data_3AG2
# 
_entry.id   3AG2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.344 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3AG2         ? ? 
RCSB  RCSB029208   ? ? 
WWPDB D_1000029208 ? ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 1occ unspecified 
PDB . 1ocz unspecified 
PDB . 1oco unspecified 
PDB . 1ocr unspecified 
PDB . 2occ unspecified 
PDB . 1v54 unspecified 
PDB . 1v55 unspecified 
PDB . 2dyr unspecified 
PDB . 2dys unspecified 
PDB . 2eij unspecified 
PDB . 2eik unspecified 
PDB . 2eil unspecified 
PDB . 2eim unspecified 
PDB . 2ein unspecified 
PDB . 2zxw unspecified 
PDB . 3abk unspecified 
PDB . 3abl unspecified 
PDB . 3abm unspecified 
PDB . 3AG1 unspecified 
PDB . 3AG3 unspecified 
PDB . 3AG4 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        3AG2 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Muramoto, K.'      1 ? 
'Ohta, K.'          2 ? 
'Shinzawa-Itoh, K.' 3 ? 
'Kanda, K.'         4 ? 
'Taniguchi, M.'     5 ? 
'Nabekura, H.'      6 ? 
'Yamashita, E.'     7 ? 
'Tsukihara, T.'     8 ? 
'Yoshikawa, S.'     9 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            107 
_citation.language                  ? 
_citation.page_first                7740 
_citation.page_last                 7745 
_citation.title                     
'Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate' 
_citation.year                      2010 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.0910410107 
_citation.pdbx_database_id_PubMed   20385840 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Muramoto, K.'      1 ? 
primary 'Ohta, K.'          2 ? 
primary 'Shinzawa-Itoh, K.' 3 ? 
primary 'Kanda, K.'         4 ? 
primary 'Taniguchi, M.'     5 ? 
primary 'Nabekura, H.'      6 ? 
primary 'Yamashita, E.'     7 ? 
primary 'Tsukihara, T.'     8 ? 
primary 'Yoshikawa, S.'     9 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     3AG2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     182.834 
_cell.length_a_esd                 ? 
_cell.length_b                     206.933 
_cell.length_b_esd                 ? 
_cell.length_c                     178.090 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         3AG2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Cytochrome c oxidase subunit 1' 57093.852 2    7.1.1.9 ? ? ? 
2  polymer     nat 'Cytochrome c oxidase subunit 2' 26068.404 2    7.1.1.9 ? ? ? 
3  polymer     nat 'Cytochrome c oxidase subunit 3' 29957.627 2    7.1.1.9 ? ? ? 
4  polymer     nat 'Cytochrome c oxidase subunit 4 isoform 1, mitochondrial' 17179.646 2    ?       ? ? ? 
5  polymer     nat 'Cytochrome c oxidase subunit 5A, mitochondrial' 12453.081 2    ?       ? ? ? 
6  polymer     nat 'Cytochrome c oxidase subunit 5B, mitochondrial' 10684.038 2    ?       ? ? ? 
7  polymer     nat 'Cytochrome c oxidase subunit 6A2, mitochondrial' 9629.782  2    ?       ? ? ? 
8  polymer     nat 'Cytochrome c oxidase subunit 6B1' 10039.244 2    ?       ? ? ? 
9  polymer     nat 'Cytochrome c oxidase subunit 6C' 8537.019  2    ?       ? ? ? 
10 polymer     nat 'Cytochrome c oxidase subunit 7A1, mitochondrial' 6682.726  2    ?       ? ? ? 
11 polymer     nat 'Cytochrome c oxidase subunit 7B, mitochondrial' 6365.217  2    ?       ? ? ? 
12 polymer     nat 'Cytochrome c oxidase subunit 7C, mitochondrial' 5449.396  2    ?       ? ? ? 
13 polymer     nat 'Cytochrome c oxidase subunit 8B, mitochondrial' 4967.756  2    ?       ? ? ? 
14 non-polymer syn HEME-A 852.837   4    ?       ? ? ? 
15 non-polymer syn 'COPPER (II) ION' 63.546    2    ?       ? ? ? 
16 non-polymer syn 'MAGNESIUM ION' 24.305    2    ?       ? ? ? 
17 non-polymer syn 'SODIUM ION' 22.990    4    ?       ? ? ? 
18 non-polymer syn 'CARBON MONOXIDE' 28.010    2    ?       ? ? ? 
19 non-polymer syn 
'(1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE' 749.007   
8    ?       ? ? ? 
20 non-polymer syn TRISTEAROYLGLYCEROL 891.480   6    ?       ? ? ? 
21 non-polymer man 1,2-ETHANEDIOL 62.068    66   ?       ? ? ? 
22 non-polymer syn 'DINUCLEAR COPPER ION' 127.092   2    ?       ? ? ? 
23 non-polymer syn 
'(7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE' 
759.068   2    ?       ? ? ? 
24 non-polymer syn 'CHOLIC ACID' 408.571   10   ?       ? ? ? 
25 non-polymer syn 
'(1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE' 
768.055   6    ?       ? ? ? 
26 non-polymer syn CARDIOLIPIN 1464.043  4    ?       ? ? ? 
27 non-polymer syn DECYL-BETA-D-MALTOPYRANOSIDE 482.562   11   ?       ? ? ? 
28 non-polymer syn 'ZINC ION' 65.409    2    ?       ? ? ? 
29 water       nat water 18.015    1765 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'Cytochrome c oxidase polypeptide I' 
2  'Cytochrome c oxidase polypeptide II' 
3  'Cytochrome c oxidase polypeptide III' 
4  'Cytochrome c oxidase polypeptide IV,Cytochrome c oxidase subunit IV isoform 1,COX IV-1' 
5  'Cytochrome c oxidase polypeptide Va' 
6  'Cytochrome c oxidase polypeptide VIa,Cytochrome c oxidase polypeptide Vb' 
7  'Cytochrome c oxidase polypeptide VIa-heart,COXVIAH,Cytochrome c oxidase polypeptide VIb' 
8  'Cytochrome c oxidase polypeptide VII,Cytochrome c oxidase subunit AED,Cytochrome c oxidase subunit VIb isoform 1,COX VIb-1' 
9  'Cytochrome c oxidase polypeptide VIc,Cytochrome c oxidase subunit STA' 
10 
;Cytochrome c oxidase subunit VIIIc,VIIIC,Cytochrome c oxidase subunit VIIa-heart,Cytochrome c oxidase subunit VIIa-H,Cytochrome c oxidase subunit VIIa-muscle,Cytochrome c oxidase subunit VIIa-M
;
11 'Cytochrome c oxidase polypeptide VIIb,IHQ' 
12 'Cytochrome c oxidase polypeptide VIIIA,Cytochrome c oxidase polypeptide VIIc' 
13 'Cytochrome c oxidase polypeptide VIII-heart,Cytochrome c oxidase subunit 8-1,Cytochrome c oxidase subunit 8H,IX,VIIIb' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no yes 
;(FME)FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIG
GFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVS
SILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFW
FFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPT
GVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHW
FPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAF
ASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
;
;MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGN
WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG
AINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV
FSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF
SGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
;
A,N ? 
2  'polypeptide(L)' no yes 
;(FME)AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILI
ALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSS
EDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
;
;MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPS
LRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVL
HSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
;
B,O ? 
3  'polypeptide(L)' no no  
;MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLR
YGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHML
QALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
;
;MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLR
YGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHML
QALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
;
C,P ? 
4  'polypeptide(L)' no no  
;AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKT
VVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
;
;AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKT
VVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
;
D,Q ? 
5  'polypeptide(L)' no no  
;SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKE
IYPYVIQELRPTLNELGISTPEELGLDKV
;
;SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKE
IYPYVIQELRPTLNELGISTPEELGLDKV
;
E,R ? 
6  'polypeptide(L)' no no  
;ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQ
RCPSCGTHYKLVPHQLAH
;
;ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQ
RCPSCGTHYKLVPHQLAH
;
F,S ? 
7  'polypeptide(L)' no yes 
;ASAAKGDHGG(TPO)GARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVN
PLPTGYEKP
;
;ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPT
GYEKP
;
G,T ? 
8  'polypeptide(L)' no no  
;AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGT
FPGKI
;
;AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGT
FPGKI
;
H,U ? 
9  'polypeptide(L)' no yes '(SAC)TALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK' 
STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK I,V ? 
10 'polypeptide(L)' no no  FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK 
FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK J,W ? 
11 'polypeptide(L)' no no  IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ 
IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ K,X ? 
12 'polypeptide(L)' no no  SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK L,Y ? 
13 'polypeptide(L)' no no  ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA M,Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   FME n 
1  2   PHE n 
1  3   ILE n 
1  4   ASN n 
1  5   ARG n 
1  6   TRP n 
1  7   LEU n 
1  8   PHE n 
1  9   SER n 
1  10  THR n 
1  11  ASN n 
1  12  HIS n 
1  13  LYS n 
1  14  ASP n 
1  15  ILE n 
1  16  GLY n 
1  17  THR n 
1  18  LEU n 
1  19  TYR n 
1  20  LEU n 
1  21  LEU n 
1  22  PHE n 
1  23  GLY n 
1  24  ALA n 
1  25  TRP n 
1  26  ALA n 
1  27  GLY n 
1  28  MET n 
1  29  VAL n 
1  30  GLY n 
1  31  THR n 
1  32  ALA n 
1  33  LEU n 
1  34  SER n 
1  35  LEU n 
1  36  LEU n 
1  37  ILE n 
1  38  ARG n 
1  39  ALA n 
1  40  GLU n 
1  41  LEU n 
1  42  GLY n 
1  43  GLN n 
1  44  PRO n 
1  45  GLY n 
1  46  THR n 
1  47  LEU n 
1  48  LEU n 
1  49  GLY n 
1  50  ASP n 
1  51  ASP n 
1  52  GLN n 
1  53  ILE n 
1  54  TYR n 
1  55  ASN n 
1  56  VAL n 
1  57  VAL n 
1  58  VAL n 
1  59  THR n 
1  60  ALA n 
1  61  HIS n 
1  62  ALA n 
1  63  PHE n 
1  64  VAL n 
1  65  MET n 
1  66  ILE n 
1  67  PHE n 
1  68  PHE n 
1  69  MET n 
1  70  VAL n 
1  71  MET n 
1  72  PRO n 
1  73  ILE n 
1  74  MET n 
1  75  ILE n 
1  76  GLY n 
1  77  GLY n 
1  78  PHE n 
1  79  GLY n 
1  80  ASN n 
1  81  TRP n 
1  82  LEU n 
1  83  VAL n 
1  84  PRO n 
1  85  LEU n 
1  86  MET n 
1  87  ILE n 
1  88  GLY n 
1  89  ALA n 
1  90  PRO n 
1  91  ASP n 
1  92  MET n 
1  93  ALA n 
1  94  PHE n 
1  95  PRO n 
1  96  ARG n 
1  97  MET n 
1  98  ASN n 
1  99  ASN n 
1  100 MET n 
1  101 SER n 
1  102 PHE n 
1  103 TRP n 
1  104 LEU n 
1  105 LEU n 
1  106 PRO n 
1  107 PRO n 
1  108 SER n 
1  109 PHE n 
1  110 LEU n 
1  111 LEU n 
1  112 LEU n 
1  113 LEU n 
1  114 ALA n 
1  115 SER n 
1  116 SER n 
1  117 MET n 
1  118 VAL n 
1  119 GLU n 
1  120 ALA n 
1  121 GLY n 
1  122 ALA n 
1  123 GLY n 
1  124 THR n 
1  125 GLY n 
1  126 TRP n 
1  127 THR n 
1  128 VAL n 
1  129 TYR n 
1  130 PRO n 
1  131 PRO n 
1  132 LEU n 
1  133 ALA n 
1  134 GLY n 
1  135 ASN n 
1  136 LEU n 
1  137 ALA n 
1  138 HIS n 
1  139 ALA n 
1  140 GLY n 
1  141 ALA n 
1  142 SER n 
1  143 VAL n 
1  144 ASP n 
1  145 LEU n 
1  146 THR n 
1  147 ILE n 
1  148 PHE n 
1  149 SER n 
1  150 LEU n 
1  151 HIS n 
1  152 LEU n 
1  153 ALA n 
1  154 GLY n 
1  155 VAL n 
1  156 SER n 
1  157 SER n 
1  158 ILE n 
1  159 LEU n 
1  160 GLY n 
1  161 ALA n 
1  162 ILE n 
1  163 ASN n 
1  164 PHE n 
1  165 ILE n 
1  166 THR n 
1  167 THR n 
1  168 ILE n 
1  169 ILE n 
1  170 ASN n 
1  171 MET n 
1  172 LYS n 
1  173 PRO n 
1  174 PRO n 
1  175 ALA n 
1  176 MET n 
1  177 SER n 
1  178 GLN n 
1  179 TYR n 
1  180 GLN n 
1  181 THR n 
1  182 PRO n 
1  183 LEU n 
1  184 PHE n 
1  185 VAL n 
1  186 TRP n 
1  187 SER n 
1  188 VAL n 
1  189 MET n 
1  190 ILE n 
1  191 THR n 
1  192 ALA n 
1  193 VAL n 
1  194 LEU n 
1  195 LEU n 
1  196 LEU n 
1  197 LEU n 
1  198 SER n 
1  199 LEU n 
1  200 PRO n 
1  201 VAL n 
1  202 LEU n 
1  203 ALA n 
1  204 ALA n 
1  205 GLY n 
1  206 ILE n 
1  207 THR n 
1  208 MET n 
1  209 LEU n 
1  210 LEU n 
1  211 THR n 
1  212 ASP n 
1  213 ARG n 
1  214 ASN n 
1  215 LEU n 
1  216 ASN n 
1  217 THR n 
1  218 THR n 
1  219 PHE n 
1  220 PHE n 
1  221 ASP n 
1  222 PRO n 
1  223 ALA n 
1  224 GLY n 
1  225 GLY n 
1  226 GLY n 
1  227 ASP n 
1  228 PRO n 
1  229 ILE n 
1  230 LEU n 
1  231 TYR n 
1  232 GLN n 
1  233 HIS n 
1  234 LEU n 
1  235 PHE n 
1  236 TRP n 
1  237 PHE n 
1  238 PHE n 
1  239 GLY n 
1  240 HIS n 
1  241 PRO n 
1  242 GLU n 
1  243 VAL n 
1  244 TYR n 
1  245 ILE n 
1  246 LEU n 
1  247 ILE n 
1  248 LEU n 
1  249 PRO n 
1  250 GLY n 
1  251 PHE n 
1  252 GLY n 
1  253 MET n 
1  254 ILE n 
1  255 SER n 
1  256 HIS n 
1  257 ILE n 
1  258 VAL n 
1  259 THR n 
1  260 TYR n 
1  261 TYR n 
1  262 SER n 
1  263 GLY n 
1  264 LYS n 
1  265 LYS n 
1  266 GLU n 
1  267 PRO n 
1  268 PHE n 
1  269 GLY n 
1  270 TYR n 
1  271 MET n 
1  272 GLY n 
1  273 MET n 
1  274 VAL n 
1  275 TRP n 
1  276 ALA n 
1  277 MET n 
1  278 MET n 
1  279 SER n 
1  280 ILE n 
1  281 GLY n 
1  282 PHE n 
1  283 LEU n 
1  284 GLY n 
1  285 PHE n 
1  286 ILE n 
1  287 VAL n 
1  288 TRP n 
1  289 ALA n 
1  290 HIS n 
1  291 HIS n 
1  292 MET n 
1  293 PHE n 
1  294 THR n 
1  295 VAL n 
1  296 GLY n 
1  297 MET n 
1  298 ASP n 
1  299 VAL n 
1  300 ASP n 
1  301 THR n 
1  302 ARG n 
1  303 ALA n 
1  304 TYR n 
1  305 PHE n 
1  306 THR n 
1  307 SER n 
1  308 ALA n 
1  309 THR n 
1  310 MET n 
1  311 ILE n 
1  312 ILE n 
1  313 ALA n 
1  314 ILE n 
1  315 PRO n 
1  316 THR n 
1  317 GLY n 
1  318 VAL n 
1  319 LYS n 
1  320 VAL n 
1  321 PHE n 
1  322 SER n 
1  323 TRP n 
1  324 LEU n 
1  325 ALA n 
1  326 THR n 
1  327 LEU n 
1  328 HIS n 
1  329 GLY n 
1  330 GLY n 
1  331 ASN n 
1  332 ILE n 
1  333 LYS n 
1  334 TRP n 
1  335 SER n 
1  336 PRO n 
1  337 ALA n 
1  338 MET n 
1  339 MET n 
1  340 TRP n 
1  341 ALA n 
1  342 LEU n 
1  343 GLY n 
1  344 PHE n 
1  345 ILE n 
1  346 PHE n 
1  347 LEU n 
1  348 PHE n 
1  349 THR n 
1  350 VAL n 
1  351 GLY n 
1  352 GLY n 
1  353 LEU n 
1  354 THR n 
1  355 GLY n 
1  356 ILE n 
1  357 VAL n 
1  358 LEU n 
1  359 ALA n 
1  360 ASN n 
1  361 SER n 
1  362 SER n 
1  363 LEU n 
1  364 ASP n 
1  365 ILE n 
1  366 VAL n 
1  367 LEU n 
1  368 HIS n 
1  369 ASP n 
1  370 THR n 
1  371 TYR n 
1  372 TYR n 
1  373 VAL n 
1  374 VAL n 
1  375 ALA n 
1  376 HIS n 
1  377 PHE n 
1  378 HIS n 
1  379 TYR n 
1  380 VAL n 
1  381 LEU n 
1  382 SER n 
1  383 MET n 
1  384 GLY n 
1  385 ALA n 
1  386 VAL n 
1  387 PHE n 
1  388 ALA n 
1  389 ILE n 
1  390 MET n 
1  391 GLY n 
1  392 GLY n 
1  393 PHE n 
1  394 VAL n 
1  395 HIS n 
1  396 TRP n 
1  397 PHE n 
1  398 PRO n 
1  399 LEU n 
1  400 PHE n 
1  401 SER n 
1  402 GLY n 
1  403 TYR n 
1  404 THR n 
1  405 LEU n 
1  406 ASN n 
1  407 ASP n 
1  408 THR n 
1  409 TRP n 
1  410 ALA n 
1  411 LYS n 
1  412 ILE n 
1  413 HIS n 
1  414 PHE n 
1  415 ALA n 
1  416 ILE n 
1  417 MET n 
1  418 PHE n 
1  419 VAL n 
1  420 GLY n 
1  421 VAL n 
1  422 ASN n 
1  423 MET n 
1  424 THR n 
1  425 PHE n 
1  426 PHE n 
1  427 PRO n 
1  428 GLN n 
1  429 HIS n 
1  430 PHE n 
1  431 LEU n 
1  432 GLY n 
1  433 LEU n 
1  434 SER n 
1  435 GLY n 
1  436 MET n 
1  437 PRO n 
1  438 ARG n 
1  439 ARG n 
1  440 TYR n 
1  441 SER n 
1  442 ASP n 
1  443 TYR n 
1  444 PRO n 
1  445 ASP n 
1  446 ALA n 
1  447 TYR n 
1  448 THR n 
1  449 MET n 
1  450 TRP n 
1  451 ASN n 
1  452 THR n 
1  453 ILE n 
1  454 SER n 
1  455 SER n 
1  456 MET n 
1  457 GLY n 
1  458 SER n 
1  459 PHE n 
1  460 ILE n 
1  461 SER n 
1  462 LEU n 
1  463 THR n 
1  464 ALA n 
1  465 VAL n 
1  466 MET n 
1  467 LEU n 
1  468 MET n 
1  469 VAL n 
1  470 PHE n 
1  471 ILE n 
1  472 ILE n 
1  473 TRP n 
1  474 GLU n 
1  475 ALA n 
1  476 PHE n 
1  477 ALA n 
1  478 SER n 
1  479 LYS n 
1  480 ARG n 
1  481 GLU n 
1  482 VAL n 
1  483 LEU n 
1  484 THR n 
1  485 VAL n 
1  486 ASP n 
1  487 LEU n 
1  488 THR n 
1  489 THR n 
1  490 THR n 
1  491 ASN n 
1  492 LEU n 
1  493 GLU n 
1  494 TRP n 
1  495 LEU n 
1  496 ASN n 
1  497 GLY n 
1  498 CYS n 
1  499 PRO n 
1  500 PRO n 
1  501 PRO n 
1  502 TYR n 
1  503 HIS n 
1  504 THR n 
1  505 PHE n 
1  506 GLU n 
1  507 GLU n 
1  508 PRO n 
1  509 THR n 
1  510 TYR n 
1  511 VAL n 
1  512 ASN n 
1  513 LEU n 
1  514 LYS n 
2  1   FME n 
2  2   ALA n 
2  3   TYR n 
2  4   PRO n 
2  5   MET n 
2  6   GLN n 
2  7   LEU n 
2  8   GLY n 
2  9   PHE n 
2  10  GLN n 
2  11  ASP n 
2  12  ALA n 
2  13  THR n 
2  14  SER n 
2  15  PRO n 
2  16  ILE n 
2  17  MET n 
2  18  GLU n 
2  19  GLU n 
2  20  LEU n 
2  21  LEU n 
2  22  HIS n 
2  23  PHE n 
2  24  HIS n 
2  25  ASP n 
2  26  HIS n 
2  27  THR n 
2  28  LEU n 
2  29  MET n 
2  30  ILE n 
2  31  VAL n 
2  32  PHE n 
2  33  LEU n 
2  34  ILE n 
2  35  SER n 
2  36  SER n 
2  37  LEU n 
2  38  VAL n 
2  39  LEU n 
2  40  TYR n 
2  41  ILE n 
2  42  ILE n 
2  43  SER n 
2  44  LEU n 
2  45  MET n 
2  46  LEU n 
2  47  THR n 
2  48  THR n 
2  49  LYS n 
2  50  LEU n 
2  51  THR n 
2  52  HIS n 
2  53  THR n 
2  54  SER n 
2  55  THR n 
2  56  MET n 
2  57  ASP n 
2  58  ALA n 
2  59  GLN n 
2  60  GLU n 
2  61  VAL n 
2  62  GLU n 
2  63  THR n 
2  64  ILE n 
2  65  TRP n 
2  66  THR n 
2  67  ILE n 
2  68  LEU n 
2  69  PRO n 
2  70  ALA n 
2  71  ILE n 
2  72  ILE n 
2  73  LEU n 
2  74  ILE n 
2  75  LEU n 
2  76  ILE n 
2  77  ALA n 
2  78  LEU n 
2  79  PRO n 
2  80  SER n 
2  81  LEU n 
2  82  ARG n 
2  83  ILE n 
2  84  LEU n 
2  85  TYR n 
2  86  MET n 
2  87  MET n 
2  88  ASP n 
2  89  GLU n 
2  90  ILE n 
2  91  ASN n 
2  92  ASN n 
2  93  PRO n 
2  94  SER n 
2  95  LEU n 
2  96  THR n 
2  97  VAL n 
2  98  LYS n 
2  99  THR n 
2  100 MET n 
2  101 GLY n 
2  102 HIS n 
2  103 GLN n 
2  104 TRP n 
2  105 TYR n 
2  106 TRP n 
2  107 SER n 
2  108 TYR n 
2  109 GLU n 
2  110 TYR n 
2  111 THR n 
2  112 ASP n 
2  113 TYR n 
2  114 GLU n 
2  115 ASP n 
2  116 LEU n 
2  117 SER n 
2  118 PHE n 
2  119 ASP n 
2  120 SER n 
2  121 TYR n 
2  122 MET n 
2  123 ILE n 
2  124 PRO n 
2  125 THR n 
2  126 SER n 
2  127 GLU n 
2  128 LEU n 
2  129 LYS n 
2  130 PRO n 
2  131 GLY n 
2  132 GLU n 
2  133 LEU n 
2  134 ARG n 
2  135 LEU n 
2  136 LEU n 
2  137 GLU n 
2  138 VAL n 
2  139 ASP n 
2  140 ASN n 
2  141 ARG n 
2  142 VAL n 
2  143 VAL n 
2  144 LEU n 
2  145 PRO n 
2  146 MET n 
2  147 GLU n 
2  148 MET n 
2  149 THR n 
2  150 ILE n 
2  151 ARG n 
2  152 MET n 
2  153 LEU n 
2  154 VAL n 
2  155 SER n 
2  156 SER n 
2  157 GLU n 
2  158 ASP n 
2  159 VAL n 
2  160 LEU n 
2  161 HIS n 
2  162 SER n 
2  163 TRP n 
2  164 ALA n 
2  165 VAL n 
2  166 PRO n 
2  167 SER n 
2  168 LEU n 
2  169 GLY n 
2  170 LEU n 
2  171 LYS n 
2  172 THR n 
2  173 ASP n 
2  174 ALA n 
2  175 ILE n 
2  176 PRO n 
2  177 GLY n 
2  178 ARG n 
2  179 LEU n 
2  180 ASN n 
2  181 GLN n 
2  182 THR n 
2  183 THR n 
2  184 LEU n 
2  185 MET n 
2  186 SER n 
2  187 SER n 
2  188 ARG n 
2  189 PRO n 
2  190 GLY n 
2  191 LEU n 
2  192 TYR n 
2  193 TYR n 
2  194 GLY n 
2  195 GLN n 
2  196 CYS n 
2  197 SER n 
2  198 GLU n 
2  199 ILE n 
2  200 CYS n 
2  201 GLY n 
2  202 SER n 
2  203 ASN n 
2  204 HIS n 
2  205 SER n 
2  206 PHE n 
2  207 MET n 
2  208 PRO n 
2  209 ILE n 
2  210 VAL n 
2  211 LEU n 
2  212 GLU n 
2  213 LEU n 
2  214 VAL n 
2  215 PRO n 
2  216 LEU n 
2  217 LYS n 
2  218 TYR n 
2  219 PHE n 
2  220 GLU n 
2  221 LYS n 
2  222 TRP n 
2  223 SER n 
2  224 ALA n 
2  225 SER n 
2  226 MET n 
2  227 LEU n 
3  1   MET n 
3  2   THR n 
3  3   HIS n 
3  4   GLN n 
3  5   THR n 
3  6   HIS n 
3  7   ALA n 
3  8   TYR n 
3  9   HIS n 
3  10  MET n 
3  11  VAL n 
3  12  ASN n 
3  13  PRO n 
3  14  SER n 
3  15  PRO n 
3  16  TRP n 
3  17  PRO n 
3  18  LEU n 
3  19  THR n 
3  20  GLY n 
3  21  ALA n 
3  22  LEU n 
3  23  SER n 
3  24  ALA n 
3  25  LEU n 
3  26  LEU n 
3  27  MET n 
3  28  THR n 
3  29  SER n 
3  30  GLY n 
3  31  LEU n 
3  32  THR n 
3  33  MET n 
3  34  TRP n 
3  35  PHE n 
3  36  HIS n 
3  37  PHE n 
3  38  ASN n 
3  39  SER n 
3  40  MET n 
3  41  THR n 
3  42  LEU n 
3  43  LEU n 
3  44  MET n 
3  45  ILE n 
3  46  GLY n 
3  47  LEU n 
3  48  THR n 
3  49  THR n 
3  50  ASN n 
3  51  MET n 
3  52  LEU n 
3  53  THR n 
3  54  MET n 
3  55  TYR n 
3  56  GLN n 
3  57  TRP n 
3  58  TRP n 
3  59  ARG n 
3  60  ASP n 
3  61  VAL n 
3  62  ILE n 
3  63  ARG n 
3  64  GLU n 
3  65  SER n 
3  66  THR n 
3  67  PHE n 
3  68  GLN n 
3  69  GLY n 
3  70  HIS n 
3  71  HIS n 
3  72  THR n 
3  73  PRO n 
3  74  ALA n 
3  75  VAL n 
3  76  GLN n 
3  77  LYS n 
3  78  GLY n 
3  79  LEU n 
3  80  ARG n 
3  81  TYR n 
3  82  GLY n 
3  83  MET n 
3  84  ILE n 
3  85  LEU n 
3  86  PHE n 
3  87  ILE n 
3  88  ILE n 
3  89  SER n 
3  90  GLU n 
3  91  VAL n 
3  92  LEU n 
3  93  PHE n 
3  94  PHE n 
3  95  THR n 
3  96  GLY n 
3  97  PHE n 
3  98  PHE n 
3  99  TRP n 
3  100 ALA n 
3  101 PHE n 
3  102 TYR n 
3  103 HIS n 
3  104 SER n 
3  105 SER n 
3  106 LEU n 
3  107 ALA n 
3  108 PRO n 
3  109 THR n 
3  110 PRO n 
3  111 GLU n 
3  112 LEU n 
3  113 GLY n 
3  114 GLY n 
3  115 CYS n 
3  116 TRP n 
3  117 PRO n 
3  118 PRO n 
3  119 THR n 
3  120 GLY n 
3  121 ILE n 
3  122 HIS n 
3  123 PRO n 
3  124 LEU n 
3  125 ASN n 
3  126 PRO n 
3  127 LEU n 
3  128 GLU n 
3  129 VAL n 
3  130 PRO n 
3  131 LEU n 
3  132 LEU n 
3  133 ASN n 
3  134 THR n 
3  135 SER n 
3  136 VAL n 
3  137 LEU n 
3  138 LEU n 
3  139 ALA n 
3  140 SER n 
3  141 GLY n 
3  142 VAL n 
3  143 SER n 
3  144 ILE n 
3  145 THR n 
3  146 TRP n 
3  147 ALA n 
3  148 HIS n 
3  149 HIS n 
3  150 SER n 
3  151 LEU n 
3  152 MET n 
3  153 GLU n 
3  154 GLY n 
3  155 ASP n 
3  156 ARG n 
3  157 LYS n 
3  158 HIS n 
3  159 MET n 
3  160 LEU n 
3  161 GLN n 
3  162 ALA n 
3  163 LEU n 
3  164 PHE n 
3  165 ILE n 
3  166 THR n 
3  167 ILE n 
3  168 THR n 
3  169 LEU n 
3  170 GLY n 
3  171 VAL n 
3  172 TYR n 
3  173 PHE n 
3  174 THR n 
3  175 LEU n 
3  176 LEU n 
3  177 GLN n 
3  178 ALA n 
3  179 SER n 
3  180 GLU n 
3  181 TYR n 
3  182 TYR n 
3  183 GLU n 
3  184 ALA n 
3  185 PRO n 
3  186 PHE n 
3  187 THR n 
3  188 ILE n 
3  189 SER n 
3  190 ASP n 
3  191 GLY n 
3  192 VAL n 
3  193 TYR n 
3  194 GLY n 
3  195 SER n 
3  196 THR n 
3  197 PHE n 
3  198 PHE n 
3  199 VAL n 
3  200 ALA n 
3  201 THR n 
3  202 GLY n 
3  203 PHE n 
3  204 HIS n 
3  205 GLY n 
3  206 LEU n 
3  207 HIS n 
3  208 VAL n 
3  209 ILE n 
3  210 ILE n 
3  211 GLY n 
3  212 SER n 
3  213 THR n 
3  214 PHE n 
3  215 LEU n 
3  216 ILE n 
3  217 VAL n 
3  218 CYS n 
3  219 PHE n 
3  220 PHE n 
3  221 ARG n 
3  222 GLN n 
3  223 LEU n 
3  224 LYS n 
3  225 PHE n 
3  226 HIS n 
3  227 PHE n 
3  228 THR n 
3  229 SER n 
3  230 ASN n 
3  231 HIS n 
3  232 HIS n 
3  233 PHE n 
3  234 GLY n 
3  235 PHE n 
3  236 GLU n 
3  237 ALA n 
3  238 ALA n 
3  239 ALA n 
3  240 TRP n 
3  241 TYR n 
3  242 TRP n 
3  243 HIS n 
3  244 PHE n 
3  245 VAL n 
3  246 ASP n 
3  247 VAL n 
3  248 VAL n 
3  249 TRP n 
3  250 LEU n 
3  251 PHE n 
3  252 LEU n 
3  253 TYR n 
3  254 VAL n 
3  255 SER n 
3  256 ILE n 
3  257 TYR n 
3  258 TRP n 
3  259 TRP n 
3  260 GLY n 
3  261 SER n 
4  1   ALA n 
4  2   HIS n 
4  3   GLY n 
4  4   SER n 
4  5   VAL n 
4  6   VAL n 
4  7   LYS n 
4  8   SER n 
4  9   GLU n 
4  10  ASP n 
4  11  TYR n 
4  12  ALA n 
4  13  LEU n 
4  14  PRO n 
4  15  SER n 
4  16  TYR n 
4  17  VAL n 
4  18  ASP n 
4  19  ARG n 
4  20  ARG n 
4  21  ASP n 
4  22  TYR n 
4  23  PRO n 
4  24  LEU n 
4  25  PRO n 
4  26  ASP n 
4  27  VAL n 
4  28  ALA n 
4  29  HIS n 
4  30  VAL n 
4  31  LYS n 
4  32  ASN n 
4  33  LEU n 
4  34  SER n 
4  35  ALA n 
4  36  SER n 
4  37  GLN n 
4  38  LYS n 
4  39  ALA n 
4  40  LEU n 
4  41  LYS n 
4  42  GLU n 
4  43  LYS n 
4  44  GLU n 
4  45  LYS n 
4  46  ALA n 
4  47  SER n 
4  48  TRP n 
4  49  SER n 
4  50  SER n 
4  51  LEU n 
4  52  SER n 
4  53  ILE n 
4  54  ASP n 
4  55  GLU n 
4  56  LYS n 
4  57  VAL n 
4  58  GLU n 
4  59  LEU n 
4  60  TYR n 
4  61  ARG n 
4  62  LEU n 
4  63  LYS n 
4  64  PHE n 
4  65  LYS n 
4  66  GLU n 
4  67  SER n 
4  68  PHE n 
4  69  ALA n 
4  70  GLU n 
4  71  MET n 
4  72  ASN n 
4  73  ARG n 
4  74  SER n 
4  75  THR n 
4  76  ASN n 
4  77  GLU n 
4  78  TRP n 
4  79  LYS n 
4  80  THR n 
4  81  VAL n 
4  82  VAL n 
4  83  GLY n 
4  84  ALA n 
4  85  ALA n 
4  86  MET n 
4  87  PHE n 
4  88  PHE n 
4  89  ILE n 
4  90  GLY n 
4  91  PHE n 
4  92  THR n 
4  93  ALA n 
4  94  LEU n 
4  95  LEU n 
4  96  LEU n 
4  97  ILE n 
4  98  TRP n 
4  99  GLU n 
4  100 LYS n 
4  101 HIS n 
4  102 TYR n 
4  103 VAL n 
4  104 TYR n 
4  105 GLY n 
4  106 PRO n 
4  107 ILE n 
4  108 PRO n 
4  109 HIS n 
4  110 THR n 
4  111 PHE n 
4  112 GLU n 
4  113 GLU n 
4  114 GLU n 
4  115 TRP n 
4  116 VAL n 
4  117 ALA n 
4  118 LYS n 
4  119 GLN n 
4  120 THR n 
4  121 LYS n 
4  122 ARG n 
4  123 MET n 
4  124 LEU n 
4  125 ASP n 
4  126 MET n 
4  127 LYS n 
4  128 VAL n 
4  129 ALA n 
4  130 PRO n 
4  131 ILE n 
4  132 GLN n 
4  133 GLY n 
4  134 PHE n 
4  135 SER n 
4  136 ALA n 
4  137 LYS n 
4  138 TRP n 
4  139 ASP n 
4  140 TYR n 
4  141 ASP n 
4  142 LYS n 
4  143 ASN n 
4  144 GLU n 
4  145 TRP n 
4  146 LYS n 
4  147 LYS n 
5  1   SER n 
5  2   HIS n 
5  3   GLY n 
5  4   SER n 
5  5   HIS n 
5  6   GLU n 
5  7   THR n 
5  8   ASP n 
5  9   GLU n 
5  10  GLU n 
5  11  PHE n 
5  12  ASP n 
5  13  ALA n 
5  14  ARG n 
5  15  TRP n 
5  16  VAL n 
5  17  THR n 
5  18  TYR n 
5  19  PHE n 
5  20  ASN n 
5  21  LYS n 
5  22  PRO n 
5  23  ASP n 
5  24  ILE n 
5  25  ASP n 
5  26  ALA n 
5  27  TRP n 
5  28  GLU n 
5  29  LEU n 
5  30  ARG n 
5  31  LYS n 
5  32  GLY n 
5  33  MET n 
5  34  ASN n 
5  35  THR n 
5  36  LEU n 
5  37  VAL n 
5  38  GLY n 
5  39  TYR n 
5  40  ASP n 
5  41  LEU n 
5  42  VAL n 
5  43  PRO n 
5  44  GLU n 
5  45  PRO n 
5  46  LYS n 
5  47  ILE n 
5  48  ILE n 
5  49  ASP n 
5  50  ALA n 
5  51  ALA n 
5  52  LEU n 
5  53  ARG n 
5  54  ALA n 
5  55  CYS n 
5  56  ARG n 
5  57  ARG n 
5  58  LEU n 
5  59  ASN n 
5  60  ASP n 
5  61  PHE n 
5  62  ALA n 
5  63  SER n 
5  64  ALA n 
5  65  VAL n 
5  66  ARG n 
5  67  ILE n 
5  68  LEU n 
5  69  GLU n 
5  70  VAL n 
5  71  VAL n 
5  72  LYS n 
5  73  ASP n 
5  74  LYS n 
5  75  ALA n 
5  76  GLY n 
5  77  PRO n 
5  78  HIS n 
5  79  LYS n 
5  80  GLU n 
5  81  ILE n 
5  82  TYR n 
5  83  PRO n 
5  84  TYR n 
5  85  VAL n 
5  86  ILE n 
5  87  GLN n 
5  88  GLU n 
5  89  LEU n 
5  90  ARG n 
5  91  PRO n 
5  92  THR n 
5  93  LEU n 
5  94  ASN n 
5  95  GLU n 
5  96  LEU n 
5  97  GLY n 
5  98  ILE n 
5  99  SER n 
5  100 THR n 
5  101 PRO n 
5  102 GLU n 
5  103 GLU n 
5  104 LEU n 
5  105 GLY n 
5  106 LEU n 
5  107 ASP n 
5  108 LYS n 
5  109 VAL n 
6  1   ALA n 
6  2   SER n 
6  3   GLY n 
6  4   GLY n 
6  5   GLY n 
6  6   VAL n 
6  7   PRO n 
6  8   THR n 
6  9   ASP n 
6  10  GLU n 
6  11  GLU n 
6  12  GLN n 
6  13  ALA n 
6  14  THR n 
6  15  GLY n 
6  16  LEU n 
6  17  GLU n 
6  18  ARG n 
6  19  GLU n 
6  20  VAL n 
6  21  MET n 
6  22  LEU n 
6  23  ALA n 
6  24  ALA n 
6  25  ARG n 
6  26  LYS n 
6  27  GLY n 
6  28  GLN n 
6  29  ASP n 
6  30  PRO n 
6  31  TYR n 
6  32  ASN n 
6  33  ILE n 
6  34  LEU n 
6  35  ALA n 
6  36  PRO n 
6  37  LYS n 
6  38  ALA n 
6  39  THR n 
6  40  SER n 
6  41  GLY n 
6  42  THR n 
6  43  LYS n 
6  44  GLU n 
6  45  ASP n 
6  46  PRO n 
6  47  ASN n 
6  48  LEU n 
6  49  VAL n 
6  50  PRO n 
6  51  SER n 
6  52  ILE n 
6  53  THR n 
6  54  ASN n 
6  55  LYS n 
6  56  ARG n 
6  57  ILE n 
6  58  VAL n 
6  59  GLY n 
6  60  CYS n 
6  61  ILE n 
6  62  CYS n 
6  63  GLU n 
6  64  GLU n 
6  65  ASP n 
6  66  ASN n 
6  67  SER n 
6  68  THR n 
6  69  VAL n 
6  70  ILE n 
6  71  TRP n 
6  72  PHE n 
6  73  TRP n 
6  74  LEU n 
6  75  HIS n 
6  76  LYS n 
6  77  GLY n 
6  78  GLU n 
6  79  ALA n 
6  80  GLN n 
6  81  ARG n 
6  82  CYS n 
6  83  PRO n 
6  84  SER n 
6  85  CYS n 
6  86  GLY n 
6  87  THR n 
6  88  HIS n 
6  89  TYR n 
6  90  LYS n 
6  91  LEU n 
6  92  VAL n 
6  93  PRO n 
6  94  HIS n 
6  95  GLN n 
6  96  LEU n 
6  97  ALA n 
6  98  HIS n 
7  1   ALA n 
7  2   SER n 
7  3   ALA n 
7  4   ALA n 
7  5   LYS n 
7  6   GLY n 
7  7   ASP n 
7  8   HIS n 
7  9   GLY n 
7  10  GLY n 
7  11  TPO n 
7  12  GLY n 
7  13  ALA n 
7  14  ARG n 
7  15  THR n 
7  16  TRP n 
7  17  ARG n 
7  18  PHE n 
7  19  LEU n 
7  20  THR n 
7  21  PHE n 
7  22  GLY n 
7  23  LEU n 
7  24  ALA n 
7  25  LEU n 
7  26  PRO n 
7  27  SER n 
7  28  VAL n 
7  29  ALA n 
7  30  LEU n 
7  31  CYS n 
7  32  THR n 
7  33  LEU n 
7  34  ASN n 
7  35  SER n 
7  36  TRP n 
7  37  LEU n 
7  38  HIS n 
7  39  SER n 
7  40  GLY n 
7  41  HIS n 
7  42  ARG n 
7  43  GLU n 
7  44  ARG n 
7  45  PRO n 
7  46  ALA n 
7  47  PHE n 
7  48  ILE n 
7  49  PRO n 
7  50  TYR n 
7  51  HIS n 
7  52  HIS n 
7  53  LEU n 
7  54  ARG n 
7  55  ILE n 
7  56  ARG n 
7  57  THR n 
7  58  LYS n 
7  59  PRO n 
7  60  PHE n 
7  61  SER n 
7  62  TRP n 
7  63  GLY n 
7  64  ASP n 
7  65  GLY n 
7  66  ASN n 
7  67  HIS n 
7  68  THR n 
7  69  PHE n 
7  70  PHE n 
7  71  HIS n 
7  72  ASN n 
7  73  PRO n 
7  74  ARG n 
7  75  VAL n 
7  76  ASN n 
7  77  PRO n 
7  78  LEU n 
7  79  PRO n 
7  80  THR n 
7  81  GLY n 
7  82  TYR n 
7  83  GLU n 
7  84  LYS n 
7  85  PRO n 
8  1   ALA n 
8  2   GLU n 
8  3   ASP n 
8  4   ILE n 
8  5   GLN n 
8  6   ALA n 
8  7   LYS n 
8  8   ILE n 
8  9   LYS n 
8  10  ASN n 
8  11  TYR n 
8  12  GLN n 
8  13  THR n 
8  14  ALA n 
8  15  PRO n 
8  16  PHE n 
8  17  ASP n 
8  18  SER n 
8  19  ARG n 
8  20  PHE n 
8  21  PRO n 
8  22  ASN n 
8  23  GLN n 
8  24  ASN n 
8  25  GLN n 
8  26  THR n 
8  27  ARG n 
8  28  ASN n 
8  29  CYS n 
8  30  TRP n 
8  31  GLN n 
8  32  ASN n 
8  33  TYR n 
8  34  LEU n 
8  35  ASP n 
8  36  PHE n 
8  37  HIS n 
8  38  ARG n 
8  39  CYS n 
8  40  GLU n 
8  41  LYS n 
8  42  ALA n 
8  43  MET n 
8  44  THR n 
8  45  ALA n 
8  46  LYS n 
8  47  GLY n 
8  48  GLY n 
8  49  ASP n 
8  50  VAL n 
8  51  SER n 
8  52  VAL n 
8  53  CYS n 
8  54  GLU n 
8  55  TRP n 
8  56  TYR n 
8  57  ARG n 
8  58  ARG n 
8  59  VAL n 
8  60  TYR n 
8  61  LYS n 
8  62  SER n 
8  63  LEU n 
8  64  CYS n 
8  65  PRO n 
8  66  ILE n 
8  67  SER n 
8  68  TRP n 
8  69  VAL n 
8  70  SER n 
8  71  THR n 
8  72  TRP n 
8  73  ASP n 
8  74  ASP n 
8  75  ARG n 
8  76  ARG n 
8  77  ALA n 
8  78  GLU n 
8  79  GLY n 
8  80  THR n 
8  81  PHE n 
8  82  PRO n 
8  83  GLY n 
8  84  LYS n 
8  85  ILE n 
9  1   SAC n 
9  2   THR n 
9  3   ALA n 
9  4   LEU n 
9  5   ALA n 
9  6   LYS n 
9  7   PRO n 
9  8   GLN n 
9  9   MET n 
9  10  ARG n 
9  11  GLY n 
9  12  LEU n 
9  13  LEU n 
9  14  ALA n 
9  15  ARG n 
9  16  ARG n 
9  17  LEU n 
9  18  ARG n 
9  19  PHE n 
9  20  HIS n 
9  21  ILE n 
9  22  VAL n 
9  23  GLY n 
9  24  ALA n 
9  25  PHE n 
9  26  MET n 
9  27  VAL n 
9  28  SER n 
9  29  LEU n 
9  30  GLY n 
9  31  PHE n 
9  32  ALA n 
9  33  THR n 
9  34  PHE n 
9  35  TYR n 
9  36  LYS n 
9  37  PHE n 
9  38  ALA n 
9  39  VAL n 
9  40  ALA n 
9  41  GLU n 
9  42  LYS n 
9  43  ARG n 
9  44  LYS n 
9  45  LYS n 
9  46  ALA n 
9  47  TYR n 
9  48  ALA n 
9  49  ASP n 
9  50  PHE n 
9  51  TYR n 
9  52  ARG n 
9  53  ASN n 
9  54  TYR n 
9  55  ASP n 
9  56  SER n 
9  57  MET n 
9  58  LYS n 
9  59  ASP n 
9  60  PHE n 
9  61  GLU n 
9  62  GLU n 
9  63  MET n 
9  64  ARG n 
9  65  LYS n 
9  66  ALA n 
9  67  GLY n 
9  68  ILE n 
9  69  PHE n 
9  70  GLN n 
9  71  SER n 
9  72  ALA n 
9  73  LYS n 
10 1   PHE n 
10 2   GLU n 
10 3   ASN n 
10 4   ARG n 
10 5   VAL n 
10 6   ALA n 
10 7   GLU n 
10 8   LYS n 
10 9   GLN n 
10 10  LYS n 
10 11  LEU n 
10 12  PHE n 
10 13  GLN n 
10 14  GLU n 
10 15  ASP n 
10 16  ASN n 
10 17  GLY n 
10 18  LEU n 
10 19  PRO n 
10 20  VAL n 
10 21  HIS n 
10 22  LEU n 
10 23  LYS n 
10 24  GLY n 
10 25  GLY n 
10 26  ALA n 
10 27  THR n 
10 28  ASP n 
10 29  ASN n 
10 30  ILE n 
10 31  LEU n 
10 32  TYR n 
10 33  ARG n 
10 34  VAL n 
10 35  THR n 
10 36  MET n 
10 37  THR n 
10 38  LEU n 
10 39  CYS n 
10 40  LEU n 
10 41  GLY n 
10 42  GLY n 
10 43  THR n 
10 44  LEU n 
10 45  TYR n 
10 46  SER n 
10 47  LEU n 
10 48  TYR n 
10 49  CYS n 
10 50  LEU n 
10 51  GLY n 
10 52  TRP n 
10 53  ALA n 
10 54  SER n 
10 55  PHE n 
10 56  PRO n 
10 57  HIS n 
10 58  LYS n 
10 59  LYS n 
11 1   ILE n 
11 2   HIS n 
11 3   GLN n 
11 4   LYS n 
11 5   ARG n 
11 6   ALA n 
11 7   PRO n 
11 8   ASP n 
11 9   PHE n 
11 10  HIS n 
11 11  ASP n 
11 12  LYS n 
11 13  TYR n 
11 14  GLY n 
11 15  ASN n 
11 16  ALA n 
11 17  VAL n 
11 18  LEU n 
11 19  ALA n 
11 20  SER n 
11 21  GLY n 
11 22  ALA n 
11 23  THR n 
11 24  PHE n 
11 25  CYS n 
11 26  VAL n 
11 27  ALA n 
11 28  VAL n 
11 29  TRP n 
11 30  VAL n 
11 31  TYR n 
11 32  MET n 
11 33  ALA n 
11 34  THR n 
11 35  GLN n 
11 36  ILE n 
11 37  GLY n 
11 38  ILE n 
11 39  GLU n 
11 40  TRP n 
11 41  ASN n 
11 42  PRO n 
11 43  SER n 
11 44  PRO n 
11 45  VAL n 
11 46  GLY n 
11 47  ARG n 
11 48  VAL n 
11 49  THR n 
11 50  PRO n 
11 51  LYS n 
11 52  GLU n 
11 53  TRP n 
11 54  ARG n 
11 55  GLU n 
11 56  GLN n 
12 1   SER n 
12 2   HIS n 
12 3   TYR n 
12 4   GLU n 
12 5   GLU n 
12 6   GLY n 
12 7   PRO n 
12 8   GLY n 
12 9   LYS n 
12 10  ASN n 
12 11  ILE n 
12 12  PRO n 
12 13  PHE n 
12 14  SER n 
12 15  VAL n 
12 16  GLU n 
12 17  ASN n 
12 18  LYS n 
12 19  TRP n 
12 20  ARG n 
12 21  LEU n 
12 22  LEU n 
12 23  ALA n 
12 24  MET n 
12 25  MET n 
12 26  THR n 
12 27  LEU n 
12 28  PHE n 
12 29  PHE n 
12 30  GLY n 
12 31  SER n 
12 32  GLY n 
12 33  PHE n 
12 34  ALA n 
12 35  ALA n 
12 36  PRO n 
12 37  PHE n 
12 38  PHE n 
12 39  ILE n 
12 40  VAL n 
12 41  ARG n 
12 42  HIS n 
12 43  GLN n 
12 44  LEU n 
12 45  LEU n 
12 46  LYS n 
12 47  LYS n 
13 1   ILE n 
13 2   THR n 
13 3   ALA n 
13 4   LYS n 
13 5   PRO n 
13 6   ALA n 
13 7   LYS n 
13 8   THR n 
13 9   PRO n 
13 10  THR n 
13 11  SER n 
13 12  PRO n 
13 13  LYS n 
13 14  GLU n 
13 15  GLN n 
13 16  ALA n 
13 17  ILE n 
13 18  GLY n 
13 19  LEU n 
13 20  SER n 
13 21  VAL n 
13 22  THR n 
13 23  PHE n 
13 24  LEU n 
13 25  SER n 
13 26  PHE n 
13 27  LEU n 
13 28  LEU n 
13 29  PRO n 
13 30  ALA n 
13 31  GLY n 
13 32  TRP n 
13 33  VAL n 
13 34  LEU n 
13 35  TYR n 
13 36  HIS n 
13 37  LEU n 
13 38  ASP n 
13 39  ASN n 
13 40  TYR n 
13 41  LYS n 
13 42  LYS n 
13 43  SER n 
13 44  SER n 
13 45  ALA n 
13 46  ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 514 Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 227 Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 261 Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 147 Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 109 Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 98  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 85  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 85  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 73  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 59  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 56  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 47  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 46  Bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP COX1_BOVIN  P00396 ? 1  
;MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGN
WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG
AINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV
FSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF
SGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
;
1  
2  UNP COX2_BOVIN  P68530 ? 2  
;MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPS
LRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVL
HSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
;
1  
3  UNP COX3_BOVIN  P00415 ? 3  
;MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLR
YGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHML
QALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
;
1  
4  UNP COX41_BOVIN P00423 ? 4  
;AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKT
VVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
;
23 
5  UNP COX5A_BOVIN P00426 ? 5  
;SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKE
IYPYVIQELRPTLNELGISTPEELGLDKV
;
44 
6  UNP COX5B_BOVIN P00428 ? 6  
;ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQ
RCPSCGTHYKLVPHQLAH
;
32 
7  UNP CX6A2_BOVIN P07471 ? 7  
;ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPT
GYEKP
;
13 
8  UNP CX6B1_BOVIN P00429 ? 8  
;AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGT
FPGKI
;
2  
9  UNP COX6C_BOVIN P04038 ? 9  STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK 2  
10 UNP CX7A1_BOVIN P07470 ? 10 FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK 22 
11 UNP COX7B_BOVIN P13183 ? 11 IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ 25 
12 UNP COX7C_BOVIN P00430 ? 12 SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK 17 
13 UNP COX8B_BOVIN P10175 ? 13 ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA 25 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3AG2 A 1 ? 514 ? P00396 1  ? 514 ? 1 514 
2  2  3AG2 B 1 ? 227 ? P68530 1  ? 227 ? 1 227 
3  3  3AG2 C 1 ? 261 ? P00415 1  ? 261 ? 1 261 
4  4  3AG2 D 1 ? 147 ? P00423 23 ? 169 ? 1 147 
5  5  3AG2 E 1 ? 109 ? P00426 44 ? 152 ? 1 109 
6  6  3AG2 F 1 ? 98  ? P00428 32 ? 129 ? 1 98  
7  7  3AG2 G 1 ? 85  ? P07471 13 ? 97  ? 1 85  
8  8  3AG2 H 1 ? 85  ? P00429 2  ? 86  ? 1 85  
9  9  3AG2 I 1 ? 73  ? P04038 2  ? 74  ? 1 73  
10 10 3AG2 J 1 ? 59  ? P07470 22 ? 80  ? 1 59  
11 11 3AG2 K 1 ? 56  ? P13183 25 ? 80  ? 1 56  
12 12 3AG2 L 1 ? 47  ? P00430 17 ? 63  ? 1 47  
13 13 3AG2 M 1 ? 46  ? P10175 25 ? 70  ? 1 46  
14 1  3AG2 N 1 ? 514 ? P00396 1  ? 514 ? 1 514 
15 2  3AG2 O 1 ? 227 ? P68530 1  ? 227 ? 1 227 
16 3  3AG2 P 1 ? 261 ? P00415 1  ? 261 ? 1 261 
17 4  3AG2 Q 1 ? 147 ? P00423 23 ? 169 ? 1 147 
18 5  3AG2 R 1 ? 109 ? P00426 44 ? 152 ? 1 109 
19 6  3AG2 S 1 ? 98  ? P00428 32 ? 129 ? 1 98  
20 7  3AG2 T 1 ? 85  ? P07471 13 ? 97  ? 1 85  
21 8  3AG2 U 1 ? 85  ? P00429 2  ? 86  ? 1 85  
22 9  3AG2 V 1 ? 73  ? P04038 2  ? 74  ? 1 73  
23 10 3AG2 W 1 ? 59  ? P07470 22 ? 80  ? 1 59  
24 11 3AG2 X 1 ? 56  ? P13183 25 ? 80  ? 1 56  
25 12 3AG2 Y 1 ? 47  ? P00430 17 ? 63  ? 1 47  
26 13 3AG2 Z 1 ? 46  ? P10175 25 ? 70  ? 1 46  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                                                                                       
'C3 H7 N O2'         89.093   
ARG 'L-peptide linking' y ARGININE ?                                                                                       
'C6 H15 N4 O2 1'     175.209  
ASN 'L-peptide linking' y ASPARAGINE ?                                                                                       
'C4 H8 N2 O3'        132.118  
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                                                                       
'C4 H7 N O4'         133.103  
CDL non-polymer         . CARDIOLIPIN 
;DIPHOSPHATIDYL GLYCEROL; BIS-(1,2-DIACYL-SN-GLYCERO-3-PHOSPHO)-1',3'-SN-GLYCEROL
;
'C81 H156 O17 P2 -2' 1464.043 
CHD non-polymer         . 'CHOLIC ACID' ?                                                                                       
'C24 H40 O5'         408.571  
CMO non-polymer         . 'CARBON MONOXIDE' ? 'C O'                28.010   
CU  non-polymer         . 'COPPER (II) ION' ? 'Cu 2'               63.546   
CUA non-polymer         . 'DINUCLEAR COPPER ION' ? Cu2                  127.092  
CYS 'L-peptide linking' y CYSTEINE ?                                                                                       
'C3 H7 N O2 S'       121.158  
DMU D-saccharide        . DECYL-BETA-D-MALTOPYRANOSIDE DECYLMALTOSIDE 'C22 H42 O11'        482.562  
EDO non-polymer         . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL'                                                                       
'C2 H6 O2'           62.068   
FME 'L-peptide linking' n N-FORMYLMETHIONINE ? 'C6 H11 N O3 S'      177.221  
GLN 'L-peptide linking' y GLUTAMINE ?                                                                                       
'C5 H10 N2 O3'       146.144  
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                                                                       
'C5 H9 N O4'         147.129  
GLY 'peptide linking'   y GLYCINE ?                                                                                       
'C2 H5 N O2'         75.067   
HEA non-polymer         . HEME-A ?                                                                                       
'C49 H56 Fe N4 O6'   852.837  
HIS 'L-peptide linking' y HISTIDINE ?                                                                                       
'C6 H10 N3 O2 1'     156.162  
HOH non-polymer         . WATER ?                                                                                       'H2 O' 
18.015   
ILE 'L-peptide linking' y ISOLEUCINE ?                                                                                       
'C6 H13 N O2'        131.173  
LEU 'L-peptide linking' y LEUCINE ?                                                                                       
'C6 H13 N O2'        131.173  
LYS 'L-peptide linking' y LYSINE ?                                                                                       
'C6 H15 N2 O2 1'     147.195  
MET 'L-peptide linking' y METHIONINE ?                                                                                       
'C5 H11 N O2 S'      149.211  
MG  non-polymer         . 'MAGNESIUM ION' ?                                                                                       
'Mg 2'               24.305   
NA  non-polymer         . 'SODIUM ION' ?                                                                                       
'Na 1'               22.990   
PEK non-polymer         . 
'(1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE' 
'PHOSPHATIDYLETHANOLAMINE; 2-ARACHIDONOYL-1-STEAROYL-SN-GLYCEROL-3-PHOSPHOETHANOLAMINE' 'C43 H78 N O8 P'     768.055  
PGV non-polymer         . 
'(1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE' 
'PHOSPHATIDYLGLYCEROL; 2-VACCENOYL-1-PALMITOYL-SN-GLYCEROL-3-PHOSPHOGLYCEROL'           'C40 H77 O10 P'      749.007  
PHE 'L-peptide linking' y PHENYLALANINE ?                                                                                       
'C9 H11 N O2'        165.189  
PRO 'L-peptide linking' y PROLINE ?                                                                                       
'C5 H9 N O2'         115.130  
PSC non-polymer         . 
'(7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE' 
'PHOSPHATIDYLCHOLINE; 2-LINOLEOYL-1-PALMITOYL-SN-GYCEROL-3-PHOSPHOCHOLINE'              'C42 H81 N O8 P 1'   759.068  
SAC 'L-peptide linking' n N-ACETYL-SERINE ?                                                                                       
'C5 H9 N O4'         147.129  
SER 'L-peptide linking' y SERINE ?                                                                                       
'C3 H7 N O3'         105.093  
TGL non-polymer         . TRISTEAROYLGLYCEROL TRIACYLGLYCEROL 'C57 H110 O6'        891.480  
THR 'L-peptide linking' y THREONINE ?                                                                                       
'C4 H9 N O3'         119.119  
TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE                                                                      
'C4 H10 N O6 P'      199.099  
TRP 'L-peptide linking' y TRYPTOPHAN ?                                                                                       
'C11 H12 N2 O2'      204.225  
TYR 'L-peptide linking' y TYROSINE ?                                                                                       
'C9 H11 N O3'        181.189  
VAL 'L-peptide linking' y VALINE ?                                                                                       
'C5 H11 N O2'        117.146  
ZN  non-polymer         . 'ZINC ION' ?                                                                                       
'Zn 2'               65.409   
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   3AG2 
_exptl.crystals_number            3 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.11 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         70.05 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'BATCH MODE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'0.2 % decal maltose in 40 mM sodium phosphate buffer, 9.0 % (w/v) protein concentration, PEG 4000 as the precipitant.' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'Bruker DIP-6040' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2007-09-22 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44XU' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL44XU 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
# 
_reflns.B_iso_Wilson_estimate                          ? 
_reflns.entry_id                                       3AG2 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              1.80 
_reflns.d_resolution_low                               80.3 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     614641 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     -3.0 
_reflns.percent_possible_obs                           99.9 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                11.5 
_reflns.pdbx_Rmerge_I_obs                              ? 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          15.70 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                ? 
_reflns.pdbx_Rpim_I_all                                ? 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   ? 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    1.80 
_reflns_shell.d_res_low                                     1.86 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           0.58 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             60763 
_reflns_shell.percent_possible_all                          99.4 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               9.5 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               ? 
_reflns_shell.pdbx_Rpim_I_all                               ? 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  ? 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 3AG2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.802 
_refine.ls_d_res_low                             39.440 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     612646 
_refine.ls_number_reflns_R_free                  30367 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.54 
_refine.ls_percent_reflns_R_free                 4.96 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1773 
_refine.ls_R_factor_R_free                       0.2084 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1757 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.32 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2EIJ 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.00 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.26 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.802 
_refine_hist.d_res_low                        39.440 
_refine_hist.number_atoms_solvent             1765 
_refine_hist.number_atoms_total               32896 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        28462 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2669 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.018  ? 32214 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.675  ? 43332 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 17.830 ? 18795 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.095  ? 4626  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.010  ? 5099  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.8023 1.8227 . . . 17812 92.00  . . . . . 0.4212 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8227 1.8442 . . . 19071 99.00  . . . . . 0.3952 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8442 1.8667 . . . 19264 99.00  . . . . . 0.3719 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8667 1.8903 . . . 19246 99.00  . . . . . 0.3554 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8903 1.9152 . . . 19266 100.00 . . . . . 0.3284 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9152 1.9414 . . . 19282 100.00 . . . . . 0.3135 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9414 1.9691 . . . 19316 100.00 . . . . . 0.3035 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9691 1.9985 . . . 19382 100.00 . . . . . 0.2873 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9985 2.0298 . . . 19498 100.00 . . . . . 0.2657 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0298 2.0630 . . . 19319 100.00 . . . . . 0.2423 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0630 2.0986 . . . 19381 100.00 . . . . . 0.2269 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0986 2.1368 . . . 19440 100.00 . . . . . 0.2104 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1368 2.1779 . . . 19445 100.00 . . . . . 0.2021 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1779 2.2223 . . . 19394 100.00 . . . . . 0.1931 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2223 2.2706 . . . 19410 100.00 . . . . . 0.1823 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2706 2.3234 . . . 19498 100.00 . . . . . 0.1717 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3234 2.3815 . . . 19429 100.00 . . . . . 0.1655 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3815 2.4459 . . . 19440 100.00 . . . . . 0.1620 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4459 2.5179 . . . 19483 100.00 . . . . . 0.1585 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5179 2.5991 . . . 19460 100.00 . . . . . 0.1536 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5991 2.6920 . . . 19460 100.00 . . . . . 0.1484 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6920 2.7998 . . . 19485 100.00 . . . . . 0.1478 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7998 2.9272 . . . 19538 100.00 . . . . . 0.1518 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9272 3.0814 . . . 19539 100.00 . . . . . 0.1530 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0814 3.2744 . . . 19573 100.00 . . . . . 0.1601 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2744 3.5271 . . . 19621 100.00 . . . . . 0.1555 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5271 3.8817 . . . 19636 100.00 . . . . . 0.1536 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8817 4.4428 . . . 19699 100.00 . . . . . 0.1398 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4428 5.5949 . . . 19800 100.00 . . . . . 0.1381 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5949 39.440 . . . 20092 99.00  . . . . . 0.1675 . . . . . . . . . . . 
# 
_struct.entry_id                     3AG2 
_struct.title                        'Bovine Heart Cytochrome c Oxidase in the Carbon Monoxide-bound Fully Reduced State at 100 K' 
_struct.pdbx_descriptor              
;Cytochrome c oxidase subunit 1 (E.C.1.9.3.1), Cytochrome c oxidase subunit 2 (E.C.1.9.3.1), Cytochrome c oxidase subunit 3 (E.C.1.9.3.1), Cytochrome c oxidase subunit 4 isoform 1 (E.C.1.9.3.1), Cytochrome c oxidase subunit 5A (E.C.1.9.3.1), Cytochrome c oxidase subunit 5B (E.C.1.9.3.1), Cytochrome c oxidase subunit 6A2 (E.C.1.9.3.1), Cytochrome c oxidase subunit 6B1 (E.C.1.9.3.1), Cytochrome c oxidase subunit 6C (E.C.1.9.3.1), Cytochrome c oxidase polypeptide 7A1 (E.C.1.9.3.1), Cytochrome c oxidase subunit 7B (E.C.1.9.3.1), Cytochrome c oxidase subunit 7C (E.C.1.9.3.1), Cytochrome c oxidase subunit 8B (E.C.1.9.3.1)
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        3AG2 
_struct_keywords.text            
;OXIDOREDUCTASE, Copper, Electron transport, Formylation, Heme, Iron, Membrane, Mitochondrion, Mitochondrion inner membrane, Respiratory chain, Transmembrane, Transport, Acetylation, Transit peptide, Zinc, Isopeptide bond, Ubl conjugation
;
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 1  ? 
O  N N 2  ? 
P  N N 3  ? 
Q  N N 4  ? 
R  N N 5  ? 
S  N N 6  ? 
T  N N 7  ? 
U  N N 8  ? 
V  N N 9  ? 
W  N N 10 ? 
X  N N 11 ? 
Y  N N 12 ? 
Z  N N 13 ? 
AA N N 14 ? 
BA N N 14 ? 
CA N N 15 ? 
DA N N 16 ? 
EA N N 17 ? 
FA N N 18 ? 
GA N N 19 ? 
HA N N 19 ? 
IA N N 20 ? 
JA N N 21 ? 
KA N N 21 ? 
LA N N 21 ? 
MA N N 21 ? 
NA N N 21 ? 
OA N N 21 ? 
PA N N 21 ? 
QA N N 21 ? 
RA N N 21 ? 
SA N N 21 ? 
TA N N 21 ? 
UA N N 21 ? 
VA N N 21 ? 
WA N N 22 ? 
XA N N 20 ? 
YA N N 23 ? 
ZA N N 24 ? 
AB N N 21 ? 
BB N N 21 ? 
CB N N 24 ? 
DB N N 17 ? 
EB N N 25 ? 
FB N N 19 ? 
GB N N 19 ? 
HB N N 26 ? 
IB N N 24 ? 
JB N N 25 ? 
KB N N 21 ? 
LB N N 21 ? 
MB N N 21 ? 
NB N N 21 ? 
OB N N 27 ? 
PB N N 27 ? 
QB N N 24 ? 
RB N N 20 ? 
SB N N 21 ? 
TB N N 21 ? 
UB N N 21 ? 
VB N N 21 ? 
WB N N 21 ? 
XB N N 21 ? 
YB N N 21 ? 
ZB N N 21 ? 
AC N N 28 ? 
BC N N 21 ? 
CC N N 21 ? 
DC N N 21 ? 
EC N N 21 ? 
FC N N 21 ? 
GC N N 27 ? 
HC N N 25 ? 
IC N N 26 ? 
JC N N 21 ? 
KC N N 21 ? 
LC N N 21 ? 
MC N N 21 ? 
NC N N 21 ? 
OC N N 24 ? 
PC N N 21 ? 
QC N N 21 ? 
RC N N 27 ? 
SC N N 27 ? 
TC N N 27 ? 
UC N N 14 ? 
VC N N 14 ? 
WC N N 15 ? 
XC N N 16 ? 
YC N N 17 ? 
ZC N N 18 ? 
AD N N 20 ? 
BD N N 19 ? 
CD N N 21 ? 
DD N N 21 ? 
ED N N 21 ? 
FD N N 21 ? 
GD N N 21 ? 
HD N N 21 ? 
ID N N 24 ? 
JD N N 22 ? 
KD N N 20 ? 
LD N N 23 ? 
MD N N 21 ? 
ND N N 21 ? 
OD N N 21 ? 
PD N N 25 ? 
QD N N 19 ? 
RD N N 17 ? 
SD N N 24 ? 
TD N N 25 ? 
UD N N 25 ? 
VD N N 19 ? 
WD N N 26 ? 
XD N N 24 ? 
YD N N 21 ? 
ZD N N 21 ? 
AE N N 21 ? 
BE N N 27 ? 
CE N N 27 ? 
DE N N 24 ? 
EE N N 21 ? 
FE N N 21 ? 
GE N N 21 ? 
HE N N 21 ? 
IE N N 28 ? 
JE N N 21 ? 
KE N N 21 ? 
LE N N 21 ? 
ME N N 21 ? 
NE N N 21 ? 
OE N N 21 ? 
PE N N 27 ? 
QE N N 26 ? 
RE N N 21 ? 
SE N N 21 ? 
TE N N 21 ? 
UE N N 21 ? 
VE N N 21 ? 
WE N N 20 ? 
XE N N 24 ? 
YE N N 19 ? 
ZE N N 27 ? 
AF N N 27 ? 
BF N N 29 ? 
CF N N 29 ? 
DF N N 29 ? 
EF N N 29 ? 
FF N N 29 ? 
GF N N 29 ? 
HF N N 29 ? 
IF N N 29 ? 
JF N N 29 ? 
KF N N 29 ? 
LF N N 29 ? 
MF N N 29 ? 
NF N N 29 ? 
OF N N 29 ? 
PF N N 29 ? 
QF N N 29 ? 
RF N N 29 ? 
SF N N 29 ? 
TF N N 29 ? 
UF N N 29 ? 
VF N N 29 ? 
WF N N 29 ? 
XF N N 29 ? 
YF N N 29 ? 
ZF N N 29 ? 
