data_3ADL
# 
_entry.id   3ADL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ADL         
NDB   NA0436       
RCSB  RCSB029119   
WWPDB D_1000029119 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3ADG . unspecified 
PDB 3ADI . unspecified 
PDB 3ADJ . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ADL 
_pdbx_database_status.recvd_initial_deposition_date   2010-01-22 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yuan, Y.A.' 1 
'Chen, H.Y.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            18 
_citation.page_first                594 
_citation.page_last                 605 
_citation.year                      2010 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20462493 
_citation.pdbx_database_id_DOI      10.1016/j.str.2010.02.006 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yang, S.W.'  1 
primary 'Chen, H.Y.'  2 
primary 'Yang, J.'    3 
primary 'Machida, S.' 4 
primary 'Chua, N.H.'  5 
primary 'Yuan, Y.A.'  6 
# 
_cell.entry_id           3ADL 
_cell.length_a           55.300 
_cell.length_b           60.425 
_cell.length_c           99.892 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3ADL 
_symmetry.space_group_name_H-M             'I 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                24 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'RISC-loading complex subunit TARBP2'           9931.413 1  ? ? 'DRBM 2 domain, UNP residues 161-231' ? 
2 polymer syn 
;RNA (5'-R(P*CP*GP*CP*GP*CP*GP*CP*GP*CP*G)-3')
;
3206.980 2  ? ? ?                                     ? 
3 water   nat water                                           18.015   47 ? ? ?                                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TAR RNA-binding protein 2, Trans-activation-responsive RNA-binding protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;HHHHHHSSGLVPRGSHEVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLL
RVHTVPLD
;
;HHHHHHSSGLVPRGSHEVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLL
RVHTVPLD
;
A   ? 
2 polyribonucleotide no no CGCGCGCGCG                                                                                  CGCGCGCGCG 
B,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  HIS n 
1 2  HIS n 
1 3  HIS n 
1 4  HIS n 
1 5  HIS n 
1 6  HIS n 
1 7  SER n 
1 8  SER n 
1 9  GLY n 
1 10 LEU n 
1 11 VAL n 
1 12 PRO n 
1 13 ARG n 
1 14 GLY n 
1 15 SER n 
1 16 HIS n 
1 17 GLU n 
1 18 VAL n 
1 19 GLY n 
1 20 ALA n 
1 21 LEU n 
1 22 GLN n 
1 23 GLU n 
1 24 LEU n 
1 25 VAL n 
1 26 VAL n 
1 27 GLN n 
1 28 LYS n 
1 29 GLY n 
1 30 TRP n 
1 31 ARG n 
1 32 LEU n 
1 33 PRO n 
1 34 GLU n 
1 35 TYR n 
1 36 THR n 
1 37 VAL n 
1 38 THR n 
1 39 GLN n 
1 40 GLU n 
1 41 SER n 
1 42 GLY n 
1 43 PRO n 
1 44 ALA n 
1 45 HIS n 
1 46 ARG n 
1 47 LYS n 
1 48 GLU n 
1 49 PHE n 
1 50 THR n 
1 51 MET n 
1 52 THR n 
1 53 CYS n 
1 54 ARG n 
1 55 VAL n 
1 56 GLU n 
1 57 ARG n 
1 58 PHE n 
1 59 ILE n 
1 60 GLU n 
1 61 ILE n 
1 62 GLY n 
1 63 SER n 
1 64 GLY n 
1 65 THR n 
1 66 SER n 
1 67 LYS n 
1 68 LYS n 
1 69 LEU n 
1 70 ALA n 
1 71 LYS n 
1 72 ARG n 
1 73 ASN n 
1 74 ALA n 
1 75 ALA n 
1 76 ALA n 
1 77 LYS n 
1 78 MET n 
1 79 LEU n 
1 80 LEU n 
1 81 ARG n 
1 82 VAL n 
1 83 HIS n 
1 84 THR n 
1 85 VAL n 
1 86 PRO n 
1 87 LEU n 
1 88 ASP n 
2 1  C   n 
2 2  G   n 
2 3  C   n 
2 4  G   n 
2 5  C   n 
2 6  G   n 
2 7  C   n 
2 8  G   n 
2 9  C   n 
2 10 G   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TARBP2, TRBP' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Synthetic RNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TRBP2_HUMAN Q15633 1 VGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLD 161 ? 
2 PDB 3ADL        3ADL   2 ?                                                                       ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ADL A 18 ? 88 ? Q15633 161 ? 231 ? 161 231 
2 2 3ADL B 1  ? 10 ? 3ADL   1   ? 10  ? 1   10  
3 2 3ADL C 1  ? 10 ? 3ADL   1   ? 10  ? 1   10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ADL HIS A 1  ? UNP Q15633 ? ? 'EXPRESSION TAG' 144 1  
1 3ADL HIS A 2  ? UNP Q15633 ? ? 'EXPRESSION TAG' 145 2  
1 3ADL HIS A 3  ? UNP Q15633 ? ? 'EXPRESSION TAG' 146 3  
1 3ADL HIS A 4  ? UNP Q15633 ? ? 'EXPRESSION TAG' 147 4  
1 3ADL HIS A 5  ? UNP Q15633 ? ? 'EXPRESSION TAG' 148 5  
1 3ADL HIS A 6  ? UNP Q15633 ? ? 'EXPRESSION TAG' 149 6  
1 3ADL SER A 7  ? UNP Q15633 ? ? 'EXPRESSION TAG' 150 7  
1 3ADL SER A 8  ? UNP Q15633 ? ? 'EXPRESSION TAG' 151 8  
1 3ADL GLY A 9  ? UNP Q15633 ? ? 'EXPRESSION TAG' 152 9  
1 3ADL LEU A 10 ? UNP Q15633 ? ? 'EXPRESSION TAG' 153 10 
1 3ADL VAL A 11 ? UNP Q15633 ? ? 'EXPRESSION TAG' 154 11 
1 3ADL PRO A 12 ? UNP Q15633 ? ? 'EXPRESSION TAG' 155 12 
1 3ADL ARG A 13 ? UNP Q15633 ? ? 'EXPRESSION TAG' 156 13 
1 3ADL GLY A 14 ? UNP Q15633 ? ? 'EXPRESSION TAG' 157 14 
1 3ADL SER A 15 ? UNP Q15633 ? ? 'EXPRESSION TAG' 158 15 
1 3ADL HIS A 16 ? UNP Q15633 ? ? 'EXPRESSION TAG' 159 16 
1 3ADL GLU A 17 ? UNP Q15633 ? ? 'EXPRESSION TAG' 160 17 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3ADL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_percent_sol   51.81 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'AS, MgSO4, Cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    1.1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3ADL 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   8276 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.046 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              14.4 
_reflns.pdbx_netI_over_sigmaI        54 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.3 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.293 
_reflns_shell.meanI_over_sigI_obs    10.1 
_reflns_shell.pdbx_redundancy        10 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3ADL 
_refine.ls_number_reflns_obs                     8276 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.84 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.04 
_refine.ls_R_factor_obs                          0.26267 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.26075 
_refine.ls_R_factor_R_free                       0.29836 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  407 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.904 
_refine.correlation_coeff_Fo_to_Fc_free          0.866 
_refine.B_iso_mean                               47.367 
_refine.aniso_B[1][1]                            1.78 
_refine.aniso_B[2][2]                            -2.18 
_refine.aniso_B[3][3]                            0.40 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1DI2' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.304 
_refine.pdbx_overall_ESU_R_Free                  0.241 
_refine.overall_SU_ML                            0.160 
_refine.overall_SU_B                             13.165 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        595 
_refine_hist.pdbx_number_atoms_nucleic_acid   430 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             47 
_refine_hist.number_atoms_total               1072 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        25.84 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.012  0.021  ? 1084 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.492  2.459  ? 1556 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.152  5.000  ? 75   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   38.303 21.600 ? 25   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   16.825 15.000 ? 115  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   15.155 15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.089  0.200  ? 191  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 655  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.192  0.200  ? 299  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.292  0.200  ? 630  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.148  0.200  ? 48   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.236  0.200  ? 37   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.091  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.798  1.500  ? 391  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.228  2.000  ? 604  'X-RAY DIFFRACTION' ? 
r_scbond_it              1.778  3.000  ? 942  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.499  4.500  ? 952  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.204 
_refine_ls_shell.d_res_low                        2.262 
_refine_ls_shell.number_reflns_R_work             577 
_refine_ls_shell.R_factor_R_work                  0.227 
_refine_ls_shell.percent_reflns_obs               98.21 
_refine_ls_shell.R_factor_R_free                  0.219 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             28 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3ADL 
_struct.title                     'Structure of TRBP2 and its molecule implications for miRNA processing' 
_struct.pdbx_descriptor           'RISC-loading complex subunit TARBP2/RNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ADL 
_struct_keywords.pdbx_keywords   'GENE REGULATION/RNA' 
_struct_keywords.text            'TRBP2, miRNA processing, GENE REGULATION-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS A 16 ? LYS A 28 ? HIS A 159 LYS A 171 1 ? 13 
HELX_P HELX_P2 2 SER A 66 ? THR A 84 ? SER A 209 THR A 227 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B C 1  N3 ? ? ? 1_555 C G 10 N1 ? ? B C 1  C G 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog2  hydrog ? ? B C 1  N4 ? ? ? 1_555 C G 10 O6 ? ? B C 1  C G 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3  hydrog ? ? B C 1  O2 ? ? ? 1_555 C G 10 N2 ? ? B C 1  C G 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog4  hydrog ? ? B G 2  N1 ? ? ? 1_555 C C 9  N3 ? ? B G 2  C C 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog5  hydrog ? ? B G 2  N2 ? ? ? 1_555 C C 9  O2 ? ? B G 2  C C 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6  hydrog ? ? B G 2  O6 ? ? ? 1_555 C C 9  N4 ? ? B G 2  C C 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog7  hydrog ? ? B C 3  N3 ? ? ? 1_555 C G 8  N1 ? ? B C 3  C G 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog8  hydrog ? ? B C 3  N4 ? ? ? 1_555 C G 8  O6 ? ? B C 3  C G 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog9  hydrog ? ? B C 3  O2 ? ? ? 1_555 C G 8  N2 ? ? B C 3  C G 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog10 hydrog ? ? B G 4  N1 ? ? ? 1_555 C C 7  N3 ? ? B G 4  C C 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog11 hydrog ? ? B G 4  N2 ? ? ? 1_555 C C 7  O2 ? ? B G 4  C C 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog12 hydrog ? ? B G 4  O6 ? ? ? 1_555 C C 7  N4 ? ? B G 4  C C 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog13 hydrog ? ? B C 5  N3 ? ? ? 1_555 C G 6  N1 ? ? B C 5  C G 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog14 hydrog ? ? B C 5  N4 ? ? ? 1_555 C G 6  O6 ? ? B C 5  C G 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog15 hydrog ? ? B C 5  O2 ? ? ? 1_555 C G 6  N2 ? ? B C 5  C G 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16 hydrog ? ? B G 6  N1 ? ? ? 1_555 C C 5  N3 ? ? B G 6  C C 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17 hydrog ? ? B G 6  N2 ? ? ? 1_555 C C 5  O2 ? ? B G 6  C C 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18 hydrog ? ? B G 6  O6 ? ? ? 1_555 C C 5  N4 ? ? B G 6  C C 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog19 hydrog ? ? B C 7  N3 ? ? ? 1_555 C G 4  N1 ? ? B C 7  C G 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog20 hydrog ? ? B C 7  N4 ? ? ? 1_555 C G 4  O6 ? ? B C 7  C G 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog21 hydrog ? ? B C 7  O2 ? ? ? 1_555 C G 4  N2 ? ? B C 7  C G 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog22 hydrog ? ? B G 8  N1 ? ? ? 1_555 C C 3  N3 ? ? B G 8  C C 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog23 hydrog ? ? B G 8  N2 ? ? ? 1_555 C C 3  O2 ? ? B G 8  C C 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog24 hydrog ? ? B G 8  O6 ? ? ? 1_555 C C 3  N4 ? ? B G 8  C C 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog25 hydrog ? ? B C 9  N3 ? ? ? 1_555 C G 2  N2 ? ? B C 9  C G 2  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog26 hydrog ? ? B C 9  O2 ? ? ? 1_555 C G 2  N1 ? ? B C 9  C G 2  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog27 hydrog ? ? B G 10 N2 ? ? ? 1_555 C C 1  N3 ? ? B G 10 C C 1  1_555 ? ? ? ? ? ? 'G-C PAIR'              ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 34 ? SER A 41 ? GLU A 177 SER A 184 
A 2 GLU A 48 ? VAL A 55 ? GLU A 191 VAL A 198 
A 3 PHE A 58 ? GLY A 64 ? PHE A 201 GLY A 207 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 36 ? N THR A 179 O THR A 52 ? O THR A 195 
A 2 3 N PHE A 49 ? N PHE A 192 O GLY A 64 ? O GLY A 207 
# 
_database_PDB_matrix.entry_id          3ADL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ADL 
_atom_sites.fract_transf_matrix[1][1]   0.018083 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016549 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010011 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLY A 1 9  ? 13.522 -6.781  1.670   1.00 69.45 ? 152 GLY A N     1 
ATOM   2    C CA    . GLY A 1 9  ? 14.813 -7.514  1.502   1.00 69.09 ? 152 GLY A CA    1 
ATOM   3    C C     . GLY A 1 9  ? 15.916 -6.820  2.265   1.00 68.84 ? 152 GLY A C     1 
ATOM   4    O O     . GLY A 1 9  ? 16.016 -6.968  3.487   1.00 69.14 ? 152 GLY A O     1 
ATOM   5    N N     . LEU A 1 10 ? 16.739 -6.046  1.558   1.00 68.21 ? 153 LEU A N     1 
ATOM   6    C CA    . LEU A 1 10 ? 17.800 -5.307  2.235   1.00 67.25 ? 153 LEU A CA    1 
ATOM   7    C C     . LEU A 1 10 ? 17.622 -3.793  2.365   1.00 66.39 ? 153 LEU A C     1 
ATOM   8    O O     . LEU A 1 10 ? 17.191 -3.094  1.443   1.00 66.35 ? 153 LEU A O     1 
ATOM   9    C CB    . LEU A 1 10 ? 19.191 -5.668  1.706   1.00 67.23 ? 153 LEU A CB    1 
ATOM   10   C CG    . LEU A 1 10 ? 19.983 -6.723  2.490   1.00 67.88 ? 153 LEU A CG    1 
ATOM   11   C CD1   . LEU A 1 10 ? 21.459 -6.429  2.368   1.00 68.79 ? 153 LEU A CD1   1 
ATOM   12   C CD2   . LEU A 1 10 ? 19.606 -6.807  3.978   1.00 68.30 ? 153 LEU A CD2   1 
ATOM   13   N N     . VAL A 1 11 ? 17.970 -3.334  3.563   1.00 64.80 ? 154 VAL A N     1 
ATOM   14   C CA    . VAL A 1 11 ? 18.060 -1.941  3.953   1.00 62.93 ? 154 VAL A CA    1 
ATOM   15   C C     . VAL A 1 11 ? 19.567 -1.598  3.910   1.00 61.93 ? 154 VAL A C     1 
ATOM   16   O O     . VAL A 1 11 ? 20.394 -2.479  4.173   1.00 61.60 ? 154 VAL A O     1 
ATOM   17   C CB    . VAL A 1 11 ? 17.460 -1.828  5.384   1.00 63.06 ? 154 VAL A CB    1 
ATOM   18   C CG1   . VAL A 1 11 ? 18.052 -0.693  6.189   1.00 62.65 ? 154 VAL A CG1   1 
ATOM   19   C CG2   . VAL A 1 11 ? 15.920 -1.761  5.324   1.00 63.02 ? 154 VAL A CG2   1 
ATOM   20   N N     . PRO A 1 12 ? 19.939 -0.344  3.539   1.00 60.76 ? 155 PRO A N     1 
ATOM   21   C CA    . PRO A 1 12 ? 21.358 0.058   3.530   1.00 60.52 ? 155 PRO A CA    1 
ATOM   22   C C     . PRO A 1 12 ? 22.059 -0.091  4.894   1.00 60.11 ? 155 PRO A C     1 
