM   1784 C  CD  . GLU B 1 26  ? -14.849 25.254 14.906  1.00 25.43 ? 26  GLU B CD  1 
ATOM   1785 O  OE1 . GLU B 1 26  ? -14.148 26.215 14.500  1.00 27.82 ? 26  GLU B OE1 1 
ATOM   1786 O  OE2 . GLU B 1 26  ? -15.899 25.419 15.533  1.00 29.60 ? 26  GLU B OE2 1 
ATOM   1787 N  N   . VAL B 1 27  ? -12.043 22.326 10.993  1.00 19.28 ? 27  VAL B N   1 
ATOM   1788 C  CA  . VAL B 1 27  ? -11.007 22.294 9.998   1.00 18.95 ? 27  VAL B CA  1 
ATOM   1789 C  C   . VAL B 1 27  ? -11.516 23.088 8.819   1.00 18.84 ? 27  VAL B C   1 
ATOM   1790 O  O   . VAL B 1 27  ? -12.692 23.003 8.483   1.00 17.40 ? 27  VAL B O   1 
ATOM   1791 C  CB  . VAL B 1 27  ? -10.727 20.819 9.547   1.00 19.25 ? 27  VAL B CB  1 
ATOM   1792 C  CG1 . VAL B 1 27  ? -9.473  20.760 8.733   1.00 20.37 ? 27  VAL B CG1 1 
ATOM   1793 C  CG2 . VAL B 1 27  ? -10.570 19.881 10.738  1.00 20.52 ? 27  VAL B CG2 1 
ATOM   1794 N  N   . LYS B 1 28  ? -10.653 23.895 8.206   1.00 19.65 ? 28  LYS B N   1 
ATOM   1795 C  CA  . LYS B 1 28  ? -10.980 24.533 6.930   1.00 18.89 ? 28  LYS B CA  1 
ATOM   1796 C  C   . LYS B 1 28  ? -9.707  24.611 6.136   1.00 19.59 ? 28  LYS B C   1 
ATOM   1797 O  O   . LYS B 1 28  ? -8.866  25.463 6.415   1.00 20.07 ? 28  LYS B O   1 
ATOM   1798 C  CB  . LYS B 1 28  ? -11.539 25.954 7.100   1.00 19.33 ? 28  LYS B CB  1 
ATOM   1799 C  CG  . LYS B 1 28  ? -12.128 26.537 5.762   1.00 18.38 ? 28  LYS B CG  1 
ATOM   1800 C  CD  . LYS B 1 28  ? -12.546 27.961 5.896   1.00 18.50 ? 28  LYS B CD  1 
ATOM   1801 C  CE  . LYS B 1 28  ? -13.569 28.370 4.819   1.00 21.70 ? 28  LYS B CE  1 
ATOM   1802 N  NZ  . LYS B 1 28  ? -13.800 29.840 4.857   1.00 22.54 ? 28  LYS B NZ  1 
ATOM   1803 N  N   . ARG B 1 29  ? -9.574  23.734 5.145   1.00 19.34 ? 29  ARG B N   1 
ATOM   1804 C  CA  . ARG B 1 29  ? -8.388  23.669 4.308   1.00 19.89 ? 29  ARG B CA  1 
ATOM   1805 C  C   . ARG B 1 29  ? -8.596  24.506 3.050   1.00 19.85 ? 29  ARG B C   1 
ATOM   1806 O  O   . ARG B 1 29  ? -9.399  24.144 2.153   1.00 17.03 ? 29  ARG B O   1 
ATOM   1807 C  CB  . ARG B 1 29  ? -8.062  22.232 3.917   1.00 20.90 ? 29  ARG B CB  1 
ATOM   1808 C  CG  . ARG B 1 29  ? -6.607  22.125 3.369   1.00 20.41 ? 29  ARG B CG  1 
ATOM   1809 C  CD  . ARG B 1 29  ? -6.358  20.839 2.630   1.00 21.68 ? 29  ARG B CD  1 
ATOM   1810 N  NE  . ARG B 1 29  ? -5.168  20.952 1.763   1.00 20.94 ? 29  ARG B NE  1 
ATOM   1811 C  CZ  . ARG B 1 29  ? -4.765  20.043 0.865   1.00 18.60 ? 29  ARG B CZ  1 
ATOM   1812 N  NH1 . ARG B 1 29  ? -5.418  18.905 0.698   1.00 21.72 ? 29  ARG B NH1 1 
ATOM   1813 N  NH2 . ARG B 1 29  ? -3.676  20.267 0.130   1.00 20.17 ? 29  ARG B NH2 1 
ATOM   1814 N  N   . GLN B 1 30  ? -7.895  25.631 2.993   1.00 19.00 ? 30  GLN B N   1 
ATOM   1815 C  CA  . GLN B 1 30  ? -8.173  26.595 1.920   1.00 18.94 ? 30  GLN B CA  1 
ATOM   1816 C  C   . GLN B 1 30  ? -6.925  27.376 1.446   1.00 19.50 ? 30  GLN B C   1 
ATOM   1817 O  O   . GLN B 1 30  ? -7.041  28.366 0.714   1.00 19.58 ? 30  GLN B O   1 
ATOM   1818 C  CB  . GLN B 1 30  ? -9.310  27.522 2.339   1.00 18.55 ? 30  GLN B CB  1 
ATOM   1819 C  CG  . GLN B 1 30  ? -8.913  28.476 3.494   1.00 17.41 ? 30  GLN B CG  1 
ATOM   1820 C  CD  . GLN B 1 30  ? -9.926  29.534 3.822   1.00 19.05 ? 30  GLN B CD  1 
ATOM   1821 O  OE1 . GLN B 1 30  ? -10.956 29.650 3.172   1.00 19.42 ? 30  GLN B OE1 1 
ATOM   1822 N  NE2 . GLN B 1 30  ? -9.640  30.333 4.875   1.00 16.32 ? 30  GLN B NE2 1 
ATOM   1823 N  N   . ASN B 1 31  ? -5.740  26.938 1.866   1.00 20.45 ? 31  ASN B N   1 
ATOM   1824 C  CA  . ASN B 1 31  ? -4.479  27.571 1.437   1.00 21.68 ? 31  ASN B CA  1 
ATOM   1825 C  C   . ASN B 1 31  ? -3.427  26.500 1.335   1.00 23.01 ? 31  ASN B C   1 
ATOM   1826 O  O   . ASN B 1 31  ? -3.358  25.650 2.243   1.00 22.94 ? 31  ASN B O   1 
ATOM   1827 C  CB  . ASN B 1 31  ? -4.029  28.662 2.437   1.00 20.39 ? 31  ASN B CB  1 
ATOM   1828 C  CG  . ASN B 1 31  ? -2.941  29.596 1.865   1.00 21.12 ? 31  ASN B CG  1 
ATOM   1829 O  OD1 . ASN B 1 31  ? -1.737  29.301 1.883   1.00 15.23 ? 31  ASN B OD1 1 
ATOM   1830 N  ND2 . ASN B 1 31  ? -3.374  30.739 1.384   1.00 23.16 ? 31  ASN B ND2 1 
ATOM   1831 N  N   . PRO B 1 32  ? -2.597  26.514 0.248   1.00 23.66 ? 32  PRO B N   1 
ATOM   1832 C  CA  . PRO B 1 32  ? -1.542  25.500 0.110   1.00 23.47 ? 32  PRO B CA  1 
ATOM   1833 C  C   . PRO B 1 32  ? -0.209  25.796 0.831   1.00 23.20 ? 32  PRO B C   1 
ATOM   1834 O  O   . PRO B 1 32  ? 0.677   24.930 0.841   1.00 22.99 ? 32  PRO B O   1 
ATOM   1835 C  CB  . PRO B 1 32  ? -1.279  25.455 -1.396  1.00 23.45 ? 32  PRO B CB  1 
ATOM   1836 C  CG  . PRO B 1 32  ? -1.901  26.700 -1.967  1.00 22.84 ? 32  PRO B CG  1 
ATOM   1837 C  CD  . PRO B 1 32  ? -2.625  27.436 -0.905  1.00 24.24 ? 32  PRO B CD  1 
ATOM   1838 N  N   . SER B 1 33  ? -0.085  26.984 1.416   1.00 22.29 ? 33  SER B N   1 
ATOM   1839 C  CA  . SER B 1 33  ? 1.150   27.468 2.040   1.00 21.15 ? 33  SER B CA  1 
ATOM   1840 C  C   . SER B 1 33  ? 1.085   27.607 3.576   1.00 19.93 ? 33  SER B C   1 
ATOM   1841 O  O   . SER B 1 33  ? 2.038   27.276 4.272   1.00 20.10 ? 33  SER B O   1 
ATOM   1842 C  CB  . SER B 1 33  ? 1.454   28.841 1.452   1.00 20.34 ? 33  SER B CB  1 
ATOM   1843 O  OG  . SER B 1 33  ? 1.860   28.708 0.101   1.00 22.64 ? 33  SER B OG  1 
ATOM   1844 N  N   . MET B 1 34  ? -0.024  28.133 4.088   1.00 19.39 ? 34  MET B N   1 
ATOM   1845 C  CA  . MET B 1 34  ? -0.100  28.535 5.499   1.00 19.30 ? 34  MET B CA  1 
ATOM   1846 C  C   . MET B 1 34  ? -1.300  27.978 6.237   1.00 18.89 ? 34  MET B C   1 
ATOM   1847 O  O   . MET B 1 34  ? -2.430  28.082 5.729   1.00 17.75 ? 34  MET B O   1 
ATOM   1848 C  CB  . MET B 1 34  ? -0.104  30.062 5.611   1.00 19.41 ? 34  MET B CB  1 
ATOM   1849 C  CG  . MET B 1 34  ? -0.069  30.593 7.040   1.00 21.38 ? 34  MET B CG  1 
ATOM   1850 S  SD  . MET B 1 34  ? 1.214   29.862 8.068   1.00 24.47 ? 34  MET B SD  1 
ATOM   1851 C  CE  . MET B 1 34  ? 2.581   30.907 7.611   1.00 24.52 ? 34  MET B CE  1 
ATOM   1852 N  N   . ILE B 1 35  ? -1.059  27.393 7.427   1.00 17.37 ? 35  ILE B N   1 
ATOM   1853 C  CA  . ILE B 1 35  ? -2.164  26.963 8.319   1.00 16.26 ? 35  ILE B CA  1 
ATOM   1854 C  C   . ILE B 1 35  ? -1.896  27.549 9.697   1.00 16.17 ? 35  ILE B C   1 
ATOM   1855 O  O   . ILE B 1 35  ? -0.741  27.537 10.215  1.00 15.62 ? 35  ILE B O   1 
ATOM   1856 C  CB  . ILE B 1 35  ? -2.362  25.396 8.408   1.00 16.83 ? 35  ILE B CB  1 
ATOM   1857 C  CG1 . ILE B 1 35  ? -3.531  25.059 9.380   1.00 18.54 ? 35  ILE B CG1 1 
ATOM   1858 C  CG2 . ILE B 1 35  ? -1.008  24.726 8.788   1.00 17.81 ? 35  ILE B CG2 1 
ATOM   1859 C  CD1 . ILE B 1 35  ? -4.035  23.576 9.466   1.00 17.26 ? 35  ILE B CD1 1 
ATOM   1860 N  N   . TYR B 1 36  ? -2.974  28.117 10.222  1.00 15.54 ? 36  TYR B N   1 
ATOM   1861 C  CA  . TYR B 1 36  ? -3.082  28.691 11.568  1.00 15.04 ? 36  TYR B CA  1 
ATOM   1862 C  C   . TYR B 1 36  ? -3.885  27.714 12.340  1.00 15.69 ? 36  TYR B C   1 
ATOM   1863 O  O   . TYR B 1 36  ? -4.950  27.238 11.864  1.00 15.32 ? 36  TYR B O   1 
ATOM   1864 C  CB  . TYR B 1 36  ? -3.789  30.032 11.463  1.00 14.61 ? 36  TYR B CB  1 
ATOM   1865 C  CG  . TYR B 1 36  ? -2.941  31.034 10.718  1.00 15.45 ? 36  TYR B CG  1 
ATOM   1866 C  CD1 . TYR B 1 36  ? -1.773  31.570 11.307  1.00 17.98 ? 36  TYR B CD1 1 
ATOM   1867 C  CD2 . TYR B 1 36  ? -3.251  31.403 9.396   1.00 16.14 ? 36  TYR B CD2 1 
ATOM   1868 C  CE1 . TYR B 1 36  ? -0.974  32.475 10.634  1.00 17.01 ? 36  TYR B CE1 1 
ATOM   1869 C  CE2 . TYR B 1 36  ? -2.469  32.327 8.719   1.00 15.23 ? 36  TYR B CE2 1 
ATOM   1870 C  CZ  . TYR B 1 36  ? -1.329  32.865 9.336   1.00 20.58 ? 36  TYR B CZ  1 
ATOM   1871 O  OH  . TYR B 1 36  ? -0.520  33.761 8.657   1.00 21.75 ? 36  TYR B OH  1 
ATOM   1872 N  N   . PHE B 1 37  ? -3.364  27.318 13.511  1.00 15.37 ? 37  PHE B N   1 
ATOM   1873 C  CA  . PHE B 1 37  ? -4.054  26.314 14.250  1.00 15.16 ? 37  PHE B CA  1 
ATOM   1874 C  C   . PHE B 1 37  ? -3.726  26.314 15.720  1.00 15.97 ? 37  PHE B C   1 
ATOM   1875 O  O   . PHE B 1 37  ? -2.807  27.028 16.188  1.00 15.83 ? 37  PHE B O   1 
ATOM   1876 C  CB  . PHE B 1 37  ? -3.805  24.902 13.663  1.00 15.14 ? 37  PHE B CB  1 
ATOM   1877 C  CG  . PHE B 1 37  ? -2.460  24.317 14.031  1.00 16.47 ? 37  PHE B CG  1 
ATOM   1878 C  CD1 . PHE B 1 37  ? -1.320  24.646 13.300  1.00 16.39 ? 37  PHE B CD1 1 
ATOM   1879 C  CD2 . PHE B 1 37  ? -2.327  23.451 15.117  1.00 15.82 ? 37  PHE B CD2 1 
ATOM   1880 C  CE1 . PHE B 1 37  ? -0.051  24.110 13.656  1.00 20.61 ? 37  PHE B CE1 1 
ATOM   1881 C  CE2 . PHE B 1 37  ? -1.081  22.898 15.464  1.00 19.02 ? 37  PHE B CE2 1 
ATOM   1882 C  CZ  . PHE B 1 37  ? 0.060   23.229 14.720  1.00 18.42 ? 37  PHE B CZ  1 
ATOM   1883 N  N   . SER B 1 38  ? -4.534  25.538 16.444  1.00 16.04 ? 38  SER B N   1 
ATOM   1884 C  CA  . SER B 1 38  ? -4.288  25.282 17.844  1.00 17.56 ? 38  SER B CA  1 
ATOM   1885 C  C   . SER B 1 38  ? -4.775  23.914 18.245  1.00 18.02 ? 38  SER B C   1 
ATOM   1886 O  O   . SER B 1 38  ? -5.923  23.540 17.952  1.00 18.72 ? 38  SER B O   1 
ATOM   1887 C  CB  . SER B 1 38  ? -4.952  26.319 18.727  1.00 18.37 ? 38  SER B CB  1 
ATOM   1888 O  OG  . SER B 1 38  ? -4.781  25.938 20.071  1.00 18.11 ? 38  SER B OG  1 
ATOM   1889 N  N   . PRO B 1 39  ? -3.899  23.145 18.929  1.00 18.43 ? 39  PRO B N   1 
ATOM   1890 C  CA  . PRO B 1 39  ? -4.270  21.882 19.535  1.00 17.93 ? 39  PRO B CA  1 
ATOM   1891 C  C   . PRO B 1 39  ? -5.037  22.088 20.861  1.00 17.56 ? 39  PRO B C   1 
ATOM   1892 O  O   . PRO B 1 39  ? -5.552  21.121 21.430  1.00 15.31 ? 39  PRO B O   1 
ATOM   1893 C  CB  . PRO B 1 39  ? -2.911  21.245 19.825  1.00 16.91 ? 39  PRO B CB  1 
ATOM   1894 C  CG  . PRO B 1 39  ? -2.057  22.400 20.170  1.00 19.33 ? 39  PRO B CG  1 
ATOM   1895 C  CD  . PRO B 1 39  ? -2.475  23.462 19.172  1.00 19.35 ? 39  PRO B CD  1 
ATOM   1896 N  N   . HIS B 1 40  ? -5.069  23.333 21.345  1.00 18.32 ? 40  HIS B N   1 
ATOM   1897 C  CA  . HIS B 1 40  ? -5.565  23.687 22.684  1.00 17.48 ? 40  HIS B CA  1 
ATOM   1898 C  C   . HIS B 1 40  ? -6.619  24.785 22.666  1.00 17.88 ? 40  HIS B C   1 
ATOM   1899 O  O   . HIS B 1 40  ? -6.628  25.672 23.528  1.00 18.64 ? 40  HIS B O   1 
ATOM   1900 C  CB  . HIS B 1 40  ? -4.367  24.086 23.551  1.00 18.38 ? 40  HIS B CB  1 
ATOM   1901 C  CG  . HIS B 1 40  ? -3.360  22.984 23.697  1.00 16.49 ? 40  HIS B CG  1 
ATOM   1902 N  ND1 . HIS B 1 40  ? -2.027  23.203 23.946  1.00 17.12 ? 40  HIS B ND1 1 
ATOM   1903 C  CD2 . HIS B 1 40  ? -3.508  21.642 23.595  1.00 16.02 ? 40  HIS B CD2 1 
ATOM   1904 C  CE1 . HIS B 1 40  ? -1.399  22.041 24.011  1.00 15.43 ? 40  HIS B CE1 1 
ATOM   1905 N  NE2 . HIS B 1 40  ? -2.277  21.078 23.798  1.00 7.80  ? 40  HIS B NE2 1 
ATOM   1906 N  N   . ALA B 1 41  ? -7.488  24.743 21.661  1.00 17.82 ? 41  ALA B N   1 
ATOM   1907 C  CA  . ALA B 1 41  ? -8.461  25.800 21.445  1.00 16.95 ? 41  ALA B CA  1 
ATOM   1908 C  C   . ALA B 1 41  ? -9.710  25.667 22.332  1.00 17.92 ? 41  ALA B C   1 
ATOM   1909 O  O   . ALA B 1 41  ? -9.703  24.865 23.276  1.00 17.00 ? 41  ALA B O   1 
ATOM   1910 C  CB  . ALA B 1 41  ? -8.815  25.858 19.994  1.00 16.65 ? 41  ALA B CB  1 
ATOM   1911 N  N   . GLY B 1 42  ? -10.751 26.451 22.043  1.00 18.54 ? 42  GLY B N   1 
ATOM   1912 C  CA  . GLY B 1 42  ? -11.912 26.604 22.948  1.00 19.64 ? 42  GLY B CA  1 
ATOM   1913 C  C   . GLY B 1 42  ? -11.495 26.940 24.384  1.00 20.66 ? 42  GLY B C   1 
ATOM   1914 O  O   . GLY B 1 42  ? -10.654 27.837 24.621  1.00 19.35 ? 42  GLY B O   1 
ATOM   1915 N  N   . GLY B 1 43  ? -12.034 26.177 25.335  1.00 20.27 ? 43  GLY B N   1 
ATOM   1916 C  CA  . GLY B 1 43  ? -11.667 26.298 26.768  1.00 18.87 ? 43  GLY B CA  1 
ATOM   1917 C  C   . GLY B 1 43  ? -10.382 25.646 27.290  1.00 20.01 ? 43  GLY B C   1 
ATOM   1918 O  O   . GLY B 1 43  ? -10.046 25.813 28.448  1.00 20.22 ? 43  GLY B O   1 
ATOM   1919 N  N   . ILE B 1 44  ? -9.620  24.926 26.466  1.00 19.85 ? 44  ILE B N   1 
ATOM   1920 C  CA  . ILE B 1 44  ? -8.274  24.482 26.921  1.00 19.45 ? 44  ILE B CA  1 
ATOM   1921 C  C   . ILE B 1 44  ? -7.315  25.703 27.176  1.00 19.13 ? 44  ILE B C   1 
ATOM   1922 O  O   . ILE B 1 44  ? -7.012  26.041 28.332  1.00 17.67 ? 44  ILE B O   1 
ATOM   1923 C  CB  . ILE B 1 44  ? -7.632  23.353 26.010  1.00 18.68 ? 44  ILE B CB  1 
ATOM   1924 C  CG1 . ILE B 1 44  ? -8.628  22.195 25.737  1.00 16.39 ? 44  ILE B CG1 1 
ATOM   1925 C  CG2 . ILE B 1 44  ? -6.320  22.849 26.670  1.00 20.21 ? 44  ILE B CG2 1 
ATOM   1926 C  CD1 . ILE B 1 44  ? -8.238  21.238 24.548  1.00 13.08 ? 44  ILE B CD1 1 
ATOM   1927 N  N   . GLU B 1 45  ? -6.871  26.376 26.111  1.00 18.88 ? 45  GLU B N   1 
ATOM   1928 C  CA  . GLU B 1 45  ? -6.206  27.659 26.246  1.00 19.27 ? 45  GLU B CA  1 
ATOM   1929 C  C   . GLU B 1 45  ? -7.098  28.783 25.676  1.00 19.08 ? 45  GLU B C   1 
ATOM   1930 O  O   . GLU B 1 45  ? -7.139  29.003 24.454  1.00 20.17 ? 45  GLU B O   1 
ATOM   1931 C  CB  . GLU B 1 45  ? -4.822  27.599 25.584  1.00 19.36 ? 45  GLU B CB  1 
ATOM   1932 C  CG  . GLU B 1 45  ? -3.822  26.838 26.462  1.00 18.71 ? 45  GLU B CG  1 
ATOM   1933 C  CD  . GLU B 1 45  ? -2.851  25.946 25.720  1.00 17.50 ? 45  GLU B CD  1 
ATOM   1934 O  OE1 . GLU B 1 45  ? -2.545  26.216 24.523  1.00 15.91 ? 45  GLU B OE1 1 
ATOM   1935 O  OE2 . GLU B 1 45  ? -2.376  24.946 26.334  1.00 16.14 ? 45  GLU B OE2 1 
ATOM   1936 N  N   . VAL B 1 46  ? -7.793  29.492 26.567  1.00 18.63 ? 46  VAL B N   1 
ATOM   1937 C  CA  . VAL B 1 46  ? -8.896  30.407 26.196  1.00 19.05 ? 46  VAL B CA  1 
ATOM   1938 C  C   . VAL B 1 46  ? -8.457  31.600 25.405  1.00 18.29 ? 46  VAL B C   1 
ATOM   1939 O  O   . VAL B 1 46  ? -7.539  32.328 25.818  1.00 18.69 ? 46  VAL B O   1 
ATOM   1940 C  CB  . VAL B 1 46  ? -9.686  30.899 27.398  1.00 18.39 ? 46  VAL B CB  1 
ATOM   1941 C  CG1 . VAL B 1 46  ? -10.609 32.081 26.981  1.00 20.52 ? 46  VAL B CG1 1 
ATOM   1942 C  CG2 . VAL B 1 46  ? -10.483 29.737 27.977  1.00 19.70 ? 46  VAL B CG2 1 
ATOM   1943 N  N   . GLY B 1 47  ? -9.118  31.804 24.256  1.00 17.71 ? 47  GLY B N   1 
ATOM   1944 C  CA  . GLY B 1 47  ? -8.775  32.902 23.393  1.00 18.58 ? 47  GLY B CA  1 
ATOM   1945 C  C   . GLY B 1 47  ? -8.033  32.547 22.118  1.00 18.05 ? 47  GLY B C   1 
ATOM   1946 O  O   . GLY B 1 47  ? -7.865  33.403 21.264  1.00 18.46 ? 47  GLY B O   1 
ATOM   1947 N  N   . THR B 1 48  ? -7.600  31.292 21.991  1.00 19.38 ? 48  THR B N   1 
ATOM   1948 C  CA  . THR B 1 48  ? -6.870  30.812 20.799  1.00 19.14 ? 48  THR B CA  1 
ATOM   1949 C  C   . THR B 1 48  ? -7.855  30.554 19.654  1.00 20.04 ? 48  THR B C   1 
ATOM   1950 O  O   . THR B 1 48  ? -7.586  30.929 18.520  1.00 20.88 ? 48  THR B O   1 
ATOM   1951 C  CB  . THR B 1 48  ? -6.020  29.562 21.106  1.00 18.93 ? 48  THR B CB  1 
ATOM   1952 O  OG1 . THR B 1 48  ? -6.857  28.519 21.650  1.00 17.49 ? 48  THR B OG1 1 
ATOM   1953 C  CG2 . THR B 1 48  ? -4.886  29.928 22.126  1.00 18.38 ? 48  THR B CG2 1 
ATOM   1954 N  N   . THR B 1 49  ? -8.996  29.936 19.960  1.00 19.17 ? 49  THR B N   1 
ATOM   1955 C  CA  . THR B 1 49  ? -10.115 29.924 19.032  1.00 21.10 ? 49  THR B CA  1 
ATOM   1956 C  C   . THR B 1 49  ? -10.395 31.307 18.414  1.00 21.14 ? 49  THR B C   1 
ATOM   1957 O  O   . THR B 1 49  ? -10.266 31.468 17.215  1.00 22.16 ? 49  THR B O   1 
ATOM   1958 C  CB  . THR B 1 49  ? -11.383 29.358 19.687  1.00 20.37 ? 49  THR B CB  1 
ATOM   1959 O  OG1 . THR B 1 49  ? -11.181 27.966 19.887  1.00 23.64 ? 49  THR B OG1 1 
ATOM   1960 C  CG2 . THR B 1 49  ? -12.624 29.564 18.770  1.00 21.37 ? 49  THR B CG2 1 
ATOM   1961 N  N   . GLU B 1 50  ? -10.733 32.298 19.234  1.00 21.25 ? 50  GLU B N   1 
ATOM   1962 C  CA  . GLU B 1 50  ? -11.101 33.628 18.716  1.00 20.78 ? 50  GLU B CA  1 
ATOM   1963 C  C   . GLU B 1 50  ? -9.981  34.254 17.854  1.00 20.37 ? 50  GLU B C   1 
ATOM   1964 O  O   . GLU B 1 50  ? -10.242 34.784 16.774  1.00 19.59 ? 50  GLU B O   1 
ATOM   1965 C  CB  . GLU B 1 50  ? -11.534 34.546 19.861  1.00 21.60 ? 50  GLU B CB  1 
ATOM   1966 C  CG  . GLU B 1 50  ? -12.865 34.127 20.564  1.00 21.96 ? 50  GLU B CG  1 
ATOM   1967 C  CD  . GLU B 1 50  ? -12.736 32.943 21.545  1.00 24.15 ? 50  GLU B CD  1 
ATOM   1968 O  OE1 . GLU B 1 50  ? -11.618 32.677 22.058  1.00 24.30 ? 50  GLU B OE1 1 
ATOM   1969 O  OE2 . GLU B 1 50  ? -13.764 32.266 21.809  1.00 25.30 ? 50  GLU B OE2 1 
ATOM   1970 N  N   . LEU B 1 51  ? -8.724  34.139 18.295  1.00 19.34 ? 51  LEU B N   1 
ATOM   1971 C  CA  . LEU B 1 51  ? -7.602  34.731 17.545  1.00 18.12 ? 51  LEU B CA  1 
ATOM   1972 C  C   . LEU B 1 51  ? -7.390  34.109 16.191  1.00 18.06 ? 51  LEU B C   1 
ATOM   1973 O  O   . LEU B 1 51  ? -7.102  34.810 15.218  1.00 16.16 ? 51  LEU B O   1 
ATOM   1974 C  CB  . LEU B 1 51  ? -6.266  34.667 18.328  1.00 18.38 ? 51  LEU B CB  1 
ATOM   1975 C  CG  . LEU B 1 51  ? -4.995  35.255 17.652  1.00 17.18 ? 51  LEU B CG  1 
ATOM   1976 C  CD1 . LEU B 1 51  ? -5.198  36.706 17.269  1.00 14.85 ? 51  LEU B CD1 1 
ATOM   1977 C  CD2 . LEU B 1 51  ? -3.850  35.202 18.612  1.00 14.39 ? 51  LEU B CD2 1 
ATOM   1978 N  N   . ILE B 1 52  ? -7.504  32.786 16.137  1.00 17.16 ? 52  ILE B N   1 
ATOM   1979 C  CA  . ILE B 1 52  ? -7.292  32.060 14.877  1.00 17.99 ? 52  ILE B CA  1 
ATOM   1980 C  C   . ILE B 1 52  ? -8.430  32.342 13.884  1.00 17.98 ? 52  ILE B C   1 
ATOM   1981 O  O   . ILE B 1 52  ? -8.190  32.452 12.686  1.00 17.63 ? 52  ILE B O   1 
ATOM   1982 C  CB  . ILE B 1 52  ? -7.127  30.572 15.168  1.00 17.59 ? 52  ILE B CB  1 
ATOM   1983 C  CG1 . ILE B 1 52  ? -5.774  30.363 15.843  1.00 18.45 ? 52  ILE B CG1 1 
ATOM   1984 C  CG2 . ILE B 1 52  ? -7.257  29.720 13.918  1.00 17.32 ? 52  ILE B CG2 1 
ATOM   1985 C  CD1 . ILE B 1 52  ? -5.508  28.928 16.247  1.00 20.96 ? 52  ILE B CD1 1 
ATOM   1986 N  N   . TYR B 1 53  ? -9.648  32.500 14.394  1.00 19.21 ? 53  TYR B N   1 
ATOM   1987 C  CA  . TYR B 1 53  ? -10.790 32.918 13.555  1.00 20.08 ? 53  TYR B CA  1 
ATOM   1988 C  C   . TYR B 1 53  ? -10.474 34.223 12.833  1.00 20.38 ? 53  TYR B C   1 
ATOM   1989 O  O   . TYR B 1 53  ? -10.556 34.317 11.597  1.00 20.79 ? 53  TYR B O   1 
ATOM   1990 C  CB  . TYR B 1 53  ? -12.058 33.087 14.397  1.00 21.00 ? 53  TYR B CB  1 
ATOM   1991 C  CG  . TYR B 1 53  ? -12.823 31.803 14.753  1.00 24.03 ? 53  TYR B CG  1 
ATOM   1992 C  CD1 . TYR B 1 53  ? -12.523 30.591 14.146  1.00 24.08 ? 53  TYR B CD1 1 
ATOM   1993 C  CD2 . TYR B 1 53  ? -13.847 31.829 15.722  1.00 27.85 ? 53  TYR B CD2 1 
ATOM   1994 C  CE1 . TYR B 1 53  ? -13.224 29.420 14.459  1.00 25.57 ? 53  TYR B CE1 1 
ATOM   1995 C  CE2 . TYR B 1 53  ? -14.558 30.674 16.053  1.00 30.59 ? 53  TYR B CE2 1 
ATOM   1996 C  CZ  . TYR B 1 53  ? -14.233 29.470 15.401  1.00 30.21 ? 53  TYR B CZ  1 
ATOM   1997 O  OH  . TYR B 1 53  ? -14.906 28.321 15.704  1.00 33.82 ? 53  TYR B OH  1 
ATOM   1998 N  N   . ARG B 1 54  ? -10.067 35.211 13.615  1.00 20.36 ? 54  ARG B N   1 
ATOM   1999 C  CA  . ARG B 1 54  ? -9.713  36.500 13.099  1.00 20.63 ? 54  ARG B CA  1 
ATOM   2000 C  C   . ARG B 1 54  ? -8.493  36.415 12.192  1.00 20.52 ? 54  ARG B C   1 
ATOM   2001 O  O   . ARG B 1 54  ? -8.516  36.971 11.127  1.00 19.74 ? 54  ARG B O   1 
ATOM   2002 C  CB  . ARG B 1 54  ? -9.485  37.472 14.246  1.00 21.13 ? 54  ARG B CB  1 
ATOM   2003 C  CG  . ARG B 1 54  ? -9.276  38.918 13.815  1.00 21.18 ? 54  ARG B CG  1 
ATOM   2004 C  CD  . ARG B 1 54  ? -10.449 39.419 13.004  1.00 21.64 ? 54  ARG B CD  1 
ATOM   2005 N  NE  . ARG B 1 54  ? -10.258 40.805 12.615  1.00 24.80 ? 54  ARG B NE  1 
ATOM   2006 C  CZ  . ARG B 1 54  ? -10.992 41.405 11.695  1.00 24.70 ? 54  ARG B CZ  1 
ATOM   2007 N  NH1 . ARG B 1 54  ? -11.943 40.724 11.078  1.00 25.45 ? 54  ARG B NH1 1 
ATOM   2008 N  NH2 . ARG B 1 54  ? -10.776 42.672 11.396  1.00 26.02 ? 54  ARG B NH2 1 
ATOM   2009 N  N   . VAL B 1 55  ? -7.423  35.717 12.596  1.00 19.42 ? 55  VAL B N   1 
ATOM   2010 C  CA  . VAL B 1 55  ? -6.228  35.645 11.706  1.00 18.63 ? 55  VAL B CA  1 
ATOM   2011 C  C   . VAL B 1 55  ? -6.588  34.975 10.390  1.00 18.66 ? 55  VAL B C   1 
ATOM   2012 O  O   . VAL B 1 55  ? -6.285  35.529 9.310   1.00 17.15 ? 55  VAL B O   1 
ATOM   2013 C  CB  . VAL B 1 55  ? -4.975  35.048 12.386  1.00 17.74 ? 55  VAL B CB  1 
ATOM   2014 C  CG1 . VAL B 1 55  ? -3.864  34.738 11.368  1.00 18.39 ? 55  VAL B CG1 1 
ATOM   2015 C  CG2 . VAL B 1 55  ? -4.467  36.037 13.469  1.00 18.19 ? 55  VAL B CG2 1 
ATOM   2016 N  N   . VAL B 1 56  ? -7.309  33.846 10.469  1.00 18.73 ? 56  VAL B N   1 
ATOM   2017 C  CA  . VAL B 1 56  ? -7.779  33.152 9.267   1.00 19.81 ? 56  VAL B CA  1 
ATOM   2018 C  C   . VAL B 1 56  ? -8.602  34.056 8.340   1.00 21.47 ? 56  VAL B C   1 
ATOM   2019 O  O   . VAL B 1 56  ? -8.317  34.059 7.146   1.00 22.04 ? 56  VAL B O   1 
ATOM   2020 C  CB  . VAL B 1 56  ? -8.545  31.814 9.542   1.00 20.50 ? 56  VAL B CB  1 
ATOM   2021 C  CG1 . VAL B 1 56  ? -9.354  31.343 8.261   1.00 18.78 ? 56  VAL B CG1 1 
ATOM   2022 C  CG2 . VAL B 1 56  ? -7.538  30.721 9.976   1.00 18.50 ? 56  VAL B CG2 1 
ATOM   2023 N  N   . GLU B 1 57  ? -9.601  34.786 8.878   1.00 21.83 ? 57  GLU B N   1 
ATOM   2024 C  CA  . GLU B 1 57  ? -10.381 35.783 8.121   1.00 23.28 ? 57  GLU B CA  1 
ATOM   2025 C  C   . GLU B 1 57  ? -9.493  36.842 7.433   1.00 23.94 ? 57  GLU B C   1 
ATOM   2026 O  O   . GLU B 1 57  ? -9.723  37.234 6.272   1.00 23.48 ? 57  GLU B O   1 