AG N N 29 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 FME A 1   ? LEU A 7   ? FME A 1   LEU A 7   1 ? 7  
HELX_P HELX_P2   AA2 ASN A 11  ? LEU A 41  ? ASN A 11  LEU A 41  1 ? 31 
HELX_P HELX_P3   AA3 ASP A 50  ? PHE A 68  ? ASP A 50  PHE A 68  1 ? 19 
HELX_P HELX_P4   AA4 MET A 69  ? ILE A 75  ? MET A 69  ILE A 75  1 ? 7  
HELX_P HELX_P5   AA5 GLY A 77  ? ILE A 87  ? GLY A 77  ILE A 87  1 ? 11 
HELX_P HELX_P6   AA6 PHE A 94  ? LEU A 104 ? PHE A 94  LEU A 104 1 ? 11 
HELX_P HELX_P7   AA7 LEU A 104 ? VAL A 118 ? LEU A 104 VAL A 118 1 ? 15 
HELX_P HELX_P8   AA8 GLY A 140 ? MET A 171 ? GLY A 140 MET A 171 1 ? 32 
HELX_P HELX_P9   AA9 SER A 177 ? THR A 181 ? SER A 177 THR A 181 5 ? 5  
HELX_P HELX_P10  AB1 PRO A 182 ? LEU A 215 ? PRO A 182 LEU A 215 1 ? 34 
HELX_P HELX_P11  AB2 ASP A 221 ? GLY A 225 ? ASP A 221 GLY A 225 5 ? 5  
HELX_P HELX_P12  AB3 ASP A 227 ? SER A 262 ? ASP A 227 SER A 262 1 ? 36 
HELX_P HELX_P13  AB4 GLY A 269 ? GLY A 284 ? GLY A 269 GLY A 284 1 ? 16 
HELX_P HELX_P14  AB5 PHE A 285 ? ILE A 286 ? PHE A 285 ILE A 286 5 ? 2  
HELX_P HELX_P15  AB6 VAL A 287 ? MET A 292 ? VAL A 287 MET A 292 5 ? 6  
HELX_P HELX_P16  AB7 ASP A 298 ? ILE A 312 ? ASP A 298 ILE A 312 1 ? 15 
HELX_P HELX_P17  AB8 ILE A 312 ? HIS A 328 ? ILE A 312 HIS A 328 1 ? 17 
HELX_P HELX_P18  AB9 SER A 335 ? ASN A 360 ? SER A 335 ASN A 360 1 ? 26 
HELX_P HELX_P19  AC1 ASN A 360 ? HIS A 368 ? ASN A 360 HIS A 368 1 ? 9  
HELX_P HELX_P20  AC2 THR A 370 ? MET A 383 ? THR A 370 MET A 383 1 ? 14 
HELX_P HELX_P21  AC3 GLY A 384 ? GLY A 402 ? GLY A 384 GLY A 402 1 ? 19 
HELX_P HELX_P22  AC4 ASN A 406 ? SER A 434 ? ASN A 406 SER A 434 1 ? 29 
HELX_P HELX_P23  AC5 PRO A 444 ? ALA A 446 ? PRO A 444 ALA A 446 5 ? 3  
HELX_P HELX_P24  AC6 TYR A 447 ? LYS A 479 ? TYR A 447 LYS A 479 1 ? 33 
HELX_P HELX_P25  AC7 LEU A 487 ? LEU A 495 ? LEU A 487 LEU A 495 5 ? 9  
HELX_P HELX_P26  AC8 SER B 14  ? LEU B 46  ? SER B 14  LEU B 46  1 ? 33 
HELX_P HELX_P27  AC9 ALA B 58  ? GLU B 89  ? ALA B 58  GLU B 89  1 ? 32 
HELX_P HELX_P28  AD1 PRO B 124 ? LEU B 128 ? PRO B 124 LEU B 128 5 ? 5  
HELX_P HELX_P29  AD2 PRO B 166 ? GLY B 169 ? PRO B 166 GLY B 169 5 ? 4  
HELX_P HELX_P30  AD3 ASN B 203 ? PHE B 206 ? ASN B 203 PHE B 206 5 ? 4  
HELX_P HELX_P31  AD4 PRO B 215 ? MET B 226 ? PRO B 215 MET B 226 1 ? 12 
HELX_P HELX_P32  AD5 PRO C 15  ? ASN C 38  ? PRO C 15  ASN C 38  1 ? 24 
HELX_P HELX_P33  AD6 MET C 40  ? THR C 66  ? MET C 40  THR C 66  1 ? 27 
HELX_P HELX_P34  AD7 THR C 72  ? LEU C 106 ? THR C 72  LEU C 106 1 ? 35 
HELX_P HELX_P35  AD8 THR C 109 ? GLY C 113 ? THR C 109 GLY C 113 5 ? 5  
HELX_P HELX_P36  AD9 GLU C 128 ? GLU C 153 ? GLU C 128 GLU C 153 1 ? 26 
HELX_P HELX_P37  AE1 ASP C 155 ? ALA C 184 ? ASP C 155 ALA C 184 1 ? 30 
HELX_P HELX_P38  AE2 ASP C 190 ? LYS C 224 ? ASP C 190 LYS C 224 1 ? 35 
HELX_P HELX_P39  AE3 HIS C 232 ? ILE C 256 ? HIS C 232 ILE C 256 1 ? 25 
HELX_P HELX_P40  AE4 LYS D 7   ? TYR D 11  ? LYS D 7   TYR D 11  5 ? 5  
HELX_P HELX_P41  AE5 SER D 34  ? LYS D 45  ? SER D 34  LYS D 45  1 ? 12 
HELX_P HELX_P42  AE6 ALA D 46  ? LEU D 51  ? ALA D 46  LEU D 51  5 ? 6  
HELX_P HELX_P43  AE7 SER D 52  ? PHE D 64  ? SER D 52  PHE D 64  1 ? 13 
HELX_P HELX_P44  AE8 SER D 67  ? ASN D 72  ? SER D 67  ASN D 72  1 ? 6  
HELX_P HELX_P45  AE9 ASN D 76  ? VAL D 103 ? ASN D 76  VAL D 103 1 ? 28 
HELX_P HELX_P46  AF1 PRO D 108 ? PHE D 111 ? PRO D 108 PHE D 111 5 ? 4  
HELX_P HELX_P47  AF2 GLU D 112 ? MET D 126 ? GLU D 112 MET D 126 1 ? 15 
HELX_P HELX_P48  AF3 PHE D 134 ? ALA D 136 ? PHE D 134 ALA D 136 5 ? 3  
HELX_P HELX_P49  AF4 THR E 7   ? LYS E 21  ? THR E 7   LYS E 21  1 ? 15 
HELX_P HELX_P50  AF5 ASP E 25  ? VAL E 37  ? ASP E 25  VAL E 37  1 ? 13 
HELX_P HELX_P51  AF6 GLU E 44  ? LEU E 58  ? GLU E 44  LEU E 58  1 ? 15 
HELX_P HELX_P52  AF7 ASP E 60  ? ALA E 75  ? ASP E 60  ALA E 75  1 ? 16 
HELX_P HELX_P53  AF8 GLU E 80  ? GLY E 97  ? GLU E 80  GLY E 97  1 ? 18 
HELX_P HELX_P54  AF9 THR F 8   ? ALA F 13  ? THR F 8   ALA F 13  1 ? 6  
HELX_P HELX_P55  AG1 THR F 14  ? LYS F 26  ? THR F 14  LYS F 26  1 ? 13 
HELX_P HELX_P56  AG2 GLY G 12  ? LEU G 23  ? GLY G 12  LEU G 23  1 ? 12 
HELX_P HELX_P57  AG3 LEU G 23  ? TRP G 36  ? LEU G 23  TRP G 36  1 ? 14 
HELX_P HELX_P58  AG4 GLN H 25  ? LYS H 46  ? GLN H 25  LYS H 46  1 ? 22 
HELX_P HELX_P59  AG5 ASP H 49  ? VAL H 52  ? ASP H 49  VAL H 52  5 ? 4  
HELX_P HELX_P60  AG6 CYS H 53  ? CYS H 64  ? CYS H 53  CYS H 64  1 ? 12 
HELX_P HELX_P61  AG7 PRO H 65  ? GLY H 79  ? PRO H 65  GLY H 79  1 ? 15 
HELX_P HELX_P62  AG8 GLY I 11  ? VAL I 39  ? GLY I 11  VAL I 39  1 ? 29 
HELX_P HELX_P63  AG9 VAL I 39  ? ASN I 53  ? VAL I 39  ASN I 53  1 ? 15 
HELX_P HELX_P64  AH1 ASP I 55  ? ALA I 66  ? ASP I 55  ALA I 66  1 ? 12 
HELX_P HELX_P65  AH2 ARG J 4   ? GLU J 14  ? ARG J 4   GLU J 14  1 ? 11 
HELX_P HELX_P66  AH3 PRO J 19  ? LYS J 23  ? PRO J 19  LYS J 23  5 ? 5  
HELX_P HELX_P67  AH4 GLY J 25  ? SER J 54  ? GLY J 25  SER J 54  1 ? 30 
HELX_P HELX_P68  AH5 ASP K 8   ? ILE K 36  ? ASP K 8   ILE K 36  1 ? 29 
HELX_P HELX_P69  AH6 ASN L 17  ? LYS L 47  ? ASN L 17  LYS L 47  1 ? 31 
HELX_P HELX_P70  AH7 SER M 11  ? HIS M 36  ? SER M 11  HIS M 36  1 ? 26 
HELX_P HELX_P71  AH8 HIS M 36  ? LYS M 41  ? HIS M 36  LYS M 41  1 ? 6  
HELX_P HELX_P72  AH9 PHE N 2   ? LEU N 7   ? PHE N 2   LEU N 7   1 ? 6  
HELX_P HELX_P73  AI1 ASN N 11  ? GLY N 42  ? ASN N 11  GLY N 42  1 ? 32 
HELX_P HELX_P74  AI2 ASP N 50  ? PHE N 68  ? ASP N 50  PHE N 68  1 ? 19 
HELX_P HELX_P75  AI3 MET N 69  ? ILE N 75  ? MET N 69  ILE N 75  1 ? 7  
HELX_P HELX_P76  AI4 GLY N 77  ? ILE N 87  ? GLY N 77  ILE N 87  1 ? 11 
HELX_P HELX_P77  AI5 PHE N 94  ? LEU N 104 ? PHE N 94  LEU N 104 1 ? 11 
HELX_P HELX_P78  AI6 LEU N 104 ? VAL N 118 ? LEU N 104 VAL N 118 1 ? 15 
HELX_P HELX_P79  AI7 GLY N 140 ? MET N 171 ? GLY N 140 MET N 171 1 ? 32 
HELX_P HELX_P80  AI8 SER N 177 ? THR N 181 ? SER N 177 THR N 181 5 ? 5  
HELX_P HELX_P81  AI9 PRO N 182 ? LEU N 215 ? PRO N 182 LEU N 215 1 ? 34 
HELX_P HELX_P82  AJ1 ASP N 221 ? GLY N 225 ? ASP N 221 GLY N 225 5 ? 5  
HELX_P HELX_P83  AJ2 ASP N 227 ? SER N 262 ? ASP N 227 SER N 262 1 ? 36 
HELX_P HELX_P84  AJ3 GLY N 269 ? GLY N 284 ? GLY N 269 GLY N 284 1 ? 16 
HELX_P HELX_P85  AJ4 PHE N 285 ? ILE N 286 ? PHE N 285 ILE N 286 5 ? 2  
HELX_P HELX_P86  AJ5 VAL N 287 ? MET N 292 ? VAL N 287 MET N 292 5 ? 6  
HELX_P HELX_P87  AJ6 ASP N 298 ? ILE N 312 ? ASP N 298 ILE N 312 1 ? 15 
HELX_P HELX_P88  AJ7 ILE N 312 ? HIS N 328 ? ILE N 312 HIS N 328 1 ? 17 
HELX_P HELX_P89  AJ8 SER N 335 ? ASN N 360 ? SER N 335 ASN N 360 1 ? 26 
HELX_P HELX_P90  AJ9 ASN N 360 ? HIS N 368 ? ASN N 360 HIS N 368 1 ? 9  
HELX_P HELX_P91  AK1 THR N 370 ? MET N 383 ? THR N 370 MET N 383 1 ? 14 
HELX_P HELX_P92  AK2 GLY N 384 ? GLY N 402 ? GLY N 384 GLY N 402 1 ? 19 
HELX_P HELX_P93  AK3 ASN N 406 ? SER N 434 ? ASN N 406 SER N 434 1 ? 29 
HELX_P HELX_P94  AK4 PRO N 444 ? ALA N 446 ? PRO N 444 ALA N 446 5 ? 3  
HELX_P HELX_P95  AK5 TYR N 447 ? LYS N 479 ? TYR N 447 LYS N 479 1 ? 33 
HELX_P HELX_P96  AK6 LEU N 487 ? LEU N 495 ? LEU N 487 LEU N 495 5 ? 9  
HELX_P HELX_P97  AK7 SER O 14  ? THR O 47  ? SER O 14  THR O 47  1 ? 34 
HELX_P HELX_P98  AK8 ALA O 58  ? GLU O 89  ? ALA O 58  GLU O 89  1 ? 32 
HELX_P HELX_P99  AK9 PRO O 124 ? LEU O 128 ? PRO O 124 LEU O 128 5 ? 5  
HELX_P HELX_P100 AL1 PRO O 166 ? GLY O 169 ? PRO O 166 GLY O 169 5 ? 4  
HELX_P HELX_P101 AL2 ASN O 203 ? MET O 207 ? ASN O 203 MET O 207 5 ? 5  
HELX_P HELX_P102 AL3 PRO O 215 ? MET O 226 ? PRO O 215 MET O 226 1 ? 12 
HELX_P HELX_P103 AL4 PRO P 15  ? PHE P 37  ? PRO P 15  PHE P 37  1 ? 23 
HELX_P HELX_P104 AL5 MET P 40  ? THR P 66  ? MET P 40  THR P 66  1 ? 27 
HELX_P HELX_P105 AL6 THR P 72  ? ALA P 107 ? THR P 72  ALA P 107 1 ? 36 
HELX_P HELX_P106 AL7 THR P 109 ? GLY P 113 ? THR P 109 GLY P 113 5 ? 5  
HELX_P HELX_P107 AL8 GLU P 128 ? GLU P 153 ? GLU P 128 GLU P 153 1 ? 26 
HELX_P HELX_P108 AL9 ASP P 155 ? ALA P 184 ? ASP P 155 ALA P 184 1 ? 30 
HELX_P HELX_P109 AM1 ASP P 190 ? LYS P 224 ? ASP P 190 LYS P 224 1 ? 35 
HELX_P HELX_P110 AM2 HIS P 232 ? ILE P 256 ? HIS P 232 ILE P 256 1 ? 25 
HELX_P HELX_P111 AM3 SER Q 34  ? LYS Q 45  ? SER Q 34  LYS Q 45  1 ? 12 
HELX_P HELX_P112 AM4 ALA Q 46  ? LEU Q 51  ? ALA Q 46  LEU Q 51  5 ? 6  
HELX_P HELX_P113 AM5 SER Q 52  ? PHE Q 64  ? SER Q 52  PHE Q 64  1 ? 13 
HELX_P HELX_P114 AM6 SER Q 67  ? ASN Q 72  ? SER Q 67  ASN Q 72  1 ? 6  
HELX_P HELX_P115 AM7 ASN Q 76  ? VAL Q 103 ? ASN Q 76  VAL Q 103 1 ? 28 
HELX_P HELX_P116 AM8 PRO Q 108 ? PHE Q 111 ? PRO Q 108 PHE Q 111 5 ? 4  
HELX_P HELX_P117 AM9 GLU Q 112 ? MET Q 126 ? GLU Q 112 MET Q 126 1 ? 15 
HELX_P HELX_P118 AN1 PHE Q 134 ? ALA Q 136 ? PHE Q 134 ALA Q 136 5 ? 3  
HELX_P HELX_P119 AN2 THR R 7   ? LYS R 21  ? THR R 7   LYS R 21  1 ? 15 
HELX_P HELX_P120 AN3 ASP R 25  ? VAL R 37  ? ASP R 25  VAL R 37  1 ? 13 
HELX_P HELX_P121 AN4 GLU R 44  ? LEU R 58  ? GLU R 44  LEU R 58  1 ? 15 
HELX_P HELX_P122 AN5 ASP R 60  ? ALA R 75  ? ASP R 60  ALA R 75  1 ? 16 
HELX_P HELX_P123 AN6 GLU R 80  ? GLY R 97  ? GLU R 80  GLY R 97  1 ? 18 
HELX_P HELX_P124 AN7 THR S 8   ? ALA S 13  ? THR S 8   ALA S 13  1 ? 6  
HELX_P HELX_P125 AN8 THR S 14  ? LYS S 26  ? THR S 14  LYS S 26  1 ? 13 
HELX_P HELX_P126 AN9 GLY T 12  ? LEU T 23  ? GLY T 12  LEU T 23  1 ? 12 
HELX_P HELX_P127 AO1 LEU T 23  ? TRP T 36  ? LEU T 23  TRP T 36  1 ? 14 
HELX_P HELX_P128 AO2 GLN U 25  ? LYS U 46  ? GLN U 25  LYS U 46  1 ? 22 
HELX_P HELX_P129 AO3 ASP U 49  ? VAL U 52  ? ASP U 49  VAL U 52  5 ? 4  
HELX_P HELX_P130 AO4 CYS U 53  ? CYS U 64  ? CYS U 53  CYS U 64  1 ? 12 
HELX_P HELX_P131 AO5 PRO U 65  ? GLY U 79  ? PRO U 65  GLY U 79  1 ? 15 
HELX_P HELX_P132 AO6 GLY V 11  ? VAL V 39  ? GLY V 11  VAL V 39  1 ? 29 
HELX_P HELX_P133 AO7 VAL V 39  ? ASN V 53  ? VAL V 39  ASN V 53  1 ? 15 
HELX_P HELX_P134 AO8 ASP V 55  ? ALA V 66  ? ASP V 55  ALA V 66  1 ? 12 
HELX_P HELX_P135 AO9 ARG W 4   ? GLU W 14  ? ARG W 4   GLU W 14  1 ? 11 
HELX_P HELX_P136 AP1 GLY W 25  ? SER W 54  ? GLY W 25  SER W 54  1 ? 30 
HELX_P HELX_P137 AP2 ASP X 8   ? ILE X 36  ? ASP X 8   ILE X 36  1 ? 29 
HELX_P HELX_P138 AP3 ASN Y 17  ? LYS Y 47  ? ASN Y 17  LYS Y 47  1 ? 31 
HELX_P HELX_P139 AP4 SER Z 11  ? HIS Z 36  ? SER Z 11  HIS Z 36  1 ? 26 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? H  CYS 29  SG  ? ? ? 1_555 H  CYS 64  SG  ? ? H CYS 29  H CYS 64   1_555 ? ? ? ? ? ? ? 2.127 ? ? 
disulf2  disulf ?    ? H  CYS 39  SG  ? ? ? 1_555 H  CYS 53  SG  ? ? H CYS 39  H CYS 53   1_555 ? ? ? ? ? ? ? 2.080 ? ? 
disulf3  disulf ?    ? U  CYS 29  SG  ? ? ? 1_555 U  CYS 64  SG  ? ? U CYS 29  U CYS 64   1_555 ? ? ? ? ? ? ? 2.131 ? ? 
disulf4  disulf ?    ? U  CYS 39  SG  ? ? ? 1_555 U  CYS 53  SG  ? ? U CYS 39  U CYS 53   1_555 ? ? ? ? ? ? ? 2.073 ? ? 
covale1  covale both ? A  FME 1   C   ? ? ? 1_555 A  PHE 2   N   ? ? A FME 1   A PHE 2    1_555 ? ? ? ? ? ? ? 1.318 ? ? 
covale2  covale both ? B  FME 1   C   ? ? ? 1_555 B  ALA 2   N   ? ? B FME 1   B ALA 2    1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale3  covale both ? G  GLY 10  C   ? ? ? 1_555 G  TPO 11  N   ? ? G GLY 10  G TPO 11   1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale4  covale both ? G  TPO 11  C   ? ? ? 1_555 G  GLY 12  N   ? ? G TPO 11  G GLY 12   1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale5  covale both ? I  SAC 1   C   ? ? ? 1_555 I  THR 2   N   ? ? I SAC 1   I THR 2    1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale6  covale both ? N  FME 1   C   ? ? ? 1_555 N  PHE 2   N   ? ? N FME 1   N PHE 2    1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale7  covale both ? O  FME 1   C   ? ? ? 1_555 O  ALA 2   N   ? ? O FME 1   O ALA 2    1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale8  covale both ? T  GLY 10  C   ? ? ? 1_555 T  TPO 11  N   ? ? T GLY 10  T TPO 11   1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale9  covale both ? T  TPO 11  C   ? ? ? 1_555 T  GLY 12  N   ? ? T TPO 11  T GLY 12   1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale10 covale both ? V  SAC 1   C   ? ? ? 1_555 V  THR 2   N   ? ? V SAC 1   V THR 2    1_555 ? ? ? ? ? ? ? 1.329 ? ? 
metalc1  metalc ?    ? A  GLU 40  O   ? ? ? 1_555 EA NA  .   NA  ? ? A GLU 40  A NA  605  1_555 ? ? ? ? ? ? ? 2.352 ? ? 
metalc2  metalc ?    ? A  GLU 40  OE1 ? ? ? 1_555 EA NA  .   NA  ? ? A GLU 40  A NA  605  1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc3  metalc ?    ? A  GLY 45  O   ? ? ? 1_555 EA NA  .   NA  ? ? A GLY 45  A NA  605  1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc4  metalc ?    ? A  HIS 61  NE2 ? ? ? 1_555 AA HEA .   FE  ? ? A HIS 61  A HEA 601  1_555 ? ? ? ? ? ? ? 1.990 ? ? 
metalc5  metalc ?    ? A  HIS 240 ND1 ? ? ? 1_555 CA CU  .   CU  ? ? A HIS 240 A CU  603  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
metalc6  metalc ?    ? A  HIS 290 NE2 ? ? ? 1_555 CA CU  .   CU  ? ? A HIS 290 A CU  603  1_555 ? ? ? ? ? ? ? 1.982 ? ? 
metalc7  metalc ?    ? A  HIS 291 NE2 ? ? ? 1_555 CA CU  .   CU  ? ? A HIS 291 A CU  603  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
metalc8  metalc ?    ? A  ASP 369 OD1 ? ? ? 1_555 DA MG  .   MG  ? ? A ASP 369 A MG  604  1_555 ? ? ? ? ? ? ? 2.061 ? ? 
metalc9  metalc ?    ? A  HIS 376 NE2 ? ? ? 1_555 BA HEA .   FE  ? ? A HIS 376 A HEA 602  1_555 ? ? ? ? ? ? ? 2.079 ? ? 
metalc10 metalc ?    ? A  HIS 378 NE2 ? ? ? 1_555 AA HEA .   FE  ? ? A HIS 378 A HEA 601  1_555 ? ? ? ? ? ? ? 1.977 ? ? 
metalc11 metalc ?    ? A  SER 441 O   ? ? ? 1_555 EA NA  .   NA  ? ? A SER 441 A NA  605  1_555 ? ? ? ? ? ? ? 2.413 ? ? 
metalc12 metalc ?    ? CA CU  .   CU  ? ? ? 1_555 FA CMO .   O   B ? A CU  603 A CMO 606  1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc13 metalc ?    ? DA MG  .   MG  ? ? ? 1_555 B  GLU 198 OE1 ? ? A MG  604 B GLU 198  1_555 ? ? ? ? ? ? ? 2.146 ? ? 
metalc14 metalc ?    ? DA MG  .   MG  ? ? ? 1_555 CF HOH .   O   ? ? A MG  604 B HOH 424  1_555 ? ? ? ? ? ? ? 2.091 ? ? 
metalc15 metalc ?    ? DA MG  .   MG  ? ? ? 1_555 CF HOH .   O   ? ? A MG  604 B HOH 454  1_555 ? ? ? ? ? ? ? 2.097 ? ? 
metalc16 metalc ?    ? DA MG  .   MG  ? ? ? 1_555 CF HOH .   O   ? ? A MG  604 B HOH 495  1_555 ? ? ? ? ? ? ? 2.148 ? ? 
metalc17 metalc ?    ? EA NA  .   NA  ? ? ? 1_555 BF HOH .   O   ? ? A NA  605 A HOH 861  1_555 ? ? ? ? ? ? ? 2.221 ? ? 
metalc18 metalc ?    ? B  HIS 161 ND1 ? ? ? 1_555 WA CUA .   CU1 ? ? B HIS 161 B CUA 301  1_555 ? ? ? ? ? ? ? 2.062 ? ? 
metalc19 metalc ?    ? B  CYS 196 SG  ? ? ? 1_555 WA CUA .   CU1 ? ? B CYS 196 B CUA 301  1_555 ? ? ? ? ? ? ? 2.264 ? ? 
metalc20 metalc ?    ? B  CYS 196 SG  ? ? ? 1_555 WA CUA .   CU2 ? ? B CYS 196 B CUA 301  1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc21 metalc ?    ? B  GLU 198 O   ? ? ? 1_555 WA CUA .   CU2 ? ? B GLU 198 B CUA 301  1_555 ? ? ? ? ? ? ? 2.589 ? ? 
metalc22 metalc ?    ? B  CYS 200 SG  ? ? ? 1_555 WA CUA .   CU1 ? ? B CYS 200 B CUA 301  1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc23 metalc ?    ? B  CYS 200 SG  ? ? ? 1_555 WA CUA .   CU2 ? ? B CYS 200 B CUA 301  1_555 ? ? ? ? ? ? ? 2.200 ? ? 
metalc24 metalc ?    ? B  HIS 204 ND1 ? ? ? 1_555 WA CUA .   CU2 ? ? B HIS 204 B CUA 301  1_555 ? ? ? ? ? ? ? 2.008 ? ? 
metalc25 metalc ?    ? B  MET 207 SD  ? ? ? 1_555 WA CUA .   CU1 ? ? B MET 207 B CUA 301  1_555 ? ? ? ? ? ? ? 2.386 ? ? 
metalc26 metalc ?    ? DB NA  .   NA  ? ? ? 1_555 DF HOH .   O   ? ? C NA  302 C HOH 516  1_555 ? ? ? ? ? ? ? 2.160 ? ? 
metalc27 metalc ?    ? F  CYS 60  SG  ? ? ? 1_555 AC ZN  .   ZN  ? ? F CYS 60  F ZN  101  1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc28 metalc ?    ? F  CYS 62  SG  ? ? ? 1_555 AC ZN  .   ZN  ? ? F CYS 62  F ZN  101  1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc29 metalc ?    ? F  CYS 82  SG  ? ? ? 1_555 AC ZN  .   ZN  ? ? F CYS 82  F ZN  101  1_555 ? ? ? ? ? ? ? 2.278 ? ? 
metalc30 metalc ?    ? F  CYS 85  SG  ? ? ? 1_555 AC ZN  .   ZN  ? ? F CYS 85  F ZN  101  1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc31 metalc ?    ? N  GLU 40  O   ? ? ? 1_555 YC NA  .   NA  ? ? N GLU 40  N NA  605  1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc32 metalc ?    ? N  GLU 40  OE1 ? ? ? 1_555 YC NA  .   NA  ? ? N GLU 40  N NA  605  1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc33 metalc ?    ? N  GLY 45  O   ? ? ? 1_555 YC NA  .   NA  ? ? N GLY 45  N NA  605  1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc34 metalc ?    ? N  HIS 61  NE2 ? ? ? 1_555 UC HEA .   FE  ? ? N HIS 61  N HEA 601  1_555 ? ? ? ? ? ? ? 2.011 ? ? 
metalc35 metalc ?    ? N  HIS 240 ND1 ? ? ? 1_555 WC CU  .   CU  ? ? N HIS 240 N CU  603  1_555 ? ? ? ? ? ? ? 1.995 ? ? 
metalc36 metalc ?    ? N  HIS 290 NE2 ? ? ? 1_555 WC CU  .   CU  ? ? N HIS 290 N CU  603  1_555 ? ? ? ? ? ? ? 2.047 ? ? 
metalc37 metalc ?    ? N  HIS 291 NE2 ? ? ? 1_555 WC CU  .   CU  ? ? N HIS 291 N CU  603  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
metalc38 metalc ?    ? N  ASP 369 OD1 ? ? ? 1_555 XC MG  .   MG  ? ? N ASP 369 N MG  604  1_555 ? ? ? ? ? ? ? 2.012 ? ? 
metalc39 metalc ?    ? N  HIS 376 NE2 ? ? ? 1_555 VC HEA .   FE  ? ? N HIS 376 N HEA 602  1_555 ? ? ? ? ? ? ? 2.101 ? ? 
metalc40 metalc ?    ? N  HIS 378 NE2 ? ? ? 1_555 UC HEA .   FE  ? ? N HIS 378 N HEA 601  1_555 ? ? ? ? ? ? ? 1.988 ? ? 
metalc41 metalc ?    ? N  SER 441 O   ? ? ? 1_555 YC NA  .   NA  ? ? N SER 441 N NA  605  1_555 ? ? ? ? ? ? ? 2.503 ? ? 
metalc42 metalc ?    ? WC CU  .   CU  ? ? ? 1_555 ZC CMO .   O   B ? N CU  603 N CMO 606  1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc43 metalc ?    ? XC MG  .   MG  ? ? ? 1_555 O  GLU 198 OE1 ? ? N MG  604 O GLU 198  1_555 ? ? ? ? ? ? ? 2.080 ? ? 
metalc44 metalc ?    ? XC MG  .   MG  ? ? ? 1_555 PF HOH .   O   ? ? N MG  604 O HOH 3016 1_555 ? ? ? ? ? ? ? 2.018 ? ? 
metalc45 metalc ?    ? XC MG  .   MG  ? ? ? 1_555 PF HOH .   O   ? ? N MG  604 O HOH 3060 1_555 ? ? ? ? ? ? ? 2.080 ? ? 
metalc46 metalc ?    ? XC MG  .   MG  ? ? ? 1_555 PF HOH .   O   ? ? N MG  604 O HOH 3074 1_555 ? ? ? ? ? ? ? 2.018 ? ? 
metalc47 metalc ?    ? YC NA  .   NA  ? ? ? 1_555 OF HOH .   O   ? ? N NA  605 N HOH 868  1_555 ? ? ? ? ? ? ? 2.141 ? ? 
metalc48 metalc ?    ? O  HIS 161 ND1 ? ? ? 1_555 JD CUA .   CU1 ? ? O HIS 161 O CUA 302  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
metalc49 metalc ?    ? O  CYS 196 SG  ? ? ? 1_555 JD CUA .   CU1 ? ? O CYS 196 O CUA 302  1_555 ? ? ? ? ? ? ? 2.273 ? ? 
metalc50 metalc ?    ? O  CYS 196 SG  ? ? ? 1_555 JD CUA .   CU2 ? ? O CYS 196 O CUA 302  1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc51 metalc ?    ? O  GLU 198 O   ? ? ? 1_555 JD CUA .   CU2 ? ? O GLU 198 O CUA 302  1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc52 metalc ?    ? O  CYS 200 SG  ? ? ? 1_555 JD CUA .   CU1 ? ? O CYS 200 O CUA 302  1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc53 metalc ?    ? O  CYS 200 SG  ? ? ? 1_555 JD CUA .   CU2 ? ? O CYS 200 O CUA 302  1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc54 metalc ?    ? O  HIS 204 ND1 ? ? ? 1_555 JD CUA .   CU2 ? ? O HIS 204 O CUA 302  1_555 ? ? ? ? ? ? ? 2.004 ? ? 
metalc55 metalc ?    ? O  MET 207 SD  ? ? ? 1_555 JD CUA .   CU1 ? ? O MET 207 O CUA 302  1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc56 metalc ?    ? RD NA  .   NA  ? ? ? 1_555 QF HOH .   O   ? ? P NA  303 P HOH 493  1_555 ? ? ? ? ? ? ? 2.136 ? ? 
metalc57 metalc ?    ? S  CYS 60  SG  ? ? ? 1_555 IE ZN  .   ZN  ? ? S CYS 60  S ZN  101  1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc58 metalc ?    ? S  CYS 62  SG  ? ? ? 1_555 IE ZN  .   ZN  ? ? S CYS 62  S ZN  101  1_555 ? ? ? ? ? ? ? 2.400 ? ? 
metalc59 metalc ?    ? S  CYS 82  SG  ? ? ? 1_555 IE ZN  .   ZN  ? ? S CYS 82  S ZN  101  1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc60 metalc ?    ? S  CYS 85  SG  ? ? ? 1_555 IE ZN  .   ZN  ? ? S CYS 85  S ZN  101  1_555 ? ? ? ? ? ? ? 2.381 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 130 A . ? PRO 130 A PRO 131 A ? PRO 131 A 1 0.48   
2 CYS 498 A . ? CYS 498 A PRO 499 A ? PRO 499 A 1 -3.81  
3 GLN 103 B . ? GLN 103 B TRP 104 B ? TRP 104 B 1 -12.59 
4 TRP 116 C . ? TRP 116 C PRO 117 C ? PRO 117 C 1 -7.72  
5 PRO 130 N . ? PRO 130 N PRO 131 N ? PRO 131 N 1 -1.19  
6 CYS 498 N . ? CYS 498 N PRO 499 N ? PRO 499 N 1 -12.59 
7 GLN 103 O . ? GLN 103 O TRP 104 O ? TRP 104 O 1 -6.36  
8 TRP 116 P . ? TRP 116 P PRO 117 P ? PRO 117 P 1 -9.66  
9 LYS 9   U . ? LYS 9   U ASN 10  U ? ASN 10  U 1 -21.86 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
AA3 ? 5 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
AA9 ? 3 ? 
AB1 ? 5 ? 
AB2 ? 3 ? 
AB3 ? 2 ? 
AB4 ? 2 ? 
AB5 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA3 4 5 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? parallel      
AB1 4 5 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? parallel      
AB5 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 482 ? THR A 484 ? VAL A 482 THR A 484 
AA1 2 THR M 2   ? ALA M 3   ? THR M 2   ALA M 3   
AA2 1 TYR A 510 ? VAL A 511 ? TYR A 510 VAL A 511 
AA2 2 LYS F 55  ? CYS F 60  ? LYS F 55  CYS F 60  
AA2 3 ILE F 70  ? HIS F 75  ? ILE F 70  HIS F 75  
AA3 1 LEU B 116 ? SER B 120 ? LEU B 116 SER B 120 
AA3 2 TYR B 105 ? TYR B 110 ? TYR B 105 TYR B 110 
AA3 3 LEU B 95  ? HIS B 102 ? LEU B 95  HIS B 102 
AA3 4 ILE B 150 ? SER B 156 ? ILE B 150 SER B 156 
AA3 5 ASN B 180 ? LEU B 184 ? ASN B 180 LEU B 184 
AA4 1 VAL B 142 ? PRO B 145 ? VAL B 142 PRO B 145 
AA4 2 PRO B 208 ? VAL B 214 ? PRO B 208 VAL B 214 
AA4 3 GLY B 190 ? GLN B 195 ? GLY B 190 GLN B 195 
AA5 1 HIS B 161 ? VAL B 165 ? HIS B 161 VAL B 165 
AA5 2 LEU B 170 ? ALA B 174 ? LEU B 170 ALA B 174 
AA6 1 TRP D 138 ? ASP D 139 ? TRP D 138 ASP D 139 
AA6 2 GLU D 144 ? TRP D 145 ? GLU D 144 TRP D 145 
AA7 1 ASN F 47  ? SER F 51  ? ASN F 47  SER F 51  
AA7 2 HIS F 88  ? PRO F 93  ? HIS F 88  PRO F 93  
AA7 3 GLN F 80  ? ARG F 81  ? GLN F 80  ARG F 81  
AA8 1 VAL N 482 ? THR N 484 ? VAL N 482 THR N 484 
AA8 2 THR Z 2   ? ALA Z 3   ? THR Z 2   ALA Z 3   
AA9 1 TYR N 510 ? VAL N 511 ? TYR N 510 VAL N 511 
AA9 2 LYS S 55  ? CYS S 60  ? LYS S 55  CYS S 60  
AA9 3 ILE S 70  ? HIS S 75  ? ILE S 70  HIS S 75  
AB1 1 LEU O 116 ? SER O 120 ? LEU O 116 SER O 120 
AB1 2 TYR O 105 ? TYR O 110 ? TYR O 105 TYR O 110 
AB1 3 LEU O 95  ? HIS O 102 ? LEU O 95  HIS O 102 
AB1 4 ILE O 150 ? SER O 156 ? ILE O 150 SER O 156 
AB1 5 ASN O 180 ? LEU O 184 ? ASN O 180 LEU O 184 
AB2 1 VAL O 142 ? PRO O 145 ? VAL O 142 PRO O 145 
AB2 2 ILE O 209 ? VAL O 214 ? ILE O 209 VAL O 214 
AB2 3 GLY O 190 ? GLY O 194 ? GLY O 190 GLY O 194 
AB3 1 HIS O 161 ? VAL O 165 ? HIS O 161 VAL O 165 
AB3 2 LEU O 170 ? ALA O 174 ? LEU O 170 ALA O 174 
AB4 1 TRP Q 138 ? ASP Q 139 ? TRP Q 138 ASP Q 139 
AB4 2 GLU Q 144 ? TRP Q 145 ? GLU Q 144 TRP Q 145 
AB5 1 ASN S 47  ? SER S 51  ? ASN S 47  SER S 51  
AB5 2 HIS S 88  ? PRO S 93  ? HIS S 88  PRO S 93  
AB5 3 GLN S 80  ? ARG S 81  ? GLN S 80  ARG S 81  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 483 ? N LEU A 483 O THR M 2   ? O THR M 2   
AA2 1 2 N TYR A 510 ? N TYR A 510 O GLY F 59  ? O GLY F 59  
AA2 2 3 N VAL F 58  ? N VAL F 58  O PHE F 72  ? O PHE F 72  
AA3 1 2 O LEU B 116 ? O LEU B 116 N TYR B 110 ? N TYR B 110 
AA3 2 3 O GLU B 109 ? O GLU B 109 N LYS B 98  ? N LYS B 98  
AA3 3 4 N LEU B 95  ? N LEU B 95  O ARG B 151 ? O ARG B 151 
AA3 4 5 N MET B 152 ? N MET B 152 O THR B 182 ? O THR B 182 
AA4 1 2 N LEU B 144 ? N LEU B 144 O GLU B 212 ? O GLU B 212 
AA4 2 3 O LEU B 211 ? O LEU B 211 N TYR B 192 ? N TYR B 192 
AA5 1 2 N HIS B 161 ? N HIS B 161 O ALA B 174 ? O ALA B 174 
AA6 1 2 N ASP D 139 ? N ASP D 139 O GLU D 144 ? O GLU D 144 
AA7 1 2 N ASN F 47  ? N ASN F 47  O LYS F 90  ? O LYS F 90  
AA7 2 3 O TYR F 89  ? O TYR F 89  N GLN F 80  ? N GLN F 80  
AA8 1 2 N LEU N 483 ? N LEU N 483 O THR Z 2   ? O THR Z 2   
AA9 1 2 N TYR N 510 ? N TYR N 510 O GLY S 59  ? O GLY S 59  
AA9 2 3 N VAL S 58  ? N VAL S 58  O PHE S 72  ? O PHE S 72  
AB1 1 2 O LEU O 116 ? O LEU O 116 N TYR O 110 ? N TYR O 110 
AB1 2 3 O GLU O 109 ? O GLU O 109 N LYS O 98  ? N LYS O 98  
AB1 3 4 N LEU O 95  ? N LEU O 95  O ARG O 151 ? O ARG O 151 
AB1 4 5 N ILE O 150 ? N ILE O 150 O LEU O 184 ? O LEU O 184 
AB2 1 2 N VAL O 142 ? N VAL O 142 O GLU O 212 ? O GLU O 212 
AB2 2 3 O LEU O 211 ? O LEU O 211 N TYR O 192 ? N TYR O 192 
AB3 1 2 N HIS O 161 ? N HIS O 161 O ALA O 174 ? O ALA O 174 
AB4 1 2 N ASP Q 139 ? N ASP Q 139 O GLU Q 144 ? O GLU Q 144 
AB5 1 2 N VAL S 49  ? N VAL S 49  O VAL S 92  ? O VAL S 92  
AB5 2 3 O TYR S 89  ? O TYR S 89  N GLN S 80  ? N GLN S 80  
# 
_database_PDB_matrix.entry_id          3AG2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3AG2 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.005469 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004832 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005615 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
CU 
FE 
MG 
N  
NA 
O  
P  
S  
X  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1     N  N   . FME A  1  1   ? 53.101  335.271 224.023 1.00 49.90  ? 1    FME A N   1 
HETATM 2     C  CN  . FME A  1  1   ? 53.889  336.019 223.284 1.00 61.61  ? 1    FME A CN  1 
HETATM 3     O  O1  . FME A  1  1   ? 54.515  335.503 222.394 1.00 47.09  ? 1    FME A O1  1 
HETATM 4     C  CA  . FME A  1  1   ? 53.430  333.908 224.323 1.00 50.15  ? 1    FME A CA  1 
HETATM 5     C  CB  . FME A  1  1   ? 52.642  333.446 225.544 1.00 62.96  ? 1    FME A CB  1 
HETATM 6     C  CG  . FME A  1  1   ? 53.451  332.476 226.394 1.00 85.17  ? 1    FME A CG  1 
HETATM 7     S  SD  . FME A  1  1   ? 54.461  333.384 227.514 1.00 120.62 ? 1    FME A SD  1 
HETATM 8     C  CE  . FME A  1  1   ? 55.969  333.748 226.662 1.00 54.25  ? 1    FME A CE  1 
HETATM 9     C  C   . FME A  1  1   ? 53.150  332.997 223.166 1.00 73.33  ? 1    FME A C   1 
HETATM 10    O  O   . FME A  1  1   ? 53.890  332.097 222.920 1.00 41.33  ? 1    FME A O   1 
ATOM   11    N  N   . PHE A  1  2   ? 52.064  333.230 222.457 1.00 41.16  ? 2    PHE A N   1 
ATOM   12    C  CA  . PHE A  1  2   ? 51.705  332.391 221.326 1.00 43.41  ? 2    PHE A CA  1 
ATOM   13    C  C   . PHE A  1  2   ? 52.741  332.483 220.202 1.00 49.36  ? 2    PHE A C   1 
ATOM   14    O  O   . PHE A  1  2   ? 53.166  331.485 219.661 1.00 39.04  ? 2    PHE A O   1 
ATOM   15    C  CB  . PHE A  1  2   ? 50.327  332.747 220.772 1.00 54.62  ? 2    PHE A CB  1 
ATOM   16    C  CG  . PHE A  1  2   ? 49.941  331.885 219.582 1.00 47.84  ? 2    PHE A CG  1 
ATOM   17    C  CD1 . PHE A  1  2   ? 49.315  330.680 219.786 1.00 144.22 ? 2    PHE A CD1 1 
ATOM   18    C  CD2 . PHE A  1  2   ? 50.282  332.257 218.288 1.00 51.12  ? 2    PHE A CD2 1 
ATOM   19    C  CE1 . PHE A  1  2   ? 48.999  329.888 218.738 1.00 39.06  ? 2    PHE A CE1 1 
ATOM   20    C  CE2 . PHE A  1  2   ? 49.971  331.448 217.202 1.00 57.16  ? 2    PHE A CE2 1 
ATOM   21    C  CZ  . PHE A  1  2   ? 49.324  330.262 217.428 1.00 51.37  ? 2    PHE A CZ  1 
ATOM   22    N  N   . ILE A  1  3   ? 53.098  333.706 219.832 1.00 39.15  ? 3    ILE A N   1 
ATOM   23    C  CA  . ILE A  1  3   ? 54.137  333.937 218.843 1.00 40.18  ? 3    ILE A CA  1 
ATOM   24    C  C   . ILE A  1  3   ? 55.480  333.377 219.300 1.00 56.63  ? 3    ILE A C   1 
ATOM   25    O  O   . ILE A  1  3   ? 56.193  332.756 218.498 1.00 39.05  ? 3    ILE A O   1 
ATOM   26    C  CB  . ILE A  1  3   ? 54.234  335.433 218.532 1.00 49.14  ? 3    ILE A CB  1 
ATOM   27    C  CG1 . ILE A  1  3   ? 53.045  335.807 217.653 1.00 61.58  ? 3    ILE A CG1 1 
ATOM   28    C  CG2 . ILE A  1  3   ? 55.637  335.766 217.865 1.00 39.85  ? 3    ILE A CG2 1 
ATOM   29    C  CD1 . ILE A  1  3   ? 52.907  337.268 217.429 1.00 55.73  ? 3    ILE A CD1 1 
ATOM   30    N  N   . ASN A  1  4   ? 55.865  333.602 220.572 1.00 35.35  ? 4    ASN A N   1 
ATOM   31    C  CA  . ASN A  1  4   ? 57.126  333.038 221.074 1.00 37.85  ? 4    ASN A CA  1 
ATOM   32    C  C   . ASN A  1  4   ? 57.162  331.539 220.896 1.00 35.55  ? 4    ASN A C   1 
ATOM   33    O  O   . ASN A  1  4   ? 58.191  330.976 220.507 1.00 36.98  ? 4    ASN A O   1 
ATOM   34    C  CB  . ASN A  1  4   ? 57.370  333.324 222.567 1.00 36.77  ? 4    ASN A CB  1 
ATOM   35    C  CG  . ASN A  1  4   ? 57.774  334.751 222.848 1.00 71.24  ? 4    ASN A CG  1 
ATOM   36    O  OD1 . ASN A  1  4   ? 58.189  335.476 221.961 1.00 45.72  ? 4    ASN A OD1 1 
ATOM   37    N  ND2 . ASN A  1  4   ? 57.636  335.164 224.098 1.00 56.34  ? 4    ASN A ND2 1 
ATOM   38    N  N   . ARG A  1  5   ? 56.085  330.863 221.303 1.00 28.73  ? 5    ARG A N   1 
ATOM   39    C  CA  . ARG A  1  5   ? 56.070  329.403 221.232 1.00 26.39  ? 5    ARG A CA  1 
ATOM   40    C  C   . ARG A  1  5   ? 56.024  328.904 219.769 1.00 33.23  ? 5    ARG A C   1 
ATOM   41    O  O   . ARG A  1  5   ? 56.697  327.939 219.407 1.00 31.06  ? 5    ARG A O   1 
ATOM   42    C  CB  . ARG A  1  5   ? 54.877  328.846 221.968 1.00 30.34  ? 5    ARG A CB  1 
ATOM   43    C  CG  . ARG A  1  5   ? 54.842  327.349 221.951 1.00 30.14  ? 5    ARG A CG  1 
ATOM   44    C  CD  . ARG A  1  5   ? 53.883  326.745 222.973 1.00 36.67  ? 5    ARG A CD  1 
ATOM   45    N  NE  . ARG A  1  5   ? 54.058  325.308 222.972 1.00 35.28  ? 5    ARG A NE  1 
ATOM   46    C  CZ  . ARG A  1  5   ? 53.496  324.463 223.804 1.00 35.77  ? 5    ARG A CZ  1 
ATOM   47    N  NH1 . ARG A  1  5   ? 52.730  324.943 224.788 1.00 32.49  ? 5    ARG A NH1 1 
ATOM   48    N  NH2 . ARG A  1  5   ? 53.716  323.147 223.662 1.00 28.59  ? 5    ARG A NH2 1 
ATOM   49    N  N   . TRP A  1  6   ? 55.213  329.499 218.934 1.00 27.14  ? 6    TRP A N   1 
ATOM   50    C  CA  . TRP A  1  6   ? 54.915  328.845 217.662 1.00 28.74  ? 6    TRP A CA  1 
ATOM   51    C  C   . TRP A  1  6   ? 55.600  329.455 216.438 1.00 38.08  ? 6    TRP A C   1 
ATOM   52    O  O   . TRP A  1  6   ? 55.631  328.799 215.384 1.00 30.77  ? 6    TRP A O   1 
ATOM   53    C  CB  . TRP A  1  6   ? 53.404  328.785 217.388 1.00 32.10  ? 6    TRP A CB  1 
ATOM   54    C  CG  . TRP A  1  6   ? 52.766  327.888 218.388 1.00 34.03  ? 6    TRP A CG  1 
ATOM   55    C  CD1 . TRP A  1  6   ? 51.999  328.267 219.471 1.00 32.52  ? 6    TRP A CD1 1 
ATOM   56    C  CD2 . TRP A  1  6   ? 52.923  326.469 218.478 1.00 31.30  ? 6    TRP A CD2 1 
ATOM   57    N  NE1 . TRP A  1  6   ? 51.630  327.150 220.196 1.00 31.07  ? 6    TRP A NE1 1 
ATOM   58    C  CE2 . TRP A  1  6   ? 52.187  326.034 219.619 1.00 31.04  ? 6    TRP A CE2 1 
ATOM   59    C  CE3 . TRP A  1  6   ? 53.580  325.509 217.675 1.00 32.52  ? 6    TRP A CE3 1 
ATOM   60    C  CZ2 . TRP A  1  6   ? 52.159  324.708 220.025 1.00 28.23  ? 6    TRP A CZ2 1 
ATOM   61    C  CZ3 . TRP A  1  6   ? 53.532  324.193 218.047 1.00 29.97  ? 6    TRP A CZ3 1 
ATOM   62    C  CH2 . TRP A  1  6   ? 52.811  323.786 219.211 1.00 28.16  ? 6    TRP A CH2 1 
ATOM   63    N  N   . LEU A  1  7   ? 56.068  330.697 216.533 1.00 29.51  ? 7    LEU A N   1 
ATOM   64    C  CA  . LEU A  1  7   ? 56.843  331.310 215.453 1.00 29.23  ? 7    LEU A CA  1 
ATOM   65    C  C   . LEU A  1  7   ? 58.322  331.340 215.759 1.00 36.90  ? 7    LEU A C   1 
ATOM   66    O  O   . LEU A  1  7   ? 59.135  331.402 214.822 1.00 29.49  ? 7    LEU A O   1 
ATOM   67    C  CB  . LEU A  1  7   ? 56.389  332.760 215.206 1.00 30.07  ? 7    LEU A CB  1 
ATOM   68    C  CG  . LEU A  1  7   ? 55.320  332.870 214.103 1.00 60.99  ? 7    LEU A CG  1 
ATOM   69    C  CD1 . LEU A  1  7   ? 54.283  331.823 214.207 1.00 42.05  ? 7    LEU A CD1 1 
ATOM   70    C  CD2 . LEU A  1  7   ? 54.641  334.202 214.146 1.00 44.31  ? 7    LEU A CD2 1 
ATOM   71    N  N   . PHE A  1  8   ? 58.677  331.379 217.053 1.00 31.65  ? 8    PHE A N   1 
ATOM   72    C  CA  . PHE A  1  8   ? 60.068  331.481 217.483 1.00 35.69  ? 8    PHE A CA  1 
ATOM   73    C  C   . PHE A  1  8   ? 60.567  330.185 218.126 1.00 35.83  ? 8    PHE A C   1 
ATOM   74    O  O   . PHE A  1  8   ? 61.513  330.224 218.902 1.00 34.62  ? 8    PHE A O   1 
ATOM   75    C  CB  . PHE A  1  8   ? 60.254  332.641 218.475 1.00 29.08  ? 8    PHE A CB  1 
ATOM   76    C  CG  . PHE A  1  8   ? 59.863  334.009 217.938 1.00 31.18  ? 8    PHE A CG  1 
ATOM   77    C  CD1 . PHE A  1  8   ? 59.580  334.224 216.591 1.00 33.09  ? 8    PHE A CD1 1 
ATOM   78    C  CD2 . PHE A  1  8   ? 59.814  335.118 218.817 1.00 44.62  ? 8    PHE A CD2 1 
ATOM   79    C  CE1 . PHE A  1  8   ? 59.260  335.484 216.125 1.00 34.43  ? 8    PHE A CE1 1 
ATOM   80    C  CE2 . PHE A  1  8   ? 59.481  336.400 218.341 1.00 29.97  ? 8    PHE A CE2 1 
ATOM   81    C  CZ  . PHE A  1  8   ? 59.197  336.571 216.992 1.00 36.82  ? 8    PHE A CZ  1 
ATOM   82    N  N   . SER A  1  9   ? 59.947  329.044 217.805 1.00 32.58  ? 9    SER A N   1 
ATOM   83    C  CA  . SER A  1  9   ? 60.240  327.801 218.492 1.00 29.94  ? 9    SER A CA  1 
ATOM   84    C  C   . SER A  1  9   ? 61.699  327.382 218.396 1.00 36.91  ? 9    SER A C   1 
ATOM   85    O  O   . SER A  1  9   ? 62.368  327.578 217.379 1.00 28.90  ? 9    SER A O   1 
ATOM   86    C  CB  . SER A  1  9   ? 59.375  326.670 217.951 1.00 27.67  ? 9    SER A CB  1 
ATOM   87    O  OG  . SER A  1  9   ? 59.651  325.498 218.757 1.00 27.95  ? 9    SER A OG  1 
ATOM   88    N  N   . THR A  1  10  ? 62.188  326.777 219.494 1.00 29.15  ? 10   THR A N   1 
ATOM   89    C  CA  . THR A  1  10  ? 63.453  326.061 219.518 1.00 28.45  ? 10   THR A CA  1 
ATOM   90    C  C   . THR A  1  10  ? 63.248  324.693 220.122 1.00 34.99  ? 10   THR A C   1 
ATOM   91    O  O   . THR A  1  10  ? 64.181  324.129 220.702 1.00 33.17  ? 10   THR A O   1 
ATOM   92    C  CB  . THR A  1  10  ? 64.555  326.792 220.304 1.00 33.47  ? 10   THR A CB  1 
ATOM   93    O  OG1 . THR A  1  10  ? 64.105  327.076 221.666 1.00 32.13  ? 10   THR A OG1 1 
ATOM   94    C  CG2 . THR A  1  10  ? 64.980  328.076 219.606 1.00 25.77  ? 10   THR A CG2 1 
ATOM   95    N  N   . ASN A  1  11  ? 62.036  324.150 220.016 1.00 28.19  ? 11   ASN A N   1 
ATOM   96    C  CA  . ASN A  1  11  ? 61.667  322.908 220.692 1.00 25.61  ? 11   ASN A CA  1 
ATOM   97    C  C   . ASN A  1  11  ? 61.392  321.839 219.649 1.00 23.50  ? 11   ASN A C   1 
ATOM   98    O  O   . ASN A  1  11  ? 60.560  322.066 218.759 1.00 26.10  ? 11   ASN A O   1 
ATOM   99    C  CB  . ASN A  1  11  ? 60.400  323.148 221.523 1.00 29.59  ? 11   ASN A CB  1 
ATOM   100   C  CG  . ASN A  1  11  ? 59.951  321.914 222.247 1.00 34.27  ? 11   ASN A CG  1 
ATOM   101   O  OD1 . ASN A  1  11  ? 59.086  321.175 221.764 1.00 30.63  ? 11   ASN A OD1 1 
ATOM   102   N  ND2 . ASN A  1  11  ? 60.522  321.684 223.418 1.00 30.24  ? 11   ASN A ND2 1 
ATOM   103   N  N   . HIS A  1  12  ? 62.002  320.643 219.778 1.00 26.59  ? 12   HIS A N   1 
ATOM   104   C  CA  . HIS A  1  12  ? 61.864  319.675 218.682 1.00 27.22  ? 12   HIS A CA  1 
ATOM   105   C  C   . HIS A  1  12  ? 60.442  319.106 218.549 1.00 29.75  ? 12   HIS A C   1 
ATOM   106   O  O   . HIS A  1  12  ? 60.030  318.697 217.438 1.00 27.59  ? 12   HIS A O   1 
ATOM   107   C  CB  . HIS A  1  12  ? 62.856  318.546 218.903 1.00 28.15  ? 12   HIS A CB  1 
ATOM   108   C  CG  . HIS A  1  12  ? 62.486  317.658 220.051 1.00 25.74  ? 12   HIS A CG  1 
ATOM   109   N  ND1 . HIS A  1  12  ? 61.873  316.437 219.857 1.00 26.71  ? 12   HIS A ND1 1 
ATOM   110   C  CD2 . HIS A  1  12  ? 62.657  317.792 221.406 1.00 29.95  ? 12   HIS A CD2 1 
ATOM   111   C  CE1 . HIS A  1  12  ? 61.703  315.846 221.043 1.00 30.26  ? 12   HIS A CE1 1 
ATOM   112   N  NE2 . HIS A  1  12  ? 62.148  316.657 221.990 1.00 27.71  ? 12   HIS A NE2 1 
ATOM   113   N  N   . LYS A  1  13  ? 59.664  319.056 219.649 1.00 28.05  ? 13   LYS A N   1 
ATOM   114   C  CA  . LYS A  1  13  ? 58.297  318.529 219.565 1.00 29.37  ? 13   LYS A CA  1 
ATOM   115   C  C   . LYS A  1  13  ? 57.385  319.528 218.875 1.00 27.15  ? 13   LYS A C   1 
ATOM   116   O  O   . LYS A  1  13  ? 56.614  319.160 217.993 1.00 25.32  ? 13   LYS A O   1 
ATOM   117   C  CB  . LYS A  1  13  ? 57.705  318.218 220.995 1.00 24.68  ? 13   LYS A CB  1 
ATOM   118   C  CG  . LYS A  1  13  ? 58.638  317.383 221.872 1.00 31.96  ? 13   LYS A CG  1 
ATOM   119   C  CD  . LYS A  1  13  ? 58.115  317.306 223.375 1.00 32.42  ? 13   LYS A CD  1 
ATOM   120   C  CE  . LYS A  1  13  ? 59.073  316.459 224.212 1.00 38.24  ? 13   LYS A CE  1 
ATOM   121   N  NZ  . LYS A  1  13  ? 60.294  317.206 224.581 1.00 33.19  ? 13   LYS A NZ  1 
ATOM   122   N  N   . ASP A  1  14  ? 57.427  320.803 219.311 1.00 24.76  ? 14   ASP A N   1 
ATOM   123   C  CA  . ASP A  1  14  ? 56.566  321.810 218.682 1.00 25.94  ? 14   ASP A CA  1 
ATOM   124   C  C   . ASP A  1  14  ? 56.918  321.979 217.191 1.00 32.17  ? 14   ASP A C   1 
ATOM   125   O  O   . ASP A  1  14  ? 56.060  322.176 216.341 1.00 24.47  ? 14   ASP A O   1 
ATOM   126   C  CB  . ASP A  1  14  ? 56.741  323.162 219.363 1.00 25.48  ? 14   ASP A CB  1 
ATOM   127   C  CG  . ASP A  1  14  ? 56.017  323.237 220.757 1.00 30.04  ? 14   ASP A CG  1 
ATOM   128   O  OD1 . ASP A  1  14  ? 55.387  322.225 221.132 1.00 29.68  ? 14   ASP A OD1 1 
ATOM   129   O  OD2 . ASP A  1  14  ? 56.100  324.324 221.386 1.00 30.81  ? 14   ASP A OD2 1 
ATOM   130   N  N   . ILE A  1  15  ? 58.178  321.980 216.860 1.00 25.69  ? 15   ILE A N   1 
ATOM   131   C  CA  . ILE A  1  15  ? 58.545  322.030 215.450 1.00 25.71  ? 15   ILE A CA  1 
ATOM   132   C  C   . ILE A  1  15  ? 58.052  320.779 214.696 1.00 24.27  ? 15   ILE A C   1 
ATOM   133   O  O   . ILE A  1  15  ? 57.567  320.882 213.565 1.00 27.74  ? 15   ILE A O   1 
ATOM   134   C  CB  . ILE A  1  15  ? 60.055  322.249 215.357 1.00 26.72  ? 15   ILE A CB  1 
ATOM   135   C  CG1 . ILE A  1  15  ? 60.364  323.672 215.790 1.00 24.88  ? 15   ILE A CG1 1 
ATOM   136   C  CG2 . ILE A  1  15  ? 60.544  322.069 213.850 1.00 24.16  ? 15   ILE A CG2 1 
ATOM   137   C  CD1 . ILE A  1  15  ? 61.935  323.904 216.002 1.00 26.81  ? 15   ILE A CD1 1 
ATOM   138   N  N   . GLY A  1  16  ? 58.193  319.591 215.289 1.00 27.34  ? 16   GLY A N   1 
ATOM   139   C  CA  . GLY A  1  16  ? 57.600  318.413 214.676 1.00 23.08  ? 16   GLY A CA  1 
ATOM   140   C  C   . GLY A  1  16  ? 56.100  318.562 214.437 1.00 32.03  ? 16   GLY A C   1 
ATOM   141   O  O   . GLY A  1  16  ? 55.563  318.141 213.394 1.00 27.00  ? 16   GLY A O   1 
ATOM   142   N  N   . THR A  1  17  ? 55.409  319.195 215.396 1.00 28.00  ? 17   THR A N   1 
ATOM   143   C  CA  . THR A  1  17  ? 53.987  319.437 215.260 1.00 25.69  ? 17   THR A CA  1 
ATOM   144   C  C   . THR A  1  17  ? 53.702  320.379 214.091 1.00 26.61  ? 17   THR A C   1 
ATOM   145   O  O   . THR A  1  17  ? 52.732  320.184 213.343 1.00 28.41  ? 17   THR A O   1 
ATOM   146   C  CB  . THR A  1  17  ? 53.457  320.004 216.604 1.00 26.52  ? 17   THR A CB  1 
ATOM   147   O  OG1 . THR A  1  17  ? 53.509  318.949 217.549 1.00 25.75  ? 17   THR A OG1 1 
ATOM   148   C  CG2 . THR A  1  17  ? 52.009  320.544 216.464 1.00 23.00  ? 17   THR A CG2 1 
ATOM   149   N  N   . LEU A  1  18  ? 54.478  321.463 213.975 1.00 28.78  ? 18   LEU A N   1 
ATOM   150   C  CA  . LEU A  1  18  ? 54.333  322.367 212.837 1.00 25.54  ? 18   LEU A CA  1 
ATOM   151   C  C   . LEU A  1  18  ? 54.494  321.619 211.532 1.00 30.00  ? 18   LEU A C   1 
ATOM   152   O  O   . LEU A  1  18  ? 53.724  321.825 210.612 1.00 25.06  ? 18   LEU A O   1 
ATOM   153   C  CB  . LEU A  1  18  ? 55.385  323.513 212.879 1.00 23.34  ? 18   LEU A CB  1 
ATOM   154   C  CG  . LEU A  1  18  ? 55.088  324.478 214.038 1.00 31.80  ? 18   LEU A CG  1 
ATOM   155   C  CD1 . LEU A  1  18  ? 56.204  325.453 214.164 1.00 26.93  ? 18   LEU A CD1 1 
ATOM   156   C  CD2 . LEU A  1  18  ? 53.816  325.263 213.743 1.00 30.62  ? 18   LEU A CD2 1 
ATOM   157   N  N   . TYR A  1  19  ? 55.493  320.749 211.438 1.00 26.60  ? 19   TYR A N   1 
ATOM   158   C  CA  . TYR A  1  19  ? 55.705  319.981 210.215 1.00 30.68  ? 19   TYR A CA  1 
ATOM   159   C  C   . TYR A  1  19  ? 54.522  319.074 209.890 1.00 35.07  ? 19   TYR A C   1 
ATOM   160   O  O   . TYR A  1  19  ? 54.171  318.905 208.701 1.00 26.38  ? 19   TYR A O   1 
ATOM   161   C  CB  . TYR A  1  19  ? 56.944  319.136 210.335 1.00 23.55  ? 19   TYR A CB  1 
ATOM   162   C  CG  . TYR A  1  19  ? 58.247  319.772 209.915 1.00 22.53  ? 19   TYR A CG  1 
ATOM   163   C  CD1 . TYR A  1  19  ? 58.553  319.954 208.561 1.00 23.94  ? 19   TYR A CD1 1 
ATOM   164   C  CD2 . TYR A  1  19  ? 59.176  320.179 210.883 1.00 24.96  ? 19   TYR A CD2 1 
ATOM   165   C  CE1 . TYR A  1  19  ? 59.758  320.468 208.179 1.00 25.29  ? 19   TYR A CE1 1 
ATOM   166   C  CE2 . TYR A  1  19  ? 60.406  320.696 210.511 1.00 26.39  ? 19   TYR A CE2 1 
ATOM   167   C  CZ  . TYR A  1  19  ? 60.709  320.793 209.133 1.00 28.84  ? 19   TYR A CZ  1 
ATOM   168   O  OH  . TYR A  1  19  ? 61.917  321.290 208.742 1.00 29.78  ? 19   TYR A OH  1 
ATOM   169   N  N   . LEU A  1  20  ? 53.953  318.425 210.919 1.00 26.67  ? 20   LEU A N   1 
ATOM   170   C  CA  . LEU A  1  20  ? 52.801  317.530 210.707 1.00 26.02  ? 20   LEU A CA  1 
ATOM   171   C  C   . LEU A  1  20  ? 51.571  318.304 210.227 1.00 26.51  ? 20   LEU A C   1 
ATOM   172   O  O   . LEU A  1  20  ? 50.835  317.833 209.327 1.00 25.81  ? 20   LEU A O   1 
ATOM   173   C  CB  . LEU A  1  20  ? 52.465  316.741 211.977 1.00 26.34  ? 20   LEU A CB  1 
ATOM   174   C  CG  . LEU A  1  20  ? 53.517  315.715 212.437 1.00 27.09  ? 20   LEU A CG  1 
ATOM   175   C  CD1 . LEU A  1  20  ? 53.158  315.154 213.842 1.00 29.74  ? 20   LEU A CD1 1 
ATOM   176   C  CD2 . LEU A  1  20  ? 53.588  314.519 211.458 1.00 25.44  ? 20   LEU A CD2 1 
ATOM   177   N  N   . LEU A  1  21  ? 51.305  319.464 210.822 1.00 24.99  ? 21   LEU A N   1 
ATOM   178   C  CA  . LEU A  1  21  ? 50.204  320.301 210.351 1.00 28.64  ? 21   LEU A CA  1 
ATOM   179   C  C   . LEU A  1  21  ? 50.447  320.767 208.892 1.00 29.80  ? 21   LEU A C   1 
ATOM   180   O  O   . LEU A  1  21  ? 49.545  320.758 208.061 1.00 25.71  ? 21   LEU A O   1 
ATOM   181   C  CB  . LEU A  1  21  ? 50.050  321.533 211.261 1.00 24.21  ? 21   LEU A CB  1 
ATOM   182   C  CG  . LEU A  1  21  ? 49.525  321.228 212.705 1.00 29.38  ? 21   LEU A CG  1 
ATOM   183   C  CD1 . LEU A  1  21  ? 49.765  322.459 213.564 1.00 35.43  ? 21   LEU A CD1 1 
ATOM   184   C  CD2 . LEU A  1  21  ? 48.040  320.840 212.615 1.00 36.56  ? 21   LEU A CD2 1 
ATOM   185   N  N   . PHE A  1  22  ? 51.660  321.237 208.604 1.00 27.34  ? 22   PHE A N   1 
ATOM   186   C  CA  . PHE A  1  22  ? 51.988  321.677 207.232 1.00 27.22  ? 22   PHE A CA  1 
ATOM   187   C  C   . PHE A  1  22  ? 51.793  320.541 206.220 1.00 25.08  ? 22   PHE A C   1 
ATOM   188   O  O   . PHE A  1  22  ? 51.185  320.725 205.144 1.00 27.28  ? 22   PHE A O   1 
ATOM   189   C  CB  . PHE A  1  22  ? 53.430  322.180 207.235 1.00 27.19  ? 22   PHE A CB  1 
ATOM   190   C  CG  . PHE A  1  22  ? 53.948  322.595 205.864 1.00 24.84  ? 22   PHE A CG  1 
ATOM   191   C  CD1 . PHE A  1  22  ? 54.492  321.662 205.016 1.00 25.80  ? 22   PHE A CD1 1 
ATOM   192   C  CD2 . PHE A  1  22  ? 53.854  323.908 205.451 1.00 27.94  ? 22   PHE A CD2 1 
ATOM   193   C  CE1 . PHE A  1  22  ? 54.914  321.989 203.773 1.00 26.50  ? 22   PHE A CE1 1 
ATOM   194   C  CE2 . PHE A  1  22  ? 54.312  324.265 204.163 1.00 25.68  ? 22   PHE A CE2 1 
ATOM   195   C  CZ  . PHE A  1  22  ? 54.866  323.279 203.349 1.00 24.73  ? 22   PHE A CZ  1 
ATOM   196   N  N   . GLY A  1  23  ? 52.354  319.363 206.538 1.00 26.66  ? 23   GLY A N   1 
ATOM   197   C  CA  . GLY A  1  23  ? 52.207  318.217 205.663 1.00 25.34  ? 23   GLY A CA  1 
ATOM   198   C  C   . GLY A  1  23  ? 50.752  317.794 205.509 1.00 31.84  ? 23   GLY A C   1 
ATOM   199   O  O   . GLY A  1  23  ? 50.316  317.369 204.416 1.00 26.36  ? 23   GLY A O   1 
ATOM   200   N  N   . ALA A  1  24  ? 49.972  317.871 206.597 1.00 26.93  ? 24   ALA A N   1 
ATOM   201   C  CA  . ALA A  1  24  ? 48.549  317.537 206.480 1.00 26.12  ? 24   ALA A CA  1 
ATOM   202   C  C   . ALA A  1  24  ? 47.849  318.510 205.544 1.00 30.59  ? 24   ALA A C   1 
ATOM   203   O  O   . ALA A  1  24  ? 47.041  318.114 204.694 1.00 28.24  ? 24   ALA A O   1 
ATOM   204   C  CB  . ALA A  1  24  ? 47.868  317.536 207.900 1.00 26.17  ? 24   ALA A CB  1 
ATOM   205   N  N   . TRP A  1  25  ? 48.128  319.794 205.683 1.00 25.20  ? 25   TRP A N   1 
ATOM   206   C  CA  . TRP A  1  25  ? 47.537  320.752 204.745 1.00 23.39  ? 25   TRP A CA  1 
ATOM   207   C  C   . TRP A  1  25  ? 47.990  320.462 203.302 1.00 34.59  ? 25   TRP A C   1 
ATOM   208   O  O   . TRP A  1  25  ? 47.171  320.439 202.383 1.00 28.29  ? 25   TRP A O   1 
ATOM   209   C  CB  . TRP A  1  25  ? 47.950  322.166 205.152 1.00 23.75  ? 25   TRP A CB  1 
ATOM   210   C  CG  . TRP A  1  25  ? 47.096  323.190 204.501 1.00 29.94  ? 25   TRP A CG  1 
ATOM   211   C  CD1 . TRP A  1  25  ? 45.845  323.599 204.907 1.00 25.76  ? 25   TRP A CD1 1 
ATOM   212   C  CD2 . TRP A  1  25  ? 47.434  323.984 203.350 1.00 32.75  ? 25   TRP A CD2 1 
ATOM   213   N  NE1 . TRP A  1  25  ? 45.382  324.588 204.047 1.00 28.19  ? 25   TRP A NE1 1 
ATOM   214   C  CE2 . TRP A  1  25  ? 46.321  324.806 203.066 1.00 29.49  ? 25   TRP A CE2 1 
ATOM   215   C  CE3 . TRP A  1  25  ? 48.552  324.035 202.484 1.00 25.56  ? 25   TRP A CE3 1 
ATOM   216   C  CZ2 . TRP A  1  25  ? 46.300  325.699 201.997 1.00 30.45  ? 25   TRP A CZ2 1 
ATOM   217   C  CZ3 . TRP A  1  25  ? 48.512  324.925 201.371 1.00 33.05  ? 25   TRP A CZ3 1 
ATOM   218   C  CH2 . TRP A  1  25  ? 47.414  325.738 201.156 1.00 33.71  ? 25   TRP A CH2 1 
ATOM   219   N  N   . ALA A  1  26  ? 49.282  320.173 203.101 1.00 25.78  ? 26   ALA A N   1 
ATOM   220   C  CA  . ALA A  1  26  ? 49.805  319.876 201.759 1.00 32.58  ? 26   ALA A CA  1 
ATOM   221   C  C   . ALA A  1  26  ? 49.117  318.659 201.142 1.00 29.60  ? 26   ALA A C   1 
ATOM   222   O  O   . ALA A  1  26  ? 48.881  318.610 199.919 1.00 26.41  ? 26   ALA A O   1 
ATOM   223   C  CB  . ALA A  1  26  ? 51.314  319.625 201.825 1.00 21.78  ? 26   ALA A CB  1 