ATOM   23   O O     . PRO A 1 12 ? 21.500 0.288   5.936   1.00 59.55 ? 155 PRO A O     1 
ATOM   24   C CB    . PRO A 1 12 ? 21.304 1.534   3.128   1.00 60.53 ? 155 PRO A CB    1 
ATOM   25   C CG    . PRO A 1 12 ? 20.026 1.687   2.419   1.00 60.07 ? 155 PRO A CG    1 
ATOM   26   C CD    . PRO A 1 12 ? 19.074 0.755   3.084   1.00 60.83 ? 155 PRO A CD    1 
ATOM   27   N N     . ARG A 1 13 ? 23.275 -0.630  4.863   1.00 59.80 ? 156 ARG A N     1 
ATOM   28   C CA    . ARG A 1 13 ? 24.038 -0.928  6.075   1.00 59.79 ? 156 ARG A CA    1 
ATOM   29   C C     . ARG A 1 13 ? 24.238 0.314   6.941   1.00 59.13 ? 156 ARG A C     1 
ATOM   30   O O     . ARG A 1 13 ? 24.734 1.344   6.471   1.00 58.77 ? 156 ARG A O     1 
ATOM   31   C CB    . ARG A 1 13 ? 25.386 -1.567  5.734   1.00 60.06 ? 156 ARG A CB    1 
ATOM   32   C CG    . ARG A 1 13 ? 26.113 -2.164  6.929   1.00 62.18 ? 156 ARG A CG    1 
ATOM   33   C CD    . ARG A 1 13 ? 27.619 -2.073  6.733   1.00 66.37 ? 156 ARG A CD    1 
ATOM   34   N NE    . ARG A 1 13 ? 28.377 -2.416  7.937   1.00 69.85 ? 156 ARG A NE    1 
ATOM   35   C CZ    . ARG A 1 13 ? 28.551 -1.613  8.989   1.00 71.84 ? 156 ARG A CZ    1 
ATOM   36   N NH1   . ARG A 1 13 ? 28.003 -0.398  9.021   1.00 72.53 ? 156 ARG A NH1   1 
ATOM   37   N NH2   . ARG A 1 13 ? 29.271 -2.035  10.024  1.00 73.08 ? 156 ARG A NH2   1 
ATOM   38   N N     . GLY A 1 14 ? 23.814 0.196   8.198   1.00 58.57 ? 157 GLY A N     1 
ATOM   39   C CA    . GLY A 1 14 ? 23.939 1.260   9.187   1.00 57.92 ? 157 GLY A CA    1 
ATOM   40   C C     . GLY A 1 14 ? 23.024 2.445   8.933   1.00 57.32 ? 157 GLY A C     1 
ATOM   41   O O     . GLY A 1 14 ? 23.385 3.576   9.257   1.00 58.17 ? 157 GLY A O     1 
ATOM   42   N N     . SER A 1 15 ? 21.863 2.195   8.323   1.00 55.66 ? 158 SER A N     1 
ATOM   43   C CA    . SER A 1 15 ? 20.864 3.235   8.095   1.00 54.08 ? 158 SER A CA    1 
ATOM   44   C C     . SER A 1 15 ? 19.699 2.990   9.030   1.00 53.04 ? 158 SER A C     1 
ATOM   45   O O     . SER A 1 15 ? 19.452 1.837   9.420   1.00 53.39 ? 158 SER A O     1 
ATOM   46   C CB    . SER A 1 15 ? 20.414 3.276   6.620   1.00 54.78 ? 158 SER A CB    1 
ATOM   47   O OG    . SER A 1 15 ? 19.600 2.165   6.257   1.00 54.95 ? 158 SER A OG    1 
ATOM   48   N N     . HIS A 1 16 ? 19.003 4.063   9.418   1.00 51.09 ? 159 HIS A N     1 
ATOM   49   C CA    . HIS A 1 16 ? 17.959 3.982   10.457  1.00 49.28 ? 159 HIS A CA    1 
ATOM   50   C C     . HIS A 1 16 ? 16.552 4.185   9.854   1.00 47.82 ? 159 HIS A C     1 
ATOM   51   O O     . HIS A 1 16 ? 16.041 5.307   9.798   1.00 46.37 ? 159 HIS A O     1 
ATOM   52   C CB    . HIS A 1 16 ? 18.233 5.024   11.552  1.00 49.68 ? 159 HIS A CB    1 
ATOM   53   C CG    . HIS A 1 16 ? 19.628 4.972   12.111  1.00 51.43 ? 159 HIS A CG    1 
ATOM   54   N ND1   . HIS A 1 16 ? 20.081 3.928   12.889  1.00 53.71 ? 159 HIS A ND1   1 
ATOM   55   C CD2   . HIS A 1 16 ? 20.658 5.847   12.022  1.00 53.26 ? 159 HIS A CD2   1 
ATOM   56   C CE1   . HIS A 1 16 ? 21.331 4.158   13.248  1.00 54.49 ? 159 HIS A CE1   1 
ATOM   57   N NE2   . HIS A 1 16 ? 21.705 5.317   12.736  1.00 54.60 ? 159 HIS A NE2   1 
ATOM   58   N N     . GLU A 1 17 ? 15.941 3.101   9.384   1.00 46.30 ? 160 GLU A N     1 
ATOM   59   C CA    . GLU A 1 17 ? 14.710 3.209   8.591   1.00 44.91 ? 160 GLU A CA    1 
ATOM   60   C C     . GLU A 1 17 ? 13.504 3.790   9.359   1.00 44.25 ? 160 GLU A C     1 
ATOM   61   O O     . GLU A 1 17 ? 12.835 4.725   8.872   1.00 42.54 ? 160 GLU A O     1 
ATOM   62   C CB    . GLU A 1 17 ? 14.371 1.857   7.952   1.00 44.15 ? 160 GLU A CB    1 
ATOM   63   C CG    . GLU A 1 17 ? 15.516 1.320   7.088   1.00 46.23 ? 160 GLU A CG    1 
ATOM   64   C CD    . GLU A 1 17 ? 15.858 2.229   5.934   1.00 42.22 ? 160 GLU A CD    1 
ATOM   65   O OE1   . GLU A 1 17 ? 16.846 2.998   5.931   1.00 50.42 ? 160 GLU A OE1   1 
ATOM   66   O OE2   . GLU A 1 17 ? 15.130 2.189   5.014   1.00 41.50 ? 160 GLU A OE2   1 
ATOM   67   N N     . VAL A 1 18 ? 13.230 3.220   10.535  1.00 43.56 ? 161 VAL A N     1 
ATOM   68   C CA    . VAL A 1 18 ? 12.079 3.645   11.359  1.00 44.38 ? 161 VAL A CA    1 
ATOM   69   C C     . VAL A 1 18 ? 12.211 5.111   11.800  1.00 43.84 ? 161 VAL A C     1 
ATOM   70   O O     . VAL A 1 18 ? 11.249 5.890   11.700  1.00 45.38 ? 161 VAL A O     1 
ATOM   71   C CB    . VAL A 1 18 ? 11.828 2.704   12.610  1.00 43.56 ? 161 VAL A CB    1 
ATOM   72   C CG1   . VAL A 1 18 ? 10.616 3.195   13.426  1.00 44.83 ? 161 VAL A CG1   1 
ATOM   73   C CG2   . VAL A 1 18 ? 11.525 1.310   12.165  1.00 42.98 ? 161 VAL A CG2   1 
ATOM   74   N N     . GLY A 1 19 ? 13.388 5.483   12.283  1.00 43.03 ? 162 GLY A N     1 
ATOM   75   C CA    . GLY A 1 19 ? 13.650 6.855   12.744  1.00 42.35 ? 162 GLY A CA    1 
ATOM   76   C C     . GLY A 1 19 ? 13.679 7.845   11.593  1.00 42.49 ? 162 GLY A C     1 
ATOM   77   O O     . GLY A 1 19 ? 13.171 8.969   11.720  1.00 42.05 ? 162 GLY A O     1 
ATOM   78   N N     . ALA A 1 20 ? 14.223 7.431   10.438  1.00 41.32 ? 163 ALA A N     1 
ATOM   79   C CA    . ALA A 1 20 ? 14.261 8.335   9.278   1.00 40.81 ? 163 ALA A CA    1 
ATOM   80   C C     . ALA A 1 20 ? 12.844 8.648   8.771   1.00 40.32 ? 163 ALA A C     1 
ATOM   81   O O     . ALA A 1 20 ? 12.561 9.765   8.389   1.00 40.64 ? 163 ALA A O     1 
ATOM   82   C CB    . ALA A 1 20 ? 15.111 7.769   8.137   1.00 40.83 ? 163 ALA A CB    1 
ATOM   83   N N     . LEU A 1 21 ? 11.982 7.645   8.737   1.00 40.25 ? 164 LEU A N     1 
ATOM   84   C CA    . LEU A 1 21 ? 10.608 7.831   8.302   1.00 40.81 ? 164 LEU A CA    1 
ATOM   85   C C     . LEU A 1 21 ? 9.898  8.723   9.303   1.00 41.29 ? 164 LEU A C     1 
ATOM   86   O O     . LEU A 1 21 ? 9.192  9.619   8.917   1.00 42.53 ? 164 LEU A O     1 
ATOM   87   C CB    . LEU A 1 21 ? 9.871  6.488   8.178   1.00 40.01 ? 164 LEU A CB    1 
ATOM   88   C CG    . LEU A 1 21 ? 8.389  6.574   7.746   1.00 41.83 ? 164 LEU A CG    1 
ATOM   89   C CD1   . LEU A 1 21 ? 8.220  7.238   6.329   1.00 39.45 ? 164 LEU A CD1   1 
ATOM   90   C CD2   . LEU A 1 21 ? 7.682  5.174   7.830   1.00 40.65 ? 164 LEU A CD2   1 
ATOM   91   N N     . GLN A 1 22 ? 10.113 8.479   10.598  1.00 41.80 ? 165 GLN A N     1 
ATOM   92   C CA    . GLN A 1 22 ? 9.431  9.252   11.605  1.00 42.13 ? 165 GLN A CA    1 
ATOM   93   C C     . GLN A 1 22 ? 9.811  10.695  11.492  1.00 42.11 ? 165 GLN A C     1 
ATOM   94   O O     . GLN A 1 22 ? 8.930  11.551  11.503  1.00 42.53 ? 165 GLN A O     1 
ATOM   95   C CB    . GLN A 1 22 ? 9.639  8.706   13.026  1.00 41.34 ? 165 GLN A CB    1 
ATOM   96   C CG    . GLN A 1 22 ? 9.151  9.696   14.066  1.00 42.74 ? 165 GLN A CG    1 
ATOM   97   C CD    . GLN A 1 22 ? 9.290  9.186   15.465  1.00 42.81 ? 165 GLN A CD    1 
ATOM   98   O OE1   . GLN A 1 22 ? 8.858  8.075   15.788  1.00 41.73 ? 165 GLN A OE1   1 
ATOM   99   N NE2   . GLN A 1 22 ? 9.890  9.996   16.317  1.00 42.55 ? 165 GLN A NE2   1 
ATOM   100  N N     . GLU A 1 23 ? 11.111 10.958  11.330  1.00 42.49 ? 166 GLU A N     1 
ATOM   101  C CA    . GLU A 1 23 ? 11.637 12.313  11.166  1.00 42.54 ? 166 GLU A CA    1 
ATOM   102  C C     . GLU A 1 23 ? 11.179 12.981  9.876   1.00 43.14 ? 166 GLU A C     1 
ATOM   103  O O     . GLU A 1 23 ? 10.844 14.177  9.857   1.00 41.70 ? 166 GLU A O     1 
ATOM   104  C CB    . GLU A 1 23 ? 13.172 12.296  11.229  1.00 43.12 ? 166 GLU A CB    1 
ATOM   105  C CG    . GLU A 1 23 ? 13.708 11.684  12.565  1.00 43.22 ? 166 GLU A CG    1 
ATOM   106  C CD    . GLU A 1 23 ? 15.222 11.587  12.593  1.00 43.76 ? 166 GLU A CD    1 
ATOM   107  O OE1   . GLU A 1 23 ? 15.887 12.336  11.843  1.00 47.38 ? 166 GLU A OE1   1 
ATOM   108  O OE2   . GLU A 1 23 ? 15.739 10.759  13.362  1.00 45.44 ? 166 GLU A OE2   1 
ATOM   109  N N     . LEU A 1 24 ? 11.155 12.216  8.784   1.00 43.59 ? 167 LEU A N     1 
ATOM   110  C CA    . LEU A 1 24 ? 10.623 12.746  7.532   1.00 43.52 ? 167 LEU A CA    1 
ATOM   111  C C     . LEU A 1 24 ? 9.140  13.151  7.652   1.00 43.90 ? 167 LEU A C     1 
ATOM   112  O O     . LEU A 1 24 ? 8.772  14.238  7.221   1.00 43.40 ? 167 LEU A O     1 
ATOM   113  C CB    . LEU A 1 24 ? 10.799 11.735  6.398   1.00 44.27 ? 167 LEU A CB    1 
ATOM   114  C CG    . LEU A 1 24 ? 10.115 11.983  5.041   1.00 44.61 ? 167 LEU A CG    1 
ATOM   115  C CD1   . LEU A 1 24 ? 10.738 13.159  4.307   1.00 47.09 ? 167 LEU A CD1   1 
ATOM   116  C CD2   . LEU A 1 24 ? 10.222 10.696  4.189   1.00 43.98 ? 167 LEU A CD2   1 
ATOM   117  N N     . VAL A 1 25 ? 8.286  12.295  8.225   1.00 43.57 ? 168 VAL A N     1 
ATOM   118  C CA    . VAL A 1 25 ? 6.848  12.629  8.210   1.00 44.21 ? 168 VAL A CA    1 
ATOM   119  C C     . VAL A 1 25 ? 6.517  13.820  9.128   1.00 44.76 ? 168 VAL A C     1 
ATOM   120  O O     . VAL A 1 25 ? 5.607  14.600  8.828   1.00 45.60 ? 168 VAL A O     1 
ATOM   121  C CB    . VAL A 1 25 ? 5.899  11.413  8.504   1.00 43.97 ? 168 VAL A CB    1 
ATOM   122  C CG1   . VAL A 1 25 ? 6.235  10.218  7.606   1.00 41.73 ? 168 VAL A CG1   1 
ATOM   123  C CG2   . VAL A 1 25 ? 5.910  11.047  9.962   1.00 44.15 ? 168 VAL A CG2   1 
ATOM   124  N N     . VAL A 1 26 ? 7.276  13.962  10.216  1.00 45.05 ? 169 VAL A N     1 
ATOM   125  C CA    . VAL A 1 26 ? 7.189  15.118  11.104  1.00 45.15 ? 169 VAL A CA    1 
ATOM   126  C C     . VAL A 1 26 ? 7.481  16.392  10.316  1.00 45.85 ? 169 VAL A C     1 
ATOM   127  O O     . VAL A 1 26 ? 6.748  17.380  10.433  1.00 45.55 ? 169 VAL A O     1 
ATOM   128  C CB    . VAL A 1 26 ? 8.108  14.950  12.359  1.00 45.04 ? 169 VAL A CB    1 
ATOM   129  C CG1   . VAL A 1 26 ? 8.263  16.251  13.135  1.00 45.76 ? 169 VAL A CG1   1 
ATOM   130  C CG2   . VAL A 1 26 ? 7.529  13.881  13.299  1.00 44.97 ? 169 VAL A CG2   1 
ATOM   131  N N     . GLN A 1 27 ? 8.517  16.367  9.475   1.00 46.59 ? 170 GLN A N     1 
ATOM   132  C CA    . GLN A 1 27 ? 8.841  17.552  8.647   1.00 47.07 ? 170 GLN A CA    1 
ATOM   133  C C     . GLN A 1 27 ? 7.838  17.796  7.513   1.00 47.37 ? 170 GLN A C     1 
ATOM   134  O O     . GLN A 1 27 ? 7.702  18.920  7.023   1.00 47.53 ? 170 GLN A O     1 
ATOM   135  C CB    . GLN A 1 27 ? 10.281 17.485  8.101   1.00 47.34 ? 170 GLN A CB    1 
ATOM   136  C CG    . GLN A 1 27 ? 11.386 17.398  9.199   1.00 49.64 ? 170 GLN A CG    1 
ATOM   137  C CD    . GLN A 1 27 ? 11.539 18.663  10.069  1.00 53.87 ? 170 GLN A CD    1 
ATOM   138  O OE1   . GLN A 1 27 ? 11.418 18.615  11.306  1.00 57.42 ? 170 GLN A OE1   1 
ATOM   139  N NE2   . GLN A 1 27 ? 11.839 19.784  9.429   1.00 58.24 ? 170 GLN A NE2   1 
ATOM   140  N N     . LYS A 1 28 ? 7.133  16.762  7.072   1.00 47.05 ? 171 LYS A N     1 
ATOM   141  C CA    . LYS A 1 28 ? 6.047  17.006  6.120   1.00 48.23 ? 171 LYS A CA    1 
ATOM   142  C C     . LYS A 1 28 ? 4.764  17.518  6.818   1.00 47.35 ? 171 LYS A C     1 
ATOM   143  O O     . LYS A 1 28 ? 3.816  17.875  6.153   1.00 47.77 ? 171 LYS A O     1 
ATOM   144  C CB    . LYS A 1 28 ? 5.769  15.761  5.252   1.00 48.34 ? 171 LYS A CB    1 
ATOM   145  C CG    . LYS A 1 28 ? 6.920  15.460  4.275   1.00 49.23 ? 171 LYS A CG    1 
ATOM   146  C CD    . LYS A 1 28 ? 6.601  14.358  3.277   1.00 49.88 ? 171 LYS A CD    1 
ATOM   147  C CE    . LYS A 1 28 ? 5.982  14.912  1.996   1.00 51.40 ? 171 LYS A CE    1 
ATOM   148  N NZ    . LYS A 1 28 ? 6.911  15.804  1.216   1.00 53.28 ? 171 LYS A NZ    1 
ATOM   149  N N     . GLY A 1 29 ? 4.752  17.538  8.149   1.00 47.09 ? 172 GLY A N     1 
ATOM   150  C CA    . GLY A 1 29 ? 3.578  17.971  8.938   1.00 46.94 ? 172 GLY A CA    1 
ATOM   151  C C     . GLY A 1 29 ? 2.473  16.924  9.062   1.00 46.36 ? 172 GLY A C     1 
ATOM   152  O O     . GLY A 1 29 ? 1.295  17.261  9.168   1.00 45.54 ? 172 GLY A O     1 
ATOM   153  N N     . TRP A 1 30 ? 2.872  15.651  9.045   1.00 46.06 ? 173 TRP A N     1 
ATOM   154  C CA    . TRP A 1 30 ? 1.968  14.520  9.135   1.00 45.72 ? 173 TRP A CA    1 
ATOM   155  C C     . TRP A 1 30 ? 2.079  13.944  10.522  1.00 46.81 ? 173 TRP A C     1 
ATOM   156  O O     . TRP A 1 30 ? 3.127  14.103  11.185  1.00 47.49 ? 173 TRP A O     1 
ATOM   157  C CB    . TRP A 1 30 ? 2.352  13.428  8.130   1.00 45.59 ? 173 TRP A CB    1 
ATOM   158  C CG    . TRP A 1 30 ? 2.344  13.824  6.652   1.00 44.55 ? 173 TRP A CG    1 
ATOM   159  C CD1   . TRP A 1 30 ? 1.787  14.938  6.094   1.00 44.52 ? 173 TRP A CD1   1 
ATOM   160  C CD2   . TRP A 1 30 ? 2.887  13.059  5.554   1.00 44.63 ? 173 TRP A CD2   1 
ATOM   161  N NE1   . TRP A 1 30 ? 1.974  14.932  4.720   1.00 43.87 ? 173 TRP A NE1   1 
ATOM   162  C CE2   . TRP A 1 30 ? 2.646  13.793  4.368   1.00 42.99 ? 173 TRP A CE2   1 
ATOM   163  C CE3   . TRP A 1 30 ? 3.571  11.836  5.466   1.00 44.81 ? 173 TRP A CE3   1 
ATOM   164  C CZ2   . TRP A 1 30 ? 3.048  13.341  3.101   1.00 44.79 ? 173 TRP A CZ2   1 
ATOM   165  C CZ3   . TRP A 1 30 ? 3.981  11.382  4.202   1.00 44.74 ? 173 TRP A CZ3   1 
ATOM   166  C CH2   . TRP A 1 30 ? 3.706  12.135  3.035   1.00 45.38 ? 173 TRP A CH2   1 
ATOM   167  N N     . ARG A 1 31 ? 1.020  13.264  10.969  1.00 46.34 ? 174 ARG A N     1 
ATOM   168  C CA    . ARG A 1 31 ? 1.104  12.450  12.187  1.00 46.26 ? 174 ARG A CA    1 
ATOM   169  C C     . ARG A 1 31 ? 2.021  11.249  11.957  1.00 46.55 ? 174 ARG A C     1 
ATOM   170  O O     . ARG A 1 31 ? 2.255  10.853  10.810  1.00 45.87 ? 174 ARG A O     1 
ATOM   171  C CB    . ARG A 1 31 ? -0.267 11.923  12.612  1.00 46.41 ? 174 ARG A CB    1 
ATOM   172  C CG    . ARG A 1 31 ? -1.287 12.952  12.997  1.00 47.01 ? 174 ARG A CG    1 
ATOM   173  C CD    . ARG A 1 31 ? -2.342 12.286  13.860  1.00 51.72 ? 174 ARG A CD    1 
ATOM   174  N NE    . ARG A 1 31 ? -2.948 11.149  13.173  1.00 53.35 ? 174 ARG A NE    1 
ATOM   175  C CZ    . ARG A 1 31 ? -4.073 11.208  12.469  1.00 54.38 ? 174 ARG A CZ    1 
ATOM   176  N NH1   . ARG A 1 31 ? -4.740 12.353  12.352  1.00 50.50 ? 174 ARG A NH1   1 
ATOM   177  N NH2   . ARG A 1 31 ? -4.518 10.110  11.872  1.00 56.87 ? 174 ARG A NH2   1 
ATOM   178  N N     . LEU A 1 32 ? 2.520  10.685  13.067  1.00 46.67 ? 175 LEU A N     1 
ATOM   179  C CA    . LEU A 1 32 ? 3.487  9.577   13.075  1.00 46.91 ? 175 LEU A CA    1 
ATOM   180  C C     . LEU A 1 32 ? 2.907  8.327   12.457  1.00 46.80 ? 175 LEU A C     1 
ATOM   181  O O     . LEU A 1 32 ? 1.714  8.070   12.601  1.00 46.42 ? 175 LEU A O     1 
ATOM   182  C CB    . LEU A 1 32 ? 3.926  9.255   14.522  1.00 46.95 ? 175 LEU A CB    1 
ATOM   183  C CG    . LEU A 1 32 ? 4.633  10.380  15.299  1.00 49.56 ? 175 LEU A CG    1 
ATOM   184  C CD1   . LEU A 1 32 ? 5.427  9.849   16.520  1.00 50.17 ? 175 LEU A CD1   1 
ATOM   185  C CD2   . LEU A 1 32 ? 5.542  11.157  14.386  1.00 50.08 ? 175 LEU A CD2   1 
ATOM   186  N N     . PRO A 1 33 ? 3.761  7.507   11.811  1.00 47.06 ? 176 PRO A N     1 
ATOM   187  C CA    . PRO A 1 33 ? 3.245  6.294   11.184  1.00 47.23 ? 176 PRO A CA    1 
ATOM   188  C C     . PRO A 1 33 ? 2.640  5.383   12.236  1.00 48.12 ? 176 PRO A C     1 
ATOM   189  O O     . PRO A 1 33 ? 3.013  5.471   13.409  1.00 48.27 ? 176 PRO A O     1 