ATOM   2027 C  CB  . GLU B 1 57  ? -11.455 36.478 9.013   1.00 23.02 ? 57  GLU B CB  1 
ATOM   2028 C  CG  . GLU B 1 57  ? -12.605 35.549 9.488   1.00 25.17 ? 57  GLU B CG  1 
ATOM   2029 C  CD  . GLU B 1 57  ? -13.287 36.011 10.791  1.00 28.53 ? 57  GLU B CD  1 
ATOM   2030 O  OE1 . GLU B 1 57  ? -12.788 36.968 11.436  1.00 31.01 ? 57  GLU B OE1 1 
ATOM   2031 O  OE2 . GLU B 1 57  ? -14.317 35.398 11.198  1.00 30.50 ? 57  GLU B OE2 1 
ATOM   2032 N  N   . LEU B 1 58  ? -8.475  37.320 8.132   1.00 23.90 ? 58  LEU B N   1 
ATOM   2033 C  CA  . LEU B 1 58  ? -7.608  38.311 7.513   1.00 24.54 ? 58  LEU B CA  1 
ATOM   2034 C  C   . LEU B 1 58  ? -6.704  37.753 6.399   1.00 24.71 ? 58  LEU B C   1 
ATOM   2035 O  O   . LEU B 1 58  ? -6.360  38.456 5.446   1.00 24.85 ? 58  LEU B O   1 
ATOM   2036 C  CB  . LEU B 1 58  ? -6.780  39.018 8.566   1.00 24.46 ? 58  LEU B CB  1 
ATOM   2037 C  CG  . LEU B 1 58  ? -7.506  39.780 9.677   1.00 26.61 ? 58  LEU B CG  1 
ATOM   2038 C  CD1 . LEU B 1 58  ? -6.424  40.337 10.581  1.00 24.35 ? 58  LEU B CD1 1 
ATOM   2039 C  CD2 . LEU B 1 58  ? -8.431  40.900 9.167   1.00 26.90 ? 58  LEU B CD2 1 
ATOM   2040 N  N   . THR B 1 59  ? -6.355  36.472 6.496   1.00 24.14 ? 59  THR B N   1 
ATOM   2041 C  CA  . THR B 1 59  ? -5.256  35.946 5.713   1.00 22.79 ? 59  THR B CA  1 
ATOM   2042 C  C   . THR B 1 59  ? -5.665  35.002 4.584   1.00 22.48 ? 59  THR B C   1 
ATOM   2043 O  O   . THR B 1 59  ? -4.923  34.850 3.624   1.00 22.25 ? 59  THR B O   1 
ATOM   2044 C  CB  . THR B 1 59  ? -4.264  35.244 6.631   1.00 23.23 ? 59  THR B CB  1 
ATOM   2045 O  OG1 . THR B 1 59  ? -4.972  34.295 7.461   1.00 21.87 ? 59  THR B OG1 1 
ATOM   2046 C  CG2 . THR B 1 59  ? -3.572  36.288 7.521   1.00 23.44 ? 59  THR B CG2 1 
ATOM   2047 N  N   . GLY B 1 60  ? -6.828  34.379 4.691   1.00 20.96 ? 60  GLY B N   1 
ATOM   2048 C  CA  . GLY B 1 60  ? -7.157  33.219 3.820   1.00 21.13 ? 60  GLY B CA  1 
ATOM   2049 C  C   . GLY B 1 60  ? -6.335  31.946 4.100   1.00 21.00 ? 60  GLY B C   1 
ATOM   2050 O  O   . GLY B 1 60  ? -6.400  30.998 3.349   1.00 21.03 ? 60  GLY B O   1 
ATOM   2051 N  N   . GLY B 1 61  ? -5.544  31.920 5.178   1.00 21.02 ? 61  GLY B N   1 
ATOM   2052 C  CA  . GLY B 1 61  ? -4.825  30.696 5.611   1.00 20.41 ? 61  GLY B CA  1 
ATOM   2053 C  C   . GLY B 1 61  ? -5.800  29.586 5.992   1.00 19.04 ? 61  GLY B C   1 
ATOM   2054 O  O   . GLY B 1 61  ? -6.977  29.870 6.249   1.00 19.56 ? 61  GLY B O   1 
ATOM   2055 N  N   . SER B 1 62  ? -5.358  28.325 5.942   1.00 19.06 ? 62  SER B N   1 
ATOM   2056 C  CA  . SER B 1 62  ? -6.217  27.212 6.414   1.00 18.05 ? 62  SER B CA  1 
ATOM   2057 C  C   . SER B 1 62  ? -6.386  27.283 7.940   1.00 18.12 ? 62  SER B C   1 
ATOM   2058 O  O   . SER B 1 62  ? -5.561  27.910 8.630   1.00 18.41 ? 62  SER B O   1 
ATOM   2059 C  CB  . SER B 1 62  ? -5.691  25.839 6.002   1.00 18.26 ? 62  SER B CB  1 
ATOM   2060 O  OG  . SER B 1 62  ? -5.537  25.700 4.581   1.00 17.98 ? 62  SER B OG  1 
ATOM   2061 N  N   . LEU B 1 63  ? -7.469  26.687 8.463   1.00 17.85 ? 63  LEU B N   1 
ATOM   2062 C  CA  . LEU B 1 63  ? -7.707  26.644 9.929   1.00 17.58 ? 63  LEU B CA  1 
ATOM   2063 C  C   . LEU B 1 63  ? -7.737  25.193 10.463  1.00 17.03 ? 63  LEU B C   1 
ATOM   2064 O  O   . LEU B 1 63  ? -8.154  24.279 9.747   1.00 16.74 ? 63  LEU B O   1 
ATOM   2065 C  CB  . LEU B 1 63  ? -8.996  27.382 10.267  1.00 17.20 ? 63  LEU B CB  1 
ATOM   2066 C  CG  . LEU B 1 63  ? -9.778  27.280 11.592  1.00 17.42 ? 63  LEU B CG  1 
ATOM   2067 C  CD1 . LEU B 1 63  ? -10.570 28.538 11.797  1.00 14.17 ? 63  LEU B CD1 1 
ATOM   2068 C  CD2 . LEU B 1 63  ? -10.681 26.044 11.508  1.00 16.70 ? 63  LEU B CD2 1 
ATOM   2069 N  N   . TYR B 1 64  ? -7.283  24.991 11.715  1.00 16.78 ? 64  TYR B N   1 
ATOM   2070 C  CA  . TYR B 1 64  ? -7.543  23.745 12.447  1.00 16.05 ? 64  TYR B CA  1 
ATOM   2071 C  C   . TYR B 1 64  ? -7.713  24.097 13.919  1.00 15.80 ? 64  TYR B C   1 
ATOM   2072 O  O   . TYR B 1 64  ? -6.885  24.814 14.440  1.00 15.18 ? 64  TYR B O   1 
ATOM   2073 C  CB  . TYR B 1 64  ? -6.427  22.682 12.236  1.00 14.83 ? 64  TYR B CB  1 
ATOM   2074 C  CG  . TYR B 1 64  ? -6.576  21.459 13.143  1.00 13.96 ? 64  TYR B CG  1 
ATOM   2075 C  CD1 . TYR B 1 64  ? -6.077  21.473 14.449  1.00 15.64 ? 64  TYR B CD1 1 
ATOM   2076 C  CD2 . TYR B 1 64  ? -7.237  20.302 12.700  1.00 15.42 ? 64  TYR B CD2 1 
ATOM   2077 C  CE1 . TYR B 1 64  ? -6.222  20.363 15.294  1.00 17.35 ? 64  TYR B CE1 1 
ATOM   2078 C  CE2 . TYR B 1 64  ? -7.422  19.204 13.531  1.00 18.19 ? 64  TYR B CE2 1 
ATOM   2079 C  CZ  . TYR B 1 64  ? -6.893  19.236 14.836  1.00 18.39 ? 64  TYR B CZ  1 
ATOM   2080 O  OH  . TYR B 1 64  ? -7.047  18.143 15.644  1.00 18.87 ? 64  TYR B OH  1 
ATOM   2081 N  N   . LEU B 1 65  ? -8.819  23.681 14.562  1.00 16.39 ? 65  LEU B N   1 
ATOM   2082 C  CA  . LEU B 1 65  ? -8.951  23.870 16.023  1.00 17.57 ? 65  LEU B CA  1 
ATOM   2083 C  C   . LEU B 1 65  ? -9.352  22.585 16.725  1.00 17.00 ? 65  LEU B C   1 
ATOM   2084 O  O   . LEU B 1 65  ? -10.312 21.934 16.344  1.00 17.61 ? 65  LEU B O   1 
ATOM   2085 C  CB  . LEU B 1 65  ? -9.959  24.981 16.376  1.00 17.66 ? 65  LEU B CB  1 
ATOM   2086 C  CG  . LEU B 1 65  ? -9.778  26.416 15.893  1.00 18.72 ? 65  LEU B CG  1 
ATOM   2087 C  CD1 . LEU B 1 65  ? -11.015 27.212 16.113  1.00 20.16 ? 65  LEU B CD1 1 
ATOM   2088 C  CD2 . LEU B 1 65  ? -8.582  27.063 16.541  1.00 17.02 ? 65  LEU B CD2 1 
ATOM   2089 N  N   . PHE B 1 66  ? -8.555  22.183 17.703  1.00 18.62 ? 66  PHE B N   1 
ATOM   2090 C  CA  . PHE B 1 66  ? -8.983  21.186 18.663  1.00 18.89 ? 66  PHE B CA  1 
ATOM   2091 C  C   . PHE B 1 66  ? -9.523  21.901 19.908  1.00 17.92 ? 66  PHE B C   1 
ATOM   2092 O  O   . PHE B 1 66  ? -8.755  22.332 20.789  1.00 17.14 ? 66  PHE B O   1 
ATOM   2093 C  CB  . PHE B 1 66  ? -7.834  20.244 19.049  1.00 18.45 ? 66  PHE B CB  1 
ATOM   2094 C  CG  . PHE B 1 66  ? -8.296  19.027 19.812  1.00 22.53 ? 66  PHE B CG  1 
ATOM   2095 C  CD1 . PHE B 1 66  ? -8.693  17.882 19.126  1.00 20.11 ? 66  PHE B CD1 1 
ATOM   2096 C  CD2 . PHE B 1 66  ? -8.349  19.039 21.218  1.00 19.24 ? 66  PHE B CD2 1 
ATOM   2097 C  CE1 . PHE B 1 66  ? -9.140  16.776 19.811  1.00 22.23 ? 66  PHE B CE1 1 
ATOM   2098 C  CE2 . PHE B 1 66  ? -8.795  17.924 21.916  1.00 20.63 ? 66  PHE B CE2 1 
ATOM   2099 C  CZ  . PHE B 1 66  ? -9.189  16.792 21.214  1.00 20.18 ? 66  PHE B CZ  1 
ATOM   2100 N  N   . GLN B 1 67  ? -10.843 21.953 20.010  1.00 17.59 ? 67  GLN B N   1 
ATOM   2101 C  CA  . GLN B 1 67  ? -11.512 22.724 21.057  1.00 19.29 ? 67  GLN B CA  1 
ATOM   2102 C  C   . GLN B 1 67  ? -11.970 21.999 22.354  1.00 20.24 ? 67  GLN B C   1 
ATOM   2103 O  O   . GLN B 1 67  ? -12.630 20.957 22.306  1.00 21.10 ? 67  GLN B O   1 
ATOM   2104 C  CB  . GLN B 1 67  ? -12.692 23.464 20.450  1.00 19.25 ? 67  GLN B CB  1 
ATOM   2105 C  CG  . GLN B 1 67  ? -12.320 24.340 19.270  1.00 19.55 ? 67  GLN B CG  1 
ATOM   2106 C  CD  . GLN B 1 67  ? -13.425 25.296 18.926  1.00 19.92 ? 67  GLN B CD  1 
ATOM   2107 O  OE1 . GLN B 1 67  ? -13.332 26.484 19.188  1.00 24.00 ? 67  GLN B OE1 1 
ATOM   2108 N  NE2 . GLN B 1 67  ? -14.507 24.775 18.384  1.00 19.12 ? 67  GLN B NE2 1 
ATOM   2109 N  N   . GLY B 1 68  ? -11.672 22.580 23.519  1.00 20.85 ? 68  GLY B N   1 
ATOM   2110 C  CA  . GLY B 1 68  ? -12.346 22.099 24.732  1.00 21.72 ? 68  GLY B CA  1 
ATOM   2111 C  C   . GLY B 1 68  ? -13.721 22.730 24.683  1.00 21.89 ? 68  GLY B C   1 
ATOM   2112 O  O   . GLY B 1 68  ? -13.865 23.864 24.188  1.00 22.67 ? 68  GLY B O   1 
ATOM   2113 N  N   . LEU B 1 69  ? -14.732 21.994 25.141  1.00 22.24 ? 69  LEU B N   1 
ATOM   2114 C  CA  . LEU B 1 69  ? -16.125 22.448 25.156  1.00 22.09 ? 69  LEU B CA  1 
ATOM   2115 C  C   . LEU B 1 69  ? -16.762 22.553 26.545  1.00 23.57 ? 69  LEU B C   1 
ATOM   2116 O  O   . LEU B 1 69  ? -17.775 23.248 26.702  1.00 23.79 ? 69  LEU B O   1 
ATOM   2117 C  CB  . LEU B 1 69  ? -17.021 21.496 24.337  1.00 23.13 ? 69  LEU B CB  1 
ATOM   2118 C  CG  . LEU B 1 69  ? -16.729 21.402 22.838  1.00 20.49 ? 69  LEU B CG  1 
ATOM   2119 C  CD1 . LEU B 1 69  ? -17.702 20.448 22.094  1.00 20.53 ? 69  LEU B CD1 1 
ATOM   2120 C  CD2 . LEU B 1 69  ? -16.679 22.783 22.230  1.00 20.25 ? 69  LEU B CD2 1 
ATOM   2121 N  N   . LEU B 1 70  ? -16.211 21.830 27.522  1.00 23.95 ? 70  LEU B N   1 
ATOM   2122 C  CA  . LEU B 1 70  ? -16.812 21.775 28.849  1.00 24.51 ? 70  LEU B CA  1 
ATOM   2123 C  C   . LEU B 1 70  ? -16.764 23.137 29.527  1.00 25.09 ? 70  LEU B C   1 
ATOM   2124 O  O   . LEU B 1 70  ? -15.858 23.949 29.280  1.00 24.63 ? 70  LEU B O   1 
ATOM   2125 C  CB  . LEU B 1 70  ? -16.133 20.737 29.777  1.00 24.68 ? 70  LEU B CB  1 
ATOM   2126 C  CG  . LEU B 1 70  ? -15.766 19.333 29.290  1.00 26.22 ? 70  LEU B CG  1 
ATOM   2127 C  CD1 . LEU B 1 70  ? -14.389 19.004 29.781  1.00 26.55 ? 70  LEU B CD1 1 
ATOM   2128 C  CD2 . LEU B 1 70  ? -16.777 18.310 29.776  1.00 26.94 ? 70  LEU B CD2 1 
ATOM   2129 N  N   . PRO B 1 71  ? -17.748 23.388 30.392  1.00 26.05 ? 71  PRO B N   1 
ATOM   2130 C  CA  . PRO B 1 71  ? -17.858 24.614 31.153  1.00 26.91 ? 71  PRO B CA  1 
ATOM   2131 C  C   . PRO B 1 71  ? -16.678 24.718 32.067  1.00 27.57 ? 71  PRO B C   1 
ATOM   2132 O  O   . PRO B 1 71  ? -16.220 25.824 32.347  1.00 27.59 ? 71  PRO B O   1 
ATOM   2133 C  CB  . PRO B 1 71  ? -19.090 24.358 32.024  1.00 27.14 ? 71  PRO B CB  1 
ATOM   2134 C  CG  . PRO B 1 71  ? -19.295 22.903 31.994  1.00 25.29 ? 71  PRO B CG  1 
ATOM   2135 C  CD  . PRO B 1 71  ? -18.936 22.541 30.605  1.00 26.40 ? 71  PRO B CD  1 
ATOM   2136 N  N   . SER B 1 72  ? -16.194 23.548 32.500  1.00 28.17 ? 72  SER B N   1 
ATOM   2137 C  CA  . SER B 1 72  ? -15.179 23.454 33.533  1.00 28.26 ? 72  SER B CA  1 
ATOM   2138 C  C   . SER B 1 72  ? -14.209 22.281 33.348  1.00 27.45 ? 72  SER B C   1 
ATOM   2139 O  O   . SER B 1 72  ? -14.563 21.224 32.831  1.00 28.03 ? 72  SER B O   1 
ATOM   2140 C  CB  . SER B 1 72  ? -15.864 23.391 34.916  1.00 27.96 ? 72  SER B CB  1 
ATOM   2141 O  OG  . SER B 1 72  ? -16.995 22.514 34.891  1.00 29.89 ? 72  SER B OG  1 
ATOM   2142 N  N   . GLY B 1 73  ? -12.963 22.496 33.758  1.00 26.79 ? 73  GLY B N   1 
ATOM   2143 C  CA  . GLY B 1 73  ? -11.983 21.432 33.809  1.00 25.67 ? 73  GLY B CA  1 
ATOM   2144 C  C   . GLY B 1 73  ? -11.545 21.041 32.399  1.00 24.73 ? 73  GLY B C   1 
ATOM   2145 O  O   . GLY B 1 73  ? -11.348 19.863 32.113  1.00 24.34 ? 73  GLY B O   1 
ATOM   2146 N  N   . ASN B 1 74  ? -11.347 22.022 31.527  1.00 24.54 ? 74  ASN B N   1 
ATOM   2147 C  CA  . ASN B 1 74  ? -10.851 21.714 30.179  1.00 24.21 ? 74  ASN B CA  1 
ATOM   2148 C  C   . ASN B 1 74  ? -9.411  21.331 30.157  1.00 24.08 ? 74  ASN B C   1 
ATOM   2149 O  O   . ASN B 1 74  ? -8.911  20.811 29.147  1.00 21.41 ? 74  ASN B O   1 
ATOM   2150 C  CB  . ASN B 1 74  ? -11.062 22.863 29.241  1.00 23.25 ? 74  ASN B CB  1 
ATOM   2151 C  CG  . ASN B 1 74  ? -12.452 22.934 28.776  1.00 21.90 ? 74  ASN B CG  1 
ATOM   2152 O  OD1 . ASN B 1 74  ? -12.888 22.121 27.982  1.00 18.02 ? 74  ASN B OD1 1 
ATOM   2153 N  ND2 . ASN B 1 74  ? -13.170 23.917 29.260  1.00 22.07 ? 74  ASN B ND2 1 
ATOM   2154 N  N   . SER B 1 75  ? -8.746  21.633 31.274  1.00 22.87 ? 75  SER B N   1 
ATOM   2155 C  CA  . SER B 1 75  ? -7.398  21.162 31.518  1.00 22.84 ? 75  SER B CA  1 
ATOM   2156 C  C   . SER B 1 75  ? -7.159  19.680 31.183  1.00 22.41 ? 75  SER B C   1 
ATOM   2157 O  O   . SER B 1 75  ? -6.129  19.352 30.621  1.00 21.49 ? 75  SER B O   1 
ATOM   2158 C  CB  . SER B 1 75  ? -7.011  21.460 32.975  1.00 21.26 ? 75  SER B CB  1 
ATOM   2159 O  OG  . SER B 1 75  ? -8.158  21.410 33.794  1.00 22.69 ? 75  SER B OG  1 
ATOM   2160 N  N   . ARG B 1 76  ? -8.105  18.787 31.503  1.00 23.34 ? 76  ARG B N   1 
ATOM   2161 C  CA  . ARG B 1 76  ? -7.910  17.335 31.223  1.00 22.97 ? 76  ARG B CA  1 
ATOM   2162 C  C   . ARG B 1 76  ? -7.786  16.983 29.731  1.00 23.01 ? 76  ARG B C   1 
ATOM   2163 O  O   . ARG B 1 76  ? -7.325  15.894 29.366  1.00 21.88 ? 76  ARG B O   1 
ATOM   2164 C  CB  . ARG B 1 76  ? -8.986  16.468 31.891  1.00 23.45 ? 76  ARG B CB  1 
ATOM   2165 C  CG  . ARG B 1 76  ? -10.381 16.469 31.221  1.00 22.37 ? 76  ARG B CG  1 
ATOM   2166 C  CD  . ARG B 1 76  ? -11.209 15.360 31.877  1.00 18.36 ? 76  ARG B CD  1 
ATOM   2167 N  NE  . ARG B 1 76  ? -12.502 15.116 31.246  1.00 13.49 ? 76  ARG B NE  1 
ATOM   2168 C  CZ  . ARG B 1 76  ? -13.653 15.745 31.510  1.00 18.17 ? 76  ARG B CZ  1 
ATOM   2169 N  NH1 . ARG B 1 76  ? -13.736 16.733 32.413  1.00 20.01 ? 76  ARG B NH1 1 
ATOM   2170 N  NH2 . ARG B 1 76  ? -14.765 15.376 30.852  1.00 14.74 ? 76  ARG B NH2 1 
ATOM   2171 N  N   . LEU B 1 77  ? -8.170  17.920 28.870  1.00 23.05 ? 77  LEU B N   1 
ATOM   2172 C  CA  . LEU B 1 77  ? -8.152  17.659 27.433  1.00 22.59 ? 77  LEU B CA  1 
ATOM   2173 C  C   . LEU B 1 77  ? -6.889  18.198 26.760  1.00 23.21 ? 77  LEU B C   1 
ATOM   2174 O  O   . LEU B 1 77  ? -6.774  18.115 25.542  1.00 21.40 ? 77  LEU B O   1 
ATOM   2175 C  CB  . LEU B 1 77  ? -9.433  18.254 26.777  1.00 23.49 ? 77  LEU B CB  1 
ATOM   2176 C  CG  . LEU B 1 77  ? -10.787 17.926 27.427  1.00 21.57 ? 77  LEU B CG  1 
ATOM   2177 C  CD1 . LEU B 1 77  ? -11.992 18.741 26.807  1.00 17.58 ? 77  LEU B CD1 1 
ATOM   2178 C  CD2 . LEU B 1 77  ? -11.101 16.391 27.479  1.00 19.50 ? 77  LEU B CD2 1 
ATOM   2179 N  N   . HIS B 1 78  ? -5.958  18.749 27.555  1.00 22.29 ? 78  HIS B N   1 
ATOM   2180 C  CA  . HIS B 1 78  ? -4.688  19.301 27.049  1.00 22.16 ? 78  HIS B CA  1 
ATOM   2181 C  C   . HIS B 1 78  ? -3.746  18.139 26.736  1.00 21.07 ? 78  HIS B C   1 
ATOM   2182 O  O   . HIS B 1 78  ? -3.379  17.364 27.629  1.00 19.91 ? 78  HIS B O   1 
ATOM   2183 C  CB  . HIS B 1 78  ? -4.068  20.238 28.098  1.00 22.35 ? 78  HIS B CB  1 
ATOM   2184 C  CG  . HIS B 1 78  ? -2.714  20.795 27.736  1.00 22.50 ? 78  HIS B CG  1 
ATOM   2185 N  ND1 . HIS B 1 78  ? -1.530  20.142 28.017  1.00 23.16 ? 78  HIS B ND1 1 
ATOM   2186 C  CD2 . HIS B 1 78  ? -2.362  21.961 27.151  1.00 22.68 ? 78  HIS B CD2 1 
ATOM   2187 C  CE1 . HIS B 1 78  ? -0.513  20.879 27.628  1.00 23.41 ? 78  HIS B CE1 1 
ATOM   2188 N  NE2 . HIS B 1 78  ? -0.989  21.989 27.095  1.00 22.35 ? 78  HIS B NE2 1 
ATOM   2189 N  N   . VAL B 1 79  ? -3.404  17.990 25.468  1.00 19.73 ? 79  VAL B N   1 
ATOM   2190 C  CA  . VAL B 1 79  ? -2.371  17.010 25.098  1.00 19.26 ? 79  VAL B CA  1 
ATOM   2191 C  C   . VAL B 1 79  ? -1.221  17.813 24.549  1.00 20.17 ? 79  VAL B C   1 
ATOM   2192 O  O   . VAL B 1 79  ? -1.378  18.456 23.496  1.00 20.76 ? 79  VAL B O   1 
ATOM   2193 C  CB  . VAL B 1 79  ? -2.903  15.963 24.058  1.00 17.75 ? 79  VAL B CB  1 
ATOM   2194 C  CG1 . VAL B 1 79  ? -1.787  15.115 23.501  1.00 13.95 ? 79  VAL B CG1 1 
ATOM   2195 C  CG2 . VAL B 1 79  ? -3.996  15.053 24.712  1.00 19.62 ? 79  VAL B CG2 1 
ATOM   2196 N  N   . THR B 1 80  ? -0.051  17.728 25.208  1.00 20.14 ? 80  THR B N   1 
ATOM   2197 C  CA  . THR B 1 80  ? 1.113   18.578 24.896  1.00 19.79 ? 80  THR B CA  1 
ATOM   2198 C  C   . THR B 1 80  ? 1.573   18.473 23.419  1.00 19.75 ? 80  THR B C   1 
ATOM   2199 O  O   . THR B 1 80  ? 1.474   17.419 22.800  1.00 19.29 ? 80  THR B O   1 
ATOM   2200 C  CB  . THR B 1 80  ? 2.321   18.383 25.900  1.00 21.16 ? 80  THR B CB  1 
ATOM   2201 O  OG1 . THR B 1 80  ? 3.269   19.455 25.762  1.00 19.97 ? 80  THR B OG1 1 
ATOM   2202 C  CG2 . THR B 1 80  ? 3.043   17.053 25.697  1.00 20.83 ? 80  THR B CG2 1 
ATOM   2203 N  N   . SER B 1 81  ? 2.074   19.579 22.874  1.00 18.36 ? 81  SER B N   1 
ATOM   2204 C  CA  . SER B 1 81  ? 2.354   19.673 21.434  1.00 18.81 ? 81  SER B CA  1 
ATOM   2205 C  C   . SER B 1 81  ? 3.104   18.486 20.852  1.00 18.82 ? 81  SER B C   1 
ATOM   2206 O  O   . SER B 1 81  ? 2.695   17.943 19.819  1.00 18.47 ? 81  SER B O   1 
ATOM   2207 C  CB  . SER B 1 81  ? 3.129   20.948 21.118  1.00 18.03 ? 81  SER B CB  1 
ATOM   2208 O  OG  . SER B 1 81  ? 2.340   22.093 21.394  1.00 19.63 ? 81  SER B OG  1 
ATOM   2209 N  N   . THR B 1 82  ? 4.214   18.116 21.500  1.00 19.38 ? 82  THR B N   1 
ATOM   2210 C  CA  . THR B 1 82  ? 5.022   16.944 21.116  1.00 20.58 ? 82  THR B CA  1 
ATOM   2211 C  C   . THR B 1 82  ? 4.301   15.578 21.161  1.00 20.32 ? 82  THR B C   1 
ATOM   2212 O  O   . THR B 1 82  ? 4.819   14.595 20.613  1.00 20.19 ? 82  THR B O   1 
ATOM   2213 C  CB  . THR B 1 82  ? 6.338   16.849 21.958  1.00 21.70 ? 82  THR B CB  1 
ATOM   2214 O  OG1 . THR B 1 82  ? 6.027   16.552 23.318  1.00 21.81 ? 82  THR B OG1 1 
ATOM   2215 C  CG2 . THR B 1 82  ? 7.096   18.151 21.922  1.00 16.42 ? 82  THR B CG2 1 
ATOM   2216 N  N   . HIS B 1 83  ? 3.138   15.505 21.809  1.00 21.24 ? 83  HIS B N   1 
ATOM   2217 C  CA  . HIS B 1 83  ? 2.334   14.248 21.868  1.00 22.17 ? 83  HIS B CA  1 
ATOM   2218 C  C   . HIS B 1 83  ? 1.077   14.245 20.977  1.00 21.83 ? 83  HIS B C   1 
ATOM   2219 O  O   . HIS B 1 83  ? 0.463   13.173 20.714  1.00 22.33 ? 83  HIS B O   1 
ATOM   2220 C  CB  . HIS B 1 83  ? 1.853   13.956 23.294  1.00 22.58 ? 83  HIS B CB  1 
ATOM   2221 C  CG  . HIS B 1 83  ? 2.943   13.760 24.300  1.00 22.20 ? 83  HIS B CG  1 
ATOM   2222 N  ND1 . HIS B 1 83  ? 2.673   13.554 25.636  1.00 22.01 ? 83  HIS B ND1 1 
ATOM   2223 C  CD2 . HIS B 1 83  ? 4.291   13.785 24.186  1.00 22.52 ? 83  HIS B CD2 1 
ATOM   2224 C  CE1 . HIS B 1 83  ? 3.809   13.443 26.301  1.00 17.84 ? 83  HIS B CE1 1 
ATOM   2225 N  NE2 . HIS B 1 83  ? 4.804   13.572 25.443  1.00 19.96 ? 83  HIS B NE2 1 
ATOM   2226 N  N   . PHE B 1 84  ? 0.691   15.446 20.547  1.00 21.31 ? 84  PHE B N   1 
ATOM   2227 C  CA  . PHE B 1 84  ? -0.549  15.703 19.843  1.00 19.52 ? 84  PHE B CA  1 
ATOM   2228 C  C   . PHE B 1 84  ? -0.547  15.162 18.407  1.00 19.55 ? 84  PHE B C   1 
ATOM   2229 O  O   . PHE B 1 84  ? 0.084   15.710 17.514  1.00 19.17 ? 84  PHE B O   1 
ATOM   2230 C  CB  . PHE B 1 84  ? -0.827  17.231 19.871  1.00 18.77 ? 84  PHE B CB  1 
ATOM   2231 C  CG  . PHE B 1 84  ? -2.199  17.615 19.377  1.00 18.75 ? 84  PHE B CG  1 
ATOM   2232 C  CD1 . PHE B 1 84  ? -2.438  17.800 18.031  1.00 18.81 ? 84  PHE B CD1 1 
ATOM   2233 C  CD2 . PHE B 1 84  ? -3.245  17.811 20.259  1.00 15.75 ? 84  PHE B CD2 1 
ATOM   2234 C  CE1 . PHE B 1 84  ? -3.705  18.125 17.574  1.00 16.93 ? 84  PHE B CE1 1 
ATOM   2235 C  CE2 . PHE B 1 84  ? -4.503  18.174 19.801  1.00 14.24 ? 84  PHE B CE2 1 
ATOM   2236 C  CZ  . PHE B 1 84  ? -4.733  18.325 18.478  1.00 13.97 ? 84  PHE B CZ  1 
ATOM   2237 N  N   . ASP B 1 85  ? -1.298  14.100 18.199  1.00 19.81 ? 85  ASP B N   1 
ATOM   2238 C  CA  . ASP B 1 85  ? -1.250  13.355 16.983  1.00 20.98 ? 85  ASP B CA  1 
ATOM   2239 C  C   . ASP B 1 85  ? -2.644  13.138 16.426  1.00 21.15 ? 85  ASP B C   1 
ATOM   2240 O  O   . ASP B 1 85  ? -2.861  12.143 15.740  1.00 22.67 ? 85  ASP B O   1 
ATOM   2241 C  CB  . ASP B 1 85  ? -0.590  12.001 17.243  1.00 21.68 ? 85  ASP B CB  1 
ATOM   2242 C  CG  . ASP B 1 85  ? -1.330  11.185 18.304  1.00 22.17 ? 85  ASP B CG  1 
ATOM   2243 O  OD1 . ASP B 1 85  ? -2.127  11.790 19.061  1.00 19.68 ? 85  ASP B OD1 1 
ATOM   2244 O  OD2 . ASP B 1 85  ? -1.107  9.949  18.369  1.00 23.68 ? 85  ASP B OD2 1 
ATOM   2245 N  N   . GLU B 1 86  ? -3.585  14.046 16.691  1.00 20.61 ? 86  GLU B N   1 
ATOM   2246 C  CA  . GLU B 1 86  ? -4.927  13.895 16.098  1.00 19.63 ? 86  GLU B CA  1 
ATOM   2247 C  C   . GLU B 1 86  ? -4.755  13.784 14.579  1.00 19.36 ? 86  GLU B C   1 
ATOM   2248 O  O   . GLU B 1 86  ? -4.132  14.676 13.955  1.00 18.72 ? 86  GLU B O   1 
ATOM   2249 C  CB  . GLU B 1 86  ? -5.845  15.048 16.482  1.00 20.05 ? 86  GLU B CB  1 
ATOM   2250 C  CG  . GLU B 1 86  ? -7.327  14.833 16.166  1.00 21.07 ? 86  GLU B CG  1 
ATOM   2251 C  CD  . GLU B 1 86  ? -7.627  15.043 14.690  1.00 21.77 ? 86  GLU B CD  1 
ATOM   2252 O  OE1 . GLU B 1 86  ? -7.264  16.097 14.140  1.00 18.74 ? 86  GLU B OE1 1 
ATOM   2253 O  OE2 . GLU B 1 86  ? -8.179  14.118 14.079  1.00 22.60 ? 86  GLU B OE2 1 
ATOM   2254 N  N   . PRO B 1 87  ? -5.281  12.697 13.974  1.00 19.10 ? 87  PRO B N   1 
ATOM   2255 C  CA  . PRO B 1 87  ? -4.826  12.423 12.600  1.00 19.00 ? 87  PRO B CA  1 
ATOM   2256 C  C   . PRO B 1 87  ? -5.264  13.458 11.557  1.00 19.00 ? 87  PRO B C   1 
ATOM   2257 O  O   . PRO B 1 87  ? -4.566  13.596 10.547  1.00 18.97 ? 87  PRO B O   1 
ATOM   2258 C  CB  . PRO B 1 87  ? -5.460  11.054 12.273  1.00 19.84 ? 87  PRO B CB  1 
ATOM   2259 C  CG  . PRO B 1 87  ? -6.622  10.912 13.274  1.00 19.62 ? 87  PRO B CG  1 
ATOM   2260 C  CD  . PRO B 1 87  ? -6.070  11.567 14.519  1.00 19.39 ? 87  PRO B CD  1 
ATOM   2261 N  N   . MET B 1 88  ? -6.391  14.156 11.765  1.00 18.71 ? 88  MET B N   1 
ATOM   2262 C  CA  . MET B 1 88  ? -6.786  15.201 10.806  1.00 19.04 ? 88  MET B CA  1 
ATOM   2263 C  C   . MET B 1 88  ? -5.802  16.382 10.838  1.00 18.55 ? 88  MET B C   1 
ATOM   2264 O  O   . MET B 1 88  ? -5.380  16.878 9.792   1.00 19.41 ? 88  MET B O   1 
ATOM   2265 C  CB  . MET B 1 88  ? -8.225  15.669 10.998  1.00 18.31 ? 88  MET B CB  1 
ATOM   2266 C  CG  . MET B 1 88  ? -9.231  14.641 10.582  1.00 18.93 ? 88  MET B CG  1 
ATOM   2267 S  SD  . MET B 1 88  ? -10.931 15.249 10.482  1.00 21.48 ? 88  MET B SD  1 
ATOM   2268 C  CE  . MET B 1 88  ? -11.166 16.190 12.001  1.00 19.25 ? 88  MET B CE  1 
ATOM   2269 N  N   . ALA B 1 89  ? -5.436  16.809 12.046  1.00 17.29 ? 89  ALA B N   1 