ATOM   224   N  N   . GLY A  1  27  ? 48.891  317.638 201.979 1.00 25.81  ? 27   GLY A N   1 
ATOM   225   C  CA  . GLY A  1  27  ? 48.168  316.450 201.580 1.00 30.01  ? 27   GLY A CA  1 
ATOM   226   C  C   . GLY A  1  27  ? 46.830  316.781 200.943 1.00 28.91  ? 27   GLY A C   1 
ATOM   227   O  O   . GLY A  1  27  ? 46.407  316.108 200.014 1.00 29.11  ? 27   GLY A O   1 
ATOM   228   N  N   . MET A  1  28  ? 46.133  317.798 201.464 1.00 25.61  ? 28   MET A N   1 
ATOM   229   C  CA  . MET A  1  28  ? 44.859  318.198 200.864 1.00 30.30  ? 28   MET A CA  1 
ATOM   230   C  C   . MET A  1  28  ? 45.077  318.747 199.471 1.00 31.25  ? 28   MET A C   1 
ATOM   231   O  O   . MET A  1  28  ? 44.287  318.468 198.576 1.00 26.59  ? 28   MET A O   1 
ATOM   232   C  CB  . MET A  1  28  ? 44.159  319.274 201.695 1.00 25.54  ? 28   MET A CB  1 
ATOM   233   C  CG  . MET A  1  28  ? 43.864  318.804 203.142 1.00 30.70  ? 28   MET A CG  1 
ATOM   234   S  SD  . MET A  1  28  ? 42.780  317.339 203.175 1.00 36.24  ? 28   MET A SD  1 
ATOM   235   C  CE  . MET A  1  28  ? 43.769  316.002 203.607 1.00 35.47  ? 28   MET A CE  1 
ATOM   236   N  N   . VAL A  1  29  ? 46.055  319.633 199.324 1.00 26.53  ? 29   VAL A N   1 
ATOM   237   C  CA  . VAL A  1  29  ? 46.366  320.203 198.008 1.00 27.41  ? 29   VAL A CA  1 
ATOM   238   C  C   . VAL A  1  29  ? 46.723  319.093 197.044 1.00 28.43  ? 29   VAL A C   1 
ATOM   239   O  O   . VAL A  1  29  ? 46.268  319.066 195.885 1.00 25.46  ? 29   VAL A O   1 
ATOM   240   C  CB  . VAL A  1  29  ? 47.525  321.230 198.130 1.00 28.92  ? 29   VAL A CB  1 
ATOM   241   C  CG1 . VAL A  1  29  ? 48.032  321.856 196.665 1.00 23.62  ? 29   VAL A CG1 1 
ATOM   242   C  CG2 . VAL A  1  29  ? 47.213  322.345 199.152 1.00 26.16  ? 29   VAL A CG2 1 
ATOM   243   N  N   . GLY A  1  30  ? 47.615  318.184 197.477 1.00 24.45  ? 30   GLY A N   1 
ATOM   244   C  CA  . GLY A  1  30  ? 48.085  317.153 196.570 1.00 27.52  ? 30   GLY A CA  1 
ATOM   245   C  C   . GLY A  1  30  ? 46.982  316.201 196.180 1.00 34.12  ? 30   GLY A C   1 
ATOM   246   O  O   . GLY A  1  30  ? 46.949  315.702 195.041 1.00 27.85  ? 30   GLY A O   1 
ATOM   247   N  N   . THR A  1  31  ? 46.068  315.935 197.105 1.00 25.04  ? 31   THR A N   1 
ATOM   248   C  CA  . THR A  1  31  ? 44.946  315.052 196.809 1.00 24.95  ? 31   THR A CA  1 
ATOM   249   C  C   . THR A  1  31  ? 43.999  315.708 195.807 1.00 27.48  ? 31   THR A C   1 
ATOM   250   O  O   . THR A  1  31  ? 43.510  315.057 194.891 1.00 24.81  ? 31   THR A O   1 
ATOM   251   C  CB  . THR A  1  31  ? 44.200  314.760 198.126 1.00 27.09  ? 31   THR A CB  1 
ATOM   252   O  OG1 . THR A  1  31  ? 45.061  314.029 199.015 1.00 31.46  ? 31   THR A OG1 1 
ATOM   253   C  CG2 . THR A  1  31  ? 42.997  313.909 197.869 1.00 28.72  ? 31   THR A CG2 1 
ATOM   254   N  N   . ALA A  1  32  ? 43.677  316.991 196.017 1.00 25.19  ? 32   ALA A N   1 
ATOM   255   C  CA  . ALA A  1  32  ? 42.770  317.669 195.100 1.00 26.65  ? 32   ALA A CA  1 
ATOM   256   C  C   . ALA A  1  32  ? 43.392  317.699 193.672 1.00 27.42  ? 32   ALA A C   1 
ATOM   257   O  O   . ALA A  1  32  ? 42.693  317.487 192.677 1.00 25.58  ? 32   ALA A O   1 
ATOM   258   C  CB  . ALA A  1  32  ? 42.518  319.093 195.632 1.00 28.04  ? 32   ALA A CB  1 
ATOM   259   N  N   . LEU A  1  33  ? 44.716  317.961 193.585 1.00 28.35  ? 33   LEU A N   1 
ATOM   260   C  CA  . LEU A  1  33  ? 45.368  317.962 192.261 1.00 28.51  ? 33   LEU A CA  1 
ATOM   261   C  C   . LEU A  1  33  ? 45.233  316.575 191.625 1.00 27.90  ? 33   LEU A C   1 
ATOM   262   O  O   . LEU A  1  33  ? 44.902  316.456 190.446 1.00 29.12  ? 33   LEU A O   1 
ATOM   263   C  CB  . LEU A  1  33  ? 46.867  318.369 192.385 1.00 24.73  ? 33   LEU A CB  1 
ATOM   264   C  CG  . LEU A  1  33  ? 47.087  319.874 192.688 1.00 22.51  ? 33   LEU A CG  1 
ATOM   265   C  CD1 . LEU A  1  33  ? 48.421  320.145 193.304 1.00 27.43  ? 33   LEU A CD1 1 
ATOM   266   C  CD2 . LEU A  1  33  ? 46.952  320.683 191.358 1.00 23.68  ? 33   LEU A CD2 1 
ATOM   267   N  N   . SER A  1  34  ? 45.455  315.501 192.418 1.00 27.58  ? 34   SER A N   1 
ATOM   268   C  CA  . SER A  1  34  ? 45.302  314.142 191.895 1.00 24.18  ? 34   SER A CA  1 
ATOM   269   C  C   . SER A  1  34  ? 43.860  313.872 191.437 1.00 28.57  ? 34   SER A C   1 
ATOM   270   O  O   . SER A  1  34  ? 43.628  313.131 190.462 1.00 27.95  ? 34   SER A O   1 
ATOM   271   C  CB  . SER A  1  34  ? 45.699  313.119 192.977 1.00 24.86  ? 34   SER A CB  1 
ATOM   272   O  OG  . SER A  1  34  ? 44.618  312.848 193.884 1.00 25.51  ? 34   SER A OG  1 
ATOM   273   N  N   . LEU A  1  35  ? 42.863  314.439 192.120 1.00 26.08  ? 35   LEU A N   1 
ATOM   274   C  CA  . LEU A  1  35  ? 41.491  314.193 191.676 1.00 28.17  ? 35   LEU A CA  1 
ATOM   275   C  C   . LEU A  1  35  ? 41.208  314.901 190.371 1.00 32.52  ? 35   LEU A C   1 
ATOM   276   O  O   . LEU A  1  35  ? 40.450  314.402 189.556 1.00 28.05  ? 35   LEU A O   1 
ATOM   277   C  CB  . LEU A  1  35  ? 40.523  314.690 192.747 1.00 23.73  ? 35   LEU A CB  1 
ATOM   278   C  CG  . LEU A  1  35  ? 40.625  313.731 193.915 1.00 36.04  ? 35   LEU A CG  1 
ATOM   279   C  CD1 . LEU A  1  35  ? 39.913  314.392 195.125 1.00 28.66  ? 35   LEU A CD1 1 
ATOM   280   C  CD2 . LEU A  1  35  ? 39.934  312.441 193.607 1.00 32.49  ? 35   LEU A CD2 1 
ATOM   281   N  N   . LEU A  1  36  ? 41.765  316.096 190.185 1.00 27.39  ? 36   LEU A N   1 
ATOM   282   C  CA  . LEU A  1  36  ? 41.633  316.805 188.919 1.00 29.39  ? 36   LEU A CA  1 
ATOM   283   C  C   . LEU A  1  36  ? 42.251  315.984 187.778 1.00 28.71  ? 36   LEU A C   1 
ATOM   284   O  O   . LEU A  1  36  ? 41.658  315.878 186.705 1.00 27.78  ? 36   LEU A O   1 
ATOM   285   C  CB  . LEU A  1  36  ? 42.298  318.192 189.045 1.00 31.95  ? 36   LEU A CB  1 
ATOM   286   C  CG  . LEU A  1  36  ? 41.363  319.152 189.835 1.00 32.04  ? 36   LEU A CG  1 
ATOM   287   C  CD1 . LEU A  1  36  ? 42.156  320.314 190.446 1.00 31.07  ? 36   LEU A CD1 1 
ATOM   288   C  CD2 . LEU A  1  36  ? 40.311  319.710 188.864 1.00 27.39  ? 36   LEU A CD2 1 
ATOM   289   N  N   . ILE A  1  37  ? 43.435  315.398 188.011 1.00 28.99  ? 37   ILE A N   1 
ATOM   290   C  CA  . ILE A  1  37  ? 44.055  314.485 187.042 1.00 23.00  ? 37   ILE A CA  1 
ATOM   291   C  C   . ILE A  1  37  ? 43.061  313.418 186.613 1.00 36.44  ? 37   ILE A C   1 
ATOM   292   O  O   . ILE A  1  37  ? 42.816  313.183 185.428 1.00 27.63  ? 37   ILE A O   1 
ATOM   293   C  CB  . ILE A  1  37  ? 45.314  313.826 187.638 1.00 26.68  ? 37   ILE A CB  1 
ATOM   294   C  CG1 . ILE A  1  37  ? 46.429  314.867 187.874 1.00 24.38  ? 37   ILE A CG1 1 
ATOM   295   C  CG2 . ILE A  1  37  ? 45.755  312.726 186.665 1.00 25.04  ? 37   ILE A CG2 1 
ATOM   296   C  CD1 . ILE A  1  37  ? 47.796  314.287 188.537 1.00 24.06  ? 37   ILE A CD1 1 
ATOM   297   N  N   . ARG A  1  38  ? 42.523  312.721 187.591 1.00 28.78  ? 38   ARG A N   1 
ATOM   298   C  CA  . ARG A  1  38  ? 41.688  311.572 187.297 1.00 32.00  ? 38   ARG A CA  1 
ATOM   299   C  C   . ARG A  1  38  ? 40.314  312.004 186.791 1.00 32.35  ? 38   ARG A C   1 
ATOM   300   O  O   . ARG A  1  38  ? 39.655  311.243 186.066 1.00 27.58  ? 38   ARG A O   1 
ATOM   301   C  CB  . ARG A  1  38  ? 41.620  310.693 188.559 1.00 27.65  ? 38   ARG A CB  1 
ATOM   302   C  CG  . ARG A  1  38  ? 42.966  309.946 188.802 1.00 26.26  ? 38   ARG A CG  1 
ATOM   303   C  CD  . ARG A  1  38  ? 42.923  308.497 188.297 1.00 23.34  ? 38   ARG A CD  1 
ATOM   304   N  NE  . ARG A  1  38  ? 42.335  308.192 186.935 1.00 28.26  ? 38   ARG A NE  1 
ATOM   305   C  CZ  . ARG A  1  38  ? 43.025  307.828 185.830 1.00 28.21  ? 38   ARG A CZ  1 
ATOM   306   N  NH1 . ARG A  1  38  ? 44.368  307.835 185.799 1.00 22.69  ? 38   ARG A NH1 1 
ATOM   307   N  NH2 . ARG A  1  38  ? 42.368  307.414 184.729 1.00 24.60  ? 38   ARG A NH2 1 
ATOM   308   N  N   . ALA A  1  39  ? 39.921  313.253 187.055 1.00 27.73  ? 39   ALA A N   1 
ATOM   309   C  CA  . ALA A  1  39  ? 38.663  313.712 186.440 1.00 28.63  ? 39   ALA A CA  1 
ATOM   310   C  C   . ALA A  1  39  ? 38.837  313.967 184.952 1.00 29.03  ? 39   ALA A C   1 
ATOM   311   O  O   . ALA A  1  39  ? 37.930  313.661 184.174 1.00 26.54  ? 39   ALA A O   1 
ATOM   312   C  CB  . ALA A  1  39  ? 38.119  314.970 187.146 1.00 24.14  ? 39   ALA A CB  1 
ATOM   313   N  N   . GLU A  1  40  ? 39.956  314.580 184.564 1.00 27.76  ? 40   GLU A N   1 
ATOM   314   C  CA  . GLU A  1  40  ? 40.290  314.769 183.155 1.00 25.44  ? 40   GLU A CA  1 
ATOM   315   C  C   . GLU A  1  40  ? 40.293  313.442 182.400 1.00 34.52  ? 40   GLU A C   1 
ATOM   316   O  O   . GLU A  1  40  ? 39.822  313.347 181.267 1.00 27.92  ? 40   GLU A O   1 
ATOM   317   C  CB  . GLU A  1  40  ? 41.658  315.463 183.058 1.00 23.73  ? 40   GLU A CB  1 
ATOM   318   C  CG  . GLU A  1  40  ? 42.109  315.650 181.485 1.00 24.22  ? 40   GLU A CG  1 
ATOM   319   C  CD  . GLU A  1  40  ? 41.146  316.453 180.659 1.00 42.80  ? 40   GLU A CD  1 
ATOM   320   O  OE1 . GLU A  1  40  ? 40.634  315.923 179.592 1.00 34.30  ? 40   GLU A OE1 1 
ATOM   321   O  OE2 . GLU A  1  40  ? 40.956  317.609 181.016 1.00 32.78  ? 40   GLU A OE2 1 
ATOM   322   N  N   . LEU A  1  41  ? 40.726  312.386 183.053 1.00 25.84  ? 41   LEU A N   1 
ATOM   323   C  CA  . LEU A  1  41  ? 40.902  311.098 182.382 1.00 24.82  ? 41   LEU A CA  1 
ATOM   324   C  C   . LEU A  1  41  ? 39.730  310.159 182.600 1.00 26.85  ? 41   LEU A C   1 
ATOM   325   O  O   . LEU A  1  41  ? 39.771  309.021 182.127 1.00 28.66  ? 41   LEU A O   1 
ATOM   326   C  CB  . LEU A  1  41  ? 42.203  310.443 182.883 1.00 20.58  ? 41   LEU A CB  1 
ATOM   327   C  CG  . LEU A  1  41  ? 43.519  311.208 182.552 1.00 27.26  ? 41   LEU A CG  1 
ATOM   328   C  CD1 . LEU A  1  41  ? 44.712  310.514 183.242 1.00 25.81  ? 41   LEU A CD1 1 
ATOM   329   C  CD2 . LEU A  1  41  ? 43.796  311.170 180.994 1.00 27.43  ? 41   LEU A CD2 1 
ATOM   330   N  N   . GLY A  1  42  ? 38.727  310.567 183.385 1.00 26.26  ? 42   GLY A N   1 
ATOM   331   C  CA  . GLY A  1  42  ? 37.702  309.608 183.799 1.00 24.00  ? 42   GLY A CA  1 
ATOM   332   C  C   . GLY A  1  42  ? 36.696  309.304 182.709 1.00 29.85  ? 42   GLY A C   1 
ATOM   333   O  O   . GLY A  1  42  ? 35.928  308.346 182.833 1.00 33.04  ? 42   GLY A O   1 
ATOM   334   N  N   . GLN A  1  43  ? 36.693  310.103 181.659 1.00 29.18  ? 43   GLN A N   1 
ATOM   335   C  CA  . GLN A  1  43  ? 36.003  309.653 180.452 1.00 31.88  ? 43   GLN A CA  1 
ATOM   336   C  C   . GLN A  1  43  ? 36.752  310.185 179.239 1.00 31.55  ? 43   GLN A C   1 
ATOM   337   O  O   . GLN A  1  43  ? 37.534  311.147 179.355 1.00 28.40  ? 43   GLN A O   1 
ATOM   338   C  CB  . GLN A  1  43  ? 34.528  310.076 180.427 1.00 39.10  ? 43   GLN A CB  1 
ATOM   339   C  CG  . GLN A  1  43  ? 34.312  311.565 180.258 1.00 47.46  ? 43   GLN A CG  1 
ATOM   340   C  CD  . GLN A  1  43  ? 32.815  311.927 180.003 1.00 48.41  ? 43   GLN A CD  1 
ATOM   341   O  OE1 . GLN A  1  43  ? 31.876  311.216 180.380 1.00 39.79  ? 43   GLN A OE1 1 
ATOM   342   N  NE2 . GLN A  1  43  ? 32.618  313.034 179.365 1.00 34.64  ? 43   GLN A NE2 1 
ATOM   343   N  N   . PRO A  1  44  ? 36.594  309.543 178.079 1.00 28.05  ? 44   PRO A N   1 
ATOM   344   C  CA  . PRO A  1  44  ? 37.305  310.015 176.878 1.00 28.22  ? 44   PRO A CA  1 
ATOM   345   C  C   . PRO A  1  44  ? 36.878  311.417 176.504 1.00 29.45  ? 44   PRO A C   1 
ATOM   346   O  O   . PRO A  1  44  ? 35.725  311.794 176.688 1.00 31.74  ? 44   PRO A O   1 
ATOM   347   C  CB  . PRO A  1  44  ? 36.895  309.003 175.786 1.00 32.66  ? 44   PRO A CB  1 
ATOM   348   C  CG  . PRO A  1  44  ? 35.755  308.203 176.348 1.00 30.06  ? 44   PRO A CG  1 
ATOM   349   C  CD  . PRO A  1  44  ? 35.853  308.269 177.843 1.00 27.05  ? 44   PRO A CD  1 
ATOM   350   N  N   . GLY A  1  45  ? 37.802  312.159 175.908 1.00 29.19  ? 45   GLY A N   1 
ATOM   351   C  CA  . GLY A  1  45  ? 37.560  313.544 175.545 1.00 32.31  ? 45   GLY A CA  1 
ATOM   352   C  C   . GLY A  1  45  ? 38.295  314.488 176.467 1.00 41.01  ? 45   GLY A C   1 
ATOM   353   O  O   . GLY A  1  45  ? 39.262  314.126 177.134 1.00 33.15  ? 45   GLY A O   1 
ATOM   354   N  N   . THR A  1  46  ? 37.844  315.733 176.494 1.00 34.41  ? 46   THR A N   1 
ATOM   355   C  CA  . THR A  1  46  ? 38.482  316.728 177.319 1.00 37.37  ? 46   THR A CA  1 
ATOM   356   C  C   . THR A  1  46  ? 37.495  317.227 178.358 1.00 57.95  ? 46   THR A C   1 
ATOM   357   O  O   . THR A  1  46  ? 36.299  317.408 178.080 1.00 43.28  ? 46   THR A O   1 
ATOM   358   C  CB  . THR A  1  46  ? 39.031  317.902 176.502 1.00 40.66  ? 46   THR A CB  1 
ATOM   359   O  OG1 . THR A  1  46  ? 39.858  318.711 177.360 1.00 44.57  ? 46   THR A OG1 1 
ATOM   360   C  CG2 . THR A  1  46  ? 37.879  318.801 175.980 1.00 35.74  ? 46   THR A CG2 1 
ATOM   361   N  N   . LEU A  1  47  ? 37.996  317.390 179.575 1.00 41.09  ? 47   LEU A N   1 
ATOM   362   C  CA  . LEU A  1  47  ? 37.244  318.035 180.651 1.00 32.73  ? 47   LEU A CA  1 
ATOM   363   C  C   . LEU A  1  47  ? 37.649  319.502 180.815 1.00 44.05  ? 47   LEU A C   1 
ATOM   364   O  O   . LEU A  1  47  ? 36.814  320.404 180.830 1.00 36.63  ? 47   LEU A O   1 
ATOM   365   C  CB  . LEU A  1  47  ? 37.457  317.251 181.986 1.00 29.00  ? 47   LEU A CB  1 
ATOM   366   C  CG  . LEU A  1  47  ? 36.804  317.947 183.172 1.00 34.44  ? 47   LEU A CG  1 
ATOM   367   C  CD1 . LEU A  1  47  ? 35.264  317.896 182.967 1.00 33.06  ? 47   LEU A CD1 1 
ATOM   368   C  CD2 . LEU A  1  47  ? 37.211  317.178 184.452 1.00 35.27  ? 47   LEU A CD2 1 
ATOM   369   N  N   . LEU A  1  48  ? 38.928  319.775 180.943 1.00 35.63  ? 48   LEU A N   1 
ATOM   370   C  CA  . LEU A  1  48  ? 39.357  321.141 181.169 1.00 33.11  ? 48   LEU A CA  1 
ATOM   371   C  C   . LEU A  1  48  ? 39.447  321.918 179.866 1.00 32.67  ? 48   LEU A C   1 
ATOM   372   O  O   . LEU A  1  48  ? 39.484  323.146 179.882 1.00 44.07  ? 48   LEU A O   1 
ATOM   373   C  CB  . LEU A  1  48  ? 40.720  321.131 181.883 1.00 33.92  ? 48   LEU A CB  1 
ATOM   374   C  CG  . LEU A  1  48  ? 40.697  320.343 183.224 1.00 30.69  ? 48   LEU A CG  1 
ATOM   375   C  CD1 . LEU A  1  48  ? 42.072  320.342 183.758 1.00 33.68  ? 48   LEU A CD1 1 
ATOM   376   C  CD2 . LEU A  1  48  ? 39.770  320.973 184.224 1.00 39.24  ? 48   LEU A CD2 1 
ATOM   377   N  N   . GLY A  1  49  ? 39.534  321.220 178.749 1.00 35.87  ? 49   GLY A N   1 
ATOM   378   C  CA  . GLY A  1  49  ? 39.711  321.913 177.483 1.00 42.65  ? 49   GLY A CA  1 
ATOM   379   C  C   . GLY A  1  49  ? 40.961  322.745 177.405 1.00 54.02  ? 49   GLY A C   1 
ATOM   380   O  O   . GLY A  1  49  ? 41.005  323.698 176.629 1.00 51.49  ? 49   GLY A O   1 
ATOM   381   N  N   . ASP A  1  50  ? 41.986  322.412 178.197 1.00 39.33  ? 50   ASP A N   1 
ATOM   382   C  CA  . ASP A  1  50  ? 43.188  323.247 178.286 1.00 38.25  ? 50   ASP A CA  1 
ATOM   383   C  C   . ASP A  1  50  ? 44.297  322.317 178.795 1.00 38.09  ? 50   ASP A C   1 
ATOM   384   O  O   . ASP A  1  50  ? 44.423  322.052 179.990 1.00 34.03  ? 50   ASP A O   1 
ATOM   385   C  CB  . ASP A  1  50  ? 43.001  324.464 179.192 1.00 35.74  ? 50   ASP A CB  1 
ATOM   386   C  CG  . ASP A  1  50  ? 44.179  325.467 179.053 1.00 41.52  ? 50   ASP A CG  1 
ATOM   387   O  OD1 . ASP A  1  50  ? 45.289  325.014 178.752 1.00 44.65  ? 50   ASP A OD1 1 
ATOM   388   O  OD2 . ASP A  1  50  ? 44.006  326.702 179.226 1.00 51.54  ? 50   ASP A OD2 1 
ATOM   389   N  N   . ASP A  1  51  ? 45.027  321.745 177.836 1.00 33.46  ? 51   ASP A N   1 
ATOM   390   C  CA  . ASP A  1  51  ? 46.014  320.748 178.243 1.00 37.42  ? 51   ASP A CA  1 
ATOM   391   C  C   . ASP A  1  51  ? 47.257  321.363 178.847 1.00 33.49  ? 51   ASP A C   1 
ATOM   392   O  O   . ASP A  1  51  ? 47.997  320.654 179.550 1.00 34.26  ? 51   ASP A O   1 
ATOM   393   C  CB  . ASP A  1  51  ? 46.388  319.845 177.065 1.00 38.93  ? 51   ASP A CB  1 
ATOM   394   C  CG  . ASP A  1  51  ? 45.187  319.195 176.467 1.00 54.09  ? 51   ASP A CG  1 
ATOM   395   O  OD1 . ASP A  1  51  ? 44.419  318.680 177.266 1.00 42.67  ? 51   ASP A OD1 1 
ATOM   396   O  OD2 . ASP A  1  51  ? 44.922  319.312 175.240 1.00 63.97  ? 51   ASP A OD2 1 
ATOM   397   N  N   . GLN A  1  52  ? 47.527  322.654 178.606 1.00 30.08  ? 52   GLN A N   1 
ATOM   398   C  CA  . GLN A  1  52  ? 48.579  323.282 179.413 1.00 33.24  ? 52   GLN A CA  1 
ATOM   399   C  C   . GLN A  1  52  ? 48.179  323.256 180.891 1.00 38.56  ? 52   GLN A C   1 
ATOM   400   O  O   . GLN A  1  52  ? 49.005  322.943 181.780 1.00 29.86  ? 52   GLN A O   1 
ATOM   401   C  CB  . GLN A  1  52  ? 48.821  324.726 178.945 1.00 32.44  ? 52   GLN A CB  1 
ATOM   402   C  CG  . GLN A  1  52  ? 49.796  325.597 179.832 1.00 32.57  ? 52   GLN A CG  1 
ATOM   403   C  CD  . GLN A  1  52  ? 51.290  325.135 179.799 1.00 30.19  ? 52   GLN A CD  1 
ATOM   404   O  OE1 . GLN A  1  52  ? 51.743  324.363 178.910 1.00 34.30  ? 52   GLN A OE1 1 
ATOM   405   N  NE2 . GLN A  1  52  ? 52.066  325.641 180.770 1.00 27.07  ? 52   GLN A NE2 1 
ATOM   406   N  N   . ILE A  1  53  ? 46.904  323.527 181.179 1.00 26.91  ? 53   ILE A N   1 
ATOM   407   C  CA  . ILE A  1  53  ? 46.483  323.462 182.598 1.00 29.50  ? 53   ILE A CA  1 
ATOM   408   C  C   . ILE A  1  53  ? 46.555  322.047 183.120 1.00 29.37  ? 53   ILE A C   1 
ATOM   409   O  O   . ILE A  1  53  ? 46.951  321.833 184.281 1.00 27.60  ? 53   ILE A O   1 
ATOM   410   C  CB  . ILE A  1  53  ? 45.056  324.009 182.782 1.00 32.86  ? 53   ILE A CB  1 
ATOM   411   C  CG1 . ILE A  1  53  ? 44.987  325.496 182.433 1.00 35.97  ? 53   ILE A CG1 1 
ATOM   412   C  CG2 . ILE A  1  53  ? 44.523  323.710 184.247 1.00 33.64  ? 53   ILE A CG2 1 
ATOM   413   C  CD1 . ILE A  1  53  ? 43.505  325.994 182.368 1.00 56.48  ? 53   ILE A CD1 1 
ATOM   414   N  N   . TYR A  1  54  ? 46.111  321.052 182.329 1.00 27.06  ? 54   TYR A N   1 
ATOM   415   C  CA  . TYR A  1  54  ? 46.307  319.661 182.738 1.00 29.95  ? 54   TYR A CA  1 
ATOM   416   C  C   . TYR A  1  54  ? 47.780  319.401 183.108 1.00 28.41  ? 54   TYR A C   1 
ATOM   417   O  O   . TYR A  1  54  ? 48.081  318.848 184.181 1.00 28.05  ? 54   TYR A O   1 
ATOM   418   C  CB  . TYR A  1  54  ? 45.841  318.694 181.635 1.00 22.85  ? 54   TYR A CB  1 
ATOM   419   C  CG  . TYR A  1  54  ? 46.077  317.251 182.050 1.00 28.64  ? 54   TYR A CG  1 
ATOM   420   C  CD1 . TYR A  1  54  ? 45.214  316.636 182.971 1.00 29.03  ? 54   TYR A CD1 1 
ATOM   421   C  CD2 . TYR A  1  54  ? 47.230  316.599 181.657 1.00 24.83  ? 54   TYR A CD2 1 
ATOM   422   C  CE1 . TYR A  1  54  ? 45.398  315.346 183.399 1.00 22.71  ? 54   TYR A CE1 1 
ATOM   423   C  CE2 . TYR A  1  54  ? 47.461  315.315 182.075 1.00 24.70  ? 54   TYR A CE2 1 
ATOM   424   C  CZ  . TYR A  1  54  ? 46.524  314.682 182.956 1.00 27.47  ? 54   TYR A CZ  1 
ATOM   425   O  OH  . TYR A  1  54  ? 46.757  313.408 183.406 1.00 27.59  ? 54   TYR A OH  1 
ATOM   426   N  N   . ASN A  1  55  ? 48.724  319.832 182.244 1.00 24.99  ? 55   ASN A N   1 
ATOM   427   C  CA  . ASN A  1  55  ? 50.131  319.575 182.515 1.00 27.21  ? 55   ASN A CA  1 
ATOM   428   C  C   . ASN A  1  55  ? 50.587  320.269 183.819 1.00 28.59  ? 55   ASN A C   1 
ATOM   429   O  O   . ASN A  1  55  ? 51.414  319.733 184.555 1.00 23.12  ? 55   ASN A O   1 
ATOM   430   C  CB  . ASN A  1  55  ? 51.006  320.038 181.348 1.00 24.52  ? 55   ASN A CB  1 
ATOM   431   C  CG  . ASN A  1  55  ? 50.809  319.186 180.128 1.00 33.06  ? 55   ASN A CG  1 
ATOM   432   O  OD1 . ASN A  1  55  ? 50.215  318.107 180.209 1.00 25.95  ? 55   ASN A OD1 1 
ATOM   433   N  ND2 . ASN A  1  55  ? 51.346  319.635 179.006 1.00 29.55  ? 55   ASN A ND2 1 
ATOM   434   N  N   . VAL A  1  56  ? 50.120  321.502 184.046 1.00 25.21  ? 56   VAL A N   1 
ATOM   435   C  CA  . VAL A  1  56  ? 50.424  322.211 185.302 1.00 26.91  ? 56   VAL A CA  1 
ATOM   436   C  C   . VAL A  1  56  ? 49.928  321.431 186.517 1.00 27.85  ? 56   VAL A C   1 
ATOM   437   O  O   . VAL A  1  56  ? 50.627  321.360 187.546 1.00 25.81  ? 56   VAL A O   1 
ATOM   438   C  CB  . VAL A  1  56  ? 49.819  323.637 185.247 1.00 27.97  ? 56   VAL A CB  1 
ATOM   439   C  CG1 . VAL A  1  56  ? 49.990  324.408 186.607 1.00 25.34  ? 56   VAL A CG1 1 
ATOM   440   C  CG2 . VAL A  1  56  ? 50.587  324.464 184.212 1.00 26.49  ? 56   VAL A CG2 1 
ATOM   441   N  N   . VAL A  1  57  ? 48.716  320.847 186.423 1.00 29.22  ? 57   VAL A N   1 
ATOM   442   C  CA  . VAL A  1  57  ? 48.123  320.092 187.535 1.00 30.31  ? 57   VAL A CA  1 
ATOM   443   C  C   . VAL A  1  57  ? 48.951  318.828 187.861 1.00 28.38  ? 57   VAL A C   1 
ATOM   444   O  O   . VAL A  1  57  ? 49.252  318.534 189.021 1.00 26.41  ? 57   VAL A O   1 
ATOM   445   C  CB  . VAL A  1  57  ? 46.663  319.716 187.177 1.00 28.19  ? 57   VAL A CB  1 
ATOM   446   C  CG1 . VAL A  1  57  ? 46.146  318.576 188.125 1.00 25.75  ? 57   VAL A CG1 1 
ATOM   447   C  CG2 . VAL A  1  57  ? 45.775  320.910 187.272 1.00 25.62  ? 57   VAL A CG2 1 
ATOM   448   N  N   . VAL A  1  58  ? 49.356  318.078 186.809 1.00 23.43  ? 58   VAL A N   1 
ATOM   449   C  CA  . VAL A  1  58  ? 50.209  316.905 186.996 1.00 24.42  ? 58   VAL A CA  1 
ATOM   450   C  C   . VAL A  1  58  ? 51.508  317.304 187.677 1.00 25.45  ? 58   VAL A C   1 
ATOM   451   O  O   . VAL A  1  58  ? 51.948  316.662 188.633 1.00 24.61  ? 58   VAL A O   1 
ATOM   452   C  CB  . VAL A  1  58  ? 50.480  316.228 185.637 1.00 27.38  ? 58   VAL A CB  1 
ATOM   453   C  CG1 . VAL A  1  58  ? 51.619  315.196 185.765 1.00 21.00  ? 58   VAL A CG1 1 
ATOM   454   C  CG2 . VAL A  1  58  ? 49.154  315.602 185.115 1.00 25.19  ? 58   VAL A CG2 1 
ATOM   455   N  N   . THR A  1  59  ? 52.144  318.364 187.168 1.00 25.38  ? 59   THR A N   1 
ATOM   456   C  CA  . THR A  1  59  ? 53.431  318.810 187.692 1.00 30.09  ? 59   THR A CA  1 
ATOM   457   C  C   . THR A  1  59  ? 53.336  319.187 189.178 1.00 26.16  ? 59   THR A C   1 
ATOM   458   O  O   . THR A  1  59  ? 54.172  318.783 190.006 1.00 25.57  ? 59   THR A O   1 
ATOM   459   C  CB  . THR A  1  59  ? 53.892  320.004 186.866 1.00 26.13  ? 59   THR A CB  1 
ATOM   460   O  OG1 . THR A  1  59  ? 54.043  319.619 185.470 1.00 25.08  ? 59   THR A OG1 1 
ATOM   461   C  CG2 . THR A  1  59  ? 55.264  320.534 187.387 1.00 22.89  ? 59   THR A CG2 1 
ATOM   462   N  N   . ALA A  1  60  ? 52.358  320.023 189.504 1.00 25.91  ? 60   ALA A N   1 
ATOM   463   C  CA  . ALA A  1  60  ? 52.167  320.486 190.881 1.00 26.93  ? 60   ALA A CA  1 
ATOM   464   C  C   . ALA A  1  60  ? 51.806  319.334 191.796 1.00 28.62  ? 60   ALA A C   1 
ATOM   465   O  O   . ALA A  1  60  ? 52.223  319.316 192.954 1.00 30.86  ? 60   ALA A O   1 
ATOM   466   C  CB  . ALA A  1  60  ? 51.042  321.534 190.918 1.00 28.20  ? 60   ALA A CB  1 
ATOM   467   N  N   . HIS A  1  61  ? 50.961  318.412 191.331 1.00 25.02  ? 61   HIS A N   1 
ATOM   468   C  CA  . HIS A  1  61  ? 50.594  317.242 192.134 1.00 32.32  ? 61   HIS A CA  1 
ATOM   469   C  C   . HIS A  1  61  ? 51.842  316.554 192.656 1.00 33.87  ? 61   HIS A C   1 
ATOM   470   O  O   . HIS A  1  61  ? 51.965  316.267 193.865 1.00 27.23  ? 61   HIS A O   1 
ATOM   471   C  CB  . HIS A  1  61  ? 49.740  316.280 191.288 1.00 22.83  ? 61   HIS A CB  1 
ATOM   472   C  CG  . HIS A  1  61  ? 49.678  314.851 191.794 1.00 22.42  ? 61   HIS A CG  1 
ATOM   473   N  ND1 . HIS A  1  61  ? 49.064  314.457 192.986 1.00 22.61  ? 61   HIS A ND1 1 
ATOM   474   C  CD2 . HIS A  1  61  ? 50.168  313.715 191.238 1.00 24.16  ? 61   HIS A CD2 1 
ATOM   475   C  CE1 . HIS A  1  61  ? 49.162  313.127 193.100 1.00 27.98  ? 61   HIS A CE1 1 
ATOM   476   N  NE2 . HIS A  1  61  ? 49.851  312.659 192.069 1.00 20.19  ? 61   HIS A NE2 1 
ATOM   477   N  N   . ALA A  1  62  ? 52.800  316.310 191.767 1.00 28.40  ? 62   ALA A N   1 
ATOM   478   C  CA  . ALA A  1  62  ? 54.014  315.609 192.174 1.00 27.29  ? 62   ALA A CA  1 
ATOM   479   C  C   . ALA A  1  62  ? 54.831  316.451 193.138 1.00 25.48  ? 62   ALA A C   1 
ATOM   480   O  O   . ALA A  1  62  ? 55.309  315.944 194.159 1.00 22.70  ? 62   ALA A O   1 
ATOM   481   C  CB  . ALA A  1  62  ? 54.863  315.252 190.920 1.00 23.87  ? 62   ALA A CB  1 
ATOM   482   N  N   . PHE A  1  63  ? 55.048  317.747 192.845 1.00 23.17  ? 63   PHE A N   1 
ATOM   483   C  CA  . PHE A  1  63  ? 55.903  318.523 193.723 1.00 25.06  ? 63   PHE A CA  1 
ATOM   484   C  C   . PHE A  1  63  ? 55.272  318.610 195.118 1.00 24.33  ? 63   PHE A C   1 
ATOM   485   O  O   . PHE A  1  63  ? 55.967  318.524 196.150 1.00 23.22  ? 63   PHE A O   1 
ATOM   486   C  CB  . PHE A  1  63  ? 56.076  319.945 193.172 1.00 20.93  ? 63   PHE A CB  1 
ATOM   487   C  CG  . PHE A  1  63  ? 57.125  320.057 192.072 1.00 25.09  ? 63   PHE A CG  1 
ATOM   488   C  CD1 . PHE A  1  63  ? 58.368  319.415 192.182 1.00 22.52  ? 63   PHE A CD1 1 
ATOM   489   C  CD2 . PHE A  1  63  ? 56.834  320.757 190.916 1.00 27.43  ? 63   PHE A CD2 1 
ATOM   490   C  CE1 . PHE A  1  63  ? 59.364  319.540 191.119 1.00 22.45  ? 63   PHE A CE1 1 
ATOM   491   C  CE2 . PHE A  1  63  ? 57.786  320.896 189.914 1.00 27.22  ? 63   PHE A CE2 1 
ATOM   492   C  CZ  . PHE A  1  63  ? 59.050  320.279 190.003 1.00 27.59  ? 63   PHE A CZ  1 
ATOM   493   N  N   . VAL A  1  64  ? 53.959  318.851 195.143 1.00 22.97  ? 64   VAL A N   1 
ATOM   494   C  CA  . VAL A  1  64  ? 53.244  318.923 196.421 1.00 25.74  ? 64   VAL A CA  1 
ATOM   495   C  C   . VAL A  1  64  ? 53.351  317.611 197.202 1.00 25.40  ? 64   VAL A C   1 
ATOM   496   O  O   . VAL A  1  64  ? 53.706  317.609 198.399 1.00 24.34  ? 64   VAL A O   1 
ATOM   497   C  CB  . VAL A  1  64  ? 51.773  319.334 196.215 1.00 23.23  ? 64   VAL A CB  1 
ATOM   498   C  CG1 . VAL A  1  64  ? 50.997  319.251 197.644 1.00 21.66  ? 64   VAL A CG1 1 
ATOM   499   C  CG2 . VAL A  1  64  ? 51.774  320.766 195.714 1.00 19.61  ? 64   VAL A CG2 1 
ATOM   500   N  N   . MET A  1  65  ? 53.052  316.469 196.566 1.00 23.98  ? 65   MET A N   1 
ATOM   501   C  CA  . MET A  1  65  ? 53.037  315.229 197.338 1.00 22.69  ? 65   MET A CA  1 
ATOM   502   C  C   . MET A  1  65  ? 54.445  314.883 197.839 1.00 28.24  ? 65   MET A C   1 
ATOM   503   O  O   . MET A  1  65  ? 54.592  314.300 198.914 1.00 25.76  ? 65   MET A O   1 
ATOM   504   C  CB  . MET A  1  65  ? 52.488  314.028 196.546 1.00 22.30  ? 65   MET A CB  1 
ATOM   505   C  CG  . MET A  1  65  ? 50.994  314.072 196.143 1.00 23.19  ? 65   MET A CG  1 
ATOM   506   S  SD  . MET A  1  65  ? 50.085  314.139 197.773 1.00 27.20  ? 65   MET A SD  1 
ATOM   507   C  CE  . MET A  1  65  ? 48.545  313.317 197.261 1.00 23.77  ? 65   MET A CE  1 
ATOM   508   N  N   . ILE A  1  66  ? 55.477  315.141 197.033 1.00 22.11  ? 66   ILE A N   1 
ATOM   509   C  CA  . ILE A  1  66  ? 56.868  314.772 197.390 1.00 20.50  ? 66   ILE A CA  1 
ATOM   510   C  C   . ILE A  1  66  ? 57.464  315.755 198.366 1.00 22.41  ? 66   ILE A C   1 
ATOM   511   O  O   . ILE A  1  66  ? 57.892  315.386 199.475 1.00 24.99  ? 66   ILE A O   1 
ATOM   512   C  CB  . ILE A  1  66  ? 57.744  314.688 196.104 1.00 21.13  ? 66   ILE A CB  1 
ATOM   513   C  CG1 . ILE A  1  66  ? 57.348  313.376 195.372 1.00 21.68  ? 66   ILE A CG1 1 
ATOM   514   C  CG2 . ILE A  1  66  ? 59.246  314.668 196.501 1.00 20.87  ? 66   ILE A CG2 1 
ATOM   515   C  CD1 . ILE A  1  66  ? 58.017  313.238 193.897 1.00 23.03  ? 66   ILE A CD1 1 
ATOM   516   N  N   . PHE A  1  67  ? 57.503  317.019 198.000 1.00 25.07  ? 67   PHE A N   1 
ATOM   517   C  CA  . PHE A  1  67  ? 58.250  317.988 198.791 1.00 23.19  ? 67   PHE A CA  1 
ATOM   518   C  C   . PHE A  1  67  ? 57.465  318.596 199.954 1.00 26.31  ? 67   PHE A C   1 
ATOM   519   O  O   . PHE A  1  67  ? 58.078  319.108 200.891 1.00 23.66  ? 67   PHE A O   1 
ATOM   520   C  CB  . PHE A  1  67  ? 58.785  319.118 197.910 1.00 20.93  ? 67   PHE A CB  1 
ATOM   521   C  CG  . PHE A  1  67  ? 59.841  318.623 196.914 1.00 25.08  ? 67   PHE A CG  1 
ATOM   522   C  CD1 . PHE A  1  67  ? 61.185  318.487 197.308 1.00 27.92  ? 67   PHE A CD1 1 
ATOM   523   C  CD2 . PHE A  1  67  ? 59.463  318.215 195.660 1.00 26.13  ? 67   PHE A CD2 1 
ATOM   524   C  CE1 . PHE A  1  67  ? 62.184  317.999 196.349 1.00 29.21  ? 67   PHE A CE1 1 
ATOM   525   C  CE2 . PHE A  1  67  ? 60.406  317.680 194.708 1.00 26.22  ? 67   PHE A CE2 1 
ATOM   526   C  CZ  . PHE A  1  67  ? 61.772  317.573 195.062 1.00 24.29  ? 67   PHE A CZ  1 
ATOM   527   N  N   . PHE A  1  68  ? 56.140  318.691 199.854 1.00 21.81  ? 68   PHE A N   1 
ATOM   528   C  CA  . PHE A  1  68  ? 55.345  319.337 200.889 1.00 22.42  ? 68   PHE A CA  1 
ATOM   529   C  C   . PHE A  1  68  ? 54.533  318.370 201.716 1.00 27.25  ? 68   PHE A C   1 
ATOM   530   O  O   . PHE A  1  68  ? 54.145  318.733 202.838 1.00 28.17  ? 68   PHE A O   1 
ATOM   531   C  CB  . PHE A  1  68  ? 54.466  320.417 200.267 1.00 20.06  ? 68   PHE A CB  1 
ATOM   532   C  CG  . PHE A  1  68  ? 55.291  321.461 199.555 1.00 27.13  ? 68   PHE A CG  1 
ATOM   533   C  CD1 . PHE A  1  68  ? 56.455  321.927 200.109 1.00 26.69  ? 68   PHE A CD1 1 
ATOM   534   C  CD2 . PHE A  1  68  ? 54.917  321.942 198.286 1.00 30.58  ? 68   PHE A CD2 1 
ATOM   535   C  CE1 . PHE A  1  68  ? 57.250  322.861 199.500 1.00 25.69  ? 68   PHE A CE1 1 
ATOM   536   C  CE2 . PHE A  1  68  ? 55.802  322.921 197.596 1.00 29.36  ? 68   PHE A CE2 1 
ATOM   537   C  CZ  . PHE A  1  68  ? 56.946  323.329 198.202 1.00 25.54  ? 68   PHE A CZ  1 
ATOM   538   N  N   . MET A  1  69  ? 54.325  317.147 201.238 1.00 25.12  ? 69   MET A N   1 
ATOM   539   C  CA  . MET A  1  69  ? 53.581  316.150 202.011 1.00 21.86  ? 69   MET A CA  1 
ATOM   540   C  C   . MET A  1  69  ? 54.528  315.101 202.573 1.00 30.33  ? 69   MET A C   1 
ATOM   541   O  O   . MET A  1  69  ? 54.744  315.073 203.787 1.00 27.16  ? 69   MET A O   1 
ATOM   542   C  CB  . MET A  1  69  ? 52.430  315.512 201.189 1.00 25.85  ? 69   MET A CB  1 
ATOM   543   C  CG  . MET A  1  69  ? 51.473  314.685 202.163 1.00 25.00  ? 69   MET A CG  1 
ATOM   544   S  SD  A MET A  1  69  ? 52.002  313.008 202.382 0.70 27.02  ? 69   MET A SD  1 
ATOM   545   S  SD  B MET A  1  69  ? 50.404  313.464 201.495 0.30 26.99  ? 69   MET A SD  1 
ATOM   546   C  CE  A MET A  1  69  ? 51.697  312.273 200.740 0.70 26.61  ? 69   MET A CE  1 
ATOM   547   C  CE  B MET A  1  69  ? 51.563  312.373 200.638 0.30 25.32  ? 69   MET A CE  1 
ATOM   548   N  N   . VAL A  1  70  ? 55.164  314.266 201.733 1.00 24.59  ? 70   VAL A N   1 
ATOM   549   C  CA  . VAL A  1  70  ? 55.916  313.139 202.306 1.00 26.86  ? 70   VAL A CA  1 
ATOM   550   C  C   . VAL A  1  70  ? 57.143  313.606 203.112 1.00 32.33  ? 70   VAL A C   1 
ATOM   551   O  O   . VAL A  1  70  ? 57.364  313.151 204.244 1.00 26.27  ? 70   VAL A O   1 
ATOM   552   C  CB  . VAL A  1  70  ? 56.303  312.102 201.235 1.00 20.71  ? 70   VAL A CB  1 
ATOM   553   C  CG1 . VAL A  1  70  ? 57.270  311.022 201.850 1.00 21.26  ? 70   VAL A CG1 1 
ATOM   554   C  CG2 . VAL A  1  70  ? 55.048  311.412 200.732 1.00 20.98  ? 70   VAL A CG2 1 
ATOM   555   N  N   . MET A  1  71  ? 58.006  314.446 202.533 1.00 24.27  ? 71   MET A N   1 
ATOM   556   C  CA  . MET A  1  71  ? 59.243  314.704 203.266 1.00 28.68  ? 71   MET A CA  1 
ATOM   557   C  C   . MET A  1  71  ? 58.968  315.473 204.559 1.00 29.58  ? 71   MET A C   1 
ATOM   558   O  O   . MET A  1  71  ? 59.535  315.133 205.595 1.00 27.96  ? 71   MET A O   1 
ATOM   559   C  CB  . MET A  1  71  ? 60.232  315.471 202.399 1.00 22.61  ? 71   MET A CB  1 
ATOM   560   C  CG  . MET A  1  71  ? 60.650  314.686 201.097 1.00 32.14  ? 71   MET A CG  1 
ATOM   561   S  SD  . MET A  1  71  ? 61.584  315.787 199.942 1.00 37.32  ? 71   MET A SD  1 
ATOM   562   C  CE  . MET A  1  71  ? 62.919  315.266 200.895 1.00 22.74  ? 71   MET A CE  1 
ATOM   563   N  N   . PRO A  1  72  ? 58.126  316.499 204.543 1.00 27.38  ? 72   PRO A N   1 
ATOM   564   C  CA  . PRO A  1  72  ? 57.878  317.184 205.832 1.00 24.51  ? 72   PRO A CA  1 
ATOM   565   C  C   . PRO A  1  72  ? 57.254  316.278 206.869 1.00 31.61  ? 72   PRO A C   1 
ATOM   566   O  O   . PRO A  1  72  ? 57.593  316.389 208.051 1.00 26.20  ? 72   PRO A O   1 
ATOM   567   C  CB  . PRO A  1  72  ? 56.955  318.343 205.431 1.00 26.62  ? 72   PRO A CB  1 
ATOM   568   C  CG  . PRO A  1  72  ? 57.237  318.586 203.948 1.00 26.67  ? 72   PRO A CG  1 
ATOM   569   C  CD  . PRO A  1  72  ? 57.491  317.208 203.407 1.00 25.47  ? 72   PRO A CD  1 
ATOM   570   N  N   . ILE A  1  73  ? 56.320  315.412 206.498 1.00 24.57  ? 73   ILE A N   1 
ATOM   571   C  CA  . ILE A  1  73  ? 55.692  314.582 207.522 1.00 25.55  ? 73   ILE A CA  1 
ATOM   572   C  C   . ILE A  1  73  ? 56.706  313.584 208.078 1.00 29.64  ? 73   ILE A C   1 
ATOM   573   O  O   . ILE A  1  73  ? 56.861  313.438 209.295 1.00 28.59  ? 73   ILE A O   1 
ATOM   574   C  CB  . ILE A  1  73  ? 54.463  313.875 206.933 1.00 24.74  ? 73   ILE A CB  1 
ATOM   575   C  CG1 . ILE A  1  73  ? 53.339  314.891 206.743 1.00 24.56  ? 73   ILE A CG1 1 
ATOM   576   C  CG2 . ILE A  1  73  ? 54.043  312.687 207.826 1.00 27.12  ? 73   ILE A CG2 1 
ATOM   577   C  CD1 . ILE A  1  73  ? 52.052  314.199 205.958 1.00 28.54  ? 73   ILE A CD1 1 
ATOM   578   N  N   . MET A  1  74  ? 57.370  312.825 207.194 1.00 25.84  ? 74   MET A N   1 
ATOM   579   C  CA  . MET A  1  74  ? 58.271  311.756 207.654 1.00 28.07  ? 74   MET A CA  1 
ATOM   580   C  C   . MET A  1  74  ? 59.500  312.304 208.375 1.00 34.62  ? 74   MET A C   1 
ATOM   581   O  O   . MET A  1  74  ? 59.867  311.822 209.453 1.00 28.73  ? 74   MET A O   1 
ATOM   582   C  CB  . MET A  1  74  ? 58.741  310.896 206.486 1.00 28.62  ? 74   MET A CB  1 
ATOM   583   C  CG  . MET A  1  74  ? 57.683  309.792 206.103 1.00 27.89  ? 74   MET A CG  1 
ATOM   584   S  SD  . MET A  1  74  ? 58.523  308.979 204.741 1.00 34.51  ? 74   MET A SD  1 
ATOM   585   C  CE  . MET A  1  74  ? 57.219  307.746 204.292 1.00 28.92  ? 74   MET A CE  1 
ATOM   586   N  N   . ILE A  1  75  ? 60.180  313.266 207.771 1.00 24.09  ? 75   ILE A N   1 
ATOM   587   C  CA  . ILE A  1  75  ? 61.463  313.715 208.297 1.00 24.23  ? 75   ILE A CA  1 
ATOM   588   C  C   . ILE A  1  75  ? 61.283  314.876 209.250 1.00 31.00  ? 75   ILE A C   1 
ATOM   589   O  O   . ILE A  1  75  ? 61.780  314.863 210.386 1.00 28.14  ? 75   ILE A O   1 
ATOM   590   C  CB  . ILE A  1  75  ? 62.423  314.101 207.127 1.00 29.18  ? 75   ILE A CB  1 
ATOM   591   C  CG1 . ILE A  1  75  ? 62.594  312.931 206.152 1.00 35.19  ? 75   ILE A CG1 1 
ATOM   592   C  CG2 . ILE A  1  75  ? 63.738  314.628 207.773 1.00 28.43  ? 75   ILE A CG2 1 
ATOM   593   C  CD1 . ILE A  1  75  ? 62.999  313.421 204.605 1.00 34.21  ? 75   ILE A CD1 1 
ATOM   594   N  N   . GLY A  1  76  ? 60.541  315.899 208.811 1.00 26.06  ? 76   GLY A N   1 
ATOM   595   C  CA  . GLY A  1  76  ? 60.332  317.026 209.712 1.00 28.35  ? 76   GLY A CA  1 
ATOM   596   C  C   . GLY A  1  76  ? 59.432  316.678 210.907 1.00 27.21  ? 76   GLY A C   1 
ATOM   597   O  O   . GLY A  1  76  ? 59.575  317.257 211.969 1.00 28.80  ? 76   GLY A O   1 
ATOM   598   N  N   . GLY A  1  77  ? 58.418  315.834 210.680 1.00 25.51  ? 77   GLY A N   1 
ATOM   599   C  CA  . GLY A  1  77  ? 57.313  315.624 211.599 1.00 23.57  ? 77   GLY A CA  1 
ATOM   600   C  C   . GLY A  1  77  ? 57.673  314.491 212.514 1.00 31.84  ? 77   GLY A C   1 
ATOM   601   O  O   . GLY A  1  77  ? 58.065  314.723 213.652 1.00 26.35  ? 77   GLY A O   1 
ATOM   602   N  N   . PHE A  1  78  ? 57.666  313.261 212.007 1.00 24.02  ? 78   PHE A N   1 
ATOM   603   C  CA  . PHE A  1  78  ? 58.077  312.134 212.838 1.00 28.03  ? 78   PHE A CA  1 
ATOM   604   C  C   . PHE A  1  78  ? 59.548  312.200 213.221 1.00 29.67  ? 78   PHE A C   1 
ATOM   605   O  O   . PHE A  1  78  ? 59.926  311.796 214.326 1.00 26.41  ? 78   PHE A O   1 
ATOM   606   C  CB  . PHE A  1  78  ? 57.776  310.834 212.105 1.00 23.89  ? 78   PHE A CB  1 
ATOM   607   C  CG  . PHE A  1  78  ? 56.289  310.561 211.951 1.00 26.55  ? 78   PHE A CG  1 
ATOM   608   C  CD1 . PHE A  1  78  ? 55.541  310.119 213.071 1.00 26.58  ? 78   PHE A CD1 1 
ATOM   609   C  CD2 . PHE A  1  78  ? 55.682  310.692 210.708 1.00 28.17  ? 78   PHE A CD2 1 
ATOM   610   C  CE1 . PHE A  1  78  ? 54.210  309.838 212.987 1.00 27.45  ? 78   PHE A CE1 1 
ATOM   611   C  CE2 . PHE A  1  78  ? 54.328  310.385 210.560 1.00 28.53  ? 78   PHE A CE2 1 
ATOM   612   C  CZ  . PHE A  1  78  ? 53.569  309.983 211.683 1.00 30.33  ? 78   PHE A CZ  1 
ATOM   613   N  N   . GLY A  1  79  ? 60.428  312.671 212.316 1.00 26.47  ? 79   GLY A N   1 
ATOM   614   C  CA  . GLY A  1  79  ? 61.836  312.712 212.721 1.00 23.34  ? 79   GLY A CA  1 
ATOM   615   C  C   . GLY A  1  79  ? 62.068  313.674 213.871 1.00 24.71  ? 79   GLY A C   1 
ATOM   616   O  O   . GLY A  1  79  ? 62.729  313.339 214.851 1.00 25.36  ? 79   GLY A O   1 
ATOM   617   N  N   . ASN A  1  80  ? 61.519  314.889 213.788 1.00 24.83  ? 80   ASN A N   1 
ATOM   618   C  CA  . ASN A  1  80  ? 61.729  315.805 214.921 1.00 25.00  ? 80   ASN A CA  1 
ATOM   619   C  C   . ASN A  1  80  ? 61.062  315.336 216.216 1.00 29.02  ? 80   ASN A C   1 
ATOM   620   O  O   . ASN A  1  80  ? 61.658  315.497 217.296 1.00 26.11  ? 80   ASN A O   1 
ATOM   621   C  CB  . ASN A  1  80  ? 61.217  317.214 214.635 1.00 26.96  ? 80   ASN A CB  1 
ATOM   622   C  CG  . ASN A  1  80  ? 62.279  318.077 213.966 1.00 37.98  ? 80   ASN A CG  1 
ATOM   623   O  OD1 . ASN A  1  80  ? 63.386  318.200 214.491 1.00 41.10  ? 80   ASN A OD1 1 
ATOM   624   N  ND2 . ASN A  1  80  ? 61.954  318.656 212.786 1.00 27.96  ? 80   ASN A ND2 1 
ATOM   625   N  N   . TRP A  1  81  ? 59.854  314.779 216.139 1.00 27.06  ? 81   TRP A N   1 
ATOM   626   C  CA  . TRP A  1  81  ? 59.194  314.335 217.382 1.00 27.58  ? 81   TRP A CA  1 
ATOM   627   C  C   . TRP A  1  81  ? 59.954  313.181 218.004 1.00 29.59  ? 81   TRP A C   1 
ATOM   628   O  O   . TRP A  1  81  ? 60.183  313.131 219.223 1.00 27.84  ? 81   TRP A O   1 
ATOM   629   C  CB  . TRP A  1  81  ? 57.747  313.877 217.092 1.00 24.03  ? 81   TRP A CB  1 
ATOM   630   C  CG  . TRP A  1  81  ? 56.683  314.846 217.537 1.00 29.82  ? 81   TRP A CG  1 
ATOM   631   C  CD1 . TRP A  1  81  ? 55.895  315.745 216.764 1.00 24.78  ? 81   TRP A CD1 1 
ATOM   632   C  CD2 . TRP A  1  81  ? 56.181  314.923 218.865 1.00 26.33  ? 81   TRP A CD2 1 
ATOM   633   N  NE1 . TRP A  1  81  ? 54.986  316.372 217.607 1.00 30.51  ? 81   TRP A NE1 1 
ATOM   634   C  CE2 . TRP A  1  81  ? 55.171  315.914 218.896 1.00 29.17  ? 81   TRP A CE2 1 
ATOM   635   C  CE3 . TRP A  1  81  ? 56.591  314.340 220.072 1.00 26.33  ? 81   TRP A CE3 1 
ATOM   636   C  CZ2 . TRP A  1  81  ? 54.490  316.269 220.104 1.00 27.01  ? 81   TRP A CZ2 1 
ATOM   637   C  CZ3 . TRP A  1  81  ? 55.867  314.629 221.256 1.00 29.51  ? 81   TRP A CZ3 1 
ATOM   638   C  CH2 . TRP A  1  81  ? 54.862  315.607 221.267 1.00 28.49  ? 81   TRP A CH2 1 
ATOM   639   N  N   . LEU A  1  82  ? 60.279  312.196 217.184 1.00 24.03  ? 82   LEU A N   1 
ATOM   640   C  CA  . LEU A  1  82  ? 60.702  310.907 217.699 1.00 25.19  ? 82   LEU A CA  1 
ATOM   641   C  C   . LEU A  1  82  ? 62.201  310.752 217.891 1.00 28.19  ? 82   LEU A C   1 
ATOM   642   O  O   . LEU A  1  82  ? 62.606  310.039 218.809 1.00 24.78  ? 82   LEU A O   1 
ATOM   643   C  CB  . LEU A  1  82  ? 60.225  309.773 216.793 1.00 27.15  ? 82   LEU A CB  1 
ATOM   644   C  CG  . LEU A  1  82  ? 58.707  309.621 216.612 1.00 28.04  ? 82   LEU A CG  1 
ATOM   645   C  CD1 . LEU A  1  82  ? 58.462  308.518 215.568 1.00 24.76  ? 82   LEU A CD1 1 
ATOM   646   C  CD2 . LEU A  1  82  ? 58.045  309.242 217.951 1.00 28.17  ? 82   LEU A CD2 1 
ATOM   647   N  N   . VAL A  1  83  ? 63.048  311.290 216.992 1.00 27.86  ? 83   VAL A N   1 
ATOM   648   C  CA  . VAL A  1  83  ? 64.478  310.975 217.079 1.00 26.18  ? 83   VAL A CA  1 
ATOM   649   C  C   . VAL A  1  83  ? 65.047  311.423 218.428 1.00 28.10  ? 83   VAL A C   1 
ATOM   650   O  O   . VAL A  1  83  ? 65.770  310.642 219.046 1.00 24.51  ? 83   VAL A O   1 
ATOM   651   C  CB  . VAL A  1  83  ? 65.233  311.554 215.865 1.00 24.71  ? 83   VAL A CB  1 
ATOM   652   C  CG1 . VAL A  1  83  ? 66.757  311.644 216.114 1.00 28.32  ? 83   VAL A CG1 1 
ATOM   653   C  CG2 . VAL A  1  83  ? 64.931  310.719 214.582 1.00 24.11  ? 83   VAL A CG2 1 
ATOM   654   N  N   . PRO A  1  84  ? 64.830  312.657 218.885 1.00 23.33  ? 84   PRO A N   1 
ATOM   655   C  CA  . PRO A  1  84  ? 65.445  313.009 220.218 1.00 22.84  ? 84   PRO A CA  1 
ATOM   656   C  C   . PRO A  1  84  ? 64.909  312.158 221.360 1.00 25.33  ? 84   PRO A C   1 
ATOM   657   O  O   . PRO A  1  84  ? 65.686  311.756 222.246 1.00 29.75  ? 84   PRO A O   1 
ATOM   658   C  CB  . PRO A  1  84  ? 65.087  314.501 220.405 1.00 23.61  ? 84   PRO A CB  1 
ATOM   659   C  CG  . PRO A  1  84  ? 64.844  314.961 218.894 1.00 28.77  ? 84   PRO A CG  1 
ATOM   660   C  CD  . PRO A  1  84  ? 64.159  313.803 218.282 1.00 27.00  ? 84   PRO A CD  1 
ATOM   661   N  N   . LEU A  1  85  ? 63.605  311.830 221.340 1.00 26.04  ? 85   LEU A N   1 
ATOM   662   C  CA  . LEU A  1  85  ? 63.028  310.979 222.381 1.00 26.36  ? 85   LEU A CA  1 
ATOM   663   C  C   . LEU A  1  85  ? 63.644  309.598 222.355 1.00 31.11  ? 85   LEU A C   1 
ATOM   664   O  O   . LEU A  1  85  ? 63.935  309.028 223.415 1.00 29.11  ? 85   LEU A O   1 
ATOM   665   C  CB  . LEU A  1  85  ? 61.500  310.863 222.243 1.00 24.78  ? 85   LEU A CB  1 
ATOM   666   C  CG  . LEU A  1  85  ? 60.760  312.165 222.327 1.00 25.60  ? 85   LEU A CG  1 
ATOM   667   C  CD1 . LEU A  1  85  ? 59.251  311.926 222.158 1.00 25.92  ? 85   LEU A CD1 1 
ATOM   668   C  CD2 . LEU A  1  85  ? 61.064  312.866 223.702 1.00 25.22  ? 85   LEU A CD2 1 
ATOM   669   N  N   . MET A  1  86  ? 63.830  309.032 221.158 1.00 27.19  ? 86   MET A N   1 
ATOM   670   C  CA  . MET A  1  86  ? 64.338  307.666 221.034 1.00 25.63  ? 86   MET A CA  1 
ATOM   671   C  C   . MET A  1  86  ? 65.791  307.511 221.441 1.00 29.99  ? 86   MET A C   1 
ATOM   672   O  O   . MET A  1  86  ? 66.225  306.373 221.660 1.00 26.27  ? 86   MET A O   1 
ATOM   673   C  CB  . MET A  1  86  ? 64.205  307.176 219.561 1.00 25.37  ? 86   MET A CB  1 
ATOM   674   C  CG  . MET A  1  86  ? 62.755  306.703 219.337 1.00 24.79  ? 86   MET A CG  1 
ATOM   675   S  SD  . MET A  1  86  ? 62.582  306.217 217.586 1.00 27.42  ? 86   MET A SD  1 
ATOM   676   C  CE  . MET A  1  86  ? 60.822  305.839 217.651 1.00 25.14  ? 86   MET A CE  1 
ATOM   677   N  N   . ILE A  1  87  ? 66.553  308.595 221.497 1.00 23.81  ? 87   ILE A N   1 
ATOM   678   C  CA  . ILE A  1  87  ? 67.930  308.499 222.012 1.00 26.24  ? 87   ILE A CA  1 
ATOM   679   C  C   . ILE A  1  87  ? 68.089  309.229 223.322 1.00 33.43  ? 87   ILE A C   1 
ATOM   680   O  O   . ILE A  1  87  ? 69.219  309.473 223.715 1.00 26.56  ? 87   ILE A O   1 
ATOM   681   C  CB  . ILE A  1  87  ? 68.991  308.997 221.005 1.00 27.42  ? 87   ILE A CB  1 
ATOM   682   C  CG1 . ILE A  1  87  ? 68.761  310.486 220.750 1.00 26.94  ? 87   ILE A CG1 1 
ATOM   683   C  CG2 . ILE A  1  87  ? 68.907  308.173 219.663 1.00 29.70  ? 87   ILE A CG2 1 
ATOM   684   C  CD1 . ILE A  1  87  ? 69.840  311.146 219.769 1.00 28.58  ? 87   ILE A CD1 1 
ATOM   685   N  N   . GLY A  1  88  ? 67.000  309.677 223.939 1.00 27.53  ? 88   GLY A N   1 
ATOM   686   C  CA  . GLY A  1  88  ? 67.121  310.300 225.259 1.00 33.90  ? 88   GLY A CA  1 
ATOM   687   C  C   . GLY A  1  88  ? 67.800  311.652 225.219 1.00 29.16  ? 88   GLY A C   1 
ATOM   688   O  O   . GLY A  1  88  ? 68.361  312.097 226.223 1.00 34.86  ? 88   GLY A O   1 
ATOM   689   N  N   . ALA A  1  89  ? 67.752  312.357 224.041 1.00 28.55  ? 89   ALA A N   1 
ATOM   690   C  CA  . ALA A  1  89  ? 68.398  313.654 223.942 1.00 25.89  ? 89   ALA A CA  1 
ATOM   691   C  C   . ALA A  1  89  ? 67.442  314.777 224.322 1.00 27.48  ? 89   ALA A C   1 
ATOM   692   O  O   . ALA A  1  89  ? 66.237  314.643 224.183 1.00 30.64  ? 89   ALA A O   1 
ATOM   693   C  CB  . ALA A  1  89  ? 68.920  313.864 222.490 1.00 25.37  ? 89   ALA A CB  1 
ATOM   694   N  N   . PRO A  1  90  ? 67.936  315.915 224.815 1.00 28.79  ? 90   PRO A N   1 
ATOM   695   C  CA  . PRO A  1  90  ? 67.013  316.950 225.263 1.00 23.92  ? 90   PRO A CA  1 
ATOM   696   C  C   . PRO A  1  90  ? 66.459  317.808 224.146 1.00 31.84  ? 90   PRO A C   1 
ATOM   697   O  O   . PRO A  1  90  ? 65.514  318.555 224.386 1.00 31.14  ? 90   PRO A O   1 
ATOM   698   C  CB  . PRO A  1  90  ? 67.880  317.793 226.245 1.00 29.63  ? 90   PRO A CB  1 
ATOM   699   C  CG  . PRO A  1  90  ? 69.294  317.708 225.624 1.00 27.04  ? 90   PRO A CG  1 
ATOM   700   C  CD  . PRO A  1  90  ? 69.351  316.243 225.137 1.00 30.57  ? 90   PRO A CD  1 
ATOM   701   N  N   . ASP A  1  91  ? 67.019  317.720 222.927 1.00 30.61  ? 91   ASP A N   1 
ATOM   702   C  CA  . ASP A  1  91  ? 66.459  318.398 221.756 1.00 32.03  ? 91   ASP A CA  1 
ATOM   703   C  C   . ASP A  1  91  ? 67.348  318.030 220.581 1.00 31.30  ? 91   ASP A C   1 
ATOM   704   O  O   . ASP A  1  91  ? 68.140  317.079 220.679 1.00 28.15  ? 91   ASP A O   1 
ATOM   705   C  CB  . ASP A  1  91  ? 66.348  319.939 221.895 1.00 28.54  ? 91   ASP A CB  1 
ATOM   706   C  CG  . ASP A  1  91  ? 65.180  320.509 221.035 1.00 34.66  ? 91   ASP A CG  1 
ATOM   707   O  OD1 . ASP A  1  91  ? 65.361  320.647 219.766 1.00 32.00  ? 91   ASP A OD1 1 
ATOM   708   O  OD2 . ASP A  1  91  ? 64.035  320.680 221.584 1.00 29.65  ? 91   ASP A OD2 1 
ATOM   709   N  N   . MET A  1  92  ? 67.159  318.694 219.435 1.00 28.58  ? 92   MET A N   1 
ATOM   710   C  CA  . MET A  1  92  ? 68.105  318.565 218.310 1.00 29.58  ? 92   MET A CA  1 