ATOM   190  C CB    . PRO A 1 33 ? 4.507  5.624   10.645  1.00 47.36 ? 176 PRO A CB    1 
ATOM   191  C CG    . PRO A 1 33 ? 5.514  6.750   10.523  1.00 46.46 ? 176 PRO A CG    1 
ATOM   192  C CD    . PRO A 1 33 ? 5.229  7.605   11.687  1.00 46.38 ? 176 PRO A CD    1 
ATOM   193  N N     . GLU A 1 34 ? 1.718  4.525   11.821  1.00 48.05 ? 177 GLU A N     1 
ATOM   194  C CA    . GLU A 1 34 ? 1.186  3.490   12.690  1.00 48.56 ? 177 GLU A CA    1 
ATOM   195  C C     . GLU A 1 34 ? 1.638  2.116   12.175  1.00 47.79 ? 177 GLU A C     1 
ATOM   196  O O     . GLU A 1 34 ? 1.491  1.824   10.986  1.00 46.83 ? 177 GLU A O     1 
ATOM   197  C CB    . GLU A 1 34 ? -0.339 3.548   12.743  1.00 48.62 ? 177 GLU A CB    1 
ATOM   198  C CG    . GLU A 1 34 ? -0.924 2.406   13.558  1.00 53.65 ? 177 GLU A CG    1 
ATOM   199  C CD    . GLU A 1 34 ? -2.415 2.488   13.694  1.00 60.49 ? 177 GLU A CD    1 
ATOM   200  O OE1   . GLU A 1 34 ? -2.884 2.776   14.824  1.00 62.44 ? 177 GLU A OE1   1 
ATOM   201  O OE2   . GLU A 1 34 ? -3.109 2.270   12.670  1.00 62.66 ? 177 GLU A OE2   1 
ATOM   202  N N     . TYR A 1 35 ? 2.188  1.299   13.079  1.00 46.44 ? 178 TYR A N     1 
ATOM   203  C CA    . TYR A 1 35 ? 2.720  -0.022  12.755  1.00 45.88 ? 178 TYR A CA    1 
ATOM   204  C C     . TYR A 1 35 ? 1.901  -1.095  13.436  1.00 46.38 ? 178 TYR A C     1 
ATOM   205  O O     . TYR A 1 35 ? 1.678  -1.048  14.648  1.00 46.65 ? 178 TYR A O     1 
ATOM   206  C CB    . TYR A 1 35 ? 4.162  -0.145  13.249  1.00 45.95 ? 178 TYR A CB    1 
ATOM   207  C CG    . TYR A 1 35 ? 5.164  0.750   12.535  1.00 45.54 ? 178 TYR A CG    1 
ATOM   208  C CD1   . TYR A 1 35 ? 5.541  1.978   13.072  1.00 43.48 ? 178 TYR A CD1   1 
ATOM   209  C CD2   . TYR A 1 35 ? 5.741  0.351   11.318  1.00 45.57 ? 178 TYR A CD2   1 
ATOM   210  C CE1   . TYR A 1 35 ? 6.483  2.784   12.437  1.00 42.10 ? 178 TYR A CE1   1 
ATOM   211  C CE2   . TYR A 1 35 ? 6.686  1.148   10.665  1.00 42.61 ? 178 TYR A CE2   1 
ATOM   212  C CZ    . TYR A 1 35 ? 7.045  2.357   11.216  1.00 44.34 ? 178 TYR A CZ    1 
ATOM   213  O OH    . TYR A 1 35 ? 7.982  3.135   10.564  1.00 43.66 ? 178 TYR A OH    1 
ATOM   214  N N     . THR A 1 36 ? 1.439  -2.064  12.664  1.00 46.18 ? 179 THR A N     1 
ATOM   215  C CA    . THR A 1 36 ? 0.670  -3.150  13.219  1.00 46.32 ? 179 THR A CA    1 
ATOM   216  C C     . THR A 1 36 ? 1.138  -4.470  12.581  1.00 46.13 ? 179 THR A C     1 
ATOM   217  O O     . THR A 1 36 ? 1.298  -4.541  11.365  1.00 44.95 ? 179 THR A O     1 
ATOM   218  C CB    . THR A 1 36 ? -0.845 -2.973  12.908  1.00 46.22 ? 179 THR A CB    1 
ATOM   219  O OG1   . THR A 1 36 ? -1.043 -3.024  11.495  1.00 48.35 ? 179 THR A OG1   1 
ATOM   220  C CG2   . THR A 1 36 ? -1.387 -1.628  13.388  1.00 46.95 ? 179 THR A CG2   1 
ATOM   221  N N     . VAL A 1 37 ? 1.285  -5.525  13.388  1.00 45.75 ? 180 VAL A N     1 
ATOM   222  C CA    . VAL A 1 37 ? 1.558  -6.851  12.845  1.00 45.13 ? 180 VAL A CA    1 
ATOM   223  C C     . VAL A 1 37 ? 0.291  -7.383  12.183  1.00 45.79 ? 180 VAL A C     1 
ATOM   224  O O     . VAL A 1 37 ? -0.714 -7.553  12.857  1.00 45.48 ? 180 VAL A O     1 
ATOM   225  C CB    . VAL A 1 37 ? 2.008  -7.853  13.947  1.00 45.44 ? 180 VAL A CB    1 
ATOM   226  C CG1   . VAL A 1 37 ? 2.278  -9.241  13.349  1.00 43.12 ? 180 VAL A CG1   1 
ATOM   227  C CG2   . VAL A 1 37 ? 3.224  -7.323  14.696  1.00 44.97 ? 180 VAL A CG2   1 
ATOM   228  N N     . THR A 1 38 ? 0.347  -7.637  10.872  1.00 45.39 ? 181 THR A N     1 
ATOM   229  C CA    . THR A 1 38 ? -0.810 -8.107  10.134  1.00 45.92 ? 181 THR A CA    1 
ATOM   230  C C     . THR A 1 38 ? -0.687 -9.530  9.575   1.00 46.74 ? 181 THR A C     1 
ATOM   231  O O     . THR A 1 38 ? -1.632 -10.018 8.944   1.00 47.05 ? 181 THR A O     1 
ATOM   232  C CB    . THR A 1 38 ? -1.209 -7.151  8.977   1.00 46.56 ? 181 THR A CB    1 
ATOM   233  O OG1   . THR A 1 38 ? -0.093 -6.972  8.092   1.00 42.96 ? 181 THR A OG1   1 
ATOM   234  C CG2   . THR A 1 38 ? -1.726 -5.800  9.527   1.00 44.76 ? 181 THR A CG2   1 
ATOM   235  N N     . GLN A 1 39 ? 0.463  -10.179 9.786   1.00 46.61 ? 182 GLN A N     1 
ATOM   236  C CA    . GLN A 1 39 ? 0.635  -11.607 9.436   1.00 47.32 ? 182 GLN A CA    1 
ATOM   237  C C     . GLN A 1 39 ? 1.799  -12.257 10.189  1.00 47.60 ? 182 GLN A C     1 
ATOM   238  O O     . GLN A 1 39 ? 2.837  -11.625 10.417  1.00 46.77 ? 182 GLN A O     1 
ATOM   239  C CB    . GLN A 1 39 ? 0.814  -11.799 7.920   1.00 46.93 ? 182 GLN A CB    1 
ATOM   240  C CG    . GLN A 1 39 ? 0.860  -13.243 7.463   1.00 47.43 ? 182 GLN A CG    1 
ATOM   241  C CD    . GLN A 1 39 ? 0.815  -13.394 5.941   1.00 48.78 ? 182 GLN A CD    1 
ATOM   242  O OE1   . GLN A 1 39 ? 1.821  -13.734 5.305   1.00 48.61 ? 182 GLN A OE1   1 
ATOM   243  N NE2   . GLN A 1 39 ? -0.355 -13.143 5.354   1.00 49.53 ? 182 GLN A NE2   1 
ATOM   244  N N     . GLU A 1 40 ? 1.591  -13.514 10.580  1.00 48.21 ? 183 GLU A N     1 
ATOM   245  C CA    . GLU A 1 40 ? 2.612  -14.383 11.161  1.00 49.75 ? 183 GLU A CA    1 
ATOM   246  C C     . GLU A 1 40 ? 2.398  -15.746 10.553  1.00 49.97 ? 183 GLU A C     1 
ATOM   247  O O     . GLU A 1 40 ? 1.281  -16.280 10.613  1.00 49.26 ? 183 GLU A O     1 
ATOM   248  C CB    . GLU A 1 40 ? 2.458  -14.516 12.687  1.00 49.06 ? 183 GLU A CB    1 
ATOM   249  C CG    . GLU A 1 40 ? 2.598  -13.233 13.480  1.00 51.59 ? 183 GLU A CG    1 
ATOM   250  C CD    . GLU A 1 40 ? 2.654  -13.463 15.001  1.00 51.97 ? 183 GLU A CD    1 
ATOM   251  O OE1   . GLU A 1 40 ? 2.684  -14.629 15.455  1.00 52.80 ? 183 GLU A OE1   1 
ATOM   252  O OE2   . GLU A 1 40 ? 2.671  -12.464 15.750  1.00 58.13 ? 183 GLU A OE2   1 
ATOM   253  N N     . SER A 1 41 ? 3.456  -16.315 9.982   1.00 50.84 ? 184 SER A N     1 
ATOM   254  C CA    . SER A 1 41 ? 3.382  -17.654 9.439   1.00 52.54 ? 184 SER A CA    1 
ATOM   255  C C     . SER A 1 41 ? 4.506  -18.556 9.944   1.00 53.48 ? 184 SER A C     1 
ATOM   256  O O     . SER A 1 41 ? 5.406  -18.117 10.685  1.00 53.36 ? 184 SER A O     1 
ATOM   257  C CB    . SER A 1 41 ? 3.330  -17.637 7.910   1.00 52.61 ? 184 SER A CB    1 
ATOM   258  O OG    . SER A 1 41 ? 4.218  -16.680 7.374   1.00 55.05 ? 184 SER A OG    1 
ATOM   259  N N     . GLY A 1 42 ? 4.419  -19.825 9.560   1.00 54.02 ? 185 GLY A N     1 
ATOM   260  C CA    . GLY A 1 42 ? 5.452  -20.796 9.841   1.00 55.55 ? 185 GLY A CA    1 
ATOM   261  C C     . GLY A 1 42 ? 5.500  -21.274 11.285  1.00 56.82 ? 185 GLY A C     1 
ATOM   262  O O     . GLY A 1 42 ? 4.884  -20.671 12.179  1.00 56.78 ? 185 GLY A O     1 
ATOM   263  N N     . PRO A 1 43 ? 6.246  -22.367 11.517  1.00 57.46 ? 186 PRO A N     1 
ATOM   264  C CA    . PRO A 1 43 ? 6.500  -22.942 12.827  1.00 58.00 ? 186 PRO A CA    1 
ATOM   265  C C     . PRO A 1 43 ? 7.218  -21.979 13.741  1.00 58.83 ? 186 PRO A C     1 
ATOM   266  O O     . PRO A 1 43 ? 7.915  -21.076 13.266  1.00 59.01 ? 186 PRO A O     1 
ATOM   267  C CB    . PRO A 1 43 ? 7.425  -24.126 12.516  1.00 58.27 ? 186 PRO A CB    1 
ATOM   268  C CG    . PRO A 1 43 ? 7.155  -24.462 11.084  1.00 57.73 ? 186 PRO A CG    1 
ATOM   269  C CD    . PRO A 1 43 ? 6.896  -23.141 10.440  1.00 57.43 ? 186 PRO A CD    1 
ATOM   270  N N     . ALA A 1 44 ? 7.060  -22.203 15.045  1.00 59.19 ? 187 ALA A N     1 
ATOM   271  C CA    . ALA A 1 44 ? 7.666  -21.390 16.090  1.00 59.71 ? 187 ALA A CA    1 
ATOM   272  C C     . ALA A 1 44 ? 9.193  -21.297 16.015  1.00 59.93 ? 187 ALA A C     1 
ATOM   273  O O     . ALA A 1 44 ? 9.796  -20.406 16.637  1.00 60.49 ? 187 ALA A O     1 
ATOM   274  C CB    . ALA A 1 44 ? 7.231  -21.902 17.463  1.00 59.91 ? 187 ALA A CB    1 
ATOM   275  N N     . HIS A 1 45 ? 9.803  -22.208 15.257  1.00 60.04 ? 188 HIS A N     1 
ATOM   276  C CA    . HIS A 1 45 ? 11.260 -22.242 15.079  1.00 60.18 ? 188 HIS A CA    1 
ATOM   277  C C     . HIS A 1 45 ? 11.735 -21.633 13.746  1.00 59.87 ? 188 HIS A C     1 
ATOM   278  O O     . HIS A 1 45 ? 12.931 -21.399 13.560  1.00 60.09 ? 188 HIS A O     1 
ATOM   279  C CB    . HIS A 1 45 ? 11.804 -23.670 15.255  1.00 60.08 ? 188 HIS A CB    1 
ATOM   280  C CG    . HIS A 1 45 ? 11.394 -24.612 14.169  1.00 60.23 ? 188 HIS A CG    1 
ATOM   281  N ND1   . HIS A 1 45 ? 10.225 -25.339 14.218  1.00 60.55 ? 188 HIS A ND1   1 
ATOM   282  C CD2   . HIS A 1 45 ? 11.997 -24.945 13.001  1.00 59.97 ? 188 HIS A CD2   1 
ATOM   283  C CE1   . HIS A 1 45 ? 10.124 -26.079 13.127  1.00 60.15 ? 188 HIS A CE1   1 
ATOM   284  N NE2   . HIS A 1 45 ? 11.185 -25.855 12.371  1.00 59.67 ? 188 HIS A NE2   1 
ATOM   285  N N     . ARG A 1 46 ? 10.802 -21.385 12.828  1.00 59.27 ? 189 ARG A N     1 
ATOM   286  C CA    . ARG A 1 46 ? 11.102 -20.660 11.587  1.00 58.79 ? 189 ARG A CA    1 
ATOM   287  C C     . ARG A 1 46 ? 9.958  -19.706 11.237  1.00 57.88 ? 189 ARG A C     1 
ATOM   288  O O     . ARG A 1 46 ? 9.315  -19.829 10.194  1.00 57.85 ? 189 ARG A O     1 
ATOM   289  C CB    . ARG A 1 46 ? 11.417 -21.618 10.434  1.00 58.75 ? 189 ARG A CB    1 
ATOM   290  C CG    . ARG A 1 46 ? 12.861 -22.102 10.436  1.00 59.64 ? 189 ARG A CG    1 
ATOM   291  C CD    . ARG A 1 46 ? 13.174 -23.043 9.279   1.00 59.51 ? 189 ARG A CD    1 
ATOM   292  N NE    . ARG A 1 46 ? 14.399 -23.802 9.540   1.00 61.19 ? 189 ARG A NE    1 
ATOM   293  C CZ    . ARG A 1 46 ? 14.916 -24.723 8.730   1.00 62.02 ? 189 ARG A CZ    1 
ATOM   294  N NH1   . ARG A 1 46 ? 14.324 -25.023 7.576   1.00 62.28 ? 189 ARG A NH1   1 
ATOM   295  N NH2   . ARG A 1 46 ? 16.034 -25.348 9.076   1.00 62.51 ? 189 ARG A NH2   1 
ATOM   296  N N     . LYS A 1 47 ? 9.715  -18.756 12.133  1.00 56.79 ? 190 LYS A N     1 
ATOM   297  C CA    . LYS A 1 47 ? 8.614  -17.822 11.975  1.00 56.09 ? 190 LYS A CA    1 
ATOM   298  C C     . LYS A 1 47 ? 8.964  -16.702 11.013  1.00 55.29 ? 190 LYS A C     1 
ATOM   299  O O     . LYS A 1 47 ? 10.129 -16.331 10.875  1.00 55.82 ? 190 LYS A O     1 
ATOM   300  C CB    . LYS A 1 47 ? 8.170  -17.260 13.328  1.00 56.03 ? 190 LYS A CB    1 
ATOM   301  C CG    . LYS A 1 47 ? 6.955  -18.008 13.910  1.00 55.89 ? 190 LYS A CG    1 
ATOM   302  C CD    . LYS A 1 47 ? 6.206  -17.158 14.907  1.00 55.90 ? 190 LYS A CD    1 
ATOM   303  C CE    . LYS A 1 47 ? 4.708  -17.472 14.930  1.00 55.43 ? 190 LYS A CE    1 
ATOM   304  N NZ    . LYS A 1 47 ? 4.044  -16.552 15.911  1.00 55.11 ? 190 LYS A NZ    1 
ATOM   305  N N     . GLU A 1 48 ? 7.952  -16.208 10.313  1.00 53.85 ? 191 GLU A N     1 
ATOM   306  C CA    . GLU A 1 48 ? 8.084  -15.005 9.498   1.00 52.61 ? 191 GLU A CA    1 
ATOM   307  C C     . GLU A 1 48 ? 6.940  -14.080 9.852   1.00 50.92 ? 191 GLU A C     1 
ATOM   308  O O     . GLU A 1 48 ? 5.802  -14.526 9.998   1.00 50.63 ? 191 GLU A O     1 
ATOM   309  C CB    . GLU A 1 48 ? 8.069  -15.328 8.004   1.00 52.40 ? 191 GLU A CB    1 
ATOM   310  C CG    . GLU A 1 48 ? 9.030  -16.445 7.605   1.00 55.76 ? 191 GLU A CG    1 
ATOM   311  C CD    . GLU A 1 48 ? 10.009 -16.016 6.536   1.00 58.38 ? 191 GLU A CD    1 
ATOM   312  O OE1   . GLU A 1 48 ? 9.808  -16.387 5.361   1.00 59.83 ? 191 GLU A OE1   1 
ATOM   313  O OE2   . GLU A 1 48 ? 10.970 -15.290 6.872   1.00 59.48 ? 191 GLU A OE2   1 
ATOM   314  N N     . PHE A 1 49 ? 7.259  -12.799 9.996   1.00 49.21 ? 192 PHE A N     1 
ATOM   315  C CA    . PHE A 1 49 ? 6.309  -11.763 10.370  1.00 48.38 ? 192 PHE A CA    1 
ATOM   316  C C     . PHE A 1 49 ? 6.103  -10.751 9.247   1.00 47.89 ? 192 PHE A C     1 
ATOM   317  O O     . PHE A 1 49 ? 7.022  -10.488 8.458   1.00 48.02 ? 192 PHE A O     1 
ATOM   318  C CB    . PHE A 1 49 ? 6.804  -11.027 11.623  1.00 48.54 ? 192 PHE A CB    1 
ATOM   319  C CG    . PHE A 1 49 ? 6.949  -11.915 12.814  1.00 49.21 ? 192 PHE A CG    1 
ATOM   320  C CD1   . PHE A 1 49 ? 8.129  -12.619 13.034  1.00 48.64 ? 192 PHE A CD1   1 
ATOM   321  C CD2   . PHE A 1 49 ? 5.884  -12.075 13.707  1.00 50.22 ? 192 PHE A CD2   1 
ATOM   322  C CE1   . PHE A 1 49 ? 8.249  -13.472 14.125  1.00 49.79 ? 192 PHE A CE1   1 
ATOM   323  C CE2   . PHE A 1 49 ? 5.992  -12.908 14.808  1.00 50.00 ? 192 PHE A CE2   1 
ATOM   324  C CZ    . PHE A 1 49 ? 7.176  -13.612 15.019  1.00 51.76 ? 192 PHE A CZ    1 
ATOM   325  N N     . THR A 1 50 ? 4.902  -10.185 9.192   1.00 46.39 ? 193 THR A N     1 
ATOM   326  C CA    . THR A 1 50 ? 4.592  -9.067  8.297   1.00 45.43 ? 193 THR A CA    1 
ATOM   327  C C     . THR A 1 50 ? 4.089  -7.890  9.124   1.00 44.98 ? 193 THR A C     1 
ATOM   328  O O     . THR A 1 50 ? 3.123  -8.024  9.888   1.00 44.84 ? 193 THR A O     1 
ATOM   329  C CB    . THR A 1 50 ? 3.540  -9.453  7.228   1.00 45.45 ? 193 THR A CB    1 
ATOM   330  O OG1   . THR A 1 50 ? 4.055  -10.496 6.397   1.00 44.41 ? 193 THR A OG1   1 
ATOM   331  C CG2   . THR A 1 50 ? 3.175  -8.268  6.347   1.00 45.77 ? 193 THR A CG2   1 
ATOM   332  N N     . MET A 1 51 ? 4.755  -6.746  8.989   1.00 43.96 ? 194 MET A N     1 
ATOM   333  C CA    . MET A 1 51 ? 4.295  -5.504  9.627   1.00 44.54 ? 194 MET A CA    1 
ATOM   334  C C     . MET A 1 51 ? 3.640  -4.644  8.571   1.00 44.48 ? 194 MET A C     1 
ATOM   335  O O     . MET A 1 51 ? 4.194  -4.499  7.484   1.00 44.69 ? 194 MET A O     1 
ATOM   336  C CB    . MET A 1 51 ? 5.493  -4.726  10.193  1.00 43.93 ? 194 MET A CB    1 
ATOM   337  C CG    . MET A 1 51 ? 5.159  -3.646  11.163  1.00 47.71 ? 194 MET A CG    1 
ATOM   338  S SD    . MET A 1 51 ? 4.632  -4.282  12.780  1.00 51.85 ? 194 MET A SD    1 
ATOM   339  C CE    . MET A 1 51 ? 6.191  -4.931  13.390  1.00 48.52 ? 194 MET A CE    1 
ATOM   340  N N     . THR A 1 52 ? 2.478  -4.073  8.885   1.00 44.20 ? 195 THR A N     1 
ATOM   341  C CA    . THR A 1 52 ? 1.909  -2.993  8.077   1.00 44.59 ? 195 THR A CA    1 
ATOM   342  C C     . THR A 1 52 ? 2.255  -1.598  8.643   1.00 45.02 ? 195 THR A C     1 
ATOM   343  O O     . THR A 1 52 ? 2.152  -1.351  9.876   1.00 43.73 ? 195 THR A O     1 
ATOM   344  C CB    . THR A 1 52 ? 0.389  -3.151  7.944   1.00 45.14 ? 195 THR A CB    1 
ATOM   345  O OG1   . THR A 1 52 ? 0.107  -4.330  7.182   1.00 43.99 ? 195 THR A OG1   1 
ATOM   346  C CG2   . THR A 1 52 ? -0.225 -1.961  7.234   1.00 45.85 ? 195 THR A CG2   1 
ATOM   347  N N     . CYS A 1 53 ? 2.707  -0.717  7.750   1.00 43.66 ? 196 CYS A N     1 
ATOM   348  C CA    . CYS A 1 53 ? 2.949  0.688   8.085   1.00 43.94 ? 196 CYS A CA    1 
ATOM   349  C C     . CYS A 1 53 ? 1.911  1.599   7.392   1.00 44.48 ? 196 CYS A C     1 
ATOM   350  O O     . CYS A 1 53 ? 1.685  1.487   6.172   1.00 42.93 ? 196 CYS A O     1 
ATOM   351  C CB    . CYS A 1 53 ? 4.358  1.074   7.678   1.00 43.85 ? 196 CYS A CB    1 
ATOM   352  S SG    . CYS A 1 53 ? 4.816  2.778   7.957   1.00 44.53 ? 196 CYS A SG    1 
ATOM   353  N N     . ARG A 1 54 ? 1.258  2.455   8.176   1.00 43.78 ? 197 ARG A N     1 
ATOM   354  C CA    . ARG A 1 54 ? 0.260  3.390   7.637   1.00 45.20 ? 197 ARG A CA    1 
ATOM   355  C C     . ARG A 1 54 ? 0.679  4.807   8.006   1.00 44.40 ? 197 ARG A C     1 
ATOM   356  O O     . ARG A 1 54 ? 0.954  5.092   9.182   1.00 44.32 ? 197 ARG A O     1 
ATOM   357  C CB    . ARG A 1 54 ? -1.144 3.129   8.208   1.00 44.64 ? 197 ARG A CB    1 