ATOM   2270 C  CA  . ALA B 1 89  ? -4.379  17.802 12.228  1.00 17.26 ? 89  ALA B CA  1 
ATOM   2271 C  C   . ALA B 1 89  ? -3.065  17.383 11.619  1.00 17.54 ? 89  ALA B C   1 
ATOM   2272 O  O   . ALA B 1 89  ? -2.396  18.220 11.039  1.00 19.77 ? 89  ALA B O   1 
ATOM   2273 C  CB  . ALA B 1 89  ? -4.152  18.140 13.709  1.00 16.26 ? 89  ALA B CB  1 
ATOM   2274 N  N   . VAL B 1 90  ? -2.697  16.113 11.790  1.00 17.47 ? 90  VAL B N   1 
ATOM   2275 C  CA  . VAL B 1 90  ? -1.470  15.543 11.222  1.00 17.79 ? 90  VAL B CA  1 
ATOM   2276 C  C   . VAL B 1 90  ? -1.584  15.586 9.711   1.00 18.80 ? 90  VAL B C   1 
ATOM   2277 O  O   . VAL B 1 90  ? -0.609  15.926 9.031   1.00 18.25 ? 90  VAL B O   1 
ATOM   2278 C  CB  . VAL B 1 90  ? -1.193  14.107 11.767  1.00 17.90 ? 90  VAL B CB  1 
ATOM   2279 C  CG1 . VAL B 1 90  ? 0.046   13.463 11.100  1.00 17.19 ? 90  VAL B CG1 1 
ATOM   2280 C  CG2 . VAL B 1 90  ? -1.022  14.177 13.303  1.00 17.12 ? 90  VAL B CG2 1 
ATOM   2281 N  N   . CYS B 1 91  ? -2.781  15.284 9.210   1.00 19.16 ? 91  CYS B N   1 
ATOM   2282 C  CA  . CYS B 1 91  ? -3.057  15.327 7.770   1.00 21.11 ? 91  CYS B CA  1 
ATOM   2283 C  C   . CYS B 1 91  ? -2.923  16.746 7.249   1.00 20.43 ? 91  CYS B C   1 
ATOM   2284 O  O   . CYS B 1 91  ? -2.133  16.992 6.335   1.00 21.89 ? 91  CYS B O   1 
ATOM   2285 C  CB  . CYS B 1 91  ? -4.443  14.773 7.431   1.00 21.35 ? 91  CYS B CB  1 
ATOM   2286 S  SG  . CYS B 1 91  ? -4.591  14.180 5.727   1.00 26.52 ? 91  CYS B SG  1 
ATOM   2287 N  N   . MET B 1 92  ? -3.708  17.668 7.819   1.00 21.19 ? 92  MET B N   1 
ATOM   2288 C  CA  . MET B 1 92  ? -3.608  19.104 7.506   1.00 21.97 ? 92  MET B CA  1 
ATOM   2289 C  C   . MET B 1 92  ? -2.178  19.664 7.428   1.00 21.75 ? 92  MET B C   1 
ATOM   2290 O  O   . MET B 1 92  ? -1.792  20.292 6.433   1.00 21.69 ? 92  MET B O   1 
ATOM   2291 C  CB  . MET B 1 92  ? -4.429  19.925 8.498   1.00 21.78 ? 92  MET B CB  1 
ATOM   2292 C  CG  . MET B 1 92  ? -5.924  19.783 8.261   1.00 22.00 ? 92  MET B CG  1 
ATOM   2293 S  SD  . MET B 1 92  ? -6.376  20.654 6.733   1.00 21.79 ? 92  MET B SD  1 
ATOM   2294 C  CE  . MET B 1 92  ? -6.614  22.259 7.468   1.00 18.78 ? 92  MET B CE  1 
ATOM   2295 N  N   . LEU B 1 93  ? -1.391  19.423 8.469   1.00 22.28 ? 93  LEU B N   1 
ATOM   2296 C  CA  . LEU B 1 93  ? -0.047  19.985 8.550   1.00 22.22 ? 93  LEU B CA  1 
ATOM   2297 C  C   . LEU B 1 93  ? 0.829   19.508 7.399   1.00 22.09 ? 93  LEU B C   1 
ATOM   2298 O  O   . LEU B 1 93  ? 1.550   20.309 6.796   1.00 20.83 ? 93  LEU B O   1 
ATOM   2299 C  CB  . LEU B 1 93  ? 0.613   19.661 9.911   1.00 21.37 ? 93  LEU B CB  1 
ATOM   2300 C  CG  . LEU B 1 93  ? 0.465   20.627 11.095  1.00 23.51 ? 93  LEU B CG  1 
ATOM   2301 C  CD1 . LEU B 1 93  ? 1.255   21.926 10.823  1.00 21.57 ? 93  LEU B CD1 1 
ATOM   2302 C  CD2 . LEU B 1 93  ? -0.995  20.948 11.547  1.00 19.22 ? 93  LEU B CD2 1 
ATOM   2303 N  N   . SER B 1 94  ? 0.724   18.216 7.094   1.00 21.74 ? 94  SER B N   1 
ATOM   2304 C  CA  . SER B 1 94  ? 1.486   17.539 6.053   1.00 23.45 ? 94  SER B CA  1 
ATOM   2305 C  C   . SER B 1 94  ? 1.334   18.174 4.680   1.00 23.60 ? 94  SER B C   1 
ATOM   2306 O  O   . SER B 1 94  ? 2.253   18.059 3.845   1.00 24.07 ? 94  SER B O   1 
ATOM   2307 C  CB  . SER B 1 94  ? 1.043   16.070 5.962   1.00 23.74 ? 94  SER B CB  1 
ATOM   2308 O  OG  . SER B 1 94  ? 0.041   15.896 4.954   1.00 25.42 ? 94  SER B OG  1 
ATOM   2309 N  N   . LYS B 1 95  ? 0.174   18.802 4.434   1.00 22.57 ? 95  LYS B N   1 
ATOM   2310 C  CA  . LYS B 1 95  ? -0.120  19.411 3.142   1.00 23.73 ? 95  LYS B CA  1 
ATOM   2311 C  C   . LYS B 1 95  ? 0.069   20.963 3.044   1.00 22.69 ? 95  LYS B C   1 
ATOM   2312 O  O   . LYS B 1 95  ? -0.333  21.560 2.055   1.00 23.33 ? 95  LYS B O   1 
ATOM   2313 C  CB  . LYS B 1 95  ? -1.513  18.959 2.633   1.00 24.16 ? 95  LYS B CB  1 
ATOM   2314 C  CG  . LYS B 1 95  ? -1.674  17.425 2.495   1.00 26.37 ? 95  LYS B CG  1 
ATOM   2315 C  CD  . LYS B 1 95  ? -2.520  17.035 1.255   1.00 29.37 ? 95  LYS B CD  1 
ATOM   2316 C  CE  . LYS B 1 95  ? -2.421  15.533 0.940   1.00 31.93 ? 95  LYS B CE  1 
ATOM   2317 N  NZ  . LYS B 1 95  ? -3.368  14.694 1.744   1.00 37.47 ? 95  LYS B NZ  1 
ATOM   2318 N  N   . HIS B 1 96  ? 0.690   21.579 4.060   1.00 22.49 ? 96  HIS B N   1 
ATOM   2319 C  CA  . HIS B 1 96  ? 0.964   23.033 4.138   1.00 21.14 ? 96  HIS B CA  1 
ATOM   2320 C  C   . HIS B 1 96  ? 2.435   23.302 4.353   1.00 21.37 ? 96  HIS B C   1 
ATOM   2321 O  O   . HIS B 1 96  ? 3.049   22.744 5.267   1.00 21.09 ? 96  HIS B O   1 
ATOM   2322 C  CB  . HIS B 1 96  ? 0.228   23.698 5.324   1.00 20.70 ? 96  HIS B CB  1 
ATOM   2323 C  CG  . HIS B 1 96  ? -1.248  23.762 5.160   1.00 18.85 ? 96  HIS B CG  1 
ATOM   2324 N  ND1 . HIS B 1 96  ? -2.064  22.685 5.425   1.00 18.74 ? 96  HIS B ND1 1 
ATOM   2325 C  CD2 . HIS B 1 96  ? -2.064  24.763 4.740   1.00 18.07 ? 96  HIS B CD2 1 
ATOM   2326 C  CE1 . HIS B 1 96  ? -3.324  23.026 5.192   1.00 15.03 ? 96  HIS B CE1 1 
ATOM   2327 N  NE2 . HIS B 1 96  ? -3.350  24.279 4.783   1.00 16.29 ? 96  HIS B NE2 1 
ATOM   2328 N  N   . THR B 1 97  ? 2.994   24.190 3.537   1.00 21.39 ? 97  THR B N   1 
ATOM   2329 C  CA  . THR B 1 97  ? 4.434   24.424 3.554   1.00 20.73 ? 97  THR B CA  1 
ATOM   2330 C  C   . THR B 1 97  ? 4.817   24.878 4.959   1.00 20.97 ? 97  THR B C   1 
ATOM   2331 O  O   . THR B 1 97  ? 5.789   24.389 5.548   1.00 20.97 ? 97  THR B O   1 
ATOM   2332 C  CB  . THR B 1 97  ? 4.833   25.497 2.488   1.00 21.22 ? 97  THR B CB  1 
ATOM   2333 O  OG1 . THR B 1 97  ? 4.396   25.049 1.194   1.00 18.56 ? 97  THR B OG1 1 
ATOM   2334 C  CG2 . THR B 1 97  ? 6.343   25.693 2.487   1.00 19.75 ? 97  THR B CG2 1 
ATOM   2335 N  N   . ASP B 1 98  ? 3.978   25.750 5.509   1.00 21.19 ? 98  ASP B N   1 
ATOM   2336 C  CA  . ASP B 1 98  ? 4.274   26.508 6.726   1.00 21.56 ? 98  ASP B CA  1 
ATOM   2337 C  C   . ASP B 1 98  ? 3.160   26.318 7.724   1.00 21.19 ? 98  ASP B C   1 
ATOM   2338 O  O   . ASP B 1 98  ? 2.059   25.873 7.349   1.00 21.09 ? 98  ASP B O   1 
ATOM   2339 C  CB  . ASP B 1 98  ? 4.375   27.981 6.376   1.00 21.70 ? 98  ASP B CB  1 
ATOM   2340 C  CG  . ASP B 1 98  ? 5.629   28.324 5.550   1.00 26.45 ? 98  ASP B CG  1 
ATOM   2341 O  OD1 . ASP B 1 98  ? 6.773   28.042 6.003   1.00 27.22 ? 98  ASP B OD1 1 
ATOM   2342 O  OD2 . ASP B 1 98  ? 5.461   28.925 4.471   1.00 29.08 ? 98  ASP B OD2 1 
ATOM   2343 N  N   . ALA B 1 99  ? 3.440   26.636 8.997   1.00 20.02 ? 99  ALA B N   1 
ATOM   2344 C  CA  . ALA B 1 99  ? 2.415   26.592 10.043  1.00 19.57 ? 99  ALA B CA  1 
ATOM   2345 C  C   . ALA B 1 99  ? 2.713   27.479 11.230  1.00 19.21 ? 99  ALA B C   1 
ATOM   2346 O  O   . ALA B 1 99  ? 3.873   27.647 11.628  1.00 19.16 ? 99  ALA B O   1 
ATOM   2347 C  CB  . ALA B 1 99  ? 2.164   25.178 10.536  1.00 19.19 ? 99  ALA B CB  1 
ATOM   2348 N  N   . VAL B 1 100 ? 1.644   27.994 11.820  1.00 18.83 ? 100 VAL B N   1 
ATOM   2349 C  CA  . VAL B 1 100 ? 1.737   28.837 13.012  1.00 19.14 ? 100 VAL B CA  1 
ATOM   2350 C  C   . VAL B 1 100 ? 0.690   28.378 14.019  1.00 18.92 ? 100 VAL B C   1 
ATOM   2351 O  O   . VAL B 1 100 ? -0.522  28.312 13.706  1.00 19.44 ? 100 VAL B O   1 
ATOM   2352 C  CB  . VAL B 1 100 ? 1.492   30.330 12.679  1.00 18.91 ? 100 VAL B CB  1 
ATOM   2353 C  CG1 . VAL B 1 100 ? 1.748   31.176 13.907  1.00 20.02 ? 100 VAL B CG1 1 
ATOM   2354 C  CG2 . VAL B 1 100 ? 2.379   30.771 11.533  1.00 18.96 ? 100 VAL B CG2 1 
ATOM   2355 N  N   . SER B 1 101 ? 1.151   28.067 15.223  1.00 18.61 ? 101 SER B N   1 
ATOM   2356 C  CA  . SER B 1 101 ? 0.276   27.568 16.278  1.00 17.61 ? 101 SER B CA  1 
ATOM   2357 C  C   . SER B 1 101 ? 0.137   28.599 17.353  1.00 18.38 ? 101 SER B C   1 
ATOM   2358 O  O   . SER B 1 101 ? 1.082   29.338 17.611  1.00 19.07 ? 101 SER B O   1 
ATOM   2359 C  CB  . SER B 1 101 ? 0.788   26.270 16.904  1.00 18.20 ? 101 SER B CB  1 
ATOM   2360 O  OG  . SER B 1 101 ? 2.036   26.477 17.506  1.00 19.17 ? 101 SER B OG  1 
ATOM   2361 N  N   . PHE B 1 102 ? -1.048  28.621 17.963  1.00 17.16 ? 102 PHE B N   1 
ATOM   2362 C  CA  . PHE B 1 102 ? -1.423  29.562 18.991  1.00 17.73 ? 102 PHE B CA  1 
ATOM   2363 C  C   . PHE B 1 102 ? -1.746  28.749 20.247  1.00 16.55 ? 102 PHE B C   1 
ATOM   2364 O  O   . PHE B 1 102 ? -2.615  27.865 20.251  1.00 16.46 ? 102 PHE B O   1 
ATOM   2365 C  CB  . PHE B 1 102 ? -2.635  30.387 18.512  1.00 17.82 ? 102 PHE B CB  1 
ATOM   2366 C  CG  . PHE B 1 102 ? -2.377  31.121 17.225  1.00 17.66 ? 102 PHE B CG  1 
ATOM   2367 C  CD1 . PHE B 1 102 ? -2.321  30.429 16.014  1.00 16.80 ? 102 PHE B CD1 1 
ATOM   2368 C  CD2 . PHE B 1 102 ? -2.146  32.516 17.232  1.00 19.41 ? 102 PHE B CD2 1 
ATOM   2369 C  CE1 . PHE B 1 102 ? -2.070  31.103 14.795  1.00 18.46 ? 102 PHE B CE1 1 
ATOM   2370 C  CE2 . PHE B 1 102 ? -1.890  33.219 16.011  1.00 19.50 ? 102 PHE B CE2 1 
ATOM   2371 C  CZ  . PHE B 1 102 ? -1.849  32.506 14.803  1.00 20.69 ? 102 PHE B CZ  1 
ATOM   2372 N  N   . HIS B 1 103 ? -0.991  29.066 21.286  1.00 17.98 ? 103 HIS B N   1 
ATOM   2373 C  CA  . HIS B 1 103 ? -1.077  28.510 22.623  1.00 17.59 ? 103 HIS B CA  1 
ATOM   2374 C  C   . HIS B 1 103 ? -1.279  29.615 23.667  1.00 18.58 ? 103 HIS B C   1 
ATOM   2375 O  O   . HIS B 1 103 ? -0.981  30.803 23.435  1.00 17.97 ? 103 HIS B O   1 
ATOM   2376 C  CB  . HIS B 1 103 ? 0.265   27.877 22.950  1.00 18.47 ? 103 HIS B CB  1 
ATOM   2377 C  CG  . HIS B 1 103 ? 0.517   26.601 22.219  1.00 18.99 ? 103 HIS B CG  1 
ATOM   2378 N  ND1 . HIS B 1 103 ? 0.137   25.384 22.724  1.00 17.64 ? 103 HIS B ND1 1 
ATOM   2379 C  CD2 . HIS B 1 103 ? 1.052   26.359 21.001  1.00 20.81 ? 103 HIS B CD2 1 
ATOM   2380 C  CE1 . HIS B 1 103 ? 0.461   24.437 21.863  1.00 21.88 ? 103 HIS B CE1 1 
ATOM   2381 N  NE2 . HIS B 1 103 ? 1.008   25.007 20.804  1.00 22.67 ? 103 HIS B NE2 1 
ATOM   2382 N  N   . GLY B 1 104 ? -1.751  29.192 24.841  1.00 17.07 ? 104 GLY B N   1 
ATOM   2383 C  CA  . GLY B 1 104 ? -1.869  30.060 25.974  1.00 18.09 ? 104 GLY B CA  1 
ATOM   2384 C  C   . GLY B 1 104 ? -1.109  29.462 27.155  1.00 18.75 ? 104 GLY B C   1 
ATOM   2385 O  O   . GLY B 1 104 ? -1.067  28.236 27.321  1.00 17.31 ? 104 GLY B O   1 
ATOM   2386 N  N   . TYR B 1 105 ? -0.472  30.329 27.936  1.00 18.65 ? 105 TYR B N   1 
ATOM   2387 C  CA  . TYR B 1 105 ? 0.152   29.874 29.187  1.00 21.12 ? 105 TYR B CA  1 
ATOM   2388 C  C   . TYR B 1 105 ? -0.316  30.790 30.278  1.00 21.38 ? 105 TYR B C   1 
ATOM   2389 O  O   . TYR B 1 105 ? -0.823  31.891 30.003  1.00 22.50 ? 105 TYR B O   1 
ATOM   2390 C  CB  . TYR B 1 105 ? 1.687   29.817 29.086  1.00 21.51 ? 105 TYR B CB  1 
ATOM   2391 C  CG  . TYR B 1 105 ? 2.382   31.153 29.030  1.00 22.56 ? 105 TYR B CG  1 
ATOM   2392 C  CD1 . TYR B 1 105 ? 2.556   31.825 27.810  1.00 23.68 ? 105 TYR B CD1 1 
ATOM   2393 C  CD2 . TYR B 1 105 ? 2.896   31.740 30.192  1.00 22.63 ? 105 TYR B CD2 1 
ATOM   2394 C  CE1 . TYR B 1 105 ? 3.207   33.058 27.768  1.00 22.72 ? 105 TYR B CE1 1 
ATOM   2395 C  CE2 . TYR B 1 105 ? 3.538   32.961 30.149  1.00 22.19 ? 105 TYR B CE2 1 
ATOM   2396 C  CZ  . TYR B 1 105 ? 3.704   33.608 28.947  1.00 23.27 ? 105 TYR B CZ  1 
ATOM   2397 O  OH  . TYR B 1 105 ? 4.356   34.820 28.936  1.00 22.77 ? 105 TYR B OH  1 
ATOM   2398 N  N   . LYS B 1 106 ? -0.168  30.348 31.522  1.00 22.25 ? 106 LYS B N   1 
ATOM   2399 C  CA  . LYS B 1 106 ? -0.726  31.109 32.606  1.00 22.40 ? 106 LYS B CA  1 
ATOM   2400 C  C   . LYS B 1 106 ? 0.286   32.170 33.092  1.00 22.60 ? 106 LYS B C   1 
ATOM   2401 O  O   . LYS B 1 106 ? 1.418   31.838 33.468  1.00 22.14 ? 106 LYS B O   1 
ATOM   2402 C  CB  . LYS B 1 106 ? -1.168  30.161 33.720  1.00 21.74 ? 106 LYS B CB  1 
ATOM   2403 C  CG  . LYS B 1 106 ? -2.205  30.759 34.648  1.00 23.77 ? 106 LYS B CG  1 
ATOM   2404 C  CD  . LYS B 1 106 ? -2.038  30.235 36.090  1.00 21.83 ? 106 LYS B CD  1 
ATOM   2405 C  CE  . LYS B 1 106 ? -2.827  31.142 37.031  1.00 23.69 ? 106 LYS B CE  1 
ATOM   2406 N  NZ  . LYS B 1 106 ? -3.591  30.445 38.136  1.00 25.06 ? 106 LYS B NZ  1 
ATOM   2407 N  N   . ASP B 1 107 ? -0.114  33.439 33.012  1.00 23.74 ? 107 ASP B N   1 
ATOM   2408 C  CA  . ASP B 1 107 ? 0.554   34.557 33.701  1.00 24.92 ? 107 ASP B CA  1 
ATOM   2409 C  C   . ASP B 1 107 ? -0.446  35.698 33.834  1.00 25.59 ? 107 ASP B C   1 
ATOM   2410 O  O   . ASP B 1 107 ? -0.613  36.475 32.928  1.00 25.78 ? 107 ASP B O   1 
ATOM   2411 C  CB  . ASP B 1 107 ? 1.871   35.041 33.015  1.00 24.27 ? 107 ASP B CB  1 
ATOM   2412 C  CG  . ASP B 1 107 ? 2.586   36.203 33.802  1.00 26.98 ? 107 ASP B CG  1 
ATOM   2413 O  OD1 . ASP B 1 107 ? 1.967   36.881 34.662  1.00 25.29 ? 107 ASP B OD1 1 
ATOM   2414 O  OD2 . ASP B 1 107 ? 3.773   36.473 33.535  1.00 28.11 ? 107 ASP B OD2 1 
ATOM   2415 N  N   . ASP B 1 108 ? -1.111  35.807 34.980  1.00 27.42 ? 108 ASP B N   1 
ATOM   2416 C  CA  . ASP B 1 108 ? -2.229  36.729 35.078  1.00 28.64 ? 108 ASP B CA  1 
ATOM   2417 C  C   . ASP B 1 108 ? -1.831  38.193 35.239  1.00 29.46 ? 108 ASP B C   1 
ATOM   2418 O  O   . ASP B 1 108 ? -2.662  39.098 35.091  1.00 29.41 ? 108 ASP B O   1 
ATOM   2419 C  CB  . ASP B 1 108 ? -3.222  36.243 36.128  1.00 29.14 ? 108 ASP B CB  1 
ATOM   2420 C  CG  . ASP B 1 108 ? -3.983  35.006 35.657  1.00 31.22 ? 108 ASP B CG  1 
ATOM   2421 O  OD1 . ASP B 1 108 ? -4.599  35.062 34.555  1.00 29.70 ? 108 ASP B OD1 1 
ATOM   2422 O  OD2 . ASP B 1 108 ? -3.957  33.981 36.382  1.00 35.48 ? 108 ASP B OD2 1 
ATOM   2423 N  N   . TYR B 1 109 ? -0.545  38.419 35.471  1.00 29.85 ? 109 TYR B N   1 
ATOM   2424 C  CA  . TYR B 1 109 ? -0.055  39.761 35.777  1.00 30.46 ? 109 TYR B CA  1 
ATOM   2425 C  C   . TYR B 1 109 ? 0.721   40.452 34.631  1.00 29.98 ? 109 TYR B C   1 
ATOM   2426 O  O   . TYR B 1 109 ? 0.723   41.672 34.590  1.00 29.75 ? 109 TYR B O   1 
ATOM   2427 C  CB  . TYR B 1 109 ? 0.780   39.722 37.070  1.00 31.17 ? 109 TYR B CB  1 
ATOM   2428 C  CG  . TYR B 1 109 ? 0.077   39.067 38.251  1.00 33.03 ? 109 TYR B CG  1 
ATOM   2429 C  CD1 . TYR B 1 109 ? -0.051  37.667 38.331  1.00 35.49 ? 109 TYR B CD1 1 
ATOM   2430 C  CD2 . TYR B 1 109 ? -0.475  39.836 39.278  1.00 36.22 ? 109 TYR B CD2 1 
ATOM   2431 C  CE1 . TYR B 1 109 ? -0.695  37.050 39.405  1.00 35.77 ? 109 TYR B CE1 1 
ATOM   2432 C  CE2 . TYR B 1 109 ? -1.130  39.220 40.380  1.00 37.01 ? 109 TYR B CE2 1 
ATOM   2433 C  CZ  . TYR B 1 109 ? -1.235  37.827 40.433  1.00 37.30 ? 109 TYR B CZ  1 
ATOM   2434 O  OH  . TYR B 1 109 ? -1.883  37.208 41.498  1.00 36.24 ? 109 TYR B OH  1 
ATOM   2435 N  N   . ASN B 1 110 ? 1.375   39.691 33.732  1.00 29.44 ? 110 ASN B N   1 
ATOM   2436 C  CA  . ASN B 1 110 ? 2.091   40.257 32.544  1.00 29.02 ? 110 ASN B CA  1 
ATOM   2437 C  C   . ASN B 1 110 ? 1.417   39.923 31.213  1.00 29.08 ? 110 ASN B C   1 
ATOM   2438 O  O   . ASN B 1 110 ? 1.061   38.758 30.971  1.00 29.58 ? 110 ASN B O   1 
ATOM   2439 C  CB  . ASN B 1 110 ? 3.536   39.719 32.419  1.00 28.61 ? 110 ASN B CB  1 
ATOM   2440 C  CG  . ASN B 1 110 ? 4.370   39.921 33.676  1.00 30.84 ? 110 ASN B CG  1 
ATOM   2441 O  OD1 . ASN B 1 110 ? 4.571   41.047 34.147  1.00 26.92 ? 110 ASN B OD1 1 
ATOM   2442 N  ND2 . ASN B 1 110 ? 4.901   38.822 34.198  1.00 31.34 ? 110 ASN B ND2 1 
ATOM   2443 N  N   . LYS B 1 111 ? 1.267   40.935 30.344  1.00 28.66 ? 111 LYS B N   1 
ATOM   2444 C  CA  . LYS B 1 111 ? 1.010   40.716 28.926  1.00 27.84 ? 111 LYS B CA  1 
ATOM   2445 C  C   . LYS B 1 111 ? 2.316   40.435 28.196  1.00 26.88 ? 111 LYS B C   1 
ATOM   2446 O  O   . LYS B 1 111 ? 3.159   41.309 28.070  1.00 27.16 ? 111 LYS B O   1 
ATOM   2447 C  CB  . LYS B 1 111 ? 0.299   41.916 28.288  1.00 27.63 ? 111 LYS B CB  1 
ATOM   2448 C  CG  . LYS B 1 111 ? -1.008  42.304 28.985  1.00 29.34 ? 111 LYS B CG  1 
ATOM   2449 C  CD  . LYS B 1 111 ? -1.858  43.202 28.108  1.00 29.01 ? 111 LYS B CD  1 
ATOM   2450 C  CE  . LYS B 1 111 ? -1.340  44.623 28.087  1.00 27.39 ? 111 LYS B CE  1 
ATOM   2451 N  NZ  . LYS B 1 111 ? -2.100  45.422 27.088  1.00 26.04 ? 111 LYS B NZ  1 
ATOM   2452 N  N   . ASN B 1 112 ? 2.485   39.196 27.739  1.00 26.31 ? 112 ASN B N   1 
ATOM   2453 C  CA  . ASN B 1 112 ? 3.636   38.808 26.955  1.00 25.53 ? 112 ASN B CA  1 
ATOM   2454 C  C   . ASN B 1 112 ? 3.283   37.645 26.059  1.00 24.73 ? 112 ASN B C   1 
ATOM   2455 O  O   . ASN B 1 112 ? 2.425   36.828 26.398  1.00 24.61 ? 112 ASN B O   1 
ATOM   2456 C  CB  . ASN B 1 112 ? 4.813   38.409 27.845  1.00 26.18 ? 112 ASN B CB  1 
ATOM   2457 C  CG  . ASN B 1 112 ? 6.162   38.790 27.239  1.00 27.12 ? 112 ASN B CG  1 
ATOM   2458 O  OD1 . ASN B 1 112 ? 6.260   39.178 26.069  1.00 29.90 ? 112 ASN B OD1 1 
ATOM   2459 N  ND2 . ASN B 1 112 ? 7.210   38.691 28.047  1.00 28.19 ? 112 ASN B ND2 1 
ATOM   2460 N  N   . THR B 1 113 ? 3.947   37.599 24.911  1.00 23.29 ? 113 THR B N   1 
ATOM   2461 C  CA  . THR B 1 113 ? 3.877   36.470 24.003  1.00 22.25 ? 113 THR B CA  1 
ATOM   2462 C  C   . THR B 1 113 ? 5.300   35.968 23.778  1.00 22.05 ? 113 THR B C   1 
ATOM   2463 O  O   . THR B 1 113 ? 6.212   36.759 23.447  1.00 22.54 ? 113 THR B O   1 
ATOM   2464 C  CB  . THR B 1 113 ? 3.305   36.881 22.652  1.00 22.45 ? 113 THR B CB  1 
ATOM   2465 O  OG1 . THR B 1 113 ? 1.935   37.290 22.810  1.00 22.98 ? 113 THR B OG1 1 
ATOM   2466 C  CG2 . THR B 1 113 ? 3.390   35.709 21.658  1.00 21.54 ? 113 THR B CG2 1 
ATOM   2467 N  N   . LEU B 1 114 ? 5.501   34.664 23.931  1.00 20.40 ? 114 LEU B N   1 
ATOM   2468 C  CA  . LEU B 1 114 ? 6.813   34.096 23.695  1.00 20.01 ? 114 LEU B CA  1 
ATOM   2469 C  C   . LEU B 1 114 ? 6.801   33.366 22.376  1.00 19.81 ? 114 LEU B C   1 
ATOM   2470 O  O   . LEU B 1 114 ? 6.059   32.408 22.226  1.00 19.71 ? 114 LEU B O   1 
ATOM   2471 C  CB  . LEU B 1 114 ? 7.212   33.156 24.830  1.00 20.59 ? 114 LEU B CB  1 
ATOM   2472 C  CG  . LEU B 1 114 ? 7.296   33.871 26.188  1.00 20.62 ? 114 LEU B CG  1 
ATOM   2473 C  CD1 . LEU B 1 114 ? 7.092   32.861 27.315  1.00 22.62 ? 114 LEU B CD1 1 
ATOM   2474 C  CD2 . LEU B 1 114 ? 8.633   34.617 26.328  1.00 25.36 ? 114 LEU B CD2 1 
ATOM   2475 N  N   . VAL B 1 115 ? 7.608   33.822 21.417  1.00 19.00 ? 115 VAL B N   1 
ATOM   2476 C  CA  . VAL B 1 115 ? 7.561   33.234 20.081  1.00 19.43 ? 115 VAL B CA  1 
ATOM   2477 C  C   . VAL B 1 115 ? 8.713   32.263 19.825  1.00 19.08 ? 115 VAL B C   1 
ATOM   2478 O  O   . VAL B 1 115 ? 9.866   32.623 20.017  1.00 20.00 ? 115 VAL B O   1 
ATOM   2479 C  CB  . VAL B 1 115 ? 7.503   34.331 18.998  1.00 19.16 ? 115 VAL B CB  1 
ATOM   2480 C  CG1 . VAL B 1 115 ? 6.868   33.767 17.695  1.00 20.78 ? 115 VAL B CG1 1 
ATOM   2481 C  CG2 . VAL B 1 115 ? 6.699   35.481 19.496  1.00 18.00 ? 115 VAL B CG2 1 
ATOM   2482 N  N   . GLY B 1 116 ? 8.389   31.039 19.401  1.00 19.66 ? 116 GLY B N   1 
ATOM   2483 C  CA  . GLY B 1 116 ? 9.359   29.987 19.166  1.00 20.16 ? 116 GLY B CA  1 
ATOM   2484 C  C   . GLY B 1 116 ? 9.164   29.291 17.819  1.00 20.60 ? 116 GLY B C   1 
ATOM   2485 O  O   . GLY B 1 116 ? 8.525   29.843 16.929  1.00 19.58 ? 116 GLY B O   1 
ATOM   2486 N  N   . GLY B 1 117 ? 9.730   28.086 17.677  1.00 20.76 ? 117 GLY B N   1 
ATOM   2487 C  CA  . GLY B 1 117 ? 9.596   27.284 16.453  1.00 21.67 ? 117 GLY B CA  1 
ATOM   2488 C  C   . GLY B 1 117 ? 10.855  27.219 15.613  1.00 22.70 ? 117 GLY B C   1 
ATOM   2489 O  O   . GLY B 1 117 ? 11.792  28.020 15.813  1.00 23.35 ? 117 GLY B O   1 
ATOM   2490 N  N   . LEU B 1 118 ? 10.891  26.283 14.668  1.00 22.44 ? 118 LEU B N   1 
ATOM   2491 C  CA  . LEU B 1 118 ? 12.030  26.149 13.778  1.00 23.69 ? 118 LEU B CA  1 
ATOM   2492 C  C   . LEU B 1 118 ? 12.039  27.138 12.623  1.00 23.70 ? 118 LEU B C   1 
ATOM   2493 O  O   . LEU B 1 118 ? 13.070  27.340 12.020  1.00 22.96 ? 118 LEU B O   1 
ATOM   2494 C  CB  . LEU B 1 118 ? 12.107  24.725 13.207  1.00 23.99 ? 118 LEU B CB  1 
ATOM   2495 C  CG  . LEU B 1 118 ? 12.507  23.747 14.300  1.00 23.16 ? 118 LEU B CG  1 
ATOM   2496 C  CD1 . LEU B 1 118 ? 12.329  22.295 13.836  1.00 20.50 ? 118 LEU B CD1 1 
ATOM   2497 C  CD2 . LEU B 1 118 ? 13.949  24.012 14.795  1.00 25.81 ? 118 LEU B CD2 1 
ATOM   2498 N  N   . ASN B 1 119 ? 10.894  27.741 12.316  1.00 24.62 ? 119 ASN B N   1 
ATOM   2499 C  CA  . ASN B 1 119 ? 10.852  28.815 11.301  1.00 25.75 ? 119 ASN B CA  1 
ATOM   2500 C  C   . ASN B 1 119 ? 11.296  30.152 11.912  1.00 25.88 ? 119 ASN B C   1 
ATOM   2501 O  O   . ASN B 1 119 ? 10.479  30.973 12.335  1.00 25.34 ? 119 ASN B O   1 
ATOM   2502 C  CB  . ASN B 1 119 ? 9.480   28.913 10.611  1.00 25.32 ? 119 ASN B CB  1 
ATOM   2503 C  CG  . ASN B 1 119 ? 9.508   29.810 9.379   1.00 23.95 ? 119 ASN B CG  1 
ATOM   2504 O  OD1 . ASN B 1 119 ? 10.303  30.735 9.287   1.00 22.85 ? 119 ASN B OD1 1 
ATOM   2505 N  ND2 . ASN B 1 119 ? 8.663   29.518 8.423   1.00 27.23 ? 119 ASN B ND2 1 
ATOM   2506 N  N   . THR B 1 120 ? 12.617  30.347 11.943  1.00 26.10 ? 120 THR B N   1 
ATOM   2507 C  CA  . THR B 1 120 ? 13.246  31.509 12.563  1.00 26.64 ? 120 THR B CA  1 
ATOM   2508 C  C   . THR B 1 120 ? 12.887  32.821 11.869  1.00 25.41 ? 120 THR B C   1 
ATOM   2509 O  O   . THR B 1 120 ? 12.673  33.838 12.529  1.00 25.05 ? 120 THR B O   1 
ATOM   2510 C  CB  . THR B 1 120 ? 14.779  31.316 12.643  1.00 27.05 ? 120 THR B CB  1 
ATOM   2511 O  OG1 . THR B 1 120 ? 15.055  30.050 13.269  1.00 30.08 ? 120 THR B OG1 1 
ATOM   2512 C  CG2 . THR B 1 120 ? 15.438  32.433 13.441  1.00 28.56 ? 120 THR B CG2 1 