ATOM   711   C  C   . MET A  1  92  ? 69.411  319.324 218.598 1.00 32.84  ? 92   MET A C   1 
ATOM   712   O  O   . MET A  1  92  ? 69.479  320.197 219.482 1.00 27.94  ? 92   MET A O   1 
ATOM   713   C  CB  . MET A  1  92  ? 67.432  319.119 217.039 1.00 25.29  ? 92   MET A CB  1 
ATOM   714   C  CG  . MET A  1  92  ? 66.127  318.358 216.624 1.00 28.16  ? 92   MET A CG  1 
ATOM   715   S  SD  . MET A  1  92  ? 66.526  316.727 215.910 1.00 31.70  ? 92   MET A SD  1 
ATOM   716   C  CE  . MET A  1  92  ? 67.175  317.308 214.279 1.00 28.19  ? 92   MET A CE  1 
ATOM   717   N  N   . ALA A  1  93  ? 70.457  319.028 217.814 1.00 24.96  ? 93   ALA A N   1 
ATOM   718   C  CA  . ALA A  1  93  ? 71.746  319.693 218.033 1.00 28.15  ? 93   ALA A CA  1 
ATOM   719   C  C   . ALA A  1  93  ? 71.632  321.182 217.784 1.00 28.76  ? 93   ALA A C   1 
ATOM   720   O  O   . ALA A  1  93  ? 72.288  321.980 218.485 1.00 29.33  ? 93   ALA A O   1 
ATOM   721   C  CB  . ALA A  1  93  ? 72.856  319.097 217.121 1.00 26.35  ? 93   ALA A CB  1 
ATOM   722   N  N   . PHE A  1  94  ? 70.849  321.595 216.771 1.00 24.38  ? 94   PHE A N   1 
ATOM   723   C  CA  . PHE A  1  94  ? 70.812  322.995 216.340 1.00 23.89  ? 94   PHE A CA  1 
ATOM   724   C  C   . PHE A  1  94  ? 69.355  323.418 216.414 1.00 28.71  ? 94   PHE A C   1 
ATOM   725   O  O   . PHE A  1  94  ? 68.639  323.456 215.407 1.00 27.96  ? 94   PHE A O   1 
ATOM   726   C  CB  . PHE A  1  94  ? 71.436  323.183 214.928 1.00 22.11  ? 94   PHE A CB  1 
ATOM   727   C  CG  . PHE A  1  94  ? 72.822  322.567 214.804 1.00 26.77  ? 94   PHE A CG  1 
ATOM   728   C  CD1 . PHE A  1  94  ? 73.829  322.843 215.768 1.00 29.91  ? 94   PHE A CD1 1 
ATOM   729   C  CD2 . PHE A  1  94  ? 73.110  321.628 213.787 1.00 26.22  ? 94   PHE A CD2 1 
ATOM   730   C  CE1 . PHE A  1  94  ? 75.098  322.262 215.686 1.00 32.91  ? 94   PHE A CE1 1 
ATOM   731   C  CE2 . PHE A  1  94  ? 74.365  321.037 213.711 1.00 26.98  ? 94   PHE A CE2 1 
ATOM   732   C  CZ  . PHE A  1  94  ? 75.382  321.371 214.669 1.00 29.35  ? 94   PHE A CZ  1 
ATOM   733   N  N   . PRO A  1  95  ? 68.837  323.646 217.630 1.00 33.12  ? 95   PRO A N   1 
ATOM   734   C  CA  . PRO A  1  95  ? 67.376  323.737 217.793 1.00 27.46  ? 95   PRO A CA  1 
ATOM   735   C  C   . PRO A  1  95  ? 66.803  324.943 217.104 1.00 31.24  ? 95   PRO A C   1 
ATOM   736   O  O   . PRO A  1  95  ? 65.600  324.963 216.837 1.00 39.48  ? 95   PRO A O   1 
ATOM   737   C  CB  . PRO A  1  95  ? 67.191  323.878 219.314 1.00 26.59  ? 95   PRO A CB  1 
ATOM   738   C  CG  . PRO A  1  95  ? 68.398  323.436 219.954 1.00 34.01  ? 95   PRO A CG  1 
ATOM   739   C  CD  . PRO A  1  95  ? 69.538  323.668 218.936 1.00 30.09  ? 95   PRO A CD  1 
ATOM   740   N  N   . ARG A  1  96  ? 67.612  325.996 216.907 1.00 31.97  ? 96   ARG A N   1 
ATOM   741   C  CA  . ARG A  1  96  ? 67.132  327.220 216.280 1.00 30.53  ? 96   ARG A CA  1 
ATOM   742   C  C   . ARG A  1  96  ? 67.276  327.105 214.756 1.00 31.95  ? 96   ARG A C   1 
ATOM   743   O  O   . ARG A  1  96  ? 66.359  327.440 214.013 1.00 32.28  ? 96   ARG A O   1 
ATOM   744   C  CB  . ARG A  1  96  ? 67.850  328.456 216.884 1.00 27.97  ? 96   ARG A CB  1 
ATOM   745   C  CG  . ARG A  1  96  ? 67.775  329.792 216.142 1.00 32.14  ? 96   ARG A CG  1 
ATOM   746   C  CD  . ARG A  1  96  ? 68.600  330.907 216.879 1.00 28.67  ? 96   ARG A CD  1 
ATOM   747   N  NE  . ARG A  1  96  ? 69.941  330.387 217.174 1.00 30.73  ? 96   ARG A NE  1 
ATOM   748   C  CZ  . ARG A  1  96  ? 70.666  330.744 218.220 1.00 35.45  ? 96   ARG A CZ  1 
ATOM   749   N  NH1 . ARG A  1  96  ? 70.210  331.663 219.091 1.00 31.58  ? 96   ARG A NH1 1 
ATOM   750   N  NH2 . ARG A  1  96  ? 71.818  330.126 218.425 1.00 28.35  ? 96   ARG A NH2 1 
ATOM   751   N  N   . MET A  1  97  ? 68.374  326.543 214.268 1.00 29.34  ? 97   MET A N   1 
ATOM   752   C  CA  . MET A  1  97  ? 68.425  326.215 212.845 1.00 27.52  ? 97   MET A CA  1 
ATOM   753   C  C   . MET A  1  97  ? 67.268  325.281 212.451 1.00 34.50  ? 97   MET A C   1 
ATOM   754   O  O   . MET A  1  97  ? 66.691  325.422 211.385 1.00 29.91  ? 97   MET A O   1 
ATOM   755   C  CB  . MET A  1  97  ? 69.763  325.559 212.478 1.00 25.34  ? 97   MET A CB  1 
ATOM   756   C  CG  . MET A  1  97  ? 69.898  325.458 210.932 1.00 28.42  ? 97   MET A CG  1 
ATOM   757   S  SD  . MET A  1  97  ? 71.587  324.979 210.453 1.00 32.47  ? 97   MET A SD  1 
ATOM   758   C  CE  . MET A  1  97  ? 71.485  323.215 210.853 1.00 24.78  ? 97   MET A CE  1 
ATOM   759   N  N   . ASN A  1  98  ? 66.933  324.320 213.313 1.00 26.87  ? 98   ASN A N   1 
ATOM   760   C  CA  . ASN A  1  98  ? 65.757  323.453 213.090 1.00 28.95  ? 98   ASN A CA  1 
ATOM   761   C  C   . ASN A  1  98  ? 64.499  324.243 212.721 1.00 29.77  ? 98   ASN A C   1 
ATOM   762   O  O   . ASN A  1  98  ? 63.726  323.843 211.835 1.00 26.73  ? 98   ASN A O   1 
ATOM   763   C  CB  . ASN A  1  98  ? 65.516  322.637 214.362 1.00 26.61  ? 98   ASN A CB  1 
ATOM   764   C  CG  . ASN A  1  98  ? 64.702  321.402 214.129 1.00 37.00  ? 98   ASN A CG  1 
ATOM   765   O  OD1 . ASN A  1  98  ? 64.639  320.911 213.040 1.00 35.62  ? 98   ASN A OD1 1 
ATOM   766   N  ND2 . ASN A  1  98  ? 64.028  320.919 215.173 1.00 32.60  ? 98   ASN A ND2 1 
ATOM   767   N  N   . ASN A  1  99  ? 64.258  325.360 213.414 1.00 28.05  ? 99   ASN A N   1 
ATOM   768   C  CA  . ASN A  1  99  ? 63.079  326.176 213.170 1.00 29.18  ? 99   ASN A CA  1 
ATOM   769   C  C   . ASN A  1  99  ? 63.134  326.830 211.797 1.00 27.33  ? 99   ASN A C   1 
ATOM   770   O  O   . ASN A  1  99  ? 62.087  327.099 211.185 1.00 24.99  ? 99   ASN A O   1 
ATOM   771   C  CB  . ASN A  1  99  ? 62.945  327.297 214.254 1.00 22.92  ? 99   ASN A CB  1 
ATOM   772   C  CG  . ASN A  1  99  ? 61.519  327.812 214.382 1.00 29.75  ? 99   ASN A CG  1 
ATOM   773   O  OD1 . ASN A  1  99  ? 60.596  327.024 214.321 1.00 27.53  ? 99   ASN A OD1 1 
ATOM   774   N  ND2 . ASN A  1  99  ? 61.336  329.113 214.532 1.00 25.37  ? 99   ASN A ND2 1 
ATOM   775   N  N   . MET A  1  100 ? 64.333  327.149 211.297 1.00 26.53  ? 100  MET A N   1 
ATOM   776   C  CA  . MET A  1  100 ? 64.386  327.765 209.977 1.00 22.51  ? 100  MET A CA  1 
ATOM   777   C  C   . MET A  1  100 ? 64.095  326.735 208.902 1.00 29.41  ? 100  MET A C   1 
ATOM   778   O  O   . MET A  1  100 ? 63.445  327.067 207.895 1.00 28.76  ? 100  MET A O   1 
ATOM   779   C  CB  . MET A  1  100 ? 65.706  328.481 209.745 1.00 24.14  ? 100  MET A CB  1 
ATOM   780   C  CG  . MET A  1  100 ? 65.670  329.272 208.355 1.00 29.45  ? 100  MET A CG  1 
ATOM   781   S  SD  . MET A  1  100 ? 67.096  330.281 208.121 1.00 32.39  ? 100  MET A SD  1 
ATOM   782   C  CE  . MET A  1  100 ? 68.366  329.004 208.105 1.00 28.83  ? 100  MET A CE  1 
ATOM   783   N  N   . SER A  1  101 ? 64.531  325.479 209.113 1.00 25.19  ? 101  SER A N   1 
ATOM   784   C  CA  . SER A  1  101 ? 64.119  324.408 208.179 1.00 26.31  ? 101  SER A CA  1 
ATOM   785   C  C   . SER A  1  101 ? 62.610  324.352 208.057 1.00 29.72  ? 101  SER A C   1 
ATOM   786   O  O   . SER A  1  101 ? 62.072  324.209 206.948 1.00 26.04  ? 101  SER A O   1 
ATOM   787   C  CB  . SER A  1  101 ? 64.654  323.043 208.643 1.00 27.35  ? 101  SER A CB  1 
ATOM   788   O  OG  . SER A  1  101 ? 66.040  322.953 208.286 1.00 32.77  ? 101  SER A OG  1 
ATOM   789   N  N   . PHE A  1  102 ? 61.880  324.470 209.183 1.00 27.58  ? 102  PHE A N   1 
ATOM   790   C  CA  . PHE A  1  102 ? 60.429  324.512 209.054 1.00 26.09  ? 102  PHE A CA  1 
ATOM   791   C  C   . PHE A  1  102 ? 59.960  325.741 208.302 1.00 27.94  ? 102  PHE A C   1 
ATOM   792   O  O   . PHE A  1  102 ? 59.205  325.632 207.310 1.00 27.51  ? 102  PHE A O   1 
ATOM   793   C  CB  . PHE A  1  102 ? 59.711  324.444 210.432 1.00 24.23  ? 102  PHE A CB  1 
ATOM   794   C  CG  . PHE A  1  102 ? 58.255  324.636 210.222 1.00 28.75  ? 102  PHE A CG  1 
ATOM   795   C  CD1 . PHE A  1  102 ? 57.534  323.614 209.639 1.00 26.16  ? 102  PHE A CD1 1 
ATOM   796   C  CD2 . PHE A  1  102 ? 57.664  325.864 210.419 1.00 27.25  ? 102  PHE A CD2 1 
ATOM   797   C  CE1 . PHE A  1  102 ? 56.171  323.760 209.311 1.00 24.83  ? 102  PHE A CE1 1 
ATOM   798   C  CE2 . PHE A  1  102 ? 56.316  326.056 210.095 1.00 27.41  ? 102  PHE A CE2 1 
ATOM   799   C  CZ  . PHE A  1  102 ? 55.550  324.988 209.516 1.00 29.49  ? 102  PHE A CZ  1 
ATOM   800   N  N   . TRP A  1  103 ? 60.357  326.930 208.736 1.00 25.78  ? 103  TRP A N   1 
ATOM   801   C  CA  . TRP A  1  103 ? 59.732  328.130 208.191 1.00 28.91  ? 103  TRP A CA  1 
ATOM   802   C  C   . TRP A  1  103 ? 60.165  328.428 206.750 1.00 24.59  ? 103  TRP A C   1 
ATOM   803   O  O   . TRP A  1  103 ? 59.522  329.268 206.100 1.00 26.29  ? 103  TRP A O   1 
ATOM   804   C  CB  . TRP A  1  103 ? 60.028  329.355 209.084 1.00 24.22  ? 103  TRP A CB  1 
ATOM   805   C  CG  . TRP A  1  103 ? 59.120  329.342 210.281 1.00 32.25  ? 103  TRP A CG  1 
ATOM   806   C  CD1 . TRP A  1  103 ? 59.473  329.081 211.626 1.00 29.61  ? 103  TRP A CD1 1 
ATOM   807   C  CD2 . TRP A  1  103 ? 57.717  329.458 210.250 1.00 33.47  ? 103  TRP A CD2 1 
ATOM   808   N  NE1 . TRP A  1  103 ? 58.337  329.068 212.389 1.00 32.98  ? 103  TRP A NE1 1 
ATOM   809   C  CE2 . TRP A  1  103 ? 57.253  329.315 211.578 1.00 31.43  ? 103  TRP A CE2 1 
ATOM   810   C  CE3 . TRP A  1  103 ? 56.777  329.713 209.218 1.00 29.07  ? 103  TRP A CE3 1 
ATOM   811   C  CZ2 . TRP A  1  103 ? 55.924  329.382 211.903 1.00 27.41  ? 103  TRP A CZ2 1 
ATOM   812   C  CZ3 . TRP A  1  103 ? 55.430  329.780 209.561 1.00 32.76  ? 103  TRP A CZ3 1 
ATOM   813   C  CH2 . TRP A  1  103 ? 55.019  329.631 210.888 1.00 33.61  ? 103  TRP A CH2 1 
ATOM   814   N  N   . LEU A  1  104 ? 61.166  327.744 206.218 1.00 25.71  ? 104  LEU A N   1 
ATOM   815   C  CA  . LEU A  1  104 ? 61.423  327.868 204.764 1.00 28.17  ? 104  LEU A CA  1 
ATOM   816   C  C   . LEU A  1  104 ? 60.343  327.177 203.925 1.00 25.74  ? 104  LEU A C   1 
ATOM   817   O  O   . LEU A  1  104 ? 60.245  327.453 202.743 1.00 28.96  ? 104  LEU A O   1 
ATOM   818   C  CB  . LEU A  1  104 ? 62.787  327.263 204.389 1.00 26.62  ? 104  LEU A CB  1 
ATOM   819   C  CG  . LEU A  1  104 ? 64.012  328.148 204.747 1.00 25.86  ? 104  LEU A CG  1 
ATOM   820   C  CD1 . LEU A  1  104 ? 65.303  327.301 204.691 1.00 24.05  ? 104  LEU A CD1 1 
ATOM   821   C  CD2 . LEU A  1  104 ? 64.190  329.289 203.700 1.00 26.94  ? 104  LEU A CD2 1 
ATOM   822   N  N   . LEU A  1  105 ? 59.543  326.254 204.508 1.00 25.87  ? 105  LEU A N   1 
ATOM   823   C  CA  . LEU A  1  105 ? 58.618  325.511 203.647 1.00 31.22  ? 105  LEU A CA  1 
ATOM   824   C  C   . LEU A  1  105 ? 57.340  326.297 203.278 1.00 26.19  ? 105  LEU A C   1 
ATOM   825   O  O   . LEU A  1  105 ? 56.886  326.188 202.119 1.00 26.31  ? 105  LEU A O   1 
ATOM   826   C  CB  . LEU A  1  105 ? 58.295  324.153 204.285 1.00 26.72  ? 105  LEU A CB  1 
ATOM   827   C  CG  . LEU A  1  105 ? 59.462  323.153 204.409 1.00 28.28  ? 105  LEU A CG  1 
ATOM   828   C  CD1 . LEU A  1  105 ? 59.005  321.790 204.917 1.00 28.02  ? 105  LEU A CD1 1 
ATOM   829   C  CD2 . LEU A  1  105 ? 60.119  322.957 202.983 1.00 29.09  ? 105  LEU A CD2 1 
ATOM   830   N  N   . PRO A  1  106 ? 56.727  327.094 204.154 1.00 28.68  ? 106  PRO A N   1 
ATOM   831   C  CA  . PRO A  1  106 ? 55.575  327.885 203.698 1.00 28.61  ? 106  PRO A CA  1 
ATOM   832   C  C   . PRO A  1  106 ? 55.970  328.814 202.560 1.00 29.49  ? 106  PRO A C   1 
ATOM   833   O  O   . PRO A  1  106 ? 55.248  328.891 201.550 1.00 30.92  ? 106  PRO A O   1 
ATOM   834   C  CB  . PRO A  1  106 ? 55.098  328.646 204.972 1.00 25.71  ? 106  PRO A CB  1 
ATOM   835   C  CG  . PRO A  1  106 ? 55.518  327.649 206.128 1.00 27.86  ? 106  PRO A CG  1 
ATOM   836   C  CD  . PRO A  1  106 ? 56.854  327.078 205.645 1.00 26.30  ? 106  PRO A CD  1 
ATOM   837   N  N   . PRO A  1  107 ? 57.115  329.507 202.631 1.00 29.86  ? 107  PRO A N   1 
ATOM   838   C  CA  . PRO A  1  107 ? 57.516  330.304 201.457 1.00 28.17  ? 107  PRO A CA  1 
ATOM   839   C  C   . PRO A  1  107 ? 57.787  329.448 200.219 1.00 30.49  ? 107  PRO A C   1 
ATOM   840   O  O   . PRO A  1  107 ? 57.470  329.878 199.129 1.00 28.62  ? 107  PRO A O   1 
ATOM   841   C  CB  . PRO A  1  107 ? 58.811  331.026 201.885 1.00 33.99  ? 107  PRO A CB  1 
ATOM   842   C  CG  . PRO A  1  107 ? 58.950  330.844 203.372 1.00 32.56  ? 107  PRO A CG  1 
ATOM   843   C  CD  . PRO A  1  107 ? 57.984  329.762 203.803 1.00 27.46  ? 107  PRO A CD  1 
ATOM   844   N  N   . SER A  1  108 ? 58.441  328.291 200.369 1.00 29.91  ? 108  SER A N   1 
ATOM   845   C  CA  . SER A  1  108 ? 58.630  327.398 199.237 1.00 31.09  ? 108  SER A CA  1 
ATOM   846   C  C   . SER A  1  108 ? 57.290  327.055 198.569 1.00 32.66  ? 108  SER A C   1 
ATOM   847   O  O   . SER A  1  108 ? 57.183  327.026 197.348 1.00 28.22  ? 108  SER A O   1 
ATOM   848   C  CB  . SER A  1  108 ? 59.327  326.110 199.680 1.00 26.54  ? 108  SER A CB  1 
ATOM   849   O  OG  . SER A  1  108 ? 59.526  325.247 198.497 1.00 27.76  ? 108  SER A OG  1 
ATOM   850   N  N   . PHE A  1  109 ? 56.295  326.689 199.372 1.00 26.87  ? 109  PHE A N   1 
ATOM   851   C  CA  . PHE A  1  109 ? 54.973  326.299 198.879 1.00 25.35  ? 109  PHE A CA  1 
ATOM   852   C  C   . PHE A  1  109 ? 54.290  327.483 198.239 1.00 32.13  ? 109  PHE A C   1 
ATOM   853   O  O   . PHE A  1  109 ? 53.624  327.346 197.208 1.00 30.01  ? 109  PHE A O   1 
ATOM   854   C  CB  . PHE A  1  109 ? 54.123  325.744 200.049 1.00 27.91  ? 109  PHE A CB  1 
ATOM   855   C  CG  . PHE A  1  109 ? 53.013  324.790 199.646 1.00 32.45  ? 109  PHE A CG  1 
ATOM   856   C  CD1 . PHE A  1  109 ? 52.516  324.731 198.347 1.00 33.82  ? 109  PHE A CD1 1 
ATOM   857   C  CD2 . PHE A  1  109 ? 52.443  323.941 200.619 1.00 29.47  ? 109  PHE A CD2 1 
ATOM   858   C  CE1 . PHE A  1  109 ? 51.493  323.850 198.004 1.00 33.52  ? 109  PHE A CE1 1 
ATOM   859   C  CE2 . PHE A  1  109 ? 51.429  323.050 200.292 1.00 31.32  ? 109  PHE A CE2 1 
ATOM   860   C  CZ  . PHE A  1  109 ? 50.941  322.996 198.939 1.00 26.46  ? 109  PHE A CZ  1 
ATOM   861   N  N   . LEU A  1  110 ? 54.446  328.657 198.845 1.00 27.28  ? 110  LEU A N   1 
ATOM   862   C  CA  . LEU A  1  110 ? 53.905  329.868 198.225 1.00 26.14  ? 110  LEU A CA  1 
ATOM   863   C  C   . LEU A  1  110 ? 54.503  330.100 196.834 1.00 33.09  ? 110  LEU A C   1 
ATOM   864   O  O   . LEU A  1  110 ? 53.809  330.540 195.905 1.00 27.16  ? 110  LEU A O   1 
ATOM   865   C  CB  . LEU A  1  110 ? 54.183  331.063 199.135 1.00 26.93  ? 110  LEU A CB  1 
ATOM   866   C  CG  . LEU A  1  110 ? 53.800  332.452 198.583 1.00 36.64  ? 110  LEU A CG  1 
ATOM   867   C  CD1 . LEU A  1  110 ? 52.332  332.473 198.335 1.00 31.26  ? 110  LEU A CD1 1 
ATOM   868   C  CD2 . LEU A  1  110 ? 54.173  333.550 199.592 1.00 35.62  ? 110  LEU A CD2 1 
ATOM   869   N  N   . LEU A  1  111 ? 55.799  329.890 196.689 1.00 28.50  ? 111  LEU A N   1 
ATOM   870   C  CA  . LEU A  1  111 ? 56.403  330.066 195.375 1.00 25.49  ? 111  LEU A CA  1 
ATOM   871   C  C   . LEU A  1  111 ? 55.836  329.072 194.366 1.00 29.28  ? 111  LEU A C   1 
ATOM   872   O  O   . LEU A  1  111 ? 55.648  329.399 193.185 1.00 28.54  ? 111  LEU A O   1 
ATOM   873   C  CB  . LEU A  1  111 ? 57.923  329.928 195.467 1.00 27.27  ? 111  LEU A CB  1 
ATOM   874   C  CG  . LEU A  1  111 ? 58.665  331.040 196.241 1.00 28.84  ? 111  LEU A CG  1 
ATOM   875   C  CD1 . LEU A  1  111 ? 60.150  330.659 196.562 1.00 32.34  ? 111  LEU A CD1 1 
ATOM   876   C  CD2 . LEU A  1  111 ? 58.624  332.372 195.497 1.00 32.08  ? 111  LEU A CD2 1 
ATOM   877   N  N   . LEU A  1  112 ? 55.644  327.828 194.770 1.00 25.49  ? 112  LEU A N   1 
ATOM   878   C  CA  . LEU A  1  112 ? 55.013  326.871 193.876 1.00 24.96  ? 112  LEU A CA  1 
ATOM   879   C  C   . LEU A  1  112 ? 53.604  327.343 193.483 1.00 35.31  ? 112  LEU A C   1 
ATOM   880   O  O   . LEU A  1  112 ? 53.191  327.270 192.305 1.00 32.30  ? 112  LEU A O   1 
ATOM   881   C  CB  . LEU A  1  112 ? 54.983  325.490 194.544 1.00 30.73  ? 112  LEU A CB  1 
ATOM   882   C  CG  . LEU A  1  112 ? 54.517  324.410 193.524 1.00 29.59  ? 112  LEU A CG  1 
ATOM   883   C  CD1 . LEU A  1  112 ? 55.708  324.219 192.394 1.00 35.96  ? 112  LEU A CD1 1 
ATOM   884   C  CD2 . LEU A  1  112 ? 54.183  323.039 194.115 1.00 32.65  ? 112  LEU A CD2 1 
ATOM   885   N  N   . LEU A  1  113 ? 52.831  327.797 194.450 1.00 29.94  ? 113  LEU A N   1 
ATOM   886   C  CA  . LEU A  1  113 ? 51.478  328.237 194.108 1.00 30.20  ? 113  LEU A CA  1 
ATOM   887   C  C   . LEU A  1  113 ? 51.536  329.463 193.195 1.00 36.28  ? 113  LEU A C   1 
ATOM   888   O  O   . LEU A  1  113 ? 50.739  329.582 192.257 1.00 32.56  ? 113  LEU A O   1 
ATOM   889   C  CB  . LEU A  1  113 ? 50.660  328.476 195.414 1.00 32.56  ? 113  LEU A CB  1 
ATOM   890   C  CG  . LEU A  1  113 ? 50.321  327.138 196.171 1.00 41.99  ? 113  LEU A CG  1 
ATOM   891   C  CD1 . LEU A  1  113 ? 49.618  327.359 197.593 1.00 56.04  ? 113  LEU A CD1 1 
ATOM   892   C  CD2 . LEU A  1  113 ? 49.529  326.048 195.404 1.00 39.11  ? 113  LEU A CD2 1 
ATOM   893   N  N   . ALA A  1  114 ? 52.514  330.339 193.420 1.00 29.57  ? 114  ALA A N   1 
ATOM   894   C  CA  . ALA A  1  114 ? 52.695  331.496 192.562 1.00 34.04  ? 114  ALA A CA  1 
ATOM   895   C  C   . ALA A  1  114 ? 52.953  331.059 191.132 1.00 36.29  ? 114  ALA A C   1 
ATOM   896   O  O   . ALA A  1  114 ? 52.410  331.630 190.185 1.00 33.76  ? 114  ALA A O   1 
ATOM   897   C  CB  . ALA A  1  114 ? 53.873  332.344 193.067 1.00 29.10  ? 114  ALA A CB  1 
ATOM   898   N  N   . SER A  1  115 ? 53.824  330.059 190.947 1.00 31.73  ? 115  SER A N   1 
ATOM   899   C  CA  . SER A  1  115 ? 54.131  329.626 189.592 1.00 29.32  ? 115  SER A CA  1 
ATOM   900   C  C   . SER A  1  115 ? 52.859  329.222 188.831 1.00 30.39  ? 115  SER A C   1 
ATOM   901   O  O   . SER A  1  115 ? 52.750  329.460 187.617 1.00 30.68  ? 115  SER A O   1 
ATOM   902   C  CB  . SER A  1  115 ? 55.136  328.470 189.626 1.00 29.38  ? 115  SER A CB  1 
ATOM   903   O  OG  . SER A  1  115 ? 54.488  327.271 190.005 1.00 41.52  ? 115  SER A OG  1 
ATOM   904   N  N   . SER A  1  116 ? 51.888  328.604 189.528 1.00 26.68  ? 116  SER A N   1 
ATOM   905   C  CA  . SER A  1  116 ? 50.679  328.095 188.890 1.00 30.06  ? 116  SER A CA  1 
ATOM   906   C  C   . SER A  1  116 ? 49.689  329.203 188.609 1.00 35.03  ? 116  SER A C   1 
ATOM   907   O  O   . SER A  1  116 ? 48.840  329.055 187.706 1.00 33.87  ? 116  SER A O   1 
ATOM   908   C  CB  . SER A  1  116 ? 50.034  327.016 189.748 1.00 32.65  ? 116  SER A CB  1 
ATOM   909   O  OG  . SER A  1  116 ? 49.406  327.634 190.884 1.00 34.06  ? 116  SER A OG  1 
ATOM   910   N  N   . MET A  1  117 ? 49.841  330.336 189.292 1.00 31.61  ? 117  MET A N   1 
ATOM   911   C  CA  . MET A  1  117 ? 48.929  331.470 189.179 1.00 34.75  ? 117  MET A CA  1 
ATOM   912   C  C   . MET A  1  117 ? 49.371  332.479 188.135 1.00 35.54  ? 117  MET A C   1 
ATOM   913   O  O   . MET A  1  117 ? 48.523  333.174 187.571 1.00 37.46  ? 117  MET A O   1 
ATOM   914   C  CB  . MET A  1  117 ? 48.814  332.226 190.529 1.00 30.65  ? 117  MET A CB  1 
ATOM   915   C  CG  . MET A  1  117 ? 48.137  331.477 191.688 1.00 43.22  ? 117  MET A CG  1 
ATOM   916   S  SD  . MET A  1  117 ? 46.399  331.284 191.230 1.00 63.06  ? 117  MET A SD  1 
ATOM   917   C  CE  . MET A  1  117 ? 45.801  332.957 191.532 1.00 71.49  ? 117  MET A CE  1 
ATOM   918   N  N   . VAL A  1  118 ? 50.671  332.646 187.919 1.00 30.84  ? 118  VAL A N   1 
ATOM   919   C  CA  . VAL A  1  118 ? 51.140  333.595 186.912 1.00 30.27  ? 118  VAL A CA  1 
ATOM   920   C  C   . VAL A  1  118 ? 51.252  332.895 185.555 1.00 31.80  ? 118  VAL A C   1 
ATOM   921   O  O   . VAL A  1  118 ? 51.374  331.669 185.464 1.00 34.57  ? 118  VAL A O   1 
ATOM   922   C  CB  . VAL A  1  118 ? 52.472  334.277 187.292 1.00 39.62  ? 118  VAL A CB  1 
ATOM   923   C  CG1 . VAL A  1  118 ? 52.350  334.946 188.684 1.00 34.23  ? 118  VAL A CG1 1 
ATOM   924   C  CG2 . VAL A  1  118 ? 53.670  333.261 187.247 1.00 31.43  ? 118  VAL A CG2 1 
ATOM   925   N  N   . GLU A  1  119 ? 51.176  333.706 184.502 1.00 37.86  ? 119  GLU A N   1 
ATOM   926   C  CA  . GLU A  1  119 ? 51.265  333.247 183.106 1.00 35.32  ? 119  GLU A CA  1 
ATOM   927   C  C   . GLU A  1  119 ? 50.366  332.037 182.910 1.00 31.38  ? 119  GLU A C   1 
ATOM   928   O  O   . GLU A  1  119 ? 49.188  332.083 183.301 1.00 34.01  ? 119  GLU A O   1 
ATOM   929   C  CB  . GLU A  1  119 ? 52.743  332.975 182.791 1.00 32.11  ? 119  GLU A CB  1 
ATOM   930   C  CG  . GLU A  1  119 ? 53.601  334.147 183.051 1.00 36.49  ? 119  GLU A CG  1 
ATOM   931   C  CD  . GLU A  1  119 ? 53.284  335.276 182.014 1.00 56.39  ? 119  GLU A CD  1 
ATOM   932   O  OE1 . GLU A  1  119 ? 53.530  336.463 182.281 1.00 63.09  ? 119  GLU A OE1 1 
ATOM   933   O  OE2 . GLU A  1  119 ? 52.745  334.964 180.934 1.00 51.72  ? 119  GLU A OE2 1 
ATOM   934   N  N   . ALA A  1  120 ? 50.880  330.939 182.358 1.00 31.43  ? 120  ALA A N   1 
ATOM   935   C  CA  . ALA A  1  120 ? 50.108  329.729 182.121 1.00 32.41  ? 120  ALA A CA  1 
ATOM   936   C  C   . ALA A  1  120 ? 50.638  328.598 182.960 1.00 29.62  ? 120  ALA A C   1 
ATOM   937   O  O   . ALA A  1  120 ? 50.322  327.441 182.691 1.00 28.68  ? 120  ALA A O   1 
ATOM   938   C  CB  . ALA A  1  120 ? 50.116  329.346 180.616 1.00 33.57  ? 120  ALA A CB  1 
ATOM   939   N  N   . GLY A  1  121 ? 51.368  328.899 184.053 1.00 34.13  ? 121  GLY A N   1 
ATOM   940   C  CA  . GLY A  1  121 ? 51.859  327.845 184.920 1.00 26.89  ? 121  GLY A CA  1 
ATOM   941   C  C   . GLY A  1  121 ? 53.075  327.126 184.336 1.00 32.40  ? 121  GLY A C   1 
ATOM   942   O  O   . GLY A  1  121 ? 53.488  327.347 183.209 1.00 27.09  ? 121  GLY A O   1 
ATOM   943   N  N   . ALA A  1  122 ? 53.652  326.240 185.121 1.00 29.31  ? 122  ALA A N   1 
ATOM   944   C  CA  . ALA A  1  122 ? 54.785  325.458 184.669 1.00 28.04  ? 122  ALA A CA  1 
ATOM   945   C  C   . ALA A  1  122 ? 54.264  324.070 184.303 1.00 32.77  ? 122  ALA A C   1 
ATOM   946   O  O   . ALA A  1  122 ? 54.055  323.243 185.173 1.00 27.19  ? 122  ALA A O   1 
ATOM   947   C  CB  . ALA A  1  122 ? 55.886  325.415 185.753 1.00 30.26  ? 122  ALA A CB  1 
ATOM   948   N  N   . GLY A  1  123 ? 54.052  323.814 182.995 1.00 28.29  ? 123  GLY A N   1 
ATOM   949   C  CA  . GLY A  1  123 ? 53.444  322.574 182.594 1.00 26.79  ? 123  GLY A CA  1 
ATOM   950   C  C   . GLY A  1  123 ? 54.517  321.630 182.095 1.00 31.69  ? 123  GLY A C   1 
ATOM   951   O  O   . GLY A  1  123 ? 54.535  321.304 180.908 1.00 27.06  ? 123  GLY A O   1 
ATOM   952   N  N   . THR A  1  124 ? 55.476  321.286 182.964 1.00 28.32  ? 124  THR A N   1 
ATOM   953   C  CA  . THR A  1  124 ? 56.759  320.710 182.565 1.00 26.56  ? 124  THR A CA  1 
ATOM   954   C  C   . THR A  1  124 ? 56.927  319.244 182.921 1.00 28.03  ? 124  THR A C   1 
ATOM   955   O  O   . THR A  1  124 ? 57.867  318.609 182.439 1.00 28.70  ? 124  THR A O   1 
ATOM   956   C  CB  . THR A  1  124 ? 57.895  321.496 183.243 1.00 28.02  ? 124  THR A CB  1 
ATOM   957   O  OG1 . THR A  1  124 ? 57.639  321.548 184.650 1.00 27.48  ? 124  THR A OG1 1 
ATOM   958   C  CG2 . THR A  1  124 ? 57.915  322.930 182.694 1.00 28.66  ? 124  THR A CG2 1 
ATOM   959   N  N   . GLY A  1  125 ? 56.082  318.715 183.812 1.00 27.39  ? 125  GLY A N   1 
ATOM   960   C  CA  . GLY A  1  125 ? 56.421  317.491 184.526 1.00 22.08  ? 125  GLY A CA  1 
ATOM   961   C  C   . GLY A  1  125 ? 57.342  317.851 185.703 1.00 27.60  ? 125  GLY A C   1 
ATOM   962   O  O   . GLY A  1  125 ? 57.983  318.905 185.642 1.00 24.25  ? 125  GLY A O   1 
ATOM   963   N  N   . TRP A  1  126 ? 57.331  317.061 186.776 1.00 25.89  ? 126  TRP A N   1 
ATOM   964   C  CA  . TRP A  1  126 ? 58.131  317.394 187.980 1.00 22.45  ? 126  TRP A CA  1 
ATOM   965   C  C   . TRP A  1  126 ? 59.641  317.242 187.714 1.00 26.97  ? 126  TRP A C   1 
ATOM   966   O  O   . TRP A  1  126 ? 60.441  317.781 188.466 1.00 26.42  ? 126  TRP A O   1 
ATOM   967   C  CB  . TRP A  1  126 ? 57.697  316.524 189.172 1.00 23.35  ? 126  TRP A CB  1 
ATOM   968   C  CG  . TRP A  1  126 ? 58.330  315.170 189.288 1.00 19.67  ? 126  TRP A CG  1 
ATOM   969   C  CD1 . TRP A  1  126 ? 57.970  314.056 188.604 1.00 24.18  ? 126  TRP A CD1 1 
ATOM   970   C  CD2 . TRP A  1  126 ? 59.348  314.769 190.222 1.00 24.89  ? 126  TRP A CD2 1 
ATOM   971   N  NE1 . TRP A  1  126 ? 58.784  312.999 188.975 1.00 20.90  ? 126  TRP A NE1 1 
ATOM   972   C  CE2 . TRP A  1  126 ? 59.610  313.405 189.986 1.00 25.01  ? 126  TRP A CE2 1 
ATOM   973   C  CE3 . TRP A  1  126 ? 60.082  315.443 191.219 1.00 23.76  ? 126  TRP A CE3 1 
ATOM   974   C  CZ2 . TRP A  1  126 ? 60.590  312.683 190.680 1.00 21.88  ? 126  TRP A CZ2 1 
ATOM   975   C  CZ3 . TRP A  1  126 ? 61.077  314.689 191.987 1.00 23.85  ? 126  TRP A CZ3 1 
ATOM   976   C  CH2 . TRP A  1  126 ? 61.289  313.342 191.731 1.00 26.97  ? 126  TRP A CH2 1 
ATOM   977   N  N   . THR A  1  127 ? 60.002  316.665 186.565 1.00 23.78  ? 127  THR A N   1 
ATOM   978   C  CA  . THR A  1  127 ? 61.401  316.574 186.098 1.00 23.80  ? 127  THR A CA  1 
ATOM   979   C  C   . THR A  1  127 ? 61.905  317.894 185.514 1.00 24.39  ? 127  THR A C   1 
ATOM   980   O  O   . THR A  1  127 ? 63.104  318.136 185.544 1.00 25.20  ? 127  THR A O   1 
ATOM   981   C  CB  . THR A  1  127 ? 61.500  315.436 185.066 1.00 31.13  ? 127  THR A CB  1 
ATOM   982   O  OG1 . THR A  1  127 ? 60.376  315.528 184.185 1.00 28.34  ? 127  THR A OG1 1 
ATOM   983   C  CG2 . THR A  1  127 ? 61.413  314.074 185.737 1.00 34.28  ? 127  THR A CG2 1 
ATOM   984   N  N   . VAL A  1  128 ? 61.006  318.760 185.045 1.00 23.50  ? 128  VAL A N   1 
ATOM   985   C  CA  . VAL A  1  128 ? 61.329  320.117 184.594 1.00 24.41  ? 128  VAL A CA  1 
ATOM   986   C  C   . VAL A  1  128 ? 62.410  320.046 183.481 1.00 25.14  ? 128  VAL A C   1 
ATOM   987   O  O   . VAL A  1  128 ? 63.312  320.886 183.443 1.00 24.11  ? 128  VAL A O   1 
ATOM   988   C  CB  . VAL A  1  128 ? 61.792  321.023 185.747 1.00 24.14  ? 128  VAL A CB  1 
ATOM   989   C  CG1 . VAL A  1  128 ? 61.703  322.505 185.322 1.00 22.74  ? 128  VAL A CG1 1 
ATOM   990   C  CG2 . VAL A  1  128 ? 60.906  320.809 187.080 1.00 23.54  ? 128  VAL A CG2 1 
ATOM   991   N  N   . TYR A  1  129 ? 62.323  319.073 182.554 1.00 24.32  ? 129  TYR A N   1 
ATOM   992   C  CA  . TYR A  1  129 ? 63.315  318.958 181.460 1.00 26.78  ? 129  TYR A CA  1 
ATOM   993   C  C   . TYR A  1  129 ? 63.341  320.186 180.539 1.00 28.07  ? 129  TYR A C   1 
ATOM   994   O  O   . TYR A  1  129 ? 62.301  320.573 179.983 1.00 28.48  ? 129  TYR A O   1 
ATOM   995   C  CB  . TYR A  1  129 ? 63.035  317.761 180.536 1.00 26.82  ? 129  TYR A CB  1 
ATOM   996   C  CG  . TYR A  1  129 ? 63.367  316.455 181.116 1.00 23.13  ? 129  TYR A CG  1 
ATOM   997   C  CD1 . TYR A  1  129 ? 63.965  316.356 182.417 1.00 20.88  ? 129  TYR A CD1 1 
ATOM   998   C  CD2 . TYR A  1  129 ? 63.156  315.306 180.377 1.00 27.95  ? 129  TYR A CD2 1 
ATOM   999   C  CE1 . TYR A  1  129 ? 64.312  315.049 182.922 1.00 25.26  ? 129  TYR A CE1 1 
ATOM   1000  C  CE2 . TYR A  1  129 ? 63.498  314.045 180.849 1.00 26.83  ? 129  TYR A CE2 1 
ATOM   1001  C  CZ  . TYR A  1  129 ? 64.023  313.931 182.149 1.00 28.72  ? 129  TYR A CZ  1 
ATOM   1002  O  OH  . TYR A  1  129 ? 64.342  312.643 182.523 1.00 26.03  ? 129  TYR A OH  1 
ATOM   1003  N  N   . PRO A  1  130 ? 64.509  320.723 180.245 1.00 25.37  ? 130  PRO A N   1 
ATOM   1004  C  CA  . PRO A  1  130 ? 64.676  321.574 179.047 1.00 25.09  ? 130  PRO A CA  1 
ATOM   1005  C  C   . PRO A  1  130 ? 64.753  320.721 177.782 1.00 31.99  ? 130  PRO A C   1 
ATOM   1006  O  O   . PRO A  1  130 ? 65.101  319.528 177.825 1.00 26.52  ? 130  PRO A O   1 
ATOM   1007  C  CB  . PRO A  1  130 ? 66.008  322.333 179.312 1.00 24.19  ? 130  PRO A CB  1 
ATOM   1008  C  CG  . PRO A  1  130 ? 66.866  321.226 180.063 1.00 25.21  ? 130  PRO A CG  1 
ATOM   1009  C  CD  . PRO A  1  130 ? 65.785  320.423 180.937 1.00 26.51  ? 130  PRO A CD  1 
ATOM   1010  N  N   . PRO A  1  131 ? 64.453  321.299 176.635 1.00 27.96  ? 131  PRO A N   1 
ATOM   1011  C  CA  . PRO A  1  131 ? 64.051  322.707 176.417 1.00 25.67  ? 131  PRO A CA  1 
ATOM   1012  C  C   . PRO A  1  131 ? 62.591  323.032 176.725 1.00 29.81  ? 131  PRO A C   1 
ATOM   1013  O  O   . PRO A  1  131 ? 62.236  324.208 176.726 1.00 23.58  ? 131  PRO A O   1 
ATOM   1014  C  CB  . PRO A  1  131 ? 64.310  322.923 174.884 1.00 26.16  ? 131  PRO A CB  1 
ATOM   1015  C  CG  . PRO A  1  131 ? 65.181  321.754 174.453 1.00 31.27  ? 131  PRO A CG  1 
ATOM   1016  C  CD  . PRO A  1  131 ? 64.741  320.602 175.337 1.00 24.02  ? 131  PRO A CD  1 
ATOM   1017  N  N   . LEU A  1  132 ? 61.733  322.046 176.962 1.00 21.25  ? 132  LEU A N   1 
ATOM   1018  C  CA  . LEU A  1  132 ? 60.346  322.420 177.332 1.00 28.18  ? 132  LEU A CA  1 
ATOM   1019  C  C   . LEU A  1  132 ? 60.309  323.426 178.486 1.00 32.12  ? 132  LEU A C   1 
ATOM   1020  O  O   . LEU A  1  132 ? 59.503  324.372 178.481 1.00 27.86  ? 132  LEU A O   1 
ATOM   1021  C  CB  . LEU A  1  132 ? 59.508  321.196 177.697 1.00 25.42  ? 132  LEU A CB  1 
ATOM   1022  C  CG  . LEU A  1  132 ? 58.045  321.490 178.117 1.00 28.94  ? 132  LEU A CG  1 
ATOM   1023  C  CD1 . LEU A  1  132 ? 57.161  322.317 177.002 1.00 28.13  ? 132  LEU A CD1 1 
ATOM   1024  C  CD2 . LEU A  1  132 ? 57.364  320.174 178.438 1.00 26.56  ? 132  LEU A CD2 1 
ATOM   1025  N  N   . ALA A  1  133 ? 61.153  323.235 179.500 1.00 25.20  ? 133  ALA A N   1 
ATOM   1026  C  CA  . ALA A  1  133 ? 61.178  324.177 180.632 1.00 25.39  ? 133  ALA A CA  1 
ATOM   1027  C  C   . ALA A  1  133 ? 62.016  325.436 180.370 1.00 32.95  ? 133  ALA A C   1 
ATOM   1028  O  O   . ALA A  1  133 ? 62.122  326.285 181.263 1.00 27.46  ? 133  ALA A O   1 
ATOM   1029  C  CB  . ALA A  1  133 ? 61.698  323.442 181.905 1.00 22.23  ? 133  ALA A CB  1 
ATOM   1030  N  N   . GLY A  1  134 ? 62.580  325.605 179.152 1.00 30.32  ? 134  GLY A N   1 
ATOM   1031  C  CA  . GLY A  1  134 ? 63.393  326.759 178.832 1.00 27.43  ? 134  GLY A CA  1 
ATOM   1032  C  C   . GLY A  1  134 ? 62.572  328.019 178.516 1.00 25.91  ? 134  GLY A C   1 
ATOM   1033  O  O   . GLY A  1  134 ? 61.338  328.025 178.542 1.00 26.70  ? 134  GLY A O   1 
ATOM   1034  N  N   . ASN A  1  135 ? 63.301  329.105 178.207 1.00 28.74  ? 135  ASN A N   1 
ATOM   1035  C  CA  . ASN A  1  135 ? 62.649  330.413 178.158 1.00 28.94  ? 135  ASN A CA  1 
ATOM   1036  C  C   . ASN A  1  135 ? 61.962  330.674 176.836 1.00 32.07  ? 135  ASN A C   1 
ATOM   1037  O  O   . ASN A  1  135 ? 61.401  331.750 176.667 1.00 29.48  ? 135  ASN A O   1 
ATOM   1038  C  CB  . ASN A  1  135 ? 63.642  331.579 178.445 1.00 29.03  ? 135  ASN A CB  1 
ATOM   1039  C  CG  . ASN A  1  135 ? 64.839  331.632 177.447 1.00 33.50  ? 135  ASN A CG  1 
ATOM   1040  O  OD1 . ASN A  1  135 ? 64.808  331.000 176.389 1.00 32.85  ? 135  ASN A OD1 1 
ATOM   1041  N  ND2 . ASN A  1  135 ? 65.920  332.351 177.816 1.00 27.57  ? 135  ASN A ND2 1 
ATOM   1042  N  N   . LEU A  1  136 ? 61.970  329.716 175.934 1.00 27.22  ? 136  LEU A N   1 
ATOM   1043  C  CA  . LEU A  1  136 ? 61.211  329.811 174.677 1.00 33.20  ? 136  LEU A CA  1 
ATOM   1044  C  C   . LEU A  1  136 ? 59.931  328.979 174.724 1.00 34.15  ? 136  LEU A C   1 
ATOM   1045  O  O   . LEU A  1  136 ? 58.857  329.496 174.441 1.00 34.89  ? 136  LEU A O   1 
ATOM   1046  C  CB  . LEU A  1  136 ? 62.134  329.368 173.545 1.00 31.75  ? 136  LEU A CB  1 
ATOM   1047  C  CG  . LEU A  1  136 ? 61.749  329.501 172.089 1.00 70.10  ? 136  LEU A CG  1 
ATOM   1048  C  CD1 . LEU A  1  136 ? 61.564  330.945 171.725 1.00 125.58 ? 136  LEU A CD1 1 
ATOM   1049  C  CD2 . LEU A  1  136 ? 62.891  328.906 171.295 1.00 79.08  ? 136  LEU A CD2 1 
ATOM   1050  N  N   . ALA A  1  137 ? 60.010  327.710 175.148 1.00 27.93  ? 137  ALA A N   1 
ATOM   1051  C  CA  . ALA A  1  137 ? 58.806  326.894 175.283 1.00 28.54  ? 137  ALA A CA  1 
ATOM   1052  C  C   . ALA A  1  137 ? 58.055  327.167 176.597 1.00 38.54  ? 137  ALA A C   1 
ATOM   1053  O  O   . ALA A  1  137 ? 56.902  326.768 176.730 1.00 29.95  ? 137  ALA A O   1 
ATOM   1054  C  CB  . ALA A  1  137 ? 59.176  325.408 175.199 1.00 27.35  ? 137  ALA A CB  1 
ATOM   1055  N  N   . HIS A  1  138 ? 58.668  327.831 177.574 1.00 32.66  ? 138  HIS A N   1 
ATOM   1056  C  CA  . HIS A  1  138 ? 57.976  328.205 178.839 1.00 32.38  ? 138  HIS A CA  1 
ATOM   1057  C  C   . HIS A  1  138 ? 58.473  329.599 179.229 1.00 30.63  ? 138  HIS A C   1 
ATOM   1058  O  O   . HIS A  1  138 ? 59.094  329.804 180.262 1.00 34.80  ? 138  HIS A O   1 
ATOM   1059  C  CB  . HIS A  1  138 ? 58.194  327.168 179.958 1.00 27.26  ? 138  HIS A CB  1 
ATOM   1060  C  CG  . HIS A  1  138 ? 57.036  326.209 180.135 1.00 26.30  ? 138  HIS A CG  1 
ATOM   1061  N  ND1 . HIS A  1  138 ? 56.952  324.986 179.492 1.00 29.84  ? 138  HIS A ND1 1 
ATOM   1062  C  CD2 . HIS A  1  138 ? 55.918  326.305 180.893 1.00 28.03  ? 138  HIS A CD2 1 
ATOM   1063  C  CE1 . HIS A  1  138 ? 55.814  324.386 179.821 1.00 31.08  ? 138  HIS A CE1 1 
ATOM   1064  N  NE2 . HIS A  1  138 ? 55.157  325.177 180.660 1.00 30.49  ? 138  HIS A NE2 1 
ATOM   1065  N  N   . ALA A  1  139 ? 58.253  330.559 178.328 1.00 31.05  ? 139  ALA A N   1 
ATOM   1066  C  CA  . ALA A  1  139 ? 58.590  331.960 178.587 1.00 32.42  ? 139  ALA A CA  1 
ATOM   1067  C  C   . ALA A  1  139 ? 57.830  332.515 179.802 1.00 30.28  ? 139  ALA A C   1 
ATOM   1068  O  O   . ALA A  1  139 ? 56.684  332.157 180.064 1.00 28.48  ? 139  ALA A O   1 
ATOM   1069  C  CB  . ALA A  1  139 ? 58.281  332.825 177.311 1.00 30.84  ? 139  ALA A CB  1 
ATOM   1070  N  N   . GLY A  1  140 ? 58.469  333.432 180.540 1.00 29.29  ? 140  GLY A N   1 
ATOM   1071  C  CA  . GLY A  1  140 ? 57.798  334.055 181.673 1.00 32.19  ? 140  GLY A CA  1 
ATOM   1072  C  C   . GLY A  1  140 ? 58.198  333.429 183.014 1.00 30.94  ? 140  GLY A C   1 
ATOM   1073  O  O   . GLY A  1  140 ? 59.034  332.520 183.101 1.00 31.10  ? 140  GLY A O   1 
ATOM   1074  N  N   . ALA A  1  141 ? 57.513  333.887 184.074 1.00 27.01  ? 141  ALA A N   1 
ATOM   1075  C  CA  . ALA A  1  141 ? 58.016  333.644 185.432 1.00 29.94  ? 141  ALA A CA  1 
ATOM   1076  C  C   . ALA A  1  141 ? 57.727  332.257 186.001 1.00 36.94  ? 141  ALA A C   1 
ATOM   1077  O  O   . ALA A  1  141 ? 58.408  331.885 186.963 1.00 29.68  ? 141  ALA A O   1 
ATOM   1078  C  CB  . ALA A  1  141 ? 57.434  334.685 186.391 1.00 28.60  ? 141  ALA A CB  1 
ATOM   1079  N  N   . SER A  1  142 ? 56.771  331.480 185.459 1.00 27.40  ? 142  SER A N   1 
ATOM   1080  C  CA  . SER A  1  142 ? 56.308  330.272 186.164 1.00 28.37  ? 142  SER A CA  1 
ATOM   1081  C  C   . SER A  1  142 ? 57.439  329.280 186.438 1.00 30.29  ? 142  SER A C   1 
ATOM   1082  O  O   . SER A  1  142 ? 57.602  328.797 187.569 1.00 29.26  ? 142  SER A O   1 
ATOM   1083  C  CB  . SER A  1  142 ? 55.202  329.548 185.390 1.00 24.17  ? 142  SER A CB  1 
ATOM   1084  O  OG  . SER A  1  142 ? 54.046  330.371 185.239 1.00 30.47  ? 142  SER A OG  1 
ATOM   1085  N  N   . VAL A  1  143 ? 58.253  328.961 185.422 1.00 29.22  ? 143  VAL A N   1 
ATOM   1086  C  CA  . VAL A  1  143 ? 59.303  327.971 185.690 1.00 27.71  ? 143  VAL A CA  1 
ATOM   1087  C  C   . VAL A  1  143 ? 60.336  328.528 186.680 1.00 32.57  ? 143  VAL A C   1 
ATOM   1088  O  O   . VAL A  1  143 ? 60.863  327.792 187.516 1.00 26.43  ? 143  VAL A O   1 
ATOM   1089  C  CB  . VAL A  1  143 ? 59.961  327.494 184.364 1.00 29.87  ? 143  VAL A CB  1 
ATOM   1090  C  CG1 . VAL A  1  143 ? 61.295  326.710 184.647 1.00 23.36  ? 143  VAL A CG1 1 
ATOM   1091  C  CG2 . VAL A  1  143 ? 58.948  326.573 183.634 1.00 26.23  ? 143  VAL A CG2 1 
ATOM   1092  N  N   . ASP A  1  144 ? 60.636  329.822 186.622 1.00 27.24  ? 144  ASP A N   1 
ATOM   1093  C  CA  . ASP A  1  144 ? 61.611  330.358 187.562 1.00 31.96  ? 144  ASP A CA  1 
ATOM   1094  C  C   . ASP A  1  144 ? 61.065  330.322 188.995 1.00 32.60  ? 144  ASP A C   1 
ATOM   1095  O  O   . ASP A  1  144 ? 61.819  330.070 189.944 1.00 31.04  ? 144  ASP A O   1 
ATOM   1096  C  CB  . ASP A  1  144 ? 62.007  331.775 187.172 1.00 27.27  ? 144  ASP A CB  1 
ATOM   1097  C  CG  . ASP A  1  144 ? 62.702  331.820 185.797 1.00 35.70  ? 144  ASP A CG  1 
ATOM   1098  O  OD1 . ASP A  1  144 ? 63.539  330.944 185.555 1.00 30.55  ? 144  ASP A OD1 1 
ATOM   1099  O  OD2 . ASP A  1  144 ? 62.359  332.669 184.959 1.00 37.14  ? 144  ASP A OD2 1 
ATOM   1100  N  N   . LEU A  1  145 ? 59.767  330.598 189.175 1.00 28.23  ? 145  LEU A N   1 
ATOM   1101  C  CA  . LEU A  1  145 ? 59.157  330.433 190.507 1.00 28.61  ? 145  LEU A CA  1 
ATOM   1102  C  C   . LEU A  1  145 ? 59.265  328.984 190.988 1.00 26.69  ? 145  LEU A C   1 
ATOM   1103  O  O   . LEU A  1  145 ? 59.501  328.736 192.181 1.00 27.58  ? 145  LEU A O   1 
ATOM   1104  C  CB  . LEU A  1  145 ? 57.686  330.883 190.485 1.00 26.06  ? 145  LEU A CB  1 
ATOM   1105  C  CG  . LEU A  1  145 ? 57.548  332.410 190.393 1.00 26.27  ? 145  LEU A CG  1 
ATOM   1106  C  CD1 . LEU A  1  145 ? 56.112  332.865 189.911 1.00 27.07  ? 145  LEU A CD1 1 
ATOM   1107  C  CD2 . LEU A  1  145 ? 57.959  333.071 191.760 1.00 27.56  ? 145  LEU A CD2 1 
ATOM   1108  N  N   . THR A  1  146 ? 59.027  328.013 190.095 1.00 27.25  ? 146  THR A N   1 
ATOM   1109  C  CA  . THR A  1  146 ? 59.197  326.599 190.461 1.00 26.00  ? 146  THR A CA  1 
ATOM   1110  C  C   . THR A  1  146 ? 60.642  326.298 190.889 1.00 29.86  ? 146  THR A C   1 
ATOM   1111  O  O   . THR A  1  146 ? 60.881  325.597 191.873 1.00 27.16  ? 146  THR A O   1 
ATOM   1112  C  CB  . THR A  1  146 ? 58.786  325.699 189.274 1.00 29.63  ? 146  THR A CB  1 
ATOM   1113  O  OG1 . THR A  1  146 ? 57.430  325.935 188.905 1.00 33.80  ? 146  THR A OG1 1 
ATOM   1114  C  CG2 . THR A  1  146 ? 58.982  324.188 189.596 1.00 29.03  ? 146  THR A CG2 1 
ATOM   1115  N  N   . ILE A  1  147 ? 61.626  326.799 190.139 1.00 26.82  ? 147  ILE A N   1 
ATOM   1116  C  CA  . ILE A  1  147 ? 63.021  326.573 190.491 1.00 27.31  ? 147  ILE A CA  1 
ATOM   1117  C  C   . ILE A  1  147 ? 63.288  327.130 191.885 1.00 29.85  ? 147  ILE A C   1 
ATOM   1118  O  O   . ILE A  1  147 ? 63.910  326.492 192.732 1.00 27.27  ? 147  ILE A O   1 
ATOM   1119  C  CB  . ILE A  1  147 ? 63.932  327.236 189.422 1.00 25.51  ? 147  ILE A CB  1 
ATOM   1120  C  CG1 . ILE A  1  147 ? 63.851  326.493 188.056 1.00 24.39  ? 147  ILE A CG1 1 
ATOM   1121  C  CG2 . ILE A  1  147 ? 65.448  327.331 189.959 1.00 24.16  ? 147  ILE A CG2 1 
ATOM   1122  C  CD1 . ILE A  1  147 ? 64.606  327.279 186.864 1.00 24.22  ? 147  ILE A CD1 1 
ATOM   1123  N  N   . PHE A  1  148 ? 62.851  328.371 192.129 1.00 21.79  ? 148  PHE A N   1 
ATOM   1124  C  CA  . PHE A  1  148 ? 63.093  328.991 193.440 1.00 26.35  ? 148  PHE A CA  1 
ATOM   1125  C  C   . PHE A  1  148 ? 62.359  328.232 194.553 1.00 30.05  ? 148  PHE A C   1 
ATOM   1126  O  O   . PHE A  1  148 ? 62.882  328.116 195.665 1.00 27.40  ? 148  PHE A O   1 
ATOM   1127  C  CB  . PHE A  1  148 ? 62.656  330.450 193.415 1.00 30.51  ? 148  PHE A CB  1 
ATOM   1128  C  CG  . PHE A  1  148 ? 63.574  331.344 192.594 1.00 31.49  ? 148  PHE A CG  1 
ATOM   1129  C  CD1 . PHE A  1  148 ? 64.973  331.243 192.734 1.00 28.68  ? 148  PHE A CD1 1 
ATOM   1130  C  CD2 . PHE A  1  148 ? 63.043  332.268 191.685 1.00 28.90  ? 148  PHE A CD2 1 
ATOM   1131  C  CE1 . PHE A  1  148 ? 65.826  332.046 191.915 1.00 26.50  ? 148  PHE A CE1 1 
ATOM   1132  C  CE2 . PHE A  1  148 ? 63.882  333.080 190.889 1.00 28.66  ? 148  PHE A CE2 1 
ATOM   1133  C  CZ  . PHE A  1  148 ? 65.273  332.987 191.040 1.00 28.23  ? 148  PHE A CZ  1 
ATOM   1134  N  N   . SER A  1  149 ? 61.190  327.677 194.255 1.00 24.35  ? 149  SER A N   1 
ATOM   1135  C  CA  . SER A  1  149 ? 60.500  326.859 195.250 1.00 24.70  ? 149  SER A CA  1 
ATOM   1136  C  C   . SER A  1  149 ? 61.387  325.673 195.641 1.00 29.52  ? 149  SER A C   1 
ATOM   1137  O  O   . SER A  1  149 ? 61.571  325.354 196.831 1.00 29.57  ? 149  SER A O   1 
ATOM   1138  C  CB  . SER A  1  149 ? 59.144  326.404 194.700 1.00 27.22  ? 149  SER A CB  1 
ATOM   1139  O  OG  . SER A  1  149 ? 58.544  325.464 195.581 1.00 27.12  ? 149  SER A OG  1 
ATOM   1140  N  N   . LEU A  1  150 ? 61.936  324.993 194.638 1.00 26.56  ? 150  LEU A N   1 
ATOM   1141  C  CA  . LEU A  1  150 ? 62.850  323.895 194.872 1.00 25.47  ? 150  LEU A CA  1 
ATOM   1142  C  C   . LEU A  1  150 ? 64.103  324.353 195.604 1.00 29.18  ? 150  LEU A C   1 
ATOM   1143  O  O   . LEU A  1  150 ? 64.614  323.631 196.450 1.00 26.18  ? 150  LEU A O   1 
ATOM   1144  C  CB  . LEU A  1  150 ? 63.210  323.232 193.512 1.00 23.38  ? 150  LEU A CB  1 
ATOM   1145  C  CG  . LEU A  1  150 ? 62.119  322.381 192.888 1.00 29.66  ? 150  LEU A CG  1 
ATOM   1146  C  CD1 . LEU A  1  150 ? 62.562  321.914 191.467 1.00 25.25  ? 150  LEU A CD1 1 
ATOM   1147  C  CD2 . LEU A  1  150 ? 61.754  321.187 193.755 1.00 30.21  ? 150  LEU A CD2 1 
ATOM   1148  N  N   . HIS A  1  151 ? 64.654  325.529 195.292 1.00 25.92  ? 151  HIS A N   1 
ATOM   1149  C  CA  . HIS A  1  151 ? 65.829  325.999 196.023 1.00 26.57  ? 151  HIS A CA  1 
ATOM   1150  C  C   . HIS A  1  151 ? 65.512  326.094 197.524 1.00 30.08  ? 151  HIS A C   1 
ATOM   1151  O  O   . HIS A  1  151 ? 66.304  325.657 198.383 1.00 26.93  ? 151  HIS A O   1 
ATOM   1152  C  CB  . HIS A  1  151 ? 66.267  327.400 195.549 1.00 24.38  ? 151  HIS A CB  1 
ATOM   1153  C  CG  . HIS A  1  151 ? 67.185  327.397 194.377 1.00 33.89  ? 151  HIS A CG  1 
ATOM   1154  N  ND1 . HIS A  1  151 ? 67.073  328.338 193.382 1.00 37.59  ? 151  HIS A ND1 1 
ATOM   1155  C  CD2 . HIS A  1  151 ? 68.230  326.603 194.043 1.00 31.50  ? 151  HIS A CD2 1 
ATOM   1156  C  CE1 . HIS A  1  151 ? 67.995  328.114 192.458 1.00 33.67  ? 151  HIS A CE1 1 
ATOM   1157  N  NE2 . HIS A  1  151 ? 68.684  327.051 192.812 1.00 27.01  ? 151  HIS A NE2 1 
ATOM   1158  N  N   . LEU A  1  152 ? 64.377  326.695 197.856 1.00 26.04  ? 152  LEU A N   1 
ATOM   1159  C  CA  . LEU A  1  152 ? 64.088  326.873 199.300 1.00 27.71  ? 152  LEU A CA  1 
ATOM   1160  C  C   . LEU A  1  152 ? 63.850  325.535 199.979 1.00 31.23  ? 152  LEU A C   1 
ATOM   1161  O  O   . LEU A  1  152 ? 64.306  325.328 201.104 1.00 26.13  ? 152  LEU A O   1 
ATOM   1162  C  CB  . LEU A  1  152 ? 62.895  327.799 199.575 1.00 25.65  ? 152  LEU A CB  1 
ATOM   1163  C  CG  . LEU A  1  152 ? 62.880  329.231 199.015 1.00 48.29  ? 152  LEU A CG  1 
ATOM   1164  C  CD1 . LEU A  1  152 ? 61.964  330.076 199.856 1.00 33.92  ? 152  LEU A CD1 1 
ATOM   1165  C  CD2 . LEU A  1  152 ? 64.247  329.816 198.859 1.00 40.26  ? 152  LEU A CD2 1 
ATOM   1166  N  N   . ALA A  1  153 ? 63.121  324.623 199.332 1.00 27.01  ? 153  ALA A N   1 
ATOM   1167  C  CA  . ALA A  1  153 ? 62.854  323.325 199.941 1.00 29.07  ? 153  ALA A CA  1 
ATOM   1168  C  C   . ALA A  1  153 ? 64.157  322.578 200.069 1.00 27.06  ? 153  ALA A C   1 
ATOM   1169  O  O   . ALA A  1  153 ? 64.371  321.816 201.022 1.00 28.08  ? 153  ALA A O   1 
ATOM   1170  C  CB  . ALA A  1  153 ? 61.846  322.510 199.051 1.00 26.85  ? 153  ALA A CB  1 
ATOM   1171  N  N   . GLY A  1  154 ? 65.035  322.769 199.088 1.00 24.66  ? 154  GLY A N   1 
ATOM   1172  C  CA  . GLY A  1  154 ? 66.352  322.166 199.139 1.00 30.87  ? 154  GLY A CA  1 
ATOM   1173  C  C   . GLY A  1  154 ? 67.181  322.659 200.301 1.00 32.94  ? 154  GLY A C   1 
ATOM   1174  O  O   . GLY A  1  154 ? 67.775  321.864 200.988 1.00 23.88  ? 154  GLY A O   1 
ATOM   1175  N  N   . VAL A  1  155 ? 67.264  323.984 200.516 1.00 25.72  ? 155  VAL A N   1 
ATOM   1176  C  CA  . VAL A  1  155 ? 67.990  324.504 201.671 1.00 29.30  ? 155  VAL A CA  1 
ATOM   1177  C  C   . VAL A  1  155 ? 67.386  323.987 202.984 1.00 25.17  ? 155  VAL A C   1 
ATOM   1178  O  O   . VAL A  1  155 ? 68.121  323.569 203.914 1.00 25.49  ? 155  VAL A O   1 
ATOM   1179  C  CB  . VAL A  1  155 ? 68.015  326.049 201.650 1.00 22.44  ? 155  VAL A CB  1 
ATOM   1180  C  CG1 . VAL A  1  155 ? 68.614  326.577 203.074 1.00 29.65  ? 155  VAL A CG1 1 
ATOM   1181  C  CG2 . VAL A  1  155 ? 68.908  326.501 200.463 1.00 27.11  ? 155  VAL A CG2 1 
ATOM   1182  N  N   . SER A  1  156 ? 66.062  323.985 203.062 1.00 26.02  ? 156  SER A N   1 
ATOM   1183  C  CA  . SER A  1  156 ? 65.373  323.460 204.245 1.00 29.98  ? 156  SER A CA  1 
ATOM   1184  C  C   . SER A  1  156 ? 65.870  322.063 204.594 1.00 31.73  ? 156  SER A C   1 
ATOM   1185  O  O   . SER A  1  156 ? 66.211  321.784 205.750 1.00 27.25  ? 156  SER A O   1 
ATOM   1186  C  CB  . SER A  1  156 ? 63.854  323.456 204.002 1.00 26.08  ? 156  SER A CB  1 
ATOM   1187  O  OG  . SER A  1  156 ? 63.218  322.768 205.079 1.00 24.78  ? 156  SER A OG  1 
ATOM   1188  N  N   . SER A  1  157 ? 65.906  321.161 203.606 1.00 27.23  ? 157  SER A N   1 
ATOM   1189  C  CA  . SER A  1  157 ? 66.241  319.761 203.837 1.00 27.52  ? 157  SER A CA  1 
ATOM   1190  C  C   . SER A  1  157 ? 67.737  319.547 204.024 1.00 27.82  ? 157  SER A C   1 
ATOM   1191  O  O   . SER A  1  157 ? 68.129  318.637 204.748 1.00 28.66  ? 157  SER A O   1 
ATOM   1192  C  CB  . SER A  1  157 ? 65.730  318.912 202.658 1.00 26.19  ? 157  SER A CB  1 
ATOM   1193  O  OG  . SER A  1  157 ? 64.356  318.631 202.768 1.00 31.26  ? 157  SER A OG  1 
ATOM   1194  N  N   . ILE A  1  158 ? 68.582  320.358 203.371 1.00 22.14  ? 158  ILE A N   1 
ATOM   1195  C  CA  . ILE A  1  158 ? 70.020  320.234 203.594 1.00 24.52  ? 158  ILE A CA  1 
ATOM   1196  C  C   . ILE A  1  158 ? 70.359  320.652 205.022 1.00 28.01  ? 158  ILE A C   1 
ATOM   1197  O  O   . ILE A  1  158 ? 71.044  319.935 205.731 1.00 25.49  ? 158  ILE A O   1 
ATOM   1198  C  CB  . ILE A  1  158 ? 70.809  321.069 202.562 1.00 26.44  ? 158  ILE A CB  1 