ATOM   358  C CG    . ARG A 1 54 ? -1.767 1.758   7.892   1.00 46.48 ? 197 ARG A CG    1 
ATOM   359  C CD    . ARG A 1 54 ? -3.040 1.464   8.738   1.00 48.57 ? 197 ARG A CD    1 
ATOM   360  N NE    . ARG A 1 54 ? -3.048 0.052   9.151   1.00 58.15 ? 197 ARG A NE    1 
ATOM   361  C CZ    . ARG A 1 54 ? -4.026 -0.598  9.792   1.00 60.99 ? 197 ARG A CZ    1 
ATOM   362  N NH1   . ARG A 1 54 ? -5.160 0.007   10.151  1.00 61.55 ? 197 ARG A NH1   1 
ATOM   363  N NH2   . ARG A 1 54 ? -3.855 -1.890  10.085  1.00 62.68 ? 197 ARG A NH2   1 
ATOM   364  N N     . VAL A 1 55 ? 0.718  5.693   7.021   1.00 43.34 ? 198 VAL A N     1 
ATOM   365  C CA    . VAL A 1 55 ? 0.915  7.118   7.319   1.00 42.97 ? 198 VAL A CA    1 
ATOM   366  C C     . VAL A 1 55 ? 0.268  7.923   6.215   1.00 42.47 ? 198 VAL A C     1 
ATOM   367  O O     . VAL A 1 55 ? 0.320  7.523   5.048   1.00 40.91 ? 198 VAL A O     1 
ATOM   368  C CB    . VAL A 1 55 ? 2.425  7.516   7.509   1.00 44.28 ? 198 VAL A CB    1 
ATOM   369  C CG1   . VAL A 1 55 ? 3.158  7.530   6.196   1.00 40.69 ? 198 VAL A CG1   1 
ATOM   370  C CG2   . VAL A 1 55 ? 2.542  8.903   8.267   1.00 44.42 ? 198 VAL A CG2   1 
ATOM   371  N N     . GLU A 1 56 ? -0.396 9.013   6.620   1.00 42.01 ? 199 GLU A N     1 
ATOM   372  C CA    . GLU A 1 56 ? -1.159 9.879   5.748   1.00 41.95 ? 199 GLU A CA    1 
ATOM   373  C C     . GLU A 1 56 ? -2.091 8.969   4.928   1.00 41.98 ? 199 GLU A C     1 
ATOM   374  O O     . GLU A 1 56 ? -2.896 8.260   5.521   1.00 40.07 ? 199 GLU A O     1 
ATOM   375  C CB    . GLU A 1 56 ? -0.230 10.762  4.891   1.00 42.84 ? 199 GLU A CB    1 
ATOM   376  C CG    . GLU A 1 56 ? -0.787 12.148  4.524   1.00 43.47 ? 199 GLU A CG    1 
ATOM   377  C CD    . GLU A 1 56 ? -1.078 12.319  3.035   1.00 45.81 ? 199 GLU A CD    1 
ATOM   378  O OE1   . GLU A 1 56 ? -0.965 11.332  2.283   1.00 47.49 ? 199 GLU A OE1   1 
ATOM   379  O OE2   . GLU A 1 56 ? -1.424 13.451  2.604   1.00 46.19 ? 199 GLU A OE2   1 
ATOM   380  N N     . ARG A 1 57 ? -1.942 8.951   3.604   1.00 42.03 ? 200 ARG A N     1 
ATOM   381  C CA    . ARG A 1 57 ? -2.824 8.173   2.713   1.00 45.14 ? 200 ARG A CA    1 
ATOM   382  C C     . ARG A 1 57 ? -2.230 6.798   2.301   1.00 45.16 ? 200 ARG A C     1 
ATOM   383  O O     . ARG A 1 57 ? -2.857 6.029   1.546   1.00 45.47 ? 200 ARG A O     1 
ATOM   384  C CB    . ARG A 1 57 ? -3.163 9.003   1.445   1.00 45.23 ? 200 ARG A CB    1 
ATOM   385  C CG    . ARG A 1 57 ? -2.065 9.017   0.365   1.00 46.90 ? 200 ARG A CG    1 
ATOM   386  C CD    . ARG A 1 57 ? -2.169 10.246  -0.625  1.00 48.85 ? 200 ARG A CD    1 
ATOM   387  N NE    . ARG A 1 57 ? -1.228 11.285  -0.188  1.00 55.84 ? 200 ARG A NE    1 
ATOM   388  C CZ    . ARG A 1 57 ? -0.264 11.822  -0.936  1.00 58.40 ? 200 ARG A CZ    1 
ATOM   389  N NH1   . ARG A 1 57 ? -0.116 11.480  -2.217  1.00 57.32 ? 200 ARG A NH1   1 
ATOM   390  N NH2   . ARG A 1 57 ? 0.551  12.728  -0.398  1.00 58.87 ? 200 ARG A NH2   1 
ATOM   391  N N     . PHE A 1 58 ? -1.027 6.506   2.790   1.00 44.80 ? 201 PHE A N     1 
ATOM   392  C CA    . PHE A 1 58 ? -0.245 5.346   2.345   1.00 44.57 ? 201 PHE A CA    1 
ATOM   393  C C     . PHE A 1 58 ? -0.347 4.128   3.265   1.00 44.52 ? 201 PHE A C     1 
ATOM   394  O O     . PHE A 1 58 ? -0.513 4.257   4.471   1.00 43.64 ? 201 PHE A O     1 
ATOM   395  C CB    . PHE A 1 58 ? 1.217  5.756   2.196   1.00 44.72 ? 201 PHE A CB    1 
ATOM   396  C CG    . PHE A 1 58 ? 1.413  6.971   1.318   1.00 44.86 ? 201 PHE A CG    1 
ATOM   397  C CD1   . PHE A 1 58 ? 1.758  8.203   1.883   1.00 44.85 ? 201 PHE A CD1   1 
ATOM   398  C CD2   . PHE A 1 58 ? 1.214  6.883   -0.059  1.00 42.77 ? 201 PHE A CD2   1 
ATOM   399  C CE1   . PHE A 1 58 ? 1.954  9.317   1.095   1.00 46.31 ? 201 PHE A CE1   1 
ATOM   400  C CE2   . PHE A 1 58 ? 1.381  7.996   -0.882  1.00 45.91 ? 201 PHE A CE2   1 
ATOM   401  C CZ    . PHE A 1 58 ? 1.754  9.224   -0.318  1.00 47.19 ? 201 PHE A CZ    1 
ATOM   402  N N     . ILE A 1 59 ? -0.260 2.943   2.670   1.00 44.67 ? 202 ILE A N     1 
ATOM   403  C CA    . ILE A 1 59 ? -0.237 1.693   3.422   1.00 44.63 ? 202 ILE A CA    1 
ATOM   404  C C     . ILE A 1 59 ? 0.802  0.840   2.718   1.00 44.19 ? 202 ILE A C     1 
ATOM   405  O O     . ILE A 1 59 ? 0.693  0.579   1.500   1.00 42.44 ? 202 ILE A O     1 
ATOM   406  C CB    . ILE A 1 59 ? -1.615 0.963   3.431   1.00 45.58 ? 202 ILE A CB    1 
ATOM   407  C CG1   . ILE A 1 59 ? -2.743 1.883   3.951   1.00 46.27 ? 202 ILE A CG1   1 
ATOM   408  C CG2   . ILE A 1 59 ? -1.530 -0.320  4.284   1.00 44.49 ? 202 ILE A CG2   1 
ATOM   409  C CD1   . ILE A 1 59 ? -4.181 1.459   3.556   1.00 46.48 ? 202 ILE A CD1   1 
ATOM   410  N N     . GLU A 1 60 ? 1.849  0.476   3.453   1.00 42.66 ? 203 GLU A N     1 
ATOM   411  C CA    . GLU A 1 60 ? 2.905  -0.361  2.887   1.00 43.52 ? 203 GLU A CA    1 
ATOM   412  C C     . GLU A 1 60 ? 3.282  -1.494  3.861   1.00 43.45 ? 203 GLU A C     1 
ATOM   413  O O     . GLU A 1 60 ? 3.291  -1.294  5.076   1.00 41.90 ? 203 GLU A O     1 
ATOM   414  C CB    . GLU A 1 60 ? 4.135  0.492   2.528   1.00 43.10 ? 203 GLU A CB    1 
ATOM   415  C CG    . GLU A 1 60 ? 3.914  1.610   1.459   1.00 44.08 ? 203 GLU A CG    1 
ATOM   416  C CD    . GLU A 1 60 ? 3.508  1.097   0.048   1.00 46.45 ? 203 GLU A CD    1 
ATOM   417  O OE1   . GLU A 1 60 ? 3.828  -0.066  -0.309  1.00 45.03 ? 203 GLU A OE1   1 
ATOM   418  O OE2   . GLU A 1 60 ? 2.866  1.871   -0.713  1.00 46.59 ? 203 GLU A OE2   1 
ATOM   419  N N     . ILE A 1 61 ? 3.599  -2.671  3.329   1.00 43.60 ? 204 ILE A N     1 
ATOM   420  C CA    . ILE A 1 61 ? 3.947  -3.806  4.205   1.00 44.14 ? 204 ILE A CA    1 
ATOM   421  C C     . ILE A 1 61 ? 5.431  -4.159  4.147   1.00 44.20 ? 204 ILE A C     1 
ATOM   422  O O     . ILE A 1 61 ? 6.095  -3.947  3.128   1.00 45.08 ? 204 ILE A O     1 
ATOM   423  C CB    . ILE A 1 61 ? 3.039  -5.063  3.949   1.00 43.76 ? 204 ILE A CB    1 
ATOM   424  C CG1   . ILE A 1 61 ? 3.321  -5.682  2.589   1.00 44.53 ? 204 ILE A CG1   1 
ATOM   425  C CG2   . ILE A 1 61 ? 1.564  -4.703  4.066   1.00 43.73 ? 204 ILE A CG2   1 
ATOM   426  C CD1   . ILE A 1 61 ? 2.440  -6.904  2.271   1.00 44.33 ? 204 ILE A CD1   1 
ATOM   427  N N     . GLY A 1 62 ? 5.955  -4.685  5.243   1.00 44.02 ? 205 GLY A N     1 
ATOM   428  C CA    . GLY A 1 62 ? 7.312  -5.232  5.274   1.00 43.91 ? 205 GLY A CA    1 
ATOM   429  C C     . GLY A 1 62 ? 7.296  -6.564  5.989   1.00 44.51 ? 205 GLY A C     1 
ATOM   430  O O     . GLY A 1 62 ? 6.499  -6.771  6.903   1.00 44.49 ? 205 GLY A O     1 
ATOM   431  N N     . SER A 1 63 ? 8.150  -7.490  5.582   1.00 44.49 ? 206 SER A N     1 
ATOM   432  C CA    . SER A 1 63 ? 8.159  -8.785  6.253   1.00 45.01 ? 206 SER A CA    1 
ATOM   433  C C     . SER A 1 63 ? 9.570  -9.208  6.644   1.00 44.32 ? 206 SER A C     1 
ATOM   434  O O     . SER A 1 63 ? 10.548 -8.710  6.084   1.00 44.71 ? 206 SER A O     1 
ATOM   435  C CB    . SER A 1 63 ? 7.470  -9.851  5.387   1.00 45.02 ? 206 SER A CB    1 
ATOM   436  O OG    . SER A 1 63 ? 8.191  -10.040 4.194   1.00 48.44 ? 206 SER A OG    1 
ATOM   437  N N     . GLY A 1 64 ? 9.679  -10.114 7.610   1.00 43.99 ? 207 GLY A N     1 
ATOM   438  C CA    . GLY A 1 64 ? 10.999 -10.570 8.072   1.00 43.57 ? 207 GLY A CA    1 
ATOM   439  C C     . GLY A 1 64 ? 10.957 -11.733 9.033   1.00 43.78 ? 207 GLY A C     1 
ATOM   440  O O     . GLY A 1 64 ? 9.882  -12.148 9.464   1.00 43.31 ? 207 GLY A O     1 
ATOM   441  N N     . THR A 1 65 ? 12.140 -12.257 9.370   1.00 43.64 ? 208 THR A N     1 
ATOM   442  C CA    . THR A 1 65 ? 12.286 -13.360 10.309  1.00 43.69 ? 208 THR A CA    1 
ATOM   443  C C     . THR A 1 65 ? 12.060 -12.932 11.762  1.00 44.30 ? 208 THR A C     1 
ATOM   444  O O     . THR A 1 65 ? 12.084 -13.753 12.662  1.00 44.86 ? 208 THR A O     1 
ATOM   445  C CB    . THR A 1 65 ? 13.689 -14.000 10.176  1.00 43.99 ? 208 THR A CB    1 
ATOM   446  O OG1   . THR A 1 65 ? 14.675 -12.962 10.274  1.00 42.47 ? 208 THR A OG1   1 
ATOM   447  C CG2   . THR A 1 65 ? 13.807 -14.729 8.823   1.00 42.49 ? 208 THR A CG2   1 
ATOM   448  N N     . SER A 1 66 ? 11.863 -11.636 11.982  1.00 45.08 ? 209 SER A N     1 
ATOM   449  C CA    . SER A 1 66 ? 11.486 -11.111 13.287  1.00 45.40 ? 209 SER A CA    1 
ATOM   450  C C     . SER A 1 66 ? 10.631 -9.883  13.085  1.00 45.53 ? 209 SER A C     1 
ATOM   451  O O     . SER A 1 66 ? 10.641 -9.287  11.994  1.00 46.09 ? 209 SER A O     1 
ATOM   452  C CB    . SER A 1 66 ? 12.721 -10.728 14.096  1.00 45.43 ? 209 SER A CB    1 
ATOM   453  O OG    . SER A 1 66 ? 13.373 -9.618  13.498  1.00 46.30 ? 209 SER A OG    1 
ATOM   454  N N     . LYS A 1 67 ? 9.921  -9.488  14.134  1.00 45.89 ? 210 LYS A N     1 
ATOM   455  C CA    . LYS A 1 67 ? 9.074  -8.307  14.102  1.00 47.13 ? 210 LYS A CA    1 
ATOM   456  C C     . LYS A 1 67 ? 9.890  -7.038  13.836  1.00 48.33 ? 210 LYS A C     1 
ATOM   457  O O     . LYS A 1 67 ? 9.447  -6.165  13.085  1.00 48.89 ? 210 LYS A O     1 
ATOM   458  C CB    . LYS A 1 67 ? 8.262  -8.164  15.398  1.00 46.81 ? 210 LYS A CB    1 
ATOM   459  C CG    . LYS A 1 67 ? 7.250  -9.270  15.638  1.00 44.93 ? 210 LYS A CG    1 
ATOM   460  C CD    . LYS A 1 67 ? 6.305  -8.869  16.763  1.00 45.89 ? 210 LYS A CD    1 
ATOM   461  C CE    . LYS A 1 67 ? 5.339  -9.986  17.105  1.00 43.53 ? 210 LYS A CE    1 
ATOM   462  N NZ    . LYS A 1 67 ? 4.496  -9.576  18.269  1.00 43.61 ? 210 LYS A NZ    1 
ATOM   463  N N     . LYS A 1 68 ? 11.052 -6.924  14.479  1.00 48.71 ? 211 LYS A N     1 
ATOM   464  C CA    . LYS A 1 68 ? 11.967 -5.777  14.273  1.00 48.80 ? 211 LYS A CA    1 
ATOM   465  C C     . LYS A 1 68 ? 12.392 -5.686  12.786  1.00 47.62 ? 211 LYS A C     1 
ATOM   466  O O     . LYS A 1 68 ? 12.359 -4.632  12.193  1.00 47.40 ? 211 LYS A O     1 
ATOM   467  C CB    . LYS A 1 68 ? 13.211 -5.919  15.177  1.00 48.96 ? 211 LYS A CB    1 
ATOM   468  C CG    . LYS A 1 68 ? 14.322 -4.849  14.969  1.00 50.10 ? 211 LYS A CG    1 
ATOM   469  C CD    . LYS A 1 68 ? 15.604 -5.182  15.793  1.00 50.24 ? 211 LYS A CD    1 
ATOM   470  C CE    . LYS A 1 68 ? 16.539 -6.088  14.979  1.00 53.14 ? 211 LYS A CE    1 
ATOM   471  N NZ    . LYS A 1 68 ? 17.775 -6.541  15.700  1.00 54.60 ? 211 LYS A NZ    1 
ATOM   472  N N     . LEU A 1 69 ? 12.797 -6.803  12.204  1.00 47.15 ? 212 LEU A N     1 
ATOM   473  C CA    . LEU A 1 69 ? 13.129 -6.841  10.771  1.00 46.66 ? 212 LEU A CA    1 
ATOM   474  C C     . LEU A 1 69 ? 11.932 -6.502  9.863   1.00 45.95 ? 212 LEU A C     1 
ATOM   475  O O     . LEU A 1 69 ? 12.063 -5.713  8.924   1.00 45.59 ? 212 LEU A O     1 
ATOM   476  C CB    . LEU A 1 69 ? 13.770 -8.170  10.398  1.00 46.34 ? 212 LEU A CB    1 
ATOM   477  C CG    . LEU A 1 69 ? 15.077 -8.443  11.153  1.00 48.44 ? 212 LEU A CG    1 
ATOM   478  C CD1   . LEU A 1 69 ? 15.832 -9.599  10.542  1.00 46.17 ? 212 LEU A CD1   1 
ATOM   479  C CD2   . LEU A 1 69 ? 15.981 -7.198  11.215  1.00 50.15 ? 212 LEU A CD2   1 
ATOM   480  N N     . ALA A 1 70 ? 10.770 -7.079  10.169  1.00 45.16 ? 213 ALA A N     1 
ATOM   481  C CA    . ALA A 1 70 ? 9.536  -6.783  9.439   1.00 43.89 ? 213 ALA A CA    1 
ATOM   482  C C     . ALA A 1 70 ? 9.217  -5.295  9.472   1.00 43.64 ? 213 ALA A C     1 
ATOM   483  O O     . ALA A 1 70 ? 8.907  -4.688  8.431   1.00 43.06 ? 213 ALA A O     1 
ATOM   484  C CB    . ALA A 1 70 ? 8.373  -7.588  9.998   1.00 44.23 ? 213 ALA A CB    1 
ATOM   485  N N     . LYS A 1 71 ? 9.301  -4.701  10.660  1.00 42.84 ? 214 LYS A N     1 
ATOM   486  C CA    . LYS A 1 71 ? 8.995  -3.278  10.830  1.00 42.27 ? 214 LYS A CA    1 
ATOM   487  C C     . LYS A 1 71 ? 9.970  -2.360  10.090  1.00 41.99 ? 214 LYS A C     1 
ATOM   488  O O     . LYS A 1 71 ? 9.557  -1.364  9.494   1.00 41.57 ? 214 LYS A O     1 
ATOM   489  C CB    . LYS A 1 71 ? 9.023  -2.906  12.297  1.00 42.56 ? 214 LYS A CB    1 
ATOM   490  C CG    . LYS A 1 71 ? 8.706  -1.454  12.567  1.00 42.38 ? 214 LYS A CG    1 
ATOM   491  C CD    . LYS A 1 71 ? 8.777  -1.181  14.093  1.00 45.87 ? 214 LYS A CD    1 
ATOM   492  C CE    . LYS A 1 71 ? 8.156  0.176   14.455  1.00 43.57 ? 214 LYS A CE    1 
ATOM   493  N NZ    . LYS A 1 71 ? 8.454  0.569   15.905  1.00 48.03 ? 214 LYS A NZ    1 
ATOM   494  N N     . ARG A 1 72 ? 11.260 -2.683  10.178  1.00 40.97 ? 215 ARG A N     1 
ATOM   495  C CA    . ARG A 1 72 ? 12.308 -1.962  9.435   1.00 41.89 ? 215 ARG A CA    1 
ATOM   496  C C     . ARG A 1 72 ? 12.045 -2.055  7.916   1.00 41.33 ? 215 ARG A C     1 
ATOM   497  O O     . ARG A 1 72 ? 12.269 -1.084  7.189   1.00 41.22 ? 215 ARG A O     1 
ATOM   498  C CB    . ARG A 1 72 ? 13.679 -2.579  9.731   1.00 40.31 ? 215 ARG A CB    1 
ATOM   499  C CG    . ARG A 1 72 ? 14.862 -1.805  9.167   1.00 43.60 ? 215 ARG A CG    1 
ATOM   500  C CD    . ARG A 1 72 ? 16.168 -2.604  9.376   1.00 43.29 ? 215 ARG A CD    1 
ATOM   501  N NE    . ARG A 1 72 ? 16.412 -2.846  10.800  1.00 45.27 ? 215 ARG A NE    1 
ATOM   502  C CZ    . ARG A 1 72 ? 17.441 -3.541  11.280  1.00 47.10 ? 215 ARG A CZ    1 
ATOM   503  N NH1   . ARG A 1 72 ? 18.343 -4.096  10.457  1.00 44.18 ? 215 ARG A NH1   1 
ATOM   504  N NH2   . ARG A 1 72 ? 17.554 -3.700  12.592  1.00 48.15 ? 215 ARG A NH2   1 
ATOM   505  N N     . ASN A 1 73 ? 11.614 -3.233  7.439   1.00 40.62 ? 216 ASN A N     1 
ATOM   506  C CA    . ASN A 1 73 ? 11.342 -3.406  6.005   1.00 40.30 ? 216 ASN A CA    1 
ATOM   507  C C     . ASN A 1 73 ? 10.069 -2.647  5.613   1.00 40.38 ? 216 ASN A C     1 
ATOM   508  O O     . ASN A 1 73 ? 9.987  -2.123  4.519   1.00 40.46 ? 216 ASN A O     1 
ATOM   509  C CB    . ASN A 1 73 ? 11.264 -4.885  5.628   1.00 40.29 ? 216 ASN A CB    1 
ATOM   510  C CG    . ASN A 1 73 ? 12.635 -5.567  5.636   1.00 41.00 ? 216 ASN A CG    1 
ATOM   511  O OD1   . ASN A 1 73 ? 13.672 -4.907  5.579   1.00 41.14 ? 216 ASN A OD1   1 
ATOM   512  N ND2   . ASN A 1 73 ? 12.637 -6.885  5.676   1.00 41.57 ? 216 ASN A ND2   1 
ATOM   513  N N     . ALA A 1 74 ? 9.106  -2.552  6.535   1.00 40.48 ? 217 ALA A N     1 
ATOM   514  C CA    . ALA A 1 74 ? 7.897  -1.737  6.324   1.00 40.58 ? 217 ALA A CA    1 
ATOM   515  C C     . ALA A 1 74 ? 8.212  -0.240  6.232   1.00 40.96 ? 217 ALA A C     1 
ATOM   516  O O     . ALA A 1 74 ? 7.689  0.464   5.356   1.00 40.53 ? 217 ALA A O     1 
ATOM   517  C CB    . ALA A 1 74 ? 6.839  -2.022  7.405   1.00 40.32 ? 217 ALA A CB    1 
ATOM   518  N N     . ALA A 1 75 ? 9.058  0.247   7.143   1.00 40.98 ? 218 ALA A N     1 
ATOM   519  C CA    . ALA A 1 75 ? 9.507  1.630   7.104   1.00 40.62 ? 218 ALA A CA    1 
ATOM   520  C C     . ALA A 1 75 ? 10.277 1.952   5.831   1.00 39.61 ? 218 ALA A C     1 
ATOM   521  O O     . ALA A 1 75 ? 10.047 2.994   5.212   1.00 40.75 ? 218 ALA A O     1 
ATOM   522  C CB    . ALA A 1 75 ? 10.350 1.993   8.357   1.00 41.03 ? 218 ALA A CB    1 
ATOM   523  N N     . ALA A 1 76 ? 11.189 1.075   5.440   1.00 38.91 ? 219 ALA A N     1 
ATOM   524  C CA    . ALA A 1 76 ? 11.950 1.256   4.198   1.00 38.33 ? 219 ALA A CA    1 