ATOM   2513 N  N   . GLU B 1 121 ? 12.792  32.809 10.540  1.00 25.45 ? 121 GLU B N   1 
ATOM   2514 C  CA  . GLU B 1 121 ? 12.403  34.020 9.836   1.00 24.88 ? 121 GLU B CA  1 
ATOM   2515 C  C   . GLU B 1 121 ? 10.991  34.511 10.155  1.00 23.80 ? 121 GLU B C   1 
ATOM   2516 O  O   . GLU B 1 121 ? 10.832  35.684 10.480  1.00 23.29 ? 121 GLU B O   1 
ATOM   2517 C  CB  . GLU B 1 121 ? 12.549  33.903 8.320   1.00 25.82 ? 121 GLU B CB  1 
ATOM   2518 C  CG  . GLU B 1 121 ? 12.208  35.245 7.670   1.00 28.08 ? 121 GLU B CG  1 
ATOM   2519 C  CD  . GLU B 1 121 ? 12.243  35.215 6.165   1.00 33.10 ? 121 GLU B CD  1 
ATOM   2520 O  OE1 . GLU B 1 121 ? 13.000  34.375 5.616   1.00 33.90 ? 121 GLU B OE1 1 
ATOM   2521 O  OE2 . GLU B 1 121 ? 11.525  36.044 5.534   1.00 33.38 ? 121 GLU B OE2 1 
ATOM   2522 N  N   . LEU B 1 122 ? 9.966   33.662 9.986   1.00 22.99 ? 122 LEU B N   1 
ATOM   2523 C  CA  . LEU B 1 122 ? 8.574   34.088 10.314  1.00 22.65 ? 122 LEU B CA  1 
ATOM   2524 C  C   . LEU B 1 122 ? 8.422   34.379 11.796  1.00 23.03 ? 122 LEU B C   1 
ATOM   2525 O  O   . LEU B 1 122 ? 7.669   35.276 12.186  1.00 22.54 ? 122 LEU B O   1 
ATOM   2526 C  CB  . LEU B 1 122 ? 7.530   33.048 9.875   1.00 22.84 ? 122 LEU B CB  1 
ATOM   2527 C  CG  . LEU B 1 122 ? 6.051   33.417 10.036  1.00 21.40 ? 122 LEU B CG  1 
ATOM   2528 C  CD1 . LEU B 1 122 ? 5.753   34.851 9.584   1.00 20.80 ? 122 LEU B CD1 1 
ATOM   2529 C  CD2 . LEU B 1 122 ? 5.213   32.406 9.261   1.00 18.37 ? 122 LEU B CD2 1 
ATOM   2530 N  N   . ARG B 1 123 ? 9.115   33.604 12.632  1.00 23.48 ? 123 ARG B N   1 
ATOM   2531 C  CA  . ARG B 1 123 ? 9.100   33.879 14.070  1.00 23.80 ? 123 ARG B CA  1 
ATOM   2532 C  C   . ARG B 1 123 ? 9.555   35.312 14.335  1.00 24.45 ? 123 ARG B C   1 
ATOM   2533 O  O   . ARG B 1 123 ? 8.854   36.061 15.012  1.00 24.78 ? 123 ARG B O   1 
ATOM   2534 C  CB  . ARG B 1 123 ? 9.971   32.878 14.847  1.00 23.93 ? 123 ARG B CB  1 
ATOM   2535 C  CG  . ARG B 1 123 ? 10.304  33.297 16.288  1.00 23.62 ? 123 ARG B CG  1 
ATOM   2536 C  CD  . ARG B 1 123 ? 11.580  32.647 16.753  1.00 23.65 ? 123 ARG B CD  1 
ATOM   2537 N  NE  . ARG B 1 123 ? 12.742  33.399 16.284  1.00 26.47 ? 123 ARG B NE  1 
ATOM   2538 C  CZ  . ARG B 1 123 ? 14.021  33.132 16.578  1.00 25.33 ? 123 ARG B CZ  1 
ATOM   2539 N  NH1 . ARG B 1 123 ? 14.352  32.093 17.342  1.00 23.05 ? 123 ARG B NH1 1 
ATOM   2540 N  NH2 . ARG B 1 123 ? 14.976  33.923 16.110  1.00 22.40 ? 123 ARG B NH2 1 
ATOM   2541 N  N   . ASN B 1 124 ? 10.723  35.681 13.802  1.00 24.77 ? 124 ASN B N   1 
ATOM   2542 C  CA  . ASN B 1 124 ? 11.272  37.040 13.977  1.00 24.63 ? 124 ASN B CA  1 
ATOM   2543 C  C   . ASN B 1 124 ? 10.328  38.119 13.388  1.00 24.58 ? 124 ASN B C   1 
ATOM   2544 O  O   . ASN B 1 124 ? 10.190  39.217 13.941  1.00 25.95 ? 124 ASN B O   1 
ATOM   2545 C  CB  . ASN B 1 124 ? 12.624  37.175 13.283  1.00 24.68 ? 124 ASN B CB  1 
ATOM   2546 C  CG  . ASN B 1 124 ? 13.755  36.399 13.956  1.00 26.54 ? 124 ASN B CG  1 
ATOM   2547 O  OD1 . ASN B 1 124 ? 13.658  35.926 15.103  1.00 25.89 ? 124 ASN B OD1 1 
ATOM   2548 N  ND2 . ASN B 1 124 ? 14.851  36.255 13.215  1.00 21.29 ? 124 ASN B ND2 1 
ATOM   2549 N  N   . LEU B 1 125 ? 9.685   37.819 12.264  1.00 24.03 ? 125 LEU B N   1 
ATOM   2550 C  CA  . LEU B 1 125 ? 8.729   38.783 11.698  1.00 23.82 ? 125 LEU B CA  1 
ATOM   2551 C  C   . LEU B 1 125 ? 7.557   39.011 12.642  1.00 23.88 ? 125 LEU B C   1 
ATOM   2552 O  O   . LEU B 1 125 ? 7.112   40.140 12.820  1.00 23.07 ? 125 LEU B O   1 
ATOM   2553 C  CB  . LEU B 1 125 ? 8.245   38.357 10.312  1.00 24.57 ? 125 LEU B CB  1 
ATOM   2554 C  CG  . LEU B 1 125 ? 9.226   38.308 9.125   1.00 25.22 ? 125 LEU B CG  1 
ATOM   2555 C  CD1 . LEU B 1 125 ? 8.570   37.576 8.028   1.00 30.27 ? 125 LEU B CD1 1 
ATOM   2556 C  CD2 . LEU B 1 125 ? 9.593   39.685 8.664   1.00 26.86 ? 125 LEU B CD2 1 
ATOM   2557 N  N   . ILE B 1 126 ? 7.068   37.935 13.260  1.00 23.17 ? 126 ILE B N   1 
ATOM   2558 C  CA  . ILE B 1 126 ? 5.873   38.018 14.113  1.00 23.37 ? 126 ILE B CA  1 
ATOM   2559 C  C   . ILE B 1 126 ? 6.165   38.884 15.348  1.00 23.51 ? 126 ILE B C   1 
ATOM   2560 O  O   . ILE B 1 126 ? 5.362   39.728 15.713  1.00 22.78 ? 126 ILE B O   1 
ATOM   2561 C  CB  . ILE B 1 126 ? 5.350   36.592 14.497  1.00 22.19 ? 126 ILE B CB  1 
ATOM   2562 C  CG1 . ILE B 1 126 ? 4.644   35.946 13.314  1.00 21.91 ? 126 ILE B CG1 1 
ATOM   2563 C  CG2 . ILE B 1 126 ? 4.354   36.674 15.616  1.00 24.11 ? 126 ILE B CG2 1 
ATOM   2564 C  CD1 . ILE B 1 126 ? 4.152   34.458 13.537  1.00 16.40 ? 126 ILE B CD1 1 
ATOM   2565 N  N   . VAL B 1 127 ? 7.342   38.699 15.939  1.00 23.60 ? 127 VAL B N   1 
ATOM   2566 C  CA  . VAL B 1 127 ? 7.757   39.453 17.117  1.00 24.18 ? 127 VAL B CA  1 
ATOM   2567 C  C   . VAL B 1 127 ? 7.877   40.935 16.759  1.00 23.92 ? 127 VAL B C   1 
ATOM   2568 O  O   . VAL B 1 127 ? 7.476   41.812 17.532  1.00 23.76 ? 127 VAL B O   1 
ATOM   2569 C  CB  . VAL B 1 127 ? 9.154   38.996 17.620  1.00 24.58 ? 127 VAL B CB  1 
ATOM   2570 C  CG1 . VAL B 1 127 ? 9.698   39.949 18.699  1.00 26.04 ? 127 VAL B CG1 1 
ATOM   2571 C  CG2 . VAL B 1 127 ? 9.143   37.533 18.119  1.00 24.50 ? 127 VAL B CG2 1 
ATOM   2572 N  N   . SER B 1 128 ? 8.507   41.201 15.617  1.00 23.80 ? 128 SER B N   1 
ATOM   2573 C  CA  . SER B 1 128 ? 8.645   42.561 15.120  1.00 25.03 ? 128 SER B CA  1 
ATOM   2574 C  C   . SER B 1 128 ? 7.292   43.235 14.863  1.00 24.87 ? 128 SER B C   1 
ATOM   2575 O  O   . SER B 1 128 ? 7.032   44.349 15.343  1.00 24.16 ? 128 SER B O   1 
ATOM   2576 C  CB  . SER B 1 128 ? 9.477   42.564 13.837  1.00 25.14 ? 128 SER B CB  1 
ATOM   2577 O  OG  . SER B 1 128 ? 9.559   43.891 13.343  1.00 29.65 ? 128 SER B OG  1 
ATOM   2578 N  N   . LYS B 1 129 ? 6.435   42.560 14.091  1.00 24.84 ? 129 LYS B N   1 
ATOM   2579 C  CA  . LYS B 1 129 ? 5.087   43.083 13.800  1.00 23.79 ? 129 LYS B CA  1 
ATOM   2580 C  C   . LYS B 1 129 ? 4.220   43.223 15.066  1.00 23.24 ? 129 LYS B C   1 
ATOM   2581 O  O   . LYS B 1 129 ? 3.515   44.233 15.248  1.00 22.76 ? 129 LYS B O   1 
ATOM   2582 C  CB  . LYS B 1 129 ? 4.376   42.210 12.748  1.00 24.23 ? 129 LYS B CB  1 
ATOM   2583 C  CG  . LYS B 1 129 ? 5.106   42.042 11.410  1.00 22.05 ? 129 LYS B CG  1 
ATOM   2584 C  CD  . LYS B 1 129 ? 5.559   43.350 10.804  1.00 26.33 ? 129 LYS B CD  1 
ATOM   2585 C  CE  . LYS B 1 129 ? 5.827   43.194 9.320   1.00 26.29 ? 129 LYS B CE  1 
ATOM   2586 N  NZ  . LYS B 1 129 ? 6.655   44.332 8.795   1.00 29.79 ? 129 LYS B NZ  1 
ATOM   2587 N  N   . LEU B 1 130 ? 4.299   42.249 15.971  1.00 22.57 ? 130 LEU B N   1 
ATOM   2588 C  CA  . LEU B 1 130 ? 3.653   42.400 17.288  1.00 23.08 ? 130 LEU B CA  1 
ATOM   2589 C  C   . LEU B 1 130 ? 4.127   43.641 18.054  1.00 23.88 ? 130 LEU B C   1 
ATOM   2590 O  O   . LEU B 1 130 ? 3.308   44.452 18.502  1.00 24.59 ? 130 LEU B O   1 
ATOM   2591 C  CB  . LEU B 1 130 ? 3.783   41.128 18.138  1.00 22.65 ? 130 LEU B CB  1 
ATOM   2592 C  CG  . LEU B 1 130 ? 2.921   39.930 17.709  1.00 20.30 ? 130 LEU B CG  1 
ATOM   2593 C  CD1 . LEU B 1 130 ? 3.097   38.682 18.621  1.00 21.17 ? 130 LEU B CD1 1 
ATOM   2594 C  CD2 . LEU B 1 130 ? 1.521   40.315 17.707  1.00 19.28 ? 130 LEU B CD2 1 
ATOM   2595 N  N   . ASN B 1 131 ? 5.442   43.781 18.180  1.00 24.60 ? 131 ASN B N   1 
ATOM   2596 C  CA  . ASN B 1 131 ? 6.077   44.967 18.789  1.00 25.02 ? 131 ASN B CA  1 
ATOM   2597 C  C   . ASN B 1 131 ? 5.700   46.319 18.159  1.00 25.65 ? 131 ASN B C   1 
ATOM   2598 O  O   . ASN B 1 131 ? 5.641   47.342 18.846  1.00 26.00 ? 131 ASN B O   1 
ATOM   2599 C  CB  . ASN B 1 131 ? 7.605   44.844 18.750  1.00 23.62 ? 131 ASN B CB  1 
ATOM   2600 C  CG  . ASN B 1 131 ? 8.148   43.775 19.678  1.00 23.25 ? 131 ASN B CG  1 
ATOM   2601 O  OD1 . ASN B 1 131 ? 9.318   43.429 19.575  1.00 20.27 ? 131 ASN B OD1 1 
ATOM   2602 N  ND2 . ASN B 1 131 ? 7.301   43.220 20.566  1.00 17.86 ? 131 ASN B ND2 1 
ATOM   2603 N  N   . SER B 1 132 ? 5.478   46.339 16.855  1.00 26.78 ? 132 SER B N   1 
ATOM   2604 C  CA  . SER B 1 132 ? 5.105   47.586 16.175  1.00 27.58 ? 132 SER B CA  1 
ATOM   2605 C  C   . SER B 1 132 ? 3.667   48.024 16.535  1.00 28.03 ? 132 SER B C   1 
ATOM   2606 O  O   . SER B 1 132 ? 3.293   49.190 16.341  1.00 27.28 ? 132 SER B O   1 
ATOM   2607 C  CB  . SER B 1 132 ? 5.209   47.412 14.665  1.00 28.52 ? 132 SER B CB  1 
ATOM   2608 O  OG  . SER B 1 132 ? 3.967   46.909 14.191  1.00 28.94 ? 132 SER B OG  1 
ATOM   2609 N  N   . LYS B 1 133 ? 2.861   47.085 17.041  1.00 27.94 ? 133 LYS B N   1 
ATOM   2610 C  CA  . LYS B 1 133 ? 1.496   47.407 17.460  1.00 27.84 ? 133 LYS B CA  1 
ATOM   2611 C  C   . LYS B 1 133 ? 1.450   47.704 18.946  1.00 27.51 ? 133 LYS B C   1 
ATOM   2612 O  O   . LYS B 1 133 ? 0.376   47.794 19.526  1.00 28.57 ? 133 LYS B O   1 
ATOM   2613 C  CB  . LYS B 1 133 ? 0.509   46.271 17.102  1.00 28.09 ? 133 LYS B CB  1 
ATOM   2614 C  CG  . LYS B 1 133 ? 0.428   45.901 15.592  1.00 28.67 ? 133 LYS B CG  1 
ATOM   2615 C  CD  . LYS B 1 133 ? 0.130   47.093 14.657  1.00 30.38 ? 133 LYS B CD  1 
ATOM   2616 C  CE  . LYS B 1 133 ? -0.469  46.574 13.348  1.00 30.05 ? 133 LYS B CE  1 
ATOM   2617 N  NZ  . LYS B 1 133 ? -0.530  47.601 12.305  1.00 31.95 ? 133 LYS B NZ  1 
ATOM   2618 N  N   . GLY B 1 134 ? 2.615   47.851 19.566  1.00 27.27 ? 134 GLY B N   1 
ATOM   2619 C  CA  . GLY B 1 134 ? 2.680   48.127 21.001  1.00 26.61 ? 134 GLY B CA  1 
ATOM   2620 C  C   . GLY B 1 134 ? 2.334   46.914 21.832  1.00 25.24 ? 134 GLY B C   1 
ATOM   2621 O  O   . GLY B 1 134 ? 1.878   47.035 22.987  1.00 26.94 ? 134 GLY B O   1 
ATOM   2622 N  N   . ILE B 1 135 ? 2.543   45.739 21.253  1.00 24.87 ? 135 ILE B N   1 
ATOM   2623 C  CA  . ILE B 1 135 ? 2.245   44.463 21.925  1.00 24.11 ? 135 ILE B CA  1 
ATOM   2624 C  C   . ILE B 1 135 ? 3.566   43.797 22.336  1.00 23.56 ? 135 ILE B C   1 
ATOM   2625 O  O   . ILE B 1 135 ? 4.533   43.736 21.545  1.00 23.37 ? 135 ILE B O   1 
ATOM   2626 C  CB  . ILE B 1 135 ? 1.374   43.537 21.012  1.00 24.72 ? 135 ILE B CB  1 
ATOM   2627 C  CG1 . ILE B 1 135 ? -0.068  44.076 20.937  1.00 24.97 ? 135 ILE B CG1 1 
ATOM   2628 C  CG2 . ILE B 1 135 ? 1.422   42.053 21.449  1.00 23.65 ? 135 ILE B CG2 1 
ATOM   2629 C  CD1 . ILE B 1 135 ? -0.804  43.751 19.656  1.00 22.74 ? 135 ILE B CD1 1 
ATOM   2630 N  N   . ALA B 1 136 ? 3.601   43.312 23.568  1.00 23.04 ? 136 ALA B N   1 
ATOM   2631 C  CA  . ALA B 1 136 ? 4.769   42.655 24.137  1.00 22.09 ? 136 ALA B CA  1 
ATOM   2632 C  C   . ALA B 1 136 ? 4.978   41.321 23.460  1.00 23.15 ? 136 ALA B C   1 
ATOM   2633 O  O   . ALA B 1 136 ? 4.069   40.483 23.452  1.00 23.77 ? 136 ALA B O   1 
ATOM   2634 C  CB  . ALA B 1 136 ? 4.583   42.460 25.646  1.00 22.71 ? 136 ALA B CB  1 
ATOM   2635 N  N   . ALA B 1 137 ? 6.160   41.136 22.862  1.00 22.64 ? 137 ALA B N   1 
ATOM   2636 C  CA  . ALA B 1 137 ? 6.544   39.856 22.256  1.00 21.86 ? 137 ALA B CA  1 
ATOM   2637 C  C   . ALA B 1 137 ? 8.059   39.760 22.161  1.00 22.32 ? 137 ALA B C   1 
ATOM   2638 O  O   . ALA B 1 137 ? 8.749   40.765 21.952  1.00 21.12 ? 137 ALA B O   1 
ATOM   2639 C  CB  . ALA B 1 137 ? 5.907   39.664 20.869  1.00 22.42 ? 137 ALA B CB  1 
ATOM   2640 N  N   . GLU B 1 138 ? 8.562   38.536 22.311  1.00 22.00 ? 138 GLU B N   1 
ATOM   2641 C  CA  . GLU B 1 138 ? 9.989   38.258 22.282  1.00 22.84 ? 138 GLU B CA  1 
ATOM   2642 C  C   . GLU B 1 138 ? 10.191  36.828 21.830  1.00 22.78 ? 138 GLU B C   1 
ATOM   2643 O  O   . GLU B 1 138 ? 9.270   35.973 21.975  1.00 22.70 ? 138 GLU B O   1 
ATOM   2644 C  CB  . GLU B 1 138 ? 10.620  38.440 23.671  1.00 23.07 ? 138 GLU B CB  1 
ATOM   2645 C  CG  . GLU B 1 138 ? 9.879   37.741 24.834  1.00 24.49 ? 138 GLU B CG  1 
ATOM   2646 C  CD  . GLU B 1 138 ? 10.515  38.060 26.174  1.00 27.02 ? 138 GLU B CD  1 
ATOM   2647 O  OE1 . GLU B 1 138 ? 11.692  38.495 26.169  1.00 30.52 ? 138 GLU B OE1 1 
ATOM   2648 O  OE2 . GLU B 1 138 ? 9.873   37.871 27.227  1.00 27.40 ? 138 GLU B OE2 1 
ATOM   2649 N  N   . VAL B 1 139 ? 11.394  36.575 21.317  1.00 21.84 ? 139 VAL B N   1 
ATOM   2650 C  CA  . VAL B 1 139 ? 11.830  35.239 20.975  1.00 22.57 ? 139 VAL B CA  1 
ATOM   2651 C  C   . VAL B 1 139 ? 12.009  34.461 22.259  1.00 22.26 ? 139 VAL B C   1 
ATOM   2652 O  O   . VAL B 1 139 ? 12.762  34.871 23.151  1.00 21.25 ? 139 VAL B O   1 
ATOM   2653 C  CB  . VAL B 1 139 ? 13.179  35.176 20.200  1.00 22.42 ? 139 VAL B CB  1 
ATOM   2654 C  CG1 . VAL B 1 139 ? 13.515  33.690 19.810  1.00 23.21 ? 139 VAL B CG1 1 
ATOM   2655 C  CG2 . VAL B 1 139 ? 13.147  36.056 18.972  1.00 23.55 ? 139 VAL B CG2 1 
ATOM   2656 N  N   . ALA B 1 140 ? 11.326  33.325 22.319  1.00 21.60 ? 140 ALA B N   1 
ATOM   2657 C  CA  . ALA B 1 140 ? 11.440  32.433 23.463  1.00 22.46 ? 140 ALA B CA  1 
ATOM   2658 C  C   . ALA B 1 140 ? 12.881  31.891 23.505  1.00 22.71 ? 140 ALA B C   1 
ATOM   2659 O  O   . ALA B 1 140 ? 13.478  31.633 22.468  1.00 22.10 ? 140 ALA B O   1 
ATOM   2660 C  CB  . ALA B 1 140 ? 10.431  31.330 23.349  1.00 22.01 ? 140 ALA B CB  1 
ATOM   2661 N  N   . THR B 1 141 ? 13.442  31.757 24.701  1.00 22.96 ? 141 THR B N   1 
ATOM   2662 C  CA  . THR B 1 141 ? 14.801  31.228 24.846  1.00 23.10 ? 141 THR B CA  1 
ATOM   2663 C  C   . THR B 1 141 ? 14.841  30.239 25.998  1.00 23.22 ? 141 THR B C   1 
ATOM   2664 O  O   . THR B 1 141 ? 15.590  29.256 25.928  1.00 25.55 ? 141 THR B O   1 
ATOM   2665 C  CB  . THR B 1 141 ? 15.853  32.334 25.117  1.00 22.68 ? 141 THR B CB  1 
ATOM   2666 O  OG1 . THR B 1 141 ? 15.473  33.065 26.290  1.00 25.59 ? 141 THR B OG1 1 
ATOM   2667 C  CG2 . THR B 1 141 ? 15.954  33.295 23.974  1.00 23.15 ? 141 THR B CG2 1 
ATOM   2668 N  N   . ASP B 1 142 ? 14.057  30.494 27.056  1.00 23.14 ? 142 ASP B N   1 
ATOM   2669 C  CA  . ASP B 1 142 ? 14.137  29.700 28.291  1.00 22.85 ? 142 ASP B CA  1 
ATOM   2670 C  C   . ASP B 1 142 ? 13.037  28.688 28.506  1.00 22.89 ? 142 ASP B C   1 
ATOM   2671 O  O   . ASP B 1 142 ? 13.177  27.806 29.354  1.00 22.87 ? 142 ASP B O   1 
ATOM   2672 C  CB  . ASP B 1 142 ? 14.254  30.605 29.524  1.00 22.33 ? 142 ASP B CB  1 
ATOM   2673 C  CG  . ASP B 1 142 ? 15.302  31.638 29.351  1.00 22.44 ? 142 ASP B CG  1 
ATOM   2674 O  OD1 . ASP B 1 142 ? 16.155  31.451 28.480  1.00 18.23 ? 142 ASP B OD1 1 
ATOM   2675 O  OD2 . ASP B 1 142 ? 15.282  32.647 30.080  1.00 26.28 ? 142 ASP B OD2 1 
ATOM   2676 N  N   . ARG B 1 143 ? 11.955  28.844 27.751  1.00 22.91 ? 143 ARG B N   1 
ATOM   2677 C  CA  . ARG B 1 143 ? 10.899  27.870 27.640  1.00 24.38 ? 143 ARG B CA  1 
ATOM   2678 C  C   . ARG B 1 143 ? 10.162  28.238 26.350  1.00 23.98 ? 143 ARG B C   1 
ATOM   2679 O  O   . ARG B 1 143 ? 10.316  29.362 25.837  1.00 24.36 ? 143 ARG B O   1 
ATOM   2680 C  CB  . ARG B 1 143 ? 9.957   27.947 28.848  1.00 25.54 ? 143 ARG B CB  1 
ATOM   2681 C  CG  . ARG B 1 143 ? 9.235   29.268 28.885  1.00 25.99 ? 143 ARG B CG  1 
ATOM   2682 C  CD  . ARG B 1 143 ? 8.545   29.571 30.149  1.00 28.41 ? 143 ARG B CD  1 
ATOM   2683 N  NE  . ARG B 1 143 ? 8.302   31.010 30.173  1.00 29.36 ? 143 ARG B NE  1 
ATOM   2684 C  CZ  . ARG B 1 143 ? 7.373   31.615 30.907  1.00 29.96 ? 143 ARG B CZ  1 
ATOM   2685 N  NH1 . ARG B 1 143 ? 6.573   30.908 31.698  1.00 31.33 ? 143 ARG B NH1 1 
ATOM   2686 N  NH2 . ARG B 1 143 ? 7.248   32.933 30.845  1.00 30.31 ? 143 ARG B NH2 1 
ATOM   2687 N  N   . PHE B 1 144 ? 9.399   27.293 25.807  1.00 23.51 ? 144 PHE B N   1 
ATOM   2688 C  CA  . PHE B 1 144 ? 8.534   27.544 24.660  1.00 22.64 ? 144 PHE B CA  1 
ATOM   2689 C  C   . PHE B 1 144 ? 9.292   27.790 23.366  1.00 23.32 ? 144 PHE B C   1 
ATOM   2690 O  O   . PHE B 1 144 ? 8.782   28.434 22.461  1.00 22.97 ? 144 PHE B O   1 
ATOM   2691 C  CB  . PHE B 1 144 ? 7.596   28.716 24.969  1.00 22.90 ? 144 PHE B CB  1 
ATOM   2692 C  CG  . PHE B 1 144 ? 6.663   28.473 26.158  1.00 22.18 ? 144 PHE B CG  1 
ATOM   2693 C  CD1 . PHE B 1 144 ? 6.242   27.185 26.489  1.00 22.30 ? 144 PHE B CD1 1 
ATOM   2694 C  CD2 . PHE B 1 144 ? 6.227   29.541 26.947  1.00 22.36 ? 144 PHE B CD2 1 
ATOM   2695 C  CE1 . PHE B 1 144 ? 5.376   26.989 27.572  1.00 22.79 ? 144 PHE B CE1 1 
ATOM   2696 C  CE2 . PHE B 1 144 ? 5.358   29.347 28.043  1.00 23.39 ? 144 PHE B CE2 1 
ATOM   2697 C  CZ  . PHE B 1 144 ? 4.944   28.083 28.344  1.00 21.35 ? 144 PHE B CZ  1 
ATOM   2698 N  N   . THR B 1 145 ? 10.514  27.266 23.277  1.00 22.70 ? 145 THR B N   1 
ATOM   2699 C  CA  . THR B 1 145 ? 11.357  27.478 22.110  1.00 22.29 ? 145 THR B CA  1 
ATOM   2700 C  C   . THR B 1 145 ? 10.877  26.705 20.856  1.00 22.20 ? 145 THR B C   1 
ATOM   2701 O  O   . THR B 1 145 ? 11.245  27.057 19.733  1.00 21.76 ? 145 THR B O   1 
ATOM   2702 C  CB  . THR B 1 145 ? 12.792  27.043 22.370  1.00 22.41 ? 145 THR B CB  1 
ATOM   2703 O  OG1 . THR B 1 145 ? 12.774  25.705 22.861  1.00 22.16 ? 145 THR B OG1 1 
ATOM   2704 C  CG2 . THR B 1 145 ? 13.528  27.964 23.365  1.00 22.27 ? 145 THR B CG2 1 
ATOM   2705 N  N   . ALA B 1 146 ? 10.102  25.646 21.065  1.00 21.79 ? 146 ALA B N   1 
ATOM   2706 C  CA  . ALA B 1 146 ? 9.446   24.891 19.983  1.00 22.01 ? 146 ALA B CA  1 
ATOM   2707 C  C   . ALA B 1 146 ? 10.389  24.502 18.837  1.00 21.39 ? 146 ALA B C   1 
ATOM   2708 O  O   . ALA B 1 146 ? 10.066  24.693 17.668  1.00 21.61 ? 146 ALA B O   1 
ATOM   2709 C  CB  . ALA B 1 146 ? 8.236   25.664 19.457  1.00 21.30 ? 146 ALA B CB  1 
ATOM   2710 N  N   . THR B 1 147 ? 11.547  23.954 19.204  1.00 20.87 ? 147 THR B N   1 
ATOM   2711 C  CA  . THR B 1 147 ? 12.543  23.412 18.254  1.00 20.69 ? 147 THR B CA  1 
ATOM   2712 C  C   . THR B 1 147 ? 12.475  21.881 18.136  1.00 20.37 ? 147 THR B C   1 
ATOM   2713 O  O   . THR B 1 147 ? 13.145  21.264 17.278  1.00 19.66 ? 147 THR B O   1 
ATOM   2714 C  CB  . THR B 1 147 ? 13.991  23.865 18.605  1.00 20.28 ? 147 THR B CB  1 
ATOM   2715 O  OG1 . THR B 1 147 ? 14.449  23.198 19.789  1.00 23.83 ? 147 THR B OG1 1 
ATOM   2716 C  CG2 . THR B 1 147 ? 14.058  25.388 18.788  1.00 17.47 ? 147 THR B CG2 1 
ATOM   2717 N  N   . ASP B 1 148 ? 11.657  21.269 18.983  1.00 21.10 ? 148 ASP B N   1 
ATOM   2718 C  CA  . ASP B 1 148 ? 11.493  19.815 18.952  1.00 22.04 ? 148 ASP B CA  1 
ATOM   2719 C  C   . ASP B 1 148 ? 10.728  19.438 17.668  1.00 22.49 ? 148 ASP B C   1 
ATOM   2720 O  O   . ASP B 1 148 ? 9.607   19.868 17.519  1.00 23.80 ? 148 ASP B O   1 
ATOM   2721 C  CB  . ASP B 1 148 ? 10.741  19.370 20.210  1.00 21.60 ? 148 ASP B CB  1 
ATOM   2722 C  CG  . ASP B 1 148 ? 10.706  17.875 20.397  1.00 20.88 ? 148 ASP B CG  1 
ATOM   2723 O  OD1 . ASP B 1 148 ? 10.871  17.125 19.414  1.00 19.15 ? 148 ASP B OD1 1 
ATOM   2724 O  OD2 . ASP B 1 148 ? 10.497  17.438 21.550  1.00 23.34 ? 148 ASP B OD2 1 
ATOM   2725 N  N   . PRO B 1 149 ? 11.339  18.629 16.746  1.00 22.84 ? 149 PRO B N   1 
ATOM   2726 C  CA  . PRO B 1 149 ? 10.679  18.218 15.498  1.00 22.73 ? 149 PRO B CA  1 
ATOM   2727 C  C   . PRO B 1 149 ? 9.348   17.457 15.707  1.00 22.50 ? 149 PRO B C   1 
ATOM   2728 O  O   . PRO B 1 149 ? 8.555   17.336 14.755  1.00 22.85 ? 149 PRO B O   1 
ATOM   2729 C  CB  . PRO B 1 149 ? 11.731  17.333 14.805  1.00 22.68 ? 149 PRO B CB  1 
ATOM   2730 C  CG  . PRO B 1 149 ? 12.606  16.874 15.876  1.00 23.90 ? 149 PRO B CG  1 
ATOM   2731 C  CD  . PRO B 1 149 ? 12.687  18.027 16.847  1.00 23.45 ? 149 PRO B CD  1 
ATOM   2732 N  N   . ASP B 1 150 ? 9.119   16.974 16.938  1.00 21.15 ? 150 ASP B N   1 
ATOM   2733 C  CA  . ASP B 1 150 ? 7.848   16.357 17.358  1.00 20.94 ? 150 ASP B CA  1 
ATOM   2734 C  C   . ASP B 1 150 ? 6.723   17.331 17.691  1.00 20.37 ? 150 ASP B C   1 
ATOM   2735 O  O   . ASP B 1 150 ? 5.545   16.935 17.717  1.00 20.61 ? 150 ASP B O   1 
ATOM   2736 C  CB  . ASP B 1 150 ? 8.069   15.393 18.542  1.00 20.59 ? 150 ASP B CB  1 
ATOM   2737 C  CG  . ASP B 1 150 ? 8.959   14.207 18.177  1.00 23.71 ? 150 ASP B CG  1 
ATOM   2738 O  OD1 . ASP B 1 150 ? 9.054   13.853 16.980  1.00 26.33 ? 150 ASP B OD1 1 
ATOM   2739 O  OD2 . ASP B 1 150 ? 9.593   13.628 19.077  1.00 20.66 ? 150 ASP B OD2 1 
ATOM   2740 N  N   . ASN B 1 151 ? 7.060   18.608 17.936  1.00 18.58 ? 151 ASN B N   1 
ATOM   2741 C  CA  . ASN B 1 151 ? 6.050   19.571 18.257  1.00 18.18 ? 151 ASN B CA  1 
ATOM   2742 C  C   . ASN B 1 151 ? 5.242   19.625 16.991  1.00 18.18 ? 151 ASN B C   1 
ATOM   2743 O  O   . ASN B 1 151 ? 5.827   19.773 15.911  1.00 17.26 ? 151 ASN B O   1 
ATOM   2744 C  CB  . ASN B 1 151 ? 6.673   20.939 18.522  1.00 17.55 ? 151 ASN B CB  1 
ATOM   2745 C  CG  . ASN B 1 151 ? 5.689   21.938 19.042  1.00 19.66 ? 151 ASN B CG  1 
ATOM   2746 O  OD1 . ASN B 1 151 ? 4.649   22.190 18.422  1.00 20.36 ? 151 ASN B OD1 1 
ATOM   2747 N  ND2 . ASN B 1 151 ? 6.013   22.545 20.187  1.00 16.17 ? 151 ASN B ND2 1 
ATOM   2748 N  N   . ILE B 1 152 ? 3.926   19.467 17.143  1.00 17.79 ? 152 ILE B N   1 
ATOM   2749 C  CA  . ILE B 1 152 ? 2.940   19.475 16.037  1.00 18.60 ? 152 ILE B CA  1 
ATOM   2750 C  C   . ILE B 1 152 ? 3.143   20.621 14.990  1.00 19.22 ? 152 ILE B C   1 
ATOM   2751 O  O   . ILE B 1 152 ? 2.995   20.403 13.763  1.00 17.94 ? 152 ILE B O   1 
ATOM   2752 C  CB  . ILE B 1 152 ? 1.452   19.389 16.631  1.00 18.35 ? 152 ILE B CB  1 
ATOM   2753 C  CG1 . ILE B 1 152 ? 0.375   19.236 15.544  1.00 19.97 ? 152 ILE B CG1 1 
ATOM   2754 C  CG2 . ILE B 1 152 ? 1.111   20.564 17.534  1.00 18.10 ? 152 ILE B CG2 1 
ATOM   2755 C  CD1 . ILE B 1 152 ? 0.634   18.130 14.554  1.00 23.33 ? 152 ILE B CD1 1 