ATOM   1199  C  CG1 . ILE A  1  158 ? 70.803  320.326 201.198 1.00 29.83  ? 158  ILE A CG1 1 
ATOM   1200  C  CG2 . ILE A  1  158 ? 72.290  321.211 203.037 1.00 24.95  ? 158  ILE A CG2 1 
ATOM   1201  C  CD1 . ILE A  1  158 ? 71.268  321.258 200.037 1.00 27.28  ? 158  ILE A CD1 1 
ATOM   1202  N  N   . LEU A  1  159 ? 69.833  321.770 205.496 1.00 24.44  ? 159  LEU A N   1 
ATOM   1203  C  CA  . LEU A  1  159 ? 70.081  322.159 206.901 1.00 23.96  ? 159  LEU A CA  1 
ATOM   1204  C  C   . LEU A  1  159 ? 69.436  321.156 207.871 1.00 29.54  ? 159  LEU A C   1 
ATOM   1205  O  O   . LEU A  1  159 ? 70.049  320.798 208.880 1.00 28.61  ? 159  LEU A O   1 
ATOM   1206  C  CB  . LEU A  1  159 ? 69.527  323.561 207.152 1.00 25.54  ? 159  LEU A CB  1 
ATOM   1207  C  CG  . LEU A  1  159 ? 70.183  324.583 206.222 1.00 31.70  ? 159  LEU A CG  1 
ATOM   1208  C  CD1 . LEU A  1  159 ? 69.522  325.929 206.550 1.00 29.16  ? 159  LEU A CD1 1 
ATOM   1209  C  CD2 . LEU A  1  159 ? 71.720  324.648 206.321 1.00 28.52  ? 159  LEU A CD2 1 
ATOM   1210  N  N   . GLY A  1  160 ? 68.276  320.587 207.511 1.00 27.56  ? 160  GLY A N   1 
ATOM   1211  C  CA  . GLY A  1  160 ? 67.686  319.542 208.351 1.00 27.51  ? 160  GLY A CA  1 
ATOM   1212  C  C   . GLY A  1  160 ? 68.555  318.305 208.420 1.00 28.49  ? 160  GLY A C   1 
ATOM   1213  O  O   . GLY A  1  160 ? 68.679  317.666 209.471 1.00 26.56  ? 160  GLY A O   1 
ATOM   1214  N  N   . ALA A  1  161 ? 69.111  317.905 207.288 1.00 26.24  ? 161  ALA A N   1 
ATOM   1215  C  CA  . ALA A  1  161 ? 69.993  316.738 207.249 1.00 22.17  ? 161  ALA A CA  1 
ATOM   1216  C  C   . ALA A  1  161 ? 71.204  316.963 208.141 1.00 22.25  ? 161  ALA A C   1 
ATOM   1217  O  O   . ALA A  1  161 ? 71.640  316.053 208.858 1.00 21.30  ? 161  ALA A O   1 
ATOM   1218  C  CB  . ALA A  1  161 ? 70.438  316.445 205.780 1.00 22.60  ? 161  ALA A CB  1 
ATOM   1219  N  N   . ILE A  1  162 ? 71.815  318.143 208.056 1.00 24.60  ? 162  ILE A N   1 
ATOM   1220  C  CA  . ILE A  1  162 ? 72.969  318.420 208.934 1.00 26.04  ? 162  ILE A CA  1 
ATOM   1221  C  C   . ILE A  1  162 ? 72.546  318.299 210.396 1.00 29.88  ? 162  ILE A C   1 
ATOM   1222  O  O   . ILE A  1  162 ? 73.277  317.764 211.251 1.00 23.59  ? 162  ILE A O   1 
ATOM   1223  C  CB  . ILE A  1  162 ? 73.494  319.832 208.621 1.00 21.31  ? 162  ILE A CB  1 
ATOM   1224  C  CG1 . ILE A  1  162 ? 74.073  319.882 207.201 1.00 25.13  ? 162  ILE A CG1 1 
ATOM   1225  C  CG2 . ILE A  1  162 ? 74.547  320.373 209.774 1.00 22.37  ? 162  ILE A CG2 1 
ATOM   1226  C  CD1 . ILE A  1  162 ? 74.489  321.309 206.758 1.00 23.49  ? 162  ILE A CD1 1 
ATOM   1227  N  N   . ASN A  1  163 ? 71.346  318.762 210.683 1.00 24.44  ? 163  ASN A N   1 
ATOM   1228  C  CA  . ASN A  1  163 ? 70.824  318.716 212.045 1.00 25.17  ? 163  ASN A CA  1 
ATOM   1229  C  C   . ASN A  1  163 ? 70.619  317.272 212.517 1.00 25.38  ? 163  ASN A C   1 
ATOM   1230  O  O   . ASN A  1  163 ? 71.069  316.889 213.620 1.00 26.22  ? 163  ASN A O   1 
ATOM   1231  C  CB  . ASN A  1  163 ? 69.537  319.491 212.095 1.00 27.29  ? 163  ASN A CB  1 
ATOM   1232  C  CG  . ASN A  1  163 ? 69.388  320.288 213.396 1.00 38.70  ? 163  ASN A CG  1 
ATOM   1233  O  OD1 . ASN A  1  163 ? 69.936  319.911 214.429 1.00 26.27  ? 163  ASN A OD1 1 
ATOM   1234  N  ND2 . ASN A  1  163 ? 68.700  321.419 213.323 1.00 29.42  ? 163  ASN A ND2 1 
ATOM   1235  N  N   . PHE A  1  164 ? 69.979  316.452 211.680 1.00 22.18  ? 164  PHE A N   1 
ATOM   1236  C  CA  . PHE A  1  164 ? 69.735  315.070 212.081 1.00 26.98  ? 164  PHE A CA  1 
ATOM   1237  C  C   . PHE A  1  164 ? 71.009  314.283 212.186 1.00 30.05  ? 164  PHE A C   1 
ATOM   1238  O  O   . PHE A  1  164 ? 71.169  313.498 213.111 1.00 26.85  ? 164  PHE A O   1 
ATOM   1239  C  CB  . PHE A  1  164 ? 68.768  314.358 211.094 1.00 22.52  ? 164  PHE A CB  1 
ATOM   1240  C  CG  . PHE A  1  164 ? 67.317  314.646 211.431 1.00 28.15  ? 164  PHE A CG  1 
ATOM   1241  C  CD1 . PHE A  1  164 ? 66.792  314.132 212.606 1.00 26.52  ? 164  PHE A CD1 1 
ATOM   1242  C  CD2 . PHE A  1  164 ? 66.523  315.446 210.608 1.00 26.92  ? 164  PHE A CD2 1 
ATOM   1243  C  CE1 . PHE A  1  164 ? 65.448  314.410 213.042 1.00 29.23  ? 164  PHE A CE1 1 
ATOM   1244  C  CE2 . PHE A  1  164 ? 65.182  315.713 211.011 1.00 29.29  ? 164  PHE A CE2 1 
ATOM   1245  C  CZ  . PHE A  1  164 ? 64.666  315.188 212.252 1.00 23.81  ? 164  PHE A CZ  1 
ATOM   1246  N  N   . ILE A  1  165 ? 71.903  314.403 211.188 1.00 23.79  ? 165  ILE A N   1 
ATOM   1247  C  CA  . ILE A  1  165 ? 73.158  313.658 211.298 1.00 23.78  ? 165  ILE A CA  1 
ATOM   1248  C  C   . ILE A  1  165 ? 73.890  314.043 212.586 1.00 25.89  ? 165  ILE A C   1 
ATOM   1249  O  O   . ILE A  1  165 ? 74.376  313.195 213.340 1.00 23.54  ? 165  ILE A O   1 
ATOM   1250  C  CB  . ILE A  1  165 ? 74.043  313.924 210.052 1.00 21.43  ? 165  ILE A CB  1 
ATOM   1251  C  CG1 . ILE A  1  165 ? 73.347  313.368 208.771 1.00 22.62  ? 165  ILE A CG1 1 
ATOM   1252  C  CG2 . ILE A  1  165 ? 75.389  313.198 210.220 1.00 23.43  ? 165  ILE A CG2 1 
ATOM   1253  C  CD1 . ILE A  1  165 ? 74.025  313.865 207.424 1.00 22.80  ? 165  ILE A CD1 1 
ATOM   1254  N  N   . THR A  1  166 ? 74.024  315.345 212.855 1.00 22.63  ? 166  THR A N   1 
ATOM   1255  C  CA  . THR A  1  166 ? 74.797  315.779 214.016 1.00 26.51  ? 166  THR A CA  1 
ATOM   1256  C  C   . THR A  1  166 ? 74.151  315.263 215.302 1.00 34.14  ? 166  THR A C   1 
ATOM   1257  O  O   . THR A  1  166 ? 74.823  314.751 216.208 1.00 25.50  ? 166  THR A O   1 
ATOM   1258  C  CB  . THR A  1  166 ? 74.889  317.315 214.055 1.00 29.52  ? 166  THR A CB  1 
ATOM   1259  O  OG1 . THR A  1  166 ? 75.564  317.802 212.864 1.00 24.85  ? 166  THR A OG1 1 
ATOM   1260  C  CG2 . THR A  1  166 ? 75.675  317.820 215.333 1.00 27.47  ? 166  THR A CG2 1 
ATOM   1261  N  N   . THR A  1  167 ? 72.833  315.398 215.387 1.00 25.12  ? 167  THR A N   1 
ATOM   1262  C  CA  . THR A  1  167 ? 72.074  314.967 216.570 1.00 27.78  ? 167  THR A CA  1 
ATOM   1263  C  C   . THR A  1  167 ? 72.280  313.491 216.833 1.00 34.94  ? 167  THR A C   1 
ATOM   1264  O  O   . THR A  1  167 ? 72.567  313.083 217.969 1.00 27.91  ? 167  THR A O   1 
ATOM   1265  C  CB  . THR A  1  167 ? 70.580  315.238 216.362 1.00 25.13  ? 167  THR A CB  1 
ATOM   1266  O  OG1 . THR A  1  167 ? 70.395  316.635 216.223 1.00 26.77  ? 167  THR A OG1 1 
ATOM   1267  C  CG2 . THR A  1  167 ? 69.716  314.725 217.659 1.00 24.04  ? 167  THR A CG2 1 
ATOM   1268  N  N   . ILE A  1  168 ? 72.121  312.675 215.776 1.00 27.32  ? 168  ILE A N   1 
ATOM   1269  C  CA  . ILE A  1  168 ? 72.132  311.229 215.948 1.00 27.31  ? 168  ILE A CA  1 
ATOM   1270  C  C   . ILE A  1  168 ? 73.557  310.727 216.263 1.00 31.84  ? 168  ILE A C   1 
ATOM   1271  O  O   . ILE A  1  168 ? 73.732  309.773 217.042 1.00 28.19  ? 168  ILE A O   1 
ATOM   1272  C  CB  . ILE A  1  168 ? 71.527  310.546 214.716 1.00 25.42  ? 168  ILE A CB  1 
ATOM   1273  C  CG1 . ILE A  1  168 ? 69.998  310.868 214.644 1.00 21.46  ? 168  ILE A CG1 1 
ATOM   1274  C  CG2 . ILE A  1  168 ? 71.795  309.020 214.682 1.00 26.09  ? 168  ILE A CG2 1 
ATOM   1275  C  CD1 . ILE A  1  168 ? 69.396  310.518 213.211 1.00 26.90  ? 168  ILE A CD1 1 
ATOM   1276  N  N   . ILE A  1  169 ? 74.590  311.359 215.682 1.00 26.76  ? 169  ILE A N   1 
ATOM   1277  C  CA  . ILE A  1  169 ? 75.975  310.988 215.979 1.00 27.05  ? 169  ILE A CA  1 
ATOM   1278  C  C   . ILE A  1  169 ? 76.428  311.475 217.350 1.00 29.68  ? 169  ILE A C   1 
ATOM   1279  O  O   . ILE A  1  169 ? 77.229  310.810 218.025 1.00 31.93  ? 169  ILE A O   1 
ATOM   1280  C  CB  . ILE A  1  169 ? 76.924  311.557 214.890 1.00 28.96  ? 169  ILE A CB  1 
ATOM   1281  C  CG1 . ILE A  1  169 ? 76.753  310.819 213.548 1.00 38.11  ? 169  ILE A CG1 1 
ATOM   1282  C  CG2 . ILE A  1  169 ? 78.362  311.508 215.332 1.00 36.74  ? 169  ILE A CG2 1 
ATOM   1283  C  CD1 . ILE A  1  169 ? 76.847  309.347 213.701 1.00 67.25  ? 169  ILE A CD1 1 
ATOM   1284  N  N   . ASN A  1  170 ? 76.031  312.694 217.733 1.00 28.35  ? 170  ASN A N   1 
ATOM   1285  C  CA  . ASN A  1  170 ? 76.679  313.378 218.854 1.00 24.42  ? 170  ASN A CA  1 
ATOM   1286  C  C   . ASN A  1  170 ? 75.861  313.360 220.151 1.00 31.92  ? 170  ASN A C   1 
ATOM   1287  O  O   . ASN A  1  170 ? 76.416  313.697 221.210 1.00 31.67  ? 170  ASN A O   1 
ATOM   1288  C  CB  . ASN A  1  170 ? 76.915  314.854 218.513 1.00 23.88  ? 170  ASN A CB  1 
ATOM   1289  C  CG  . ASN A  1  170 ? 77.875  315.513 219.487 1.00 41.70  ? 170  ASN A CG  1 
ATOM   1290  O  OD1 . ASN A  1  170 ? 78.905  314.942 219.731 1.00 30.17  ? 170  ASN A OD1 1 
ATOM   1291  N  ND2 . ASN A  1  170 ? 77.538  316.664 220.071 1.00 26.77  ? 170  ASN A ND2 1 
ATOM   1292  N  N   . MET A  1  171 ? 74.539  313.083 220.095 1.00 28.26  ? 171  MET A N   1 
ATOM   1293  C  CA  . MET A  1  171 ? 73.706  313.322 221.296 1.00 27.84  ? 171  MET A CA  1 
ATOM   1294  C  C   . MET A  1  171 ? 73.067  312.052 221.848 1.00 31.35  ? 171  MET A C   1 
ATOM   1295  O  O   . MET A  1  171 ? 72.022  312.119 222.489 1.00 29.04  ? 171  MET A O   1 
ATOM   1296  C  CB  . MET A  1  171 ? 72.654  314.411 221.008 1.00 26.17  ? 171  MET A CB  1 
ATOM   1297  C  CG  . MET A  1  171 ? 73.349  315.738 220.540 1.00 26.47  ? 171  MET A CG  1 
ATOM   1298  S  SD  . MET A  1  171 ? 72.173  316.982 220.167 1.00 30.20  ? 171  MET A SD  1 
ATOM   1299  C  CE  . MET A  1  171 ? 71.493  317.453 221.768 1.00 31.88  ? 171  MET A CE  1 
ATOM   1300  N  N   . LYS A  1  172 ? 73.660  310.896 221.642 1.00 27.50  ? 172  LYS A N   1 
ATOM   1301  C  CA  . LYS A  1  172 ? 73.191  309.684 222.301 1.00 27.32  ? 172  LYS A CA  1 
ATOM   1302  C  C   . LYS A  1  172 ? 73.789  309.609 223.707 1.00 33.41  ? 172  LYS A C   1 
ATOM   1303  O  O   . LYS A  1  172 ? 74.796  310.260 223.978 1.00 32.24  ? 172  LYS A O   1 
ATOM   1304  C  CB  . LYS A  1  172 ? 73.602  308.440 221.537 1.00 27.62  ? 172  LYS A CB  1 
ATOM   1305  C  CG  . LYS A  1  172 ? 73.105  308.443 220.051 1.00 28.90  ? 172  LYS A CG  1 
ATOM   1306  C  CD  . LYS A  1  172 ? 73.649  307.130 219.364 1.00 36.54  ? 172  LYS A CD  1 
ATOM   1307  C  CE  . LYS A  1  172 ? 75.151  306.971 219.361 1.00 41.77  ? 172  LYS A CE  1 
ATOM   1308  N  NZ  . LYS A  1  172 ? 75.840  308.049 218.633 1.00 45.98  ? 172  LYS A NZ  1 
ATOM   1309  N  N   . PRO A  1  173 ? 73.221  308.789 224.600 1.00 32.60  ? 173  PRO A N   1 
ATOM   1310  C  CA  . PRO A  1  173 ? 73.891  308.544 225.896 1.00 25.79  ? 173  PRO A CA  1 
ATOM   1311  C  C   . PRO A  1  173 ? 75.286  308.012 225.657 1.00 32.46  ? 173  PRO A C   1 
ATOM   1312  O  O   . PRO A  1  173 ? 75.540  307.303 224.655 1.00 33.53  ? 173  PRO A O   1 
ATOM   1313  C  CB  . PRO A  1  173 ? 72.978  307.503 226.576 1.00 27.04  ? 173  PRO A CB  1 
ATOM   1314  C  CG  . PRO A  1  173 ? 71.549  307.652 225.907 1.00 26.37  ? 173  PRO A CG  1 
ATOM   1315  C  CD  . PRO A  1  173 ? 72.010  307.959 224.430 1.00 23.59  ? 173  PRO A CD  1 
ATOM   1316  N  N   . PRO A  1  174 ? 76.254  308.360 226.522 1.00 35.01  ? 174  PRO A N   1 
ATOM   1317  C  CA  . PRO A  1  174 ? 77.655  307.995 226.227 1.00 34.18  ? 174  PRO A CA  1 
ATOM   1318  C  C   . PRO A  1  174 ? 77.865  306.527 226.162 1.00 32.09  ? 174  PRO A C   1 
ATOM   1319  O  O   . PRO A  1  174 ? 78.730  306.086 225.398 1.00 34.37  ? 174  PRO A O   1 
ATOM   1320  C  CB  . PRO A  1  174 ? 78.464  308.649 227.365 1.00 38.92  ? 174  PRO A CB  1 
ATOM   1321  C  CG  . PRO A  1  174 ? 77.473  309.161 228.344 1.00 37.03  ? 174  PRO A CG  1 
ATOM   1322  C  CD  . PRO A  1  174 ? 76.150  309.324 227.658 1.00 31.08  ? 174  PRO A CD  1 
ATOM   1323  N  N   . ALA A  1  175 ? 76.994  305.730 226.774 1.00 31.59  ? 175  ALA A N   1 
ATOM   1324  C  CA  . ALA A  1  175 ? 77.152  304.277 226.672 1.00 28.69  ? 175  ALA A CA  1 
ATOM   1325  C  C   . ALA A  1  175 ? 76.510  303.668 225.442 1.00 40.88  ? 175  ALA A C   1 
ATOM   1326  O  O   . ALA A  1  175 ? 76.819  302.525 225.107 1.00 34.22  ? 175  ALA A O   1 
ATOM   1327  C  CB  . ALA A  1  175 ? 76.575  303.593 227.948 1.00 32.65  ? 175  ALA A CB  1 
ATOM   1328  N  N   . MET A  1  176 ? 75.630  304.386 224.745 1.00 32.45  ? 176  MET A N   1 
ATOM   1329  C  CA  . MET A  1  176 ? 74.894  303.794 223.632 1.00 31.62  ? 176  MET A CA  1 
ATOM   1330  C  C   . MET A  1  176 ? 75.749  303.911 222.366 1.00 37.77  ? 176  MET A C   1 
ATOM   1331  O  O   . MET A  1  176 ? 76.061  305.022 221.959 1.00 31.38  ? 176  MET A O   1 
ATOM   1332  C  CB  . MET A  1  176 ? 73.583  304.535 223.445 1.00 25.26  ? 176  MET A CB  1 
ATOM   1333  C  CG  . MET A  1  176 ? 72.647  304.002 222.241 1.00 27.07  ? 176  MET A CG  1 
ATOM   1334  S  SD  . MET A  1  176 ? 71.320  305.175 221.885 1.00 35.49  ? 176  MET A SD  1 
ATOM   1335  C  CE  . MET A  1  176 ? 70.193  304.633 223.220 1.00 36.18  ? 176  MET A CE  1 
ATOM   1336  N  N   . SER A  1  177 ? 76.114  302.791 221.756 1.00 29.43  ? 177  SER A N   1 
ATOM   1337  C  CA  . SER A  1  177 ? 76.762  302.890 220.451 1.00 30.96  ? 177  SER A CA  1 
ATOM   1338  C  C   . SER A  1  177 ? 75.723  303.087 219.333 1.00 33.01  ? 177  SER A C   1 
ATOM   1339  O  O   . SER A  1  177 ? 74.510  302.966 219.535 1.00 25.55  ? 177  SER A O   1 
ATOM   1340  C  CB  . SER A  1  177 ? 77.591  301.654 220.134 1.00 33.33  ? 177  SER A CB  1 
ATOM   1341  O  OG  . SER A  1  177 ? 76.781  300.593 219.654 1.00 36.85  ? 177  SER A OG  1 
ATOM   1342  N  N   . GLN A  1  178 ? 76.228  303.333 218.102 1.00 23.68  ? 178  GLN A N   1 
ATOM   1343  C  CA  . GLN A  1  178 ? 75.271  303.410 216.982 1.00 25.77  ? 178  GLN A CA  1 
ATOM   1344  C  C   . GLN A  1  178 ? 74.508  302.100 216.809 1.00 29.31  ? 178  GLN A C   1 
ATOM   1345  O  O   . GLN A  1  178 ? 73.387  302.093 216.275 1.00 29.12  ? 178  GLN A O   1 
ATOM   1346  C  CB  . GLN A  1  178 ? 76.006  303.780 215.680 1.00 34.38  ? 178  GLN A CB  1 
ATOM   1347  C  CG  . GLN A  1  178 ? 75.233  304.879 214.846 1.00 51.18  ? 178  GLN A CG  1 
ATOM   1348  C  CD  . GLN A  1  178 ? 74.949  306.194 215.607 1.00 74.77  ? 178  GLN A CD  1 
ATOM   1349  O  OE1 . GLN A  1  178 ? 75.837  306.920 216.024 1.00 48.17  ? 178  GLN A OE1 1 
ATOM   1350  N  NE2 . GLN A  1  178 ? 73.712  306.475 215.791 1.00 37.75  ? 178  GLN A NE2 1 
ATOM   1351  N  N   . TYR A  1  179 ? 75.060  300.991 217.277 1.00 26.76  ? 179  TYR A N   1 
ATOM   1352  C  CA  . TYR A  1  179 ? 74.355  299.739 217.101 1.00 28.32  ? 179  TYR A CA  1 
ATOM   1353  C  C   . TYR A  1  179 ? 73.430  299.470 218.269 1.00 34.73  ? 179  TYR A C   1 
ATOM   1354  O  O   . TYR A  1  179 ? 73.000  298.336 218.448 1.00 28.06  ? 179  TYR A O   1 
ATOM   1355  C  CB  . TYR A  1  179 ? 75.338  298.565 216.912 1.00 32.29  ? 179  TYR A CB  1 
ATOM   1356  C  CG  . TYR A  1  179 ? 76.327  298.903 215.752 1.00 30.08  ? 179  TYR A CG  1 
ATOM   1357  C  CD1 . TYR A  1  179 ? 75.859  299.129 214.449 1.00 28.25  ? 179  TYR A CD1 1 
ATOM   1358  C  CD2 . TYR A  1  179 ? 77.675  299.117 216.048 1.00 36.45  ? 179  TYR A CD2 1 
ATOM   1359  C  CE1 . TYR A  1  179 ? 76.753  299.495 213.398 1.00 32.99  ? 179  TYR A CE1 1 
ATOM   1360  C  CE2 . TYR A  1  179 ? 78.551  299.446 215.080 1.00 35.67  ? 179  TYR A CE2 1 
ATOM   1361  C  CZ  . TYR A  1  179 ? 78.100  299.643 213.725 1.00 34.97  ? 179  TYR A CZ  1 
ATOM   1362  O  OH  . TYR A  1  179 ? 79.012  299.996 212.748 1.00 37.83  ? 179  TYR A OH  1 
ATOM   1363  N  N   . GLN A  1  180 ? 73.156  300.478 219.076 1.00 25.00  ? 180  GLN A N   1 
ATOM   1364  C  CA  . GLN A  1  180 ? 72.120  300.369 220.108 1.00 26.48  ? 180  GLN A CA  1 
ATOM   1365  C  C   . GLN A  1  180 ? 71.041  301.421 219.871 1.00 30.79  ? 180  GLN A C   1 
ATOM   1366  O  O   . GLN A  1  180 ? 70.319  301.785 220.803 1.00 31.04  ? 180  GLN A O   1 
ATOM   1367  C  CB  . GLN A  1  180 ? 72.725  300.503 221.544 1.00 30.29  ? 180  GLN A CB  1 
ATOM   1368  C  CG  . GLN A  1  180 ? 73.250  299.167 221.967 1.00 33.65  ? 180  GLN A CG  1 
ATOM   1369  C  CD  . GLN A  1  180 ? 74.678  299.108 222.381 1.00 53.13  ? 180  GLN A CD  1 
ATOM   1370  O  OE1 . GLN A  1  180 ? 75.340  300.120 222.522 1.00 40.72  ? 180  GLN A OE1 1 
ATOM   1371  N  NE2 . GLN A  1  180 ? 75.136  297.904 222.703 1.00 52.39  ? 180  GLN A NE2 1 
ATOM   1372  N  N   . THR A  1  181 ? 70.983  301.955 218.687 1.00 28.80  ? 181  THR A N   1 
ATOM   1373  C  CA  . THR A  1  181 ? 69.925  302.936 218.433 1.00 30.98  ? 181  THR A CA  1 
ATOM   1374  C  C   . THR A  1  181 ? 68.776  302.256 217.704 1.00 30.57  ? 181  THR A C   1 
ATOM   1375  O  O   . THR A  1  181 ? 69.001  301.265 217.001 1.00 30.97  ? 181  THR A O   1 
ATOM   1376  C  CB  . THR A  1  181 ? 70.414  304.108 217.562 1.00 40.22  ? 181  THR A CB  1 
ATOM   1377  O  OG1 . THR A  1  181 ? 70.749  303.580 216.300 1.00 40.10  ? 181  THR A OG1 1 
ATOM   1378  C  CG2 . THR A  1  181 ? 71.672  304.707 218.128 1.00 41.40  ? 181  THR A CG2 1 
ATOM   1379  N  N   . PRO A  1  182 ? 67.549  302.747 217.879 1.00 28.22  ? 182  PRO A N   1 
ATOM   1380  C  CA  . PRO A  1  182 ? 66.419  302.089 217.226 1.00 31.92  ? 182  PRO A CA  1 
ATOM   1381  C  C   . PRO A  1  182 ? 66.526  302.239 215.697 1.00 27.14  ? 182  PRO A C   1 
ATOM   1382  O  O   . PRO A  1  182 ? 67.062  303.207 215.167 1.00 23.38  ? 182  PRO A O   1 
ATOM   1383  C  CB  . PRO A  1  182 ? 65.206  302.833 217.803 1.00 27.11  ? 182  PRO A CB  1 
ATOM   1384  C  CG  . PRO A  1  182 ? 65.701  303.412 219.183 1.00 28.48  ? 182  PRO A CG  1 
ATOM   1385  C  CD  . PRO A  1  182 ? 67.126  303.838 218.797 1.00 24.39  ? 182  PRO A CD  1 
ATOM   1386  N  N   . LEU A  1  183 ? 65.893  301.313 214.999 1.00 22.65  ? 183  LEU A N   1 
ATOM   1387  C  CA  . LEU A  1  183 ? 65.898  301.320 213.515 1.00 28.51  ? 183  LEU A CA  1 
ATOM   1388  C  C   . LEU A  1  183 ? 65.324  302.601 212.903 1.00 33.43  ? 183  LEU A C   1 
ATOM   1389  O  O   . LEU A  1  183 ? 65.780  303.027 211.844 1.00 26.48  ? 183  LEU A O   1 
ATOM   1390  C  CB  . LEU A  1  183 ? 65.146  300.110 212.989 1.00 27.68  ? 183  LEU A CB  1 
ATOM   1391  C  CG  . LEU A  1  183 ? 65.922  298.814 213.231 1.00 27.67  ? 183  LEU A CG  1 
ATOM   1392  C  CD1 . LEU A  1  183 ? 65.181  297.650 212.575 1.00 26.84  ? 183  LEU A CD1 1 
ATOM   1393  C  CD2 . LEU A  1  183 ? 67.374  298.929 212.614 1.00 25.98  ? 183  LEU A CD2 1 
ATOM   1394  N  N   . PHE A  1  184 ? 64.318  303.223 213.513 1.00 27.86  ? 184  PHE A N   1 
ATOM   1395  C  CA  . PHE A  1  184 ? 63.821  304.482 212.936 1.00 25.27  ? 184  PHE A CA  1 
ATOM   1396  C  C   . PHE A  1  184 ? 64.882  305.575 212.942 1.00 26.92  ? 184  PHE A C   1 
ATOM   1397  O  O   . PHE A  1  184 ? 64.968  306.397 212.004 1.00 24.83  ? 184  PHE A O   1 
ATOM   1398  C  CB  . PHE A  1  184 ? 62.577  305.009 213.682 1.00 25.87  ? 184  PHE A CB  1 
ATOM   1399  C  CG  . PHE A  1  184 ? 62.056  306.302 213.066 1.00 24.68  ? 184  PHE A CG  1 
ATOM   1400  C  CD1 . PHE A  1  184 ? 61.531  306.289 211.760 1.00 21.11  ? 184  PHE A CD1 1 
ATOM   1401  C  CD2 . PHE A  1  184 ? 62.098  307.499 213.771 1.00 28.65  ? 184  PHE A CD2 1 
ATOM   1402  C  CE1 . PHE A  1  184 ? 61.087  307.444 211.143 1.00 27.71  ? 184  PHE A CE1 1 
ATOM   1403  C  CE2 . PHE A  1  184 ? 61.625  308.658 213.190 1.00 27.77  ? 184  PHE A CE2 1 
ATOM   1404  C  CZ  . PHE A  1  184 ? 61.110  308.636 211.853 1.00 21.62  ? 184  PHE A CZ  1 
ATOM   1405  N  N   . VAL A  1  185 ? 65.671  305.633 214.024 1.00 24.04  ? 185  VAL A N   1 
ATOM   1406  C  CA  . VAL A  1  185 ? 66.793  306.568 214.102 1.00 21.88  ? 185  VAL A CA  1 
ATOM   1407  C  C   . VAL A  1  185 ? 67.820  306.279 212.990 1.00 25.06  ? 185  VAL A C   1 
ATOM   1408  O  O   . VAL A  1  185 ? 68.307  307.194 212.320 1.00 23.29  ? 185  VAL A O   1 
ATOM   1409  C  CB  . VAL A  1  185 ? 67.438  306.496 215.496 1.00 26.34  ? 185  VAL A CB  1 
ATOM   1410  C  CG1 . VAL A  1  185 ? 68.679  307.357 215.552 1.00 23.44  ? 185  VAL A CG1 1 
ATOM   1411  C  CG2 . VAL A  1  185 ? 66.353  306.968 216.551 1.00 25.49  ? 185  VAL A CG2 1 
ATOM   1412  N  N   . TRP A  1  186 ? 68.189  305.019 212.814 1.00 22.08  ? 186  TRP A N   1 
ATOM   1413  C  CA  . TRP A  1  186 ? 69.060  304.668 211.687 1.00 19.78  ? 186  TRP A CA  1 
ATOM   1414  C  C   . TRP A  1  186 ? 68.444  305.120 210.355 1.00 29.16  ? 186  TRP A C   1 
ATOM   1415  O  O   . TRP A  1  186 ? 69.129  305.682 209.510 1.00 24.33  ? 186  TRP A O   1 
ATOM   1416  C  CB  . TRP A  1  186 ? 69.265  303.149 211.612 1.00 22.21  ? 186  TRP A CB  1 
ATOM   1417  C  CG  . TRP A  1  186 ? 70.356  302.654 212.395 1.00 27.07  ? 186  TRP A CG  1 
ATOM   1418  C  CD1 . TRP A  1  186 ? 70.279  301.967 213.632 1.00 25.85  ? 186  TRP A CD1 1 
ATOM   1419  C  CD2 . TRP A  1  186 ? 71.742  302.781 212.080 1.00 24.01  ? 186  TRP A CD2 1 
ATOM   1420  N  NE1 . TRP A  1  186 ? 71.573  301.655 214.042 1.00 26.49  ? 186  TRP A NE1 1 
ATOM   1421  C  CE2 . TRP A  1  186 ? 72.475  302.097 213.088 1.00 27.25  ? 186  TRP A CE2 1 
ATOM   1422  C  CE3 . TRP A  1  186 ? 72.428  303.314 210.948 1.00 27.56  ? 186  TRP A CE3 1 
ATOM   1423  C  CZ2 . TRP A  1  186 ? 73.885  302.032 213.063 1.00 29.87  ? 186  TRP A CZ2 1 
ATOM   1424  C  CZ3 . TRP A  1  186 ? 73.827  303.219 210.905 1.00 31.19  ? 186  TRP A CZ3 1 
ATOM   1425  C  CH2 . TRP A  1  186 ? 74.535  302.564 211.950 1.00 29.72  ? 186  TRP A CH2 1 
ATOM   1426  N  N   . SER A  1  187 ? 67.156  304.905 210.184 1.00 21.91  ? 187  SER A N   1 
ATOM   1427  C  CA  . SER A  1  187 ? 66.521  305.257 208.902 1.00 20.87  ? 187  SER A CA  1 
ATOM   1428  C  C   . SER A  1  187 ? 66.574  306.762 208.627 1.00 29.35  ? 187  SER A C   1 
ATOM   1429  O  O   . SER A  1  187 ? 66.788  307.190 207.469 1.00 27.09  ? 187  SER A O   1 
ATOM   1430  C  CB  . SER A  1  187 ? 65.079  304.690 208.850 1.00 21.40  ? 187  SER A CB  1 
ATOM   1431  O  OG  . SER A  1  187 ? 64.128  305.507 209.509 1.00 23.60  ? 187  SER A OG  1 
ATOM   1432  N  N   . VAL A  1  188 ? 66.452  307.578 209.675 1.00 22.22  ? 188  VAL A N   1 
ATOM   1433  C  CA  . VAL A  1  188 ? 66.540  309.026 209.529 1.00 24.27  ? 188  VAL A CA  1 
ATOM   1434  C  C   . VAL A  1  188 ? 67.980  309.455 209.219 1.00 27.41  ? 188  VAL A C   1 
ATOM   1435  O  O   . VAL A  1  188 ? 68.217  310.328 208.386 1.00 22.68  ? 188  VAL A O   1 
ATOM   1436  C  CB  . VAL A  1  188 ? 65.977  309.700 210.793 1.00 25.21  ? 188  VAL A CB  1 
ATOM   1437  C  CG1 . VAL A  1  188 ? 66.180  311.222 210.730 1.00 23.58  ? 188  VAL A CG1 1 
ATOM   1438  C  CG2 . VAL A  1  188 ? 64.509  309.439 210.847 1.00 23.81  ? 188  VAL A CG2 1 
ATOM   1439  N  N   . MET A  1  189 ? 68.961  308.896 209.943 1.00 22.38  ? 189  MET A N   1 
ATOM   1440  C  CA  . MET A  1  189 ? 70.361  309.247 209.660 1.00 24.09  ? 189  MET A CA  1 
ATOM   1441  C  C   . MET A  1  189 ? 70.721  308.944 208.208 1.00 23.70  ? 189  MET A C   1 
ATOM   1442  O  O   . MET A  1  189 ? 71.397  309.723 207.562 1.00 24.78  ? 189  MET A O   1 
ATOM   1443  C  CB  . MET A  1  189 ? 71.331  308.475 210.545 1.00 23.50  ? 189  MET A CB  1 
ATOM   1444  C  CG  . MET A  1  189 ? 72.811  309.057 210.220 1.00 29.78  ? 189  MET A CG  1 
ATOM   1445  S  SD  . MET A  1  189 ? 73.962  308.744 211.464 1.00 46.45  ? 189  MET A SD  1 
ATOM   1446  C  CE  . MET A  1  189 ? 73.589  307.038 211.794 1.00 45.17  ? 189  MET A CE  1 
ATOM   1447  N  N   . ILE A  1  190 ? 70.371  307.746 207.738 1.00 22.13  ? 190  ILE A N   1 
ATOM   1448  C  CA  . ILE A  1  190 ? 70.703  307.360 206.358 1.00 21.85  ? 190  ILE A CA  1 
ATOM   1449  C  C   . ILE A  1  190 ? 70.002  308.251 205.361 1.00 26.11  ? 190  ILE A C   1 
ATOM   1450  O  O   . ILE A  1  190 ? 70.630  308.755 204.415 1.00 24.41  ? 190  ILE A O   1 
ATOM   1451  C  CB  . ILE A  1  190 ? 70.408  305.868 206.140 1.00 22.71  ? 190  ILE A CB  1 
ATOM   1452  C  CG1 . ILE A  1  190 ? 71.393  305.071 207.019 1.00 25.17  ? 190  ILE A CG1 1 
ATOM   1453  C  CG2 . ILE A  1  190 ? 70.724  305.453 204.658 1.00 24.57  ? 190  ILE A CG2 1 
ATOM   1454  C  CD1 . ILE A  1  190 ? 70.908  303.619 207.182 1.00 24.56  ? 190  ILE A CD1 1 
ATOM   1455  N  N   . THR A  1  191 ? 68.702  308.551 205.598 1.00 22.09  ? 191  THR A N   1 
ATOM   1456  C  CA  . THR A  1  191 ? 67.969  309.473 204.730 1.00 24.51  ? 191  THR A CA  1 
ATOM   1457  C  C   . THR A  1  191 ? 68.664  310.832 204.713 1.00 21.24  ? 191  THR A C   1 
ATOM   1458  O  O   . THR A  1  191 ? 68.848  311.460 203.666 1.00 23.57  ? 191  THR A O   1 
ATOM   1459  C  CB  . THR A  1  191 ? 66.527  309.634 205.296 1.00 21.35  ? 191  THR A CB  1 
ATOM   1460  O  OG1 . THR A  1  191 ? 65.875  308.380 205.188 1.00 23.12  ? 191  THR A OG1 1 
ATOM   1461  C  CG2 . THR A  1  191 ? 65.754  310.740 204.581 1.00 21.71  ? 191  THR A CG2 1 
ATOM   1462  N  N   . ALA A  1  192 ? 69.090  311.289 205.879 1.00 19.77  ? 192  ALA A N   1 
ATOM   1463  C  CA  . ALA A  1  192 ? 69.782  312.592 205.965 1.00 21.25  ? 192  ALA A CA  1 
ATOM   1464  C  C   . ALA A  1  192 ? 71.102  312.581 205.194 1.00 23.91  ? 192  ALA A C   1 
ATOM   1465  O  O   . ALA A  1  192 ? 71.460  313.561 204.524 1.00 23.43  ? 192  ALA A O   1 
ATOM   1466  C  CB  . ALA A  1  192 ? 70.059  312.919 207.492 1.00 19.69  ? 192  ALA A CB  1 
ATOM   1467  N  N   . VAL A  1  193 ? 71.861  311.508 205.288 1.00 20.82  ? 193  VAL A N   1 
ATOM   1468  C  CA  . VAL A  1  193 ? 73.084  311.468 204.425 1.00 20.93  ? 193  VAL A CA  1 
ATOM   1469  C  C   . VAL A  1  193 ? 72.699  311.546 202.944 1.00 27.27  ? 193  VAL A C   1 
ATOM   1470  O  O   . VAL A  1  193 ? 73.372  312.214 202.134 1.00 24.80  ? 193  VAL A O   1 
ATOM   1471  C  CB  . VAL A  1  193 ? 73.930  310.206 204.709 1.00 23.98  ? 193  VAL A CB  1 
ATOM   1472  C  CG1 . VAL A  1  193 ? 75.093  310.014 203.633 1.00 26.46  ? 193  VAL A CG1 1 
ATOM   1473  C  CG2 . VAL A  1  193 ? 74.553  310.301 206.167 1.00 25.30  ? 193  VAL A CG2 1 
ATOM   1474  N  N   . LEU A  1  194 ? 71.685  310.798 202.531 1.00 23.47  ? 194  LEU A N   1 
ATOM   1475  C  CA  . LEU A  1  194 ? 71.298  310.883 201.095 1.00 21.04  ? 194  LEU A CA  1 
ATOM   1476  C  C   . LEU A  1  194 ? 70.873  312.288 200.699 1.00 26.21  ? 194  LEU A C   1 
ATOM   1477  O  O   . LEU A  1  194 ? 71.210  312.766 199.576 1.00 25.09  ? 194  LEU A O   1 
ATOM   1478  C  CB  . LEU A  1  194 ? 70.154  309.921 200.774 1.00 26.33  ? 194  LEU A CB  1 
ATOM   1479  C  CG  . LEU A  1  194 ? 70.542  308.524 200.266 1.00 32.65  ? 194  LEU A CG  1 
ATOM   1480  C  CD1 . LEU A  1  194 ? 71.618  307.904 201.139 1.00 26.12  ? 194  LEU A CD1 1 
ATOM   1481  C  CD2 . LEU A  1  194 ? 69.316  307.574 200.080 1.00 27.63  ? 194  LEU A CD2 1 
ATOM   1482  N  N   . LEU A  1  195 ? 70.136  312.977 201.602 1.00 22.85  ? 195  LEU A N   1 
ATOM   1483  C  CA  . LEU A  1  195 ? 69.734  314.352 201.327 1.00 21.05  ? 195  LEU A CA  1 
ATOM   1484  C  C   . LEU A  1  195 ? 70.935  315.263 201.189 1.00 27.66  ? 195  LEU A C   1 
ATOM   1485  O  O   . LEU A  1  195 ? 70.945  316.185 200.340 1.00 24.76  ? 195  LEU A O   1 
ATOM   1486  C  CB  . LEU A  1  195 ? 68.822  314.877 202.430 1.00 21.24  ? 195  LEU A CB  1 
ATOM   1487  C  CG  . LEU A  1  195 ? 67.352  314.361 202.355 1.00 24.97  ? 195  LEU A CG  1 
ATOM   1488  C  CD1 . LEU A  1  195 ? 66.702  314.617 203.812 1.00 27.56  ? 195  LEU A CD1 1 
ATOM   1489  C  CD2 . LEU A  1  195 ? 66.576  315.069 201.249 1.00 22.08  ? 195  LEU A CD2 1 
ATOM   1490  N  N   . LEU A  1  196 ? 71.909  315.080 202.084 1.00 21.60  ? 196  LEU A N   1 
ATOM   1491  C  CA  . LEU A  1  196 ? 73.077  315.965 202.140 1.00 22.98  ? 196  LEU A CA  1 
ATOM   1492  C  C   . LEU A  1  196 ? 73.869  315.892 200.841 1.00 22.34  ? 196  LEU A C   1 
ATOM   1493  O  O   . LEU A  1  196 ? 74.441  316.903 200.406 1.00 25.09  ? 196  LEU A O   1 
ATOM   1494  C  CB  . LEU A  1  196 ? 73.983  315.563 203.314 1.00 21.50  ? 196  LEU A CB  1 
ATOM   1495  C  CG  . LEU A  1  196 ? 75.170  316.492 203.579 1.00 34.81  ? 196  LEU A CG  1 
ATOM   1496  C  CD1 . LEU A  1  196 ? 74.680  317.769 204.337 1.00 28.27  ? 196  LEU A CD1 1 
ATOM   1497  C  CD2 . LEU A  1  196 ? 76.278  315.756 204.402 1.00 23.73  ? 196  LEU A CD2 1 
ATOM   1498  N  N   . LEU A  1  197 ? 73.981  314.701 200.258 1.00 22.89  ? 197  LEU A N   1 
ATOM   1499  C  CA  . LEU A  1  197 ? 74.797  314.468 199.054 1.00 20.02  ? 197  LEU A CA  1 
ATOM   1500  C  C   . LEU A  1  197 ? 74.018  314.730 197.760 1.00 22.43  ? 197  LEU A C   1 
ATOM   1501  O  O   . LEU A  1  197 ? 74.605  315.209 196.766 1.00 27.54  ? 197  LEU A O   1 
ATOM   1502  C  CB  . LEU A  1  197 ? 75.266  313.018 198.996 1.00 22.90  ? 197  LEU A CB  1 
ATOM   1503  C  CG  . LEU A  1  197 ? 76.092  312.679 200.250 1.00 28.47  ? 197  LEU A CG  1 
ATOM   1504  C  CD1 . LEU A  1  197 ? 76.466  311.205 200.205 1.00 26.17  ? 197  LEU A CD1 1 
ATOM   1505  C  CD2 . LEU A  1  197 ? 77.299  313.580 200.348 1.00 26.89  ? 197  LEU A CD2 1 
ATOM   1506  N  N   . SER A  1  198 ? 72.696  314.523 197.777 1.00 23.86  ? 198  SER A N   1 
ATOM   1507  C  CA  . SER A  1  198 ? 71.984  314.577 196.487 1.00 24.35  ? 198  SER A CA  1 
ATOM   1508  C  C   . SER A  1  198 ? 71.397  315.963 196.214 1.00 27.13  ? 198  SER A C   1 
ATOM   1509  O  O   . SER A  1  198 ? 71.424  316.434 195.058 1.00 25.16  ? 198  SER A O   1 
ATOM   1510  C  CB  . SER A  1  198 ? 70.863  313.513 196.441 1.00 21.03  ? 198  SER A CB  1 
ATOM   1511  O  OG  . SER A  1  198 ? 69.902  313.793 197.490 1.00 24.92  ? 198  SER A OG  1 
ATOM   1512  N  N   . LEU A  1  199 ? 70.798  316.594 197.219 1.00 25.64  ? 199  LEU A N   1 
ATOM   1513  C  CA  . LEU A  1  199 ? 70.183  317.891 196.978 1.00 23.62  ? 199  LEU A CA  1 
ATOM   1514  C  C   . LEU A  1  199 ? 71.145  318.943 196.424 1.00 23.21  ? 199  LEU A C   1 
ATOM   1515  O  O   . LEU A  1  199 ? 70.658  319.771 195.634 1.00 26.23  ? 199  LEU A O   1 
ATOM   1516  C  CB  . LEU A  1  199 ? 69.466  318.435 198.245 1.00 24.19  ? 199  LEU A CB  1 
ATOM   1517  C  CG  . LEU A  1  199 ? 68.054  317.786 198.410 1.00 26.96  ? 199  LEU A CG  1 
ATOM   1518  C  CD1 . LEU A  1  199 ? 67.606  318.105 199.823 1.00 28.21  ? 199  LEU A CD1 1 
ATOM   1519  C  CD2 . LEU A  1  199 ? 67.073  318.456 197.481 1.00 21.11  ? 199  LEU A CD2 1 
ATOM   1520  N  N   . PRO A  1  200 ? 72.449  318.971 196.766 1.00 26.44  ? 200  PRO A N   1 
ATOM   1521  C  CA  . PRO A  1  200 ? 73.321  319.994 196.158 1.00 25.35  ? 200  PRO A CA  1 
ATOM   1522  C  C   . PRO A  1  200 ? 73.488  319.766 194.672 1.00 24.55  ? 200  PRO A C   1 
ATOM   1523  O  O   . PRO A  1  200 ? 73.763  320.722 193.942 1.00 24.51  ? 200  PRO A O   1 
ATOM   1524  C  CB  . PRO A  1  200 ? 74.680  319.829 196.877 1.00 21.46  ? 200  PRO A CB  1 
ATOM   1525  C  CG  . PRO A  1  200 ? 74.174  319.357 198.302 1.00 26.23  ? 200  PRO A CG  1 
ATOM   1526  C  CD  . PRO A  1  200 ? 73.116  318.337 197.952 1.00 23.30  ? 200  PRO A CD  1 
ATOM   1527  N  N   . VAL A  1  201 ? 73.371  318.520 194.232 1.00 23.94  ? 201  VAL A N   1 
ATOM   1528  C  CA  . VAL A  1  201 ? 73.517  318.307 192.789 1.00 20.55  ? 201  VAL A CA  1 
ATOM   1529  C  C   . VAL A  1  201 ? 72.258  318.777 192.066 1.00 29.09  ? 201  VAL A C   1 
ATOM   1530  O  O   . VAL A  1  201 ? 72.331  319.412 191.005 1.00 29.67  ? 201  VAL A O   1 
ATOM   1531  C  CB  . VAL A  1  201 ? 73.834  316.833 192.490 1.00 22.93  ? 201  VAL A CB  1 
ATOM   1532  C  CG1 . VAL A  1  201 ? 73.978  316.667 190.914 1.00 24.77  ? 201  VAL A CG1 1 
ATOM   1533  C  CG2 . VAL A  1  201 ? 75.136  316.424 193.236 1.00 22.24  ? 201  VAL A CG2 1 
ATOM   1534  N  N   . LEU A  1  202 ? 71.077  318.493 192.624 1.00 24.58  ? 202  LEU A N   1 
ATOM   1535  C  CA  . LEU A  1  202 ? 69.850  319.100 192.078 1.00 23.05  ? 202  LEU A CA  1 
ATOM   1536  C  C   . LEU A  1  202 ? 69.972  320.607 192.039 1.00 28.44  ? 202  LEU A C   1 
ATOM   1537  O  O   . LEU A  1  202 ? 69.596  321.247 191.063 1.00 25.78  ? 202  LEU A O   1 
ATOM   1538  C  CB  . LEU A  1  202 ? 68.636  318.731 192.952 1.00 22.26  ? 202  LEU A CB  1 
ATOM   1539  C  CG  . LEU A  1  202 ? 67.322  319.432 192.504 1.00 24.48  ? 202  LEU A CG  1 
ATOM   1540  C  CD1 . LEU A  1  202 ? 66.782  318.862 191.136 1.00 26.40  ? 202  LEU A CD1 1 
ATOM   1541  C  CD2 . LEU A  1  202 ? 66.263  319.248 193.698 1.00 24.23  ? 202  LEU A CD2 1 
ATOM   1542  N  N   . ALA A  1  203 ? 70.440  321.193 193.133 1.00 24.62  ? 203  ALA A N   1 
ATOM   1543  C  CA  . ALA A  1  203 ? 70.556  322.652 193.215 1.00 22.96  ? 203  ALA A CA  1 
ATOM   1544  C  C   . ALA A  1  203 ? 71.459  323.183 192.108 1.00 30.91  ? 203  ALA A C   1 
ATOM   1545  O  O   . ALA A  1  203 ? 71.195  324.242 191.529 1.00 25.51  ? 203  ALA A O   1 
ATOM   1546  C  CB  . ALA A  1  203 ? 71.149  323.053 194.624 1.00 23.54  ? 203  ALA A CB  1 
ATOM   1547  N  N   . ALA A  1  204 ? 72.549  322.476 191.856 1.00 23.01  ? 204  ALA A N   1 
ATOM   1548  C  CA  . ALA A  1  204 ? 73.461  322.851 190.773 1.00 26.47  ? 204  ALA A CA  1 
ATOM   1549  C  C   . ALA A  1  204 ? 72.736  322.790 189.438 1.00 27.35  ? 204  ALA A C   1 
ATOM   1550  O  O   . ALA A  1  204 ? 72.747  323.751 188.679 1.00 23.43  ? 204  ALA A O   1 
ATOM   1551  C  CB  . ALA A  1  204 ? 74.683  321.932 190.745 1.00 25.03  ? 204  ALA A CB  1 
ATOM   1552  N  N   . GLY A  1  205 ? 72.048  321.697 189.159 1.00 22.53  ? 205  GLY A N   1 
ATOM   1553  C  CA  . GLY A  1  205 ? 71.354  321.582 187.872 1.00 22.82  ? 205  GLY A CA  1 
ATOM   1554  C  C   . GLY A  1  205 ? 70.227  322.585 187.675 1.00 25.91  ? 205  GLY A C   1 
ATOM   1555  O  O   . GLY A  1  205 ? 70.030  323.095 186.562 1.00 25.46  ? 205  GLY A O   1 
ATOM   1556  N  N   . ILE A  1  206 ? 69.412  322.835 188.710 1.00 24.46  ? 206  ILE A N   1 
ATOM   1557  C  CA  . ILE A  1  206 ? 68.304  323.781 188.478 1.00 23.20  ? 206  ILE A CA  1 
ATOM   1558  C  C   . ILE A  1  206 ? 68.810  325.205 188.470 1.00 28.33  ? 206  ILE A C   1 
ATOM   1559  O  O   . ILE A  1  206 ? 68.198  326.076 187.839 1.00 28.80  ? 206  ILE A O   1 
ATOM   1560  C  CB  . ILE A  1  206 ? 67.164  323.658 189.500 1.00 23.77  ? 206  ILE A CB  1 
ATOM   1561  C  CG1 . ILE A  1  206 ? 67.653  323.971 190.945 1.00 23.02  ? 206  ILE A CG1 1 
ATOM   1562  C  CG2 . ILE A  1  206 ? 66.510  322.212 189.408 1.00 24.89  ? 206  ILE A CG2 1 
ATOM   1563  C  CD1 . ILE A  1  206 ? 66.493  323.801 191.996 1.00 25.28  ? 206  ILE A CD1 1 
ATOM   1564  N  N   . THR A  1  207 ? 69.986  325.445 189.041 1.00 23.58  ? 207  THR A N   1 
ATOM   1565  C  CA  . THR A  1  207 ? 70.577  326.786 188.921 1.00 21.73  ? 207  THR A CA  1 
ATOM   1566  C  C   . THR A  1  207 ? 71.073  327.025 187.494 1.00 25.27  ? 207  THR A C   1 
ATOM   1567  O  O   . THR A  1  207 ? 70.935  328.124 186.944 1.00 25.93  ? 207  THR A O   1 
ATOM   1568  C  CB  . THR A  1  207 ? 71.708  326.930 189.956 1.00 26.78  ? 207  THR A CB  1 
ATOM   1569  O  OG1 . THR A  1  207 ? 71.143  326.784 191.276 1.00 32.18  ? 207  THR A OG1 1 
ATOM   1570  C  CG2 . THR A  1  207 ? 72.369  328.305 189.852 1.00 26.70  ? 207  THR A CG2 1 
ATOM   1571  N  N   . MET A  1  208 ? 71.655  326.000 186.889 1.00 24.38  ? 208  MET A N   1 
ATOM   1572  C  CA  . MET A  1  208 ? 72.030  326.069 185.471 1.00 27.70  ? 208  MET A CA  1 
ATOM   1573  C  C   . MET A  1  208 ? 70.814  326.287 184.583 1.00 28.10  ? 208  MET A C   1 
ATOM   1574  O  O   . MET A  1  208 ? 70.904  326.971 183.553 1.00 27.97  ? 208  MET A O   1 
ATOM   1575  C  CB  . MET A  1  208 ? 72.785  324.787 185.083 1.00 21.65  ? 208  MET A CB  1 
ATOM   1576  C  CG  . MET A  1  208 ? 74.217  324.817 185.682 1.00 30.35  ? 208  MET A CG  1 
ATOM   1577  S  SD  . MET A  1  208 ? 74.983  323.215 185.360 1.00 41.19  ? 208  MET A SD  1 
ATOM   1578  C  CE  . MET A  1  208 ? 75.496  322.356 186.932 1.00 32.80  ? 208  MET A CE  1 
ATOM   1579  N  N   . LEU A  1  209 ? 69.672  325.688 184.939 1.00 28.28  ? 209  LEU A N   1 
ATOM   1580  C  CA  . LEU A  1  209 ? 68.459  325.938 184.169 1.00 27.04  ? 209  LEU A CA  1 
ATOM   1581  C  C   . LEU A  1  209 ? 68.007  327.376 184.325 1.00 26.55  ? 209  LEU A C   1 
ATOM   1582  O  O   . LEU A  1  209 ? 67.653  328.048 183.333 1.00 25.29  ? 209  LEU A O   1 
ATOM   1583  C  CB  . LEU A  1  209 ? 67.373  324.959 184.574 1.00 23.80  ? 209  LEU A CB  1 
ATOM   1584  C  CG  . LEU A  1  209 ? 66.013  325.071 183.830 1.00 30.78  ? 209  LEU A CG  1 
ATOM   1585  C  CD1 . LEU A  1  209 ? 66.148  324.772 182.281 1.00 28.62  ? 209  LEU A CD1 1 
ATOM   1586  C  CD2 . LEU A  1  209 ? 65.034  324.104 184.512 1.00 24.14  ? 209  LEU A CD2 1 
ATOM   1587  N  N   . LEU A  1  210 ? 68.123  327.900 185.551 1.00 27.11  ? 210  LEU A N   1 
ATOM   1588  C  CA  . LEU A  1  210 ? 67.811  329.308 185.809 1.00 26.14  ? 210  LEU A CA  1 
ATOM   1589  C  C   . LEU A  1  210 ? 68.706  330.242 184.998 1.00 27.24  ? 210  LEU A C   1 
ATOM   1590  O  O   . LEU A  1  210 ? 68.221  331.247 184.450 1.00 27.01  ? 210  LEU A O   1 
ATOM   1591  C  CB  . LEU A  1  210 ? 67.968  329.595 187.323 1.00 22.39  ? 210  LEU A CB  1 
ATOM   1592  C  CG  . LEU A  1  210 ? 67.580  331.008 187.735 1.00 26.53  ? 210  LEU A CG  1 
ATOM   1593  C  CD1 . LEU A  1  210 ? 66.014  331.091 187.874 1.00 23.27  ? 210  LEU A CD1 1 
ATOM   1594  C  CD2 . LEU A  1  210 ? 68.284  331.313 189.097 1.00 24.55  ? 210  LEU A CD2 1 
ATOM   1595  N  N   . THR A  1  211 ? 70.017  329.947 184.912 1.00 25.23  ? 211  THR A N   1 
ATOM   1596  C  CA  . THR A  1  211 ? 70.865  330.860 184.169 1.00 25.30  ? 211  THR A CA  1 
ATOM   1597  C  C   . THR A  1  211 ? 70.643  330.680 182.671 1.00 31.39  ? 211  THR A C   1 
ATOM   1598  O  O   . THR A  1  211 ? 70.728  331.664 181.953 1.00 27.97  ? 211  THR A O   1 
ATOM   1599  C  CB  . THR A  1  211 ? 72.344  330.700 184.536 1.00 28.91  ? 211  THR A CB  1 
ATOM   1600  O  OG1 . THR A  1  211 ? 72.786  329.365 184.224 1.00 25.74  ? 211  THR A OG1 1 
ATOM   1601  C  CG2 . THR A  1  211 ? 72.550  330.968 186.030 1.00 24.82  ? 211  THR A CG2 1 
ATOM   1602  N  N   . ASP A  1  212 ? 70.361  329.450 182.191 1.00 25.68  ? 212  ASP A N   1 
ATOM   1603  C  CA  . ASP A  1  212 ? 69.963  329.306 180.767 1.00 33.54  ? 212  ASP A CA  1 
ATOM   1604  C  C   . ASP A  1  212 ? 68.712  330.131 180.466 1.00 33.18  ? 212  ASP A C   1 
ATOM   1605  O  O   . ASP A  1  212 ? 68.584  330.706 179.376 1.00 31.60  ? 212  ASP A O   1 
ATOM   1606  C  CB  . ASP A  1  212 ? 69.690  327.841 180.378 1.00 29.09  ? 212  ASP A CB  1 
ATOM   1607  C  CG  . ASP A  1  212 ? 70.961  327.048 180.001 1.00 32.29  ? 212  ASP A CG  1 
ATOM   1608  O  OD1 . ASP A  1  212 ? 72.086  327.424 180.420 1.00 26.15  ? 212  ASP A OD1 1 
ATOM   1609  O  OD2 . ASP A  1  212 ? 70.836  326.016 179.283 1.00 28.70  ? 212  ASP A OD2 1 
ATOM   1610  N  N   . ARG A  1  213 ? 67.785  330.234 181.433 1.00 27.00  ? 213  ARG A N   1 
ATOM   1611  C  CA  . ARG A  1  213 ? 66.524  330.942 181.181 1.00 26.06  ? 213  ARG A CA  1 
ATOM   1612  C  C   . ARG A  1  213 ? 66.700  332.453 181.308 1.00 29.58  ? 213  ARG A C   1 
ATOM   1613  O  O   . ARG A  1  213 ? 65.940  333.204 180.704 1.00 32.59  ? 213  ARG A O   1 
ATOM   1614  C  CB  . ARG A  1  213 ? 65.403  330.472 182.179 1.00 23.17  ? 213  ARG A CB  1 
ATOM   1615  C  CG  . ARG A  1  213 ? 64.906  329.081 181.892 1.00 28.07  ? 213  ARG A CG  1 
ATOM   1616  C  CD  . ARG A  1  213 ? 63.997  328.582 183.058 1.00 26.89  ? 213  ARG A CD  1 
ATOM   1617  N  NE  . ARG A  1  213 ? 62.983  329.614 183.305 1.00 28.79  ? 213  ARG A NE  1 
ATOM   1618  C  CZ  . ARG A  1  213 ? 61.909  329.824 182.536 1.00 32.44  ? 213  ARG A CZ  1 
ATOM   1619  N  NH1 . ARG A  1  213 ? 61.577  328.994 181.526 1.00 26.65  ? 213  ARG A NH1 1 
ATOM   1620  N  NH2 . ARG A  1  213 ? 61.105  330.828 182.843 1.00 30.63  ? 213  ARG A NH2 1 
ATOM   1621  N  N   . ASN A  1  214 ? 67.696  332.922 182.089 1.00 32.23  ? 214  ASN A N   1 
ATOM   1622  C  CA  . ASN A  1  214 ? 67.769  334.342 182.421 1.00 29.39  ? 214  ASN A CA  1 
ATOM   1623  C  C   . ASN A  1  214 ? 69.097  335.024 182.198 1.00 32.57  ? 214  ASN A C   1 
ATOM   1624  O  O   . ASN A  1  214 ? 69.104  336.254 182.196 1.00 31.49  ? 214  ASN A O   1 
ATOM   1625  C  CB  . ASN A  1  214 ? 67.354  334.562 183.906 1.00 31.85  ? 214  ASN A CB  1 
ATOM   1626  C  CG  . ASN A  1  214 ? 65.910  334.189 184.108 1.00 29.59  ? 214  ASN A CG  1 
ATOM   1627  O  OD1 . ASN A  1  214 ? 65.019  334.877 183.619 1.00 32.13  ? 214  ASN A OD1 1 
ATOM   1628  N  ND2 . ASN A  1  214 ? 65.677  333.012 184.683 1.00 27.09  ? 214  ASN A ND2 1 
ATOM   1629  N  N   . LEU A  1  215 ? 70.222  334.305 182.064 1.00 27.06  ? 215  LEU A N   1 
ATOM   1630  C  CA  . LEU A  1  215 ? 71.511  334.970 181.900 1.00 28.83  ? 215  LEU A CA  1 
ATOM   1631  C  C   . LEU A  1  215 ? 72.229  334.587 180.607 1.00 29.96  ? 215  LEU A C   1 
ATOM   1632  O  O   . LEU A  1  215 ? 73.451  334.738 180.544 1.00 30.44  ? 215  LEU A O   1 
ATOM   1633  C  CB  . LEU A  1  215 ? 72.448  334.641 183.090 1.00 27.12  ? 215  LEU A CB  1 
ATOM   1634  C  CG  . LEU A  1  215 ? 71.899  335.107 184.484 1.00 36.35  ? 215  LEU A CG  1 
ATOM   1635  C  CD1 . LEU A  1  215 ? 72.941  334.744 185.620 1.00 32.97  ? 215  LEU A CD1 1 
ATOM   1636  C  CD2 . LEU A  1  215 ? 71.603  336.579 184.520 1.00 33.39  ? 215  LEU A CD2 1 
ATOM   1637  N  N   . ASN A  1  216 ? 71.517  333.979 179.652 1.00 27.31  ? 216  ASN A N   1 
ATOM   1638  C  CA  . ASN A  1  216 ? 72.066  333.601 178.345 1.00 29.96  ? 216  ASN A CA  1 
ATOM   1639  C  C   . ASN A  1  216 ? 73.201  332.589 178.436 1.00 34.83  ? 216  ASN A C   1 
ATOM   1640  O  O   . ASN A  1  216 ? 74.080  332.514 177.550 1.00 29.64  ? 216  ASN A O   1 
ATOM   1641  C  CB  . ASN A  1  216 ? 72.455  334.848 177.551 1.00 34.24  ? 216  ASN A CB  1 
ATOM   1642  C  CG  . ASN A  1  216 ? 71.211  335.616 177.153 1.00 29.88  ? 216  ASN A CG  1 
ATOM   1643  O  OD1 . ASN A  1  216 ? 70.244  335.013 176.648 1.00 28.87  ? 216  ASN A OD1 1 
ATOM   1644  N  ND2 . ASN A  1  216 ? 71.174  336.916 177.465 1.00 32.91  ? 216  ASN A ND2 1 
ATOM   1645  N  N   . THR A  1  217 ? 73.166  331.748 179.470 1.00 28.59  ? 217  THR A N   1 
ATOM   1646  C  CA  . THR A  1  217 ? 74.045  330.580 179.442 1.00 28.43  ? 217  THR A CA  1 
ATOM   1647  C  C   . THR A  1  217 ? 73.423  329.511 178.561 1.00 29.74  ? 217  THR A C   1 
ATOM   1648  O  O   . THR A  1  217 ? 72.243  329.555 178.207 1.00 28.68  ? 217  THR A O   1 
ATOM   1649  C  CB  . THR A  1  217 ? 74.305  329.979 180.865 1.00 28.73  ? 217  THR A CB  1 
ATOM   1650  O  OG1 . THR A  1  217 ? 73.058  329.595 181.493 1.00 26.79  ? 217  THR A OG1 1 
ATOM   1651  C  CG2 . THR A  1  217 ? 74.989  331.004 181.809 1.00 28.03  ? 217  THR A CG2 1 
ATOM   1652  N  N   . THR A  1  218 ? 74.213  328.497 178.254 1.00 25.87  ? 218  THR A N   1 
ATOM   1653  C  CA  . THR A  1  218 ? 73.697  327.463 177.350 1.00 28.80  ? 218  THR A CA  1 
ATOM   1654  C  C   . THR A  1  218 ? 74.154  326.084 177.786 1.00 28.05  ? 218  THR A C   1 
ATOM   1655  O  O   . THR A  1  218 ? 74.499  325.226 176.969 1.00 26.93  ? 218  THR A O   1 
ATOM   1656  C  CB  . THR A  1  218 ? 74.145  327.747 175.908 1.00 39.79  ? 218  THR A CB  1 
ATOM   1657  O  OG1 . THR A  1  218 ? 75.535  328.028 175.935 1.00 31.17  ? 218  THR A OG1 1 
ATOM   1658  C  CG2 . THR A  1  218 ? 73.420  328.988 175.311 1.00 25.07  ? 218  THR A CG2 1 
ATOM   1659  N  N   . PHE A  1  219 ? 74.154  325.833 179.092 1.00 28.17  ? 219  PHE A N   1 
ATOM   1660  C  CA  . PHE A  1  219 ? 74.423  324.470 179.557 1.00 24.02  ? 219  PHE A CA  1 
ATOM   1661  C  C   . PHE A  1  219 ? 73.604  323.404 178.834 1.00 30.67  ? 219  PHE A C   1 
ATOM   1662  O  O   . PHE A  1  219 ? 74.066  322.268 178.674 1.00 27.18  ? 219  PHE A O   1 
ATOM   1663  C  CB  . PHE A  1  219 ? 74.073  324.407 181.043 1.00 24.62  ? 219  PHE A CB  1 
ATOM   1664  C  CG  . PHE A  1  219 ? 74.985  325.251 181.909 1.00 30.39  ? 219  PHE A CG  1 
ATOM   1665  C  CD1 . PHE A  1  219 ? 76.305  324.846 182.132 1.00 29.02  ? 219  PHE A CD1 1 
ATOM   1666  C  CD2 . PHE A  1  219 ? 74.529  326.442 182.459 1.00 22.76  ? 219  PHE A CD2 1 
ATOM   1667  C  CE1 . PHE A  1  219 ? 77.144  325.622 182.985 1.00 29.70  ? 219  PHE A CE1 1 
ATOM   1668  C  CE2 . PHE A  1  219 ? 75.355  327.240 183.322 1.00 25.18  ? 219  PHE A CE2 1 
ATOM   1669  C  CZ  . PHE A  1  219 ? 76.654  326.832 183.545 1.00 24.95  ? 219  PHE A CZ  1 
ATOM   1670  N  N   . PHE A  1  220 ? 72.335  323.683 178.560 1.00 24.03  ? 220  PHE A N   1 
ATOM   1671  C  CA  . PHE A  1  220 ? 71.439  322.649 178.054 1.00 25.16  ? 220  PHE A CA  1 
ATOM   1672  C  C   . PHE A  1  220 ? 70.958  322.961 176.650 1.00 27.49  ? 220  PHE A C   1 
ATOM   1673  O  O   . PHE A  1  220 ? 69.968  322.368 176.183 1.00 29.07  ? 220  PHE A O   1 
ATOM   1674  C  CB  . PHE A  1  220 ? 70.229  322.505 178.990 1.00 24.34  ? 220  PHE A CB  1 
ATOM   1675  C  CG  . PHE A  1  220 ? 70.636  322.317 180.476 1.00 26.84  ? 220  PHE A CG  1 
ATOM   1676  C  CD1 . PHE A  1  220 ? 71.629  321.413 180.794 1.00 22.48  ? 220  PHE A CD1 1 
ATOM   1677  C  CD2 . PHE A  1  220 ? 70.106  323.135 181.459 1.00 21.94  ? 220  PHE A CD2 1 
ATOM   1678  C  CE1 . PHE A  1  220 ? 72.063  321.235 182.114 1.00 23.99  ? 220  PHE A CE1 1 
ATOM   1679  C  CE2 . PHE A  1  220 ? 70.505  322.960 182.819 1.00 24.12  ? 220  PHE A CE2 1 
ATOM   1680  C  CZ  . PHE A  1  220 ? 71.470  322.005 183.161 1.00 24.18  ? 220  PHE A CZ  1 
ATOM   1681  N  N   . ASP A  1  221 ? 71.589  323.955 176.011 1.00 29.51  ? 221  ASP A N   1 
ATOM   1682  C  CA  . ASP A  1  221 ? 71.145  324.487 174.726 1.00 31.20  ? 221  ASP A CA  1 
ATOM   1683  C  C   . ASP A  1  221 ? 72.178  324.125 173.671 1.00 23.95  ? 221  ASP A C   1 
ATOM   1684  O  O   . ASP A  1  221 ? 73.284  324.688 173.679 1.00 28.75  ? 221  ASP A O   1 
ATOM   1685  C  CB  . ASP A  1  221 ? 70.956  326.000 174.821 1.00 28.51  ? 221  ASP A CB  1 