ATOM   525  C C     . ALA A 1 76 ? 10.996 1.407   3.003   1.00 38.49 ? 219 ALA A C     1 
ATOM   526  O O     . ALA A 1 76 ? 11.152 2.344   2.190   1.00 38.37 ? 219 ALA A O     1 
ATOM   527  C CB    . ALA A 1 76 ? 12.881 0.084   3.968   1.00 37.01 ? 219 ALA A CB    1 
ATOM   528  N N     . LYS A 1 77 ? 10.042 0.478   2.877   1.00 38.68 ? 220 LYS A N     1 
ATOM   529  C CA    . LYS A 1 77 ? 9.036  0.507   1.785   1.00 39.82 ? 220 LYS A CA    1 
ATOM   530  C C     . LYS A 1 77 ? 8.256  1.825   1.808   1.00 39.58 ? 220 LYS A C     1 
ATOM   531  O O     . LYS A 1 77 ? 8.030  2.454   0.779   1.00 40.16 ? 220 LYS A O     1 
ATOM   532  C CB    . LYS A 1 77 ? 8.025  -0.622  1.960   1.00 40.26 ? 220 LYS A CB    1 
ATOM   533  C CG    . LYS A 1 77 ? 8.181  -1.764  1.015   1.00 45.59 ? 220 LYS A CG    1 
ATOM   534  C CD    . LYS A 1 77 ? 6.802  -2.228  0.563   1.00 49.34 ? 220 LYS A CD    1 
ATOM   535  C CE    . LYS A 1 77 ? 6.846  -3.700  0.233   1.00 50.19 ? 220 LYS A CE    1 
ATOM   536  N NZ    . LYS A 1 77 ? 5.506  -4.241  -0.094  1.00 53.23 ? 220 LYS A NZ    1 
ATOM   537  N N     . MET A 1 78 ? 7.864  2.256   2.995   1.00 39.14 ? 221 MET A N     1 
ATOM   538  C CA    . MET A 1 78 ? 7.147  3.527   3.124   1.00 39.97 ? 221 MET A CA    1 
ATOM   539  C C     . MET A 1 78 ? 8.014  4.721   2.707   1.00 40.93 ? 221 MET A C     1 
ATOM   540  O O     . MET A 1 78 ? 7.534  5.634   2.032   1.00 42.19 ? 221 MET A O     1 
ATOM   541  C CB    . MET A 1 78 ? 6.567  3.706   4.531   1.00 39.43 ? 221 MET A CB    1 
ATOM   542  C CG    . MET A 1 78 ? 5.707  4.973   4.710   1.00 38.77 ? 221 MET A CG    1 
ATOM   543  S SD    . MET A 1 78 ? 4.263  4.964   3.613   1.00 39.22 ? 221 MET A SD    1 
ATOM   544  C CE    . MET A 1 78 ? 3.255  3.701   4.453   1.00 32.35 ? 221 MET A CE    1 
ATOM   545  N N     . LEU A 1 79 ? 9.279  4.719   3.113   1.00 41.14 ? 222 LEU A N     1 
ATOM   546  C CA    . LEU A 1 79 ? 10.212 5.761   2.706   1.00 41.98 ? 222 LEU A CA    1 
ATOM   547  C C     . LEU A 1 79 ? 10.308 5.851   1.173   1.00 41.37 ? 222 LEU A C     1 
ATOM   548  O O     . LEU A 1 79 ? 10.298 6.932   0.596   1.00 41.40 ? 222 LEU A O     1 
ATOM   549  C CB    . LEU A 1 79 ? 11.601 5.484   3.298   1.00 41.28 ? 222 LEU A CB    1 
ATOM   550  C CG    . LEU A 1 79 ? 11.860 5.892   4.768   1.00 43.70 ? 222 LEU A CG    1 
ATOM   551  C CD1   . LEU A 1 79 ? 13.184 5.272   5.298   1.00 40.76 ? 222 LEU A CD1   1 
ATOM   552  C CD2   . LEU A 1 79 ? 11.890 7.440   4.906   1.00 44.70 ? 222 LEU A CD2   1 
ATOM   553  N N     . LEU A 1 80 ? 10.399 4.701   0.532   1.00 41.00 ? 223 LEU A N     1 
ATOM   554  C CA    . LEU A 1 80 ? 10.419 4.624   -0.928  1.00 41.19 ? 223 LEU A CA    1 
ATOM   555  C C     . LEU A 1 80 ? 9.114  5.190   -1.512  1.00 41.72 ? 223 LEU A C     1 
ATOM   556  O O     . LEU A 1 80 ? 9.150  5.983   -2.460  1.00 41.78 ? 223 LEU A O     1 
ATOM   557  C CB    . LEU A 1 80 ? 10.669 3.191   -1.394  1.00 39.48 ? 223 LEU A CB    1 
ATOM   558  C CG    . LEU A 1 80 ? 12.067 2.621   -1.089  1.00 39.80 ? 223 LEU A CG    1 
ATOM   559  C CD1   . LEU A 1 80 ? 12.112 1.103   -1.282  1.00 40.91 ? 223 LEU A CD1   1 
ATOM   560  C CD2   . LEU A 1 80 ? 13.178 3.279   -1.894  1.00 38.96 ? 223 LEU A CD2   1 
ATOM   561  N N     . ARG A 1 81 ? 7.989  4.818   -0.910  1.00 42.22 ? 224 ARG A N     1 
ATOM   562  C CA    . ARG A 1 81 ? 6.684  5.288   -1.359  1.00 44.20 ? 224 ARG A CA    1 
ATOM   563  C C     . ARG A 1 81 ? 6.590  6.821   -1.268  1.00 44.81 ? 224 ARG A C     1 
ATOM   564  O O     . ARG A 1 81 ? 6.321  7.484   -2.270  1.00 44.31 ? 224 ARG A O     1 
ATOM   565  C CB    . ARG A 1 81 ? 5.553  4.606   -0.578  1.00 43.90 ? 224 ARG A CB    1 
ATOM   566  C CG    . ARG A 1 81 ? 4.185  5.241   -0.779  1.00 46.34 ? 224 ARG A CG    1 
ATOM   567  C CD    . ARG A 1 81 ? 3.696  5.150   -2.263  1.00 46.68 ? 224 ARG A CD    1 
ATOM   568  N NE    . ARG A 1 81 ? 3.216  3.805   -2.548  1.00 47.42 ? 224 ARG A NE    1 
ATOM   569  C CZ    . ARG A 1 81 ? 3.004  3.294   -3.755  1.00 51.27 ? 224 ARG A CZ    1 
ATOM   570  N NH1   . ARG A 1 81 ? 3.229  4.007   -4.862  1.00 49.24 ? 224 ARG A NH1   1 
ATOM   571  N NH2   . ARG A 1 81 ? 2.558  2.043   -3.854  1.00 51.97 ? 224 ARG A NH2   1 
ATOM   572  N N     . VAL A 1 82 ? 6.875  7.367   -0.086  1.00 45.37 ? 225 VAL A N     1 
ATOM   573  C CA    . VAL A 1 82 ? 6.773  8.806   0.162   1.00 46.76 ? 225 VAL A CA    1 
ATOM   574  C C     . VAL A 1 82 ? 7.755  9.645   -0.669  1.00 47.70 ? 225 VAL A C     1 
ATOM   575  O O     . VAL A 1 82 ? 7.377  10.691  -1.202  1.00 47.92 ? 225 VAL A O     1 
ATOM   576  C CB    . VAL A 1 82 ? 6.915  9.136   1.690   1.00 46.87 ? 225 VAL A CB    1 
ATOM   577  C CG1   . VAL A 1 82 ? 7.028  10.647  1.934   1.00 47.05 ? 225 VAL A CG1   1 
ATOM   578  C CG2   . VAL A 1 82 ? 5.719  8.573   2.443   1.00 46.10 ? 225 VAL A CG2   1 
ATOM   579  N N     . HIS A 1 83 ? 8.996  9.175   -0.794  1.00 48.70 ? 226 HIS A N     1 
ATOM   580  C CA    . HIS A 1 83 ? 10.026 9.887   -1.548  1.00 49.50 ? 226 HIS A CA    1 
ATOM   581  C C     . HIS A 1 83 ? 9.856  9.807   -3.072  1.00 50.24 ? 226 HIS A C     1 
ATOM   582  O O     . HIS A 1 83 ? 10.441 10.618  -3.798  1.00 51.04 ? 226 HIS A O     1 
ATOM   583  C CB    . HIS A 1 83 ? 11.426 9.407   -1.164  1.00 49.74 ? 226 HIS A CB    1 
ATOM   584  C CG    . HIS A 1 83 ? 11.946 9.990   0.113   1.00 49.84 ? 226 HIS A CG    1 
ATOM   585  N ND1   . HIS A 1 83 ? 12.229 11.332  0.260   1.00 49.66 ? 226 HIS A ND1   1 
ATOM   586  C CD2   . HIS A 1 83 ? 12.279 9.406   1.290   1.00 51.83 ? 226 HIS A CD2   1 
ATOM   587  C CE1   . HIS A 1 83 ? 12.681 11.554  1.483   1.00 50.18 ? 226 HIS A CE1   1 
ATOM   588  N NE2   . HIS A 1 83 ? 12.728 10.402  2.126   1.00 50.31 ? 226 HIS A NE2   1 
ATOM   589  N N     . THR A 1 84 ? 9.073  8.844   -3.565  1.00 50.60 ? 227 THR A N     1 
ATOM   590  C CA    . THR A 1 84 ? 8.946  8.651   -5.022  1.00 50.43 ? 227 THR A CA    1 
ATOM   591  C C     . THR A 1 84 ? 7.572  9.051   -5.552  1.00 50.88 ? 227 THR A C     1 
ATOM   592  O O     . THR A 1 84 ? 7.369  9.132   -6.773  1.00 50.98 ? 227 THR A O     1 
ATOM   593  C CB    . THR A 1 84 ? 9.333  7.199   -5.522  1.00 50.46 ? 227 THR A CB    1 
ATOM   594  O OG1   . THR A 1 84 ? 8.365  6.234   -5.080  1.00 49.93 ? 227 THR A OG1   1 
ATOM   595  C CG2   . THR A 1 84 ? 10.736 6.792   -5.050  1.00 48.84 ? 227 THR A CG2   1 
ATOM   596  P P     . C   B 2 1  ? 21.099 -4.010  17.324  1.00 68.48 ? 1   C   B P     1 
ATOM   597  O OP1   . C   B 2 1  ? 19.837 -4.452  17.980  1.00 65.84 ? 1   C   B OP1   1 
ATOM   598  O OP2   . C   B 2 1  ? 21.385 -4.318  15.895  1.00 67.75 ? 1   C   B OP2   1 
ATOM   599  O "O5'" . C   B 2 1  ? 22.330 -4.461  18.232  1.00 65.14 ? 1   C   B "O5'" 1 
ATOM   600  C "C5'" . C   B 2 1  ? 23.652 -4.055  17.985  1.00 65.03 ? 1   C   B "C5'" 1 
ATOM   601  C "C4'" . C   B 2 1  ? 24.328 -3.773  19.313  1.00 64.30 ? 1   C   B "C4'" 1 
ATOM   602  O "O4'" . C   B 2 1  ? 23.702 -2.602  19.893  1.00 64.97 ? 1   C   B "O4'" 1 
ATOM   603  C "C3'" . C   B 2 1  ? 24.122 -4.819  20.404  1.00 62.92 ? 1   C   B "C3'" 1 
ATOM   604  O "O3'" . C   B 2 1  ? 24.965 -5.967  20.226  1.00 61.62 ? 1   C   B "O3'" 1 
ATOM   605  C "C2'" . C   B 2 1  ? 24.443 -4.001  21.653  1.00 62.85 ? 1   C   B "C2'" 1 
ATOM   606  O "O2'" . C   B 2 1  ? 25.827 -3.775  21.861  1.00 62.31 ? 1   C   B "O2'" 1 
ATOM   607  C "C1'" . C   B 2 1  ? 23.730 -2.691  21.311  1.00 62.94 ? 1   C   B "C1'" 1 
ATOM   608  N N1    . C   B 2 1  ? 22.331 -2.541  21.896  1.00 61.11 ? 1   C   B N1    1 
ATOM   609  C C2    . C   B 2 1  ? 22.174 -2.051  23.212  1.00 61.18 ? 1   C   B C2    1 
ATOM   610  O O2    . C   B 2 1  ? 23.168 -1.738  23.906  1.00 60.17 ? 1   C   B O2    1 
ATOM   611  N N3    . C   B 2 1  ? 20.912 -1.925  23.705  1.00 59.91 ? 1   C   B N3    1 
ATOM   612  C C4    . C   B 2 1  ? 19.848 -2.255  22.970  1.00 60.76 ? 1   C   B C4    1 
ATOM   613  N N4    . C   B 2 1  ? 18.644 -2.090  23.529  1.00 60.56 ? 1   C   B N4    1 
ATOM   614  C C5    . C   B 2 1  ? 19.977 -2.751  21.634  1.00 60.37 ? 1   C   B C5    1 
ATOM   615  C C6    . C   B 2 1  ? 21.225 -2.877  21.154  1.00 61.21 ? 1   C   B C6    1 
ATOM   616  P P     . G   B 2 2  ? 24.385 -7.459  20.408  0.50 59.07 ? 2   G   B P     1 
ATOM   617  O OP1   . G   B 2 2  ? 25.398 -8.390  19.848  0.50 58.58 ? 2   G   B OP1   1 
ATOM   618  O OP2   . G   B 2 2  ? 22.984 -7.532  19.932  0.50 57.61 ? 2   G   B OP2   1 
ATOM   619  O "O5'" . G   B 2 2  ? 24.384 -7.596  22.001  0.50 55.74 ? 2   G   B "O5'" 1 
ATOM   620  C "C5'" . G   B 2 2  ? 25.581 -7.317  22.719  0.50 52.13 ? 2   G   B "C5'" 1 
ATOM   621  C "C4'" . G   B 2 2  ? 25.331 -7.029  24.189  0.50 49.48 ? 2   G   B "C4'" 1 
ATOM   622  O "O4'" . G   B 2 2  ? 24.665 -5.755  24.374  0.50 48.58 ? 2   G   B "O4'" 1 
ATOM   623  C "C3'" . G   B 2 2  ? 24.424 -7.993  24.937  0.50 47.90 ? 2   G   B "C3'" 1 
ATOM   624  O "O3'" . G   B 2 2  ? 25.109 -9.217  25.189  0.50 48.22 ? 2   G   B "O3'" 1 
ATOM   625  C "C2'" . G   B 2 2  ? 24.244 -7.156  26.198  0.50 47.01 ? 2   G   B "C2'" 1 
ATOM   626  O "O2'" . G   B 2 2  ? 25.431 -7.142  26.972  0.50 46.03 ? 2   G   B "O2'" 1 
ATOM   627  C "C1'" . G   B 2 2  ? 23.966 -5.773  25.609  0.50 46.13 ? 2   G   B "C1'" 1 
ATOM   628  N N9    . G   B 2 2  ? 22.532 -5.513  25.396  0.50 45.39 ? 2   G   B N9    1 
ATOM   629  C C8    . G   B 2 2  ? 21.849 -5.633  24.216  0.50 44.92 ? 2   G   B C8    1 
ATOM   630  N N7    . G   B 2 2  ? 20.578 -5.366  24.306  0.50 44.81 ? 2   G   B N7    1 
ATOM   631  C C5    . G   B 2 2  ? 20.395 -5.039  25.639  0.50 45.16 ? 2   G   B C5    1 
ATOM   632  C C6    . G   B 2 2  ? 19.213 -4.650  26.331  0.50 44.71 ? 2   G   B C6    1 
ATOM   633  O O6    . G   B 2 2  ? 18.059 -4.513  25.883  1.00 47.26 ? 2   G   B O6    1 
ATOM   634  N N1    . G   B 2 2  ? 19.447 -4.412  27.678  0.50 43.30 ? 2   G   B N1    1 
ATOM   635  C C2    . G   B 2 2  ? 20.670 -4.526  28.283  0.50 44.76 ? 2   G   B C2    1 
ATOM   636  N N2    . G   B 2 2  ? 20.681 -4.257  29.598  1.00 46.04 ? 2   G   B N2    1 
ATOM   637  N N3    . G   B 2 2  ? 21.794 -4.876  27.650  0.50 44.81 ? 2   G   B N3    1 
ATOM   638  C C4    . G   B 2 2  ? 21.590 -5.123  26.328  0.50 44.83 ? 2   G   B C4    1 
ATOM   639  P P     . C   B 2 3  ? 24.314 -10.597 25.368  0.50 46.76 ? 3   C   B P     1 
ATOM   640  O OP1   . C   B 2 3  ? 25.343 -11.659 25.391  0.50 48.39 ? 3   C   B OP1   1 
ATOM   641  O OP2   . C   B 2 3  ? 23.212 -10.685 24.398  0.50 46.75 ? 3   C   B OP2   1 
ATOM   642  O "O5'" . C   B 2 3  ? 23.682 -10.439 26.831  0.50 47.04 ? 3   C   B "O5'" 1 
ATOM   643  C "C5'" . C   B 2 3  ? 24.505 -10.400 28.005  0.50 45.19 ? 3   C   B "C5'" 1 
ATOM   644  C "C4'" . C   B 2 3  ? 23.726 -9.913  29.219  0.50 44.47 ? 3   C   B "C4'" 1 
ATOM   645  O "O4'" . C   B 2 3  ? 23.159 -8.598  28.954  0.50 44.85 ? 3   C   B "O4'" 1 
ATOM   646  C "C3'" . C   B 2 3  ? 22.512 -10.746 29.630  0.50 43.82 ? 3   C   B "C3'" 1 
ATOM   647  O "O3'" . C   B 2 3  ? 22.870 -11.929 30.355  0.50 41.91 ? 3   C   B "O3'" 1 
ATOM   648  C "C2'" . C   B 2 3  ? 21.745 -9.715  30.463  0.50 44.63 ? 3   C   B "C2'" 1 
ATOM   649  O "O2'" . C   B 2 3  ? 22.300 -9.438  31.732  0.50 45.08 ? 3   C   B "O2'" 1 
ATOM   650  C "C1'" . C   B 2 3  ? 21.886 -8.470  29.594  0.50 44.88 ? 3   C   B "C1'" 1 
ATOM   651  N N1    . C   B 2 3  ? 20.733 -8.312  28.620  0.50 44.02 ? 3   C   B N1    1 
ATOM   652  C C2    . C   B 2 3  ? 19.447 -7.890  29.057  0.50 44.51 ? 3   C   B C2    1 
ATOM   653  O O2    . C   B 2 3  ? 19.213 -7.631  30.250  1.00 47.86 ? 3   C   B O2    1 
ATOM   654  N N3    . C   B 2 3  ? 18.451 -7.766  28.153  0.50 42.18 ? 3   C   B N3    1 
ATOM   655  C C4    . C   B 2 3  ? 18.673 -8.055  26.866  0.50 43.82 ? 3   C   B C4    1 
ATOM   656  N N4    . C   B 2 3  ? 17.651 -7.942  26.009  1.00 46.14 ? 3   C   B N4    1 
ATOM   657  C C5    . C   B 2 3  ? 19.949 -8.490  26.396  0.50 44.45 ? 3   C   B C5    1 
ATOM   658  C C6    . C   B 2 3  ? 20.933 -8.602  27.298  0.50 43.78 ? 3   C   B C6    1 
ATOM   659  P P     . G   B 2 4  ? 22.003 -13.283 30.271  0.50 42.22 ? 4   G   B P     1 
ATOM   660  O OP1   . G   B 2 4  ? 22.847 -14.375 30.818  0.50 42.17 ? 4   G   B OP1   1 
ATOM   661  O OP2   . G   B 2 4  ? 21.439 -13.430 28.922  0.50 41.86 ? 4   G   B OP2   1 
ATOM   662  O "O5'" . G   B 2 4  ? 20.806 -13.005 31.303  0.50 41.74 ? 4   G   B "O5'" 1 
ATOM   663  C "C5'" . G   B 2 4  ? 21.111 -12.628 32.658  0.50 41.13 ? 4   G   B "C5'" 1 
ATOM   664  C "C4'" . G   B 2 4  ? 19.896 -12.207 33.474  0.50 39.77 ? 4   G   B "C4'" 1 
ATOM   665  O "O4'" . G   B 2 4  ? 19.398 -10.936 32.999  0.50 40.04 ? 4   G   B "O4'" 1 
ATOM   666  C "C3'" . G   B 2 4  ? 18.664 -13.115 33.437  0.50 40.29 ? 4   G   B "C3'" 1 
ATOM   667  O "O3'" . G   B 2 4  ? 18.789 -14.188 34.363  0.50 36.15 ? 4   G   B "O3'" 1 
ATOM   668  C "C2'" . G   B 2 4  ? 17.542 -12.148 33.818  0.50 39.56 ? 4   G   B "C2'" 1 
ATOM   669  O "O2'" . G   B 2 4  ? 17.577 -11.724 35.176  0.50 37.63 ? 4   G   B "O2'" 1 
ATOM   670  C "C1'" . G   B 2 4  ? 17.974 -10.954 33.001  0.50 41.55 ? 4   G   B "C1'" 1 
ATOM   671  N N9    . G   B 2 4  ? 17.426 -10.832 31.644  1.00 42.82 ? 4   G   B N9    1 
ATOM   672  C C8    . G   B 2 4  ? 18.101 -11.076 30.460  1.00 43.63 ? 4   G   B C8    1 
ATOM   673  N N7    . G   B 2 4  ? 17.369 -10.846 29.401  1.00 44.67 ? 4   G   B N7    1 
ATOM   674  C C5    . G   B 2 4  ? 16.140 -10.433 29.895  0.50 42.36 ? 4   G   B C5    1 
ATOM   675  C C6    . G   B 2 4  ? 14.966 -10.063 29.196  0.50 42.54 ? 4   G   B C6    1 
ATOM   676  O O6    . G   B 2 4  ? 14.794 -10.019 27.971  1.00 45.20 ? 4   G   B O6    1 
ATOM   677  N N1    . G   B 2 4  ? 13.918 -9.711  30.041  0.50 40.21 ? 4   G   B N1    1 
ATOM   678  C C2    . G   B 2 4  ? 14.020 -9.730  31.410  0.50 42.01 ? 4   G   B C2    1 
ATOM   679  N N2    . G   B 2 4  ? 12.910 -9.366  32.059  1.00 42.51 ? 4   G   B N2    1 
ATOM   680  N N3    . G   B 2 4  ? 15.119 -10.075 32.093  0.50 40.47 ? 4   G   B N3    1 
ATOM   681  C C4    . G   B 2 4  ? 16.149 -10.419 31.276  0.50 41.75 ? 4   G   B C4    1 
ATOM   682  P P     . C   B 2 5  ? 18.205 -15.614 33.989  0.50 38.65 ? 5   C   B P     1 
ATOM   683  O OP1   . C   B 2 5  ? 18.732 -16.563 34.992  0.50 36.97 ? 5   C   B OP1   1 
ATOM   684  O OP2   . C   B 2 5  ? 18.390 -15.855 32.538  0.50 37.58 ? 5   C   B OP2   1 
ATOM   685  O "O5'" . C   B 2 5  ? 16.629 -15.432 34.197  0.50 37.23 ? 5   C   B "O5'" 1 
ATOM   686  C "C5'" . C   B 2 5  ? 16.069 -15.377 35.495  0.50 35.98 ? 5   C   B "C5'" 1 
ATOM   687  C "C4'" . C   B 2 5  ? 14.659 -14.847 35.404  0.50 33.17 ? 5   C   B "C4'" 1 
ATOM   688  O "O4'" . C   B 2 5  ? 14.613 -13.556 34.713  0.50 32.87 ? 5   C   B "O4'" 1 
ATOM   689  C "C3'" . C   B 2 5  ? 13.761 -15.759 34.605  0.50 32.42 ? 5   C   B "C3'" 1 
ATOM   690  O "O3'" . C   B 2 5  ? 13.354 -16.918 35.366  0.50 33.03 ? 5   C   B "O3'" 1 
ATOM   691  C "C2'" . C   B 2 5  ? 12.666 -14.767 34.212  0.50 30.73 ? 5   C   B "C2'" 1 
ATOM   692  O "O2'" . C   B 2 5  ? 11.778 -14.358 35.234  0.50 30.54 ? 5   C   B "O2'" 1 