ATOM   2756 N  N   . VAL B 1 153 ? 3.495   21.823 15.468  1.00 19.47 ? 153 VAL B N   1 
ATOM   2757 C  CA  . VAL B 1 153 ? 3.721   22.982 14.565  1.00 20.08 ? 153 VAL B CA  1 
ATOM   2758 C  C   . VAL B 1 153 ? 4.911   22.798 13.581  1.00 19.86 ? 153 VAL B C   1 
ATOM   2759 O  O   . VAL B 1 153 ? 4.960   23.412 12.498  1.00 19.01 ? 153 VAL B O   1 
ATOM   2760 C  CB  . VAL B 1 153 ? 3.871   24.336 15.340  1.00 19.91 ? 153 VAL B CB  1 
ATOM   2761 C  CG1 . VAL B 1 153 ? 5.323   24.483 15.948  1.00 19.84 ? 153 VAL B CG1 1 
ATOM   2762 C  CG2 . VAL B 1 153 ? 3.556   25.520 14.425  1.00 21.17 ? 153 VAL B CG2 1 
ATOM   2763 N  N   . ASN B 1 154 ? 5.853   21.937 13.948  1.00 19.29 ? 154 ASN B N   1 
ATOM   2764 C  CA  . ASN B 1 154 ? 7.021   21.686 13.111  1.00 19.01 ? 154 ASN B CA  1 
ATOM   2765 C  C   . ASN B 1 154 ? 6.780   20.543 12.152  1.00 19.31 ? 154 ASN B C   1 
ATOM   2766 O  O   . ASN B 1 154 ? 7.687   20.125 11.443  1.00 21.48 ? 154 ASN B O   1 
ATOM   2767 C  CB  . ASN B 1 154 ? 8.246   21.415 14.009  1.00 18.85 ? 154 ASN B CB  1 
ATOM   2768 C  CG  . ASN B 1 154 ? 8.792   22.709 14.640  1.00 17.15 ? 154 ASN B CG  1 
ATOM   2769 O  OD1 . ASN B 1 154 ? 8.773   23.778 13.998  1.00 16.24 ? 154 ASN B OD1 1 
ATOM   2770 N  ND2 . ASN B 1 154 ? 9.310   22.614 15.873  1.00 17.47 ? 154 ASN B ND2 1 
ATOM   2771 N  N   . ARG B 1 155 ? 5.570   19.980 12.195  1.00 19.52 ? 155 ARG B N   1 
ATOM   2772 C  CA  . ARG B 1 155 ? 5.209   18.824 11.377  1.00 18.28 ? 155 ARG B CA  1 
ATOM   2773 C  C   . ARG B 1 155 ? 4.497   19.310 10.110  1.00 19.27 ? 155 ARG B C   1 
ATOM   2774 O  O   . ARG B 1 155 ? 3.841   18.518 9.402   1.00 18.97 ? 155 ARG B O   1 
ATOM   2775 C  CB  . ARG B 1 155 ? 4.385   17.809 12.192  1.00 19.07 ? 155 ARG B CB  1 
ATOM   2776 C  CG  . ARG B 1 155 ? 5.131   17.395 13.497  1.00 16.83 ? 155 ARG B CG  1 
ATOM   2777 C  CD  . ARG B 1 155 ? 4.463   16.293 14.297  1.00 18.17 ? 155 ARG B CD  1 
ATOM   2778 N  NE  . ARG B 1 155 ? 4.221   15.119 13.480  1.00 18.53 ? 155 ARG B NE  1 
ATOM   2779 C  CZ  . ARG B 1 155 ? 3.403   14.128 13.819  1.00 16.91 ? 155 ARG B CZ  1 
ATOM   2780 N  NH1 . ARG B 1 155 ? 2.751   14.153 14.976  1.00 18.00 ? 155 ARG B NH1 1 
ATOM   2781 N  NH2 . ARG B 1 155 ? 3.245   13.105 12.981  1.00 22.38 ? 155 ARG B NH2 1 
ATOM   2782 N  N   . CYS B 1 156 ? 4.680   20.595 9.769   1.00 18.21 ? 156 CYS B N   1 
ATOM   2783 C  CA  . CYS B 1 156 ? 4.226   21.055 8.440   1.00 19.70 ? 156 CYS B CA  1 
ATOM   2784 C  C   . CYS B 1 156 ? 5.208   20.441 7.383   1.00 20.75 ? 156 CYS B C   1 
ATOM   2785 O  O   . CYS B 1 156 ? 6.217   19.820 7.759   1.00 19.97 ? 156 CYS B O   1 
ATOM   2786 C  CB  . CYS B 1 156 ? 4.102   22.596 8.384   1.00 19.63 ? 156 CYS B CB  1 
ATOM   2787 S  SG  . CYS B 1 156 ? 5.620   23.443 8.936   1.00 23.30 ? 156 CYS B SG  1 
ATOM   2788 N  N   . ALA B 1 157 ? 4.913   20.580 6.090   1.00 20.79 ? 157 ALA B N   1 
ATOM   2789 C  CA  . ALA B 1 157 ? 5.751   19.942 5.063   1.00 21.57 ? 157 ALA B CA  1 
ATOM   2790 C  C   . ALA B 1 157 ? 7.211   20.484 5.019   1.00 21.74 ? 157 ALA B C   1 
ATOM   2791 O  O   . ALA B 1 157 ? 8.140   19.737 4.691   1.00 21.68 ? 157 ALA B O   1 
ATOM   2792 C  CB  . ALA B 1 157 ? 5.093   20.034 3.717   1.00 21.72 ? 157 ALA B CB  1 
ATOM   2793 N  N   . SER B 1 158 ? 7.416   21.755 5.350   1.00 20.92 ? 158 SER B N   1 
ATOM   2794 C  CA  . SER B 1 158 ? 8.788   22.280 5.475   1.00 22.66 ? 158 SER B CA  1 
ATOM   2795 C  C   . SER B 1 158 ? 9.516   21.754 6.724   1.00 22.24 ? 158 SER B C   1 
ATOM   2796 O  O   . SER B 1 158 ? 10.726  21.899 6.853   1.00 22.11 ? 158 SER B O   1 
ATOM   2797 C  CB  . SER B 1 158 ? 8.804   23.807 5.456   1.00 22.91 ? 158 SER B CB  1 
ATOM   2798 O  OG  . SER B 1 158 ? 8.302   24.344 6.675   1.00 22.64 ? 158 SER B OG  1 
ATOM   2799 N  N   . GLY B 1 159 ? 8.769   21.160 7.637   1.00 21.57 ? 159 GLY B N   1 
ATOM   2800 C  CA  . GLY B 1 159 ? 9.327   20.789 8.944   1.00 22.90 ? 159 GLY B CA  1 
ATOM   2801 C  C   . GLY B 1 159 ? 9.735   21.964 9.825   1.00 22.16 ? 159 GLY B C   1 
ATOM   2802 O  O   . GLY B 1 159 ? 10.432  21.770 10.815  1.00 22.24 ? 159 GLY B O   1 
ATOM   2803 N  N   . LYS B 1 160 ? 9.274   23.176 9.501   1.00 21.46 ? 160 LYS B N   1 
ATOM   2804 C  CA  . LYS B 1 160 ? 9.661   24.367 10.264  1.00 22.31 ? 160 LYS B CA  1 
ATOM   2805 C  C   . LYS B 1 160 ? 8.433   25.181 10.537  1.00 21.84 ? 160 LYS B C   1 
ATOM   2806 O  O   . LYS B 1 160 ? 7.859   25.757 9.599   1.00 21.44 ? 160 LYS B O   1 
ATOM   2807 C  CB  . LYS B 1 160 ? 10.610  25.274 9.480   1.00 22.89 ? 160 LYS B CB  1 
ATOM   2808 C  CG  . LYS B 1 160 ? 12.031  24.796 9.288   1.00 26.98 ? 160 LYS B CG  1 
ATOM   2809 C  CD  . LYS B 1 160 ? 12.959  25.968 9.017   1.00 27.78 ? 160 LYS B CD  1 
ATOM   2810 C  CE  . LYS B 1 160 ? 12.759  26.583 7.619   1.00 29.72 ? 160 LYS B CE  1 
ATOM   2811 N  NZ  . LYS B 1 160 ? 11.704  27.654 7.557   1.00 27.77 ? 160 LYS B NZ  1 
ATOM   2812 N  N   . GLY B 1 161 ? 8.019   25.224 11.807  1.00 21.56 ? 161 GLY B N   1 
ATOM   2813 C  CA  . GLY B 1 161 ? 6.838   25.992 12.227  1.00 19.92 ? 161 GLY B CA  1 
ATOM   2814 C  C   . GLY B 1 161 ? 7.137   27.214 13.092  1.00 19.52 ? 161 GLY B C   1 
ATOM   2815 O  O   . GLY B 1 161 ? 8.289   27.471 13.416  1.00 19.99 ? 161 GLY B O   1 
ATOM   2816 N  N   . VAL B 1 162 ? 6.103   27.976 13.441  1.00 17.87 ? 162 VAL B N   1 
ATOM   2817 C  CA  . VAL B 1 162 ? 6.250   29.067 14.413  1.00 18.14 ? 162 VAL B CA  1 
ATOM   2818 C  C   . VAL B 1 162 ? 5.220   28.854 15.513  1.00 17.81 ? 162 VAL B C   1 
ATOM   2819 O  O   . VAL B 1 162 ? 4.055   28.693 15.223  1.00 18.18 ? 162 VAL B O   1 
ATOM   2820 C  CB  . VAL B 1 162 ? 6.006   30.467 13.771  1.00 17.89 ? 162 VAL B CB  1 
ATOM   2821 C  CG1 . VAL B 1 162 ? 6.091   31.589 14.844  1.00 15.47 ? 162 VAL B CG1 1 
ATOM   2822 C  CG2 . VAL B 1 162 ? 6.990   30.735 12.628  1.00 17.24 ? 162 VAL B CG2 1 
ATOM   2823 N  N   . GLN B 1 163 ? 5.639   28.892 16.774  1.00 18.76 ? 163 GLN B N   1 
ATOM   2824 C  CA  . GLN B 1 163 ? 4.689   28.767 17.885  1.00 17.93 ? 163 GLN B CA  1 
ATOM   2825 C  C   . GLN B 1 163 ? 4.535   30.075 18.655  1.00 18.14 ? 163 GLN B C   1 
ATOM   2826 O  O   . GLN B 1 163 ? 5.555   30.745 18.897  1.00 16.20 ? 163 GLN B O   1 
ATOM   2827 C  CB  . GLN B 1 163 ? 5.180   27.686 18.841  1.00 19.25 ? 163 GLN B CB  1 
ATOM   2828 C  CG  . GLN B 1 163 ? 4.335   27.535 20.100  1.00 18.28 ? 163 GLN B CG  1 
ATOM   2829 C  CD  . GLN B 1 163 ? 4.852   26.423 20.914  1.00 16.47 ? 163 GLN B CD  1 
ATOM   2830 O  OE1 . GLN B 1 163 ? 4.602   25.259 20.602  1.00 17.47 ? 163 GLN B OE1 1 
ATOM   2831 N  NE2 . GLN B 1 163 ? 5.619   26.749 21.955  1.00 16.21 ? 163 GLN B NE2 1 
ATOM   2832 N  N   . LEU B 1 164 ? 3.289   30.437 19.037  1.00 17.60 ? 164 LEU B N   1 
ATOM   2833 C  CA  . LEU B 1 164 ? 3.055   31.600 19.926  1.00 18.32 ? 164 LEU B CA  1 
ATOM   2834 C  C   . LEU B 1 164 ? 2.485   31.092 21.256  1.00 19.52 ? 164 LEU B C   1 
ATOM   2835 O  O   . LEU B 1 164 ? 1.493   30.334 21.297  1.00 19.08 ? 164 LEU B O   1 
ATOM   2836 C  CB  . LEU B 1 164 ? 2.118   32.690 19.339  1.00 18.80 ? 164 LEU B CB  1 
ATOM   2837 C  CG  . LEU B 1 164 ? 2.640   33.710 18.293  1.00 17.29 ? 164 LEU B CG  1 
ATOM   2838 C  CD1 . LEU B 1 164 ? 2.910   33.044 16.955  1.00 22.05 ? 164 LEU B CD1 1 
ATOM   2839 C  CD2 . LEU B 1 164 ? 1.675   34.897 18.121  1.00 17.94 ? 164 LEU B CD2 1 
ATOM   2840 N  N   . GLU B 1 165 ? 3.149   31.497 22.326  1.00 19.01 ? 165 GLU B N   1 
ATOM   2841 C  CA  . GLU B 1 165 ? 2.729   31.177 23.657  1.00 20.16 ? 165 GLU B CA  1 
ATOM   2842 C  C   . GLU B 1 165 ? 2.403   32.519 24.221  1.00 18.31 ? 165 GLU B C   1 
ATOM   2843 O  O   . GLU B 1 165 ? 3.248   33.400 24.284  1.00 17.96 ? 165 GLU B O   1 
ATOM   2844 C  CB  . GLU B 1 165 ? 3.843   30.471 24.435  1.00 19.50 ? 165 GLU B CB  1 
ATOM   2845 C  CG  . GLU B 1 165 ? 3.885   28.964 24.197  1.00 23.64 ? 165 GLU B CG  1 
ATOM   2846 C  CD  . GLU B 1 165 ? 2.842   28.212 25.026  1.00 27.90 ? 165 GLU B CD  1 
ATOM   2847 O  OE1 . GLU B 1 165 ? 2.035   28.862 25.700  1.00 26.76 ? 165 GLU B OE1 1 
ATOM   2848 O  OE2 . GLU B 1 165 ? 2.815   26.967 24.982  1.00 31.02 ? 165 GLU B OE2 1 
ATOM   2849 N  N   . ILE B 1 166 ? 1.140   32.664 24.562  1.00 19.05 ? 166 ILE B N   1 
ATOM   2850 C  CA  . ILE B 1 166 ? 0.561   33.940 24.855  1.00 18.23 ? 166 ILE B CA  1 
ATOM   2851 C  C   . ILE B 1 166 ? 0.061   33.867 26.291  1.00 19.74 ? 166 ILE B C   1 
ATOM   2852 O  O   . ILE B 1 166 ? -0.732  32.981 26.654  1.00 20.39 ? 166 ILE B O   1 
ATOM   2853 C  CB  . ILE B 1 166 ? -0.620  34.250 23.914  1.00 18.42 ? 166 ILE B CB  1 
ATOM   2854 C  CG1 . ILE B 1 166 ? -0.231  33.992 22.440  1.00 15.13 ? 166 ILE B CG1 1 
ATOM   2855 C  CG2 . ILE B 1 166 ? -1.156  35.694 24.187  1.00 15.86 ? 166 ILE B CG2 1 
ATOM   2856 C  CD1 . ILE B 1 166 ? -1.311  34.332 21.401  1.00 17.23 ? 166 ILE B CD1 1 
ATOM   2857 N  N   . SER B 1 167 ? 0.467   34.843 27.094  1.00 20.05 ? 167 SER B N   1 
ATOM   2858 C  CA  . SER B 1 167 ? 0.111   34.846 28.515  1.00 19.90 ? 167 SER B CA  1 
ATOM   2859 C  C   . SER B 1 167 ? -1.393  35.009 28.731  1.00 20.40 ? 167 SER B C   1 
ATOM   2860 O  O   . SER B 1 167 ? -2.069  35.718 27.974  1.00 19.64 ? 167 SER B O   1 
ATOM   2861 C  CB  . SER B 1 167 ? 0.835   35.983 29.210  1.00 19.60 ? 167 SER B CB  1 
ATOM   2862 O  OG  . SER B 1 167 ? 0.193   37.210 28.912  1.00 21.23 ? 167 SER B OG  1 
ATOM   2863 N  N   . SER B 1 168 ? -1.909  34.357 29.782  1.00 21.23 ? 168 SER B N   1 
ATOM   2864 C  CA  . SER B 1 168 ? -3.298  34.566 30.206  1.00 21.67 ? 168 SER B CA  1 
ATOM   2865 C  C   . SER B 1 168 ? -3.671  36.050 30.290  1.00 22.03 ? 168 SER B C   1 
ATOM   2866 O  O   . SER B 1 168 ? -4.737  36.435 29.801  1.00 20.59 ? 168 SER B O   1 
ATOM   2867 C  CB  . SER B 1 168 ? -3.626  33.821 31.519  1.00 22.20 ? 168 SER B CB  1 
ATOM   2868 O  OG  . SER B 1 168 ? -2.653  34.056 32.510  1.00 22.97 ? 168 SER B OG  1 
ATOM   2869 N  N   . ALA B 1 169 ? -2.799  36.882 30.888  1.00 21.99 ? 169 ALA B N   1 
ATOM   2870 C  CA  . ALA B 1 169 ? -3.091  38.329 30.961  1.00 23.17 ? 169 ALA B CA  1 
ATOM   2871 C  C   . ALA B 1 169 ? -3.320  38.916 29.571  1.00 22.76 ? 169 ALA B C   1 
ATOM   2872 O  O   . ALA B 1 169 ? -4.270  39.687 29.371  1.00 23.61 ? 169 ALA B O   1 
ATOM   2873 C  CB  . ALA B 1 169 ? -2.001  39.093 31.717  1.00 23.71 ? 169 ALA B CB  1 
ATOM   2874 N  N   . GLN B 1 170 ? -2.455  38.561 28.620  1.00 22.10 ? 170 GLN B N   1 
ATOM   2875 C  CA  . GLN B 1 170 ? -2.639  38.984 27.238  1.00 21.44 ? 170 GLN B CA  1 
ATOM   2876 C  C   . GLN B 1 170 ? -3.977  38.557 26.624  1.00 21.75 ? 170 GLN B C   1 
ATOM   2877 O  O   . GLN B 1 170 ? -4.648  39.378 25.997  1.00 21.72 ? 170 GLN B O   1 
ATOM   2878 C  CB  . GLN B 1 170 ? -1.461  38.573 26.351  1.00 21.58 ? 170 GLN B CB  1 
ATOM   2879 C  CG  . GLN B 1 170 ? -1.558  39.091 24.901  1.00 21.77 ? 170 GLN B CG  1 
ATOM   2880 C  CD  . GLN B 1 170 ? -1.467  40.583 24.775  1.00 23.04 ? 170 GLN B CD  1 
ATOM   2881 O  OE1 . GLN B 1 170 ? -0.371  41.144 24.775  1.00 27.13 ? 170 GLN B OE1 1 
ATOM   2882 N  NE2 . GLN B 1 170 ? -2.636  41.253 24.603  1.00 23.12 ? 170 GLN B NE2 1 
ATOM   2883 N  N   . ARG B 1 171 ? -4.369  37.295 26.822  1.00 21.65 ? 171 ARG B N   1 
ATOM   2884 C  CA  . ARG B 1 171 ? -5.624  36.779 26.256  1.00 22.46 ? 171 ARG B CA  1 
ATOM   2885 C  C   . ARG B 1 171 ? -6.895  37.400 26.860  1.00 23.47 ? 171 ARG B C   1 
ATOM   2886 O  O   . ARG B 1 171 ? -7.850  37.728 26.133  1.00 23.11 ? 171 ARG B O   1 
ATOM   2887 C  CB  . ARG B 1 171 ? -5.633  35.249 26.270  1.00 22.42 ? 171 ARG B CB  1 
ATOM   2888 C  CG  . ARG B 1 171 ? -4.432  34.686 25.463  1.00 23.42 ? 171 ARG B CG  1 
ATOM   2889 C  CD  . ARG B 1 171 ? -4.209  33.204 25.605  1.00 24.55 ? 171 ARG B CD  1 
ATOM   2890 N  NE  . ARG B 1 171 ? -3.679  32.775 26.912  1.00 29.27 ? 171 ARG B NE  1 
ATOM   2891 C  CZ  . ARG B 1 171 ? -4.284  31.908 27.722  1.00 28.91 ? 171 ARG B CZ  1 
ATOM   2892 N  NH1 . ARG B 1 171 ? -5.466  31.402 27.390  1.00 30.07 ? 171 ARG B NH1 1 
ATOM   2893 N  NH2 . ARG B 1 171 ? -3.705  31.537 28.869  1.00 33.61 ? 171 ARG B NH2 1 
ATOM   2894 N  N   . ARG B 1 172 ? -6.878  37.624 28.176  1.00 23.74 ? 172 ARG B N   1 
ATOM   2895 C  CA  . ARG B 1 172 ? -7.942  38.381 28.842  1.00 24.61 ? 172 ARG B CA  1 
ATOM   2896 C  C   . ARG B 1 172 ? -8.113  39.717 28.176  1.00 24.19 ? 172 ARG B C   1 
ATOM   2897 O  O   . ARG B 1 172 ? -9.243  40.106 27.849  1.00 24.94 ? 172 ARG B O   1 
ATOM   2898 C  CB  . ARG B 1 172 ? -7.637  38.545 30.330  1.00 24.63 ? 172 ARG B CB  1 
ATOM   2899 C  CG  . ARG B 1 172 ? -7.664  37.224 31.082  1.00 26.28 ? 172 ARG B CG  1 
ATOM   2900 C  CD  . ARG B 1 172 ? -7.710  37.434 32.587  1.00 30.49 ? 172 ARG B CD  1 
ATOM   2901 N  NE  . ARG B 1 172 ? -7.250  36.234 33.283  1.00 32.37 ? 172 ARG B NE  1 
ATOM   2902 C  CZ  . ARG B 1 172 ? -8.060  35.262 33.681  1.00 32.88 ? 172 ARG B CZ  1 
ATOM   2903 N  NH1 . ARG B 1 172 ? -9.362  35.363 33.455  1.00 31.37 ? 172 ARG B NH1 1 
ATOM   2904 N  NH2 . ARG B 1 172 ? -7.566  34.193 34.299  1.00 32.01 ? 172 ARG B NH2 1 
ATOM   2905 N  N   . ALA B 1 173 ? -6.987  40.360 27.879  1.00 24.83 ? 173 ALA B N   1 
ATOM   2906 C  CA  . ALA B 1 173 ? -6.945  41.671 27.221  1.00 25.31 ? 173 ALA B CA  1 
ATOM   2907 C  C   . ALA B 1 173 ? -7.486  41.686 25.788  1.00 25.75 ? 173 ALA B C   1 
ATOM   2908 O  O   . ALA B 1 173 ? -7.647  42.769 25.192  1.00 26.16 ? 173 ALA B O   1 
ATOM   2909 C  CB  . ALA B 1 173 ? -5.522  42.235 27.264  1.00 26.00 ? 173 ALA B CB  1 
ATOM   2910 N  N   . PHE B 1 174 ? -7.765  40.498 25.227  1.00 26.01 ? 174 PHE B N   1 
ATOM   2911 C  CA  . PHE B 1 174 ? -8.431  40.395 23.920  1.00 25.87 ? 174 PHE B CA  1 
ATOM   2912 C  C   . PHE B 1 174 ? -9.921  40.674 24.018  1.00 27.25 ? 174 PHE B C   1 
ATOM   2913 O  O   . PHE B 1 174 ? -10.580 40.875 22.997  1.00 26.64 ? 174 PHE B O   1 
ATOM   2914 C  CB  . PHE B 1 174 ? -8.251  39.011 23.295  1.00 25.00 ? 174 PHE B CB  1 
ATOM   2915 C  CG  . PHE B 1 174 ? -6.861  38.703 22.855  1.00 23.00 ? 174 PHE B CG  1 
ATOM   2916 C  CD1 . PHE B 1 174 ? -5.936  39.720 22.594  1.00 20.57 ? 174 PHE B CD1 1 
ATOM   2917 C  CD2 . PHE B 1 174 ? -6.477  37.370 22.665  1.00 22.60 ? 174 PHE B CD2 1 
ATOM   2918 C  CE1 . PHE B 1 174 ? -4.675  39.422 22.190  1.00 22.86 ? 174 PHE B CE1 1 
ATOM   2919 C  CE2 . PHE B 1 174 ? -5.207  37.058 22.264  1.00 24.56 ? 174 PHE B CE2 1 
ATOM   2920 C  CZ  . PHE B 1 174 ? -4.293  38.071 22.021  1.00 22.86 ? 174 PHE B CZ  1 
ATOM   2921 N  N   . PHE B 1 175 ? -10.453 40.686 25.245  1.00 28.50 ? 175 PHE B N   1 
ATOM   2922 C  CA  . PHE B 1 175 ? -11.893 40.790 25.467  1.00 29.65 ? 175 PHE B CA  1 
ATOM   2923 C  C   . PHE B 1 175 ? -12.311 41.993 26.312  1.00 31.03 ? 175 PHE B C   1 
ATOM   2924 O  O   . PHE B 1 175 ? -11.571 42.418 27.207  1.00 30.34 ? 175 PHE B O   1 
ATOM   2925 C  CB  . PHE B 1 175 ? -12.411 39.504 26.111  1.00 29.97 ? 175 PHE B CB  1 
ATOM   2926 C  CG  . PHE B 1 175 ? -12.080 38.266 25.339  1.00 29.41 ? 175 PHE B CG  1 
ATOM   2927 C  CD1 . PHE B 1 175 ? -12.825 37.905 24.217  1.00 30.19 ? 175 PHE B CD1 1 
ATOM   2928 C  CD2 . PHE B 1 175 ? -11.024 37.454 25.733  1.00 28.59 ? 175 PHE B CD2 1 
ATOM   2929 C  CE1 . PHE B 1 175 ? -12.512 36.767 23.504  1.00 30.01 ? 175 PHE B CE1 1 
ATOM   2930 C  CE2 . PHE B 1 175 ? -10.709 36.310 25.025  1.00 28.04 ? 175 PHE B CE2 1 
ATOM   2931 C  CZ  . PHE B 1 175 ? -11.451 35.964 23.914  1.00 30.57 ? 175 PHE B CZ  1 
ATOM   2932 N  N   . GLN B 1 176 ? -13.497 42.532 26.010  1.00 31.60 ? 176 GLN B N   1 
ATOM   2933 C  CA  . GLN B 1 176 ? -14.059 43.679 26.727  1.00 33.71 ? 176 GLN B CA  1 
ATOM   2934 C  C   . GLN B 1 176 ? -14.235 43.412 28.216  1.00 34.43 ? 176 GLN B C   1 
ATOM   2935 O  O   . GLN B 1 176 ? -14.505 42.288 28.619  1.00 35.05 ? 176 GLN B O   1 
ATOM   2936 C  CB  . GLN B 1 176 ? -15.390 44.101 26.120  1.00 33.47 ? 176 GLN B CB  1 
ATOM   2937 C  CG  . GLN B 1 176 ? -15.237 44.814 24.818  1.00 35.72 ? 176 GLN B CG  1 
ATOM   2938 C  CD  . GLN B 1 176 ? -16.549 44.973 24.101  1.00 39.39 ? 176 GLN B CD  1 
ATOM   2939 O  OE1 . GLN B 1 176 ? -17.531 45.470 24.665  1.00 39.39 ? 176 GLN B OE1 1 
ATOM   2940 N  NE2 . GLN B 1 176 ? -16.578 44.556 22.842  1.00 41.92 ? 176 GLN B NE2 1 
ATOM   2941 N  N   . ASN B 1 177 ? -14.064 44.469 29.011  1.00 35.55 ? 177 ASN B N   1 
ATOM   2942 C  CA  . ASN B 1 177 ? -13.988 44.395 30.469  1.00 36.43 ? 177 ASN B CA  1 
ATOM   2943 C  C   . ASN B 1 177 ? -12.929 43.402 30.977  1.00 36.77 ? 177 ASN B C   1 
ATOM   2944 O  O   . ASN B 1 177 ? -12.992 42.912 32.121  1.00 37.10 ? 177 ASN B O   1 
ATOM   2945 C  CB  . ASN B 1 177 ? -15.372 44.139 31.079  1.00 36.26 ? 177 ASN B CB  1 
ATOM   2946 C  CG  . ASN B 1 177 ? -16.254 45.354 31.015  1.00 36.40 ? 177 ASN B CG  1 
ATOM   2947 O  OD1 . ASN B 1 177 ? -15.832 46.388 30.529  1.00 36.02 ? 177 ASN B OD1 1 
ATOM   2948 N  ND2 . ASN B 1 177 ? -17.486 45.244 31.518  1.00 36.20 ? 177 ASN B ND2 1 
ATOM   2949 N  N   . ASN B 1 178 ? -11.946 43.122 30.116  1.00 37.28 ? 178 ASN B N   1 
ATOM   2950 C  CA  . ASN B 1 178 ? -10.948 42.090 30.377  1.00 36.91 ? 178 ASN B CA  1 
ATOM   2951 C  C   . ASN B 1 178 ? -11.600 40.773 30.744  1.00 36.59 ? 178 ASN B C   1 
ATOM   2952 O  O   . ASN B 1 178 ? -11.031 39.961 31.467  1.00 37.28 ? 178 ASN B O   1 
ATOM   2953 C  CB  . ASN B 1 178 ? -9.969  42.545 31.476  1.00 36.66 ? 178 ASN B CB  1 
ATOM   2954 C  CG  . ASN B 1 178 ? -8.828  43.349 30.923  1.00 36.37 ? 178 ASN B CG  1 
ATOM   2955 O  OD1 . ASN B 1 178 ? -7.857  42.789 30.455  1.00 37.71 ? 178 ASN B OD1 1 
ATOM   2956 N  ND2 . ASN B 1 178 ? -8.946  44.663 30.959  1.00 35.34 ? 178 ASN B ND2 1 
ATOM   2957 N  N   . ASP B 1 179 ? -12.802 40.557 30.234  1.00 36.89 ? 179 ASP B N   1 
ATOM   2958 C  CA  . ASP B 1 179 ? -13.608 39.432 30.681  1.00 36.12 ? 179 ASP B CA  1 
ATOM   2959 C  C   . ASP B 1 179 ? -13.678 38.371 29.589  1.00 35.63 ? 179 ASP B C   1 
ATOM   2960 O  O   . ASP B 1 179 ? -14.145 38.632 28.473  1.00 34.68 ? 179 ASP B O   1 
ATOM   2961 C  CB  . ASP B 1 179 ? -14.976 39.911 31.151  1.00 35.73 ? 179 ASP B CB  1 
ATOM   2962 C  CG  . ASP B 1 179 ? -15.989 38.801 31.232  1.00 36.30 ? 179 ASP B CG  1 
ATOM   2963 O  OD1 . ASP B 1 179 ? -15.705 37.729 31.838  1.00 34.96 ? 179 ASP B OD1 1 
ATOM   2964 O  OD2 . ASP B 1 179 ? -17.088 39.022 30.699  1.00 37.23 ? 179 ASP B OD2 1 
ATOM   2965 N  N   . TRP B 1 180 ? -13.187 37.185 29.954  1.00 35.41 ? 180 TRP B N   1 
ATOM   2966 C  CA  . TRP B 1 180 ? -12.880 36.098 29.022  1.00 35.28 ? 180 TRP B CA  1 
ATOM   2967 C  C   . TRP B 1 180 ? -13.796 34.899 29.262  1.00 35.28 ? 180 TRP B C   1 
ATOM   2968 O  O   . TRP B 1 180 ? -13.652 33.817 28.666  1.00 35.25 ? 180 TRP B O   1 
ATOM   2969 C  CB  . TRP B 1 180 ? -11.370 35.762 29.109  1.00 34.79 ? 180 TRP B CB  1 
ATOM   2970 C  CG  . TRP B 1 180 ? -10.943 34.702 30.082  1.00 34.32 ? 180 TRP B CG  1 
ATOM   2971 C  CD1 . TRP B 1 180 ? -11.668 34.176 31.114  1.00 34.29 ? 180 TRP B CD1 1 
ATOM   2972 C  CD2 . TRP B 1 180 ? -9.658  34.064 30.129  1.00 33.64 ? 180 TRP B CD2 1 
ATOM   2973 N  NE1 . TRP B 1 180 ? -10.929 33.223 31.779  1.00 32.95 ? 180 TRP B NE1 1 
ATOM   2974 C  CE2 . TRP B 1 180 ? -9.693  33.130 31.194  1.00 34.04 ? 180 TRP B CE2 1 
ATOM   2975 C  CE3 . TRP B 1 180 ? -8.492  34.170 29.359  1.00 33.21 ? 180 TRP B CE3 1 
ATOM   2976 C  CZ2 . TRP B 1 180 ? -8.595  32.312 31.518  1.00 34.24 ? 180 TRP B CZ2 1 
ATOM   2977 C  CZ3 . TRP B 1 180 ? -7.399  33.357 29.677  1.00 35.09 ? 180 TRP B CZ3 1 
ATOM   2978 C  CH2 . TRP B 1 180 ? -7.460  32.438 30.747  1.00 34.67 ? 180 TRP B CH2 1 
ATOM   2979 N  N   . SER B 1 181 ? -14.757 35.104 30.152  1.00 35.47 ? 181 SER B N   1 
ATOM   2980 C  CA  . SER B 1 181 ? -15.871 34.189 30.285  1.00 35.58 ? 181 SER B CA  1 
ATOM   2981 C  C   . SER B 1 181 ? -16.490 33.975 28.887  1.00 35.26 ? 181 SER B C   1 
ATOM   2982 O  O   . SER B 1 181 ? -16.546 34.904 28.079  1.00 35.06 ? 181 SER B O   1 
ATOM   2983 C  CB  . SER B 1 181 ? -16.885 34.735 31.297  1.00 35.84 ? 181 SER B CB  1 
ATOM   2984 O  OG  . SER B 1 181 ? -17.636 35.791 30.734  1.00 36.94 ? 181 SER B OG  1 
ATOM   2985 N  N   . LYS B 1 182 ? -16.909 32.742 28.598  1.00 35.44 ? 182 LYS B N   1 
ATOM   2986 C  CA  . LYS B 1 182 ? -17.312 32.343 27.233  1.00 35.48 ? 182 LYS B CA  1 
ATOM   2987 C  C   . LYS B 1 182 ? -18.458 33.180 26.649  1.00 35.66 ? 182 LYS B C   1 
ATOM   2988 O  O   . LYS B 1 182 ? -18.453 33.506 25.455  1.00 34.91 ? 182 LYS B O   1 
ATOM   2989 C  CB  . LYS B 1 182 ? -17.664 30.851 27.189  1.00 35.34 ? 182 LYS B CB  1 
ATOM   2990 C  CG  . LYS B 1 182 ? -17.937 30.333 25.783  1.00 35.48 ? 182 LYS B CG  1 
ATOM   2991 C  CD  . LYS B 1 182 ? -18.724 29.057 25.804  1.00 37.91 ? 182 LYS B CD  1 
ATOM   2992 C  CE  . LYS B 1 182 ? -18.759 28.411 24.418  1.00 41.32 ? 182 LYS B CE  1 
ATOM   2993 N  NZ  . LYS B 1 182 ? -19.857 27.410 24.340  1.00 41.72 ? 182 LYS B NZ  1 
ATOM   2994 N  N   . ALA B 1 183 ? -19.430 33.524 27.503  1.00 35.86 ? 183 ALA B N   1 
ATOM   2995 C  CA  . ALA B 1 183 ? -20.559 34.358 27.108  1.00 35.93 ? 183 ALA B CA  1 
ATOM   2996 C  C   . ALA B 1 183 ? -20.120 35.649 26.386  1.00 36.01 ? 183 ALA B C   1 
ATOM   2997 O  O   . ALA B 1 183 ? -20.820 36.142 25.489  1.00 36.03 ? 183 ALA B O   1 
ATOM   2998 C  CB  . ALA B 1 183 ? -21.442 34.675 28.328  1.00 35.66 ? 183 ALA B CB  1 