ATOM   1686  C  CG  . ASP A  1  221 ? 70.463  326.625 173.528 1.00 43.25  ? 221  ASP A CG  1 
ATOM   1687  O  OD1 . ASP A  1  221 ? 70.421  325.914 172.538 1.00 32.20  ? 221  ASP A OD1 1 
ATOM   1688  O  OD2 . ASP A  1  221 ? 70.121  327.816 173.501 1.00 29.48  ? 221  ASP A OD2 1 
ATOM   1689  N  N   . PRO A  1  222 ? 71.862  323.159 172.779 1.00 29.97  ? 222  PRO A N   1 
ATOM   1690  C  CA  . PRO A  1  222 ? 72.802  322.770 171.682 1.00 25.80  ? 222  PRO A CA  1 
ATOM   1691  C  C   . PRO A  1  222 ? 73.358  323.924 170.925 1.00 31.24  ? 222  PRO A C   1 
ATOM   1692  O  O   . PRO A  1  222 ? 74.521  323.836 170.488 1.00 28.01  ? 222  PRO A O   1 
ATOM   1693  C  CB  . PRO A  1  222 ? 71.952  321.888 170.747 1.00 31.80  ? 222  PRO A CB  1 
ATOM   1694  C  CG  . PRO A  1  222 ? 70.679  321.517 171.536 1.00 49.36  ? 222  PRO A CG  1 
ATOM   1695  C  CD  . PRO A  1  222 ? 70.495  322.595 172.616 1.00 29.38  ? 222  PRO A CD  1 
ATOM   1696  N  N   . ALA A  1  223 ? 72.570  324.999 170.717 1.00 26.89  ? 223  ALA A N   1 
ATOM   1697  C  CA  . ALA A  1  223 ? 73.079  326.146 169.958 1.00 34.30  ? 223  ALA A CA  1 
ATOM   1698  C  C   . ALA A  1  223 ? 74.373  326.694 170.545 1.00 39.14  ? 223  ALA A C   1 
ATOM   1699  O  O   . ALA A  1  223 ? 75.191  327.285 169.822 1.00 27.65  ? 223  ALA A O   1 
ATOM   1700  C  CB  . ALA A  1  223 ? 72.023  327.271 169.873 1.00 30.52  ? 223  ALA A CB  1 
ATOM   1701  N  N   . GLY A  1  224 ? 74.521  326.634 171.872 1.00 32.73  ? 224  GLY A N   1 
ATOM   1702  C  CA  . GLY A  1  224 ? 75.750  327.082 172.478 1.00 29.40  ? 224  GLY A CA  1 
ATOM   1703  C  C   . GLY A  1  224 ? 76.701  325.952 172.784 1.00 28.99  ? 224  GLY A C   1 
ATOM   1704  O  O   . GLY A  1  224 ? 77.733  326.199 173.407 1.00 29.00  ? 224  GLY A O   1 
ATOM   1705  N  N   . GLY A  1  225 ? 76.440  324.731 172.293 1.00 25.83  ? 225  GLY A N   1 
ATOM   1706  C  CA  . GLY A  1  225 ? 77.287  323.591 172.631 1.00 28.23  ? 225  GLY A CA  1 
ATOM   1707  C  C   . GLY A  1  225 ? 76.824  322.810 173.853 1.00 30.87  ? 225  GLY A C   1 
ATOM   1708  O  O   . GLY A  1  225 ? 77.569  321.916 174.327 1.00 26.59  ? 225  GLY A O   1 
ATOM   1709  N  N   . GLY A  1  226 ? 75.648  323.152 174.406 1.00 28.93  ? 226  GLY A N   1 
ATOM   1710  C  CA  . GLY A  1  226 ? 75.108  322.493 175.601 1.00 26.68  ? 226  GLY A CA  1 
ATOM   1711  C  C   . GLY A  1  226 ? 74.345  321.233 175.174 1.00 31.53  ? 226  GLY A C   1 
ATOM   1712  O  O   . GLY A  1  226 ? 74.365  320.840 174.031 1.00 28.57  ? 226  GLY A O   1 
ATOM   1713  N  N   . ASP A  1  227 ? 73.691  320.577 176.126 1.00 25.19  ? 227  ASP A N   1 
ATOM   1714  C  CA  . ASP A  1  227 ? 73.103  319.256 175.931 1.00 25.75  ? 227  ASP A CA  1 
ATOM   1715  C  C   . ASP A  1  227 ? 71.934  319.089 176.916 1.00 26.01  ? 227  ASP A C   1 
ATOM   1716  O  O   . ASP A  1  227 ? 72.163  319.084 178.128 1.00 27.54  ? 227  ASP A O   1 
ATOM   1717  C  CB  . ASP A  1  227 ? 74.174  318.183 176.210 1.00 23.80  ? 227  ASP A CB  1 
ATOM   1718  C  CG  . ASP A  1  227 ? 73.683  316.771 175.934 1.00 27.87  ? 227  ASP A CG  1 
ATOM   1719  O  OD1 . ASP A  1  227 ? 72.525  316.584 175.520 1.00 28.66  ? 227  ASP A OD1 1 
ATOM   1720  O  OD2 . ASP A  1  227 ? 74.486  315.843 176.163 1.00 29.29  ? 227  ASP A OD2 1 
ATOM   1721  N  N   . PRO A  1  228 ? 70.715  318.894 176.430 1.00 26.23  ? 228  PRO A N   1 
ATOM   1722  C  CA  . PRO A  1  228 ? 69.565  318.664 177.334 1.00 29.90  ? 228  PRO A CA  1 
ATOM   1723  C  C   . PRO A  1  228 ? 69.761  317.455 178.193 1.00 24.50  ? 228  PRO A C   1 
ATOM   1724  O  O   . PRO A  1  228 ? 69.186  317.379 179.298 1.00 25.93  ? 228  PRO A O   1 
ATOM   1725  C  CB  . PRO A  1  228 ? 68.380  318.418 176.350 1.00 25.30  ? 228  PRO A CB  1 
ATOM   1726  C  CG  . PRO A  1  228 ? 68.790  319.154 175.072 1.00 25.71  ? 228  PRO A CG  1 
ATOM   1727  C  CD  . PRO A  1  228 ? 70.324  319.032 174.977 1.00 25.91  ? 228  PRO A CD  1 
ATOM   1728  N  N   . ILE A  1  229 ? 70.500  316.473 177.665 1.00 22.71  ? 229  ILE A N   1 
ATOM   1729  C  CA  . ILE A  1  229 ? 70.724  315.222 178.389 1.00 23.46  ? 229  ILE A CA  1 
ATOM   1730  C  C   . ILE A  1  229 ? 71.579  315.466 179.629 1.00 27.47  ? 229  ILE A C   1 
ATOM   1731  O  O   . ILE A  1  229 ? 71.426  314.761 180.634 1.00 25.63  ? 229  ILE A O   1 
ATOM   1732  C  CB  . ILE A  1  229 ? 71.363  314.163 177.458 1.00 28.02  ? 229  ILE A CB  1 
ATOM   1733  C  CG1 . ILE A  1  229 ? 70.422  313.823 176.249 1.00 27.48  ? 229  ILE A CG1 1 
ATOM   1734  C  CG2 . ILE A  1  229 ? 71.716  312.907 178.248 1.00 31.28  ? 229  ILE A CG2 1 
ATOM   1735  C  CD1 . ILE A  1  229 ? 68.925  313.672 176.690 1.00 32.51  ? 229  ILE A CD1 1 
ATOM   1736  N  N   . LEU A  1  230 ? 72.484  316.458 179.601 1.00 23.92  ? 230  LEU A N   1 
ATOM   1737  C  CA  . LEU A  1  230 ? 73.202  316.804 180.839 1.00 23.70  ? 230  LEU A CA  1 
ATOM   1738  C  C   . LEU A  1  230 ? 72.229  317.133 181.982 1.00 28.71  ? 230  LEU A C   1 
ATOM   1739  O  O   . LEU A  1  230 ? 72.452  316.743 183.138 1.00 25.16  ? 230  LEU A O   1 
ATOM   1740  C  CB  . LEU A  1  230 ? 74.164  317.986 180.557 1.00 26.29  ? 230  LEU A CB  1 
ATOM   1741  C  CG  . LEU A  1  230 ? 74.793  318.545 181.864 1.00 29.11  ? 230  LEU A CG  1 
ATOM   1742  C  CD1 . LEU A  1  230 ? 75.712  317.491 182.595 1.00 23.64  ? 230  LEU A CD1 1 
ATOM   1743  C  CD2 . LEU A  1  230 ? 75.557  319.888 181.572 1.00 27.86  ? 230  LEU A CD2 1 
ATOM   1744  N  N   . TYR A  1  231 ? 71.196  317.947 181.707 1.00 23.31  ? 231  TYR A N   1 
ATOM   1745  C  CA  . TYR A  1  231 ? 70.226  318.257 182.768 1.00 23.68  ? 231  TYR A CA  1 
ATOM   1746  C  C   . TYR A  1  231 ? 69.638  316.990 183.337 1.00 24.49  ? 231  TYR A C   1 
ATOM   1747  O  O   . TYR A  1  231 ? 69.404  316.898 184.565 1.00 26.11  ? 231  TYR A O   1 
ATOM   1748  C  CB  . TYR A  1  231 ? 69.087  319.151 182.229 1.00 25.31  ? 231  TYR A CB  1 
ATOM   1749  C  CG  . TYR A  1  231 ? 67.994  319.374 183.309 1.00 24.87  ? 231  TYR A CG  1 
ATOM   1750  C  CD1 . TYR A  1  231 ? 66.969  318.444 183.491 1.00 22.24  ? 231  TYR A CD1 1 
ATOM   1751  C  CD2 . TYR A  1  231 ? 68.079  320.456 184.174 1.00 24.86  ? 231  TYR A CD2 1 
ATOM   1752  C  CE1 . TYR A  1  231 ? 66.020  318.631 184.484 1.00 23.33  ? 231  TYR A CE1 1 
ATOM   1753  C  CE2 . TYR A  1  231 ? 67.140  320.632 185.183 1.00 25.26  ? 231  TYR A CE2 1 
ATOM   1754  C  CZ  . TYR A  1  231 ? 66.128  319.729 185.316 1.00 29.01  ? 231  TYR A CZ  1 
ATOM   1755  O  OH  . TYR A  1  231 ? 65.174  319.929 186.292 1.00 24.69  ? 231  TYR A OH  1 
ATOM   1756  N  N   . GLN A  1  232 ? 69.354  316.015 182.462 1.00 25.57  ? 232  GLN A N   1 
ATOM   1757  C  CA  . GLN A  1  232 ? 68.705  314.794 182.930 1.00 21.97  ? 232  GLN A CA  1 
ATOM   1758  C  C   . GLN A  1  232 ? 69.607  314.040 183.883 1.00 23.87  ? 232  GLN A C   1 
ATOM   1759  O  O   . GLN A  1  232 ? 69.123  313.455 184.859 1.00 23.71  ? 232  GLN A O   1 
ATOM   1760  C  CB  . GLN A  1  232 ? 68.282  313.882 181.770 1.00 22.35  ? 232  GLN A CB  1 
ATOM   1761  C  CG  . GLN A  1  232 ? 67.308  314.605 180.797 1.00 26.91  ? 232  GLN A CG  1 
ATOM   1762  C  CD  . GLN A  1  232 ? 66.702  313.675 179.761 1.00 29.88  ? 232  GLN A CD  1 
ATOM   1763  O  OE1 . GLN A  1  232 ? 66.750  312.437 179.877 1.00 27.34  ? 232  GLN A OE1 1 
ATOM   1764  N  NE2 . GLN A  1  232 ? 66.132  314.274 178.735 1.00 26.80  ? 232  GLN A NE2 1 
ATOM   1765  N  N   . HIS A  1  233 ? 70.909  313.945 183.564 1.00 22.42  ? 233  HIS A N   1 
ATOM   1766  C  CA  . HIS A  1  233 ? 71.846  313.280 184.490 1.00 23.23  ? 233  HIS A CA  1 
ATOM   1767  C  C   . HIS A  1  233 ? 71.874  313.983 185.858 1.00 24.56  ? 233  HIS A C   1 
ATOM   1768  O  O   . HIS A  1  233 ? 71.924  313.324 186.909 1.00 25.31  ? 233  HIS A O   1 
ATOM   1769  C  CB  . HIS A  1  233 ? 73.273  313.291 183.850 1.00 23.58  ? 233  HIS A CB  1 
ATOM   1770  C  CG  . HIS A  1  233 ? 73.475  312.240 182.800 1.00 27.10  ? 233  HIS A CG  1 
ATOM   1771  N  ND1 . HIS A  1  233 ? 73.273  310.898 183.057 1.00 25.10  ? 233  HIS A ND1 1 
ATOM   1772  C  CD2 . HIS A  1  233 ? 73.809  312.326 181.468 1.00 25.95  ? 233  HIS A CD2 1 
ATOM   1773  C  CE1 . HIS A  1  233 ? 73.504  310.197 181.958 1.00 29.31  ? 233  HIS A CE1 1 
ATOM   1774  N  NE2 . HIS A  1  233 ? 73.854  311.036 180.988 1.00 24.93  ? 233  HIS A NE2 1 
ATOM   1775  N  N   . LEU A  1  234 ? 71.937  315.322 185.865 1.00 21.89  ? 234  LEU A N   1 
ATOM   1776  C  CA  . LEU A  1  234 ? 72.028  316.020 187.153 1.00 26.38  ? 234  LEU A CA  1 
ATOM   1777  C  C   . LEU A  1  234 ? 70.757  315.857 187.948 1.00 26.59  ? 234  LEU A C   1 
ATOM   1778  O  O   . LEU A  1  234 ? 70.802  315.660 189.202 1.00 25.92  ? 234  LEU A O   1 
ATOM   1779  C  CB  . LEU A  1  234 ? 72.299  317.510 186.920 1.00 22.60  ? 234  LEU A CB  1 
ATOM   1780  C  CG  . LEU A  1  234 ? 73.655  317.781 186.217 1.00 29.30  ? 234  LEU A CG  1 
ATOM   1781  C  CD1 . LEU A  1  234 ? 73.727  319.260 185.818 1.00 24.69  ? 234  LEU A CD1 1 
ATOM   1782  C  CD2 . LEU A  1  234 ? 74.826  317.443 187.170 1.00 26.07  ? 234  LEU A CD2 1 
ATOM   1783  N  N   . PHE A  1  235 ? 69.618  315.955 187.252 1.00 23.42  ? 235  PHE A N   1 
ATOM   1784  C  CA  . PHE A  1  235 ? 68.339  315.799 187.907 1.00 21.17  ? 235  PHE A CA  1 
ATOM   1785  C  C   . PHE A  1  235 ? 68.211  314.418 188.504 1.00 23.90  ? 235  PHE A C   1 
ATOM   1786  O  O   . PHE A  1  235 ? 67.828  314.279 189.675 1.00 24.06  ? 235  PHE A O   1 
ATOM   1787  C  CB  . PHE A  1  235 ? 67.175  316.067 186.952 1.00 20.63  ? 235  PHE A CB  1 
ATOM   1788  C  CG  . PHE A  1  235 ? 65.882  315.907 187.624 1.00 22.94  ? 235  PHE A CG  1 
ATOM   1789  C  CD1 . PHE A  1  235 ? 65.313  316.988 188.252 1.00 21.76  ? 235  PHE A CD1 1 
ATOM   1790  C  CD2 . PHE A  1  235 ? 65.272  314.677 187.693 1.00 22.67  ? 235  PHE A CD2 1 
ATOM   1791  C  CE1 . PHE A  1  235 ? 64.106  316.839 189.015 1.00 24.86  ? 235  PHE A CE1 1 
ATOM   1792  C  CE2 . PHE A  1  235 ? 64.056  314.502 188.491 1.00 25.77  ? 235  PHE A CE2 1 
ATOM   1793  C  CZ  . PHE A  1  235 ? 63.492  315.600 189.103 1.00 22.37  ? 235  PHE A CZ  1 
ATOM   1794  N  N   . TRP A  1  236 ? 68.473  313.372 187.711 1.00 18.13  ? 236  TRP A N   1 
ATOM   1795  C  CA  . TRP A  1  236 ? 68.257  312.014 188.239 1.00 23.35  ? 236  TRP A CA  1 
ATOM   1796  C  C   . TRP A  1  236 ? 69.361  311.546 189.171 1.00 24.31  ? 236  TRP A C   1 
ATOM   1797  O  O   . TRP A  1  236 ? 69.117  310.645 190.015 1.00 22.18  ? 236  TRP A O   1 
ATOM   1798  C  CB  . TRP A  1  236 ? 68.109  310.989 187.074 1.00 22.67  ? 236  TRP A CB  1 
ATOM   1799  C  CG  . TRP A  1  236 ? 66.745  311.155 186.496 1.00 23.24  ? 236  TRP A CG  1 
ATOM   1800  C  CD1 . TRP A  1  236 ? 66.405  311.588 185.199 1.00 24.51  ? 236  TRP A CD1 1 
ATOM   1801  C  CD2 . TRP A  1  236 ? 65.484  310.962 187.188 1.00 24.41  ? 236  TRP A CD2 1 
ATOM   1802  N  NE1 . TRP A  1  236 ? 65.009  311.647 185.081 1.00 24.15  ? 236  TRP A NE1 1 
ATOM   1803  C  CE2 . TRP A  1  236 ? 64.430  311.278 186.267 1.00 29.23  ? 236  TRP A CE2 1 
ATOM   1804  C  CE3 . TRP A  1  236 ? 65.138  310.585 188.518 1.00 20.38  ? 236  TRP A CE3 1 
ATOM   1805  C  CZ2 . TRP A  1  236 ? 63.077  311.207 186.601 1.00 23.42  ? 236  TRP A CZ2 1 
ATOM   1806  C  CZ3 . TRP A  1  236 ? 63.776  310.507 188.849 1.00 24.20  ? 236  TRP A CZ3 1 
ATOM   1807  C  CH2 . TRP A  1  236 ? 62.740  310.823 187.881 1.00 26.47  ? 236  TRP A CH2 1 
ATOM   1808  N  N   . PHE A  1  237 ? 70.539  312.149 189.077 1.00 21.20  ? 237  PHE A N   1 
ATOM   1809  C  CA  . PHE A  1  237 ? 71.570  311.864 190.083 1.00 18.08  ? 237  PHE A CA  1 
ATOM   1810  C  C   . PHE A  1  237 ? 71.023  312.207 191.474 1.00 31.85  ? 237  PHE A C   1 
ATOM   1811  O  O   . PHE A  1  237 ? 71.337  311.539 192.460 1.00 24.03  ? 237  PHE A O   1 
ATOM   1812  C  CB  . PHE A  1  237 ? 72.867  312.620 189.799 1.00 21.50  ? 237  PHE A CB  1 
ATOM   1813  C  CG  . PHE A  1  237 ? 74.006  312.169 190.741 1.00 27.37  ? 237  PHE A CG  1 
ATOM   1814  C  CD1 . PHE A  1  237 ? 74.215  312.823 191.913 1.00 25.19  ? 237  PHE A CD1 1 
ATOM   1815  C  CD2 . PHE A  1  237 ? 74.749  311.031 190.436 1.00 26.74  ? 237  PHE A CD2 1 
ATOM   1816  C  CE1 . PHE A  1  237 ? 75.176  312.419 192.822 1.00 27.98  ? 237  PHE A CE1 1 
ATOM   1817  C  CE2 . PHE A  1  237 ? 75.753  310.570 191.338 1.00 23.44  ? 237  PHE A CE2 1 
ATOM   1818  C  CZ  . PHE A  1  237 ? 75.954  311.287 192.525 1.00 21.47  ? 237  PHE A CZ  1 
ATOM   1819  N  N   . PHE A  1  238 ? 70.201  313.247 191.554 1.00 21.98  ? 238  PHE A N   1 
ATOM   1820  C  CA  . PHE A  1  238 ? 69.417  313.511 192.791 1.00 20.73  ? 238  PHE A CA  1 
ATOM   1821  C  C   . PHE A  1  238 ? 68.167  312.649 192.851 1.00 25.04  ? 238  PHE A C   1 
ATOM   1822  O  O   . PHE A  1  238 ? 67.775  312.156 193.927 1.00 22.32  ? 238  PHE A O   1 
ATOM   1823  C  CB  . PHE A  1  238 ? 69.011  315.001 192.843 1.00 22.93  ? 238  PHE A CB  1 
ATOM   1824  C  CG  . PHE A  1  238 ? 67.698  315.251 193.557 1.00 27.08  ? 238  PHE A CG  1 
ATOM   1825  C  CD1 . PHE A  1  238 ? 67.681  315.352 194.974 1.00 23.55  ? 238  PHE A CD1 1 
ATOM   1826  C  CD2 . PHE A  1  238 ? 66.482  315.347 192.838 1.00 25.67  ? 238  PHE A CD2 1 
ATOM   1827  C  CE1 . PHE A  1  238 ? 66.419  315.562 195.640 1.00 27.27  ? 238  PHE A CE1 1 
ATOM   1828  C  CE2 . PHE A  1  238 ? 65.262  315.543 193.501 1.00 25.30  ? 238  PHE A CE2 1 
ATOM   1829  C  CZ  . PHE A  1  238 ? 65.239  315.661 194.927 1.00 23.31  ? 238  PHE A CZ  1 
ATOM   1830  N  N   . GLY A  1  239 ? 67.447  312.517 191.731 1.00 24.76  ? 239  GLY A N   1 
ATOM   1831  C  CA  . GLY A  1  239 ? 66.086  312.021 191.846 1.00 22.20  ? 239  GLY A CA  1 
ATOM   1832  C  C   . GLY A  1  239 ? 65.990  310.550 192.195 1.00 23.68  ? 239  GLY A C   1 
ATOM   1833  O  O   . GLY A  1  239 ? 64.974  310.110 192.780 1.00 24.04  ? 239  GLY A O   1 
ATOM   1834  N  N   . HIS A  1  240 ? 66.983  309.734 191.820 1.00 21.78  ? 240  HIS A N   1 
ATOM   1835  C  CA  . HIS A  1  240 ? 66.885  308.375 192.342 1.00 18.48  ? 240  HIS A CA  1 
ATOM   1836  C  C   . HIS A  1  240 ? 67.153  308.340 193.837 1.00 21.25  ? 240  HIS A C   1 
ATOM   1837  O  O   . HIS A  1  240 ? 66.305  307.778 194.571 1.00 22.17  ? 240  HIS A O   1 
ATOM   1838  C  CB  . HIS A  1  240 ? 67.773  307.331 191.618 1.00 21.27  ? 240  HIS A CB  1 
ATOM   1839  C  CG  . HIS A  1  240 ? 67.441  305.998 192.172 1.00 24.31  ? 240  HIS A CG  1 
ATOM   1840  N  ND1 . HIS A  1  240 ? 66.360  305.261 191.701 1.00 25.79  ? 240  HIS A ND1 1 
ATOM   1841  C  CD2 . HIS A  1  240 ? 67.763  305.471 193.381 1.00 28.69  ? 240  HIS A CD2 1 
ATOM   1842  C  CE1 . HIS A  1  240 ? 66.113  304.268 192.571 1.00 25.54  ? 240  HIS A CE1 1 
ATOM   1843  N  NE2 . HIS A  1  240 ? 66.910  304.414 193.610 1.00 25.83  ? 240  HIS A NE2 1 
ATOM   1844  N  N   . PRO A  1  241 ? 68.266  308.870 194.366 1.00 24.86  ? 241  PRO A N   1 
ATOM   1845  C  CA  . PRO A  1  241 ? 68.345  308.956 195.864 1.00 20.27  ? 241  PRO A CA  1 
ATOM   1846  C  C   . PRO A  1  241 ? 67.086  309.545 196.458 1.00 28.88  ? 241  PRO A C   1 
ATOM   1847  O  O   . PRO A  1  241 ? 66.640  309.072 197.491 1.00 24.18  ? 241  PRO A O   1 
ATOM   1848  C  CB  . PRO A  1  241 ? 69.566  309.854 196.119 1.00 23.68  ? 241  PRO A CB  1 
ATOM   1849  C  CG  . PRO A  1  241 ? 70.526  309.567 194.934 1.00 20.52  ? 241  PRO A CG  1 
ATOM   1850  C  CD  . PRO A  1  241 ? 69.495  309.383 193.701 1.00 22.90  ? 241  PRO A CD  1 
ATOM   1851  N  N   . GLU A  1  242 ? 66.454  310.521 195.824 1.00 24.01  ? 242  GLU A N   1 
ATOM   1852  C  CA  . GLU A  1  242 ? 65.225  311.094 196.383 1.00 25.72  ? 242  GLU A CA  1 
ATOM   1853  C  C   . GLU A  1  242 ? 64.148  310.034 196.634 1.00 23.36  ? 242  GLU A C   1 
ATOM   1854  O  O   . GLU A  1  242 ? 63.415  310.126 197.636 1.00 26.82  ? 242  GLU A O   1 
ATOM   1855  C  CB  . GLU A  1  242 ? 64.697  312.172 195.435 1.00 20.76  ? 242  GLU A CB  1 
ATOM   1856  C  CG  . GLU A  1  242 ? 63.275  312.626 195.878 1.00 21.26  ? 242  GLU A CG  1 
ATOM   1857  C  CD  . GLU A  1  242 ? 63.296  313.449 197.222 1.00 32.14  ? 242  GLU A CD  1 
ATOM   1858  O  OE1 . GLU A  1  242 ? 62.226  313.741 197.731 1.00 34.52  ? 242  GLU A OE1 1 
ATOM   1859  O  OE2 . GLU A  1  242 ? 64.340  313.810 197.788 1.00 26.44  ? 242  GLU A OE2 1 
ATOM   1860  N  N   . VAL A  1  243 ? 63.982  309.040 195.717 1.00 24.38  ? 243  VAL A N   1 
ATOM   1861  C  CA  . VAL A  1  243 ? 62.929  308.061 196.016 1.00 20.44  ? 243  VAL A CA  1 
ATOM   1862  C  C   . VAL A  1  243 ? 63.322  307.199 197.213 1.00 27.69  ? 243  VAL A C   1 
ATOM   1863  O  O   . VAL A  1  243 ? 62.447  306.816 198.012 1.00 21.98  ? 243  VAL A O   1 
ATOM   1864  C  CB  . VAL A  1  243 ? 62.490  307.205 194.800 1.00 25.06  ? 243  VAL A CB  1 
ATOM   1865  C  CG1 . VAL A  1  243 ? 62.130  308.134 193.645 1.00 24.63  ? 243  VAL A CG1 1 
ATOM   1866  C  CG2 . VAL A  1  243 ? 63.563  306.184 194.403 1.00 24.76  ? 243  VAL A CG2 1 
ATOM   1867  N  N   . TYR A  1  244 ? 64.625  306.929 197.417 1.00 25.14  ? 244  TYR A N   1 
ATOM   1868  C  CA  . TYR A  1  244 ? 65.025  306.204 198.638 1.00 23.96  ? 244  TYR A CA  1 
ATOM   1869  C  C   . TYR A  1  244 ? 64.893  307.076 199.890 1.00 27.36  ? 244  TYR A C   1 
ATOM   1870  O  O   . TYR A  1  244 ? 64.543  306.573 200.937 1.00 25.79  ? 244  TYR A O   1 
ATOM   1871  C  CB  . TYR A  1  244 ? 66.462  305.622 198.516 1.00 21.67  ? 244  TYR A CB  1 
ATOM   1872  C  CG  . TYR A  1  244 ? 66.389  304.621 197.419 1.00 23.69  ? 244  TYR A CG  1 
ATOM   1873  C  CD1 . TYR A  1  244 ? 65.777  303.393 197.640 1.00 23.43  ? 244  TYR A CD1 1 
ATOM   1874  C  CD2 . TYR A  1  244 ? 66.777  304.972 196.110 1.00 20.93  ? 244  TYR A CD2 1 
ATOM   1875  C  CE1 . TYR A  1  244 ? 65.593  302.452 196.551 1.00 28.47  ? 244  TYR A CE1 1 
ATOM   1876  C  CE2 . TYR A  1  244 ? 66.656  304.034 195.011 1.00 24.46  ? 244  TYR A CE2 1 
ATOM   1877  C  CZ  . TYR A  1  244 ? 66.035  302.812 195.243 1.00 25.51  ? 244  TYR A CZ  1 
ATOM   1878  O  OH  . TYR A  1  244 ? 65.829  301.842 194.233 1.00 23.43  ? 244  TYR A OH  1 
ATOM   1879  N  N   . ILE A  1  245 ? 65.135  308.375 199.763 1.00 21.49  ? 245  ILE A N   1 
ATOM   1880  C  CA  . ILE A  1  245 ? 64.797  309.323 200.811 1.00 28.35  ? 245  ILE A CA  1 
ATOM   1881  C  C   . ILE A  1  245 ? 63.299  309.256 201.198 1.00 31.38  ? 245  ILE A C   1 
ATOM   1882  O  O   . ILE A  1  245 ? 62.937  309.432 202.358 1.00 25.55  ? 245  ILE A O   1 
ATOM   1883  C  CB  . ILE A  1  245 ? 65.197  310.733 200.315 1.00 25.59  ? 245  ILE A CB  1 
ATOM   1884  C  CG1 . ILE A  1  245 ? 66.723  310.889 200.383 1.00 24.33  ? 245  ILE A CG1 1 
ATOM   1885  C  CG2 . ILE A  1  245 ? 64.413  311.829 201.095 1.00 24.59  ? 245  ILE A CG2 1 
ATOM   1886  C  CD1 . ILE A  1  245 ? 67.282  311.985 199.433 1.00 21.96  ? 245  ILE A CD1 1 
ATOM   1887  N  N   . LEU A  1  246 ? 62.406  309.116 200.216 1.00 26.45  ? 246  LEU A N   1 
ATOM   1888  C  CA  . LEU A  1  246 ? 60.961  309.102 200.498 1.00 23.67  ? 246  LEU A CA  1 
ATOM   1889  C  C   . LEU A  1  246 ? 60.531  307.823 201.197 1.00 27.32  ? 246  LEU A C   1 
ATOM   1890  O  O   . LEU A  1  246 ? 59.546  307.834 201.925 1.00 28.36  ? 246  LEU A O   1 
ATOM   1891  C  CB  . LEU A  1  246 ? 60.164  309.239 199.164 1.00 17.71  ? 246  LEU A CB  1 
ATOM   1892  C  CG  . LEU A  1  246 ? 60.340  310.596 198.468 1.00 20.04  ? 246  LEU A CG  1 
ATOM   1893  C  CD1 . LEU A  1  246 ? 59.771  310.580 197.015 1.00 20.78  ? 246  LEU A CD1 1 
ATOM   1894  C  CD2 . LEU A  1  246 ? 59.623  311.738 199.286 1.00 22.78  ? 246  LEU A CD2 1 
ATOM   1895  N  N   . ILE A  1  247 ? 61.213  306.716 200.968 1.00 22.72  ? 247  ILE A N   1 
ATOM   1896  C  CA  . ILE A  1  247 ? 60.781  305.447 201.566 1.00 26.17  ? 247  ILE A CA  1 
ATOM   1897  C  C   . ILE A  1  247 ? 61.537  305.043 202.854 1.00 26.58  ? 247  ILE A C   1 
ATOM   1898  O  O   . ILE A  1  247 ? 60.970  304.338 203.708 1.00 25.09  ? 247  ILE A O   1 
ATOM   1899  C  CB  . ILE A  1  247 ? 60.837  304.292 200.537 1.00 22.73  ? 247  ILE A CB  1 
ATOM   1900  C  CG1 . ILE A  1  247 ? 59.826  303.163 200.887 1.00 23.91  ? 247  ILE A CG1 1 
ATOM   1901  C  CG2 . ILE A  1  247 ? 62.342  303.688 200.415 1.00 22.18  ? 247  ILE A CG2 1 
ATOM   1902  C  CD1 . ILE A  1  247 ? 58.347  303.571 200.877 1.00 23.62  ? 247  ILE A CD1 1 
ATOM   1903  N  N   . LEU A  1  248 ? 62.826  305.447 203.002 1.00 19.92  ? 248  LEU A N   1 
ATOM   1904  C  CA  . LEU A  1  248 ? 63.627  304.945 204.139 1.00 19.58  ? 248  LEU A CA  1 
ATOM   1905  C  C   . LEU A  1  248 ? 63.020  305.260 205.524 1.00 22.52  ? 248  LEU A C   1 
ATOM   1906  O  O   . LEU A  1  248 ? 62.965  304.338 206.356 1.00 23.16  ? 248  LEU A O   1 
ATOM   1907  C  CB  . LEU A  1  248 ? 65.083  305.512 204.056 1.00 20.45  ? 248  LEU A CB  1 
ATOM   1908  C  CG  . LEU A  1  248 ? 65.940  304.684 203.122 1.00 31.69  ? 248  LEU A CG  1 
ATOM   1909  C  CD1 . LEU A  1  248 ? 67.249  305.478 202.745 1.00 29.45  ? 248  LEU A CD1 1 
ATOM   1910  C  CD2 . LEU A  1  248 ? 66.249  303.370 203.822 1.00 27.27  ? 248  LEU A CD2 1 
ATOM   1911  N  N   . PRO A  1  249 ? 62.587  306.475 205.835 1.00 22.24  ? 249  PRO A N   1 
ATOM   1912  C  CA  . PRO A  1  249 ? 61.906  306.690 207.122 1.00 19.73  ? 249  PRO A CA  1 
ATOM   1913  C  C   . PRO A  1  249 ? 60.663  305.888 207.249 1.00 27.91  ? 249  PRO A C   1 
ATOM   1914  O  O   . PRO A  1  249 ? 60.286  305.510 208.383 1.00 24.18  ? 249  PRO A O   1 
ATOM   1915  C  CB  . PRO A  1  249 ? 61.597  308.213 207.133 1.00 24.23  ? 249  PRO A CB  1 
ATOM   1916  C  CG  . PRO A  1  249 ? 62.593  308.840 206.013 1.00 25.78  ? 249  PRO A CG  1 
ATOM   1917  C  CD  . PRO A  1  249 ? 62.559  307.708 205.002 1.00 21.34  ? 249  PRO A CD  1 
ATOM   1918  N  N   . GLY A  1  250 ? 60.002  305.623 206.126 1.00 24.97  ? 250  GLY A N   1 
ATOM   1919  C  CA  . GLY A  1  250 ? 58.915  304.688 206.105 1.00 22.22  ? 250  GLY A CA  1 
ATOM   1920  C  C   . GLY A  1  250 ? 59.341  303.302 206.545 1.00 24.46  ? 250  GLY A C   1 
ATOM   1921  O  O   . GLY A  1  250 ? 58.669  302.677 207.396 1.00 26.26  ? 250  GLY A O   1 
ATOM   1922  N  N   . PHE A  1  251 ? 60.423  302.796 205.968 1.00 20.81  ? 251  PHE A N   1 
ATOM   1923  C  CA  . PHE A  1  251 ? 60.929  301.478 206.408 1.00 20.63  ? 251  PHE A CA  1 
ATOM   1924  C  C   . PHE A  1  251 ? 61.189  301.520 207.918 1.00 26.20  ? 251  PHE A C   1 
ATOM   1925  O  O   . PHE A  1  251 ? 60.951  300.547 208.649 1.00 23.85  ? 251  PHE A O   1 
ATOM   1926  C  CB  . PHE A  1  251 ? 62.287  301.163 205.766 1.00 22.03  ? 251  PHE A CB  1 
ATOM   1927  C  CG  . PHE A  1  251 ? 62.235  300.793 204.264 1.00 24.56  ? 251  PHE A CG  1 
ATOM   1928  C  CD1 . PHE A  1  251 ? 61.021  300.520 203.644 1.00 27.08  ? 251  PHE A CD1 1 
ATOM   1929  C  CD2 . PHE A  1  251 ? 63.430  300.653 203.568 1.00 27.97  ? 251  PHE A CD2 1 
ATOM   1930  C  CE1 . PHE A  1  251 ? 60.983  300.163 202.267 1.00 25.69  ? 251  PHE A CE1 1 
ATOM   1931  C  CE2 . PHE A  1  251 ? 63.438  300.291 202.185 1.00 26.34  ? 251  PHE A CE2 1 
ATOM   1932  C  CZ  . PHE A  1  251 ? 62.202  300.029 201.545 1.00 30.48  ? 251  PHE A CZ  1 
ATOM   1933  N  N   . GLY A  1  252 ? 61.792  302.604 208.386 1.00 21.94  ? 252  GLY A N   1 
ATOM   1934  C  CA  . GLY A  1  252 ? 62.065  302.741 209.836 1.00 22.25  ? 252  GLY A CA  1 
ATOM   1935  C  C   . GLY A  1  252 ? 60.778  302.634 210.661 1.00 28.99  ? 252  GLY A C   1 
ATOM   1936  O  O   . GLY A  1  252 ? 60.715  301.904 211.651 1.00 24.91  ? 252  GLY A O   1 
ATOM   1937  N  N   . MET A  1  253 ? 59.744  303.427 210.304 1.00 25.40  ? 253  MET A N   1 
ATOM   1938  C  CA  . MET A  1  253 ? 58.475  303.342 211.063 1.00 26.16  ? 253  MET A CA  1 
ATOM   1939  C  C   . MET A  1  253 ? 57.870  301.949 211.003 1.00 27.09  ? 253  MET A C   1 
ATOM   1940  O  O   . MET A  1  253 ? 57.392  301.431 212.024 1.00 28.19  ? 253  MET A O   1 
ATOM   1941  C  CB  . MET A  1  253 ? 57.464  304.364 210.533 1.00 24.18  ? 253  MET A CB  1 
ATOM   1942  C  CG  . MET A  1  253 ? 57.916  305.723 210.894 1.00 27.72  ? 253  MET A CG  1 
ATOM   1943  S  SD  . MET A  1  253 ? 56.752  307.046 210.623 1.00 31.01  ? 253  MET A SD  1 
ATOM   1944  C  CE  . MET A  1  253 ? 56.703  307.183 208.809 1.00 26.72  ? 253  MET A CE  1 
ATOM   1945  N  N   . ILE A  1  254 ? 57.888  301.322 209.810 1.00 26.55  ? 254  ILE A N   1 
ATOM   1946  C  CA  . ILE A  1  254 ? 57.333  299.976 209.650 1.00 24.80  ? 254  ILE A CA  1 
ATOM   1947  C  C   . ILE A  1  254 ? 58.022  298.997 210.609 1.00 26.70  ? 254  ILE A C   1 
ATOM   1948  O  O   . ILE A  1  254 ? 57.376  298.189 211.265 1.00 25.49  ? 254  ILE A O   1 
ATOM   1949  C  CB  . ILE A  1  254 ? 57.438  299.494 208.189 1.00 25.48  ? 254  ILE A CB  1 
ATOM   1950  C  CG1 . ILE A  1  254 ? 56.484  300.323 207.277 1.00 25.99  ? 254  ILE A CG1 1 
ATOM   1951  C  CG2 . ILE A  1  254 ? 57.131  297.948 208.098 1.00 22.32  ? 254  ILE A CG2 1 
ATOM   1952  C  CD1 . ILE A  1  254 ? 54.963  300.023 207.545 1.00 26.50  ? 254  ILE A CD1 1 
ATOM   1953  N  N   . SER A  1  255 ? 59.346  299.040 210.668 1.00 25.34  ? 255  SER A N   1 
ATOM   1954  C  CA  . SER A  1  255 ? 60.051  298.190 211.594 1.00 21.50  ? 255  SER A CA  1 
ATOM   1955  C  C   . SER A  1  255 ? 59.536  298.400 213.052 1.00 23.88  ? 255  SER A C   1 
ATOM   1956  O  O   . SER A  1  255 ? 59.279  297.435 213.739 1.00 25.43  ? 255  SER A O   1 
ATOM   1957  C  CB  . SER A  1  255 ? 61.567  298.472 211.580 1.00 27.63  ? 255  SER A CB  1 
ATOM   1958  O  OG  . SER A  1  255 ? 62.130  297.952 210.375 1.00 29.24  ? 255  SER A OG  1 
ATOM   1959  N  N   . HIS A  1  256 ? 59.294  299.640 213.488 1.00 24.68  ? 256  HIS A N   1 
ATOM   1960  C  CA  . HIS A  1  256 ? 58.791  299.836 214.869 1.00 30.84  ? 256  HIS A CA  1 
ATOM   1961  C  C   . HIS A  1  256 ? 57.354  299.366 215.024 1.00 30.20  ? 256  HIS A C   1 
ATOM   1962  O  O   . HIS A  1  256 ? 57.020  298.763 216.039 1.00 25.70  ? 256  HIS A O   1 
ATOM   1963  C  CB  . HIS A  1  256 ? 58.872  301.301 215.256 1.00 23.95  ? 256  HIS A CB  1 
ATOM   1964  C  CG  . HIS A  1  256 ? 60.252  301.769 215.549 1.00 29.63  ? 256  HIS A CG  1 
ATOM   1965  N  ND1 . HIS A  1  256 ? 60.604  302.287 216.783 1.00 25.42  ? 256  HIS A ND1 1 
ATOM   1966  C  CD2 . HIS A  1  256 ? 61.372  301.806 214.792 1.00 25.93  ? 256  HIS A CD2 1 
ATOM   1967  C  CE1 . HIS A  1  256 ? 61.877  302.615 216.783 1.00 30.11  ? 256  HIS A CE1 1 
ATOM   1968  N  NE2 . HIS A  1  256 ? 62.385  302.339 215.595 1.00 24.87  ? 256  HIS A NE2 1 
ATOM   1969  N  N   . ILE A  1  257 ? 56.491  299.639 214.030 1.00 25.51  ? 257  ILE A N   1 
ATOM   1970  C  CA  . ILE A  1  257 ? 55.082  299.250 214.130 1.00 24.71  ? 257  ILE A CA  1 
ATOM   1971  C  C   . ILE A  1  257 ? 54.922  297.738 214.134 1.00 29.90  ? 257  ILE A C   1 
ATOM   1972  O  O   . ILE A  1  257 ? 54.185  297.172 214.958 1.00 27.80  ? 257  ILE A O   1 
ATOM   1973  C  CB  . ILE A  1  257 ? 54.282  299.875 212.985 1.00 23.51  ? 257  ILE A CB  1 
ATOM   1974  C  CG1 . ILE A  1  257 ? 54.287  301.410 213.197 1.00 25.60  ? 257  ILE A CG1 1 
ATOM   1975  C  CG2 . ILE A  1  257 ? 52.867  299.250 212.889 1.00 21.26  ? 257  ILE A CG2 1 
ATOM   1976  C  CD1 . ILE A  1  257 ? 53.827  302.147 211.850 1.00 25.14  ? 257  ILE A CD1 1 
ATOM   1977  N  N   . VAL A  1  258 ? 55.621  297.054 213.234 1.00 26.21  ? 258  VAL A N   1 
ATOM   1978  C  CA  . VAL A  1  258 ? 55.510  295.596 213.185 1.00 24.80  ? 258  VAL A CA  1 
ATOM   1979  C  C   . VAL A  1  258 ? 56.058  294.968 214.474 1.00 26.19  ? 258  VAL A C   1 
ATOM   1980  O  O   . VAL A  1  258 ? 55.459  294.027 215.012 1.00 26.81  ? 258  VAL A O   1 
ATOM   1981  C  CB  . VAL A  1  258 ? 56.229  295.067 211.919 1.00 30.60  ? 258  VAL A CB  1 
ATOM   1982  C  CG1 . VAL A  1  258 ? 56.345  293.614 211.905 1.00 28.31  ? 258  VAL A CG1 1 
ATOM   1983  C  CG2 . VAL A  1  258 ? 55.457  295.513 210.631 1.00 25.89  ? 258  VAL A CG2 1 
ATOM   1984  N  N   . THR A  1  259 ? 57.216  295.420 214.949 1.00 25.63  ? 259  THR A N   1 
ATOM   1985  C  CA  . THR A  1  259 ? 57.756  294.930 216.232 1.00 22.75  ? 259  THR A CA  1 
ATOM   1986  C  C   . THR A  1  259 ? 56.721  295.143 217.362 1.00 27.49  ? 259  THR A C   1 
ATOM   1987  O  O   . THR A  1  259 ? 56.359  294.204 218.083 1.00 25.80  ? 259  THR A O   1 
ATOM   1988  C  CB  . THR A  1  259 ? 59.056  295.684 216.565 1.00 22.13  ? 259  THR A CB  1 
ATOM   1989  O  OG1 . THR A  1  259 ? 60.055  295.438 215.556 1.00 26.85  ? 259  THR A OG1 1 
ATOM   1990  C  CG2 . THR A  1  259 ? 59.633  295.254 217.939 1.00 24.53  ? 259  THR A CG2 1 
ATOM   1991  N  N   . TYR A  1  260 ? 56.146  296.339 217.435 1.00 27.01  ? 260  TYR A N   1 
ATOM   1992  C  CA  . TYR A  1  260 ? 55.253  296.695 218.541 1.00 32.14  ? 260  TYR A CA  1 
ATOM   1993  C  C   . TYR A  1  260 ? 53.984  295.850 218.528 1.00 32.41  ? 260  TYR A C   1 
ATOM   1994  O  O   . TYR A  1  260 ? 53.616  295.213 219.536 1.00 28.31  ? 260  TYR A O   1 
ATOM   1995  C  CB  . TYR A  1  260 ? 54.928  298.209 218.473 1.00 29.54  ? 260  TYR A CB  1 
ATOM   1996  C  CG  . TYR A  1  260 ? 54.202  298.720 219.703 1.00 30.70  ? 260  TYR A CG  1 
ATOM   1997  C  CD1 . TYR A  1  260 ? 52.791  298.621 219.807 1.00 24.85  ? 260  TYR A CD1 1 
ATOM   1998  C  CD2 . TYR A  1  260 ? 54.917  299.311 220.736 1.00 27.48  ? 260  TYR A CD2 1 
ATOM   1999  C  CE1 . TYR A  1  260 ? 52.086  299.042 220.996 1.00 29.42  ? 260  TYR A CE1 1 
ATOM   2000  C  CE2 . TYR A  1  260 ? 54.289  299.784 221.861 1.00 29.48  ? 260  TYR A CE2 1 
ATOM   2001  C  CZ  . TYR A  1  260 ? 52.881  299.628 222.022 1.00 30.58  ? 260  TYR A CZ  1 
ATOM   2002  O  OH  . TYR A  1  260 ? 52.284  300.057 223.198 1.00 29.70  ? 260  TYR A OH  1 
ATOM   2003  N  N   . TYR A  1  261 ? 53.284  295.806 217.397 1.00 27.69  ? 261  TYR A N   1 
ATOM   2004  C  CA  . TYR A  1  261 ? 52.019  295.061 217.430 1.00 27.76  ? 261  TYR A CA  1 
ATOM   2005  C  C   . TYR A  1  261 ? 52.217  293.565 217.249 1.00 33.80  ? 261  TYR A C   1 
ATOM   2006  O  O   . TYR A  1  261 ? 51.246  292.816 217.285 1.00 30.95  ? 261  TYR A O   1 
ATOM   2007  C  CB  . TYR A  1  261 ? 51.016  295.606 216.361 1.00 26.37  ? 261  TYR A CB  1 
ATOM   2008  C  CG  . TYR A  1  261 ? 50.648  297.039 216.691 1.00 27.50  ? 261  TYR A CG  1 
ATOM   2009  C  CD1 . TYR A  1  261 ? 49.708  297.312 217.717 1.00 31.02  ? 261  TYR A CD1 1 
ATOM   2010  C  CD2 . TYR A  1  261 ? 51.320  298.099 216.097 1.00 29.62  ? 261  TYR A CD2 1 
ATOM   2011  C  CE1 . TYR A  1  261 ? 49.403  298.610 218.098 1.00 27.97  ? 261  TYR A CE1 1 
ATOM   2012  C  CE2 . TYR A  1  261 ? 51.055  299.420 216.467 1.00 26.01  ? 261  TYR A CE2 1 
ATOM   2013  C  CZ  . TYR A  1  261 ? 50.046  299.670 217.475 1.00 28.53  ? 261  TYR A CZ  1 
ATOM   2014  O  OH  . TYR A  1  261 ? 49.769  300.984 217.842 1.00 26.23  ? 261  TYR A OH  1 
ATOM   2015  N  N   . SER A  1  262 ? 53.443  293.096 217.079 1.00 25.35  ? 262  SER A N   1 
ATOM   2016  C  CA  . SER A  1  262 ? 53.696  291.664 217.226 1.00 29.53  ? 262  SER A CA  1 
ATOM   2017  C  C   . SER A  1  262 ? 53.975  291.327 218.668 1.00 31.16  ? 262  SER A C   1 
ATOM   2018  O  O   . SER A  1  262 ? 54.260  290.167 218.986 1.00 29.20  ? 262  SER A O   1 
ATOM   2019  C  CB  . SER A  1  262 ? 54.890  291.192 216.367 1.00 30.53  ? 262  SER A CB  1 
ATOM   2020  O  OG  . SER A  1  262 ? 54.665  291.528 215.014 1.00 32.18  ? 262  SER A OG  1 
ATOM   2021  N  N   . GLY A  1  263 ? 53.970  292.329 219.519 1.00 27.00  ? 263  GLY A N   1 
ATOM   2022  C  CA  . GLY A  1  263 ? 54.328  292.100 220.939 1.00 32.46  ? 263  GLY A CA  1 
ATOM   2023  C  C   . GLY A  1  263 ? 55.764  291.688 221.161 1.00 45.68  ? 263  GLY A C   1 
ATOM   2024  O  O   . GLY A  1  263 ? 56.057  290.967 222.129 1.00 35.06  ? 263  GLY A O   1 
ATOM   2025  N  N   . LYS A  1  264 ? 56.684  292.126 220.298 1.00 32.97  ? 264  LYS A N   1 
ATOM   2026  C  CA  . LYS A  1  264 ? 58.076  291.723 220.379 1.00 29.28  ? 264  LYS A CA  1 
ATOM   2027  C  C   . LYS A  1  264 ? 58.851  292.828 221.063 1.00 29.87  ? 264  LYS A C   1 
ATOM   2028  O  O   . LYS A  1  264 ? 58.508  294.021 220.986 1.00 28.26  ? 264  LYS A O   1 
ATOM   2029  C  CB  . LYS A  1  264 ? 58.700  291.474 218.989 1.00 32.58  ? 264  LYS A CB  1 
ATOM   2030  C  CG  . LYS A  1  264 ? 58.042  290.362 218.201 1.00 35.18  ? 264  LYS A CG  1 
ATOM   2031  C  CD  . LYS A  1  264 ? 58.175  289.010 218.866 1.00 37.86  ? 264  LYS A CD  1 
ATOM   2032  C  CE  . LYS A  1  264 ? 57.647  287.893 217.907 1.00 36.71  ? 264  LYS A CE  1 
ATOM   2033  N  NZ  . LYS A  1  264 ? 58.585  287.537 216.809 1.00 32.41  ? 264  LYS A NZ  1 
ATOM   2034  N  N   . LYS A  1  265 ? 59.920  292.456 221.691 1.00 27.83  ? 265  LYS A N   1 
ATOM   2035  C  CA  . LYS A  1  265 ? 60.809  293.495 222.229 1.00 29.45  ? 265  LYS A CA  1 
ATOM   2036  C  C   . LYS A  1  265 ? 61.794  294.023 221.194 1.00 30.05  ? 265  LYS A C   1 
ATOM   2037  O  O   . LYS A  1  265 ? 62.425  295.069 221.432 1.00 29.06  ? 265  LYS A O   1 
ATOM   2038  C  CB  . LYS A  1  265 ? 61.562  292.960 223.441 1.00 32.48  ? 265  LYS A CB  1 
ATOM   2039  C  CG  . LYS A  1  265 ? 62.569  291.892 223.097 1.00 31.94  ? 265  LYS A CG  1 
ATOM   2040  C  CD  . LYS A  1  265 ? 63.084  291.287 224.525 1.00 45.82  ? 265  LYS A CD  1 
ATOM   2041  C  CE  . LYS A  1  265 ? 64.124  290.187 224.376 1.00 56.98  ? 265  LYS A CE  1 
ATOM   2042  N  NZ  . LYS A  1  265 ? 63.766  289.148 223.388 1.00 71.19  ? 265  LYS A NZ  1 
ATOM   2043  N  N   . GLU A  1  266 ? 61.901  293.378 220.038 1.00 25.47  ? 266  GLU A N   1 
ATOM   2044  C  CA  . GLU A  1  266 ? 62.896  293.842 219.073 1.00 27.10  ? 266  GLU A CA  1 
ATOM   2045  C  C   . GLU A  1  266 ? 62.544  293.304 217.710 1.00 30.84  ? 266  GLU A C   1 
ATOM   2046  O  O   . GLU A  1  266 ? 61.921  292.237 217.595 1.00 28.36  ? 266  GLU A O   1 
ATOM   2047  C  CB  . GLU A  1  266 ? 64.316  293.352 219.470 1.00 28.68  ? 266  GLU A CB  1 
ATOM   2048  C  CG  . GLU A  1  266 ? 64.314  291.811 219.517 1.00 35.82  ? 266  GLU A CG  1 
ATOM   2049  C  CD  . GLU A  1  266 ? 65.413  291.230 220.376 1.00 60.56  ? 266  GLU A CD  1 
ATOM   2050  O  OE1 . GLU A  1  266 ? 65.991  291.968 221.217 1.00 38.06  ? 266  GLU A OE1 1 
ATOM   2051  O  OE2 . GLU A  1  266 ? 65.713  290.029 220.205 1.00 44.39  ? 266  GLU A OE2 1 
ATOM   2052  N  N   . PRO A  1  267 ? 62.937  294.013 216.650 1.00 27.69  ? 267  PRO A N   1 
ATOM   2053  C  CA  . PRO A  1  267 ? 62.794  293.492 215.297 1.00 25.65  ? 267  PRO A CA  1 
ATOM   2054  C  C   . PRO A  1  267 ? 63.718  292.316 215.066 1.00 31.15  ? 267  PRO A C   1 
ATOM   2055  O  O   . PRO A  1  267 ? 64.824  292.255 215.616 1.00 28.50  ? 267  PRO A O   1 
ATOM   2056  C  CB  . PRO A  1  267 ? 63.216  294.697 214.404 1.00 26.53  ? 267  PRO A CB  1 
ATOM   2057  C  CG  . PRO A  1  267 ? 64.303  295.319 215.266 1.00 29.06  ? 267  PRO A CG  1 
ATOM   2058  C  CD  . PRO A  1  267 ? 63.636  295.307 216.694 1.00 27.60  ? 267  PRO A CD  1 
ATOM   2059  N  N   . PHE A  1  268 ? 63.254  291.375 214.240 1.00 28.22  ? 268  PHE A N   1 
ATOM   2060  C  CA  . PHE A  1  268 ? 64.114  290.285 213.798 1.00 31.93  ? 268  PHE A CA  1 
ATOM   2061  C  C   . PHE A  1  268 ? 65.340  290.825 213.053 1.00 31.64  ? 268  PHE A C   1 
ATOM   2062  O  O   . PHE A  1  268 ? 65.210  291.676 212.155 1.00 29.12  ? 268  PHE A O   1 
ATOM   2063  C  CB  . PHE A  1  268 ? 63.338  289.348 212.853 1.00 29.07  ? 268  PHE A CB  1 
ATOM   2064  C  CG  . PHE A  1  268 ? 64.139  288.161 212.392 1.00 29.28  ? 268  PHE A CG  1 
ATOM   2065  C  CD1 . PHE A  1  268 ? 64.930  288.228 211.251 1.00 29.36  ? 268  PHE A CD1 1 
ATOM   2066  C  CD2 . PHE A  1  268 ? 64.118  286.961 213.148 1.00 33.92  ? 268  PHE A CD2 1 
ATOM   2067  C  CE1 . PHE A  1  268 ? 65.663  287.135 210.831 1.00 39.48  ? 268  PHE A CE1 1 
ATOM   2068  C  CE2 . PHE A  1  268 ? 64.817  285.852 212.724 1.00 43.36  ? 268  PHE A CE2 1 
ATOM   2069  C  CZ  . PHE A  1  268 ? 65.607  285.938 211.568 1.00 41.90  ? 268  PHE A CZ  1 
ATOM   2070  N  N   . GLY A  1  269 ? 66.539  290.300 213.396 1.00 27.82  ? 269  GLY A N   1 
ATOM   2071  C  CA  . GLY A  1  269 ? 67.699  290.607 212.564 1.00 30.30  ? 269  GLY A CA  1 
ATOM   2072  C  C   . GLY A  1  269 ? 68.110  292.069 212.483 1.00 30.64  ? 269  GLY A C   1 
ATOM   2073  O  O   . GLY A  1  269 ? 68.342  292.609 211.401 1.00 28.07  ? 269  GLY A O   1 
ATOM   2074  N  N   . TYR A  1  270 ? 68.363  292.671 213.633 1.00 25.58  ? 270  TYR A N   1 
ATOM   2075  C  CA  . TYR A  1  270 ? 68.584  294.110 213.706 1.00 27.57  ? 270  TYR A CA  1 
ATOM   2076  C  C   . TYR A  1  270 ? 69.790  294.548 212.854 1.00 34.52  ? 270  TYR A C   1 
ATOM   2077  O  O   . TYR A  1  270 ? 69.726  295.559 212.171 1.00 26.23  ? 270  TYR A O   1 
ATOM   2078  C  CB  . TYR A  1  270 ? 68.790  294.489 215.191 1.00 23.29  ? 270  TYR A CB  1 
ATOM   2079  C  CG  . TYR A  1  270 ? 69.347  295.899 215.432 1.00 28.35  ? 270  TYR A CG  1 
ATOM   2080  C  CD1 . TYR A  1  270 ? 70.733  296.145 215.393 1.00 28.88  ? 270  TYR A CD1 1 
ATOM   2081  C  CD2 . TYR A  1  270 ? 68.498  296.959 215.680 1.00 24.67  ? 270  TYR A CD2 1 
ATOM   2082  C  CE1 . TYR A  1  270 ? 71.260  297.403 215.607 1.00 25.86  ? 270  TYR A CE1 1 
ATOM   2083  C  CE2 . TYR A  1  270 ? 69.016  298.251 215.942 1.00 26.75  ? 270  TYR A CE2 1 
ATOM   2084  C  CZ  . TYR A  1  270 ? 70.387  298.433 215.899 1.00 26.55  ? 270  TYR A CZ  1 
ATOM   2085  O  OH  . TYR A  1  270 ? 70.861  299.686 216.155 1.00 26.02  ? 270  TYR A OH  1 
ATOM   2086  N  N   . MET A  1  271 ? 70.917  293.855 212.958 1.00 24.48  ? 271  MET A N   1 
ATOM   2087  C  CA  . MET A  1  271 ? 72.098  294.323 212.226 1.00 22.15  ? 271  MET A CA  1 
ATOM   2088  C  C   . MET A  1  271 ? 71.884  294.126 210.722 1.00 23.65  ? 271  MET A C   1 
ATOM   2089  O  O   . MET A  1  271 ? 72.385  294.911 209.915 1.00 25.61  ? 271  MET A O   1 
ATOM   2090  C  CB  . MET A  1  271 ? 73.373  293.579 212.691 1.00 24.47  ? 271  MET A CB  1 
ATOM   2091  C  CG  . MET A  1  271 ? 73.809  293.957 214.139 1.00 25.19  ? 271  MET A CG  1 
ATOM   2092  S  SD  . MET A  1  271 ? 74.269  295.700 214.242 1.00 32.90  ? 271  MET A SD  1 
ATOM   2093  C  CE  . MET A  1  271 ? 76.005  295.562 213.695 1.00 38.27  ? 271  MET A CE  1 
ATOM   2094  N  N   . GLY A  1  272 ? 71.184  293.054 210.336 1.00 23.45  ? 272  GLY A N   1 
ATOM   2095  C  CA  . GLY A  1  272 ? 70.737  292.885 208.942 1.00 22.13  ? 272  GLY A CA  1 
ATOM   2096  C  C   . GLY A  1  272 ? 69.883  294.046 208.424 1.00 30.99  ? 272  GLY A C   1 
ATOM   2097  O  O   . GLY A  1  272 ? 69.976  294.431 207.248 1.00 24.80  ? 272  GLY A O   1 
ATOM   2098  N  N   . MET A  1  273 ? 69.016  294.608 209.272 1.00 28.57  ? 273  MET A N   1 
ATOM   2099  C  CA  . MET A  1  273 ? 68.184  295.745 208.862 1.00 23.47  ? 273  MET A CA  1 
ATOM   2100  C  C   . MET A  1  273 ? 69.019  296.993 208.678 1.00 26.13  ? 273  MET A C   1 
ATOM   2101  O  O   . MET A  1  273 ? 68.776  297.803 207.766 1.00 22.86  ? 273  MET A O   1 
ATOM   2102  C  CB  . MET A  1  273 ? 67.069  296.012 209.929 1.00 23.68  ? 273  MET A CB  1 
ATOM   2103  C  CG  . MET A  1  273 ? 66.057  294.812 210.135 1.00 23.35  ? 273  MET A CG  1 
ATOM   2104  S  SD  . MET A  1  273 ? 65.133  294.555 208.587 1.00 28.34  ? 273  MET A SD  1 
ATOM   2105  C  CE  . MET A  1  273 ? 63.465  294.960 209.171 1.00 33.12  ? 273  MET A CE  1 
ATOM   2106  N  N   . VAL A  1  274 ? 69.995  297.189 209.556 1.00 23.19  ? 274  VAL A N   1 
ATOM   2107  C  CA  . VAL A  1  274 ? 70.922  298.288 209.421 1.00 22.87  ? 274  VAL A CA  1 
ATOM   2108  C  C   . VAL A  1  274 ? 71.720  298.112 208.169 1.00 24.00  ? 274  VAL A C   1 
ATOM   2109  O  O   . VAL A  1  274 ? 71.854  299.037 207.352 1.00 23.42  ? 274  VAL A O   1 
ATOM   2110  C  CB  . VAL A  1  274 ? 71.841  298.369 210.678 1.00 23.27  ? 274  VAL A CB  1 
ATOM   2111  C  CG1 . VAL A  1  274 ? 73.007  299.350 210.453 1.00 21.53  ? 274  VAL A CG1 1 
ATOM   2112  C  CG2 . VAL A  1  274 ? 71.017  298.708 211.989 1.00 25.83  ? 274  VAL A CG2 1 
ATOM   2113  N  N   . TRP A  1  275 ? 72.244  296.913 207.977 1.00 23.35  ? 275  TRP A N   1 
ATOM   2114  C  CA  . TRP A  1  275 ? 73.010  296.664 206.767 1.00 25.37  ? 275  TRP A CA  1 
ATOM   2115  C  C   . TRP A  1  275 ? 72.153  296.956 205.535 1.00 29.27  ? 275  TRP A C   1 
ATOM   2116  O  O   . TRP A  1  275 ? 72.643  297.527 204.555 1.00 23.57  ? 275  TRP A O   1 
ATOM   2117  C  CB  . TRP A  1  275 ? 73.495  295.216 206.777 1.00 21.37  ? 275  TRP A CB  1 
ATOM   2118  C  CG  . TRP A  1  275 ? 74.043  294.770 205.438 1.00 25.46  ? 275  TRP A CG  1 
ATOM   2119  C  CD1 . TRP A  1  275 ? 75.323  295.017 204.950 1.00 23.27  ? 275  TRP A CD1 1 
ATOM   2120  C  CD2 . TRP A  1  275 ? 73.317  294.084 204.375 1.00 26.39  ? 275  TRP A CD2 1 
ATOM   2121  N  NE1 . TRP A  1  275 ? 75.424  294.478 203.630 1.00 25.21  ? 275  TRP A NE1 1 
ATOM   2122  C  CE2 . TRP A  1  275 ? 74.207  293.912 203.291 1.00 25.31  ? 275  TRP A CE2 1 
ATOM   2123  C  CE3 . TRP A  1  275 ? 71.999  293.534 204.274 1.00 25.88  ? 275  TRP A CE3 1 
ATOM   2124  C  CZ2 . TRP A  1  275 ? 73.843  293.232 202.093 1.00 28.84  ? 275  TRP A CZ2 1 
ATOM   2125  C  CZ3 . TRP A  1  275 ? 71.599  292.912 203.111 1.00 25.63  ? 275  TRP A CZ3 1 
ATOM   2126  C  CH2 . TRP A  1  275 ? 72.532  292.768 201.994 1.00 31.23  ? 275  TRP A CH2 1 
ATOM   2127  N  N   . ALA A  1  276 ? 70.895  296.569 205.564 1.00 25.58  ? 276  ALA A N   1 
ATOM   2128  C  CA  . ALA A  1  276 ? 70.051  296.679 204.356 1.00 21.94  ? 276  ALA A CA  1 
ATOM   2129  C  C   . ALA A  1  276 ? 69.785  298.141 203.998 1.00 26.59  ? 276  ALA A C   1 
ATOM   2130  O  O   . ALA A  1  276 ? 69.899  298.549 202.829 1.00 22.71  ? 276  ALA A O   1 
ATOM   2131  C  CB  . ALA A  1  276 ? 68.737  295.900 204.548 1.00 25.85  ? 276  ALA A CB  1 
ATOM   2132  N  N   . MET A  1  277 ? 69.479  298.961 205.005 1.00 24.47  ? 277  MET A N   1 
ATOM   2133  C  CA  . MET A  1  277 ? 69.262  300.381 204.741 1.00 28.23  ? 277  MET A CA  1 
ATOM   2134  C  C   . MET A  1  277 ? 70.532  301.076 204.252 1.00 28.55  ? 277  MET A C   1 
ATOM   2135  O  O   . MET A  1  277 ? 70.474  301.914 203.335 1.00 27.31  ? 277  MET A O   1 
ATOM   2136  C  CB  . MET A  1  277 ? 68.705  301.081 205.999 1.00 25.72  ? 277  MET A CB  1 
ATOM   2137  C  CG  . MET A  1  277 ? 67.244  300.557 206.353 1.00 25.41  ? 277  MET A CG  1 
ATOM   2138  S  SD  . MET A  1  277 ? 66.469  301.604 207.596 1.00 26.25  ? 277  MET A SD  1 
ATOM   2139  C  CE  . MET A  1  277 ? 67.230  300.886 209.059 1.00 21.99  ? 277  MET A CE  1 
ATOM   2140  N  N   . MET A  1  278 ? 71.697  300.771 204.879 1.00 22.80  ? 278  MET A N   1 
ATOM   2141  C  CA  . MET A  1  278 ? 72.940  301.353 204.399 1.00 24.42  ? 278  MET A CA  1 
ATOM   2142  C  C   . MET A  1  278 ? 73.252  300.926 202.935 1.00 23.42  ? 278  MET A C   1 
ATOM   2143  O  O   . MET A  1  278 ? 73.678  301.745 202.152 1.00 23.69  ? 278  MET A O   1 
ATOM   2144  C  CB  . MET A  1  278 ? 74.074  300.959 205.349 1.00 24.66  ? 278  MET A CB  1 
ATOM   2145  C  CG  . MET A  1  278 ? 73.859  301.810 206.628 1.00 33.95  ? 278  MET A CG  1 
ATOM   2146  S  SD  . MET A  1  278 ? 75.347  302.248 207.274 1.00 61.54  ? 278  MET A SD  1 
ATOM   2147  C  CE  . MET A  1  278 ? 75.607  300.562 207.750 1.00 30.37  ? 278  MET A CE  1 
ATOM   2148  N  N   . SER A  1  279 ? 73.088  299.634 202.599 1.00 21.92  ? 279  SER A N   1 
ATOM   2149  C  CA  . SER A  1  279 ? 73.304  299.107 201.255 1.00 23.78  ? 279  SER A CA  1 
ATOM   2150  C  C   . SER A  1  279 ? 72.374  299.776 200.247 1.00 29.10  ? 279  SER A C   1 
ATOM   2151  O  O   . SER A  1  279 ? 72.789  300.149 199.137 1.00 27.90  ? 279  SER A O   1 
ATOM   2152  C  CB  . SER A  1  279 ? 73.052  297.570 201.253 1.00 22.69  ? 279  SER A CB  1 
ATOM   2153  O  OG  . SER A  1  279 ? 74.052  296.984 202.041 1.00 30.77  ? 279  SER A OG  1 
ATOM   2154  N  N   . ILE A  1  280 ? 71.094  299.893 200.600 1.00 25.35  ? 280  ILE A N   1 
ATOM   2155  C  CA  . ILE A  1  280 ? 70.133  300.575 199.751 1.00 27.79  ? 280  ILE A CA  1 
ATOM   2156  C  C   . ILE A  1  280 ? 70.580  302.009 199.507 1.00 31.35  ? 280  ILE A C   1 
ATOM   2157  O  O   . ILE A  1  280 ? 70.565  302.517 198.376 1.00 29.70  ? 280  ILE A O   1 
ATOM   2158  C  CB  . ILE A  1  280 ? 68.741  300.498 200.403 1.00 25.88  ? 280  ILE A CB  1 
ATOM   2159  C  CG1 . ILE A  1  280 ? 68.194  299.086 200.209 1.00 20.81  ? 280  ILE A CG1 1 
ATOM   2160  C  CG2 . ILE A  1  280 ? 67.739  301.552 199.759 1.00 24.02  ? 280  ILE A CG2 1 
ATOM   2161  C  CD1 . ILE A  1  280 ? 66.975  298.747 201.176 1.00 22.58  ? 280  ILE A CD1 1 
ATOM   2162  N  N   . GLY A  1  281 ? 70.972  302.680 200.578 1.00 25.97  ? 281  GLY A N   1 
ATOM   2163  C  CA  . GLY A  1  281 ? 71.378  304.059 200.472 1.00 30.94  ? 281  GLY A CA  1 
ATOM   2164  C  C   . GLY A  1  281 ? 72.566  304.197 199.536 1.00 34.84  ? 281  GLY A C   1 
ATOM   2165  O  O   . GLY A  1  281 ? 72.592  305.084 198.688 1.00 29.06  ? 281  GLY A O   1 
ATOM   2166  N  N   . PHE A  1  282 ? 73.544  303.298 199.666 1.00 25.69  ? 282  PHE A N   1 
ATOM   2167  C  CA  . PHE A  1  282 ? 74.734  303.341 198.835 1.00 26.28  ? 282  PHE A CA  1 
ATOM   2168  C  C   . PHE A  1  282 ? 74.411  303.014 197.376 1.00 31.92  ? 282  PHE A C   1 
ATOM   2169  O  O   . PHE A  1  282 ? 74.798  303.741 196.452 1.00 25.11  ? 282  PHE A O   1 
ATOM   2170  C  CB  . PHE A  1  282 ? 75.737  302.343 199.403 1.00 27.26  ? 282  PHE A CB  1 
ATOM   2171  C  CG  . PHE A  1  282 ? 76.937  302.185 198.579 1.00 38.31  ? 282  PHE A CG  1 
ATOM   2172  C  CD1 . PHE A  1  282 ? 78.008  303.055 198.752 1.00 64.89  ? 282  PHE A CD1 1 
ATOM   2173  C  CD2 . PHE A  1  282 ? 77.003  301.207 197.586 1.00 48.96  ? 282  PHE A CD2 1 