ATOM   693  C "C1'" . C   B 2 5  ? 13.506 -13.570 33.814  0.50 32.59 ? 5   C   B "C1'" 1 
ATOM   694  N N1    . C   B 2 5  ? 13.850 -13.512 32.331  0.50 32.06 ? 5   C   B N1    1 
ATOM   695  C C2    . C   B 2 5  ? 12.820 -13.133 31.458  0.50 32.89 ? 5   C   B C2    1 
ATOM   696  O O2    . C   B 2 5  ? 11.688 -12.879 31.915  1.00 37.95 ? 5   C   B O2    1 
ATOM   697  N N3    . C   B 2 5  ? 13.067 -13.061 30.128  0.50 31.07 ? 5   C   B N3    1 
ATOM   698  C C4    . C   B 2 5  ? 14.278 -13.379 29.660  0.50 33.17 ? 5   C   B C4    1 
ATOM   699  N N4    . C   B 2 5  ? 14.429 -13.284 28.336  1.00 36.10 ? 5   C   B N4    1 
ATOM   700  C C5    . C   B 2 5  ? 15.366 -13.775 30.516  0.50 32.54 ? 5   C   B C5    1 
ATOM   701  C C6    . C   B 2 5  ? 15.103 -13.835 31.835  0.50 31.56 ? 5   C   B C6    1 
ATOM   702  P P     . G   B 2 6  ? 13.154 -18.346 34.664  0.50 35.71 ? 6   G   B P     1 
ATOM   703  O OP1   . G   B 2 6  ? 12.916 -19.354 35.703  0.50 37.56 ? 6   G   B OP1   1 
ATOM   704  O OP2   . G   B 2 6  ? 14.225 -18.542 33.668  0.50 37.02 ? 6   G   B OP2   1 
ATOM   705  O "O5'" . G   B 2 6  ? 11.774 -18.209 33.879  0.50 36.42 ? 6   G   B "O5'" 1 
ATOM   706  C "C5'" . G   B 2 6  ? 10.564 -17.860 34.532  0.50 34.72 ? 6   G   B "C5'" 1 
ATOM   707  C "C4'" . G   B 2 6  ? 9.510  -17.484 33.499  0.50 34.16 ? 6   G   B "C4'" 1 
ATOM   708  O "O4'" . G   B 2 6  ? 9.941  -16.289 32.793  0.50 35.52 ? 6   G   B "O4'" 1 
ATOM   709  C "C3'" . G   B 2 6  ? 9.298  -18.474 32.359  0.50 34.10 ? 6   G   B "C3'" 1 
ATOM   710  O "O3'" . G   B 2 6  ? 8.565  -19.645 32.719  0.50 34.57 ? 6   G   B "O3'" 1 
ATOM   711  C "C2'" . G   B 2 6  ? 8.566  -17.588 31.350  0.50 34.95 ? 6   G   B "C2'" 1 
ATOM   712  O "O2'" . G   B 2 6  ? 7.229  -17.270 31.671  0.50 32.67 ? 6   G   B "O2'" 1 
ATOM   713  C "C1'" . G   B 2 6  ? 9.381  -16.324 31.480  0.50 38.44 ? 6   G   B "C1'" 1 
ATOM   714  N N9    . G   B 2 6  ? 10.425 -16.235 30.467  1.00 41.44 ? 6   G   B N9    1 
ATOM   715  C C8    . G   B 2 6  ? 11.786 -16.389 30.659  1.00 41.79 ? 6   G   B C8    1 
ATOM   716  N N7    . G   B 2 6  ? 12.470 -16.195 29.557  1.00 44.29 ? 6   G   B N7    1 
ATOM   717  C C5    . G   B 2 6  ? 11.514 -15.902 28.584  0.50 40.67 ? 6   G   B C5    1 
ATOM   718  C C6    . G   B 2 6  ? 11.655 -15.625 27.204  0.50 40.75 ? 6   G   B C6    1 
ATOM   719  O O6    . G   B 2 6  ? 12.687 -15.588 26.539  1.00 42.78 ? 6   G   B O6    1 
ATOM   720  N N1    . G   B 2 6  ? 10.445 -15.381 26.565  0.50 38.79 ? 6   G   B N1    1 
ATOM   721  C C2    . G   B 2 6  ? 9.250  -15.408 27.212  0.50 39.78 ? 6   G   B C2    1 
ATOM   722  N N2    . G   B 2 6  ? 8.192  -15.161 26.455  1.00 41.34 ? 6   G   B N2    1 
ATOM   723  N N3    . G   B 2 6  ? 9.085  -15.673 28.498  0.50 39.06 ? 6   G   B N3    1 
ATOM   724  C C4    . G   B 2 6  ? 10.257 -15.911 29.128  0.50 40.14 ? 6   G   B C4    1 
ATOM   725  P P     . C   B 2 7  ? 8.799  -20.979 31.880  0.50 36.60 ? 7   C   B P     1 
ATOM   726  O OP1   . C   B 2 7  ? 8.014  -22.043 32.527  0.50 37.92 ? 7   C   B OP1   1 
ATOM   727  O OP2   . C   B 2 7  ? 10.254 -21.155 31.677  0.50 36.80 ? 7   C   B OP2   1 
ATOM   728  O "O5'" . C   B 2 7  ? 8.148  -20.595 30.465  0.50 38.74 ? 7   C   B "O5'" 1 
ATOM   729  C "C5'" . C   B 2 7  ? 6.737  -20.612 30.312  0.50 40.06 ? 7   C   B "C5'" 1 
ATOM   730  C "C4'" . C   B 2 7  ? 6.289  -20.115 28.954  0.50 39.48 ? 7   C   B "C4'" 1 
ATOM   731  O "O4'" . C   B 2 7  ? 7.001  -18.904 28.564  0.50 39.14 ? 7   C   B "O4'" 1 
ATOM   732  C "C3'" . C   B 2 7  ? 6.575  -21.076 27.813  0.50 40.34 ? 7   C   B "C3'" 1 
ATOM   733  O "O3'" . C   B 2 7  ? 5.665  -22.167 27.783  0.50 42.04 ? 7   C   B "O3'" 1 
ATOM   734  C "C2'" . C   B 2 7  ? 6.430  -20.125 26.624  0.50 39.49 ? 7   C   B "C2'" 1 
ATOM   735  O "O2'" . C   B 2 7  ? 5.085  -19.795 26.346  0.50 39.91 ? 7   C   B "O2'" 1 
ATOM   736  C "C1'" . C   B 2 7  ? 7.180  -18.911 27.154  0.50 37.93 ? 7   C   B "C1'" 1 
ATOM   737  N N1    . C   B 2 7  ? 8.659  -18.874 26.808  0.50 37.90 ? 7   C   B N1    1 
ATOM   738  C C2    . C   B 2 7  ? 9.058  -18.523 25.508  0.50 36.65 ? 7   C   B C2    1 
ATOM   739  O O2    . C   B 2 7  ? 8.201  -18.296 24.656  0.50 37.25 ? 7   C   B O2    1 
ATOM   740  N N3    . C   B 2 7  ? 10.374 -18.481 25.197  0.50 36.93 ? 7   C   B N3    1 
ATOM   741  C C4    . C   B 2 7  ? 11.292 -18.764 26.123  0.50 38.48 ? 7   C   B C4    1 
ATOM   742  N N4    . C   B 2 7  ? 12.586 -18.696 25.756  1.00 40.35 ? 7   C   B N4    1 
ATOM   743  C C5    . C   B 2 7  ? 10.922 -19.118 27.455  0.50 37.35 ? 7   C   B C5    1 
ATOM   744  C C6    . C   B 2 7  ? 9.615  -19.160 27.748  0.50 36.85 ? 7   C   B C6    1 
ATOM   745  P P     . G   B 2 8  ? 6.259  -23.599 27.412  0.50 45.23 ? 8   G   B P     1 
ATOM   746  O OP1   . G   B 2 8  ? 5.250  -24.628 27.736  0.50 46.33 ? 8   G   B OP1   1 
ATOM   747  O OP2   . G   B 2 8  ? 7.637  -23.743 27.953  0.50 45.36 ? 8   G   B OP2   1 
ATOM   748  O "O5'" . G   B 2 8  ? 6.312  -23.388 25.830  0.50 46.62 ? 8   G   B "O5'" 1 
ATOM   749  C "C5'" . G   B 2 8  ? 5.101  -22.994 25.182  0.50 48.21 ? 8   G   B "C5'" 1 
ATOM   750  C "C4'" . G   B 2 8  ? 5.348  -22.639 23.733  0.50 49.80 ? 8   G   B "C4'" 1 
ATOM   751  O "O4'" . G   B 2 8  ? 6.227  -21.484 23.629  0.50 50.50 ? 8   G   B "O4'" 1 
ATOM   752  C "C3'" . G   B 2 8  ? 6.059  -23.723 22.953  0.50 49.95 ? 8   G   B "C3'" 1 
ATOM   753  O "O3'" . G   B 2 8  ? 5.120  -24.723 22.567  0.50 50.47 ? 8   G   B "O3'" 1 
ATOM   754  C "C2'" . G   B 2 8  ? 6.619  -22.916 21.785  0.50 51.00 ? 8   G   B "C2'" 1 
ATOM   755  O "O2'" . G   B 2 8  ? 5.641  -22.640 20.801  0.50 51.14 ? 8   G   B "O2'" 1 
ATOM   756  C "C1'" . G   B 2 8  ? 7.041  -21.619 22.471  0.50 51.09 ? 8   G   B "C1'" 1 
ATOM   757  N N9    . G   B 2 8  ? 8.437  -21.538 22.911  1.00 51.81 ? 8   G   B N9    1 
ATOM   758  C C8    . G   B 2 8  ? 8.863  -21.738 24.206  1.00 52.16 ? 8   G   B C8    1 
ATOM   759  N N7    . G   B 2 8  ? 10.140 -21.584 24.376  1.00 52.01 ? 8   G   B N7    1 
ATOM   760  C C5    . G   B 2 8  ? 10.598 -21.256 23.113  0.50 51.06 ? 8   G   B C5    1 
ATOM   761  C C6    . G   B 2 8  ? 11.914 -20.976 22.711  0.50 51.08 ? 8   G   B C6    1 
ATOM   762  O O6    . G   B 2 8  ? 12.918 -20.978 23.428  1.00 52.15 ? 8   G   B O6    1 
ATOM   763  N N1    . G   B 2 8  ? 12.008 -20.671 21.358  0.50 50.78 ? 8   G   B N1    1 
ATOM   764  C C2    . G   B 2 8  ? 10.941 -20.638 20.502  0.50 51.17 ? 8   G   B C2    1 
ATOM   765  N N2    . G   B 2 8  ? 11.248 -20.332 19.233  1.00 51.38 ? 8   G   B N2    1 
ATOM   766  N N3    . G   B 2 8  ? 9.682  -20.895 20.867  0.50 51.47 ? 8   G   B N3    1 
ATOM   767  C C4    . G   B 2 8  ? 9.577  -21.202 22.193  0.50 51.40 ? 8   G   B C4    1 
ATOM   768  P P     . C   B 2 9  ? 5.586  -26.253 22.496  0.50 49.75 ? 9   C   B P     1 
ATOM   769  O OP1   . C   B 2 9  ? 4.391  -27.106 22.288  0.50 49.96 ? 9   C   B OP1   1 
ATOM   770  O OP2   . C   B 2 9  ? 6.494  -26.518 23.640  0.50 49.49 ? 9   C   B OP2   1 
ATOM   771  O "O5'" . C   B 2 9  ? 6.426  -26.260 21.138  0.50 48.26 ? 9   C   B "O5'" 1 
ATOM   772  C "C5'" . C   B 2 9  ? 7.814  -25.957 21.137  0.50 46.24 ? 9   C   B "C5'" 1 
ATOM   773  C "C4'" . C   B 2 9  ? 8.260  -25.666 19.716  0.50 44.74 ? 9   C   B "C4'" 1 
ATOM   774  O "O4'" . C   B 2 9  ? 8.840  -24.336 19.674  0.50 44.07 ? 9   C   B "O4'" 1 
ATOM   775  C "C3'" . C   B 2 9  ? 9.334  -26.592 19.159  0.50 44.60 ? 9   C   B "C3'" 1 
ATOM   776  O "O3'" . C   B 2 9  ? 8.727  -27.679 18.474  0.50 44.56 ? 9   C   B "O3'" 1 
ATOM   777  C "C2'" . C   B 2 9  ? 10.041 -25.645 18.193  0.50 44.21 ? 9   C   B "C2'" 1 
ATOM   778  O "O2'" . C   B 2 9  ? 9.266  -25.424 17.024  0.50 45.43 ? 9   C   B "O2'" 1 
ATOM   779  C "C1'" . C   B 2 9  ? 10.087 -24.360 19.004  0.50 41.64 ? 9   C   B "C1'" 1 
ATOM   780  N N1    . C   B 2 9  ? 11.233 -24.181 19.999  0.50 40.75 ? 9   C   B N1    1 
ATOM   781  C C2    . C   B 2 9  ? 12.503 -23.718 19.577  0.50 39.70 ? 9   C   B C2    1 
ATOM   782  O O2    . C   B 2 9  ? 12.717 -23.470 18.382  0.50 40.16 ? 9   C   B O2    1 
ATOM   783  N N3    . C   B 2 9  ? 13.492 -23.563 20.496  0.50 38.72 ? 9   C   B N3    1 
ATOM   784  C C4    . C   B 2 9  ? 13.263 -23.847 21.784  0.50 39.35 ? 9   C   B C4    1 
ATOM   785  N N4    . C   B 2 9  ? 14.265 -23.687 22.660  0.50 40.37 ? 9   C   B N4    1 
ATOM   786  C C5    . C   B 2 9  ? 11.993 -24.307 22.240  0.50 38.69 ? 9   C   B C5    1 
ATOM   787  C C6    . C   B 2 9  ? 11.027 -24.447 21.331  0.50 38.70 ? 9   C   B C6    1 
ATOM   788  P P     . G   B 2 10 ? 9.378  -29.141 18.414  0.50 44.72 ? 10  G   B P     1 
ATOM   789  O OP1   . G   B 2 10 ? 8.469  -29.969 17.601  0.50 43.62 ? 10  G   B OP1   1 
ATOM   790  O OP2   . G   B 2 10 ? 9.703  -29.564 19.792  0.50 43.67 ? 10  G   B OP2   1 
ATOM   791  O "O5'" . G   B 2 10 ? 10.749 -28.940 17.600  0.50 44.81 ? 10  G   B "O5'" 1 
ATOM   792  C "C5'" . G   B 2 10 ? 10.762 -28.679 16.191  0.50 45.14 ? 10  G   B "C5'" 1 
ATOM   793  C "C4'" . G   B 2 10 ? 12.127 -28.197 15.712  0.50 45.05 ? 10  G   B "C4'" 1 
ATOM   794  O "O4'" . G   B 2 10 ? 12.544 -27.013 16.442  0.50 44.96 ? 10  G   B "O4'" 1 
ATOM   795  C "C3'" . G   B 2 10 ? 13.257 -29.198 15.891  0.50 44.85 ? 10  G   B "C3'" 1 
ATOM   796  O "O3'" . G   B 2 10 ? 13.376 -29.957 14.701  0.50 44.78 ? 10  G   B "O3'" 1 
ATOM   797  C "C2'" . G   B 2 10 ? 14.485 -28.322 16.136  0.50 45.37 ? 10  G   B "C2'" 1 
ATOM   798  O "O2'" . G   B 2 10 ? 15.100 -27.928 14.917  0.50 45.22 ? 10  G   B "O2'" 1 
ATOM   799  C "C1'" . G   B 2 10 ? 13.895 -27.114 16.870  0.50 44.29 ? 10  G   B "C1'" 1 
ATOM   800  N N9    . G   B 2 10 ? 13.871 -27.115 18.346  0.50 44.21 ? 10  G   B N9    1 
ATOM   801  C C8    . G   B 2 10 ? 12.777 -27.424 19.135  0.50 44.59 ? 10  G   B C8    1 
ATOM   802  N N7    . G   B 2 10 ? 12.974 -27.339 20.422  0.50 44.02 ? 10  G   B N7    1 
ATOM   803  C C5    . G   B 2 10 ? 14.295 -26.926 20.512  0.50 44.12 ? 10  G   B C5    1 
ATOM   804  C C6    . G   B 2 10 ? 15.069 -26.665 21.673  0.50 44.01 ? 10  G   B C6    1 
ATOM   805  O O6    . G   B 2 10 ? 14.712 -26.745 22.859  0.50 43.84 ? 10  G   B O6    1 
ATOM   806  N N1    . G   B 2 10 ? 16.375 -26.274 21.354  0.50 44.04 ? 10  G   B N1    1 
ATOM   807  C C2    . G   B 2 10 ? 16.859 -26.154 20.066  0.50 44.09 ? 10  G   B C2    1 
ATOM   808  N N2    . G   B 2 10 ? 18.137 -25.766 19.955  0.50 44.15 ? 10  G   B N2    1 
ATOM   809  N N3    . G   B 2 10 ? 16.141 -26.390 18.966  0.50 44.35 ? 10  G   B N3    1 
ATOM   810  C C4    . G   B 2 10 ? 14.865 -26.778 19.252  0.50 44.34 ? 10  G   B C4    1 
ATOM   811  P P     . C   C 2 1  ? 25.266 -24.975 27.107  0.50 58.74 ? 1   C   C P     1 
ATOM   812  O OP1   . C   C 2 1  ? 26.644 -24.905 27.648  0.50 58.55 ? 1   C   C OP1   1 
ATOM   813  O OP2   . C   C 2 1  ? 24.873 -26.136 26.273  0.50 59.12 ? 1   C   C OP2   1 
ATOM   814  O "O5'" . C   C 2 1  ? 24.945 -23.637 26.287  0.50 57.76 ? 1   C   C "O5'" 1 
ATOM   815  C "C5'" . C   C 2 1  ? 23.598 -23.308 25.957  0.50 56.65 ? 1   C   C "C5'" 1 
ATOM   816  C "C4'" . C   C 2 1  ? 23.338 -23.592 24.490  0.50 55.58 ? 1   C   C "C4'" 1 
ATOM   817  O "O4'" . C   C 2 1  ? 22.469 -24.741 24.347  0.50 54.92 ? 1   C   C "O4'" 1 
ATOM   818  C "C3'" . C   C 2 1  ? 22.595 -22.498 23.746  0.50 55.40 ? 1   C   C "C3'" 1 
ATOM   819  O "O3'" . C   C 2 1  ? 23.491 -21.443 23.388  0.50 55.87 ? 1   C   C "O3'" 1 
ATOM   820  C "C2'" . C   C 2 1  ? 22.051 -23.263 22.537  0.50 54.90 ? 1   C   C "C2'" 1 
ATOM   821  O "O2'" . C   C 2 1  ? 22.982 -23.376 21.476  0.50 54.56 ? 1   C   C "O2'" 1 
ATOM   822  C "C1'" . C   C 2 1  ? 21.770 -24.651 23.116  0.50 54.24 ? 1   C   C "C1'" 1 
ATOM   823  N N1    . C   C 2 1  ? 20.303 -24.991 23.306  0.50 53.66 ? 1   C   C N1    1 
ATOM   824  C C2    . C   C 2 1  ? 19.489 -25.303 22.195  0.50 53.25 ? 1   C   C C2    1 
ATOM   825  O O2    . C   C 2 1  ? 19.964 -25.291 21.052  0.50 52.98 ? 1   C   C O2    1 
ATOM   826  N N3    . C   C 2 1  ? 18.178 -25.613 22.401  0.50 53.07 ? 1   C   C N3    1 
ATOM   827  C C4    . C   C 2 1  ? 17.672 -25.626 23.640  0.50 53.55 ? 1   C   C C4    1 
ATOM   828  N N4    . C   C 2 1  ? 16.377 -25.934 23.788  0.50 53.49 ? 1   C   C N4    1 
ATOM   829  C C5    . C   C 2 1  ? 18.478 -25.322 24.784  0.50 53.56 ? 1   C   C C5    1 
ATOM   830  C C6    . C   C 2 1  ? 19.767 -25.015 24.570  0.50 53.79 ? 1   C   C C6    1 
ATOM   831  P P     . G   C 2 2  ? 22.931 -20.088 22.728  0.50 56.52 ? 2   G   C P     1 
ATOM   832  O OP1   . G   C 2 2  ? 23.652 -18.959 23.356  0.50 56.53 ? 2   G   C OP1   1 
ATOM   833  O OP2   . G   C 2 2  ? 21.448 -20.124 22.766  0.50 55.75 ? 2   G   C OP2   1 
ATOM   834  O "O5'" . G   C 2 2  ? 23.443 -20.224 21.217  0.50 56.77 ? 2   G   C "O5'" 1 
ATOM   835  C "C5'" . G   C 2 2  ? 22.828 -19.496 20.161  0.50 57.33 ? 2   G   C "C5'" 1 
ATOM   836  C "C4'" . G   C 2 2  ? 21.910 -20.381 19.335  0.50 57.20 ? 2   G   C "C4'" 1 
ATOM   837  O "O4'" . G   C 2 2  ? 21.057 -21.181 20.182  0.50 56.77 ? 2   G   C "O4'" 1 
ATOM   838  C "C3'" . G   C 2 2  ? 20.916 -19.596 18.498  0.50 57.63 ? 2   G   C "C3'" 1 
ATOM   839  O "O3'" . G   C 2 2  ? 21.534 -19.215 17.275  0.50 58.97 ? 2   G   C "O3'" 1 
ATOM   840  C "C2'" . G   C 2 2  ? 19.717 -20.543 18.333  0.50 56.46 ? 2   G   C "C2'" 1 
ATOM   841  O "O2'" . G   C 2 2  ? 19.656 -21.182 17.071  0.50 55.72 ? 2   G   C "O2'" 1 
ATOM   842  C "C1'" . G   C 2 2  ? 19.943 -21.598 19.415  0.50 55.43 ? 2   G   C "C1'" 1 
ATOM   843  N N9    . G   C 2 2  ? 18.808 -21.883 20.302  0.50 55.05 ? 2   G   C N9    1 
ATOM   844  C C8    . G   C 2 2  ? 18.821 -21.847 21.680  0.50 54.87 ? 2   G   C C8    1 
ATOM   845  N N7    . G   C 2 2  ? 17.681 -22.157 22.231  0.50 54.50 ? 2   G   C N7    1 
ATOM   846  C C5    . G   C 2 2  ? 16.853 -22.431 21.152  0.50 54.63 ? 2   G   C C5    1 
ATOM   847  C C6    . G   C 2 2  ? 15.492 -22.830 21.133  0.50 54.76 ? 2   G   C C6    1 
ATOM   848  O O6    . G   C 2 2  ? 14.746 -23.017 22.104  0.50 55.01 ? 2   G   C O6    1 
ATOM   849  N N1    . G   C 2 2  ? 15.003 -23.000 19.838  0.50 54.41 ? 2   G   C N1    1 
ATOM   850  C C2    . G   C 2 2  ? 15.750 -22.813 18.695  0.50 54.65 ? 2   G   C C2    1 
ATOM   851  N N2    . G   C 2 2  ? 15.114 -23.027 17.531  0.50 54.77 ? 2   G   C N2    1 
ATOM   852  N N3    . G   C 2 2  ? 17.032 -22.446 18.697  0.50 54.42 ? 2   G   C N3    1 
ATOM   853  C C4    . G   C 2 2  ? 17.525 -22.271 19.955  0.50 54.76 ? 2   G   C C4    1 
ATOM   854  P P     . C   C 2 3  ? 21.240 -17.735 16.750  0.50 60.59 ? 3   C   C P     1 
ATOM   855  O OP1   . C   C 2 3  ? 21.536 -17.688 15.295  0.50 59.83 ? 3   C   C OP1   1 
ATOM   856  O OP2   . C   C 2 3  ? 21.865 -16.766 17.688  0.50 60.59 ? 3   C   C OP2   1 
ATOM   857  O "O5'" . C   C 2 3  ? 19.659 -17.676 16.974  0.50 59.05 ? 3   C   C "O5'" 1 
ATOM   858  C "C5'" . C   C 2 3  ? 18.917 -16.652 16.375  0.50 58.03 ? 3   C   C "C5'" 1 
ATOM   859  C "C4'" . C   C 2 3  ? 17.650 -17.212 15.757  0.50 56.77 ? 3   C   C "C4'" 1 