ATOM   2999 N  N   . ASN B 1 184 ? -18.921 36.126 26.735  1.00 35.59 ? 184 ASN B N   1 
ATOM   3000 C  CA  . ASN B 1 184 ? -18.398 37.434 26.341  1.00 35.00 ? 184 ASN B CA  1 
ATOM   3001 C  C   . ASN B 1 184 ? -17.373 37.417 25.184  1.00 34.89 ? 184 ASN B C   1 
ATOM   3002 O  O   . ASN B 1 184 ? -16.929 38.473 24.739  1.00 34.89 ? 184 ASN B O   1 
ATOM   3003 C  CB  . ASN B 1 184 ? -17.771 38.056 27.587  1.00 35.11 ? 184 ASN B CB  1 
ATOM   3004 C  CG  . ASN B 1 184 ? -17.457 39.511 27.433  1.00 34.14 ? 184 ASN B CG  1 
ATOM   3005 O  OD1 . ASN B 1 184 ? -18.194 40.254 26.803  1.00 35.71 ? 184 ASN B OD1 1 
ATOM   3006 N  ND2 . ASN B 1 184 ? -16.356 39.937 28.037  1.00 34.56 ? 184 ASN B ND2 1 
ATOM   3007 N  N   . ARG B 1 185 ? -17.052 36.228 24.670  1.00 34.22 ? 185 ARG B N   1 
ATOM   3008 C  CA  . ARG B 1 185 ? -15.912 36.039 23.767  1.00 34.17 ? 185 ARG B CA  1 
ATOM   3009 C  C   . ARG B 1 185 ? -16.069 36.563 22.342  1.00 33.27 ? 185 ARG B C   1 
ATOM   3010 O  O   . ARG B 1 185 ? -15.105 36.556 21.577  1.00 33.70 ? 185 ARG B O   1 
ATOM   3011 C  CB  . ARG B 1 185 ? -15.429 34.583 23.764  1.00 33.95 ? 185 ARG B CB  1 
ATOM   3012 C  CG  . ARG B 1 185 ? -14.597 34.214 24.988  1.00 35.39 ? 185 ARG B CG  1 
ATOM   3013 C  CD  . ARG B 1 185 ? -14.129 32.759 24.921  1.00 35.98 ? 185 ARG B CD  1 
ATOM   3014 N  NE  . ARG B 1 185 ? -14.031 32.171 26.256  1.00 38.22 ? 185 ARG B NE  1 
ATOM   3015 C  CZ  . ARG B 1 185 ? -14.050 30.870 26.511  1.00 37.42 ? 185 ARG B CZ  1 
ATOM   3016 N  NH1 . ARG B 1 185 ? -14.162 29.987 25.519  1.00 37.59 ? 185 ARG B NH1 1 
ATOM   3017 N  NH2 . ARG B 1 185 ? -13.953 30.452 27.762  1.00 39.56 ? 185 ARG B NH2 1 
ATOM   3018 N  N   . GLY B 1 186 ? -17.272 37.019 21.997  1.00 32.46 ? 186 GLY B N   1 
ATOM   3019 C  CA  . GLY B 1 186 ? -17.533 37.669 20.718  1.00 31.05 ? 186 GLY B CA  1 
ATOM   3020 C  C   . GLY B 1 186 ? -17.315 39.171 20.829  1.00 30.55 ? 186 GLY B C   1 
ATOM   3021 O  O   . GLY B 1 186 ? -17.232 39.872 19.824  1.00 29.87 ? 186 GLY B O   1 
ATOM   3022 N  N   . ASN B 1 187 ? -17.235 39.661 22.064  1.00 29.20 ? 187 ASN B N   1 
ATOM   3023 C  CA  . ASN B 1 187 ? -16.929 41.062 22.334  1.00 28.73 ? 187 ASN B CA  1 
ATOM   3024 C  C   . ASN B 1 187 ? -15.427 41.267 22.487  1.00 27.98 ? 187 ASN B C   1 
ATOM   3025 O  O   . ASN B 1 187 ? -14.874 41.141 23.592  1.00 28.29 ? 187 ASN B O   1 
ATOM   3026 C  CB  . ASN B 1 187 ? -17.670 41.519 23.596  1.00 28.39 ? 187 ASN B CB  1 
ATOM   3027 C  CG  . ASN B 1 187 ? -19.182 41.439 23.426  1.00 29.74 ? 187 ASN B CG  1 
ATOM   3028 O  OD1 . ASN B 1 187 ? -19.699 41.691 22.346  1.00 27.25 ? 187 ASN B OD1 1 
ATOM   3029 N  ND2 . ASN B 1 187 ? -19.884 41.053 24.485  1.00 30.57 ? 187 ASN B ND2 1 
ATOM   3030 N  N   . VAL B 1 188 ? -14.762 41.586 21.382  1.00 27.36 ? 188 VAL B N   1 
ATOM   3031 C  CA  . VAL B 1 188 ? -13.287 41.670 21.387  1.00 26.88 ? 188 VAL B CA  1 
ATOM   3032 C  C   . VAL B 1 188 ? -12.784 43.120 21.462  1.00 26.01 ? 188 VAL B C   1 
ATOM   3033 O  O   . VAL B 1 188 ? -13.505 44.061 21.093  1.00 25.20 ? 188 VAL B O   1 
ATOM   3034 C  CB  . VAL B 1 188 ? -12.642 40.904 20.190  1.00 27.01 ? 188 VAL B CB  1 
ATOM   3035 C  CG1 . VAL B 1 188 ? -12.907 39.370 20.280  1.00 27.33 ? 188 VAL B CG1 1 
ATOM   3036 C  CG2 . VAL B 1 188 ? -13.121 41.461 18.833  1.00 27.13 ? 188 VAL B CG2 1 
ATOM   3037 N  N   . THR B 1 189 ? -11.541 43.280 21.925  1.00 25.83 ? 189 THR B N   1 
ATOM   3038 C  CA  . THR B 1 189 ? -10.911 44.594 22.039  1.00 25.25 ? 189 THR B CA  1 
ATOM   3039 C  C   . THR B 1 189 ? -10.186 45.037 20.772  1.00 25.76 ? 189 THR B C   1 
ATOM   3040 O  O   . THR B 1 189 ? -10.119 44.323 19.746  1.00 25.37 ? 189 THR B O   1 
ATOM   3041 C  CB  . THR B 1 189 ? -9.904  44.672 23.183  1.00 24.95 ? 189 THR B CB  1 
ATOM   3042 O  OG1 . THR B 1 189 ? -8.835  43.729 22.969  1.00 21.90 ? 189 THR B OG1 1 
ATOM   3043 C  CG2 . THR B 1 189 ? -10.604 44.426 24.528  1.00 26.22 ? 189 THR B CG2 1 
ATOM   3044 N  N   . GLN B 1 190 ? -9.629  46.231 20.875  1.00 25.09 ? 190 GLN B N   1 
ATOM   3045 C  CA  . GLN B 1 190 ? -8.769  46.760 19.844  1.00 25.01 ? 190 GLN B CA  1 
ATOM   3046 C  C   . GLN B 1 190 ? -7.410  46.051 19.886  1.00 24.73 ? 190 GLN B C   1 
ATOM   3047 O  O   . GLN B 1 190 ? -6.897  45.675 18.854  1.00 24.60 ? 190 GLN B O   1 
ATOM   3048 C  CB  . GLN B 1 190 ? -8.639  48.281 19.994  1.00 24.93 ? 190 GLN B CB  1 
ATOM   3049 C  CG  . GLN B 1 190 ? -7.805  48.916 18.889  1.00 25.50 ? 190 GLN B CG  1 
ATOM   3050 C  CD  . GLN B 1 190 ? -8.453  48.703 17.551  1.00 27.77 ? 190 GLN B CD  1 
ATOM   3051 O  OE1 . GLN B 1 190 ? -9.603  49.108 17.346  1.00 25.49 ? 190 GLN B OE1 1 
ATOM   3052 N  NE2 . GLN B 1 190 ? -7.733  48.053 16.632  1.00 24.39 ? 190 GLN B NE2 1 
ATOM   3053 N  N   . GLU B 1 191 ? -6.837  45.859 21.073  1.00 24.67 ? 191 GLU B N   1 
ATOM   3054 C  CA  . GLU B 1 191 ? -5.607  45.067 21.190  1.00 24.56 ? 191 GLU B CA  1 
ATOM   3055 C  C   . GLU B 1 191 ? -5.729  43.698 20.499  1.00 23.74 ? 191 GLU B C   1 
ATOM   3056 O  O   . GLU B 1 191 ? -4.811  43.300 19.787  1.00 23.12 ? 191 GLU B O   1 
ATOM   3057 C  CB  . GLU B 1 191 ? -5.175  44.895 22.638  1.00 24.22 ? 191 GLU B CB  1 
ATOM   3058 C  CG  . GLU B 1 191 ? -3.765  44.413 22.725  1.00 26.77 ? 191 GLU B CG  1 
ATOM   3059 C  CD  . GLU B 1 191 ? -3.116  44.815 24.005  1.00 30.36 ? 191 GLU B CD  1 
ATOM   3060 O  OE1 . GLU B 1 191 ? -2.775  46.012 24.142  1.00 34.79 ? 191 GLU B OE1 1 
ATOM   3061 O  OE2 . GLU B 1 191 ? -2.939  43.943 24.875  1.00 28.86 ? 191 GLU B OE2 1 
ATOM   3062 N  N   . PHE B 1 192 ? -6.875  43.022 20.670  1.00 23.25 ? 192 PHE B N   1 
ATOM   3063 C  CA  . PHE B 1 192 ? -7.205  41.800 19.908  1.00 22.71 ? 192 PHE B CA  1 
ATOM   3064 C  C   . PHE B 1 192 ? -7.071  42.013 18.413  1.00 22.47 ? 192 PHE B C   1 
ATOM   3065 O  O   . PHE B 1 192 ? -6.400  41.246 17.734  1.00 22.09 ? 192 PHE B O   1 
ATOM   3066 C  CB  . PHE B 1 192 ? -8.621  41.265 20.237  1.00 23.06 ? 192 PHE B CB  1 
ATOM   3067 C  CG  . PHE B 1 192 ? -9.050  40.087 19.384  1.00 21.55 ? 192 PHE B CG  1 
ATOM   3068 C  CD1 . PHE B 1 192 ? -8.747  38.773 19.755  1.00 23.18 ? 192 PHE B CD1 1 
ATOM   3069 C  CD2 . PHE B 1 192 ? -9.757  40.292 18.199  1.00 23.74 ? 192 PHE B CD2 1 
ATOM   3070 C  CE1 . PHE B 1 192 ? -9.169  37.695 18.975  1.00 22.61 ? 192 PHE B CE1 1 
ATOM   3071 C  CE2 . PHE B 1 192 ? -10.166 39.218 17.405  1.00 22.04 ? 192 PHE B CE2 1 
ATOM   3072 C  CZ  . PHE B 1 192 ? -9.869  37.927 17.787  1.00 22.94 ? 192 PHE B CZ  1 
ATOM   3073 N  N   . LEU B 1 193 ? -7.721  43.062 17.895  1.00 22.87 ? 193 LEU B N   1 
ATOM   3074 C  CA  . LEU B 1 193 ? -7.686  43.342 16.473  1.00 22.33 ? 193 LEU B CA  1 
ATOM   3075 C  C   . LEU B 1 193 ? -6.244  43.592 16.017  1.00 23.04 ? 193 LEU B C   1 
ATOM   3076 O  O   . LEU B 1 193 ? -5.804  43.015 15.013  1.00 22.94 ? 193 LEU B O   1 
ATOM   3077 C  CB  . LEU B 1 193 ? -8.641  44.498 16.098  1.00 22.62 ? 193 LEU B CB  1 
ATOM   3078 C  CG  . LEU B 1 193 ? -10.169 44.265 16.273  1.00 21.09 ? 193 LEU B CG  1 
ATOM   3079 C  CD1 . LEU B 1 193 ? -10.930 45.515 15.832  1.00 18.99 ? 193 LEU B CD1 1 
ATOM   3080 C  CD2 . LEU B 1 193 ? -10.696 43.038 15.487  1.00 17.29 ? 193 LEU B CD2 1 
ATOM   3081 N  N   . ASP B 1 194 ? -5.501  44.397 16.788  1.00 22.82 ? 194 ASP B N   1 
ATOM   3082 C  CA  . ASP B 1 194 ? -4.090  44.708 16.496  1.00 24.01 ? 194 ASP B CA  1 
ATOM   3083 C  C   . ASP B 1 194 ? -3.237  43.469 16.417  1.00 23.58 ? 194 ASP B C   1 
ATOM   3084 O  O   . ASP B 1 194 ? -2.385  43.304 15.526  1.00 23.91 ? 194 ASP B O   1 
ATOM   3085 C  CB  . ASP B 1 194 ? -3.514  45.650 17.563  1.00 24.08 ? 194 ASP B CB  1 
ATOM   3086 C  CG  . ASP B 1 194 ? -4.112  47.040 17.489  1.00 26.68 ? 194 ASP B CG  1 
ATOM   3087 O  OD1 . ASP B 1 194 ? -4.804  47.313 16.478  1.00 26.38 ? 194 ASP B OD1 1 
ATOM   3088 O  OD2 . ASP B 1 194 ? -3.906  47.841 18.433  1.00 22.14 ? 194 ASP B OD2 1 
ATOM   3089 N  N   . TYR B 1 195 ? -3.484  42.589 17.363  1.00 23.57 ? 195 TYR B N   1 
ATOM   3090 C  CA  . TYR B 1 195 ? -2.689  41.408 17.509  1.00 24.16 ? 195 TYR B CA  1 
ATOM   3091 C  C   . TYR B 1 195 ? -2.874  40.552 16.261  1.00 24.18 ? 195 TYR B C   1 
ATOM   3092 O  O   . TYR B 1 195 ? -1.900  40.233 15.603  1.00 25.12 ? 195 TYR B O   1 
ATOM   3093 C  CB  . TYR B 1 195 ? -3.088  40.697 18.796  1.00 23.53 ? 195 TYR B CB  1 
ATOM   3094 C  CG  . TYR B 1 195 ? -2.090  39.678 19.282  1.00 22.35 ? 195 TYR B CG  1 
ATOM   3095 C  CD1 . TYR B 1 195 ? -1.900  38.487 18.582  1.00 18.67 ? 195 TYR B CD1 1 
ATOM   3096 C  CD2 . TYR B 1 195 ? -1.378  39.879 20.461  1.00 22.29 ? 195 TYR B CD2 1 
ATOM   3097 C  CE1 . TYR B 1 195 ? -1.005  37.520 19.028  1.00 20.64 ? 195 TYR B CE1 1 
ATOM   3098 C  CE2 . TYR B 1 195 ? -0.470  38.912 20.921  1.00 24.59 ? 195 TYR B CE2 1 
ATOM   3099 C  CZ  . TYR B 1 195 ? -0.284  37.744 20.190  1.00 20.99 ? 195 TYR B CZ  1 
ATOM   3100 O  OH  . TYR B 1 195 ? 0.605   36.781 20.625  1.00 17.48 ? 195 TYR B OH  1 
ATOM   3101 N  N   . ALA B 1 196 ? -4.120  40.265 15.885  1.00 25.18 ? 196 ALA B N   1 
ATOM   3102 C  CA  . ALA B 1 196 ? -4.376  39.513 14.648  1.00 25.76 ? 196 ALA B CA  1 
ATOM   3103 C  C   . ALA B 1 196 ? -3.868  40.232 13.403  1.00 26.20 ? 196 ALA B C   1 
ATOM   3104 O  O   . ALA B 1 196 ? -3.382  39.588 12.452  1.00 26.71 ? 196 ALA B O   1 
ATOM   3105 C  CB  . ALA B 1 196 ? -5.868  39.155 14.518  1.00 26.48 ? 196 ALA B CB  1 
ATOM   3106 N  N   . GLU B 1 197 ? -3.967  41.561 13.397  1.00 25.85 ? 197 GLU B N   1 
ATOM   3107 C  CA  . GLU B 1 197 ? -3.493  42.334 12.234  1.00 25.76 ? 197 GLU B CA  1 
ATOM   3108 C  C   . GLU B 1 197 ? -1.988  42.221 12.046  1.00 25.02 ? 197 GLU B C   1 
ATOM   3109 O  O   . GLU B 1 197 ? -1.516  42.188 10.917  1.00 25.79 ? 197 GLU B O   1 
ATOM   3110 C  CB  . GLU B 1 197 ? -3.924  43.801 12.330  1.00 25.99 ? 197 GLU B CB  1 
ATOM   3111 C  CG  . GLU B 1 197 ? -3.361  44.745 11.247  1.00 28.14 ? 197 GLU B CG  1 
ATOM   3112 C  CD  . GLU B 1 197 ? -3.749  44.374 9.813   1.00 29.53 ? 197 GLU B CD  1 
ATOM   3113 O  OE1 . GLU B 1 197 ? -4.753  43.660 9.596   1.00 27.55 ? 197 GLU B OE1 1 
ATOM   3114 O  OE2 . GLU B 1 197 ? -3.030  44.806 8.895   1.00 31.37 ? 197 GLU B OE2 1 
ATOM   3115 N  N   . ALA B 1 198 ? -1.244  42.172 13.155  1.00 24.54 ? 198 ALA B N   1 
ATOM   3116 C  CA  . ALA B 1 198 ? 0.203   41.964 13.150  1.00 23.41 ? 198 ALA B CA  1 
ATOM   3117 C  C   . ALA B 1 198 ? 0.599   40.651 12.515  1.00 23.38 ? 198 ALA B C   1 
ATOM   3118 O  O   . ALA B 1 198 ? 1.589   40.594 11.783  1.00 23.95 ? 198 ALA B O   1 
ATOM   3119 C  CB  . ALA B 1 198 ? 0.771   42.052 14.557  1.00 22.33 ? 198 ALA B CB  1 
ATOM   3120 N  N   . ILE B 1 199 ? -0.168  39.596 12.803  1.00 23.50 ? 199 ILE B N   1 
ATOM   3121 C  CA  . ILE B 1 199 ? 0.153   38.283 12.277  1.00 22.85 ? 199 ILE B CA  1 
ATOM   3122 C  C   . ILE B 1 199 ? -0.013  38.261 10.743  1.00 22.00 ? 199 ILE B C   1 
ATOM   3123 O  O   . ILE B 1 199 ? 0.802   37.659 10.064  1.00 22.35 ? 199 ILE B O   1 
ATOM   3124 C  CB  . ILE B 1 199 ? -0.637  37.105 12.961  1.00 22.41 ? 199 ILE B CB  1 
ATOM   3125 C  CG1 . ILE B 1 199 ? -0.374  37.044 14.468  1.00 23.64 ? 199 ILE B CG1 1 
ATOM   3126 C  CG2 . ILE B 1 199 ? -0.236  35.760 12.355  1.00 20.09 ? 199 ILE B CG2 1 
ATOM   3127 C  CD1 . ILE B 1 199 ? 1.093   36.889 14.801  1.00 23.50 ? 199 ILE B CD1 1 
ATOM   3128 N  N   . LYS B 1 200 ? -1.068  38.884 10.218  1.00 22.82 ? 200 LYS B N   1 
ATOM   3129 C  CA  . LYS B 1 200 ? -1.273  39.007 8.752   1.00 22.64 ? 200 LYS B CA  1 
ATOM   3130 C  C   . LYS B 1 200 ? -0.155  39.814 8.091   1.00 22.84 ? 200 LYS B C   1 
ATOM   3131 O  O   . LYS B 1 200 ? 0.312   39.469 7.023   1.00 22.75 ? 200 LYS B O   1 
ATOM   3132 C  CB  . LYS B 1 200 ? -2.634  39.632 8.431   1.00 23.33 ? 200 LYS B CB  1 
ATOM   3133 C  CG  . LYS B 1 200 ? -2.804  40.088 6.958   1.00 24.84 ? 200 LYS B CG  1 
ATOM   3134 C  CD  . LYS B 1 200 ? -4.000  41.006 6.836   1.00 26.37 ? 200 LYS B CD  1 
ATOM   3135 C  CE  . LYS B 1 200 ? -3.661  42.379 7.271   1.00 28.19 ? 200 LYS B CE  1 
ATOM   3136 N  NZ  . LYS B 1 200 ? -3.176  43.270 6.162   1.00 29.12 ? 200 LYS B NZ  1 
ATOM   3137 N  N   . GLU B 1 201 ? 0.293   40.883 8.732   1.00 23.56 ? 201 GLU B N   1 
ATOM   3138 C  CA  . GLU B 1 201 ? 1.397   41.649 8.177   1.00 24.16 ? 201 GLU B CA  1 
ATOM   3139 C  C   . GLU B 1 201 ? 2.686   40.816 8.141   1.00 24.57 ? 201 GLU B C   1 
ATOM   3140 O  O   . GLU B 1 201 ? 3.410   40.843 7.131   1.00 24.06 ? 201 GLU B O   1 
ATOM   3141 C  CB  . GLU B 1 201 ? 1.610   42.948 8.921   1.00 25.06 ? 201 GLU B CB  1 
ATOM   3142 C  CG  . GLU B 1 201 ? 0.450   43.911 8.870   1.00 26.32 ? 201 GLU B CG  1 
ATOM   3143 C  CD  . GLU B 1 201 ? 0.704   45.094 9.771   1.00 26.71 ? 201 GLU B CD  1 
ATOM   3144 O  OE1 . GLU B 1 201 ? 1.843   45.196 10.265  1.00 27.97 ? 201 GLU B OE1 1 
ATOM   3145 O  OE2 . GLU B 1 201 ? -0.206  45.916 9.994   1.00 27.27 ? 201 GLU B OE2 1 
ATOM   3146 N  N   . ALA B 1 202 ? 2.932   40.033 9.196   1.00 24.20 ? 202 ALA B N   1 
ATOM   3147 C  CA  . ALA B 1 202 ? 4.094   39.141 9.241   1.00 24.06 ? 202 ALA B CA  1 
ATOM   3148 C  C   . ALA B 1 202 ? 4.072   38.141 8.087   1.00 24.44 ? 202 ALA B C   1 
ATOM   3149 O  O   . ALA B 1 202 ? 4.986   38.117 7.248   1.00 24.89 ? 202 ALA B O   1 
ATOM   3150 C  CB  . ALA B 1 202 ? 4.174   38.405 10.597  1.00 23.78 ? 202 ALA B CB  1 
ATOM   3151 N  N   . GLU B 1 203 ? 3.020   37.332 8.048   1.00 24.71 ? 203 GLU B N   1 
ATOM   3152 C  CA  . GLU B 1 203 ? 2.761   36.462 6.900   1.00 26.26 ? 203 GLU B CA  1 
ATOM   3153 C  C   . GLU B 1 203 ? 2.959   37.171 5.545   1.00 25.99 ? 203 GLU B C   1 
ATOM   3154 O  O   . GLU B 1 203 ? 3.684   36.659 4.692   1.00 26.19 ? 203 GLU B O   1 
ATOM   3155 C  CB  . GLU B 1 203 ? 1.348   35.869 6.956   1.00 26.40 ? 203 GLU B CB  1 
ATOM   3156 C  CG  . GLU B 1 203 ? 1.228   34.648 6.047   1.00 27.84 ? 203 GLU B CG  1 
ATOM   3157 C  CD  . GLU B 1 203 ? -0.187  34.289 5.574   1.00 31.31 ? 203 GLU B CD  1 
ATOM   3158 O  OE1 . GLU B 1 203 ? -1.166  34.420 6.337   1.00 31.23 ? 203 GLU B OE1 1 
ATOM   3159 O  OE2 . GLU B 1 203 ? -0.302  33.814 4.413   1.00 35.79 ? 203 GLU B OE2 1 
ATOM   3160 N  N   . ALA B 1 204 ? 2.309   38.316 5.341   1.00 26.86 ? 204 ALA B N   1 
ATOM   3161 C  CA  . ALA B 1 204 ? 2.419   39.033 4.057   1.00 26.94 ? 204 ALA B CA  1 
ATOM   3162 C  C   . ALA B 1 204 ? 3.869   39.403 3.757   1.00 28.20 ? 204 ALA B C   1 
ATOM   3163 O  O   . ALA B 1 204 ? 4.400   39.016 2.700   1.00 29.08 ? 204 ALA B O   1 
ATOM   3164 C  CB  . ALA B 1 204 ? 1.516   40.241 4.019   1.00 27.94 ? 204 ALA B CB  1 
ATOM   3165 N  N   . GLU B 1 205 ? 4.530   40.095 4.690   1.00 28.37 ? 205 GLU B N   1 
ATOM   3166 C  CA  . GLU B 1 205 ? 5.974   40.346 4.564   1.00 29.53 ? 205 GLU B CA  1 
ATOM   3167 C  C   . GLU B 1 205 ? 6.795   39.084 4.289   1.00 29.98 ? 205 GLU B C   1 
ATOM   3168 O  O   . GLU B 1 205 ? 7.751   39.132 3.506   1.00 31.15 ? 205 GLU B O   1 
ATOM   3169 C  CB  . GLU B 1 205 ? 6.573   41.096 5.757   1.00 28.41 ? 205 GLU B CB  1 
ATOM   3170 C  CG  . GLU B 1 205 ? 7.922   41.732 5.393   1.00 30.81 ? 205 GLU B CG  1 
ATOM   3171 C  CD  . GLU B 1 205 ? 8.767   42.202 6.566   1.00 31.84 ? 205 GLU B CD  1 
ATOM   3172 O  OE1 . GLU B 1 205 ? 8.222   42.594 7.630   1.00 31.50 ? 205 GLU B OE1 1 
ATOM   3173 O  OE2 . GLU B 1 205 ? 10.007  42.202 6.400   1.00 34.45 ? 205 GLU B OE2 1 
ATOM   3174 N  N   . TYR B 1 206 ? 6.418   37.965 4.902   1.00 30.82 ? 206 TYR B N   1 
ATOM   3175 C  CA  . TYR B 1 206 ? 7.154   36.690 4.776   1.00 31.51 ? 206 TYR B CA  1 
ATOM   3176 C  C   . TYR B 1 206 ? 7.265   36.115 3.362   1.00 33.19 ? 206 TYR B C   1 
ATOM   3177 O  O   . TYR B 1 206 ? 8.365   35.835 2.875   1.00 32.64 ? 206 TYR B O   1 
ATOM   3178 C  CB  . TYR B 1 206 ? 6.545   35.627 5.699   1.00 31.23 ? 206 TYR B CB  1 
ATOM   3179 C  CG  . TYR B 1 206 ? 7.240   34.284 5.656   1.00 29.63 ? 206 TYR B CG  1 
ATOM   3180 C  CD1 . TYR B 1 206 ? 8.609   34.168 5.916   1.00 29.67 ? 206 TYR B CD1 1 
ATOM   3181 C  CD2 . TYR B 1 206 ? 6.525   33.124 5.383   1.00 28.55 ? 206 TYR B CD2 1 
ATOM   3182 C  CE1 . TYR B 1 206 ? 9.247   32.924 5.884   1.00 29.33 ? 206 TYR B CE1 1 
ATOM   3183 C  CE2 . TYR B 1 206 ? 7.147   31.892 5.337   1.00 26.83 ? 206 TYR B CE2 1 
ATOM   3184 C  CZ  . TYR B 1 206 ? 8.500   31.789 5.598   1.00 29.10 ? 206 TYR B CZ  1 
ATOM   3185 O  OH  . TYR B 1 206 ? 9.114   30.547 5.577   1.00 27.87 ? 206 TYR B OH  1 
ATOM   3186 N  N   . TYR B 1 207 ? 6.119   35.943 2.716   1.00 34.44 ? 207 TYR B N   1 
ATOM   3187 C  CA  . TYR B 1 207 ? 6.064   35.323 1.410   1.00 35.72 ? 207 TYR B CA  1 
ATOM   3188 C  C   . TYR B 1 207 ? 6.636   36.199 0.309   1.00 37.41 ? 207 TYR B C   1 
ATOM   3189 O  O   . TYR B 1 207 ? 7.259   35.679 -0.626  1.00 37.44 ? 207 TYR B O   1 
ATOM   3190 C  CB  . TYR B 1 207 ? 4.646   34.866 1.093   1.00 35.38 ? 207 TYR B CB  1 
ATOM   3191 C  CG  . TYR B 1 207 ? 4.236   33.671 1.925   1.00 33.80 ? 207 TYR B CG  1 
ATOM   3192 C  CD1 . TYR B 1 207 ? 4.829   32.435 1.719   1.00 31.54 ? 207 TYR B CD1 1 
ATOM   3193 C  CD2 . TYR B 1 207 ? 3.267   33.779 2.915   1.00 32.77 ? 207 TYR B CD2 1 
ATOM   3194 C  CE1 . TYR B 1 207 ? 4.476   31.327 2.471   1.00 30.80 ? 207 TYR B CE1 1 
ATOM   3195 C  CE2 . TYR B 1 207 ? 2.900   32.671 3.689   1.00 31.54 ? 207 TYR B CE2 1 
ATOM   3196 C  CZ  . TYR B 1 207 ? 3.522   31.448 3.463   1.00 29.46 ? 207 TYR B CZ  1 
ATOM   3197 O  OH  . TYR B 1 207 ? 3.181   30.337 4.190   1.00 22.70 ? 207 TYR B OH  1 
ATOM   3198 N  N   . GLY B 1 208 ? 6.438   37.514 0.436   1.00 38.83 ? 208 GLY B N   1 
ATOM   3199 C  CA  . GLY B 1 208 ? 7.102   38.507 -0.416  1.00 41.29 ? 208 GLY B CA  1 
ATOM   3200 C  C   . GLY B 1 208 ? 8.582   38.234 -0.659  1.00 43.22 ? 208 GLY B C   1 
ATOM   3201 O  O   . GLY B 1 208 ? 9.140   38.720 -1.648  1.00 43.59 ? 208 GLY B O   1 
ATOM   3202 N  N   . LEU B 1 209 ? 9.220   37.474 0.245   1.00 44.92 ? 209 LEU B N   1 
ATOM   3203 C  CA  . LEU B 1 209 ? 10.564  36.909 0.024   1.00 46.41 ? 209 LEU B CA  1 
ATOM   3204 C  C   . LEU B 1 209 ? 10.606  35.997 -1.160  1.00 47.11 ? 209 LEU B C   1 
ATOM   3205 O  O   . LEU B 1 209 ? 11.366  36.212 -2.091  1.00 47.73 ? 209 LEU B O   1 
ATOM   3206 C  CB  . LEU B 1 209 ? 11.030  36.054 1.216   1.00 46.69 ? 209 LEU B CB  1 
ATOM   3207 C  CG  . LEU B 1 209 ? 12.302  35.204 0.986   1.00 47.66 ? 209 LEU B CG  1 
ATOM   3208 C  CD1 . LEU B 1 209 ? 13.497  36.074 0.598   1.00 48.96 ? 209 LEU B CD1 1 
ATOM   3209 C  CD2 . LEU B 1 209 ? 12.662  34.304 2.165   1.00 48.92 ? 209 LEU B CD2 1 
ATOM   3210 N  N   . GLU B 1 210 ? 9.796   34.949 -1.077  1.00 47.91 ? 210 GLU B N   1 
ATOM   3211 C  CA  . GLU B 1 210 ? 9.977   33.754 -1.869  1.00 48.37 ? 210 GLU B CA  1 
ATOM   3212 C  C   . GLU B 1 210 ? 9.314   33.919 -3.222  1.00 48.57 ? 210 GLU B C   1 
ATOM   3213 O  O   . GLU B 1 210 ? 9.506   34.940 -3.878  1.00 49.00 ? 210 GLU B O   1 
ATOM   3214 C  CB  . GLU B 1 210 ? 9.415   32.543 -1.111  1.00 48.75 ? 210 GLU B CB  1 
ATOM   3215 C  CG  . GLU B 1 210 ? 9.741   32.522 0.402   1.00 48.82 ? 210 GLU B CG  1 
ATOM   3216 C  CD  . GLU B 1 210 ? 9.216   31.270 1.123   1.00 50.48 ? 210 GLU B CD  1 
ATOM   3217 O  OE1 . GLU B 1 210 ? 8.299   30.603 0.591   1.00 51.77 ? 210 GLU B OE1 1 
ATOM   3218 O  OE2 . GLU B 1 210 ? 9.708   30.953 2.227   1.00 49.08 ? 210 GLU B OE2 1 
HETATM 3219 ZN ZN  . ZN  C 2 .   ? -22.779 13.929 -6.397  1.00 32.14 ? 251 ZN  A ZN  1 
HETATM 3220 P  P   . PO4 D 3 .   ? -22.186 10.764 -7.834  1.00 36.33 ? 261 PO4 A P   1 
HETATM 3221 O  O1  . PO4 D 3 .   ? -21.369 10.156 -8.954  1.00 37.37 ? 261 PO4 A O1  1 
HETATM 3222 O  O2  . PO4 D 3 .   ? -23.602 10.213 -7.789  1.00 36.48 ? 261 PO4 A O2  1 
HETATM 3223 O  O3  . PO4 D 3 .   ? -21.473 10.366 -6.569  1.00 37.37 ? 261 PO4 A O3  1 
HETATM 3224 O  O4  . PO4 D 3 .   ? -22.251 12.260 -7.974  1.00 34.44 ? 261 PO4 A O4  1 
HETATM 3225 ZN ZN  . ZN  E 2 .   ? -0.989  24.899 24.582  1.00 29.42 ? 251 ZN  B ZN  1 
HETATM 3226 P  P   . PO4 F 3 .   ? 1.878   22.856 25.418  1.00 28.08 ? 261 PO4 B P   1 
HETATM 3227 O  O1  . PO4 F 3 .   ? 2.639   21.926 26.353  1.00 30.44 ? 261 PO4 B O1  1 
HETATM 3228 O  O2  . PO4 F 3 .   ? 2.716   24.120 25.353  1.00 29.69 ? 261 PO4 B O2  1 
HETATM 3229 O  O3  . PO4 F 3 .   ? 1.804   22.251 24.048  1.00 29.06 ? 261 PO4 B O3  1 
HETATM 3230 O  O4  . PO4 F 3 .   ? 0.529   23.273 25.970  1.00 28.28 ? 261 PO4 B O4  1 
HETATM 3231 O  O   . HOH G 4 .   ? -23.542 24.273 -2.846  1.00 14.61 ? 217 HOH A O   1 
HETATM 3232 O  O   . HOH G 4 .   ? -22.196 26.930 -2.481  1.00 19.49 ? 218 HOH A O   1 
HETATM 3233 O  O   . HOH G 4 .   ? -17.715 11.195 15.536  1.00 18.36 ? 219 HOH A O   1 
HETATM 3234 O  O   . HOH G 4 .   ? -15.474 15.344 -5.779  1.00 16.75 ? 220 HOH A O   1 
HETATM 3235 O  O   . HOH G 4 .   ? -37.412 16.480 -3.979  1.00 25.38 ? 221 HOH A O   1 
HETATM 3236 O  O   . HOH G 4 .   ? -23.039 9.323  -1.492  1.00 19.90 ? 222 HOH A O   1 
HETATM 3237 O  O   . HOH G 4 .   ? -29.724 8.132  -3.720  1.00 22.17 ? 223 HOH A O   1 
HETATM 3238 O  O   . HOH G 4 .   ? -23.056 3.923  -4.981  1.00 23.94 ? 224 HOH A O   1 
HETATM 3239 O  O   . HOH G 4 .   ? -14.490 5.412  6.105   1.00 19.88 ? 225 HOH A O   1 
HETATM 3240 O  O   . HOH G 4 .   ? -12.591 14.671 -11.211 1.00 27.26 ? 226 HOH A O   1 