ATOM   2174  C  CE1 . PHE A  1  282 ? 79.144  302.939 197.954 1.00 56.40  ? 282  PHE A CE1 1 
ATOM   2175  C  CE2 . PHE A  1  282 ? 78.125  301.087 196.780 1.00 52.13  ? 282  PHE A CE2 1 
ATOM   2176  C  CZ  . PHE A  1  282 ? 79.196  301.950 196.966 1.00 54.36  ? 282  PHE A CZ  1 
ATOM   2177  N  N   . LEU A  1  283 ? 73.724  301.901 197.141 1.00 23.15  ? 283  LEU A N   1 
ATOM   2178  C  CA  . LEU A  1  283 ? 73.361  301.553 195.765 1.00 23.39  ? 283  LEU A CA  1 
ATOM   2179  C  C   . LEU A  1  283 ? 72.459  302.608 195.130 1.00 27.66  ? 283  LEU A C   1 
ATOM   2180  O  O   . LEU A  1  283 ? 72.487  302.792 193.880 1.00 26.13  ? 283  LEU A O   1 
ATOM   2181  C  CB  . LEU A  1  283 ? 72.637  300.208 195.762 1.00 27.38  ? 283  LEU A CB  1 
ATOM   2182  C  CG  . LEU A  1  283 ? 73.553  299.067 196.204 1.00 29.54  ? 283  LEU A CG  1 
ATOM   2183  C  CD1 . LEU A  1  283 ? 72.628  297.882 196.514 1.00 27.31  ? 283  LEU A CD1 1 
ATOM   2184  C  CD2 . LEU A  1  283 ? 74.548  298.620 195.099 1.00 27.09  ? 283  LEU A CD2 1 
ATOM   2185  N  N   . GLY A  1  284 ? 71.705  303.341 195.953 1.00 25.81  ? 284  GLY A N   1 
ATOM   2186  C  CA  . GLY A  1  284 ? 70.810  304.360 195.427 1.00 25.49  ? 284  GLY A CA  1 
ATOM   2187  C  C   . GLY A  1  284 ? 71.537  305.523 194.739 1.00 27.60  ? 284  GLY A C   1 
ATOM   2188  O  O   . GLY A  1  284 ? 70.893  306.330 194.063 1.00 27.59  ? 284  GLY A O   1 
ATOM   2189  N  N   . PHE A  1  285 ? 72.833  305.637 194.889 1.00 22.67  ? 285  PHE A N   1 
ATOM   2190  C  CA  . PHE A  1  285 ? 73.619  306.651 194.151 1.00 25.00  ? 285  PHE A CA  1 
ATOM   2191  C  C   . PHE A  1  285 ? 74.235  306.169 192.829 1.00 26.90  ? 285  PHE A C   1 
ATOM   2192  O  O   . PHE A  1  285 ? 74.881  306.971 192.143 1.00 23.16  ? 285  PHE A O   1 
ATOM   2193  C  CB  . PHE A  1  285 ? 74.755  307.177 195.027 1.00 23.51  ? 285  PHE A CB  1 
ATOM   2194  C  CG  . PHE A  1  285 ? 74.318  308.243 195.984 1.00 21.74  ? 285  PHE A CG  1 
ATOM   2195  C  CD1 . PHE A  1  285 ? 74.114  309.565 195.525 1.00 22.15  ? 285  PHE A CD1 1 
ATOM   2196  C  CD2 . PHE A  1  285 ? 73.974  307.923 197.231 1.00 24.05  ? 285  PHE A CD2 1 
ATOM   2197  C  CE1 . PHE A  1  285 ? 73.648  310.551 196.448 1.00 23.95  ? 285  PHE A CE1 1 
ATOM   2198  C  CE2 . PHE A  1  285 ? 73.558  308.914 198.139 1.00 31.54  ? 285  PHE A CE2 1 
ATOM   2199  C  CZ  . PHE A  1  285 ? 73.355  310.196 197.714 1.00 28.99  ? 285  PHE A CZ  1 
ATOM   2200  N  N   . ILE A  1  286 ? 74.154  304.900 192.493 1.00 21.01  ? 286  ILE A N   1 
ATOM   2201  C  CA  . ILE A  1  286 ? 74.837  304.423 191.277 1.00 24.05  ? 286  ILE A CA  1 
ATOM   2202  C  C   . ILE A  1  286 ? 73.914  303.764 190.263 1.00 30.21  ? 286  ILE A C   1 
ATOM   2203  O  O   . ILE A  1  286 ? 74.370  302.961 189.435 1.00 25.32  ? 286  ILE A O   1 
ATOM   2204  C  CB  . ILE A  1  286 ? 75.986  303.452 191.609 1.00 24.72  ? 286  ILE A CB  1 
ATOM   2205  C  CG1 . ILE A  1  286 ? 75.437  302.168 192.216 1.00 30.30  ? 286  ILE A CG1 1 
ATOM   2206  C  CG2 . ILE A  1  286 ? 77.029  304.201 192.597 1.00 24.15  ? 286  ILE A CG2 1 
ATOM   2207  C  CD1 . ILE A  1  286 ? 76.556  301.138 192.581 1.00 30.55  ? 286  ILE A CD1 1 
ATOM   2208  N  N   . VAL A  1  287 ? 72.642  304.163 190.255 1.00 27.42  ? 287  VAL A N   1 
ATOM   2209  C  CA  . VAL A  1  287 ? 71.644  303.532 189.391 1.00 22.25  ? 287  VAL A CA  1 
ATOM   2210  C  C   . VAL A  1  287 ? 70.828  304.534 188.603 1.00 22.92  ? 287  VAL A C   1 
ATOM   2211  O  O   . VAL A  1  287 ? 69.951  304.124 187.852 1.00 21.87  ? 287  VAL A O   1 
ATOM   2212  C  CB  . VAL A  1  287 ? 70.698  302.637 190.228 1.00 23.16  ? 287  VAL A CB  1 
ATOM   2213  C  CG1 . VAL A  1  287 ? 71.479  301.551 190.904 1.00 23.09  ? 287  VAL A CG1 1 
ATOM   2214  C  CG2 . VAL A  1  287 ? 69.975  303.517 191.298 1.00 21.48  ? 287  VAL A CG2 1 
ATOM   2215  N  N   . TRP A  1  288 ? 71.109  305.826 188.718 1.00 21.91  ? 288  TRP A N   1 
ATOM   2216  C  CA  . TRP A  1  288 ? 70.175  306.877 188.268 1.00 25.22  ? 288  TRP A CA  1 
ATOM   2217  C  C   . TRP A  1  288 ? 69.846  306.790 186.773 1.00 31.06  ? 288  TRP A C   1 
ATOM   2218  O  O   . TRP A  1  288 ? 68.759  307.200 186.345 1.00 22.50  ? 288  TRP A O   1 
ATOM   2219  C  CB  . TRP A  1  288 ? 70.759  308.276 188.530 1.00 20.12  ? 288  TRP A CB  1 
ATOM   2220  C  CG  . TRP A  1  288 ? 71.831  308.723 187.618 1.00 22.82  ? 288  TRP A CG  1 
ATOM   2221  C  CD1 . TRP A  1  288 ? 71.662  309.433 186.433 1.00 21.19  ? 288  TRP A CD1 1 
ATOM   2222  C  CD2 . TRP A  1  288 ? 73.222  308.435 187.710 1.00 23.27  ? 288  TRP A CD2 1 
ATOM   2223  N  NE1 . TRP A  1  288 ? 72.900  309.598 185.786 1.00 24.47  ? 288  TRP A NE1 1 
ATOM   2224  C  CE2 . TRP A  1  288 ? 73.862  308.996 186.546 1.00 25.47  ? 288  TRP A CE2 1 
ATOM   2225  C  CE3 . TRP A  1  288 ? 74.009  307.743 188.675 1.00 24.27  ? 288  TRP A CE3 1 
ATOM   2226  C  CZ2 . TRP A  1  288 ? 75.250  308.930 186.319 1.00 30.72  ? 288  TRP A CZ2 1 
ATOM   2227  C  CZ3 . TRP A  1  288 ? 75.425  307.666 188.457 1.00 27.33  ? 288  TRP A CZ3 1 
ATOM   2228  C  CH2 . TRP A  1  288 ? 76.024  308.248 187.289 1.00 30.62  ? 288  TRP A CH2 1 
ATOM   2229  N  N   . ALA A  1  289 ? 70.747  306.265 185.958 1.00 25.03  ? 289  ALA A N   1 
ATOM   2230  C  CA  . ALA A  1  289 ? 70.418  306.358 184.538 1.00 20.41  ? 289  ALA A CA  1 
ATOM   2231  C  C   . ALA A  1  289 ? 69.386  305.346 184.077 1.00 29.18  ? 289  ALA A C   1 
ATOM   2232  O  O   . ALA A  1  289 ? 69.061  305.387 182.888 1.00 26.65  ? 289  ALA A O   1 
ATOM   2233  C  CB  . ALA A  1  289 ? 71.706  306.233 183.678 1.00 27.36  ? 289  ALA A CB  1 
ATOM   2234  N  N   . HIS A  1  290 ? 68.843  304.479 184.959 1.00 23.93  ? 290  HIS A N   1 
ATOM   2235  C  CA  . HIS A  1  290 ? 67.664  303.707 184.554 1.00 22.69  ? 290  HIS A CA  1 
ATOM   2236  C  C   . HIS A  1  290 ? 66.461  304.616 184.306 1.00 22.41  ? 290  HIS A C   1 
ATOM   2237  O  O   . HIS A  1  290 ? 65.425  304.150 183.834 1.00 24.63  ? 290  HIS A O   1 
ATOM   2238  C  CB  . HIS A  1  290 ? 67.313  302.600 185.566 1.00 24.20  ? 290  HIS A CB  1 
ATOM   2239  C  CG  . HIS A  1  290 ? 66.922  303.113 186.946 1.00 31.63  ? 290  HIS A CG  1 
ATOM   2240  N  ND1 . HIS A  1  290 ? 67.375  302.507 188.091 1.00 24.31  ? 290  HIS A ND1 1 
ATOM   2241  C  CD2 . HIS A  1  290 ? 66.100  304.105 187.359 1.00 22.10  ? 290  HIS A CD2 1 
ATOM   2242  C  CE1 . HIS A  1  290 ? 66.864  303.092 189.164 1.00 27.05  ? 290  HIS A CE1 1 
ATOM   2243  N  NE2 . HIS A  1  290 ? 66.086  304.085 188.779 1.00 24.46  ? 290  HIS A NE2 1 
ATOM   2244  N  N   . HIS A  1  291 ? 66.582  305.900 184.613 1.00 22.32  ? 291  HIS A N   1 
ATOM   2245  C  CA  . HIS A  1  291 ? 65.576  306.888 184.214 1.00 19.55  ? 291  HIS A CA  1 
ATOM   2246  C  C   . HIS A  1  291 ? 65.825  307.413 182.804 1.00 28.95  ? 291  HIS A C   1 
ATOM   2247  O  O   . HIS A  1  291 ? 65.146  308.350 182.380 1.00 25.59  ? 291  HIS A O   1 
ATOM   2248  C  CB  . HIS A  1  291 ? 65.609  308.068 185.218 1.00 20.86  ? 291  HIS A CB  1 
ATOM   2249  C  CG  . HIS A  1  291 ? 65.145  307.644 186.599 1.00 21.44  ? 291  HIS A CG  1 
ATOM   2250  N  ND1 . HIS A  1  291 ? 63.805  307.501 186.912 1.00 20.86  ? 291  HIS A ND1 1 
ATOM   2251  C  CD2 . HIS A  1  291 ? 65.850  307.242 187.693 1.00 26.18  ? 291  HIS A CD2 1 
ATOM   2252  C  CE1 . HIS A  1  291 ? 63.699  307.044 188.158 1.00 24.50  ? 291  HIS A CE1 1 
ATOM   2253  N  NE2 . HIS A  1  291 ? 64.927  306.863 188.655 1.00 26.69  ? 291  HIS A NE2 1 
ATOM   2254  N  N   . MET A  1  292 ? 66.828  306.893 182.127 1.00 22.10  ? 292  MET A N   1 
ATOM   2255  C  CA  . MET A  1  292 ? 67.254  307.464 180.848 1.00 22.65  ? 292  MET A CA  1 
ATOM   2256  C  C   . MET A  1  292 ? 67.513  306.364 179.810 1.00 21.97  ? 292  MET A C   1 
ATOM   2257  O  O   . MET A  1  292 ? 68.293  306.559 178.885 1.00 24.14  ? 292  MET A O   1 
ATOM   2258  C  CB  . MET A  1  292 ? 68.515  308.345 181.086 1.00 21.93  ? 292  MET A CB  1 
ATOM   2259  C  CG  . MET A  1  292 ? 68.257  309.515 182.042 1.00 22.78  ? 292  MET A CG  1 
ATOM   2260  S  SD  . MET A  1  292 ? 69.791  310.306 182.608 1.00 25.91  ? 292  MET A SD  1 
ATOM   2261  C  CE  . MET A  1  292 ? 70.413  310.963 180.956 1.00 24.56  ? 292  MET A CE  1 
ATOM   2262  N  N   . PHE A  1  293 ? 66.847  305.217 179.919 1.00 24.02  ? 293  PHE A N   1 
ATOM   2263  C  CA  . PHE A  1  293 ? 67.150  304.138 178.985 1.00 22.30  ? 293  PHE A CA  1 
ATOM   2264  C  C   . PHE A  1  293 ? 66.725  304.407 177.540 1.00 26.63  ? 293  PHE A C   1 
ATOM   2265  O  O   . PHE A  1  293 ? 67.200  303.683 176.677 1.00 26.08  ? 293  PHE A O   1 
ATOM   2266  C  CB  . PHE A  1  293 ? 66.434  302.841 179.407 1.00 21.55  ? 293  PHE A CB  1 
ATOM   2267  C  CG  . PHE A  1  293 ? 67.088  302.134 180.658 1.00 27.71  ? 293  PHE A CG  1 
ATOM   2268  C  CD1 . PHE A  1  293 ? 68.465  302.121 180.828 1.00 30.68  ? 293  PHE A CD1 1 
ATOM   2269  C  CD2 . PHE A  1  293 ? 66.282  301.421 181.557 1.00 23.60  ? 293  PHE A CD2 1 
ATOM   2270  C  CE1 . PHE A  1  293 ? 69.075  301.398 181.919 1.00 29.90  ? 293  PHE A CE1 1 
ATOM   2271  C  CE2 . PHE A  1  293 ? 66.828  300.689 182.622 1.00 22.03  ? 293  PHE A CE2 1 
ATOM   2272  C  CZ  . PHE A  1  293 ? 68.251  300.662 182.808 1.00 26.34  ? 293  PHE A CZ  1 
ATOM   2273  N  N   . THR A  1  294 ? 65.888  305.412 177.264 1.00 23.58  ? 294  THR A N   1 
ATOM   2274  C  CA  . THR A  1  294 ? 65.480  305.686 175.861 1.00 25.75  ? 294  THR A CA  1 
ATOM   2275  C  C   . THR A  1  294 ? 66.144  306.929 175.289 1.00 29.39  ? 294  THR A C   1 
ATOM   2276  O  O   . THR A  1  294 ? 65.783  307.347 174.186 1.00 27.12  ? 294  THR A O   1 
ATOM   2277  C  CB  . THR A  1  294 ? 63.938  305.834 175.727 1.00 26.91  ? 294  THR A CB  1 
ATOM   2278  O  OG1 . THR A  1  294 ? 63.515  306.954 176.505 1.00 25.27  ? 294  THR A OG1 1 
ATOM   2279  C  CG2 . THR A  1  294 ? 63.195  304.620 176.255 1.00 23.96  ? 294  THR A CG2 1 
ATOM   2280  N  N   . VAL A  1  295 ? 67.125  307.515 175.986 1.00 25.21  ? 295  VAL A N   1 
ATOM   2281  C  CA  . VAL A  1  295 ? 67.642  308.785 175.536 1.00 26.01  ? 295  VAL A CA  1 
ATOM   2282  C  C   . VAL A  1  295 ? 68.734  308.556 174.488 1.00 29.08  ? 295  VAL A C   1 
ATOM   2283  O  O   . VAL A  1  295 ? 69.274  309.528 173.955 1.00 26.16  ? 295  VAL A O   1 
ATOM   2284  C  CB  . VAL A  1  295 ? 68.195  309.695 176.633 1.00 29.48  ? 295  VAL A CB  1 
ATOM   2285  C  CG1 . VAL A  1  295 ? 67.101  309.903 177.745 1.00 23.53  ? 295  VAL A CG1 1 
ATOM   2286  C  CG2 . VAL A  1  295 ? 69.591  309.140 177.136 1.00 25.34  ? 295  VAL A CG2 1 
ATOM   2287  N  N   . GLY A  1  296 ? 69.144  307.314 174.291 1.00 27.54  ? 296  GLY A N   1 
ATOM   2288  C  CA  . GLY A  1  296 ? 70.134  307.048 173.222 1.00 30.60  ? 296  GLY A CA  1 
ATOM   2289  C  C   . GLY A  1  296 ? 71.474  306.751 173.882 1.00 38.67  ? 296  GLY A C   1 
ATOM   2290  O  O   . GLY A  1  296 ? 72.485  307.396 173.596 1.00 34.72  ? 296  GLY A O   1 
ATOM   2291  N  N   . MET A  1  297 ? 71.495  305.750 174.746 1.00 31.45  ? 297  MET A N   1 
ATOM   2292  C  CA  . MET A  1  297 ? 72.641  305.497 175.612 1.00 28.33  ? 297  MET A CA  1 
ATOM   2293  C  C   . MET A  1  297 ? 73.336  304.275 175.084 1.00 25.15  ? 297  MET A C   1 
ATOM   2294  O  O   . MET A  1  297 ? 72.660  303.345 174.638 1.00 32.84  ? 297  MET A O   1 
ATOM   2295  C  CB  . MET A  1  297 ? 72.193  305.237 177.109 1.00 48.10  ? 297  MET A CB  1 
ATOM   2296  C  CG  . MET A  1  297 ? 72.658  306.242 178.228 1.00 89.11  ? 297  MET A CG  1 
ATOM   2297  S  SD  . MET A  1  297 ? 71.864  305.917 179.897 1.00 68.11  ? 297  MET A SD  1 
ATOM   2298  C  CE  . MET A  1  297 ? 71.369  304.146 179.622 1.00 16.60  ? 297  MET A CE  1 
ATOM   2299  N  N   . ASP A  1  298 ? 74.691  304.233 175.222 1.00 33.45  ? 298  ASP A N   1 
ATOM   2300  C  CA  . ASP A  1  298 ? 75.403  303.070 174.673 1.00 38.31  ? 298  ASP A CA  1 
ATOM   2301  C  C   . ASP A  1  298 ? 74.915  301.798 175.371 1.00 41.99  ? 298  ASP A C   1 
ATOM   2302  O  O   . ASP A  1  298 ? 74.383  301.821 176.503 1.00 39.27  ? 298  ASP A O   1 
ATOM   2303  C  CB  . ASP A  1  298 ? 76.948  303.187 174.781 1.00 41.67  ? 298  ASP A CB  1 
ATOM   2304  C  CG  A ASP A  1  298 ? 77.517  304.518 174.284 0.50 52.73  ? 298  ASP A CG  1 
ATOM   2305  C  CG  B ASP A  1  298 ? 77.486  302.996 176.207 0.50 40.65  ? 298  ASP A CG  1 
ATOM   2306  O  OD1 A ASP A  1  298 ? 76.893  305.175 173.430 0.50 43.87  ? 298  ASP A OD1 1 
ATOM   2307  O  OD1 B ASP A  1  298 ? 77.773  301.838 176.603 0.50 40.81  ? 298  ASP A OD1 1 
ATOM   2308  O  OD2 A ASP A  1  298 ? 78.641  304.893 174.742 0.50 40.12  ? 298  ASP A OD2 1 
ATOM   2309  O  OD2 B ASP A  1  298 ? 77.656  304.008 176.915 0.50 40.76  ? 298  ASP A OD2 1 
ATOM   2310  N  N   . VAL A  1  299 ? 75.090  300.669 174.688 1.00 34.28  ? 299  VAL A N   1 
ATOM   2311  C  CA  . VAL A  1  299 ? 74.525  299.418 175.169 1.00 31.87  ? 299  VAL A CA  1 
ATOM   2312  C  C   . VAL A  1  299 ? 75.217  298.933 176.458 1.00 34.77  ? 299  VAL A C   1 
ATOM   2313  O  O   . VAL A  1  299 ? 74.566  298.349 177.330 1.00 33.69  ? 299  VAL A O   1 
ATOM   2314  C  CB  . VAL A  1  299 ? 74.558  298.343 174.064 1.00 40.32  ? 299  VAL A CB  1 
ATOM   2315  C  CG1 . VAL A  1  299 ? 76.005  298.000 173.661 1.00 38.21  ? 299  VAL A CG1 1 
ATOM   2316  C  CG2 . VAL A  1  299 ? 73.854  297.102 174.536 1.00 34.83  ? 299  VAL A CG2 1 
ATOM   2317  N  N   . ASP A  1  300 ? 76.543  299.108 176.584 1.00 27.65  ? 300  ASP A N   1 
ATOM   2318  C  CA  . ASP A  1  300 ? 77.211  298.598 177.785 1.00 26.72  ? 300  ASP A CA  1 
ATOM   2319  C  C   . ASP A  1  300 ? 76.779  299.418 179.012 1.00 26.07  ? 300  ASP A C   1 
ATOM   2320  O  O   . ASP A  1  300 ? 76.669  298.890 180.104 1.00 30.67  ? 300  ASP A O   1 
ATOM   2321  C  CB  . ASP A  1  300 ? 78.751  298.692 177.677 1.00 27.56  ? 300  ASP A CB  1 
ATOM   2322  C  CG  . ASP A  1  300 ? 79.335  297.778 176.651 1.00 43.81  ? 300  ASP A CG  1 
ATOM   2323  O  OD1 . ASP A  1  300 ? 78.735  296.761 176.304 1.00 37.17  ? 300  ASP A OD1 1 
ATOM   2324  O  OD2 . ASP A  1  300 ? 80.420  298.101 176.199 1.00 40.86  ? 300  ASP A OD2 1 
ATOM   2325  N  N   . THR A  1  301 ? 76.580  300.724 178.830 1.00 28.77  ? 301  THR A N   1 
ATOM   2326  C  CA  . THR A  1  301 ? 76.016  301.544 179.897 1.00 32.33  ? 301  THR A CA  1 
ATOM   2327  C  C   . THR A  1  301 ? 74.641  301.028 180.329 1.00 42.58  ? 301  THR A C   1 
ATOM   2328  O  O   . THR A  1  301 ? 74.382  300.854 181.527 1.00 31.27  ? 301  THR A O   1 
ATOM   2329  C  CB  . THR A  1  301 ? 75.967  302.988 179.450 1.00 36.41  ? 301  THR A CB  1 
ATOM   2330  O  OG1 . THR A  1  301 ? 77.322  303.452 179.397 1.00 31.87  ? 301  THR A OG1 1 
ATOM   2331  C  CG2 . THR A  1  301 ? 75.181  303.873 180.466 1.00 28.12  ? 301  THR A CG2 1 
ATOM   2332  N  N   . ARG A  1  302 ? 73.780  300.706 179.366 1.00 27.85  ? 302  ARG A N   1 
ATOM   2333  C  CA  . ARG A  1  302 ? 72.463  300.152 179.673 1.00 28.69  ? 302  ARG A CA  1 
ATOM   2334  C  C   . ARG A  1  302 ? 72.576  298.839 180.434 1.00 35.03  ? 302  ARG A C   1 
ATOM   2335  O  O   . ARG A  1  302 ? 71.845  298.605 181.418 1.00 29.29  ? 302  ARG A O   1 
ATOM   2336  C  CB  . ARG A  1  302 ? 71.648  299.958 178.362 1.00 25.05  ? 302  ARG A CB  1 
ATOM   2337  C  CG  . ARG A  1  302 ? 70.999  301.268 177.871 1.00 38.88  ? 302  ARG A CG  1 
ATOM   2338  C  CD  . ARG A  1  302 ? 70.232  301.072 176.562 1.00 61.27  ? 302  ARG A CD  1 
ATOM   2339  N  NE  A ARG A  1  302 ? 71.047  301.486 175.465 0.50 36.61  ? 302  ARG A NE  1 
ATOM   2340  N  NE  B ARG A  1  302 ? 69.185  300.036 176.620 0.50 39.98  ? 302  ARG A NE  1 
ATOM   2341  C  CZ  A ARG A  1  302 ? 70.929  300.959 174.260 0.50 56.48  ? 302  ARG A CZ  1 
ATOM   2342  C  CZ  B ARG A  1  302 ? 68.461  299.584 175.599 0.50 66.98  ? 302  ARG A CZ  1 
ATOM   2343  N  NH1 A ARG A  1  302 ? 70.049  299.999 174.028 0.50 45.64  ? 302  ARG A NH1 1 
ATOM   2344  N  NH1 B ARG A  1  302 ? 68.644  300.016 174.350 0.50 31.22  ? 302  ARG A NH1 1 
ATOM   2345  N  NH2 A ARG A  1  302 ? 71.705  301.390 173.310 0.50 26.04  ? 302  ARG A NH2 1 
ATOM   2346  N  NH2 B ARG A  1  302 ? 67.539  298.661 175.835 0.50 24.36  ? 302  ARG A NH2 1 
ATOM   2347  N  N   . ALA A  1  303 ? 73.519  297.995 180.021 1.00 32.12  ? 303  ALA A N   1 
ATOM   2348  C  CA  . ALA A  1  303 ? 73.705  296.713 180.692 1.00 28.46  ? 303  ALA A CA  1 
ATOM   2349  C  C   . ALA A  1  303 ? 74.177  296.940 182.132 1.00 33.78  ? 303  ALA A C   1 
ATOM   2350  O  O   . ALA A  1  303 ? 73.735  296.259 183.046 1.00 26.73  ? 303  ALA A O   1 
ATOM   2351  C  CB  . ALA A  1  303 ? 74.700  295.810 179.923 1.00 33.31  ? 303  ALA A CB  1 
ATOM   2352  N  N   . TYR A  1  304 ? 75.029  297.932 182.350 1.00 23.71  ? 304  TYR A N   1 
ATOM   2353  C  CA  . TYR A  1  304 ? 75.488  298.180 183.740 1.00 28.07  ? 304  TYR A CA  1 
ATOM   2354  C  C   . TYR A  1  304 ? 74.339  298.719 184.604 1.00 29.21  ? 304  TYR A C   1 
ATOM   2355  O  O   . TYR A  1  304 ? 74.096  298.224 185.716 1.00 28.03  ? 304  TYR A O   1 
ATOM   2356  C  CB  . TYR A  1  304 ? 76.672  299.169 183.752 1.00 25.72  ? 304  TYR A CB  1 
ATOM   2357  C  CG  . TYR A  1  304 ? 76.723  299.805 185.149 1.00 30.76  ? 304  TYR A CG  1 
ATOM   2358  C  CD1 . TYR A  1  304 ? 77.313  299.111 186.204 1.00 32.47  ? 304  TYR A CD1 1 
ATOM   2359  C  CD2 . TYR A  1  304 ? 76.102  301.034 185.406 1.00 27.76  ? 304  TYR A CD2 1 
ATOM   2360  C  CE1 . TYR A  1  304 ? 77.279  299.657 187.584 1.00 29.99  ? 304  TYR A CE1 1 
ATOM   2361  C  CE2 . TYR A  1  304 ? 76.046  301.592 186.738 1.00 22.33  ? 304  TYR A CE2 1 
ATOM   2362  C  CZ  . TYR A  1  304 ? 76.685  300.891 187.810 1.00 25.30  ? 304  TYR A CZ  1 
ATOM   2363  O  OH  . TYR A  1  304 ? 76.582  301.434 189.109 1.00 28.86  ? 304  TYR A OH  1 
ATOM   2364  N  N   . PHE A  1  305 ? 73.583  299.720 184.102 1.00 27.29  ? 305  PHE A N   1 
ATOM   2365  C  CA  . PHE A  1  305 ? 72.505  300.284 184.918 1.00 29.29  ? 305  PHE A CA  1 
ATOM   2366  C  C   . PHE A  1  305 ? 71.400  299.277 185.163 1.00 31.96  ? 305  PHE A C   1 
ATOM   2367  O  O   . PHE A  1  305 ? 70.811  299.277 186.247 1.00 28.68  ? 305  PHE A O   1 
ATOM   2368  C  CB  . PHE A  1  305 ? 71.988  301.597 184.311 1.00 22.57  ? 305  PHE A CB  1 
ATOM   2369  C  CG  . PHE A  1  305 ? 72.879  302.748 184.681 1.00 26.70  ? 305  PHE A CG  1 
ATOM   2370  C  CD1 . PHE A  1  305 ? 72.803  303.275 185.972 1.00 23.26  ? 305  PHE A CD1 1 
ATOM   2371  C  CD2 . PHE A  1  305 ? 73.857  303.233 183.803 1.00 23.70  ? 305  PHE A CD2 1 
ATOM   2372  C  CE1 . PHE A  1  305 ? 73.610  304.399 186.387 1.00 26.98  ? 305  PHE A CE1 1 
ATOM   2373  C  CE2 . PHE A  1  305 ? 74.692  304.298 184.153 1.00 23.00  ? 305  PHE A CE2 1 
ATOM   2374  C  CZ  . PHE A  1  305 ? 74.586  304.903 185.485 1.00 26.10  ? 305  PHE A CZ  1 
ATOM   2375  N  N   . THR A  1  306 ? 71.177  298.348 184.263 1.00 27.23  ? 306  THR A N   1 
ATOM   2376  C  CA  . THR A  1  306 ? 70.212  297.283 184.504 1.00 27.70  ? 306  THR A CA  1 
ATOM   2377  C  C   . THR A  1  306 ? 70.652  296.424 185.678 1.00 32.97  ? 306  THR A C   1 
ATOM   2378  O  O   . THR A  1  306 ? 69.867  296.141 186.583 1.00 29.99  ? 306  THR A O   1 
ATOM   2379  C  CB  . THR A  1  306 ? 70.072  296.402 183.263 1.00 35.36  ? 306  THR A CB  1 
ATOM   2380  O  OG1 . THR A  1  306 ? 69.293  297.092 182.321 1.00 30.50  ? 306  THR A OG1 1 
ATOM   2381  C  CG2 . THR A  1  306 ? 69.368  295.091 183.611 1.00 27.17  ? 306  THR A CG2 1 
ATOM   2382  N  N   . SER A  1  307 ? 71.913  295.996 185.651 1.00 26.94  ? 307  SER A N   1 
ATOM   2383  C  CA  . SER A  1  307 ? 72.431  295.065 186.660 1.00 27.60  ? 307  SER A CA  1 
ATOM   2384  C  C   . SER A  1  307 ? 72.571  295.722 188.033 1.00 26.18  ? 307  SER A C   1 
ATOM   2385  O  O   . SER A  1  307 ? 72.202  295.113 189.043 1.00 31.30  ? 307  SER A O   1 
ATOM   2386  C  CB  . SER A  1  307 ? 73.788  294.556 186.227 1.00 28.99  ? 307  SER A CB  1 
ATOM   2387  O  OG  . SER A  1  307 ? 73.622  294.039 184.889 1.00 39.78  ? 307  SER A OG  1 
ATOM   2388  N  N   . ALA A  1  308 ? 73.092  296.948 188.087 1.00 27.66  ? 308  ALA A N   1 
ATOM   2389  C  CA  . ALA A  1  308 ? 73.240  297.622 189.375 1.00 30.88  ? 308  ALA A CA  1 
ATOM   2390  C  C   . ALA A  1  308 ? 71.877  297.863 190.012 1.00 33.21  ? 308  ALA A C   1 
ATOM   2391  O  O   . ALA A  1  308 ? 71.716  297.699 191.220 1.00 27.74  ? 308  ALA A O   1 
ATOM   2392  C  CB  . ALA A  1  308 ? 73.968  298.976 189.178 1.00 23.21  ? 308  ALA A CB  1 
ATOM   2393  N  N   . THR A  1  309 ? 70.886  298.266 189.218 1.00 25.08  ? 309  THR A N   1 
ATOM   2394  C  CA  . THR A  1  309 ? 69.540  298.497 189.740 1.00 24.64  ? 309  THR A CA  1 
ATOM   2395  C  C   . THR A  1  309 ? 68.958  297.223 190.358 1.00 28.68  ? 309  THR A C   1 
ATOM   2396  O  O   . THR A  1  309 ? 68.355  297.262 191.420 1.00 27.80  ? 309  THR A O   1 
ATOM   2397  C  CB  . THR A  1  309 ? 68.629  298.994 188.592 1.00 25.75  ? 309  THR A CB  1 
ATOM   2398  O  OG1 . THR A  1  309 ? 69.148  300.253 188.117 1.00 26.46  ? 309  THR A OG1 1 
ATOM   2399  C  CG2 . THR A  1  309 ? 67.177  299.229 189.137 1.00 24.24  ? 309  THR A CG2 1 
ATOM   2400  N  N   . MET A  1  310 ? 69.123  296.085 189.684 1.00 26.41  ? 310  MET A N   1 
ATOM   2401  C  CA  . MET A  1  310 ? 68.501  294.865 190.212 1.00 27.24  ? 310  MET A CA  1 
ATOM   2402  C  C   . MET A  1  310 ? 69.092  294.438 191.561 1.00 30.21  ? 310  MET A C   1 
ATOM   2403  O  O   . MET A  1  310 ? 68.418  293.748 192.334 1.00 29.69  ? 310  MET A O   1 
ATOM   2404  C  CB  . MET A  1  310 ? 68.615  293.715 189.182 1.00 30.65  ? 310  MET A CB  1 
ATOM   2405  C  CG  . MET A  1  310 ? 67.443  293.833 188.112 1.00 24.72  ? 310  MET A CG  1 
ATOM   2406  S  SD  . MET A  1  310 ? 67.320  292.373 187.115 1.00 48.61  ? 310  MET A SD  1 
ATOM   2407  C  CE  . MET A  1  310 ? 66.409  291.252 188.104 1.00 196.80 ? 310  MET A CE  1 
ATOM   2408  N  N   . ILE A  1  311 ? 70.354  294.761 191.802 1.00 25.71  ? 311  ILE A N   1 
ATOM   2409  C  CA  . ILE A  1  311 ? 71.029  294.342 193.033 1.00 31.55  ? 311  ILE A CA  1 
ATOM   2410  C  C   . ILE A  1  311 ? 70.340  294.916 194.257 1.00 25.36  ? 311  ILE A C   1 
ATOM   2411  O  O   . ILE A  1  311 ? 70.402  294.312 195.349 1.00 27.21  ? 311  ILE A O   1 
ATOM   2412  C  CB  . ILE A  1  311 ? 72.501  294.784 192.995 1.00 29.93  ? 311  ILE A CB  1 
ATOM   2413  C  CG1 . ILE A  1  311 ? 73.180  293.929 191.933 1.00 43.60  ? 311  ILE A CG1 1 
ATOM   2414  C  CG2 . ILE A  1  311 ? 73.189  294.539 194.366 1.00 34.38  ? 311  ILE A CG2 1 
ATOM   2415  C  CD1 . ILE A  1  311 ? 74.534  294.403 191.700 1.00 49.12  ? 311  ILE A CD1 1 
ATOM   2416  N  N   . ILE A  1  312 ? 69.684  296.073 194.120 1.00 27.03  ? 312  ILE A N   1 
ATOM   2417  C  CA  . ILE A  1  312 ? 68.929  296.686 195.239 1.00 29.11  ? 312  ILE A CA  1 
ATOM   2418  C  C   . ILE A  1  312 ? 67.841  295.752 195.792 1.00 31.23  ? 312  ILE A C   1 
ATOM   2419  O  O   . ILE A  1  312 ? 67.437  295.887 196.962 1.00 27.82  ? 312  ILE A O   1 
ATOM   2420  C  CB  . ILE A  1  312 ? 68.338  298.030 194.753 1.00 31.20  ? 312  ILE A CB  1 
ATOM   2421  C  CG1 . ILE A  1  312 ? 69.490  298.969 194.411 1.00 38.65  ? 312  ILE A CG1 1 
ATOM   2422  C  CG2 . ILE A  1  312 ? 67.368  298.686 195.837 1.00 34.65  ? 312  ILE A CG2 1 
ATOM   2423  C  CD1 . ILE A  1  312 ? 69.013  300.303 193.723 1.00 35.67  ? 312  ILE A CD1 1 
ATOM   2424  N  N   . ALA A  1  313 ? 67.282  294.861 194.963 1.00 26.62  ? 313  ALA A N   1 
ATOM   2425  C  CA  . ALA A  1  313 ? 66.319  293.876 195.490 1.00 28.12  ? 313  ALA A CA  1 
ATOM   2426  C  C   . ALA A  1  313 ? 66.891  293.022 196.624 1.00 31.25  ? 313  ALA A C   1 
ATOM   2427  O  O   . ALA A  1  313 ? 66.134  292.490 197.450 1.00 28.19  ? 313  ALA A O   1 
ATOM   2428  C  CB  . ALA A  1  313 ? 65.870  292.923 194.364 1.00 25.38  ? 313  ALA A CB  1 
ATOM   2429  N  N   . ILE A  1  314 ? 68.197  292.786 196.631 1.00 29.27  ? 314  ILE A N   1 
ATOM   2430  C  CA  . ILE A  1  314 ? 68.742  291.870 197.642 1.00 27.96  ? 314  ILE A CA  1 
ATOM   2431  C  C   . ILE A  1  314 ? 68.632  292.500 199.024 1.00 26.01  ? 314  ILE A C   1 
ATOM   2432  O  O   . ILE A  1  314 ? 67.986  291.901 199.908 1.00 28.53  ? 314  ILE A O   1 
ATOM   2433  C  CB  . ILE A  1  314 ? 70.193  291.466 197.294 1.00 27.53  ? 314  ILE A CB  1 
ATOM   2434  C  CG1 . ILE A  1  314 ? 70.205  290.627 196.001 1.00 30.03  ? 314  ILE A CG1 1 
ATOM   2435  C  CG2 . ILE A  1  314 ? 70.812  290.615 198.497 1.00 27.08  ? 314  ILE A CG2 1 
ATOM   2436  C  CD1 . ILE A  1  314 ? 71.588  290.346 195.448 1.00 32.78  ? 314  ILE A CD1 1 
ATOM   2437  N  N   . PRO A  1  315 ? 69.248  293.681 199.326 1.00 22.95  ? 315  PRO A N   1 
ATOM   2438  C  CA  . PRO A  1  315 ? 69.016  294.211 200.725 1.00 25.59  ? 315  PRO A CA  1 
ATOM   2439  C  C   . PRO A  1  315 ? 67.544  294.499 200.993 1.00 33.36  ? 315  PRO A C   1 
ATOM   2440  O  O   . PRO A  1  315 ? 67.051  294.375 202.148 1.00 24.61  ? 315  PRO A O   1 
ATOM   2441  C  CB  . PRO A  1  315 ? 69.863  295.496 200.777 1.00 25.39  ? 315  PRO A CB  1 
ATOM   2442  C  CG  . PRO A  1  315 ? 70.023  295.909 199.212 1.00 22.66  ? 315  PRO A CG  1 
ATOM   2443  C  CD  . PRO A  1  315 ? 70.195  294.525 198.565 1.00 24.11  ? 315  PRO A CD  1 
ATOM   2444  N  N   . THR A  1  316 ? 66.782  294.844 199.943 1.00 26.41  ? 316  THR A N   1 
ATOM   2445  C  CA  . THR A  1  316 ? 65.379  295.148 200.193 1.00 27.17  ? 316  THR A CA  1 
ATOM   2446  C  C   . THR A  1  316 ? 64.633  293.901 200.612 1.00 29.77  ? 316  THR A C   1 
ATOM   2447  O  O   . THR A  1  316 ? 63.781  293.963 201.492 1.00 28.09  ? 316  THR A O   1 
ATOM   2448  C  CB  . THR A  1  316 ? 64.709  295.796 198.956 1.00 31.53  ? 316  THR A CB  1 
ATOM   2449  O  OG1 . THR A  1  316 ? 65.501  296.904 198.539 1.00 26.30  ? 316  THR A OG1 1 
ATOM   2450  C  CG2 . THR A  1  316 ? 63.363  296.376 199.379 1.00 24.55  ? 316  THR A CG2 1 
ATOM   2451  N  N   . GLY A  1  317 ? 64.932  292.765 199.976 1.00 23.72  ? 317  GLY A N   1 
ATOM   2452  C  CA  . GLY A  1  317 ? 64.273  291.514 200.357 1.00 25.93  ? 317  GLY A CA  1 
ATOM   2453  C  C   . GLY A  1  317 ? 64.637  291.097 201.780 1.00 31.54  ? 317  GLY A C   1 
ATOM   2454  O  O   . GLY A  1  317 ? 63.796  290.567 202.512 1.00 29.02  ? 317  GLY A O   1 
ATOM   2455  N  N   . VAL A  1  318 ? 65.900  291.296 202.183 1.00 25.09  ? 318  VAL A N   1 
ATOM   2456  C  CA  . VAL A  1  318 ? 66.239  291.065 203.605 1.00 23.30  ? 318  VAL A CA  1 
ATOM   2457  C  C   . VAL A  1  318 ? 65.315  291.852 204.555 1.00 25.22  ? 318  VAL A C   1 
ATOM   2458  O  O   . VAL A  1  318 ? 64.847  291.325 205.580 1.00 28.82  ? 318  VAL A O   1 
ATOM   2459  C  CB  . VAL A  1  318 ? 67.726  291.371 203.838 1.00 23.28  ? 318  VAL A CB  1 
ATOM   2460  C  CG1 . VAL A  1  318 ? 68.066  291.325 205.450 1.00 24.62  ? 318  VAL A CG1 1 
ATOM   2461  C  CG2 . VAL A  1  318 ? 68.546  290.321 203.083 1.00 26.33  ? 318  VAL A CG2 1 
ATOM   2462  N  N   . LYS A  1  319 ? 64.955  293.107 204.206 1.00 29.26  ? 319  LYS A N   1 
ATOM   2463  C  CA  . LYS A  1  319 ? 64.013  293.815 205.102 1.00 26.81  ? 319  LYS A CA  1 
ATOM   2464  C  C   . LYS A  1  319 ? 62.617  293.197 205.062 1.00 32.48  ? 319  LYS A C   1 
ATOM   2465  O  O   . LYS A  1  319 ? 61.965  293.045 206.107 1.00 24.79  ? 319  LYS A O   1 
ATOM   2466  C  CB  . LYS A  1  319 ? 63.932  295.299 204.745 1.00 26.44  ? 319  LYS A CB  1 
ATOM   2467  C  CG  . LYS A  1  319 ? 65.316  295.946 204.804 1.00 29.48  ? 319  LYS A CG  1 
ATOM   2468  C  CD  . LYS A  1  319 ? 65.288  297.503 204.751 1.00 25.65  ? 319  LYS A CD  1 
ATOM   2469  C  CE  . LYS A  1  319 ? 64.592  298.208 205.979 1.00 20.63  ? 319  LYS A CE  1 
ATOM   2470  N  NZ  . LYS A  1  319 ? 65.287  297.769 207.302 1.00 24.17  ? 319  LYS A NZ  1 
ATOM   2471  N  N   . VAL A  1  320 ? 62.106  292.879 203.871 1.00 27.43  ? 320  VAL A N   1 
ATOM   2472  C  CA  . VAL A  1  320 ? 60.757  292.299 203.808 1.00 28.35  ? 320  VAL A CA  1 
ATOM   2473  C  C   . VAL A  1  320 ? 60.700  290.993 204.593 1.00 28.69  ? 320  VAL A C   1 
ATOM   2474  O  O   . VAL A  1  320 ? 59.770  290.749 205.380 1.00 31.77  ? 320  VAL A O   1 
ATOM   2475  C  CB  . VAL A  1  320 ? 60.330  292.108 202.341 1.00 31.37  ? 320  VAL A CB  1 
ATOM   2476  C  CG1 . VAL A  1  320 ? 59.031  291.245 202.249 1.00 27.37  ? 320  VAL A CG1 1 
ATOM   2477  C  CG2 . VAL A  1  320 ? 60.121  293.494 201.703 1.00 27.98  ? 320  VAL A CG2 1 
ATOM   2478  N  N   . PHE A  1  321 ? 61.659  290.109 204.355 1.00 25.41  ? 321  PHE A N   1 
ATOM   2479  C  CA  . PHE A  1  321 ? 61.613  288.850 205.077 1.00 31.23  ? 321  PHE A CA  1 
ATOM   2480  C  C   . PHE A  1  321 ? 61.824  289.059 206.582 1.00 30.06  ? 321  PHE A C   1 
ATOM   2481  O  O   . PHE A  1  321 ? 61.235  288.334 207.394 1.00 31.51  ? 321  PHE A O   1 
ATOM   2482  C  CB  . PHE A  1  321 ? 62.653  287.918 204.491 1.00 33.20  ? 321  PHE A CB  1 
ATOM   2483  C  CG  . PHE A  1  321 ? 62.383  287.588 203.034 1.00 65.23  ? 321  PHE A CG  1 
ATOM   2484  C  CD1 . PHE A  1  321 ? 61.089  287.337 202.612 1.00 50.63  ? 321  PHE A CD1 1 
ATOM   2485  C  CD2 . PHE A  1  321 ? 63.404  287.573 202.088 1.00 72.26  ? 321  PHE A CD2 1 
ATOM   2486  C  CE1 . PHE A  1  321 ? 60.803  287.070 201.250 1.00 53.33  ? 321  PHE A CE1 1 
ATOM   2487  C  CE2 . PHE A  1  321 ? 63.135  287.296 200.747 1.00 48.31  ? 321  PHE A CE2 1 
ATOM   2488  C  CZ  . PHE A  1  321 ? 61.816  287.057 200.339 1.00 42.74  ? 321  PHE A CZ  1 
ATOM   2489  N  N   . SER A  1  322 ? 62.604  290.079 206.954 1.00 26.86  ? 322  SER A N   1 
ATOM   2490  C  CA  . SER A  1  322 ? 62.816  290.322 208.390 1.00 28.19  ? 322  SER A CA  1 
ATOM   2491  C  C   . SER A  1  322 ? 61.560  290.862 209.045 1.00 27.98  ? 322  SER A C   1 
ATOM   2492  O  O   . SER A  1  322 ? 61.299  290.522 210.201 1.00 28.33  ? 322  SER A O   1 
ATOM   2493  C  CB  . SER A  1  322 ? 63.992  291.285 208.652 1.00 26.83  ? 322  SER A CB  1 
ATOM   2494  O  OG  . SER A  1  322 ? 65.190  290.676 208.213 1.00 27.48  ? 322  SER A OG  1 
ATOM   2495  N  N   . TRP A  1  323 ? 60.749  291.660 208.333 1.00 31.11  ? 323  TRP A N   1 
ATOM   2496  C  CA  . TRP A  1  323 ? 59.460  292.043 208.897 1.00 31.09  ? 323  TRP A CA  1 
ATOM   2497  C  C   . TRP A  1  323 ? 58.569  290.837 209.057 1.00 31.71  ? 323  TRP A C   1 
ATOM   2498  O  O   . TRP A  1  323 ? 57.863  290.723 210.069 1.00 27.23  ? 323  TRP A O   1 
ATOM   2499  C  CB  . TRP A  1  323 ? 58.738  293.059 208.032 1.00 26.60  ? 323  TRP A CB  1 
ATOM   2500  C  CG  . TRP A  1  323 ? 59.404  294.379 208.025 1.00 24.72  ? 323  TRP A CG  1 
ATOM   2501  C  CD1 . TRP A  1  323 ? 59.961  295.045 209.131 1.00 25.10  ? 323  TRP A CD1 1 
ATOM   2502  C  CD2 . TRP A  1  323 ? 59.618  295.233 206.881 1.00 29.16  ? 323  TRP A CD2 1 
ATOM   2503  N  NE1 . TRP A  1  323 ? 60.453  296.258 208.714 1.00 25.95  ? 323  TRP A NE1 1 
ATOM   2504  C  CE2 . TRP A  1  323 ? 60.273  296.408 207.365 1.00 31.34  ? 323  TRP A CE2 1 
ATOM   2505  C  CE3 . TRP A  1  323 ? 59.256  295.148 205.531 1.00 32.44  ? 323  TRP A CE3 1 
ATOM   2506  C  CZ2 . TRP A  1  323 ? 60.626  297.475 206.526 1.00 28.86  ? 323  TRP A CZ2 1 
ATOM   2507  C  CZ3 . TRP A  1  323 ? 59.641  296.195 204.652 1.00 33.01  ? 323  TRP A CZ3 1 
ATOM   2508  C  CH2 . TRP A  1  323 ? 60.305  297.358 205.164 1.00 27.58  ? 323  TRP A CH2 1 
ATOM   2509  N  N   . LEU A  1  324 ? 58.549  289.955 208.064 1.00 28.18  ? 324  LEU A N   1 
ATOM   2510  C  CA  . LEU A  1  324 ? 57.725  288.757 208.214 1.00 31.22  ? 324  LEU A CA  1 
ATOM   2511  C  C   . LEU A  1  324 ? 58.217  287.965 209.408 1.00 33.53  ? 324  LEU A C   1 
ATOM   2512  O  O   . LEU A  1  324 ? 57.421  287.421 210.162 1.00 30.32  ? 324  LEU A O   1 
ATOM   2513  C  CB  . LEU A  1  324 ? 57.799  287.877 206.978 1.00 26.38  ? 324  LEU A CB  1 
ATOM   2514  C  CG  . LEU A  1  324 ? 57.314  288.608 205.656 1.00 33.53  ? 324  LEU A CG  1 
ATOM   2515  C  CD1 . LEU A  1  324 ? 57.320  287.645 204.427 1.00 30.01  ? 324  LEU A CD1 1 
ATOM   2516  C  CD2 . LEU A  1  324 ? 55.986  289.213 205.888 1.00 34.16  ? 324  LEU A CD2 1 
ATOM   2517  N  N   . ALA A  1  325 ? 59.542  287.848 209.546 1.00 30.85  ? 325  ALA A N   1 
ATOM   2518  C  CA  . ALA A  1  325 ? 60.089  287.115 210.668 1.00 28.37  ? 325  ALA A CA  1 
ATOM   2519  C  C   . ALA A  1  325 ? 59.802  287.812 211.992 1.00 26.63  ? 325  ALA A C   1 
ATOM   2520  O  O   . ALA A  1  325 ? 59.852  287.143 213.016 1.00 29.82  ? 325  ALA A O   1 
ATOM   2521  C  CB  . ALA A  1  325 ? 61.594  286.909 210.490 1.00 34.13  ? 325  ALA A CB  1 
ATOM   2522  N  N   . THR A  1  326 ? 59.574  289.135 212.012 1.00 27.77  ? 326  THR A N   1 
ATOM   2523  C  CA  . THR A  1  326 ? 59.211  289.793 213.260 1.00 29.48  ? 326  THR A CA  1 
ATOM   2524  C  C   . THR A  1  326 ? 57.778  289.397 213.656 1.00 32.67  ? 326  THR A C   1 
ATOM   2525  O  O   . THR A  1  326 ? 57.505  289.152 214.838 1.00 29.86  ? 326  THR A O   1 
ATOM   2526  C  CB  . THR A  1  326 ? 59.372  291.309 213.110 1.00 27.88  ? 326  THR A CB  1 
ATOM   2527  O  OG1 . THR A  1  326 ? 60.735  291.556 212.735 1.00 26.48  ? 326  THR A OG1 1 
ATOM   2528  C  CG2 . THR A  1  326 ? 59.077  292.051 214.422 1.00 28.33  ? 326  THR A CG2 1 
ATOM   2529  N  N   . LEU A  1  327 ? 56.882  289.274 212.657 1.00 29.75  ? 327  LEU A N   1 
ATOM   2530  C  CA  . LEU A  1  327 ? 55.490  288.820 212.906 1.00 30.13  ? 327  LEU A CA  1 
ATOM   2531  C  C   . LEU A  1  327 ? 55.464  287.396 213.443 1.00 30.25  ? 327  LEU A C   1 
ATOM   2532  O  O   . LEU A  1  327 ? 54.627  287.051 214.279 1.00 32.77  ? 327  LEU A O   1 
ATOM   2533  C  CB  . LEU A  1  327 ? 54.682  288.846 211.583 1.00 28.43  ? 327  LEU A CB  1 
ATOM   2534  C  CG  . LEU A  1  327 ? 54.482  290.167 210.878 1.00 36.62  ? 327  LEU A CG  1 
ATOM   2535  C  CD1 . LEU A  1  327 ? 53.774  289.933 209.495 1.00 31.59  ? 327  LEU A CD1 1 
ATOM   2536  C  CD2 . LEU A  1  327 ? 53.633  291.101 211.728 1.00 27.82  ? 327  LEU A CD2 1 
ATOM   2537  N  N   . HIS A  1  328 ? 56.382  286.556 212.958 1.00 29.66  ? 328  HIS A N   1 
ATOM   2538  C  CA  . HIS A  1  328 ? 56.388  285.131 213.245 1.00 30.38  ? 328  HIS A CA  1 
ATOM   2539  C  C   . HIS A  1  328 ? 56.414  284.886 214.748 1.00 33.81  ? 328  HIS A C   1 
ATOM   2540  O  O   . HIS A  1  328 ? 57.372  285.295 215.431 1.00 31.62  ? 328  HIS A O   1 
ATOM   2541  C  CB  . HIS A  1  328 ? 57.645  284.524 212.640 1.00 31.18  ? 328  HIS A CB  1 
ATOM   2542  C  CG  . HIS A  1  328 ? 57.808  283.061 212.912 1.00 34.05  ? 328  HIS A CG  1 
ATOM   2543  N  ND1 . HIS A  1  328 ? 56.861  282.126 212.541 1.00 30.22  ? 328  HIS A ND1 1 
ATOM   2544  C  CD2 . HIS A  1  328 ? 58.814  282.363 213.491 1.00 31.08  ? 328  HIS A CD2 1 
ATOM   2545  C  CE1 . HIS A  1  328 ? 57.270  280.916 212.884 1.00 33.94  ? 328  HIS A CE1 1 
ATOM   2546  N  NE2 . HIS A  1  328 ? 58.458  281.033 213.457 1.00 39.19  ? 328  HIS A NE2 1 
ATOM   2547  N  N   . GLY A  1  329 ? 55.404  284.189 215.266 1.00 29.74  ? 329  GLY A N   1 
ATOM   2548  C  CA  . GLY A  1  329 ? 55.443  283.914 216.722 1.00 28.38  ? 329  GLY A CA  1 
ATOM   2549  C  C   . GLY A  1  329 ? 54.922  285.049 217.580 1.00 39.90  ? 329  GLY A C   1 
ATOM   2550  O  O   . GLY A  1  329 ? 54.945  284.947 218.815 1.00 32.72  ? 329  GLY A O   1 
ATOM   2551  N  N   . GLY A  1  330 ? 54.441  286.134 216.965 1.00 31.03  ? 330  GLY A N   1 
ATOM   2552  C  CA  . GLY A  1  330 ? 54.008  287.275 217.758 1.00 33.08  ? 330  GLY A CA  1 
ATOM   2553  C  C   . GLY A  1  330 ? 52.643  287.040 218.363 1.00 28.90  ? 330  GLY A C   1 
ATOM   2554  O  O   . GLY A  1  330 ? 51.864  286.197 217.926 1.00 32.78  ? 330  GLY A O   1 
ATOM   2555  N  N   . ASN A  1  331 ? 52.399  287.745 219.448 1.00 32.37  ? 331  ASN A N   1 
ATOM   2556  C  CA  . ASN A  1  331 ? 51.051  287.916 219.969 1.00 39.36  ? 331  ASN A CA  1 
ATOM   2557  C  C   . ASN A  1  331 ? 50.476  289.119 219.209 1.00 31.51  ? 331  ASN A C   1 
ATOM   2558  O  O   . ASN A  1  331 ? 50.623  290.282 219.620 1.00 37.88  ? 331  ASN A O   1 
ATOM   2559  C  CB  . ASN A  1  331 ? 51.083  288.119 221.499 1.00 36.31  ? 331  ASN A CB  1 
ATOM   2560  C  CG  . ASN A  1  331 ? 49.692  288.430 222.066 1.00 43.98  ? 331  ASN A CG  1 
ATOM   2561  O  OD1 . ASN A  1  331 ? 48.696  288.179 221.407 1.00 39.42  ? 331  ASN A OD1 1 
ATOM   2562  N  ND2 . ASN A  1  331 ? 49.633  289.003 223.267 1.00 45.05  ? 331  ASN A ND2 1 
ATOM   2563  N  N   . ILE A  1  332 ? 49.821  288.823 218.079 1.00 37.02  ? 332  ILE A N   1 
ATOM   2564  C  CA  . ILE A  1  332 ? 49.449  289.842 217.095 1.00 41.23  ? 332  ILE A CA  1 
ATOM   2565  C  C   . ILE A  1  332 ? 48.320  290.694 217.639 1.00 36.04  ? 332  ILE A C   1 
ATOM   2566  O  O   . ILE A  1  332 ? 47.236  290.184 217.947 1.00 36.59  ? 332  ILE A O   1 
ATOM   2567  C  CB  . ILE A  1  332 ? 49.007  289.214 215.760 1.00 42.19  ? 332  ILE A CB  1 
ATOM   2568  C  CG1 . ILE A  1  332 ? 50.075  288.297 215.182 1.00 34.36  ? 332  ILE A CG1 1 
ATOM   2569  C  CG2 . ILE A  1  332 ? 48.615  290.332 214.739 1.00 33.28  ? 332  ILE A CG2 1 
ATOM   2570  C  CD1 . ILE A  1  332 ? 51.446  288.954 215.011 1.00 34.92  ? 332  ILE A CD1 1 
ATOM   2571  N  N   . LYS A  1  333 ? 48.564  291.997 217.782 1.00 34.22  ? 333  LYS A N   1 
ATOM   2572  C  CA  . LYS A  1  333 ? 47.496  292.936 218.069 1.00 36.04  ? 333  LYS A CA  1 
ATOM   2573  C  C   . LYS A  1  333 ? 46.980  293.531 216.751 1.00 51.25  ? 333  LYS A C   1 
ATOM   2574  O  O   . LYS A  1  333 ? 47.743  294.166 216.018 1.00 32.26  ? 333  LYS A O   1 
ATOM   2575  C  CB  . LYS A  1  333 ? 47.966  294.033 219.012 1.00 34.85  ? 333  LYS A CB  1 
ATOM   2576  C  CG  . LYS A  1  333 ? 46.778  294.942 219.424 1.00 38.89  ? 333  LYS A CG  1 
ATOM   2577  C  CD  . LYS A  1  333 ? 47.087  295.729 220.656 1.00 53.34  ? 333  LYS A CD  1 
ATOM   2578  C  CE  . LYS A  1  333 ? 45.813  296.317 221.251 1.00 93.46  ? 333  LYS A CE  1 
ATOM   2579  N  NZ  . LYS A  1  333 ? 45.963  296.717 222.701 1.00 69.27  ? 333  LYS A NZ  1 
ATOM   2580  N  N   . TRP A  1  334 ? 45.694  293.330 216.442 1.00 32.28  ? 334  TRP A N   1 
ATOM   2581  C  CA  . TRP A  1  334 ? 45.139  293.806 215.156 1.00 38.23  ? 334  TRP A CA  1 
ATOM   2582  C  C   . TRP A  1  334 ? 44.679  295.257 215.240 1.00 33.73  ? 334  TRP A C   1 
ATOM   2583  O  O   . TRP A  1  334 ? 43.524  295.588 214.972 1.00 36.09  ? 334  TRP A O   1 
ATOM   2584  C  CB  . TRP A  1  334 ? 43.986  292.930 214.690 1.00 35.82  ? 334  TRP A CB  1 
ATOM   2585  C  CG  . TRP A  1  334 ? 44.431  291.585 214.282 1.00 36.29  ? 334  TRP A CG  1 
ATOM   2586  C  CD1 . TRP A  1  334 ? 44.586  290.488 215.081 1.00 66.93  ? 334  TRP A CD1 1 
ATOM   2587  C  CD2 . TRP A  1  334 ? 44.817  291.199 212.990 1.00 44.66  ? 334  TRP A CD2 1 
ATOM   2588  N  NE1 . TRP A  1  334 ? 45.059  289.440 214.347 1.00 43.71  ? 334  TRP A NE1 1 
ATOM   2589  C  CE2 . TRP A  1  334 ? 45.171  289.836 213.050 1.00 45.29  ? 334  TRP A CE2 1 
ATOM   2590  C  CE3 . TRP A  1  334 ? 44.925  291.876 211.775 1.00 55.16  ? 334  TRP A CE3 1 
ATOM   2591  C  CZ2 . TRP A  1  334 ? 45.630  289.136 211.927 1.00 52.32  ? 334  TRP A CZ2 1 
ATOM   2592  C  CZ3 . TRP A  1  334 ? 45.360  291.171 210.661 1.00 57.92  ? 334  TRP A CZ3 1 
ATOM   2593  C  CH2 . TRP A  1  334 ? 45.702  289.819 210.745 1.00 81.44  ? 334  TRP A CH2 1 
ATOM   2594  N  N   . SER A  1  335 ? 45.617  296.139 215.594 1.00 29.15  ? 335  SER A N   1 
ATOM   2595  C  CA  . SER A  1  335 ? 45.328  297.556 215.686 1.00 27.65  ? 335  SER A CA  1 
ATOM   2596  C  C   . SER A  1  335 ? 45.266  298.129 214.271 1.00 30.00  ? 335  SER A C   1 
ATOM   2597  O  O   . SER A  1  335 ? 45.757  297.542 213.326 1.00 30.62  ? 335  SER A O   1 
ATOM   2598  C  CB  . SER A  1  335 ? 46.420  298.326 216.426 1.00 36.44  ? 335  SER A CB  1 
ATOM   2599  O  OG  . SER A  1  335 ? 47.625  298.183 215.670 1.00 34.52  ? 335  SER A OG  1 
ATOM   2600  N  N   . PRO A  1  336 ? 44.711  299.303 214.145 1.00 27.80  ? 336  PRO A N   1 
ATOM   2601  C  CA  . PRO A  1  336 ? 44.702  299.961 212.828 1.00 31.53  ? 336  PRO A CA  1 
ATOM   2602  C  C   . PRO A  1  336 ? 46.131  300.234 212.349 1.00 30.53  ? 336  PRO A C   1 
ATOM   2603  O  O   . PRO A  1  336 ? 46.409  300.048 211.172 1.00 26.75  ? 336  PRO A O   1 
ATOM   2604  C  CB  . PRO A  1  336 ? 43.924  301.251 213.087 1.00 32.92  ? 336  PRO A CB  1 
ATOM   2605  C  CG  . PRO A  1  336 ? 43.623  301.318 214.590 1.00 32.80  ? 336  PRO A CG  1 
ATOM   2606  C  CD  . PRO A  1  336 ? 43.908  299.989 215.200 1.00 28.16  ? 336  PRO A CD  1 
ATOM   2607  N  N   . ALA A  1  337 ? 47.067  300.614 213.239 1.00 26.49  ? 337  ALA A N   1 
ATOM   2608  C  CA  . ALA A  1  337 ? 48.443  300.848 212.768 1.00 23.25  ? 337  ALA A CA  1 
ATOM   2609  C  C   . ALA A  1  337 ? 49.035  299.573 212.168 1.00 29.41  ? 337  ALA A C   1 
ATOM   2610  O  O   . ALA A  1  337 ? 49.779  299.619 211.187 1.00 24.38  ? 337  ALA A O   1 
ATOM   2611  C  CB  . ALA A  1  337 ? 49.316  301.421 213.946 1.00 22.02  ? 337  ALA A CB  1 
ATOM   2612  N  N   . MET A  1  338 ? 48.771  298.419 212.789 1.00 25.14  ? 338  MET A N   1 
ATOM   2613  C  CA  . MET A  1  338 ? 49.267  297.156 212.271 1.00 27.72  ? 338  MET A CA  1 
ATOM   2614  C  C   . MET A  1  338 ? 48.672  296.870 210.889 1.00 33.14  ? 338  MET A C   1 
ATOM   2615  O  O   . MET A  1  338 ? 49.330  296.274 210.031 1.00 26.74  ? 338  MET A O   1 
ATOM   2616  C  CB  . MET A  1  338 ? 48.925  296.001 213.249 1.00 29.53  ? 338  MET A CB  1 
ATOM   2617  C  CG  . MET A  1  338 ? 49.367  294.593 212.721 1.00 29.61  ? 338  MET A CG  1 
ATOM   2618  S  SD  . MET A  1  338 ? 51.206  294.604 212.614 1.00 31.34  ? 338  MET A SD  1 
ATOM   2619  C  CE  . MET A  1  338 ? 51.559  293.108 213.608 1.00 36.86  ? 338  MET A CE  1 
ATOM   2620  N  N   . MET A  1  339 ? 47.397  297.221 210.683 1.00 24.81  ? 339  MET A N   1 
ATOM   2621  C  CA  . MET A  1  339 ? 46.789  296.976 209.363 1.00 26.20  ? 339  MET A CA  1 
ATOM   2622  C  C   . MET A  1  339 ? 47.493  297.790 208.289 1.00 25.80  ? 339  MET A C   1 
ATOM   2623  O  O   . MET A  1  339 ? 47.785  297.260 207.214 1.00 26.93  ? 339  MET A O   1 
ATOM   2624  C  CB  . MET A  1  339 ? 45.296  297.327 209.367 1.00 22.98  ? 339  MET A CB  1 
ATOM   2625  C  CG  . MET A  1  339 ? 44.516  296.340 210.334 1.00 28.46  ? 339  MET A CG  1 
ATOM   2626  S  SD  . MET A  1  339 ? 42.743  296.802 210.293 1.00 35.69  ? 339  MET A SD  1 
ATOM   2627  C  CE  . MET A  1  339 ? 42.233  295.593 211.583 1.00 36.12  ? 339  MET A CE  1 
ATOM   2628  N  N   . TRP A  1  340 ? 47.778  299.077 208.569 1.00 25.52  ? 340  TRP A N   1 
ATOM   2629  C  CA  . TRP A  1  340 ? 48.556  299.926 207.645 1.00 29.15  ? 340  TRP A CA  1 
ATOM   2630  C  C   . TRP A  1  340 ? 49.908  299.295 207.344 1.00 28.81  ? 340  TRP A C   1 
ATOM   2631  O  O   . TRP A  1  340 ? 50.380  299.331 206.201 1.00 24.60  ? 340  TRP A O   1 
ATOM   2632  C  CB  . TRP A  1  340 ? 48.781  301.337 208.223 1.00 25.25  ? 340  TRP A CB  1 
ATOM   2633  C  CG  . TRP A  1  340 ? 47.504  302.173 208.227 1.00 26.27  ? 340  TRP A CG  1 
ATOM   2634  C  CD1 . TRP A  1  340 ? 46.724  302.539 209.296 1.00 28.37  ? 340  TRP A CD1 1 
ATOM   2635  C  CD2 . TRP A  1  340 ? 46.865  302.708 207.059 1.00 28.64  ? 340  TRP A CD2 1 
ATOM   2636  N  NE1 . TRP A  1  340 ? 45.664  303.279 208.874 1.00 29.51  ? 340  TRP A NE1 1 
ATOM   2637  C  CE2 . TRP A  1  340 ? 45.730  303.412 207.497 1.00 27.89  ? 340  TRP A CE2 1 
ATOM   2638  C  CE3 . TRP A  1  340 ? 47.165  302.652 205.673 1.00 27.71  ? 340  TRP A CE3 1 
ATOM   2639  C  CZ2 . TRP A  1  340 ? 44.867  304.079 206.628 1.00 28.15  ? 340  TRP A CZ2 1 
ATOM   2640  C  CZ3 . TRP A  1  340 ? 46.320  303.293 204.807 1.00 26.39  ? 340  TRP A CZ3 1 
ATOM   2641  C  CH2 . TRP A  1  340 ? 45.169  303.998 205.245 1.00 25.50  ? 340  TRP A CH2 1 
ATOM   2642  N  N   . ALA A  1  341 ? 50.553  298.710 208.357 1.00 25.58  ? 341  ALA A N   1 
ATOM   2643  C  CA  . ALA A  1  341 ? 51.897  298.160 208.173 1.00 26.65  ? 341  ALA A CA  1 
ATOM   2644  C  C   . ALA A  1  341 ? 51.864  296.876 207.357 1.00 26.14  ? 341  ALA A C   1 
ATOM   2645  O  O   . ALA A  1  341 ? 52.745  296.626 206.526 1.00 29.21  ? 341  ALA A O   1 
ATOM   2646  C  CB  . ALA A  1  341 ? 52.532  297.871 209.570 1.00 26.07  ? 341  ALA A CB  1 
ATOM   2647  N  N   . LEU A  1  342 ? 50.882  296.019 207.623 1.00 25.58  ? 342  LEU A N   1 
ATOM   2648  C  CA  . LEU A  1  342 ? 50.729  294.814 206.812 1.00 29.05  ? 342  LEU A CA  1 
ATOM   2649  C  C   . LEU A  1  342 ? 50.372  295.147 205.371 1.00 32.22  ? 342  LEU A C   1 
ATOM   2650  O  O   . LEU A  1  342 ? 50.856  294.503 204.423 1.00 28.50  ? 342  LEU A O   1 
ATOM   2651  C  CB  . LEU A  1  342 ? 49.652  293.920 207.408 1.00 27.98  ? 342  LEU A CB  1 
ATOM   2652  C  CG  . LEU A  1  342 ? 49.988  293.428 208.848 1.00 30.57  ? 342  LEU A CG  1 
ATOM   2653  C  CD1 . LEU A  1  342 ? 48.741  292.754 209.396 1.00 31.65  ? 342  LEU A CD1 1 
ATOM   2654  C  CD2 . LEU A  1  342 ? 51.082  292.390 208.787 1.00 30.15  ? 342  LEU A CD2 1 
ATOM   2655  N  N   . GLY A  1  343 ? 49.487  296.106 205.168 1.00 24.78  ? 343  GLY A N   1 
ATOM   2656  C  CA  . GLY A  1  343 ? 49.238  296.527 203.789 1.00 25.80  ? 343  GLY A CA  1 
ATOM   2657  C  C   . GLY A  1  343 ? 50.498  297.090 203.150 1.00 32.43  ? 343  GLY A C   1 
ATOM   2658  O  O   . GLY A  1  343 ? 50.750  296.890 201.954 1.00 27.83  ? 343  GLY A O   1 
ATOM   2659  N  N   . PHE A  1  344 ? 51.295  297.817 203.942 1.00 27.82  ? 344  PHE A N   1 
ATOM   2660  C  CA  . PHE A  1  344 ? 52.574  298.326 203.443 1.00 27.31  ? 344  PHE A CA  1 