ATOM   860  O "O4'" . C   C 2 3  ? 17.388 -18.580 16.184  0.50 56.67 ? 3   C   C "O4'" 1 
ATOM   861  C "C3'" . C   C 2 3  ? 16.406 -16.470 16.198  0.50 55.74 ? 3   C   C "C3'" 1 
ATOM   862  O "O3'" . C   C 2 3  ? 16.339 -15.217 15.536  0.50 53.90 ? 3   C   C "O3'" 1 
ATOM   863  C "C2'" . C   C 2 3  ? 15.340 -17.483 15.789  0.50 55.83 ? 3   C   C "C2'" 1 
ATOM   864  O "O2'" . C   C 2 3  ? 15.140 -17.551 14.387  0.50 56.27 ? 3   C   C "O2'" 1 
ATOM   865  C "C1'" . C   C 2 3  ? 15.983 -18.773 16.302  0.50 55.68 ? 3   C   C "C1'" 1 
ATOM   866  N N1    . C   C 2 3  ? 15.632 -19.106 17.733  0.50 54.82 ? 3   C   C N1    1 
ATOM   867  C C2    . C   C 2 3  ? 14.366 -19.636 18.072  0.50 54.55 ? 3   C   C C2    1 
ATOM   868  O O2    . C   C 2 3  ? 13.508 -19.846 17.194  1.00 54.54 ? 3   C   C O2    1 
ATOM   869  N N3    . C   C 2 3  ? 14.106 -19.907 19.382  0.50 54.16 ? 3   C   C N3    1 
ATOM   870  C C4    . C   C 2 3  ? 15.039 -19.675 20.317  0.50 54.99 ? 3   C   C C4    1 
ATOM   871  N N4    . C   C 2 3  ? 14.750 -19.957 21.591  1.00 55.46 ? 3   C   C N4    1 
ATOM   872  C C5    . C   C 2 3  ? 16.320 -19.137 19.997  0.50 54.40 ? 3   C   C C5    1 
ATOM   873  C C6    . C   C 2 3  ? 16.566 -18.879 18.710  0.50 54.24 ? 3   C   C C6    1 
ATOM   874  P P     . G   C 2 4  ? 16.151 -13.898 16.415  0.50 53.25 ? 4   G   C P     1 
ATOM   875  O OP1   . G   C 2 4  ? 16.551 -12.744 15.583  0.50 53.41 ? 4   G   C OP1   1 
ATOM   876  O OP2   . G   C 2 4  ? 16.762 -14.067 17.759  0.50 53.25 ? 4   G   C OP2   1 
ATOM   877  O "O5'" . G   C 2 4  ? 14.569 -13.922 16.593  0.50 49.90 ? 4   G   C "O5'" 1 
ATOM   878  C "C5'" . G   C 2 4  ? 13.798 -14.494 15.545  0.50 45.09 ? 4   G   C "C5'" 1 
ATOM   879  C "C4'" . G   C 2 4  ? 12.464 -15.014 16.045  0.50 41.50 ? 4   G   C "C4'" 1 
ATOM   880  O "O4'" . G   C 2 4  ? 12.637 -16.324 16.650  0.50 40.96 ? 4   G   C "O4'" 1 
ATOM   881  C "C3'" . G   C 2 4  ? 11.791 -14.215 17.141  0.50 38.01 ? 4   G   C "C3'" 1 
ATOM   882  O "O3'" . G   C 2 4  ? 11.164 -13.064 16.622  0.50 34.66 ? 4   G   C "O3'" 1 
ATOM   883  C "C2'" . G   C 2 4  ? 10.793 -15.250 17.647  0.50 38.54 ? 4   G   C "C2'" 1 
ATOM   884  O "O2'" . G   C 2 4  ? 9.731  -15.506 16.749  0.50 37.87 ? 4   G   C "O2'" 1 
ATOM   885  C "C1'" . G   C 2 4  ? 11.690 -16.473 17.693  0.50 40.25 ? 4   G   C "C1'" 1 
ATOM   886  N N9    . G   C 2 4  ? 12.371 -16.689 18.970  0.50 40.45 ? 4   G   C N9    1 
ATOM   887  C C8    . G   C 2 4  ? 13.716 -16.564 19.233  0.50 40.65 ? 4   G   C C8    1 
ATOM   888  N N7    . G   C 2 4  ? 14.035 -16.825 20.469  0.50 40.59 ? 4   G   C N7    1 
ATOM   889  C C5    . G   C 2 4  ? 12.826 -17.139 21.073  0.50 40.61 ? 4   G   C C5    1 
ATOM   890  C C6    . G   C 2 4  ? 12.545 -17.512 22.404  0.50 40.85 ? 4   G   C C6    1 
ATOM   891  O O6    . G   C 2 4  ? 13.340 -17.650 23.348  1.00 44.09 ? 4   G   C O6    1 
ATOM   892  N N1    . G   C 2 4  ? 11.193 -17.740 22.611  0.50 38.83 ? 4   G   C N1    1 
ATOM   893  C C2    . G   C 2 4  ? 10.243 -17.624 21.635  0.50 39.31 ? 4   G   C C2    1 
ATOM   894  N N2    . G   C 2 4  ? 8.998  -17.879 22.013  1.00 40.67 ? 4   G   C N2    1 
ATOM   895  N N3    . G   C 2 4  ? 10.478 -17.285 20.382  0.50 39.12 ? 4   G   C N3    1 
ATOM   896  C C4    . G   C 2 4  ? 11.791 -17.060 20.165  0.50 39.97 ? 4   G   C C4    1 
ATOM   897  P P     . C   C 2 5  ? 10.922 -11.773 17.535  0.50 32.00 ? 5   C   C P     1 
ATOM   898  O OP1   . C   C 2 5  ? 10.397 -10.730 16.624  0.50 35.05 ? 5   C   C OP1   1 
ATOM   899  O OP2   . C   C 2 5  ? 12.133 -11.572 18.325  0.50 29.95 ? 5   C   C OP2   1 
ATOM   900  O "O5'" . C   C 2 5  ? 9.731  -12.141 18.517  0.50 32.36 ? 5   C   C "O5'" 1 
ATOM   901  C "C5'" . C   C 2 5  ? 8.534  -12.720 18.071  0.50 34.25 ? 5   C   C "C5'" 1 
ATOM   902  C "C4'" . C   C 2 5  ? 7.644  -13.105 19.246  0.50 33.28 ? 5   C   C "C4'" 1 
ATOM   903  O "O4'" . C   C 2 5  ? 8.098  -14.366 19.808  0.50 36.68 ? 5   C   C "O4'" 1 
ATOM   904  C "C3'" . C   C 2 5  ? 7.645  -12.167 20.447  0.50 32.71 ? 5   C   C "C3'" 1 
ATOM   905  O "O3'" . C   C 2 5  ? 6.852  -11.022 20.208  0.50 32.26 ? 5   C   C "O3'" 1 
ATOM   906  C "C2'" . C   C 2 5  ? 7.055  -13.099 21.501  0.50 33.57 ? 5   C   C "C2'" 1 
ATOM   907  O "O2'" . C   C 2 5  ? 5.703  -13.509 21.296  0.50 30.37 ? 5   C   C "O2'" 1 
ATOM   908  C "C1'" . C   C 2 5  ? 7.957  -14.297 21.230  0.50 36.18 ? 5   C   C "C1'" 1 
ATOM   909  N N1    . C   C 2 5  ? 9.299  -14.295 21.943  0.50 36.46 ? 5   C   C N1    1 
ATOM   910  C C2    . C   C 2 5  ? 9.340  -14.680 23.296  0.50 37.47 ? 5   C   C C2    1 
ATOM   911  O O2    . C   C 2 5  ? 8.301  -14.976 23.881  1.00 41.16 ? 5   C   C O2    1 
ATOM   912  N N3    . C   C 2 5  ? 10.514 -14.709 23.955  0.50 35.25 ? 5   C   C N3    1 
ATOM   913  C C4    . C   C 2 5  ? 11.638 -14.358 23.339  0.50 37.32 ? 5   C   C C4    1 
ATOM   914  N N4    . C   C 2 5  ? 12.764 -14.411 24.069  1.00 40.79 ? 5   C   C N4    1 
ATOM   915  C C5    . C   C 2 5  ? 11.652 -13.960 21.968  0.50 36.70 ? 5   C   C C5    1 
ATOM   916  C C6    . C   C 2 5  ? 10.472 -13.947 21.320  0.50 36.74 ? 5   C   C C6    1 
ATOM   917  P P     . G   C 2 6  ? 6.996  -9.637  20.962  0.50 30.80 ? 6   G   C P     1 
ATOM   918  O OP1   . G   C 2 6  ? 5.933  -8.782  20.390  0.50 31.75 ? 6   G   C OP1   1 
ATOM   919  O OP2   . G   C 2 6  ? 8.381  -9.192  20.972  0.50 31.51 ? 6   G   C OP2   1 
ATOM   920  O "O5'" . G   C 2 6  ? 6.598  -9.965  22.493  0.50 35.98 ? 6   G   C "O5'" 1 
ATOM   921  C "C5'" . G   C 2 6  ? 5.266  -10.433 22.823  0.50 37.24 ? 6   G   C "C5'" 1 
ATOM   922  C "C4'" . G   C 2 6  ? 5.108  -10.687 24.314  0.50 37.62 ? 6   G   C "C4'" 1 
ATOM   923  O "O4'" . G   C 2 6  ? 5.834  -11.893 24.703  0.50 39.35 ? 6   G   C "O4'" 1 
ATOM   924  C "C3'" . G   C 2 6  ? 5.709  -9.606  25.215  0.50 37.92 ? 6   G   C "C3'" 1 
ATOM   925  O "O3'" . G   C 2 6  ? 4.848  -8.486  25.352  0.50 37.58 ? 6   G   C "O3'" 1 
ATOM   926  C "C2'" . G   C 2 6  ? 5.893  -10.351 26.523  0.50 38.13 ? 6   G   C "C2'" 1 
ATOM   927  O "O2'" . G   C 2 6  ? 4.677  -10.565 27.220  0.50 40.72 ? 6   G   C "O2'" 1 
ATOM   928  C "C1'" . G   C 2 6  ? 6.430  -11.665 25.973  0.50 39.87 ? 6   G   C "C1'" 1 
ATOM   929  N N9    . G   C 2 6  ? 7.898  -11.716 25.899  1.00 41.74 ? 6   G   C N9    1 
ATOM   930  C C8    . G   C 2 6  ? 8.716  -11.552 24.807  1.00 41.16 ? 6   G   C C8    1 
ATOM   931  N N7    . G   C 2 6  ? 9.980  -11.712 25.096  1.00 41.43 ? 6   G   C N7    1 
ATOM   932  C C5    . G   C 2 6  ? 10.005 -11.967 26.451  0.50 39.83 ? 6   G   C C5    1 
ATOM   933  C C6    . G   C 2 6  ? 11.101 -12.205 27.285  0.50 39.15 ? 6   G   C C6    1 
ATOM   934  O O6    . G   C 2 6  ? 12.274 -12.199 26.934  1.00 43.11 ? 6   G   C O6    1 
ATOM   935  N N1    . G   C 2 6  ? 10.761 -12.437 28.610  0.50 38.01 ? 6   G   C N1    1 
ATOM   936  C C2    . G   C 2 6  ? 9.457  -12.435 29.051  0.50 39.60 ? 6   G   C C2    1 
ATOM   937  N N2    . G   C 2 6  ? 9.287  -12.681 30.364  1.00 41.76 ? 6   G   C N2    1 
ATOM   938  N N3    . G   C 2 6  ? 8.400  -12.217 28.266  0.50 37.24 ? 6   G   C N3    1 
ATOM   939  C C4    . G   C 2 6  ? 8.743  -11.981 26.976  0.50 39.44 ? 6   G   C C4    1 
ATOM   940  P P     . C   C 2 7  ? 5.460  -7.047  25.614  0.50 41.16 ? 7   C   C P     1 
ATOM   941  O OP1   . C   C 2 7  ? 4.283  -6.145  25.638  0.50 42.37 ? 7   C   C OP1   1 
ATOM   942  O OP2   . C   C 2 7  ? 6.631  -6.892  24.733  0.50 39.27 ? 7   C   C OP2   1 
ATOM   943  O "O5'" . C   C 2 7  ? 6.043  -7.055  27.107  0.50 39.98 ? 7   C   C "O5'" 1 
ATOM   944  C "C5'" . C   C 2 7  ? 5.195  -7.249  28.215  0.50 37.97 ? 7   C   C "C5'" 1 
ATOM   945  C "C4'" . C   C 2 7  ? 6.030  -7.491  29.463  0.50 37.40 ? 7   C   C "C4'" 1 
ATOM   946  O "O4'" . C   C 2 7  ? 6.759  -8.745  29.350  0.50 36.02 ? 7   C   C "O4'" 1 
ATOM   947  C "C3'" . C   C 2 7  ? 7.151  -6.503  29.698  0.50 35.52 ? 7   C   C "C3'" 1 
ATOM   948  O "O3'" . C   C 2 7  ? 6.673  -5.272  30.137  0.50 39.84 ? 7   C   C "O3'" 1 
ATOM   949  C "C2'" . C   C 2 7  ? 7.974  -7.262  30.740  0.50 35.05 ? 7   C   C "C2'" 1 
ATOM   950  O "O2'" . C   C 2 7  ? 7.426  -7.350  32.052  0.50 33.24 ? 7   C   C "O2'" 1 
ATOM   951  C "C1'" . C   C 2 7  ? 7.998  -8.620  30.051  0.50 36.88 ? 7   C   C "C1'" 1 
ATOM   952  N N1    . C   C 2 7  ? 9.186  -8.756  29.151  0.50 35.62 ? 7   C   C N1    1 
ATOM   953  C C2    . C   C 2 7  ? 10.435 -9.111  29.700  0.50 37.80 ? 7   C   C C2    1 
ATOM   954  O O2    . C   C 2 7  ? 10.551 -9.321  30.942  1.00 41.85 ? 7   C   C O2    1 
ATOM   955  N N3    . C   C 2 7  ? 11.499 -9.219  28.851  0.50 34.70 ? 7   C   C N3    1 
ATOM   956  C C4    . C   C 2 7  ? 11.359 -8.962  27.546  0.50 37.85 ? 7   C   C C4    1 
ATOM   957  N N4    . C   C 2 7  ? 12.443 -9.072  26.766  1.00 41.32 ? 7   C   C N4    1 
ATOM   958  C C5    . C   C 2 7  ? 10.110 -8.584  26.967  0.50 38.07 ? 7   C   C C5    1 
ATOM   959  C C6    . C   C 2 7  ? 9.063  -8.500  27.800  0.50 37.18 ? 7   C   C C6    1 
ATOM   960  P P     . G   C 2 8  ? 7.489  -3.916  29.885  0.50 42.97 ? 8   G   C P     1 
ATOM   961  O OP1   . G   C 2 8  ? 6.618  -2.818  30.359  0.50 43.85 ? 8   G   C OP1   1 
ATOM   962  O OP2   . G   C 2 8  ? 8.005  -3.895  28.497  0.50 43.28 ? 8   G   C OP2   1 
ATOM   963  O "O5'" . G   C 2 8  ? 8.755  -4.078  30.844  0.50 42.58 ? 8   G   C "O5'" 1 
ATOM   964  C "C5'" . G   C 2 8  ? 8.631  -4.264  32.239  0.50 43.65 ? 8   G   C "C5'" 1 
ATOM   965  C "C4'" . G   C 2 8  ? 10.001 -4.641  32.778  0.50 45.34 ? 8   G   C "C4'" 1 
ATOM   966  O "O4'" . G   C 2 8  ? 10.461 -5.853  32.109  0.50 46.59 ? 8   G   C "O4'" 1 
ATOM   967  C "C3'" . G   C 2 8  ? 11.108 -3.683  32.406  0.50 45.38 ? 8   G   C "C3'" 1 
ATOM   968  O "O3'" . G   C 2 8  ? 11.039 -2.428  33.119  0.50 45.45 ? 8   G   C "O3'" 1 
ATOM   969  C "C2'" . G   C 2 8  ? 12.328 -4.557  32.698  0.50 45.62 ? 8   G   C "C2'" 1 
ATOM   970  O "O2'" . G   C 2 8  ? 12.578 -4.893  34.052  0.50 47.81 ? 8   G   C "O2'" 1 
ATOM   971  C "C1'" . G   C 2 8  ? 11.873 -5.817  31.998  0.50 46.29 ? 8   G   C "C1'" 1 
ATOM   972  N N9    . G   C 2 8  ? 12.343 -5.941  30.603  1.00 47.82 ? 8   G   C N9    1 
ATOM   973  C C8    . G   C 2 8  ? 11.662 -5.733  29.421  1.00 47.21 ? 8   G   C C8    1 
ATOM   974  N N7    . G   C 2 8  ? 12.420 -5.941  28.375  1.00 48.79 ? 8   G   C N7    1 
ATOM   975  C C5    . G   C 2 8  ? 13.658 -6.298  28.901  0.50 46.37 ? 8   G   C C5    1 
ATOM   976  C C6    . G   C 2 8  ? 14.879 -6.629  28.274  0.50 46.07 ? 8   G   C C6    1 
ATOM   977  O O6    . G   C 2 8  ? 15.093 -6.694  27.068  1.00 48.16 ? 8   G   C O6    1 
ATOM   978  N N1    . G   C 2 8  ? 15.903 -6.910  29.173  0.50 44.57 ? 8   G   C N1    1 
ATOM   979  C C2    . G   C 2 8  ? 15.744 -6.873  30.531  0.50 45.45 ? 8   G   C C2    1 
ATOM   980  N N2    . G   C 2 8  ? 16.803 -7.159  31.284  1.00 46.92 ? 8   G   C N2    1 
ATOM   981  N N3    . G   C 2 8  ? 14.618 -6.563  31.136  0.50 44.90 ? 8   G   C N3    1 
ATOM   982  C C4    . G   C 2 8  ? 13.623 -6.297  30.264  0.50 45.33 ? 8   G   C C4    1 
ATOM   983  P P     . C   C 2 9  ? 11.569 -1.093  32.411  0.50 40.91 ? 9   C   C P     1 
ATOM   984  O OP1   . C   C 2 9  ? 10.987 0.083   33.084  0.50 42.74 ? 9   C   C OP1   1 
ATOM   985  O OP2   . C   C 2 9  ? 11.430 -1.184  30.960  0.50 40.79 ? 9   C   C OP2   1 
ATOM   986  O "O5'" . C   C 2 9  ? 13.100 -1.233  32.773  0.50 40.52 ? 9   C   C "O5'" 1 
ATOM   987  C "C5'" . C   C 2 9  ? 13.521 -1.456  34.093  0.50 40.88 ? 9   C   C "C5'" 1 
ATOM   988  C "C4'" . C   C 2 9  ? 14.944 -1.965  34.079  0.50 39.39 ? 9   C   C "C4'" 1 
ATOM   989  O "O4'" . C   C 2 9  ? 15.004 -3.176  33.281  0.50 38.66 ? 9   C   C "O4'" 1 
ATOM   990  C "C3'" . C   C 2 9  ? 15.970 -1.063  33.414  0.50 40.49 ? 9   C   C "C3'" 1 
ATOM   991  O "O3'" . C   C 2 9  ? 16.385 -0.053  34.317  0.50 42.41 ? 9   C   C "O3'" 1 
ATOM   992  C "C2'" . C   C 2 9  ? 17.069 -2.085  33.186  0.50 39.53 ? 9   C   C "C2'" 1 
ATOM   993  O "O2'" . C   C 2 9  ? 17.635 -2.504  34.418  0.50 36.46 ? 9   C   C "O2'" 1 
ATOM   994  C "C1'" . C   C 2 9  ? 16.250 -3.239  32.615  0.50 38.22 ? 9   C   C "C1'" 1 
ATOM   995  N N1    . C   C 2 9  ? 16.076 -3.273  31.091  0.50 37.08 ? 9   C   C N1    1 
ATOM   996  C C2    . C   C 2 9  ? 17.134 -3.735  30.281  0.50 36.02 ? 9   C   C C2    1 
ATOM   997  O O2    . C   C 2 9  ? 18.208 -4.090  30.798  0.50 35.80 ? 9   C   C O2    1 
ATOM   998  N N3    . C   C 2 9  ? 16.961 -3.767  28.936  0.50 34.06 ? 9   C   C N3    1 
ATOM   999  C C4    . C   C 2 9  ? 15.814 -3.367  28.411  0.50 36.69 ? 9   C   C C4    1 
ATOM   1000 N N4    . C   C 2 9  ? 15.710 -3.423  27.095  1.00 39.34 ? 9   C   C N4    1 
ATOM   1001 C C5    . C   C 2 9  ? 14.713 -2.900  29.192  0.50 36.92 ? 9   C   C C5    1 
ATOM   1002 C C6    . C   C 2 9  ? 14.897 -2.878  30.520  0.50 37.42 ? 9   C   C C6    1 
ATOM   1003 P P     . G   C 2 10 ? 16.881 1.370   33.807  0.50 43.31 ? 10  G   C P     1 
ATOM   1004 O OP1   . G   C 2 10 ? 16.994 2.205   35.037  0.50 46.16 ? 10  G   C OP1   1 
ATOM   1005 O OP2   . G   C 2 10 ? 16.043 1.833   32.699  0.50 46.45 ? 10  G   C OP2   1 
ATOM   1006 O "O5'" . G   C 2 10 ? 18.380 1.096   33.266  0.50 45.45 ? 10  G   C "O5'" 1 
ATOM   1007 C "C5'" . G   C 2 10 ? 19.380 0.551   34.168  0.50 48.04 ? 10  G   C "C5'" 1 
ATOM   1008 C "C4'" . G   C 2 10 ? 20.648 0.016   33.496  0.50 49.50 ? 10  G   C "C4'" 1 
ATOM   1009 O "O4'" . G   C 2 10 ? 20.314 -0.937  32.462  0.50 49.78 ? 10  G   C "O4'" 1 
ATOM   1010 C "C3'" . G   C 2 10 ? 21.545 1.052   32.832  0.50 50.11 ? 10  G   C "C3'" 1 
ATOM   1011 O "O3'" . G   C 2 10 ? 22.672 1.334   33.663  0.50 51.05 ? 10  G   C "O3'" 1 
ATOM   1012 C "C2'" . G   C 2 10 ? 21.993 0.443   31.505  0.50 50.64 ? 10  G   C "C2'" 1 
ATOM   1013 O "O2'" . G   C 2 10 ? 23.367 0.105   31.476  0.50 51.61 ? 10  G   C "O2'" 1 
ATOM   1014 C "C1'" . G   C 2 10 ? 21.186 -0.832  31.364  0.50 50.08 ? 10  G   C "C1'" 1 
ATOM   1015 N N9    . G   C 2 10 ? 20.360 -0.840  30.169  1.00 51.13 ? 10  G   C N9    1 
ATOM   1016 C C8    . G   C 2 10 ? 19.000 -0.601  30.111  1.00 51.03 ? 10  G   C C8    1 
ATOM   1017 N N7    . G   C 2 10 ? 18.510 -0.680  28.903  1.00 50.75 ? 10  G   C N7    1 
ATOM   1018 C C5    . G   C 2 10 ? 19.599 -0.994  28.115  0.50 49.91 ? 10  G   C C5    1 
ATOM   1019 C C6    . G   C 2 10 ? 19.654 -1.215  26.728  0.50 49.76 ? 10  G   C C6    1 
ATOM   1020 O O6    . G   C 2 10 ? 18.718 -1.166  25.926  1.00 50.76 ? 10  G   C O6    1 
ATOM   1021 N N1    . G   C 2 10 ? 20.942 -1.512  26.295  0.50 49.76 ? 10  G   C N1    1 
ATOM   1022 C C2    . G   C 2 10 ? 22.034 -1.594  27.123  0.50 50.42 ? 10  G   C C2    1 
ATOM   1023 N N2    . G   C 2 10 ? 23.196 -1.887  26.528  1.00 51.21 ? 10  G   C N2    1 
ATOM   1024 N N3    . G   C 2 10 ? 21.998 -1.396  28.436  0.50 50.11 ? 10  G   C N3    1 
ATOM   1025 C C4    . G   C 2 10 ? 20.747 -1.100  28.867  0.50 50.54 ? 10  G   C C4    1 
HETATM 1026 O O     . HOH D 3 .  ? -4.152 14.965  13.309  1.00 43.99 ? 1   HOH A O     1 
HETATM 1027 O O     . HOH D 3 .  ? -0.273 -7.947  5.645   1.00 60.48 ? 2   HOH A O     1 