HETATM 3241 O  O   . HOH G 4 .   ? -31.390 2.103  -0.914  1.00 23.94 ? 227 HOH A O   1 
HETATM 3242 O  O   . HOH G 4 .   ? -24.662 0.859  -5.601  1.00 19.53 ? 228 HOH A O   1 
HETATM 3243 O  O   . HOH G 4 .   ? -10.531 6.097  -4.957  1.00 19.64 ? 229 HOH A O   1 
HETATM 3244 O  O   . HOH G 4 .   ? -35.280 24.540 8.597   1.00 24.70 ? 230 HOH A O   1 
HETATM 3245 O  O   . HOH G 4 .   ? -40.557 10.929 -5.694  1.00 26.92 ? 231 HOH A O   1 
HETATM 3246 O  O   . HOH G 4 .   ? -16.018 27.993 1.580   1.00 25.55 ? 232 HOH A O   1 
HETATM 3247 O  O   . HOH G 4 .   ? -18.622 -0.198 3.035   1.00 19.55 ? 233 HOH A O   1 
HETATM 3248 O  O   . HOH G 4 .   ? -20.802 6.949  -6.962  1.00 27.58 ? 234 HOH A O   1 
HETATM 3249 O  O   . HOH G 4 .   ? -2.984  23.132 -3.131  1.00 26.10 ? 235 HOH A O   1 
HETATM 3250 O  O   . HOH G 4 .   ? -25.328 6.040  -6.279  1.00 22.14 ? 236 HOH A O   1 
HETATM 3251 O  O   . HOH G 4 .   ? -42.426 22.666 1.095   1.00 32.15 ? 237 HOH A O   1 
HETATM 3252 O  O   . HOH G 4 .   ? -25.627 -3.830 -4.709  1.00 13.25 ? 238 HOH A O   1 
HETATM 3253 O  O   . HOH G 4 .   ? -31.336 0.297  1.836   1.00 19.37 ? 239 HOH A O   1 
HETATM 3254 O  O   . HOH G 4 .   ? -31.688 0.118  8.343   1.00 30.28 ? 240 HOH A O   1 
HETATM 3255 O  O   . HOH G 4 .   ? -6.453  24.544 -9.437  1.00 24.41 ? 242 HOH A O   1 
HETATM 3256 O  O   . HOH G 4 .   ? -19.094 3.466  -9.316  1.00 30.79 ? 243 HOH A O   1 
HETATM 3257 O  O   . HOH G 4 .   ? -23.080 -3.566 -0.421  1.00 26.21 ? 244 HOH A O   1 
HETATM 3258 O  O   . HOH G 4 .   ? -15.335 5.711  -0.927  1.00 20.81 ? 245 HOH A O   1 
HETATM 3259 O  O   . HOH G 4 .   ? -21.015 28.157 -7.851  1.00 36.63 ? 246 HOH A O   1 
HETATM 3260 O  O   . HOH G 4 .   ? -7.196  15.796 1.442   1.00 24.84 ? 247 HOH A O   1 
HETATM 3261 O  O   . HOH G 4 .   ? -8.272  8.301  6.164   1.00 19.93 ? 248 HOH A O   1 
HETATM 3262 O  O   . HOH G 4 .   ? -13.275 9.497  -10.450 1.00 39.93 ? 249 HOH A O   1 
HETATM 3263 O  O   . HOH G 4 .   ? -26.378 5.683  8.385   1.00 19.42 ? 250 HOH A O   1 
HETATM 3264 O  O   . HOH G 4 .   ? -10.268 5.716  0.794   1.00 39.06 ? 252 HOH A O   1 
HETATM 3265 O  O   . HOH G 4 .   ? -40.204 5.364  -2.580  1.00 17.34 ? 253 HOH A O   1 
HETATM 3266 O  O   . HOH G 4 .   ? -27.658 27.036 4.817   1.00 30.03 ? 254 HOH A O   1 
HETATM 3267 O  O   . HOH G 4 .   ? -19.274 28.154 -5.187  1.00 47.67 ? 255 HOH A O   1 
HETATM 3268 O  O   . HOH G 4 .   ? -41.747 18.759 -10.475 1.00 20.71 ? 256 HOH A O   1 
HETATM 3269 O  O   . HOH G 4 .   ? -24.134 6.174  17.924  1.00 29.15 ? 257 HOH A O   1 
HETATM 3270 O  O   . HOH G 4 .   ? -26.873 4.604  15.299  1.00 51.35 ? 258 HOH A O   1 
HETATM 3271 O  O   . HOH G 4 .   ? -35.639 12.935 -11.919 1.00 26.94 ? 259 HOH A O   1 
HETATM 3272 O  O   . HOH G 4 .   ? -24.100 22.496 14.380  1.00 36.19 ? 260 HOH A O   1 
HETATM 3273 O  O   . HOH G 4 .   ? -32.763 34.243 3.079   1.00 36.77 ? 262 HOH A O   1 
HETATM 3274 O  O   . HOH G 4 .   ? -8.361  7.482  1.470   1.00 30.68 ? 263 HOH A O   1 
HETATM 3275 O  O   . HOH G 4 .   ? -26.415 2.395  10.522  1.00 30.28 ? 264 HOH A O   1 
HETATM 3276 O  O   . HOH G 4 .   ? -19.634 24.988 -12.284 1.00 31.69 ? 265 HOH A O   1 
HETATM 3277 O  O   . HOH G 4 .   ? -25.166 21.825 -9.547  1.00 44.66 ? 266 HOH A O   1 
HETATM 3278 O  O   . HOH G 4 .   ? -20.606 -1.509 3.018   1.00 34.16 ? 267 HOH A O   1 
HETATM 3279 O  O   . HOH G 4 .   ? -4.029  20.473 -4.023  1.00 26.07 ? 268 HOH A O   1 
HETATM 3280 O  O   . HOH G 4 .   ? -40.386 18.787 -4.772  1.00 27.13 ? 269 HOH A O   1 
HETATM 3281 O  O   . HOH G 4 .   ? -32.525 18.551 -17.578 1.00 40.71 ? 270 HOH A O   1 
HETATM 3282 O  O   . HOH G 4 .   ? -13.912 4.241  -2.945  1.00 27.77 ? 271 HOH A O   1 
HETATM 3283 O  O   . HOH G 4 .   ? -16.385 9.275  18.244  1.00 30.69 ? 272 HOH A O   1 
HETATM 3284 O  O   . HOH G 4 .   ? -26.648 35.612 -1.184  1.00 34.22 ? 273 HOH A O   1 
HETATM 3285 O  O   . HOH G 4 .   ? -32.418 15.332 14.460  1.00 38.91 ? 274 HOH A O   1 
HETATM 3286 O  O   . HOH G 4 .   ? -45.450 10.857 4.547   1.00 30.09 ? 275 HOH A O   1 
HETATM 3287 O  O   . HOH G 4 .   ? -5.805  12.000 -13.492 0.50 31.68 ? 276 HOH A O   1 
HETATM 3288 O  O   . HOH G 4 .   ? -31.987 35.618 -11.054 1.00 36.71 ? 277 HOH A O   1 
HETATM 3289 O  O   . HOH G 4 .   ? -20.297 17.823 -11.451 1.00 51.24 ? 278 HOH A O   1 
HETATM 3290 O  O   . HOH G 4 .   ? -22.382 32.771 -9.567  1.00 39.86 ? 279 HOH A O   1 
HETATM 3291 O  O   . HOH G 4 .   ? -34.712 28.796 12.568  1.00 33.64 ? 280 HOH A O   1 
HETATM 3292 O  O   . HOH G 4 .   ? -19.113 10.398 -12.343 1.00 33.42 ? 281 HOH A O   1 
HETATM 3293 O  O   . HOH G 4 .   ? -13.195 8.788  18.665  1.00 40.70 ? 282 HOH A O   1 
HETATM 3294 O  O   . HOH G 4 .   ? -27.628 29.923 2.762   1.00 27.52 ? 283 HOH A O   1 
HETATM 3295 O  O   . HOH G 4 .   ? -38.840 3.458  -5.388  1.00 20.18 ? 284 HOH A O   1 
HETATM 3296 O  O   . HOH G 4 .   ? -45.488 15.845 -2.583  1.00 35.05 ? 285 HOH A O   1 
HETATM 3297 O  O   . HOH G 4 .   ? -12.436 30.401 -7.901  1.00 46.23 ? 286 HOH A O   1 
HETATM 3298 O  O   . HOH G 4 .   ? -42.509 8.623  10.080  1.00 30.58 ? 287 HOH A O   1 
HETATM 3299 O  O   . HOH G 4 .   ? -39.381 27.173 -4.290  1.00 30.98 ? 288 HOH A O   1 
HETATM 3300 O  O   . HOH G 4 .   ? -18.618 7.553  17.304  1.00 28.52 ? 289 HOH A O   1 
HETATM 3301 O  O   . HOH G 4 .   ? -15.613 4.511  14.616  1.00 26.52 ? 290 HOH A O   1 
HETATM 3302 O  O   . HOH G 4 .   ? -20.842 2.879  16.152  1.00 27.76 ? 291 HOH A O   1 
HETATM 3303 O  O   . HOH G 4 .   ? -22.444 15.930 -10.771 1.00 27.76 ? 292 HOH A O   1 
HETATM 3304 O  O   . HOH G 4 .   ? -26.381 14.628 -12.898 1.00 32.97 ? 293 HOH A O   1 
HETATM 3305 O  O   . HOH G 4 .   ? -24.625 13.367 -7.605  1.00 34.48 ? 294 HOH A O   1 
HETATM 3306 O  O   . HOH G 4 .   ? -28.893 9.233  -14.717 1.00 42.27 ? 295 HOH A O   1 
HETATM 3307 O  O   . HOH G 4 .   ? -23.976 -2.254 11.245  1.00 32.23 ? 296 HOH A O   1 
HETATM 3308 O  O   . HOH G 4 .   ? -28.591 38.894 -1.761  1.00 34.29 ? 297 HOH A O   1 
HETATM 3309 O  O   . HOH G 4 .   ? -43.765 25.521 5.235   1.00 52.74 ? 298 HOH A O   1 
HETATM 3310 O  O   . HOH G 4 .   ? -34.297 11.417 19.405  1.00 35.73 ? 299 HOH A O   1 
HETATM 3311 O  O   . HOH G 4 .   ? -35.833 0.553  21.008  1.00 50.56 ? 300 HOH A O   1 
HETATM 3312 O  O   . HOH G 4 .   ? -21.635 -3.503 2.738   1.00 26.12 ? 301 HOH A O   1 
HETATM 3313 O  O   . HOH G 4 .   ? -23.318 12.848 -10.716 1.00 33.36 ? 302 HOH A O   1 
HETATM 3314 O  O   . HOH G 4 .   ? -26.599 11.387 18.288  1.00 39.04 ? 303 HOH A O   1 
HETATM 3315 O  O   . HOH G 4 .   ? -27.225 14.667 15.927  1.00 38.39 ? 304 HOH A O   1 
HETATM 3316 O  O   . HOH G 4 .   ? -18.977 22.065 -14.769 1.00 35.92 ? 305 HOH A O   1 
HETATM 3317 O  O   . HOH G 4 .   ? -15.232 15.274 -13.167 1.00 35.23 ? 306 HOH A O   1 
HETATM 3318 O  O   . HOH G 4 .   ? -7.878  5.794  -8.958  1.00 38.99 ? 307 HOH A O   1 
HETATM 3319 O  O   . HOH G 4 .   ? -34.546 7.361  -11.031 1.00 34.40 ? 308 HOH A O   1 
HETATM 3320 O  O   . HOH G 4 .   ? -32.456 0.090  10.824  1.00 36.09 ? 309 HOH A O   1 
HETATM 3321 O  O   . HOH G 4 .   ? -10.855 4.779  -7.483  1.00 43.10 ? 310 HOH A O   1 
HETATM 3322 O  O   . HOH G 4 .   ? -43.093 11.937 -4.666  1.00 26.63 ? 311 HOH A O   1 
HETATM 3323 O  O   . HOH G 4 .   ? -35.845 9.417  -11.517 1.00 29.62 ? 312 HOH A O   1 
HETATM 3324 O  O   . HOH G 4 .   ? -4.658  7.863  -9.377  1.00 37.44 ? 313 HOH A O   1 
HETATM 3325 O  O   . HOH G 4 .   ? -15.319 2.718  11.348  1.00 27.55 ? 314 HOH A O   1 
HETATM 3326 O  O   . HOH G 4 .   ? -18.851 5.416  15.890  1.00 33.53 ? 315 HOH A O   1 
HETATM 3327 O  O   . HOH G 4 .   ? -36.434 37.432 -2.599  1.00 25.37 ? 316 HOH A O   1 
HETATM 3328 O  O   . HOH G 4 .   ? -28.629 11.707 -13.730 1.00 35.72 ? 317 HOH A O   1 
HETATM 3329 O  O   . HOH G 4 .   ? -7.354  4.372  -3.726  1.00 46.78 ? 318 HOH A O   1 
HETATM 3330 O  O   . HOH G 4 .   ? -4.098  15.169 -11.481 1.00 33.81 ? 319 HOH A O   1 
HETATM 3331 O  O   . HOH G 4 .   ? -36.543 24.188 11.236  1.00 39.99 ? 320 HOH A O   1 
HETATM 3332 O  O   . HOH G 4 .   ? -10.021 30.895 -1.080  1.00 27.88 ? 321 HOH A O   1 
HETATM 3333 O  O   . HOH G 4 .   ? -20.076 25.472 -14.948 1.00 30.18 ? 322 HOH A O   1 
HETATM 3334 O  O   . HOH G 4 .   ? -15.795 20.952 -15.419 1.00 23.70 ? 323 HOH A O   1 
HETATM 3335 O  O   . HOH G 4 .   ? -7.866  7.311  3.687   1.00 31.31 ? 324 HOH A O   1 
HETATM 3336 O  O   . HOH G 4 .   ? -24.744 12.542 -12.361 1.00 30.34 ? 325 HOH A O   1 
HETATM 3337 O  O   . HOH G 4 .   ? -25.225 15.565 -15.620 1.00 29.61 ? 326 HOH A O   1 
HETATM 3338 O  O   . HOH G 4 .   ? -45.240 18.645 7.712   1.00 27.70 ? 327 HOH A O   1 
HETATM 3339 O  O   . HOH G 4 .   ? -36.372 5.432  -7.931  1.00 31.01 ? 328 HOH A O   1 
HETATM 3340 O  O   . HOH G 4 .   ? -14.122 2.010  4.542   1.00 39.88 ? 329 HOH A O   1 
HETATM 3341 O  O   . HOH G 4 .   ? -41.233 28.482 5.816   1.00 28.11 ? 330 HOH A O   1 
HETATM 3342 O  O   . HOH G 4 .   ? -38.669 3.858  21.458  1.00 33.08 ? 331 HOH A O   1 
HETATM 3343 O  O   . HOH G 4 .   ? -26.171 -4.591 -0.756  1.00 24.65 ? 332 HOH A O   1 
HETATM 3344 O  O   . HOH G 4 .   ? -20.038 30.730 -9.673  1.00 39.56 ? 333 HOH A O   1 
HETATM 3345 O  O   . HOH G 4 .   ? -16.004 0.079  4.804   1.00 35.48 ? 334 HOH A O   1 
HETATM 3346 O  O   . HOH G 4 .   ? -18.222 -1.671 8.492   1.00 31.32 ? 335 HOH A O   1 
HETATM 3347 O  O   . HOH H 4 .   ? 18.111  33.273 31.154  1.00 25.92 ? 217 HOH B O   1 
HETATM 3348 O  O   . HOH H 4 .   ? -16.157 26.031 24.001  1.00 30.64 ? 218 HOH B O   1 
HETATM 3349 O  O   . HOH H 4 .   ? -8.895  47.986 13.787  1.00 26.45 ? 219 HOH B O   1 
HETATM 3350 O  O   . HOH H 4 .   ? -7.444  12.766 8.380   1.00 26.30 ? 220 HOH B O   1 
HETATM 3351 O  O   . HOH H 4 .   ? -4.172  17.028 30.407  1.00 24.40 ? 221 HOH B O   1 
HETATM 3352 O  O   . HOH H 4 .   ? -3.684  9.755  33.792  1.00 31.97 ? 222 HOH B O   1 
HETATM 3353 O  O   . HOH H 4 .   ? -11.592 25.038 31.766  1.00 20.03 ? 223 HOH B O   1 
HETATM 3354 O  O   . HOH H 4 .   ? -5.216  18.703 23.314  1.00 20.56 ? 224 HOH B O   1 
HETATM 3355 O  O   . HOH H 4 .   ? -19.666 32.661 29.984  1.00 33.57 ? 225 HOH B O   1 
HETATM 3356 O  O   . HOH H 4 .   ? -20.717 24.102 34.119  1.00 23.37 ? 226 HOH B O   1 
HETATM 3357 O  O   . HOH H 4 .   ? -13.502 29.771 22.635  1.00 24.88 ? 227 HOH B O   1 
HETATM 3358 O  O   . HOH H 4 .   ? -3.108  22.839 1.888   1.00 20.42 ? 228 HOH B O   1 
HETATM 3359 O  O   . HOH H 4 .   ? -13.829 13.683 33.237  1.00 27.64 ? 229 HOH B O   1 
HETATM 3360 O  O   . HOH H 4 .   ? 1.799   39.603 24.666  1.00 17.96 ? 230 HOH B O   1 
HETATM 3361 O  O   . HOH H 4 .   ? 2.922   24.554 19.013  1.00 18.26 ? 231 HOH B O   1 
HETATM 3362 O  O   . HOH H 4 .   ? 6.463   29.707 21.475  1.00 17.69 ? 232 HOH B O   1 
HETATM 3363 O  O   . HOH H 4 .   ? 8.333   21.486 21.537  1.00 22.77 ? 233 HOH B O   1 
HETATM 3364 O  O   . HOH H 4 .   ? 2.262   16.110 9.355   1.00 28.11 ? 234 HOH B O   1 
HETATM 3365 O  O   . HOH H 4 .   ? -10.722 12.067 27.856  1.00 36.86 ? 235 HOH B O   1 
HETATM 3366 O  O   . HOH H 4 .   ? 12.902  29.585 18.041  1.00 32.34 ? 236 HOH B O   1 
HETATM 3367 O  O   . HOH H 4 .   ? 11.150  22.380 21.679  1.00 19.51 ? 237 HOH B O   1 
HETATM 3368 O  O   . HOH H 4 .   ? 1.820   10.824 20.204  1.00 29.57 ? 238 HOH B O   1 
HETATM 3369 O  O   . HOH H 4 .   ? -7.818  42.333 13.166  1.00 24.17 ? 239 HOH B O   1 
HETATM 3370 O  O   . HOH H 4 .   ? 8.111   41.104 25.561  1.00 34.08 ? 240 HOH B O   1 
HETATM 3371 O  O   . HOH H 4 .   ? 7.175   21.414 23.986  1.00 19.89 ? 241 HOH B O   1 
HETATM 3372 O  O   . HOH H 4 .   ? -19.682 21.421 18.903  1.00 19.80 ? 242 HOH B O   1 
HETATM 3373 O  O   . HOH H 4 .   ? -18.142 24.734 18.134  1.00 32.24 ? 243 HOH B O   1 
HETATM 3374 O  O   . HOH H 4 .   ? 2.758   16.068 16.853  1.00 20.36 ? 244 HOH B O   1 
HETATM 3375 O  O   . HOH H 4 .   ? 5.302   19.171 24.052  1.00 17.05 ? 245 HOH B O   1 
HETATM 3376 O  O   . HOH H 4 .   ? -17.377 10.354 20.692  1.00 19.24 ? 246 HOH B O   1 
HETATM 3377 O  O   . HOH H 4 .   ? 15.351  20.613 21.104  1.00 24.60 ? 247 HOH B O   1 
HETATM 3378 O  O   . HOH H 4 .   ? -3.053  47.255 20.762  1.00 32.02 ? 248 HOH B O   1 
HETATM 3379 O  O   . HOH H 4 .   ? -4.699  46.508 13.803  1.00 22.36 ? 249 HOH B O   1 
HETATM 3380 O  O   . HOH H 4 .   ? 11.876  32.843 27.140  1.00 28.94 ? 250 HOH B O   1 
HETATM 3381 O  O   . HOH H 4 .   ? 9.504   15.135 21.609  1.00 16.00 ? 252 HOH B O   1 
HETATM 3382 O  O   . HOH H 4 .   ? -8.890  6.189  26.777  1.00 24.41 ? 253 HOH B O   1 
HETATM 3383 O  O   . HOH H 4 .   ? 0.242   13.956 26.757  1.00 26.47 ? 254 HOH B O   1 
HETATM 3384 O  O   . HOH H 4 .   ? -1.260  10.698 14.186  1.00 24.09 ? 255 HOH B O   1 
HETATM 3385 O  O   . HOH H 4 .   ? -9.624  12.643 15.567  1.00 32.62 ? 256 HOH B O   1 
HETATM 3386 O  O   . HOH H 4 .   ? 5.576   23.143 0.569   1.00 26.39 ? 257 HOH B O   1 
HETATM 3387 O  O   . HOH H 4 .   ? 3.378   43.730 28.448  1.00 27.36 ? 258 HOH B O   1 
HETATM 3388 O  O   . HOH H 4 .   ? 0.497   26.078 25.864  1.00 22.94 ? 259 HOH B O   1 
HETATM 3389 O  O   . HOH H 4 .   ? -7.826  45.541 25.736  1.00 51.85 ? 260 HOH B O   1 
HETATM 3390 O  O   . HOH H 4 .   ? 1.446   11.169 14.716  1.00 26.09 ? 262 HOH B O   1 
HETATM 3391 O  O   . HOH H 4 .   ? 2.630   10.023 25.144  1.00 30.18 ? 263 HOH B O   1 
HETATM 3392 O  O   . HOH H 4 .   ? -7.451  4.220  25.703  1.00 26.50 ? 264 HOH B O   1 
HETATM 3393 O  O   . HOH H 4 .   ? -22.501 15.239 21.375  1.00 44.82 ? 265 HOH B O   1 
HETATM 3394 O  O   . HOH H 4 .   ? -0.662  32.523 0.888   1.00 37.93 ? 266 HOH B O   1 
HETATM 3395 O  O   . HOH H 4 .   ? 13.006  39.077 21.066  1.00 25.68 ? 267 HOH B O   1 
HETATM 3396 O  O   . HOH H 4 .   ? 10.554  44.469 17.343  1.00 33.97 ? 268 HOH B O   1 
HETATM 3397 O  O   . HOH H 4 .   ? -14.673 36.569 18.255  1.00 22.68 ? 269 HOH B O   1 
HETATM 3398 O  O   . HOH H 4 .   ? 1.340   27.899 31.926  1.00 24.69 ? 270 HOH B O   1 
HETATM 3399 O  O   . HOH H 4 .   ? -11.195 3.609  28.004  1.00 53.55 ? 271 HOH B O   1 
HETATM 3400 O  O   . HOH H 4 .   ? -7.363  29.635 29.471  1.00 46.92 ? 272 HOH B O   1 
HETATM 3401 O  O   . HOH H 4 .   ? -7.878  47.142 23.315  1.00 28.67 ? 273 HOH B O   1 
HETATM 3402 O  O   . HOH H 4 .   ? 0.351   27.006 34.534  1.00 32.18 ? 274 HOH B O   1 
HETATM 3403 O  O   . HOH H 4 .   ? 1.003   43.623 25.375  1.00 29.96 ? 275 HOH B O   1 
HETATM 3404 O  O   . HOH H 4 .   ? 17.062  27.191 25.083  1.00 22.04 ? 276 HOH B O   1 
HETATM 3405 O  O   . HOH H 4 .   ? 3.618   43.403 5.481   1.00 37.41 ? 277 HOH B O   1 
HETATM 3406 O  O   . HOH H 4 .   ? -2.795  11.554 9.996   1.00 25.35 ? 278 HOH B O   1 
HETATM 3407 O  O   . HOH H 4 .   ? 15.876  20.788 16.309  1.00 31.38 ? 279 HOH B O   1 
HETATM 3408 O  O   . HOH H 4 .   ? -1.719  10.346 11.841  1.00 27.70 ? 280 HOH B O   1 
HETATM 3409 O  O   . HOH H 4 .   ? 7.543   28.882 2.689   1.00 34.86 ? 281 HOH B O   1 
HETATM 3410 O  O   . HOH H 4 .   ? -0.198  33.962 37.176  1.00 26.32 ? 282 HOH B O   1 
HETATM 3411 O  O   . HOH H 4 .   ? -4.018  29.176 30.267  1.00 34.86 ? 283 HOH B O   1 
HETATM 3412 O  O   . HOH H 4 .   ? -21.437 22.833 25.449  1.00 28.77 ? 284 HOH B O   1 
HETATM 3413 O  O   . HOH H 4 .   ? 12.128  26.921 31.877  1.00 20.06 ? 285 HOH B O   1 
HETATM 3414 O  O   . HOH H 4 .   ? -16.446 42.327 18.722  1.00 37.20 ? 286 HOH B O   1 
HETATM 3415 O  O   . HOH H 4 .   ? 3.330   10.298 27.817  1.00 30.50 ? 287 HOH B O   1 
HETATM 3416 O  O   . HOH H 4 .   ? 8.455   43.052 24.110  1.00 36.51 ? 288 HOH B O   1 
HETATM 3417 O  O   . HOH H 4 .   ? 14.155  18.157 20.560  1.00 29.53 ? 289 HOH B O   1 
HETATM 3418 O  O   . HOH H 4 .   ? -12.600 36.473 16.430  1.00 37.84 ? 290 HOH B O   1 
HETATM 3419 O  O   . HOH H 4 .   ? 14.529  36.991 23.440  1.00 22.31 ? 291 HOH B O   1 
HETATM 3420 O  O   . HOH H 4 .   ? -20.323 43.502 25.287  1.00 35.13 ? 292 HOH B O   1 
HETATM 3421 O  O   . HOH H 4 .   ? 9.100   34.376 31.048  1.00 56.39 ? 293 HOH B O   1 
HETATM 3422 O  O   . HOH H 4 .   ? -20.396 39.004 21.117  1.00 42.63 ? 294 HOH B O   1 
HETATM 3423 O  O   . HOH H 4 .   ? -13.705 4.987  27.221  1.00 41.21 ? 295 HOH B O   1 
HETATM 3424 O  O   . HOH H 4 .   ? 4.591   16.590 4.449   1.00 41.62 ? 296 HOH B O   1 
HETATM 3425 O  O   . HOH H 4 .   ? -1.811  17.629 35.769  1.00 19.53 ? 297 HOH B O   1 
HETATM 3426 O  O   . HOH H 4 .   ? -21.864 19.912 20.426  1.00 28.00 ? 298 HOH B O   1 
HETATM 3427 O  O   . HOH H 4 .   ? 0.273   22.555 -0.388  1.00 31.35 ? 299 HOH B O   1 
HETATM 3428 O  O   . HOH H 4 .   ? -2.181  32.363 3.088   1.00 42.44 ? 300 HOH B O   1 
HETATM 3429 O  O   . HOH H 4 .   ? 4.720   13.769 17.995  1.00 44.62 ? 301 HOH B O   1 
HETATM 3430 O  O   . HOH H 4 .   ? 6.588   27.984 9.074   1.00 24.45 ? 302 HOH B O   1 
HETATM 3431 O  O   . HOH H 4 .   ? 9.221   26.844 6.708   1.00 35.78 ? 303 HOH B O   1 
HETATM 3432 O  O   . HOH H 4 .   ? 1.906   26.296 29.019  1.00 45.85 ? 304 HOH B O   1 
HETATM 3433 O  O   . HOH H 4 .   ? -23.537 19.642 24.576  1.00 37.13 ? 305 HOH B O   1 
HETATM 3434 O  O   . HOH H 4 .   ? 3.330   40.757 38.823  1.00 57.98 ? 306 HOH B O   1 
HETATM 3435 O  O   . HOH H 4 .   ? 2.525   43.636 30.941  1.00 32.84 ? 307 HOH B O   1 
HETATM 3436 O  O   . HOH H 4 .   ? 12.450  40.803 15.159  1.00 28.86 ? 308 HOH B O   1 
HETATM 3437 O  O   . HOH H 4 .   ? -1.537  48.842 18.005  1.00 37.61 ? 309 HOH B O   1 
HETATM 3438 O  O   . HOH H 4 .   ? 10.430  43.470 21.883  1.00 28.46 ? 310 HOH B O   1 
HETATM 3439 O  O   . HOH H 4 .   ? 15.991  31.198 21.687  1.00 48.17 ? 311 HOH B O   1 
HETATM 3440 O  O   . HOH H 4 .   ? 9.092   18.262 12.367  1.00 38.23 ? 312 HOH B O   1 
HETATM 3441 O  O   . HOH H 4 .   ? 6.286   14.191 11.876  1.00 31.69 ? 313 HOH B O   1 
HETATM 3442 O  O   . HOH H 4 .   ? 12.139  22.818 4.530   1.00 30.76 ? 314 HOH B O   1 
HETATM 3443 O  O   . HOH H 4 .   ? -5.162  38.793 33.887  1.00 42.81 ? 315 HOH B O   1 
HETATM 3444 O  O   . HOH H 4 .   ? -18.852 43.204 27.881  1.00 40.73 ? 316 HOH B O   1 
HETATM 3445 O  O   . HOH H 4 .   ? 7.084   42.117 1.388   1.00 39.02 ? 317 HOH B O   1 
HETATM 3446 O  O   . HOH H 4 .   ? -19.789 13.913 27.556  1.00 32.50 ? 318 HOH B O   1 
HETATM 3447 O  O   . HOH H 4 .   ? -6.076  24.263 31.286  1.00 24.68 ? 319 HOH B O   1 
HETATM 3448 O  O   . HOH H 4 .   ? 6.794   24.812 23.750  1.00 32.11 ? 320 HOH B O   1 
HETATM 3449 O  O   . HOH H 4 .   ? -14.808 27.304 32.478  1.00 32.75 ? 321 HOH B O   1 
HETATM 3450 O  O   . HOH H 4 .   ? 9.905   14.317 14.128  1.00 28.93 ? 322 HOH B O   1 
HETATM 3451 O  O   . HOH H 4 .   ? 2.933   10.038 16.086  1.00 26.28 ? 323 HOH B O   1 
HETATM 3452 O  O   . HOH H 4 .   ? 5.216   35.668 31.481  1.00 27.73 ? 324 HOH B O   1 
HETATM 3453 O  O   . HOH H 4 .   ? -7.526  44.046 10.927  1.00 29.00 ? 325 HOH B O   1 
HETATM 3454 O  O   . HOH H 4 .   ? 3.471   11.505 17.369  1.00 29.66 ? 326 HOH B O   1 
HETATM 3455 O  O   . HOH H 4 .   ? 15.429  25.990 11.923  1.00 21.97 ? 327 HOH B O   1 
HETATM 3456 O  O   . HOH H 4 .   ? 11.593  19.402 11.395  1.00 44.55 ? 328 HOH B O   1 
HETATM 3457 O  O   . HOH H 4 .   ? -11.919 28.997 0.711   1.00 34.75 ? 329 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   GLN 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   4   THR THR A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  TYR 23  23  23  TYR TYR A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  ASN 31  31  31  ASN ASN A . n 
A 1 32  PRO 32  32  32  PRO PRO A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  MET 34  34  34  MET MET A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  TYR 36  36  36  TYR TYR A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  HIS 40  40  40  HIS HIS A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  TYR 64  64  64  TYR TYR A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  PHE 66  66  66  PHE PHE A . n 
A 1 67  GLN 67  67  67  GLN GLN A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  HIS 78  78  78  HIS HIS A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  HIS 83  83  83  HIS HIS A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  MET 88  88  88  MET MET A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  CYS 91  91  91  CYS CYS A . n 
A 1 92  MET 92  92  92  MET MET A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 HIS 103 103 103 HIS HIS A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 THR 113 113 113 THR THR A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 ASN 124 124 124 ASN ASN A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 CYS 156 156 156 CYS CYS A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 SER 168 168 168 SER SER A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 GLN 170 170 170 GLN GLN A . n 
A 1 171 ARG 171 171 171 ARG ARG A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 ASN 178 178 178 ASN ASN A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 TRP 180 180 180 TRP TRP A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 ASN 184 184 184 ASN ASN A . n 
A 1 185 ARG 185 185 185 ARG ARG A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 GLN 190 190 190 GLN GLN A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLU 205 205 205 GLU GLU A . n 
A 1 206 TYR 206 206 206 TYR TYR A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 GLY 208 208 208 GLY GLY A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 GLU 210 210 210 GLU GLU A . n 
A 1 211 HIS 211 211 ?   ?   ?   A . n 
A 1 212 HIS 212 212 ?   ?   ?   A . n 
A 1 213 HIS 213 213 ?   ?   ?   A . n 
A 1 214 HIS 214 214 ?   ?   ?   A . n 
A 1 215 HIS 215 215 ?   ?   ?   A . n 
A 1 216 HIS 216 216 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   ?   ?   ?   B . n 
B 1 3   GLN 3   3   ?   ?   ?   B . n 
B 1 4   THR 4   4   4   THR THR B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   THR 6   6   6   THR THR B . n 
B 1 7   TYR 7   7   7   TYR TYR B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   ASN 9   9   9   ASN ASN B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  GLU 11  11  11  GLU GLU B . n 
B 1 12  ALA 12  12  12  ALA ALA B . n 
B 1 13  LEU 13  13  13  LEU LEU B . n 
B 1 14  GLU 14  14  14  GLU GLU B . n 
B 1 15  ASN 15  15  15  ASN ASN B . n 
B 1 16  ALA 16  16  16  ALA ALA B . n 
B 1 17  GLU 17  17  17  GLU GLU B . n 
B 1 18  THR 18  18  18  THR THR B . n 
B 1 19  VAL 19  19  19  VAL VAL B . n 
B 1 20  GLY 20  20  20  GLY GLY B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  ALA 22  22  22  ALA ALA B . n 
B 1 23  TYR 23  23  23  TYR TYR B . n 
B 1 24  ASN 24  24  24  ASN ASN B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  VAL 27  27  27  VAL VAL B . n 
B 1 28  LYS 28  28  28  LYS LYS B . n 
B 1 29  ARG 29  29  29  ARG ARG B . n 
B 1 30  GLN 30  30  30  GLN GLN B . n 
B 1 31  ASN 31  31  31  ASN ASN B . n 
B 1 32  PRO 32  32  32  PRO PRO B . n 
B 1 33  SER 33  33  33  SER SER B . n 
B 1 34  MET 34  34  34  MET MET B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  TYR 36  36  36  TYR TYR B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  SER 38  38  38  SER SER B . n 
B 1 39  PRO 39  39  39  PRO PRO B . n 
B 1 40  HIS 40  40  40  HIS HIS B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  GLY 42  42  42  GLY GLY B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  ILE 44  44  44  ILE ILE B . n 
B 1 45  GLU 45  45  45  GLU GLU B . n 
B 1 46  VAL 46  46  46  VAL VAL B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  THR 48  48  48  THR THR B . n 
B 1 49  THR 49  49  49  THR THR B . n 
B 1 50  GLU 50  50  50  GLU GLU B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  ILE 52  52  52  ILE ILE B . n 
B 1 53  TYR 53  53  53  TYR TYR B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  VAL 56  56  56  VAL VAL B . n 
B 1 57  GLU 57  57  57  GLU GLU B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  THR 59  59  59  THR THR B . n 
B 1 60  GLY 60  60  60  GLY GLY B . n 
B 1 61  GLY 61  61  61  GLY GLY B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  TYR 64  64  64  TYR TYR B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  PHE 66  66  66  PHE PHE B . n 
B 1 67  GLN 67  67  67  GLN GLN B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  LEU 70  70  70  LEU LEU B . n 
B 1 71  PRO 71  71  71  PRO PRO B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  GLY 73  73  73  GLY GLY B . n 
B 1 74  ASN 74  74  74  ASN ASN B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  ARG 76  76  76  ARG ARG B . n 
B 1 77  LEU 77  77  77  LEU LEU B . n 
B 1 78  HIS 78  78  78  HIS HIS B . n 
B 1 79  VAL 79  79  79  VAL VAL B . n 
B 1 80  THR 80  80  80  THR THR B . n 
B 1 81  SER 81  81  81  SER SER B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  HIS 83  83  83  HIS HIS B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  PRO 87  87  87  PRO PRO B . n 
B 1 88  MET 88  88  88  MET MET B . n 
B 1 89  ALA 89  89  89  ALA ALA B . n 
B 1 90  VAL 90  90  90  VAL VAL B . n 
B 1 91  CYS 91  91  91  CYS CYS B . n 
B 1 92  MET 92  92  92  MET MET B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  SER 94  94  94  SER SER B . n 
B 1 95  LYS 95  95  95  LYS LYS B . n 
B 1 96  HIS 96  96  96  HIS HIS B . n 
B 1 97  THR 97  97  97  THR THR B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  ALA 99  99  99  ALA ALA B . n 
B 1 100 VAL 100 100 100 VAL VAL B . n 
B 1 101 SER 101 101 101 SER SER B . n 
B 1 102 PHE 102 102 102 PHE PHE B . n 
B 1 103 HIS 103 103 103 HIS HIS B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 ASP 107 107 107 ASP ASP B . n 
B 1 108 ASP 108 108 108 ASP ASP B . n 
B 1 109 TYR 109 109 109 TYR TYR B . n 
B 1 110 ASN 110 110 110 ASN ASN B . n 
B 1 111 LYS 111 111 111 LYS LYS B . n 
B 1 112 ASN 112 112 112 ASN ASN B . n 
B 1 113 THR 113 113 113 THR THR B . n 
B 1 114 LEU 114 114 114 LEU LEU B . n 
B 1 115 VAL 115 115 115 VAL VAL B . n 
B 1 116 GLY 116 116 116 GLY GLY B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 ASN 119 119 119 ASN ASN B . n 
B 1 120 THR 120 120 120 THR THR B . n 
B 1 121 GLU 121 121 121 GLU GLU B . n 
B 1 122 LEU 122 122 122 LEU LEU B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 ASN 124 124 124 ASN ASN B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 ILE 126 126 126 ILE ILE B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 SER 128 128 128 SER SER B . n 
B 1 129 LYS 129 129 129 LYS LYS B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASN 131 131 131 ASN ASN B . n 
B 1 132 SER 132 132 132 SER SER B . n 
B 1 133 LYS 133 133 133 LYS LYS B . n 
B 1 134 GLY 134 134 134 GLY GLY B . n 
B 1 135 ILE 135 135 135 ILE ILE B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 ALA 137 137 137 ALA ALA B . n 
B 1 138 GLU 138 138 138 GLU GLU B . n 
B 1 139 VAL 139 139 139 VAL VAL B . n 
B 1 140 ALA 140 140 140 ALA ALA B . n 
B 1 141 THR 141 141 141 THR THR B . n 
B 1 142 ASP 142 142 142 ASP ASP B . n 
B 1 143 ARG 143 143 143 ARG ARG B . n 
B 1 144 PHE 144 144 144 PHE PHE B . n 
B 1 145 THR 145 145 145 THR THR B . n 
B 1 146 ALA 146 146 146 ALA ALA B . n 
B 1 147 THR 147 147 147 THR THR B . n 
B 1 148 ASP 148 148 148 ASP ASP B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 ASP 150 150 150 ASP ASP B . n 
B 1 151 ASN 151 151 151 ASN ASN B . n 
B 1 152 ILE 152 152 152 ILE ILE B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 ASN 154 154 154 ASN ASN B . n 
B 1 155 ARG 155 155 155 ARG ARG B . n 
B 1 156 CYS 156 156 156 CYS CYS B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 SER 158 158 158 SER SER B . n 
B 1 159 GLY 159 159 159 GLY GLY B . n 
B 1 160 LYS 160 160 160 LYS LYS B . n 
B 1 161 GLY 161 161 161 GLY GLY B . n 
B 1 162 VAL 162 162 162 VAL VAL B . n 
B 1 163 GLN 163 163 163 GLN GLN B . n 
B 1 164 LEU 164 164 164 LEU LEU B . n 
B 1 165 GLU 165 165 165 GLU GLU B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 SER 167 167 167 SER SER B . n 
B 1 168 SER 168 168 168 SER SER B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 GLN 170 170 170 GLN GLN B . n 
B 1 171 ARG 171 171 171 ARG ARG B . n 
B 1 172 ARG 172 172 172 ARG ARG B . n 
B 1 173 ALA 173 173 173 ALA ALA B . n 
B 1 174 PHE 174 174 174 PHE PHE B . n 
B 1 175 PHE 175 175 175 PHE PHE B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ASN 177 177 177 ASN ASN B . n 
B 1 178 ASN 178 178 178 ASN ASN B . n 
B 1 179 ASP 179 179 179 ASP ASP B . n 
B 1 180 TRP 180 180 180 TRP TRP B . n 
B 1 181 SER 181 181 181 SER SER B . n 
B 1 182 LYS 182 182 182 LYS LYS B . n 
B 1 183 ALA 183 183 183 ALA ALA B . n 
B 1 184 ASN 184 184 184 ASN ASN B . n 
B 1 185 ARG 185 185 185 ARG ARG B . n 
B 1 186 GLY 186 186 186 GLY GLY B . n 
B 1 187 ASN 187 187 187 ASN ASN B . n 
B 1 188 VAL 188 188 188 VAL VAL B . n 
B 1 189 THR 189 189 189 THR THR B . n 
B 1 190 GLN 190 190 190 GLN GLN B . n 
B 1 191 GLU 191 191 191 GLU GLU B . n 
B 1 192 PHE 192 192 192 PHE PHE B . n 
B 1 193 LEU 193 193 193 LEU LEU B . n 
B 1 194 ASP 194 194 194 ASP ASP B . n 
B 1 195 TYR 195 195 195 TYR TYR B . n 
B 1 196 ALA 196 196 196 ALA ALA B . n 
B 1 197 GLU 197 197 197 GLU GLU B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 ILE 199 199 199 ILE ILE B . n 
B 1 200 LYS 200 200 200 LYS LYS B . n 
B 1 201 GLU 201 201 201 GLU GLU B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 GLU 203 203 203 GLU GLU B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLU 205 205 205 GLU GLU B . n 
B 1 206 TYR 206 206 206 TYR TYR B . n 
B 1 207 TYR 207 207 207 TYR TYR B . n 
B 1 208 GLY 208 208 208 GLY GLY B . n 
B 1 209 LEU 209 209 209 LEU LEU B . n 
B 1 210 GLU 210 210 210 GLU GLU B . n 
B 1 211 HIS 211 211 ?   ?   ?   B . n 
B 1 212 HIS 212 212 ?   ?   ?   B . n 
B 1 213 HIS 213 213 ?   ?   ?   B . n 
B 1 214 HIS 214 214 ?   ?   ?   B . n 
B 1 215 HIS 215 215 ?   ?   ?   B . n 
B 1 216 HIS 216 216 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2260  ? 
1 MORE         -108  ? 
1 'SSA (A^2)'  16100 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? A HIS 40  ? A HIS 40  ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 OE1 ? A GLU 45  ? A GLU 45  ? 1_555 105.1 ? 
2  ND1 ? A HIS 40  ? A HIS 40  ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 ND1 ? A HIS 103 ? A HIS 103 ? 1_555 98.1  ? 
3  OE1 ? A GLU 45  ? A GLU 45  ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 ND1 ? A HIS 103 ? A HIS 103 ? 1_555 103.6 ? 
4  ND1 ? A HIS 40  ? A HIS 40  ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 O4  ? D PO4 .   ? A PO4 261 ? 1_555 88.0  ? 
5  OE1 ? A GLU 45  ? A GLU 45  ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 O4  ? D PO4 .   ? A PO4 261 ? 1_555 143.3 ? 
6  ND1 ? A HIS 103 ? A HIS 103 ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 O4  ? D PO4 .   ? A PO4 261 ? 1_555 108.3 ? 
7  ND1 ? A HIS 40  ? A HIS 40  ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 O   ? G HOH .   ? A HOH 294 ? 1_555 156.0 ? 
8  OE1 ? A GLU 45  ? A GLU 45  ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 O   ? G HOH .   ? A HOH 294 ? 1_555 89.1  ? 
9  ND1 ? A HIS 103 ? A HIS 103 ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 O   ? G HOH .   ? A HOH 294 ? 1_555 97.1  ? 
10 O4  ? D PO4 .   ? A PO4 261 ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 O   ? G HOH .   ? A HOH 294 ? 1_555 69.6  ? 
11 ND1 ? A HIS 40  ? A HIS 40  ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 OE2 ? A GLU 45  ? A GLU 45  ? 1_555 89.4  ? 
12 OE1 ? A GLU 45  ? A GLU 45  ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 OE2 ? A GLU 45  ? A GLU 45  ? 1_555 54.6  ? 
13 ND1 ? A HIS 103 ? A HIS 103 ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 OE2 ? A GLU 45  ? A GLU 45  ? 1_555 158.2 ? 
14 O4  ? D PO4 .   ? A PO4 261 ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 OE2 ? A GLU 45  ? A GLU 45  ? 1_555 92.3  ? 
15 O   ? G HOH .   ? A HOH 294 ? 1_555 ZN ? C ZN . ? A ZN 251 ? 1_555 OE2 ? A GLU 45  ? A GLU 45  ? 1_555 83.2  ? 
16 ND1 ? B HIS 40  ? B HIS 40  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 OE1 ? B GLU 45  ? B GLU 45  ? 1_555 97.8  ? 
17 ND1 ? B HIS 40  ? B HIS 40  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 OE2 ? B GLU 45  ? B GLU 45  ? 1_555 87.0  ? 
18 OE1 ? B GLU 45  ? B GLU 45  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 OE2 ? B GLU 45  ? B GLU 45  ? 1_555 62.3  ? 
19 ND1 ? B HIS 40  ? B HIS 40  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 ND1 ? B HIS 103 ? B HIS 103 ? 1_555 100.0 ? 
20 OE1 ? B GLU 45  ? B GLU 45  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 ND1 ? B HIS 103 ? B HIS 103 ? 1_555 102.8 ? 
21 OE2 ? B GLU 45  ? B GLU 45  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 ND1 ? B HIS 103 ? B HIS 103 ? 1_555 164.5 ? 
22 ND1 ? B HIS 40  ? B HIS 40  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 O   ? H HOH .   ? B HOH 259 ? 1_555 155.7 ? 
23 OE1 ? B GLU 45  ? B GLU 45  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 O   ? H HOH .   ? B HOH 259 ? 1_555 100.3 ? 
24 OE2 ? B GLU 45  ? B GLU 45  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 O   ? H HOH .   ? B HOH 259 ? 1_555 87.3  ? 
25 ND1 ? B HIS 103 ? B HIS 103 ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 O   ? H HOH .   ? B HOH 259 ? 1_555 91.5  ? 
26 ND1 ? B HIS 40  ? B HIS 40  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 O4  ? F PO4 .   ? B PO4 261 ? 1_555 86.9  ? 
27 OE1 ? B GLU 45  ? B GLU 45  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 O4  ? F PO4 .   ? B PO4 261 ? 1_555 149.0 ? 
28 OE2 ? B GLU 45  ? B GLU 45  ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 O4  ? F PO4 .   ? B PO4 261 ? 1_555 87.6  ? 
29 ND1 ? B HIS 103 ? B HIS 103 ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 O4  ? F PO4 .   ? B PO4 261 ? 1_555 106.5 ? 
30 O   ? H HOH .   ? B HOH 259 ? 1_555 ZN ? E ZN . ? B ZN 251 ? 1_555 O4  ? F PO4 .   ? B PO4 261 ? 1_555 69.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-11-10 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-02-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
UGUI@PF  'data collection' .        ? 1 
SOLVE    phasing           .        ? 2 
REFMAC   refinement        5.5.0072 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OH B TYR 7   ? ? O B HOH 235 ? ? 1.69 
2 1 O  B HOH 323 ? ? O B HOH 326 ? ? 2.02 
3 1 O  B PRO 71  ? ? O B HOH 321 ? ? 2.05 
4 1 CZ B TYR 7   ? ? O B HOH 235 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 30  ? ? -152.88 9.82   
2 1 ASP A 107 ? ? -165.37 95.00  
3 1 THR A 141 ? ? -135.75 -67.32 
4 1 ASN A 177 ? ? 82.47   7.58   
5 1 GLN B 30  ? ? -147.15 11.69  
6 1 ILE B 44  ? ? -64.32  -71.23 
7 1 THR B 141 ? ? -136.70 -34.95 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A GLN 3   ? A GLN 3   
4  1 Y 1 A HIS 211 ? A HIS 211 
5  1 Y 1 A HIS 212 ? A HIS 212 
6  1 Y 1 A HIS 213 ? A HIS 213 
7  1 Y 1 A HIS 214 ? A HIS 214 
8  1 Y 1 A HIS 215 ? A HIS 215 
9  1 Y 1 A HIS 216 ? A HIS 216 
10 1 Y 1 B MET 1   ? B MET 1   
11 1 Y 1 B ALA 2   ? B ALA 2   
12 1 Y 1 B GLN 3   ? B GLN 3   
13 1 Y 1 B HIS 211 ? B HIS 211 
14 1 Y 1 B HIS 212 ? B HIS 212 
15 1 Y 1 B HIS 213 ? B HIS 213 
16 1 Y 1 B HIS 214 ? B HIS 214 
17 1 Y 1 B HIS 215 ? B HIS 215 
18 1 Y 1 B HIS 216 ? B HIS 216 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'      ZN  
3 'PHOSPHATE ION' PO4 
4 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1   251 251 ZN  ZN  A . 
D 3 PO4 1   261 261 PO4 PO4 A . 
E 2 ZN  1   251 251 ZN  ZN  B . 
F 3 PO4 1   261 261 PO4 PO4 B . 
G 4 HOH 1   217 1   HOH HOH A . 
G 4 HOH 2   218 2   HOH HOH A . 
G 4 HOH 3   219 3   HOH HOH A . 
G 4 HOH 4   220 4   HOH HOH A . 
G 4 HOH 5   221 5   HOH HOH A . 
G 4 HOH 6   222 6   HOH HOH A . 
G 4 HOH 7   223 7   HOH HOH A . 
G 4 HOH 8   224 8   HOH HOH A . 
G 4 HOH 9   225 9   HOH HOH A . 
G 4 HOH 10  226 10  HOH HOH A . 
G 4 HOH 11  227 11  HOH HOH A . 
G 4 HOH 12  228 12  HOH HOH A . 
G 4 HOH 13  229 13  HOH HOH A . 
G 4 HOH 14  230 14  HOH HOH A . 
G 4 HOH 15  231 15  HOH HOH A . 
G 4 HOH 16  232 16  HOH HOH A . 
G 4 HOH 17  233 17  HOH HOH A . 
G 4 HOH 18  234 18  HOH HOH A . 
G 4 HOH 19  235 19  HOH HOH A . 
G 4 HOH 20  236 20  HOH HOH A . 
G 4 HOH 21  237 21  HOH HOH A . 
G 4 HOH 22  238 22  HOH HOH A . 
G 4 HOH 23  239 23  HOH HOH A . 
G 4 HOH 24  240 24  HOH HOH A . 
G 4 HOH 25  242 26  HOH HOH A . 
G 4 HOH 26  243 27  HOH HOH A . 
G 4 HOH 27  244 28  HOH HOH A . 
G 4 HOH 28  245 29  HOH HOH A . 
G 4 HOH 29  246 30  HOH HOH A . 
G 4 HOH 30  247 31  HOH HOH A . 
G 4 HOH 31  248 32  HOH HOH A . 
G 4 HOH 32  249 33  HOH HOH A . 
G 4 HOH 33  250 34  HOH HOH A . 
G 4 HOH 34  252 35  HOH HOH A . 
G 4 HOH 35  253 36  HOH HOH A . 
G 4 HOH 36  254 37  HOH HOH A . 
G 4 HOH 37  255 38  HOH HOH A . 
G 4 HOH 38  256 39  HOH HOH A . 
G 4 HOH 39  257 40  HOH HOH A . 
G 4 HOH 40  258 41  HOH HOH A . 
G 4 HOH 41  259 42  HOH HOH A . 
G 4 HOH 42  260 43  HOH HOH A . 
G 4 HOH 43  262 44  HOH HOH A . 
G 4 HOH 44  263 45  HOH HOH A . 
G 4 HOH 45  264 46  HOH HOH A . 
G 4 HOH 46  265 47  HOH HOH A . 
G 4 HOH 47  266 48  HOH HOH A . 
G 4 HOH 48  267 49  HOH HOH A . 
G 4 HOH 49  268 50  HOH HOH A . 
G 4 HOH 50  269 51  HOH HOH A . 
G 4 HOH 51  270 52  HOH HOH A . 
G 4 HOH 52  271 53  HOH HOH A . 
G 4 HOH 53  272 54  HOH HOH A . 
G 4 HOH 54  273 55  HOH HOH A . 
G 4 HOH 55  274 56  HOH HOH A . 
G 4 HOH 56  275 57  HOH HOH A . 
G 4 HOH 57  276 58  HOH HOH A . 
G 4 HOH 58  277 59  HOH HOH A . 
G 4 HOH 59  278 60  HOH HOH A . 
G 4 HOH 60  279 61  HOH HOH A . 
G 4 HOH 61  280 62  HOH HOH A . 
G 4 HOH 62  281 63  HOH HOH A . 
G 4 HOH 63  282 64  HOH HOH A . 
G 4 HOH 64  283 65  HOH HOH A . 
G 4 HOH 65  284 66  HOH HOH A . 
G 4 HOH 66  285 67  HOH HOH A . 
G 4 HOH 67  286 68  HOH HOH A . 
G 4 HOH 68  287 69  HOH HOH A . 
G 4 HOH 69  288 70  HOH HOH A . 
G 4 HOH 70  289 71  HOH HOH A . 
G 4 HOH 71  290 72  HOH HOH A . 
G 4 HOH 72  291 73  HOH HOH A . 
G 4 HOH 73  292 74  HOH HOH A . 
G 4 HOH 74  293 75  HOH HOH A . 
G 4 HOH 75  294 76  HOH HOH A . 
G 4 HOH 76  295 77  HOH HOH A . 
G 4 HOH 77  296 78  HOH HOH A . 
G 4 HOH 78  297 79  HOH HOH A . 
G 4 HOH 79  298 80  HOH HOH A . 
G 4 HOH 80  299 81  HOH HOH A . 
G 4 HOH 81  300 82  HOH HOH A . 
G 4 HOH 82  301 83  HOH HOH A . 
G 4 HOH 83  302 84  HOH HOH A . 
G 4 HOH 84  303 85  HOH HOH A . 
G 4 HOH 85  304 86  HOH HOH A . 
G 4 HOH 86  305 87  HOH HOH A . 
G 4 HOH 87  306 88  HOH HOH A . 
G 4 HOH 88  307 89  HOH HOH A . 
G 4 HOH 89  308 90  HOH HOH A . 
G 4 HOH 90  309 91  HOH HOH A . 
G 4 HOH 91  310 92  HOH HOH A . 
G 4 HOH 92  311 93  HOH HOH A . 
G 4 HOH 93  312 94  HOH HOH A . 
G 4 HOH 94  313 95  HOH HOH A . 
G 4 HOH 95  314 96  HOH HOH A . 
G 4 HOH 96  315 97  HOH HOH A . 
G 4 HOH 97  316 98  HOH HOH A . 
G 4 HOH 98  317 99  HOH HOH A . 
G 4 HOH 99  318 100 HOH HOH A . 
G 4 HOH 100 319 101 HOH HOH A . 
G 4 HOH 101 320 102 HOH HOH A . 
G 4 HOH 102 321 103 HOH HOH A . 
G 4 HOH 103 322 104 HOH HOH A . 
G 4 HOH 104 323 105 HOH HOH A . 
G 4 HOH 105 324 106 HOH HOH A . 
G 4 HOH 106 325 107 HOH HOH A . 
G 4 HOH 107 326 108 HOH HOH A . 
G 4 HOH 108 327 109 HOH HOH A . 
G 4 HOH 109 328 110 HOH HOH A . 
G 4 HOH 110 329 111 HOH HOH A . 
G 4 HOH 111 330 112 HOH HOH A . 
G 4 HOH 112 331 113 HOH HOH A . 
G 4 HOH 113 332 114 HOH HOH A . 
G 4 HOH 114 333 115 HOH HOH A . 
G 4 HOH 115 334 116 HOH HOH A . 
G 4 HOH 116 335 117 HOH HOH A . 
H 4 HOH 1   217 1   HOH HOH B . 
H 4 HOH 2   218 2   HOH HOH B . 
H 4 HOH 3   219 3   HOH HOH B . 
H 4 HOH 4   220 4   HOH HOH B . 
H 4 HOH 5   221 5   HOH HOH B . 
H 4 HOH 6   222 6   HOH HOH B . 
H 4 HOH 7   223 7   HOH HOH B . 
H 4 HOH 8   224 8   HOH HOH B . 
H 4 HOH 9   225 9   HOH HOH B . 
H 4 HOH 10  226 10  HOH HOH B . 
H 4 HOH 11  227 11  HOH HOH B . 
H 4 HOH 12  228 12  HOH HOH B . 
H 4 HOH 13  229 13  HOH HOH B . 
H 4 HOH 14  230 14  HOH HOH B . 
H 4 HOH 15  231 15  HOH HOH B . 
H 4 HOH 16  232 16  HOH HOH B . 
H 4 HOH 17  233 17  HOH HOH B . 
H 4 HOH 18  234 18  HOH HOH B . 
H 4 HOH 19  235 19  HOH HOH B . 
H 4 HOH 20  236 20  HOH HOH B . 
H 4 HOH 21  237 21  HOH HOH B . 
H 4 HOH 22  238 22  HOH HOH B . 
H 4 HOH 23  239 23  HOH HOH B . 
H 4 HOH 24  240 24  HOH HOH B . 
H 4 HOH 25  241 25  HOH HOH B . 
H 4 HOH 26  242 26  HOH HOH B . 
H 4 HOH 27  243 27  HOH HOH B . 
H 4 HOH 28  244 28  HOH HOH B . 
H 4 HOH 29  245 29  HOH HOH B . 
H 4 HOH 30  246 30  HOH HOH B . 
H 4 HOH 31  247 31  HOH HOH B . 
H 4 HOH 32  248 32  HOH HOH B . 
H 4 HOH 33  249 33  HOH HOH B . 
H 4 HOH 34  250 34  HOH HOH B . 
H 4 HOH 35  252 35  HOH HOH B . 
H 4 HOH 36  253 36  HOH HOH B . 
H 4 HOH 37  254 37  HOH HOH B . 
H 4 HOH 38  255 38  HOH HOH B . 
H 4 HOH 39  256 39  HOH HOH B . 
H 4 HOH 40  257 40  HOH HOH B . 
H 4 HOH 41  258 41  HOH HOH B . 
H 4 HOH 42  259 42  HOH HOH B . 
H 4 HOH 43  260 43  HOH HOH B . 
H 4 HOH 44  262 44  HOH HOH B . 
H 4 HOH 45  263 45  HOH HOH B . 
H 4 HOH 46  264 46  HOH HOH B . 
H 4 HOH 47  265 47  HOH HOH B . 
H 4 HOH 48  266 48  HOH HOH B . 
H 4 HOH 49  267 49  HOH HOH B . 
H 4 HOH 50  268 50  HOH HOH B . 
H 4 HOH 51  269 51  HOH HOH B . 
H 4 HOH 52  270 52  HOH HOH B . 
H 4 HOH 53  271 53  HOH HOH B . 
H 4 HOH 54  272 54  HOH HOH B . 
H 4 HOH 55  273 55  HOH HOH B . 
H 4 HOH 56  274 56  HOH HOH B . 
H 4 HOH 57  275 57  HOH HOH B . 
H 4 HOH 58  276 58  HOH HOH B . 
H 4 HOH 59  277 59  HOH HOH B . 
H 4 HOH 60  278 60  HOH HOH B . 
H 4 HOH 61  279 61  HOH HOH B . 
H 4 HOH 62  280 62  HOH HOH B . 
H 4 HOH 63  281 63  HOH HOH B . 
H 4 HOH 64  282 64  HOH HOH B . 
H 4 HOH 65  283 65  HOH HOH B . 
H 4 HOH 66  284 66  HOH HOH B . 
H 4 HOH 67  285 67  HOH HOH B . 
H 4 HOH 68  286 68  HOH HOH B . 
H 4 HOH 69  287 69  HOH HOH B . 
H 4 HOH 70  288 70  HOH HOH B . 
H 4 HOH 71  289 71  HOH HOH B . 
H 4 HOH 72  290 72  HOH HOH B . 
H 4 HOH 73  291 73  HOH HOH B . 
H 4 HOH 74  292 74  HOH HOH B . 
H 4 HOH 75  293 75  HOH HOH B . 
H 4 HOH 76  294 76  HOH HOH B . 
H 4 HOH 77  295 77  HOH HOH B . 
H 4 HOH 78  296 78  HOH HOH B . 
H 4 HOH 79  297 79  HOH HOH B . 
H 4 HOH 80  298 80  HOH HOH B . 
H 4 HOH 81  299 81  HOH HOH B . 
H 4 HOH 82  300 82  HOH HOH B . 
H 4 HOH 83  301 83  HOH HOH B . 
H 4 HOH 84  302 84  HOH HOH B . 
H 4 HOH 85  303 85  HOH HOH B . 
H 4 HOH 86  304 86  HOH HOH B . 
H 4 HOH 87  305 87  HOH HOH B . 
H 4 HOH 88  306 88  HOH HOH B . 
H 4 HOH 89  307 89  HOH HOH B . 
H 4 HOH 90  308 90  HOH HOH B . 
H 4 HOH 91  309 91  HOH HOH B . 
H 4 HOH 92  310 92  HOH HOH B . 
H 4 HOH 93  311 93  HOH HOH B . 
H 4 HOH 94  312 94  HOH HOH B . 
H 4 HOH 95  313 95  HOH HOH B . 
H 4 HOH 96  314 96  HOH HOH B . 
H 4 HOH 97  315 97  HOH HOH B . 
H 4 HOH 98  316 98  HOH HOH B . 
H 4 HOH 99  317 99  HOH HOH B . 
H 4 HOH 100 318 100 HOH HOH B . 
H 4 HOH 101 319 101 HOH HOH B . 
H 4 HOH 102 320 102 HOH HOH B . 
H 4 HOH 103 321 103 HOH HOH B . 
H 4 HOH 104 322 104 HOH HOH B . 
H 4 HOH 105 323 105 HOH HOH B . 
H 4 HOH 106 324 106 HOH HOH B . 
H 4 HOH 107 325 107 HOH HOH B . 
H 4 HOH 108 326 108 HOH HOH B . 
H 4 HOH 109 327 109 HOH HOH B . 
H 4 HOH 110 328 110 HOH HOH B . 
H 4 HOH 111 329 25  HOH HOH B . 
#