HETATM 1028 O O     . HOH D 3 .  ? -0.097 15.115  0.961   0.50 50.47 ? 3   HOH A O     1 
HETATM 1029 O O     . HOH D 3 .  ? 0.631  3.163   -0.248  1.00 41.37 ? 4   HOH A O     1 
HETATM 1030 O O     . HOH D 3 .  ? 3.450  -2.884  0.528   1.00 43.14 ? 6   HOH A O     1 
HETATM 1031 O O     . HOH D 3 .  ? 8.674  5.622   11.731  1.00 41.96 ? 7   HOH A O     1 
HETATM 1032 O O     . HOH D 3 .  ? 9.828  -6.786  3.034   1.00 45.67 ? 8   HOH A O     1 
HETATM 1033 O O     . HOH D 3 .  ? 9.966  12.930  15.967  1.00 42.37 ? 9   HOH A O     1 
HETATM 1034 O O     . HOH D 3 .  ? 11.692 -8.081  17.141  1.00 53.75 ? 10  HOH A O     1 
HETATM 1035 O O     . HOH D 3 .  ? 12.448 -2.126  13.488  1.00 52.07 ? 11  HOH A O     1 
HETATM 1036 O O     . HOH D 3 .  ? 12.378 13.441  -2.463  1.00 72.38 ? 12  HOH A O     1 
HETATM 1037 O O     . HOH D 3 .  ? 14.205 11.316  7.264   1.00 60.05 ? 14  HOH A O     1 
HETATM 1038 O O     . HOH D 3 .  ? 15.263 1.439   12.003  1.00 57.68 ? 18  HOH A O     1 
HETATM 1039 O O     . HOH D 3 .  ? -8.222 9.798   13.240  1.00 60.88 ? 19  HOH A O     1 
HETATM 1040 O O     . HOH D 3 .  ? 0.564  -5.037  16.381  1.00 65.94 ? 20  HOH A O     1 
HETATM 1041 O O     . HOH D 3 .  ? 2.815  -19.240 12.730  1.00 57.37 ? 21  HOH A O     1 
HETATM 1042 O O     . HOH D 3 .  ? 2.960  -1.074  -2.592  1.00 47.29 ? 22  HOH A O     1 
HETATM 1043 O O     . HOH D 3 .  ? 9.892  -12.869 2.215   1.00 68.21 ? 25  HOH A O     1 
HETATM 1044 O O     . HOH D 3 .  ? 9.266  8.788   -9.445  1.00 70.58 ? 26  HOH A O     1 
HETATM 1045 O O     . HOH D 3 .  ? 17.487 0.245   9.582   1.00 45.50 ? 27  HOH A O     1 
HETATM 1046 O O     . HOH D 3 .  ? 18.083 -4.836  7.731   1.00 53.45 ? 28  HOH A O     1 
HETATM 1047 O O     . HOH D 3 .  ? -2.875 -12.786 3.387   1.00 66.58 ? 32  HOH A O     1 
HETATM 1048 O O     . HOH D 3 .  ? -1.193 8.047   11.460  1.00 67.43 ? 33  HOH A O     1 
HETATM 1049 O O     . HOH D 3 .  ? 1.071  11.622  16.045  1.00 57.64 ? 34  HOH A O     1 
HETATM 1050 O O     . HOH D 3 .  ? 7.979  12.275  -3.304  1.00 74.46 ? 35  HOH A O     1 
HETATM 1051 O O     . HOH D 3 .  ? 8.494  8.644   -11.815 1.00 81.81 ? 36  HOH A O     1 
HETATM 1052 O O     . HOH D 3 .  ? 22.137 -2.367  9.026   1.00 85.47 ? 43  HOH A O     1 
HETATM 1053 O O     . HOH D 3 .  ? -4.813 3.782   7.216   1.00 62.32 ? 44  HOH A O     1 
HETATM 1054 O O     . HOH D 3 .  ? 12.326 -16.382 12.789  1.00 50.29 ? 45  HOH A O     1 
HETATM 1055 O O     . HOH D 3 .  ? 12.123 -2.418  16.113  1.00 61.24 ? 46  HOH A O     1 
HETATM 1056 O O     . HOH D 3 .  ? 13.302 16.173  6.644   1.00 76.44 ? 47  HOH A O     1 
HETATM 1057 O O     . HOH E 3 .  ? 14.919 -17.214 29.117  1.00 49.32 ? 15  HOH B O     1 
HETATM 1058 O O     . HOH E 3 .  ? 19.906 -35.016 16.829  1.00 77.53 ? 31  HOH B O     1 
HETATM 1059 O O     . HOH E 3 .  ? 10.435 -31.511 21.516  1.00 60.50 ? 37  HOH B O     1 
HETATM 1060 O O     . HOH E 3 .  ? 13.596 -32.413 15.826  1.00 58.20 ? 38  HOH B O     1 
HETATM 1061 O O     . HOH E 3 .  ? 16.468 -31.140 15.976  1.00 71.56 ? 39  HOH B O     1 
HETATM 1062 O O     . HOH E 3 .  ? 16.861 -5.111  23.547  1.00 59.01 ? 41  HOH B O     1 
HETATM 1063 O O     . HOH E 3 .  ? 17.609 -34.819 18.453  1.00 64.33 ? 42  HOH B O     1 
HETATM 1064 O O     . HOH F 3 .  ? 3.875  -12.308 19.413  1.00 59.91 ? 11  HOH C O     1 
HETATM 1065 O O     . HOH F 3 .  ? 13.880 3.008   31.818  1.00 71.25 ? 13  HOH C O     1 
HETATM 1066 O O     . HOH F 3 .  ? 14.067 -11.468 24.896  1.00 47.30 ? 16  HOH C O     1 
HETATM 1067 O O     . HOH F 3 .  ? 14.777 -6.709  33.819  1.00 54.63 ? 17  HOH C O     1 
HETATM 1068 O O     . HOH F 3 .  ? 5.772  -12.827 30.349  1.00 78.90 ? 23  HOH C O     1 
HETATM 1069 O O     . HOH F 3 .  ? 8.909  -7.894  23.510  1.00 51.58 ? 24  HOH C O     1 
HETATM 1070 O O     . HOH F 3 .  ? 3.783  -11.044 29.819  1.00 62.49 ? 29  HOH C O     1 
HETATM 1071 O O     . HOH F 3 .  ? 7.472  -13.701 33.077  1.00 50.35 ? 30  HOH C O     1 
HETATM 1072 O O     . HOH F 3 .  ? 16.252 0.130   24.695  0.50 51.14 ? 40  HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  HIS 1  144 ?   ?   ?   A . n 
A 1 2  HIS 2  145 ?   ?   ?   A . n 
A 1 3  HIS 3  146 ?   ?   ?   A . n 
A 1 4  HIS 4  147 ?   ?   ?   A . n 
A 1 5  HIS 5  148 ?   ?   ?   A . n 
A 1 6  HIS 6  149 ?   ?   ?   A . n 
A 1 7  SER 7  150 ?   ?   ?   A . n 
A 1 8  SER 8  151 ?   ?   ?   A . n 
A 1 9  GLY 9  152 152 GLY GLY A . n 
A 1 10 LEU 10 153 153 LEU LEU A . n 
A 1 11 VAL 11 154 154 VAL VAL A . n 
A 1 12 PRO 12 155 155 PRO PRO A . n 
A 1 13 ARG 13 156 156 ARG ARG A . n 
A 1 14 GLY 14 157 157 GLY GLY A . n 
A 1 15 SER 15 158 158 SER SER A . n 
A 1 16 HIS 16 159 159 HIS HIS A . n 
A 1 17 GLU 17 160 160 GLU GLU A . n 
A 1 18 VAL 18 161 161 VAL VAL A . n 
A 1 19 GLY 19 162 162 GLY GLY A . n 
A 1 20 ALA 20 163 163 ALA ALA A . n 
A 1 21 LEU 21 164 164 LEU LEU A . n 
A 1 22 GLN 22 165 165 GLN GLN A . n 
A 1 23 GLU 23 166 166 GLU GLU A . n 
A 1 24 LEU 24 167 167 LEU LEU A . n 
A 1 25 VAL 25 168 168 VAL VAL A . n 
A 1 26 VAL 26 169 169 VAL VAL A . n 
A 1 27 GLN 27 170 170 GLN GLN A . n 
A 1 28 LYS 28 171 171 LYS LYS A . n 
A 1 29 GLY 29 172 172 GLY GLY A . n 
A 1 30 TRP 30 173 173 TRP TRP A . n 
A 1 31 ARG 31 174 174 ARG ARG A . n 
A 1 32 LEU 32 175 175 LEU LEU A . n 
A 1 33 PRO 33 176 176 PRO PRO A . n 
A 1 34 GLU 34 177 177 GLU GLU A . n 
A 1 35 TYR 35 178 178 TYR TYR A . n 
A 1 36 THR 36 179 179 THR THR A . n 
A 1 37 VAL 37 180 180 VAL VAL A . n 
A 1 38 THR 38 181 181 THR THR A . n 
A 1 39 GLN 39 182 182 GLN GLN A . n 
A 1 40 GLU 40 183 183 GLU GLU A . n 
A 1 41 SER 41 184 184 SER SER A . n 
A 1 42 GLY 42 185 185 GLY GLY A . n 
A 1 43 PRO 43 186 186 PRO PRO A . n 
A 1 44 ALA 44 187 187 ALA ALA A . n 
A 1 45 HIS 45 188 188 HIS HIS A . n 
A 1 46 ARG 46 189 189 ARG ARG A . n 
A 1 47 LYS 47 190 190 LYS LYS A . n 
A 1 48 GLU 48 191 191 GLU GLU A . n 
A 1 49 PHE 49 192 192 PHE PHE A . n 
A 1 50 THR 50 193 193 THR THR A . n 
A 1 51 MET 51 194 194 MET MET A . n 
A 1 52 THR 52 195 195 THR THR A . n 
A 1 53 CYS 53 196 196 CYS CYS A . n 
A 1 54 ARG 54 197 197 ARG ARG A . n 
A 1 55 VAL 55 198 198 VAL VAL A . n 
A 1 56 GLU 56 199 199 GLU GLU A . n 
A 1 57 ARG 57 200 200 ARG ARG A . n 
A 1 58 PHE 58 201 201 PHE PHE A . n 
A 1 59 ILE 59 202 202 ILE ILE A . n 
A 1 60 GLU 60 203 203 GLU GLU A . n 
A 1 61 ILE 61 204 204 ILE ILE A . n 
A 1 62 GLY 62 205 205 GLY GLY A . n 
A 1 63 SER 63 206 206 SER SER A . n 
A 1 64 GLY 64 207 207 GLY GLY A . n 
A 1 65 THR 65 208 208 THR THR A . n 
A 1 66 SER 66 209 209 SER SER A . n 
A 1 67 LYS 67 210 210 LYS LYS A . n 
A 1 68 LYS 68 211 211 LYS LYS A . n 
A 1 69 LEU 69 212 212 LEU LEU A . n 
A 1 70 ALA 70 213 213 ALA ALA A . n 
A 1 71 LYS 71 214 214 LYS LYS A . n 
A 1 72 ARG 72 215 215 ARG ARG A . n 
A 1 73 ASN 73 216 216 ASN ASN A . n 
A 1 74 ALA 74 217 217 ALA ALA A . n 
A 1 75 ALA 75 218 218 ALA ALA A . n 
A 1 76 ALA 76 219 219 ALA ALA A . n 
A 1 77 LYS 77 220 220 LYS LYS A . n 
A 1 78 MET 78 221 221 MET MET A . n 
A 1 79 LEU 79 222 222 LEU LEU A . n 
A 1 80 LEU 80 223 223 LEU LEU A . n 
A 1 81 ARG 81 224 224 ARG ARG A . n 
A 1 82 VAL 82 225 225 VAL VAL A . n 
A 1 83 HIS 83 226 226 HIS HIS A . n 
A 1 84 THR 84 227 227 THR THR A . n 
A 1 85 VAL 85 228 ?   ?   ?   A . n 
A 1 86 PRO 86 229 ?   ?   ?   A . n 
A 1 87 LEU 87 230 ?   ?   ?   A . n 
A 1 88 ASP 88 231 ?   ?   ?   A . n 
B 2 1  C   1  1   1   C   C   B . n 
B 2 2  G   2  2   2   G   G   B . n 
B 2 3  C   3  3   3   C   C   B . n 
B 2 4  G   4  4   4   G   G   B . n 
B 2 5  C   5  5   5   C   C   B . n 
B 2 6  G   6  6   6   G   G   B . n 
B 2 7  C   7  7   7   C   C   B . n 
B 2 8  G   8  8   8   G   G   B . n 
B 2 9  C   9  9   9   C   C   B . n 
B 2 10 G   10 10  10  G   G   B . n 
C 2 1  C   1  1   1   C   C   C . n 
C 2 2  G   2  2   2   G   G   C . n 
C 2 3  C   3  3   3   C   C   C . n 
C 2 4  G   4  4   4   G   G   C . n 
C 2 5  C   5  5   5   C   C   C . n 
C 2 6  G   6  6   6   G   G   C . n 
C 2 7  C   7  7   7   C   C   C . n 
C 2 8  G   8  8   8   G   G   C . n 
C 2 9  C   9  9   9   C   C   C . n 
C 2 10 G   10 10  10  G   G   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1820 ? 
1 MORE         -12  ? 
1 'SSA (A^2)'  8560 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     3 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-05-26 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         9.8972 
_pdbx_refine_tls.origin_y         -4.1129 
_pdbx_refine_tls.origin_z         13.0194 
_pdbx_refine_tls.T[1][1]          -0.1095 
_pdbx_refine_tls.T[2][2]          -0.0397 
_pdbx_refine_tls.T[3][3]          -0.0325 
_pdbx_refine_tls.T[1][2]          0.0069 
_pdbx_refine_tls.T[1][3]          0.0277 
_pdbx_refine_tls.T[2][3]          -0.0224 
_pdbx_refine_tls.L[1][1]          0.2040 
_pdbx_refine_tls.L[2][2]          2.3836 
_pdbx_refine_tls.L[3][3]          4.4069 
_pdbx_refine_tls.L[1][2]          -0.1169 
_pdbx_refine_tls.L[1][3]          0.5877 
_pdbx_refine_tls.L[2][3]          -2.1090 
_pdbx_refine_tls.S[1][1]          0.0510 
_pdbx_refine_tls.S[1][2]          0.2537 
_pdbx_refine_tls.S[1][3]          -0.1581 
_pdbx_refine_tls.S[2][1]          -0.1008 
_pdbx_refine_tls.S[2][2]          -0.1251 
_pdbx_refine_tls.S[2][3]          -0.1593 
_pdbx_refine_tls.S[3][1]          0.3051 
_pdbx_refine_tls.S[3][2]          0.1690 
_pdbx_refine_tls.S[3][3]          0.0742 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     152 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     227 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
MOLREP   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             160 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             160 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.174 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            -0.078 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" B C 3 ? ? "C1'" B C 3 ? ? N1 B C 3 ? ? 113.47 108.50 4.97 0.70 N 
2 1 "O4'" B C 5 ? ? "C1'" B C 5 ? ? N1 B C 5 ? ? 115.98 108.50 7.48 0.70 N 
3 1 "O4'" C G 8 ? ? "C1'" C G 8 ? ? N9 C G 8 ? ? 112.89 108.50 4.39 0.70 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    GLU 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     199 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             50.28 
_pdbx_validate_torsion.psi             -118.02 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS 144 ? A HIS 1  
2  1 Y 1 A HIS 145 ? A HIS 2  
3  1 Y 1 A HIS 146 ? A HIS 3  
4  1 Y 1 A HIS 147 ? A HIS 4  
5  1 Y 1 A HIS 148 ? A HIS 5  
6  1 Y 1 A HIS 149 ? A HIS 6  
7  1 Y 1 A SER 150 ? A SER 7  
8  1 Y 1 A SER 151 ? A SER 8  
9  1 Y 1 A VAL 228 ? A VAL 85 
10 1 Y 1 A PRO 229 ? A PRO 86 
11 1 Y 1 A LEU 230 ? A LEU 87 
12 1 Y 1 A ASP 231 ? A ASP 88 
# 
_ndb_struct_conf_na.entry_id   3ADL 
_ndb_struct_conf_na.feature    'a-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B C 1  1_555 C G 10 1_555 0.424  -0.492 -0.234 8.462  -15.779 -2.138  1  B_C1:G10_C B 1  ? C 10 ? 19 1 
1 B G 2  1_555 C C 9  1_555 -0.563 -0.255 -0.136 -1.182 -12.372 -0.055  2  B_G2:C9_C  B 2  ? C 9  ? 19 1 
1 B C 3  1_555 C G 8  1_555 0.179  -0.109 0.132  1.924  -9.667  2.143   3  B_C3:G8_C  B 3  ? C 8  ? 19 1 
1 B G 4  1_555 C C 7  1_555 -0.208 -0.271 -0.098 2.831  -11.146 0.406   4  B_G4:C7_C  B 4  ? C 7  ? 19 1 
1 B C 5  1_555 C G 6  1_555 0.445  -0.272 0.041  3.863  -12.857 -4.094  5  B_C5:G6_C  B 5  ? C 6  ? 19 1 
1 B G 6  1_555 C C 5  1_555 -0.143 -0.304 0.102  -2.006 -13.254 0.235   6  B_G6:C5_C  B 6  ? C 5  ? 19 1 
1 B C 7  1_555 C G 4  1_555 0.041  -0.216 0.137  -2.420 -8.967  -2.312  7  B_C7:G4_C  B 7  ? C 4  ? 19 1 
1 B G 8  1_555 C C 3  1_555 1.165  -0.153 -0.180 -8.819 -10.154 -7.927  8  B_G8:C3_C  B 8  ? C 3  ? 19 1 
1 B C 9  1_555 C G 2  1_555 0.061  -1.554 0.098  0.330  -10.288 -25.478 9  B_C9:G2_C  B 9  ? C 2  ? 22 1 
1 B G 10 1_555 C C 1  1_555 0.875  -0.881 0.124  -0.426 -4.806  -4.498  10 B_G10:C1_C B 10 ? C 1  ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B C 1 1_555 C G 10 1_555 B G 2  1_555 C C 9 1_555 0.528  -1.571 3.495 0.490  13.366 27.799 -5.482 -0.902 2.502 25.999 -0.953 
30.792 1 BB_C1G2:C9G10_CC B 1 ? C 10 ? B 2  ? C 9 ? 
1 B G 2 1_555 C C 9  1_555 B C 3  1_555 C G 8 1_555 0.106  -1.434 3.324 -1.976 2.682  31.798 -3.088 -0.550 3.183 4.878  3.595  
31.968 2 BB_G2C3:G8C9_CC  B 2 ? C 9  ? B 3  ? C 8 ? 
1 B C 3 1_555 C G 8  1_555 B G 4  1_555 C C 7 1_555 -0.916 -1.789 3.191 0.103  8.944  26.552 -5.581 1.916  2.465 18.807 -0.216 
27.993 3 BB_C3G4:C7G8_CC  B 3 ? C 8  ? B 4  ? C 7 ? 
1 B G 4 1_555 C C 7  1_555 B C 5  1_555 C G 6 1_555 -0.337 -1.239 3.249 -2.235 6.067  33.547 -3.036 0.233  3.001 10.391 3.829  
34.147 4 BB_G4C5:G6C7_CC  B 4 ? C 7  ? B 5  ? C 6 ? 
1 B C 5 1_555 C G 6  1_555 B G 6  1_555 C C 5 1_555 0.391  -1.827 3.201 0.654  12.948 30.940 -5.034 -0.585 2.282 23.043 -1.164 
33.485 5 BB_C5G6:C5G6_CC  B 5 ? C 6  ? B 6  ? C 5 ? 
1 B G 6 1_555 C C 5  1_555 B C 7  1_555 C G 4 1_555 0.055  -1.913 3.279 0.572  1.287  33.039 -3.576 -0.001 3.205 2.262  -1.005 
33.068 6 BB_G6C7:G4C5_CC  B 6 ? C 5  ? B 7  ? C 4 ? 
1 B C 7 1_555 C G 4  1_555 B G 8  1_555 C C 3 1_555 -0.737 -1.539 3.266 4.405  11.698 35.055 -3.843 1.694  2.534 18.702 -7.042 
37.151 7 BB_C7G8:C3G4_CC  B 7 ? C 4  ? B 8  ? C 3 ? 
1 B G 8 1_555 C C 3  1_555 B C 9  1_555 C G 2 1_555 0.003  -1.725 2.983 0.578  6.175  29.213 -4.451 0.098  2.572 12.072 -1.129 
29.850 8 BB_G8C9:G2C3_CC  B 8 ? C 3  ? B 9  ? C 2 ? 
1 B C 9 1_555 C G 2  1_555 B G 10 1_555 C C 1 1_555 1.016  -0.881 3.431 1.718  6.619  39.716 -2.053 -1.274 3.288 9.656  -2.506 
40.277 9 BB_C9G10:C1G2_CC B 9 ? C 2  ? B 10 ? C 1 ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 HOH 1  1  1  HOH HOH A . 
D 3 HOH 2  2  2  HOH HOH A . 
D 3 HOH 3  3  3  HOH HOH A . 
D 3 HOH 4  4  4  HOH HOH A . 
D 3 HOH 5  6  6  HOH HOH A . 
D 3 HOH 6  7  7  HOH HOH A . 
D 3 HOH 7  8  8  HOH HOH A . 
D 3 HOH 8  9  9  HOH HOH A . 
D 3 HOH 9  10 10 HOH HOH A . 
D 3 HOH 10 11 11 HOH HOH A . 
D 3 HOH 11 12 12 HOH HOH A . 
D 3 HOH 12 14 14 HOH HOH A . 
D 3 HOH 13 18 18 HOH HOH A . 
D 3 HOH 14 19 19 HOH HOH A . 
D 3 HOH 15 20 20 HOH HOH A . 
D 3 HOH 16 21 21 HOH HOH A . 
D 3 HOH 17 22 22 HOH HOH A . 
D 3 HOH 18 25 25 HOH HOH A . 
D 3 HOH 19 26 26 HOH HOH A . 
D 3 HOH 20 27 27 HOH HOH A . 
D 3 HOH 21 28 28 HOH HOH A . 
D 3 HOH 22 32 32 HOH HOH A . 
D 3 HOH 23 33 33 HOH HOH A . 
D 3 HOH 24 34 34 HOH HOH A . 
D 3 HOH 25 35 35 HOH HOH A . 
D 3 HOH 26 36 36 HOH HOH A . 
D 3 HOH 27 43 43 HOH HOH A . 
D 3 HOH 28 44 44 HOH HOH A . 
D 3 HOH 29 45 45 HOH HOH A . 
D 3 HOH 30 46 46 HOH HOH A . 
D 3 HOH 31 47 47 HOH HOH A . 
E 3 HOH 1  15 15 HOH HOH B . 
E 3 HOH 2  31 31 HOH HOH B . 
E 3 HOH 3  37 37 HOH HOH B . 
E 3 HOH 4  38 38 HOH HOH B . 
E 3 HOH 5  39 39 HOH HOH B . 
E 3 HOH 6  41 41 HOH HOH B . 
E 3 HOH 7  42 42 HOH HOH B . 
F 3 HOH 1  11 5  HOH HOH C . 
F 3 HOH 2  13 13 HOH HOH C . 
F 3 HOH 3  16 16 HOH HOH C . 
F 3 HOH 4  17 17 HOH HOH C . 
F 3 HOH 5  23 23 HOH HOH C . 
F 3 HOH 6  24 24 HOH HOH C . 
F 3 HOH 7  29 29 HOH HOH C . 
F 3 HOH 8  30 30 HOH HOH C . 
F 3 HOH 9  40 40 HOH HOH C . 
#