ATOM   2661  C  C   . PHE A  1  344 ? 53.437  297.187 202.938 1.00 32.65  ? 344  PHE A C   1 
ATOM   2662  O  O   . PHE A  1  344 ? 53.980  297.253 201.821 1.00 29.95  ? 344  PHE A O   1 
ATOM   2663  C  CB  . PHE A  1  344 ? 53.344  299.086 204.542 1.00 24.11  ? 344  PHE A CB  1 
ATOM   2664  C  CG  . PHE A  1  344 ? 54.720  299.513 204.109 1.00 23.55  ? 344  PHE A CG  1 
ATOM   2665  C  CD1 . PHE A  1  344 ? 55.774  298.608 204.134 1.00 26.35  ? 344  PHE A CD1 1 
ATOM   2666  C  CD2 . PHE A  1  344 ? 54.950  300.814 203.678 1.00 23.40  ? 344  PHE A CD2 1 
ATOM   2667  C  CE1 . PHE A  1  344 ? 57.051  298.985 203.661 1.00 29.18  ? 344  PHE A CE1 1 
ATOM   2668  C  CE2 . PHE A  1  344 ? 56.249  301.227 203.207 1.00 23.47  ? 344  PHE A CE2 1 
ATOM   2669  C  CZ  . PHE A  1  344 ? 57.272  300.309 203.232 1.00 23.22  ? 344  PHE A CZ  1 
ATOM   2670  N  N   . ILE A  1  345 ? 53.606  296.140 203.758 1.00 28.25  ? 345  ILE A N   1 
ATOM   2671  C  CA  . ILE A  1  345 ? 54.557  295.101 203.392 1.00 26.48  ? 345  ILE A CA  1 
ATOM   2672  C  C   . ILE A  1  345 ? 54.166  294.494 202.050 1.00 36.87  ? 345  ILE A C   1 
ATOM   2673  O  O   . ILE A  1  345 ? 55.007  294.302 201.164 1.00 25.79  ? 345  ILE A O   1 
ATOM   2674  C  CB  . ILE A  1  345 ? 54.660  294.023 204.472 1.00 27.50  ? 345  ILE A CB  1 
ATOM   2675  C  CG1 . ILE A  1  345 ? 55.377  294.581 205.713 1.00 26.18  ? 345  ILE A CG1 1 
ATOM   2676  C  CG2 . ILE A  1  345 ? 55.500  292.847 203.938 1.00 27.82  ? 345  ILE A CG2 1 
ATOM   2677  C  CD1 . ILE A  1  345 ? 55.062  293.648 206.957 1.00 27.16  ? 345  ILE A CD1 1 
ATOM   2678  N  N   . PHE A  1  346 ? 52.876  294.171 201.903 1.00 27.07  ? 346  PHE A N   1 
ATOM   2679  C  CA  . PHE A  1  346 ? 52.429  293.537 200.650 1.00 30.04  ? 346  PHE A CA  1 
ATOM   2680  C  C   . PHE A  1  346 ? 52.469  294.484 199.439 1.00 31.13  ? 346  PHE A C   1 
ATOM   2681  O  O   . PHE A  1  346 ? 52.973  294.116 198.371 1.00 27.79  ? 346  PHE A O   1 
ATOM   2682  C  CB  . PHE A  1  346 ? 51.022  292.971 200.817 1.00 28.05  ? 346  PHE A CB  1 
ATOM   2683  C  CG  . PHE A  1  346 ? 50.469  292.397 199.503 1.00 33.97  ? 346  PHE A CG  1 
ATOM   2684  C  CD1 . PHE A  1  346 ? 51.100  291.314 198.911 1.00 30.91  ? 346  PHE A CD1 1 
ATOM   2685  C  CD2 . PHE A  1  346 ? 49.380  292.978 198.876 1.00 33.74  ? 346  PHE A CD2 1 
ATOM   2686  C  CE1 . PHE A  1  346 ? 50.617  290.777 197.650 1.00 34.04  ? 346  PHE A CE1 1 
ATOM   2687  C  CE2 . PHE A  1  346 ? 48.865  292.442 197.669 1.00 38.22  ? 346  PHE A CE2 1 
ATOM   2688  C  CZ  . PHE A  1  346 ? 49.509  291.359 197.056 1.00 34.32  ? 346  PHE A CZ  1 
ATOM   2689  N  N   . LEU A  1  347 ? 51.942  295.701 199.570 1.00 25.93  ? 347  LEU A N   1 
ATOM   2690  C  CA  . LEU A  1  347 ? 51.837  296.568 198.394 1.00 27.41  ? 347  LEU A CA  1 
ATOM   2691  C  C   . LEU A  1  347 ? 53.190  297.158 198.019 1.00 30.17  ? 347  LEU A C   1 
ATOM   2692  O  O   . LEU A  1  347 ? 53.456  297.405 196.818 1.00 26.17  ? 347  LEU A O   1 
ATOM   2693  C  CB  . LEU A  1  347 ? 50.826  297.690 198.671 1.00 26.18  ? 347  LEU A CB  1 
ATOM   2694  C  CG  . LEU A  1  347 ? 49.452  297.147 199.059 1.00 34.00  ? 347  LEU A CG  1 
ATOM   2695  C  CD1 . LEU A  1  347 ? 48.559  298.236 199.650 1.00 33.27  ? 347  LEU A CD1 1 
ATOM   2696  C  CD2 . LEU A  1  347 ? 48.758  296.529 197.820 1.00 32.48  ? 347  LEU A CD2 1 
ATOM   2697  N  N   . PHE A  1  348 ? 54.054  297.416 199.002 1.00 25.89  ? 348  PHE A N   1 
ATOM   2698  C  CA  . PHE A  1  348 ? 55.402  297.858 198.671 1.00 25.04  ? 348  PHE A CA  1 
ATOM   2699  C  C   . PHE A  1  348 ? 56.121  296.771 197.902 1.00 26.29  ? 348  PHE A C   1 
ATOM   2700  O  O   . PHE A  1  348 ? 56.896  297.049 196.992 1.00 29.82  ? 348  PHE A O   1 
ATOM   2701  C  CB  . PHE A  1  348 ? 56.236  298.217 199.965 1.00 23.02  ? 348  PHE A CB  1 
ATOM   2702  C  CG  . PHE A  1  348 ? 57.700  298.466 199.660 1.00 21.35  ? 348  PHE A CG  1 
ATOM   2703  C  CD1 . PHE A  1  348 ? 58.119  299.688 199.165 1.00 24.42  ? 348  PHE A CD1 1 
ATOM   2704  C  CD2 . PHE A  1  348 ? 58.638  297.386 199.759 1.00 23.35  ? 348  PHE A CD2 1 
ATOM   2705  C  CE1 . PHE A  1  348 ? 59.508  299.892 198.807 1.00 26.14  ? 348  PHE A CE1 1 
ATOM   2706  C  CE2 . PHE A  1  348 ? 60.019  297.557 199.408 1.00 27.68  ? 348  PHE A CE2 1 
ATOM   2707  C  CZ  . PHE A  1  348 ? 60.441  298.828 198.918 1.00 26.93  ? 348  PHE A CZ  1 
ATOM   2708  N  N   . THR A  1  349 ? 55.922  295.518 198.307 1.00 22.48  ? 349  THR A N   1 
ATOM   2709  C  CA  . THR A  1  349 ? 56.578  294.419 197.602 1.00 26.77  ? 349  THR A CA  1 
ATOM   2710  C  C   . THR A  1  349 ? 56.106  294.363 196.146 1.00 32.02  ? 349  THR A C   1 
ATOM   2711  O  O   . THR A  1  349 ? 56.919  294.227 195.221 1.00 26.69  ? 349  THR A O   1 
ATOM   2712  C  CB  . THR A  1  349 ? 56.266  293.096 198.277 1.00 27.47  ? 349  THR A CB  1 
ATOM   2713  O  OG1 . THR A  1  349 ? 56.890  293.052 199.546 1.00 29.16  ? 349  THR A OG1 1 
ATOM   2714  C  CG2 . THR A  1  349 ? 56.790  291.897 197.432 1.00 26.29  ? 349  THR A CG2 1 
ATOM   2715  N  N   . VAL A  1  350 ? 54.809  294.521 195.926 1.00 24.30  ? 350  VAL A N   1 
ATOM   2716  C  CA  . VAL A  1  350 ? 54.276  294.558 194.543 1.00 23.57  ? 350  VAL A CA  1 
ATOM   2717  C  C   . VAL A  1  350 ? 54.937  295.666 193.742 1.00 27.99  ? 350  VAL A C   1 
ATOM   2718  O  O   . VAL A  1  350 ? 55.398  295.453 192.595 1.00 26.47  ? 350  VAL A O   1 
ATOM   2719  C  CB  . VAL A  1  350 ? 52.739  294.723 194.566 1.00 27.67  ? 350  VAL A CB  1 
ATOM   2720  C  CG1 . VAL A  1  350 ? 52.177  294.986 193.076 1.00 25.70  ? 350  VAL A CG1 1 
ATOM   2721  C  CG2 . VAL A  1  350 ? 52.138  293.439 195.127 1.00 29.03  ? 350  VAL A CG2 1 
ATOM   2722  N  N   . GLY A  1  351 ? 54.972  296.867 194.309 1.00 27.18  ? 351  GLY A N   1 
ATOM   2723  C  CA  . GLY A  1  351 ? 55.594  297.977 193.605 1.00 26.47  ? 351  GLY A CA  1 
ATOM   2724  C  C   . GLY A  1  351 ? 57.080  297.765 193.397 1.00 29.09  ? 351  GLY A C   1 
ATOM   2725  O  O   . GLY A  1  351 ? 57.625  298.129 192.360 1.00 24.30  ? 351  GLY A O   1 
ATOM   2726  N  N   . GLY A  1  352 ? 57.788  297.241 194.401 1.00 25.51  ? 352  GLY A N   1 
ATOM   2727  C  CA  . GLY A  1  352 ? 59.227  296.988 194.207 1.00 22.41  ? 352  GLY A CA  1 
ATOM   2728  C  C   . GLY A  1  352 ? 59.459  295.984 193.074 1.00 28.68  ? 352  GLY A C   1 
ATOM   2729  O  O   . GLY A  1  352 ? 60.401  296.122 192.258 1.00 25.04  ? 352  GLY A O   1 
ATOM   2730  N  N   . LEU A  1  353 ? 58.621  294.961 192.989 1.00 25.57  ? 353  LEU A N   1 
ATOM   2731  C  CA  . LEU A  1  353 ? 58.780  293.972 191.927 1.00 27.69  ? 353  LEU A CA  1 
ATOM   2732  C  C   . LEU A  1  353 ? 58.515  294.557 190.523 1.00 32.03  ? 353  LEU A C   1 
ATOM   2733  O  O   . LEU A  1  353 ? 59.204  294.188 189.560 1.00 26.83  ? 353  LEU A O   1 
ATOM   2734  C  CB  . LEU A  1  353 ? 57.864  292.793 192.200 1.00 25.66  ? 353  LEU A CB  1 
ATOM   2735  C  CG  . LEU A  1  353 ? 58.321  291.873 193.377 1.00 31.66  ? 353  LEU A CG  1 
ATOM   2736  C  CD1 . LEU A  1  353 ? 57.191  290.921 193.732 1.00 25.52  ? 353  LEU A CD1 1 
ATOM   2737  C  CD2 . LEU A  1  353 ? 59.577  291.048 192.980 1.00 29.37  ? 353  LEU A CD2 1 
ATOM   2738  N  N   . THR A  1  354 ? 57.533  295.452 190.374 1.00 26.23  ? 354  THR A N   1 
ATOM   2739  C  CA  . THR A  1  354 ? 57.386  296.068 189.041 1.00 24.42  ? 354  THR A CA  1 
ATOM   2740  C  C   . THR A  1  354 ? 58.536  297.038 188.772 1.00 27.60  ? 354  THR A C   1 
ATOM   2741  O  O   . THR A  1  354 ? 58.859  297.284 187.607 1.00 26.49  ? 354  THR A O   1 
ATOM   2742  C  CB  . THR A  1  354 ? 56.026  296.772 188.872 1.00 25.61  ? 354  THR A CB  1 
ATOM   2743  O  OG1 . THR A  1  354 ? 55.865  297.767 189.908 1.00 26.46  ? 354  THR A OG1 1 
ATOM   2744  C  CG2 . THR A  1  354 ? 54.826  295.750 188.980 1.00 25.27  ? 354  THR A CG2 1 
ATOM   2745  N  N   . GLY A  1  355 ? 59.209  297.549 189.830 1.00 22.20  ? 355  GLY A N   1 
ATOM   2746  C  CA  . GLY A  1  355 ? 60.478  298.278 189.633 1.00 23.48  ? 355  GLY A CA  1 
ATOM   2747  C  C   . GLY A  1  355 ? 61.547  297.403 189.012 1.00 25.50  ? 355  GLY A C   1 
ATOM   2748  O  O   . GLY A  1  355 ? 62.290  297.829 188.116 1.00 27.90  ? 355  GLY A O   1 
ATOM   2749  N  N   . ILE A  1  356 ? 61.590  296.143 189.424 1.00 25.75  ? 356  ILE A N   1 
ATOM   2750  C  CA  . ILE A  1  356 ? 62.585  295.215 188.899 1.00 29.76  ? 356  ILE A CA  1 
ATOM   2751  C  C   . ILE A  1  356 ? 62.249  294.880 187.449 1.00 32.39  ? 356  ILE A C   1 
ATOM   2752  O  O   . ILE A  1  356 ? 63.142  294.665 186.620 1.00 28.31  ? 356  ILE A O   1 
ATOM   2753  C  CB  . ILE A  1  356 ? 62.623  293.960 189.799 1.00 30.44  ? 356  ILE A CB  1 
ATOM   2754  C  CG1 . ILE A  1  356 ? 63.248  294.350 191.152 1.00 29.45  ? 356  ILE A CG1 1 
ATOM   2755  C  CG2 . ILE A  1  356 ? 63.370  292.792 189.073 1.00 26.43  ? 356  ILE A CG2 1 
ATOM   2756  C  CD1 . ILE A  1  356 ? 64.875  294.636 191.068 1.00 26.85  ? 356  ILE A CD1 1 
ATOM   2757  N  N   . VAL A  1  357 ? 60.963  294.810 187.122 1.00 22.66  ? 357  VAL A N   1 
ATOM   2758  C  CA  . VAL A  1  357 ? 60.613  294.706 185.695 1.00 23.27  ? 357  VAL A CA  1 
ATOM   2759  C  C   . VAL A  1  357 ? 61.222  295.870 184.905 1.00 25.31  ? 357  VAL A C   1 
ATOM   2760  O  O   . VAL A  1  357 ? 61.844  295.665 183.852 1.00 27.60  ? 357  VAL A O   1 
ATOM   2761  C  CB  . VAL A  1  357 ? 59.097  294.658 185.527 1.00 27.17  ? 357  VAL A CB  1 
ATOM   2762  C  CG1 . VAL A  1  357 ? 58.701  294.672 184.005 1.00 24.30  ? 357  VAL A CG1 1 
ATOM   2763  C  CG2 . VAL A  1  357 ? 58.561  293.427 186.179 1.00 28.10  ? 357  VAL A CG2 1 
ATOM   2764  N  N   . LEU A  1  358 ? 61.000  297.094 185.363 1.00 22.63  ? 358  LEU A N   1 
ATOM   2765  C  CA  . LEU A  1  358 ? 61.484  298.303 184.684 1.00 25.84  ? 358  LEU A CA  1 
ATOM   2766  C  C   . LEU A  1  358 ? 62.999  298.435 184.629 1.00 30.78  ? 358  LEU A C   1 
ATOM   2767  O  O   . LEU A  1  358 ? 63.534  299.124 183.735 1.00 26.51  ? 358  LEU A O   1 
ATOM   2768  C  CB  . LEU A  1  358 ? 60.889  299.515 185.411 1.00 26.89  ? 358  LEU A CB  1 
ATOM   2769  C  CG  . LEU A  1  358 ? 59.373  299.673 185.189 1.00 22.93  ? 358  LEU A CG  1 
ATOM   2770  C  CD1 . LEU A  1  358 ? 58.796  300.660 186.208 1.00 24.20  ? 358  LEU A CD1 1 
ATOM   2771  C  CD2 . LEU A  1  358 ? 59.056  300.106 183.653 1.00 23.00  ? 358  LEU A CD2 1 
ATOM   2772  N  N   . ALA A  1  359 ? 63.696  297.801 185.561 1.00 24.51  ? 359  ALA A N   1 
ATOM   2773  C  CA  . ALA A  1  359 ? 65.152  297.868 185.601 1.00 23.41  ? 359  ALA A CA  1 
ATOM   2774  C  C   . ALA A  1  359 ? 65.717  297.227 184.352 1.00 24.99  ? 359  ALA A C   1 
ATOM   2775  O  O   . ALA A  1  359 ? 66.832  297.530 183.968 1.00 27.41  ? 359  ALA A O   1 
ATOM   2776  C  CB  . ALA A  1  359 ? 65.692  297.091 186.854 1.00 23.76  ? 359  ALA A CB  1 
ATOM   2777  N  N   . ASN A  1  360 ? 64.969  296.308 183.725 1.00 24.85  ? 360  ASN A N   1 
ATOM   2778  C  CA  . ASN A  1  360 ? 65.475  295.656 182.513 1.00 32.06  ? 360  ASN A CA  1 
ATOM   2779  C  C   . ASN A  1  360 ? 65.330  296.600 181.322 1.00 27.54  ? 360  ASN A C   1 
ATOM   2780  O  O   . ASN A  1  360 ? 64.221  296.839 180.842 1.00 28.64  ? 360  ASN A O   1 
ATOM   2781  C  CB  . ASN A  1  360 ? 64.728  294.355 182.284 1.00 30.97  ? 360  ASN A CB  1 
ATOM   2782  C  CG  . ASN A  1  360 ? 65.054  293.380 183.364 1.00 37.26  ? 360  ASN A CG  1 
ATOM   2783  O  OD1 . ASN A  1  360 ? 66.100  292.698 183.306 1.00 32.13  ? 360  ASN A OD1 1 
ATOM   2784  N  ND2 . ASN A  1  360 ? 64.238  293.364 184.416 1.00 40.97  ? 360  ASN A ND2 1 
ATOM   2785  N  N   . SER A  1  361 ? 66.454  297.171 180.873 1.00 27.90  ? 361  SER A N   1 
ATOM   2786  C  CA  . SER A  1  361 ? 66.352  298.271 179.918 1.00 29.04  ? 361  SER A CA  1 
ATOM   2787  C  C   . SER A  1  361 ? 65.710  297.806 178.605 1.00 33.84  ? 361  SER A C   1 
ATOM   2788  O  O   . SER A  1  361 ? 64.956  298.578 177.988 1.00 31.03  ? 361  SER A O   1 
ATOM   2789  C  CB  . SER A  1  361 ? 67.714  298.911 179.624 1.00 36.13  ? 361  SER A CB  1 
ATOM   2790  O  OG  . SER A  1  361 ? 68.411  298.098 178.732 1.00 44.90  ? 361  SER A OG  1 
ATOM   2791  N  N   . SER A  1  362 ? 65.860  296.533 178.249 1.00 29.99  ? 362  SER A N   1 
ATOM   2792  C  CA  . SER A  1  362 ? 65.189  296.036 177.033 1.00 35.77  ? 362  SER A CA  1 
ATOM   2793  C  C   . SER A  1  362 ? 63.672  296.151 177.154 1.00 38.91  ? 362  SER A C   1 
ATOM   2794  O  O   . SER A  1  362 ? 63.004  296.669 176.237 1.00 33.64  ? 362  SER A O   1 
ATOM   2795  C  CB  . SER A  1  362 ? 65.574  294.584 176.735 1.00 34.71  ? 362  SER A CB  1 
ATOM   2796  O  OG  . SER A  1  362 ? 66.864  294.540 176.248 1.00 46.08  ? 362  SER A OG  1 
ATOM   2797  N  N   . LEU A  1  363 ? 63.093  295.699 178.280 1.00 28.93  ? 363  LEU A N   1 
ATOM   2798  C  CA  . LEU A  1  363 ? 61.654  295.889 178.459 1.00 26.64  ? 363  LEU A CA  1 
ATOM   2799  C  C   . LEU A  1  363 ? 61.303  297.348 178.701 1.00 31.82  ? 363  LEU A C   1 
ATOM   2800  O  O   . LEU A  1  363 ? 60.215  297.807 178.332 1.00 30.49  ? 363  LEU A O   1 
ATOM   2801  C  CB  . LEU A  1  363 ? 61.137  295.061 179.643 1.00 29.05  ? 363  LEU A CB  1 
ATOM   2802  C  CG  . LEU A  1  363 ? 60.689  293.665 179.437 1.00 48.08  ? 363  LEU A CG  1 
ATOM   2803  C  CD1 . LEU A  1  363 ? 60.158  293.251 180.741 1.00 35.59  ? 363  LEU A CD1 1 
ATOM   2804  C  CD2 . LEU A  1  363 ? 59.611  293.631 178.373 1.00 44.67  ? 363  LEU A CD2 1 
ATOM   2805  N  N   . ASP A  1  364 ? 62.171  298.072 179.395 1.00 28.39  ? 364  ASP A N   1 
ATOM   2806  C  CA  . ASP A  1  364 ? 61.861  299.464 179.673 1.00 24.26  ? 364  ASP A CA  1 
ATOM   2807  C  C   . ASP A  1  364 ? 61.725  300.294 178.389 1.00 27.68  ? 364  ASP A C   1 
ATOM   2808  O  O   . ASP A  1  364 ? 61.112  301.371 178.422 1.00 26.64  ? 364  ASP A O   1 
ATOM   2809  C  CB  . ASP A  1  364 ? 62.955  300.131 180.551 1.00 22.19  ? 364  ASP A CB  1 
ATOM   2810  C  CG  . ASP A  1  364 ? 62.529  301.490 180.993 1.00 30.57  ? 364  ASP A CG  1 
ATOM   2811  O  OD1 . ASP A  1  364 ? 61.554  301.592 181.771 1.00 25.73  ? 364  ASP A OD1 1 
ATOM   2812  O  OD2 . ASP A  1  364 ? 63.134  302.455 180.572 1.00 26.40  ? 364  ASP A OD2 1 
ATOM   2813  N  N   . ILE A  1  365 ? 62.333  299.879 177.272 1.00 26.99  ? 365  ILE A N   1 
ATOM   2814  C  CA  . ILE A  1  365 ? 62.085  300.640 176.038 1.00 25.81  ? 365  ILE A CA  1 
ATOM   2815  C  C   . ILE A  1  365 ? 60.591  300.749 175.806 1.00 26.13  ? 365  ILE A C   1 
ATOM   2816  O  O   . ILE A  1  365 ? 60.063  301.803 175.485 1.00 28.65  ? 365  ILE A O   1 
ATOM   2817  C  CB  . ILE A  1  365 ? 62.792  299.993 174.830 1.00 25.92  ? 365  ILE A CB  1 
ATOM   2818  C  CG1 . ILE A  1  365 ? 64.321  299.935 175.055 1.00 30.65  ? 365  ILE A CG1 1 
ATOM   2819  C  CG2 . ILE A  1  365 ? 62.384  300.747 173.461 1.00 32.08  ? 365  ILE A CG2 1 
ATOM   2820  C  CD1 . ILE A  1  365 ? 64.942  301.240 175.204 1.00 33.54  ? 365  ILE A CD1 1 
ATOM   2821  N  N   . VAL A  1  366 ? 59.881  299.638 175.978 1.00 21.42  ? 366  VAL A N   1 
ATOM   2822  C  CA  . VAL A  1  366 ? 58.448  299.681 175.681 1.00 22.20  ? 366  VAL A CA  1 
ATOM   2823  C  C   . VAL A  1  366 ? 57.638  300.211 176.873 1.00 31.17  ? 366  VAL A C   1 
ATOM   2824  O  O   . VAL A  1  366 ? 56.547  300.753 176.679 1.00 27.84  ? 366  VAL A O   1 
ATOM   2825  C  CB  . VAL A  1  366 ? 57.970  298.275 175.266 1.00 31.80  ? 366  VAL A CB  1 
ATOM   2826  C  CG1 . VAL A  1  366 ? 56.533  298.320 174.834 1.00 39.21  ? 366  VAL A CG1 1 
ATOM   2827  C  CG2 . VAL A  1  366 ? 58.815  297.850 173.982 1.00 34.71  ? 366  VAL A CG2 1 
ATOM   2828  N  N   . LEU A  1  367 ? 58.167  300.134 178.095 1.00 24.47  ? 367  LEU A N   1 
ATOM   2829  C  CA  . LEU A  1  367 ? 57.371  300.571 179.274 1.00 23.79  ? 367  LEU A CA  1 
ATOM   2830  C  C   . LEU A  1  367 ? 57.640  302.005 179.677 1.00 27.63  ? 367  LEU A C   1 
ATOM   2831  O  O   . LEU A  1  367 ? 56.821  302.611 180.389 1.00 24.56  ? 367  LEU A O   1 
ATOM   2832  C  CB  . LEU A  1  367 ? 57.613  299.643 180.476 1.00 24.53  ? 367  LEU A CB  1 
ATOM   2833  C  CG  . LEU A  1  367 ? 57.127  298.201 180.148 1.00 29.31  ? 367  LEU A CG  1 
ATOM   2834  C  CD1 . LEU A  1  367 ? 57.505  297.204 181.275 1.00 30.57  ? 367  LEU A CD1 1 
ATOM   2835  C  CD2 . LEU A  1  367 ? 55.595  298.093 179.838 1.00 28.27  ? 367  LEU A CD2 1 
ATOM   2836  N  N   . HIS A  1  368 ? 58.782  302.541 179.269 1.00 23.33  ? 368  HIS A N   1 
ATOM   2837  C  CA  . HIS A  1  368 ? 59.171  303.879 179.676 1.00 25.09  ? 368  HIS A CA  1 
ATOM   2838  C  C   . HIS A  1  368 ? 58.139  304.871 179.194 1.00 26.93  ? 368  HIS A C   1 
ATOM   2839  O  O   . HIS A  1  368 ? 57.669  304.766 178.045 1.00 25.53  ? 368  HIS A O   1 
ATOM   2840  C  CB  . HIS A  1  368 ? 60.550  304.269 179.108 1.00 24.37  ? 368  HIS A CB  1 
ATOM   2841  C  CG  . HIS A  1  368 ? 60.913  305.699 179.389 1.00 20.33  ? 368  HIS A CG  1 
ATOM   2842  N  ND1 . HIS A  1  368 ? 61.237  306.142 180.672 1.00 20.69  ? 368  HIS A ND1 1 
ATOM   2843  C  CD2 . HIS A  1  368 ? 60.888  306.783 178.591 1.00 27.93  ? 368  HIS A CD2 1 
ATOM   2844  C  CE1 . HIS A  1  368 ? 61.473  307.456 180.597 1.00 25.13  ? 368  HIS A CE1 1 
ATOM   2845  N  NE2 . HIS A  1  368 ? 61.229  307.867 179.360 1.00 21.98  ? 368  HIS A NE2 1 
ATOM   2846  N  N   . ASP A  1  369 ? 57.855  305.879 180.047 1.00 23.62  ? 369  ASP A N   1 
ATOM   2847  C  CA  . ASP A  1  369 ? 56.925  306.963 179.702 1.00 31.19  ? 369  ASP A CA  1 
ATOM   2848  C  C   . ASP A  1  369 ? 55.532  306.395 179.370 1.00 26.09  ? 369  ASP A C   1 
ATOM   2849  O  O   . ASP A  1  369 ? 54.773  306.956 178.568 1.00 26.30  ? 369  ASP A O   1 
ATOM   2850  C  CB  . ASP A  1  369 ? 57.511  307.854 178.568 1.00 23.95  ? 369  ASP A CB  1 
ATOM   2851  C  CG  . ASP A  1  369 ? 57.783  309.284 179.031 1.00 27.24  ? 369  ASP A CG  1 
ATOM   2852  O  OD1 . ASP A  1  369 ? 58.961  309.712 179.133 1.00 26.21  ? 369  ASP A OD1 1 
ATOM   2853  O  OD2 . ASP A  1  369 ? 56.811  310.041 179.274 1.00 27.41  ? 369  ASP A OD2 1 
ATOM   2854  N  N   . THR A  1  370 ? 55.156  305.292 180.022 1.00 25.06  ? 370  THR A N   1 
ATOM   2855  C  CA  . THR A  1  370 ? 53.814  304.747 179.940 1.00 24.19  ? 370  THR A CA  1 
ATOM   2856  C  C   . THR A  1  370 ? 53.222  304.644 181.341 1.00 27.33  ? 370  THR A C   1 
ATOM   2857  O  O   . THR A  1  370 ? 53.932  304.747 182.353 1.00 24.69  ? 370  THR A O   1 
ATOM   2858  C  CB  . THR A  1  370 ? 53.737  303.337 179.344 1.00 27.05  ? 370  THR A CB  1 
ATOM   2859  O  OG1 . THR A  1  370 ? 54.185  302.357 180.296 1.00 24.48  ? 370  THR A OG1 1 
ATOM   2860  C  CG2 . THR A  1  370 ? 54.488  303.155 177.948 1.00 22.44  ? 370  THR A CG2 1 
ATOM   2861  N  N   . TYR A  1  371 ? 51.932  304.378 181.392 1.00 23.99  ? 371  TYR A N   1 
ATOM   2862  C  CA  . TYR A  1  371 ? 51.295  304.185 182.710 1.00 23.78  ? 371  TYR A CA  1 
ATOM   2863  C  C   . TYR A  1  371 ? 51.846  302.996 183.492 1.00 32.45  ? 371  TYR A C   1 
ATOM   2864  O  O   . TYR A  1  371 ? 51.445  302.821 184.647 1.00 27.94  ? 371  TYR A O   1 
ATOM   2865  C  CB  . TYR A  1  371 ? 49.765  304.044 182.539 1.00 22.87  ? 371  TYR A CB  1 
ATOM   2866  C  CG  . TYR A  1  371 ? 49.161  305.356 182.844 1.00 25.16  ? 371  TYR A CG  1 
ATOM   2867  C  CD1 . TYR A  1  371 ? 49.128  306.357 181.851 1.00 27.77  ? 371  TYR A CD1 1 
ATOM   2868  C  CD2 . TYR A  1  371 ? 48.746  305.705 184.185 1.00 23.33  ? 371  TYR A CD2 1 
ATOM   2869  C  CE1 . TYR A  1  371 ? 48.663  307.666 182.152 1.00 26.98  ? 371  TYR A CE1 1 
ATOM   2870  C  CE2 . TYR A  1  371 ? 48.251  306.995 184.475 1.00 24.89  ? 371  TYR A CE2 1 
ATOM   2871  C  CZ  . TYR A  1  371 ? 48.191  307.952 183.464 1.00 27.87  ? 371  TYR A CZ  1 
ATOM   2872  O  OH  . TYR A  1  371 ? 47.693  309.225 183.710 1.00 22.19  ? 371  TYR A OH  1 
ATOM   2873  N  N   . TYR A  1  372 ? 52.704  302.149 182.913 1.00 26.49  ? 372  TYR A N   1 
ATOM   2874  C  CA  . TYR A  1  372 ? 53.290  301.072 183.711 1.00 29.10  ? 372  TYR A CA  1 
ATOM   2875  C  C   . TYR A  1  372 ? 54.217  301.657 184.764 1.00 31.01  ? 372  TYR A C   1 
ATOM   2876  O  O   . TYR A  1  372 ? 54.242  301.162 185.888 1.00 24.54  ? 372  TYR A O   1 
ATOM   2877  C  CB  . TYR A  1  372 ? 54.041  300.034 182.869 1.00 23.87  ? 372  TYR A CB  1 
ATOM   2878  C  CG  . TYR A  1  372 ? 54.394  298.735 183.619 1.00 26.12  ? 372  TYR A CG  1 
ATOM   2879  C  CD1 . TYR A  1  372 ? 55.608  298.628 184.391 1.00 23.44  ? 372  TYR A CD1 1 
ATOM   2880  C  CD2 . TYR A  1  372 ? 53.584  297.635 183.539 1.00 24.71  ? 372  TYR A CD2 1 
ATOM   2881  C  CE1 . TYR A  1  372 ? 55.921  297.389 185.047 1.00 20.79  ? 372  TYR A CE1 1 
ATOM   2882  C  CE2 . TYR A  1  372 ? 53.901  296.443 184.154 1.00 28.95  ? 372  TYR A CE2 1 
ATOM   2883  C  CZ  . TYR A  1  372 ? 55.079  296.326 184.913 1.00 29.26  ? 372  TYR A CZ  1 
ATOM   2884  O  OH  . TYR A  1  372 ? 55.416  295.123 185.488 1.00 27.72  ? 372  TYR A OH  1 
ATOM   2885  N  N   . VAL A  1  373 ? 54.905  302.759 184.427 1.00 25.23  ? 373  VAL A N   1 
ATOM   2886  C  CA  . VAL A  1  373 ? 55.760  303.446 185.375 1.00 27.38  ? 373  VAL A CA  1 
ATOM   2887  C  C   . VAL A  1  373 ? 54.902  304.103 186.445 1.00 28.70  ? 373  VAL A C   1 
ATOM   2888  O  O   . VAL A  1  373 ? 55.207  304.021 187.630 1.00 25.02  ? 373  VAL A O   1 
ATOM   2889  C  CB  . VAL A  1  373 ? 56.654  304.488 184.631 1.00 20.23  ? 373  VAL A CB  1 
ATOM   2890  C  CG1 . VAL A  1  373 ? 57.613  305.241 185.670 1.00 20.55  ? 373  VAL A CG1 1 
ATOM   2891  C  CG2 . VAL A  1  373 ? 57.532  303.680 183.564 1.00 21.70  ? 373  VAL A CG2 1 
ATOM   2892  N  N   . VAL A  1  374 ? 53.804  304.742 186.040 1.00 23.48  ? 374  VAL A N   1 
ATOM   2893  C  CA  . VAL A  1  374 ? 52.903  305.420 186.981 1.00 21.90  ? 374  VAL A CA  1 
ATOM   2894  C  C   . VAL A  1  374 ? 52.362  304.410 187.962 1.00 27.49  ? 374  VAL A C   1 
ATOM   2895  O  O   . VAL A  1  374 ? 52.285  304.687 189.152 1.00 25.86  ? 374  VAL A O   1 
ATOM   2896  C  CB  . VAL A  1  374 ? 51.775  306.164 186.226 1.00 25.27  ? 374  VAL A CB  1 
ATOM   2897  C  CG1 . VAL A  1  374 ? 50.790  306.836 187.198 1.00 24.76  ? 374  VAL A CG1 1 
ATOM   2898  C  CG2 . VAL A  1  374 ? 52.436  307.180 185.254 1.00 26.78  ? 374  VAL A CG2 1 
ATOM   2899  N  N   . ALA A  1  375 ? 51.925  303.244 187.457 1.00 23.36  ? 375  ALA A N   1 
ATOM   2900  C  CA  . ALA A  1  375 ? 51.417  302.201 188.341 1.00 30.46  ? 375  ALA A CA  1 
ATOM   2901  C  C   . ALA A  1  375 ? 52.504  301.768 189.328 1.00 27.62  ? 375  ALA A C   1 
ATOM   2902  O  O   . ALA A  1  375 ? 52.260  301.701 190.545 1.00 24.49  ? 375  ALA A O   1 
ATOM   2903  C  CB  . ALA A  1  375 ? 50.936  300.999 187.523 1.00 22.51  ? 375  ALA A CB  1 
ATOM   2904  N  N   . HIS A  1  376 ? 53.687  301.418 188.803 1.00 24.16  ? 376  HIS A N   1 
ATOM   2905  C  CA  . HIS A  1  376 ? 54.820  301.085 189.667 1.00 26.26  ? 376  HIS A CA  1 
ATOM   2906  C  C   . HIS A  1  376 ? 54.984  302.093 190.788 1.00 28.31  ? 376  HIS A C   1 
ATOM   2907  O  O   . HIS A  1  376 ? 55.099  301.734 191.960 1.00 26.35  ? 376  HIS A O   1 
ATOM   2908  C  CB  . HIS A  1  376 ? 56.142  301.028 188.868 1.00 21.58  ? 376  HIS A CB  1 
ATOM   2909  C  CG  . HIS A  1  376 ? 57.377  301.232 189.706 1.00 25.74  ? 376  HIS A CG  1 
ATOM   2910  N  ND1 . HIS A  1  376 ? 57.798  300.309 190.644 1.00 27.20  ? 376  HIS A ND1 1 
ATOM   2911  C  CD2 . HIS A  1  376 ? 58.279  302.248 189.768 1.00 23.07  ? 376  HIS A CD2 1 
ATOM   2912  C  CE1 . HIS A  1  376 ? 58.887  300.762 191.266 1.00 27.55  ? 376  HIS A CE1 1 
ATOM   2913  N  NE2 . HIS A  1  376 ? 59.225  301.931 190.740 1.00 24.75  ? 376  HIS A NE2 1 
ATOM   2914  N  N   . PHE A  1  377 ? 55.119  303.378 190.428 1.00 20.89  ? 377  PHE A N   1 
ATOM   2915  C  CA  . PHE A  1  377 ? 55.554  304.196 191.552 1.00 22.60  ? 377  PHE A CA  1 
ATOM   2916  C  C   . PHE A  1  377 ? 54.395  304.640 192.462 1.00 23.62  ? 377  PHE A C   1 
ATOM   2917  O  O   . PHE A  1  377 ? 54.648  305.028 193.601 1.00 23.85  ? 377  PHE A O   1 
ATOM   2918  C  CB  . PHE A  1  377 ? 56.397  305.414 191.137 1.00 24.04  ? 377  PHE A CB  1 
ATOM   2919  C  CG  . PHE A  1  377 ? 55.716  306.467 190.259 1.00 29.53  ? 377  PHE A CG  1 
ATOM   2920  C  CD1 . PHE A  1  377 ? 54.846  307.436 190.816 1.00 25.33  ? 377  PHE A CD1 1 
ATOM   2921  C  CD2 . PHE A  1  377 ? 56.083  306.597 188.876 1.00 20.47  ? 377  PHE A CD2 1 
ATOM   2922  C  CE1 . PHE A  1  377 ? 54.253  308.445 190.051 1.00 25.19  ? 377  PHE A CE1 1 
ATOM   2923  C  CE2 . PHE A  1  377 ? 55.485  307.640 188.089 1.00 23.16  ? 377  PHE A CE2 1 
ATOM   2924  C  CZ  . PHE A  1  377 ? 54.556  308.540 188.616 1.00 24.12  ? 377  PHE A CZ  1 
ATOM   2925  N  N   . HIS A  1  378 ? 53.140  304.573 192.014 1.00 23.37  ? 378  HIS A N   1 
ATOM   2926  C  CA  . HIS A  1  378 ? 52.083  304.772 193.013 1.00 22.44  ? 378  HIS A CA  1 
ATOM   2927  C  C   . HIS A  1  378 ? 51.898  303.555 193.931 1.00 27.84  ? 378  HIS A C   1 
ATOM   2928  O  O   . HIS A  1  378 ? 51.402  303.705 195.064 1.00 25.13  ? 378  HIS A O   1 
ATOM   2929  C  CB  . HIS A  1  378 ? 50.773  305.167 192.330 1.00 21.86  ? 378  HIS A CB  1 
ATOM   2930  C  CG  . HIS A  1  378 ? 50.790  306.601 191.870 1.00 20.20  ? 378  HIS A CG  1 
ATOM   2931  N  ND1 . HIS A  1  378 ? 51.132  306.981 190.578 1.00 23.84  ? 378  HIS A ND1 1 
ATOM   2932  C  CD2 . HIS A  1  378 ? 50.450  307.729 192.532 1.00 25.52  ? 378  HIS A CD2 1 
ATOM   2933  C  CE1 . HIS A  1  378 ? 51.037  308.314 190.486 1.00 23.91  ? 378  HIS A CE1 1 
ATOM   2934  N  NE2 . HIS A  1  378 ? 50.613  308.787 191.666 1.00 20.17  ? 378  HIS A NE2 1 
ATOM   2935  N  N   . TYR A  1  379 ? 52.347  302.369 193.520 1.00 23.61  ? 379  TYR A N   1 
ATOM   2936  C  CA  . TYR A  1  379 ? 52.363  301.290 194.542 1.00 25.15  ? 379  TYR A CA  1 
ATOM   2937  C  C   . TYR A  1  379 ? 53.455  301.545 195.578 1.00 28.27  ? 379  TYR A C   1 
ATOM   2938  O  O   . TYR A  1  379 ? 53.193  301.529 196.777 1.00 28.26  ? 379  TYR A O   1 
ATOM   2939  C  CB  . TYR A  1  379 ? 52.580  299.892 193.905 1.00 26.04  ? 379  TYR A CB  1 
ATOM   2940  C  CG  . TYR A  1  379 ? 51.236  299.238 193.586 1.00 22.94  ? 379  TYR A CG  1 
ATOM   2941  C  CD1 . TYR A  1  379 ? 50.495  299.630 192.447 1.00 24.90  ? 379  TYR A CD1 1 
ATOM   2942  C  CD2 . TYR A  1  379 ? 50.681  298.314 194.458 1.00 26.24  ? 379  TYR A CD2 1 
ATOM   2943  C  CE1 . TYR A  1  379 ? 49.248  299.088 192.178 1.00 22.89  ? 379  TYR A CE1 1 
ATOM   2944  C  CE2 . TYR A  1  379 ? 49.403  297.776 194.254 1.00 28.41  ? 379  TYR A CE2 1 
ATOM   2945  C  CZ  . TYR A  1  379 ? 48.687  298.176 193.089 1.00 32.40  ? 379  TYR A CZ  1 
ATOM   2946  O  OH  . TYR A  1  379 ? 47.427  297.689 192.887 1.00 30.51  ? 379  TYR A OH  1 
ATOM   2947  N  N   A VAL A  1  380 ? 54.638  302.008 195.183 0.65 20.88  ? 380  VAL A N   1 
ATOM   2948  N  N   B VAL A  1  380 ? 54.697  301.650 195.093 0.35 25.78  ? 380  VAL A N   1 
ATOM   2949  C  CA  A VAL A  1  380 ? 55.571  302.262 196.304 0.65 19.69  ? 380  VAL A CA  1 
ATOM   2950  C  CA  B VAL A  1  380 ? 55.899  301.539 195.917 0.35 37.54  ? 380  VAL A CA  1 
ATOM   2951  C  C   A VAL A  1  380 ? 55.316  303.590 197.026 0.65 24.79  ? 380  VAL A C   1 
ATOM   2952  C  C   B VAL A  1  380 ? 56.187  302.854 196.612 0.35 28.96  ? 380  VAL A C   1 
ATOM   2953  O  O   A VAL A  1  380 ? 55.767  303.755 198.177 0.65 20.10  ? 380  VAL A O   1 
ATOM   2954  O  O   B VAL A  1  380 ? 56.775  302.865 197.700 0.35 32.44  ? 380  VAL A O   1 
ATOM   2955  C  CB  A VAL A  1  380 ? 57.028  302.167 195.828 0.65 17.88  ? 380  VAL A CB  1 
ATOM   2956  C  CB  B VAL A  1  380 ? 57.091  301.068 195.049 0.35 34.56  ? 380  VAL A CB  1 
ATOM   2957  C  CG1 A VAL A  1  380 ? 57.352  300.685 195.524 0.65 25.85  ? 380  VAL A CG1 1 
ATOM   2958  C  CG1 B VAL A  1  380 ? 57.616  302.190 194.104 0.35 15.63  ? 380  VAL A CG1 1 
ATOM   2959  C  CG2 A VAL A  1  380 ? 57.243  303.046 194.612 0.65 31.56  ? 380  VAL A CG2 1 
ATOM   2960  C  CG2 B VAL A  1  380 ? 58.224  300.524 195.900 0.35 19.50  ? 380  VAL A CG2 1 
ATOM   2961  N  N   A LEU A  1  381 ? 54.632  304.560 196.406 0.65 22.66  ? 381  LEU A N   1 
ATOM   2962  N  N   B LEU A  1  381 ? 55.787  303.975 196.007 0.35 22.16  ? 381  LEU A N   1 
ATOM   2963  C  CA  A LEU A  1  381 ? 54.432  305.861 197.055 0.65 28.20  ? 381  LEU A CA  1 
ATOM   2964  C  CA  B LEU A  1  381 ? 55.947  305.293 196.598 0.35 28.91  ? 381  LEU A CA  1 
ATOM   2965  C  C   A LEU A  1  381 ? 53.061  306.013 197.713 0.65 29.64  ? 381  LEU A C   1 
ATOM   2966  C  C   B LEU A  1  381 ? 54.658  305.875 197.135 0.35 19.88  ? 381  LEU A C   1 
ATOM   2967  O  O   A LEU A  1  381 ? 52.957  306.383 198.894 0.65 25.98  ? 381  LEU A O   1 
ATOM   2968  O  O   B LEU A  1  381 ? 54.636  306.370 198.247 0.35 31.65  ? 381  LEU A O   1 
ATOM   2969  C  CB  A LEU A  1  381 ? 54.626  306.990 196.031 0.65 19.48  ? 381  LEU A CB  1 
ATOM   2970  C  CB  B LEU A  1  381 ? 56.553  306.278 195.608 0.35 12.07  ? 381  LEU A CB  1 
ATOM   2971  C  CG  A LEU A  1  381 ? 56.068  307.399 195.768 0.65 30.26  ? 381  LEU A CG  1 
ATOM   2972  C  CG  B LEU A  1  381 ? 56.485  307.776 195.943 0.35 23.87  ? 381  LEU A CG  1 
ATOM   2973  C  CD1 A LEU A  1  381 ? 56.142  308.295 194.513 0.65 24.56  ? 381  LEU A CD1 1 
ATOM   2974  C  CD1 B LEU A  1  381 ? 57.170  308.142 197.283 0.35 19.02  ? 381  LEU A CD1 1 
ATOM   2975  C  CD2 A LEU A  1  381 ? 56.674  308.058 197.023 0.65 34.37  ? 381  LEU A CD2 1 
ATOM   2976  C  CD2 B LEU A  1  381 ? 57.061  308.611 194.777 0.35 17.96  ? 381  LEU A CD2 1 
ATOM   2977  N  N   A SER A  1  382 ? 51.989  305.725 196.977 0.65 29.75  ? 382  SER A N   1 
ATOM   2978  N  N   B SER A  1  382 ? 53.582  305.856 196.365 0.35 49.23  ? 382  SER A N   1 
ATOM   2979  C  CA  A SER A  1  382 ? 50.664  305.904 197.537 0.65 19.94  ? 382  SER A CA  1 
ATOM   2980  C  CA  B SER A  1  382 ? 52.381  306.498 196.870 0.35 17.35  ? 382  SER A CA  1 
ATOM   2981  C  C   A SER A  1  382 ? 50.194  304.691 198.330 0.65 20.40  ? 382  SER A C   1 
ATOM   2982  C  C   B SER A  1  382 ? 51.675  305.640 197.905 0.35 26.60  ? 382  SER A C   1 
ATOM   2983  O  O   A SER A  1  382 ? 49.246  304.813 199.107 0.65 36.00  ? 382  SER A O   1 
ATOM   2984  O  O   B SER A  1  382 ? 51.275  306.165 198.929 0.35 30.20  ? 382  SER A O   1 
ATOM   2985  C  CB  A SER A  1  382 ? 49.672  306.301 196.379 0.65 28.55  ? 382  SER A CB  1 
ATOM   2986  C  CB  B SER A  1  382 ? 51.444  306.847 195.727 0.35 27.92  ? 382  SER A CB  1 
ATOM   2987  O  OG  A SER A  1  382 ? 48.476  306.764 196.935 0.34 23.88  ? 382  SER A OG  1 
ATOM   2988  O  OG  B SER A  1  382 ? 52.192  307.563 194.743 0.35 49.51  ? 382  SER A OG  1 
ATOM   2989  O  OG  D SER A  1  382 ? 49.187  304.949 196.399 0.31 31.50  ? 382  SER A OG  1 
ATOM   2990  N  N   A MET A  1  383 ? 50.868  303.542 198.219 0.65 24.01  ? 383  MET A N   1 
ATOM   2991  N  N   B MET A  1  383 ? 51.518  304.337 197.680 0.35 16.18  ? 383  MET A N   1 
ATOM   2992  C  CA  A MET A  1  383 ? 50.618  302.399 199.096 0.65 20.73  ? 383  MET A CA  1 
ATOM   2993  C  CA  B MET A  1  383 ? 50.960  303.494 198.736 0.35 33.51  ? 383  MET A CA  1 
ATOM   2994  C  C   A MET A  1  383 ? 51.877  301.997 199.869 0.65 35.65  ? 383  MET A C   1 
ATOM   2995  C  C   B MET A  1  383 ? 51.997  303.157 199.804 0.35 22.44  ? 383  MET A C   1 
ATOM   2996  O  O   A MET A  1  383 ? 51.898  300.935 200.485 0.65 44.14  ? 383  MET A O   1 
ATOM   2997  O  O   B MET A  1  383 ? 51.693  303.182 201.001 0.35 14.81  ? 383  MET A O   1 
ATOM   2998  C  CB  A MET A  1  383 ? 50.150  301.201 198.287 0.65 25.35  ? 383  MET A CB  1 
ATOM   2999  C  CB  B MET A  1  383 ? 50.405  302.205 198.144 0.35 26.62  ? 383  MET A CB  1 
ATOM   3000  C  CG  A MET A  1  383 ? 49.006  301.537 197.337 0.65 32.65  ? 383  MET A CG  1 
ATOM   3001  C  CG  B MET A  1  383 ? 49.199  302.378 197.180 0.35 19.11  ? 383  MET A CG  1 
ATOM   3002  S  SD  A MET A  1  383 ? 48.520  300.043 196.507 0.65 32.35  ? 383  MET A SD  1 
ATOM   3003  S  SD  B MET A  1  383 ? 49.013  300.802 196.392 0.35 28.43  ? 383  MET A SD  1 
ATOM   3004  C  CE  A MET A  1  383 ? 47.821  300.777 194.979 0.65 27.72  ? 383  MET A CE  1 
ATOM   3005  C  CE  B MET A  1  383 ? 48.511  301.293 194.732 0.35 15.40  ? 383  MET A CE  1 
ATOM   3006  N  N   A GLY A  1  384 ? 52.958  302.765 199.762 0.65 45.99  ? 384  GLY A N   1 
ATOM   3007  N  N   B GLY A  1  384 ? 53.198  302.782 199.393 0.35 16.14  ? 384  GLY A N   1 
ATOM   3008  C  CA  A GLY A  1  384 ? 54.169  302.498 200.534 0.65 22.07  ? 384  GLY A CA  1 
ATOM   3009  C  CA  B GLY A  1  384 ? 54.252  302.500 200.368 0.35 29.70  ? 384  GLY A CA  1 
ATOM   3010  C  C   A GLY A  1  384 ? 54.395  303.657 201.457 0.65 36.79  ? 384  GLY A C   1 
ATOM   3011  C  C   B GLY A  1  384 ? 54.446  303.607 201.381 0.35 23.72  ? 384  GLY A C   1 
ATOM   3012  O  O   A GLY A  1  384 ? 54.118  303.563 202.662 0.65 21.80  ? 384  GLY A O   1 
ATOM   3013  O  O   B GLY A  1  384 ? 54.206  303.418 202.581 0.35 35.42  ? 384  GLY A O   1 
ATOM   3014  N  N   . ALA A  1  385 ? 54.829  304.783 200.910 1.00 28.80  ? 385  ALA A N   1 
ATOM   3015  C  CA  . ALA A  1  385 ? 55.099  305.924 201.778 1.00 35.74  ? 385  ALA A CA  1 
ATOM   3016  C  C   . ALA A  1  385 ? 53.831  306.358 202.524 1.00 32.66  ? 385  ALA A C   1 
ATOM   3017  O  O   . ALA A  1  385 ? 53.891  306.653 203.726 1.00 29.32  ? 385  ALA A O   1 
ATOM   3018  C  CB  . ALA A  1  385 ? 55.672  307.103 200.968 1.00 26.65  ? 385  ALA A CB  1 
ATOM   3019  N  N   . VAL A  1  386 ? 52.685  306.410 201.834 1.00 26.69  ? 386  VAL A N   1 
ATOM   3020  C  CA  . VAL A  1  386 ? 51.458  306.869 202.484 1.00 29.02  ? 386  VAL A CA  1 
ATOM   3021  C  C   . VAL A  1  386 ? 50.990  305.868 203.548 1.00 29.36  ? 386  VAL A C   1 
ATOM   3022  O  O   . VAL A  1  386 ? 50.436  306.268 204.571 1.00 26.96  ? 386  VAL A O   1 
ATOM   3023  C  CB  . VAL A  1  386 ? 50.350  307.124 201.437 1.00 28.36  ? 386  VAL A CB  1 
ATOM   3024  C  CG1 . VAL A  1  386 ? 48.941  307.118 202.120 1.00 28.61  ? 386  VAL A CG1 1 
ATOM   3025  C  CG2 . VAL A  1  386 ? 50.588  308.464 200.689 1.00 34.26  ? 386  VAL A CG2 1 
ATOM   3026  N  N   . PHE A  1  387 ? 51.089  304.552 203.274 1.00 24.60  ? 387  PHE A N   1 
ATOM   3027  C  CA  . PHE A  1  387 ? 50.663  303.588 204.309 1.00 24.44  ? 387  PHE A CA  1 
ATOM   3028  C  C   . PHE A  1  387 ? 51.594  303.642 205.517 1.00 31.44  ? 387  PHE A C   1 
ATOM   3029  O  O   . PHE A  1  387 ? 51.136  303.444 206.659 1.00 24.73  ? 387  PHE A O   1 
ATOM   3030  C  CB  . PHE A  1  387 ? 50.629  302.129 203.785 1.00 23.81  ? 387  PHE A CB  1 
ATOM   3031  C  CG  . PHE A  1  387 ? 49.354  301.790 202.976 1.00 25.37  ? 387  PHE A CG  1 
ATOM   3032  C  CD1 . PHE A  1  387 ? 48.822  302.717 202.064 1.00 22.78  ? 387  PHE A CD1 1 
ATOM   3033  C  CD2 . PHE A  1  387 ? 48.712  300.581 203.162 1.00 29.21  ? 387  PHE A CD2 1 
ATOM   3034  C  CE1 . PHE A  1  387 ? 47.643  302.398 201.341 1.00 27.57  ? 387  PHE A CE1 1 
ATOM   3035  C  CE2 . PHE A  1  387 ? 47.529  300.254 202.492 1.00 30.93  ? 387  PHE A CE2 1 
ATOM   3036  C  CZ  . PHE A  1  387 ? 46.996  301.147 201.569 1.00 28.92  ? 387  PHE A CZ  1 
ATOM   3037  N  N   . ALA A  1  388 ? 52.898  303.851 205.294 1.00 24.25  ? 388  ALA A N   1 
ATOM   3038  C  CA  . ALA A  1  388 ? 53.783  304.032 206.451 1.00 27.60  ? 388  ALA A CA  1 
ATOM   3039  C  C   . ALA A  1  388 ? 53.429  305.292 207.224 1.00 27.00  ? 388  ALA A C   1 
ATOM   3040  O  O   . ALA A  1  388 ? 53.459  305.296 208.465 1.00 25.81  ? 388  ALA A O   1 
ATOM   3041  C  CB  . ALA A  1  388 ? 55.250  304.065 206.038 1.00 23.62  ? 388  ALA A CB  1 
ATOM   3042  N  N   . ILE A  1  389 ? 53.152  306.386 206.517 1.00 24.65  ? 389  ILE A N   1 
ATOM   3043  C  CA  . ILE A  1  389 ? 52.692  307.600 207.187 1.00 25.68  ? 389  ILE A CA  1 
ATOM   3044  C  C   . ILE A  1  389 ? 51.407  307.361 207.978 1.00 29.52  ? 389  ILE A C   1 
ATOM   3045  O  O   . ILE A  1  389 ? 51.298  307.790 209.127 1.00 27.68  ? 389  ILE A O   1 
ATOM   3046  C  CB  . ILE A  1  389 ? 52.504  308.736 206.187 1.00 27.68  ? 389  ILE A CB  1 
ATOM   3047  C  CG1 . ILE A  1  389 ? 53.882  309.282 205.727 1.00 23.21  ? 389  ILE A CG1 1 
ATOM   3048  C  CG2 . ILE A  1  389 ? 51.660  309.815 206.780 1.00 22.96  ? 389  ILE A CG2 1 
ATOM   3049  C  CD1 . ILE A  1  389 ? 53.786  310.232 204.427 1.00 25.62  ? 389  ILE A CD1 1 
ATOM   3050  N  N   . MET A  1  390 ? 50.416  306.681 207.383 1.00 25.49  ? 390  MET A N   1 
ATOM   3051  C  CA  . MET A  1  390 ? 49.173  306.486 208.138 1.00 26.99  ? 390  MET A CA  1 
ATOM   3052  C  C   . MET A  1  390 ? 49.418  305.599 209.346 1.00 27.25  ? 390  MET A C   1 
ATOM   3053  O  O   . MET A  1  390 ? 48.832  305.816 210.434 1.00 26.36  ? 390  MET A O   1 
ATOM   3054  C  CB  . MET A  1  390 ? 48.115  305.826 207.257 1.00 24.44  ? 390  MET A CB  1 
ATOM   3055  C  CG  . MET A  1  390 ? 47.477  306.735 206.185 1.00 31.61  ? 390  MET A CG  1 
ATOM   3056  S  SD  . MET A  1  390 ? 47.100  308.406 206.765 1.00 40.28  ? 390  MET A SD  1 
ATOM   3057  C  CE  . MET A  1  390 ? 45.975  308.104 208.148 1.00 50.52  ? 390  MET A CE  1 
ATOM   3058  N  N   . GLY A  1  391 ? 50.226  304.552 209.155 1.00 27.85  ? 391  GLY A N   1 
ATOM   3059  C  CA  . GLY A  1  391 ? 50.553  303.662 210.266 1.00 27.63  ? 391  GLY A CA  1 
ATOM   3060  C  C   . GLY A  1  391 ? 51.216  304.407 211.403 1.00 28.28  ? 391  GLY A C   1 
ATOM   3061  O  O   . GLY A  1  391 ? 50.835  304.260 212.575 1.00 27.03  ? 391  GLY A O   1 
ATOM   3062  N  N   . GLY A  1  392 ? 52.237  305.185 211.070 1.00 23.45  ? 392  GLY A N   1 
ATOM   3063  C  CA  . GLY A  1  392 ? 52.944  305.957 212.104 1.00 25.40  ? 392  GLY A CA  1 
ATOM   3064  C  C   . GLY A  1  392 ? 52.022  307.004 212.731 1.00 27.53  ? 392  GLY A C   1 
ATOM   3065  O  O   . GLY A  1  392 ? 52.061  307.243 213.936 1.00 28.54  ? 392  GLY A O   1 
ATOM   3066  N  N   . PHE A  1  393 ? 51.126  307.595 211.924 1.00 26.46  ? 393  PHE A N   1 
ATOM   3067  C  CA  . PHE A  1  393 ? 50.260  308.631 212.484 1.00 23.66  ? 393  PHE A CA  1 
ATOM   3068  C  C   . PHE A  1  393 ? 49.279  308.017 213.482 1.00 27.72  ? 393  PHE A C   1 
ATOM   3069  O  O   . PHE A  1  393 ? 49.097  308.538 214.599 1.00 26.75  ? 393  PHE A O   1 
ATOM   3070  C  CB  . PHE A  1  393 ? 49.485  309.331 211.361 1.00 25.47  ? 393  PHE A CB  1 
ATOM   3071  C  CG  . PHE A  1  393 ? 48.583  310.411 211.888 1.00 27.83  ? 393  PHE A CG  1 
ATOM   3072  C  CD1 . PHE A  1  393 ? 49.122  311.667 212.237 1.00 27.18  ? 393  PHE A CD1 1 
ATOM   3073  C  CD2 . PHE A  1  393 ? 47.218  310.182 212.033 1.00 28.20  ? 393  PHE A CD2 1 
ATOM   3074  C  CE1 . PHE A  1  393 ? 48.299  312.698 212.758 1.00 30.42  ? 393  PHE A CE1 1 
ATOM   3075  C  CE2 . PHE A  1  393 ? 46.375  311.183 212.575 1.00 35.40  ? 393  PHE A CE2 1 
ATOM   3076  C  CZ  . PHE A  1  393 ? 46.898  312.430 212.914 1.00 30.29  ? 393  PHE A CZ  1 
ATOM   3077  N  N   . VAL A  1  394 ? 48.677  306.896 213.101 1.00 25.83  ? 394  VAL A N   1 
ATOM   3078  C  CA  . VAL A  1  394 ? 47.732  306.231 214.002 1.00 30.26  ? 394  VAL A CA  1 
ATOM   3079  C  C   . VAL A  1  394 ? 48.446  305.750 215.255 1.00 31.30  ? 394  VAL A C   1 
ATOM   3080  O  O   . VAL A  1  394 ? 47.938  305.884 216.396 1.00 24.90  ? 394  VAL A O   1 
ATOM   3081  C  CB  . VAL A  1  394 ? 47.037  305.075 213.233 1.00 30.11  ? 394  VAL A CB  1 
ATOM   3082  C  CG1 . VAL A  1  394 ? 46.248  304.190 214.197 1.00 37.96  ? 394  VAL A CG1 1 
ATOM   3083  C  CG2 . VAL A  1  394 ? 46.080  305.675 212.176 1.00 30.87  ? 394  VAL A CG2 1 
ATOM   3084  N  N   . HIS A  1  395 ? 49.615  305.138 215.069 1.00 26.31  ? 395  HIS A N   1 
ATOM   3085  C  CA  . HIS A  1  395 ? 50.348  304.580 216.222 1.00 27.71  ? 395  HIS A CA  1 
ATOM   3086  C  C   . HIS A  1  395 ? 50.766  305.648 217.215 1.00 28.64  ? 395  HIS A C   1 
ATOM   3087  O  O   . HIS A  1  395 ? 50.646  305.450 218.466 1.00 28.23  ? 395  HIS A O   1 
ATOM   3088  C  CB  . HIS A  1  395 ? 51.548  303.801 215.680 1.00 22.80  ? 395  HIS A CB  1 
ATOM   3089  C  CG  . HIS A  1  395 ? 52.424  303.243 216.760 1.00 31.08  ? 395  HIS A CG  1 
ATOM   3090  N  ND1 . HIS A  1  395 ? 51.960  302.368 217.731 1.00 27.91  ? 395  HIS A ND1 1 
ATOM   3091  C  CD2 . HIS A  1  395 ? 53.728  303.437 217.023 1.00 28.88  ? 395  HIS A CD2 1 
ATOM   3092  C  CE1 . HIS A  1  395 ? 52.958  302.013 218.517 1.00 26.99  ? 395  HIS A CE1 1 
ATOM   3093  N  NE2 . HIS A  1  395 ? 54.041  302.680 218.153 1.00 27.45  ? 395  HIS A NE2 1 
ATOM   3094  N  N   . TRP A  1  396 ? 51.304  306.792 216.726 1.00 24.24  ? 396  TRP A N   1 
ATOM   3095  C  CA  . TRP A  1  396 ? 51.923  307.780 217.601 1.00 27.87  ? 396  TRP A CA  1 
ATOM   3096  C  C   . TRP A  1  396 ? 51.033  308.991 217.892 1.00 26.87  ? 396  TRP A C   1 
ATOM   3097  O  O   . TRP A  1  396 ? 51.350  309.782 218.789 1.00 25.52  ? 396  TRP A O   1 
ATOM   3098  C  CB  . TRP A  1  396 ? 53.290  308.278 217.093 1.00 21.12  ? 396  TRP A CB  1 
ATOM   3099  C  CG  . TRP A  1  396 ? 54.432  307.301 217.359 1.00 27.49  ? 396  TRP A CG  1 
ATOM   3100  C  CD1 . TRP A  1  396 ? 54.963  306.927 218.594 1.00 28.44  ? 396  TRP A CD1 1 
ATOM   3101  C  CD2 . TRP A  1  396 ? 55.200  306.603 216.354 1.00 29.85  ? 396  TRP A CD2 1 
ATOM   3102  N  NE1 . TRP A  1  396 ? 56.017  306.038 218.402 1.00 26.01  ? 396  TRP A NE1 1 
ATOM   3103  C  CE2 . TRP A  1  396 ? 56.181  305.816 217.049 1.00 31.01  ? 396  TRP A CE2 1 
ATOM   3104  C  CE3 . TRP A  1  396 ? 55.130  306.549 214.932 1.00 27.53  ? 396  TRP A CE3 1 
ATOM   3105  C  CZ2 . TRP A  1  396 ? 57.086  304.972 216.380 1.00 24.55  ? 396  TRP A CZ2 1 
ATOM   3106  C  CZ3 . TRP A  1  396 ? 56.048  305.717 214.253 1.00 29.57  ? 396  TRP A CZ3 1 
ATOM   3107  C  CH2 . TRP A  1  396 ? 57.036  304.963 214.967 1.00 27.18  ? 396  TRP A CH2 1 
ATOM   3108  N  N   . PHE A  1  397 ? 49.895  309.100 217.242 1.00 23.79  ? 397  PHE A N   1 
ATOM   3109  C  CA  . PHE A  1  397 ? 48.923  310.138 217.606 1.00 25.91  ? 397  PHE A CA  1 
ATOM   3110  C  C   . PHE A  1  397 ? 48.658  310.211 219.122 1.00 28.42  ? 397  PHE A C   1 
ATOM   3111  O  O   . PHE A  1  397 ? 48.616  311.331 219.655 1.00 26.84  ? 397  PHE A O   1 
ATOM   3112  C  CB  . PHE A  1  397 ? 47.582  309.911 216.894 1.00 26.48  ? 397  PHE A CB  1 
ATOM   3113  C  CG  . PHE A  1  397 ? 46.567  310.991 217.206 1.00 29.76  ? 397  PHE A CG  1 
ATOM   3114  C  CD1 . PHE A  1  397 ? 46.592  312.196 216.514 1.00 33.16  ? 397  PHE A CD1 1 
ATOM   3115  C  CD2 . PHE A  1  397 ? 45.594  310.796 218.218 1.00 29.27  ? 397  PHE A CD2 1 
ATOM   3116  C  CE1 . PHE A  1  397 ? 45.673  313.226 216.815 1.00 37.09  ? 397  PHE A CE1 1 
ATOM   3117  C  CE2 . PHE A  1  397 ? 44.657  311.798 218.492 1.00 23.70  ? 397  PHE A CE2 1 
ATOM   3118  C  CZ  . PHE A  1  397 ? 44.710  313.031 217.729 1.00 30.53  ? 397  PHE A CZ  1 
ATOM   3119  N  N   . PRO A  1  398 ? 48.507  309.126 219.852 1.00 27.78  ? 398  PRO A N   1 
ATOM   3120  C  CA  . PRO A  1  398 ? 48.251  309.300 221.309 1.00 30.83  ? 398  PRO A CA  1 
ATOM   3121  C  C   . PRO A  1  398 ? 49.452  309.830 222.029 1.00 37.33  ? 398  PRO A C   1 
ATOM   3122  O  O   . PRO A  1  398 ? 49.295  310.554 223.015 1.00 29.08  ? 398  PRO A O   1 
ATOM   3123  C  CB  . PRO A  1  398 ? 47.902  307.889 221.799 1.00 28.57  ? 398  PRO A CB  1 
ATOM   3124  C  CG  . PRO A  1  398 ? 47.426  307.179 220.500 1.00 28.55  ? 398  PRO A CG  1 
ATOM   3125  C  CD  . PRO A  1  398 ? 48.416  307.701 219.470 1.00 27.20  ? 398  PRO A CD  1 
ATOM   3126  N  N   . LEU A  1  399 ? 50.657  309.506 221.553 1.00 28.54  ? 399  LEU A N   1 
ATOM   3127  C  CA  . LEU A  1  399 ? 51.859  310.088 222.134 1.00 25.17  ? 399  LEU A CA  1 
ATOM   3128  C  C   . LEU A  1  399 ? 51.895  311.589 221.920 1.00 27.84  ? 399  LEU A C   1 
ATOM   3129  O  O   . LEU A  1  399 ? 52.194  312.347 222.852 1.00 29.29  ? 399  LEU A O   1 
ATOM   3130  C  CB  . LEU A  1  399 ? 53.125  309.424 221.533 1.00 26.26  ? 399  LEU A CB  1 
ATOM   3131  C  CG  . LEU A  1  399 ? 54.456  310.033 222.044 1.00 29.06  ? 399  LEU A CG  1 
ATOM   3132  C  CD1 . LEU A  1  399 ? 54.618  310.036 223.631 1.00 25.96  ? 399  LEU A CD1 1 
ATOM   3133  C  CD2 . LEU A  1  399 ? 55.695  309.363 221.296 1.00 27.11  ? 399  LEU A CD2 1 
ATOM   3134  N  N   . PHE A  1  400 ? 51.709  312.030 220.678 1.00 24.43  ? 400  PHE A N   1 
ATOM   3135  C  CA  . PHE A  1  400 ? 51.817  313.460 220.363 1.00 25.79  ? 400  PHE A CA  1 
ATOM   3136  C  C   . PHE A  1  400 ? 50.727  314.274 221.028 1.00 29.80  ? 400  PHE A C   1 
ATOM   3137  O  O   . PHE A  1  400 ? 50.935  315.450 221.338 1.00 30.44  ? 400  PHE A O   1 
ATOM   3138  C  CB  . PHE A  1  400 ? 51.717  313.674 218.833 1.00 24.80  ? 400  PHE A CB  1 
ATOM   3139  C  CG  . PHE A  1  400 ? 52.800  312.936 218.042 1.00 29.20  ? 400  PHE A CG  1 
ATOM   3140  C  CD1 . PHE A  1  400 ? 53.939  312.471 218.694 1.00 33.19  ? 400  PHE A CD1 1 
ATOM   3141  C  CD2 . PHE A  1  400 ? 52.637  312.683 216.677 1.00 30.69  ? 400  PHE A CD2 1 
ATOM   3142  C  CE1 . PHE A  1  400 ? 54.941  311.793 217.995 1.00 37.85  ? 400  PHE A CE1 1 
ATOM   3143  C  CE2 . PHE A  1  400 ? 53.649  311.967 215.957 1.00 29.12  ? 400  PHE A CE2 1 
ATOM   3144  C  CZ  . PHE A  1  400 ? 54.790  311.556 216.605 1.00 30.75  ? 400  PHE A CZ  1 
ATOM   3145  N  N   . SER A  1  401 ? 49.514  313.727 221.116 1.00 27.26  ? 401  SER A N   1 
ATOM   3146  C  CA  . SER A  1  401 ? 48.385  314.560 221.528 1.00 28.73  ? 401  SER A CA  1 
ATOM   3147  C  C   . SER A  1  401 ? 47.937  314.327 222.974 1.00 31.57  ? 401  SER A C   1 
ATOM   3148  O  O   . SER A  1  401 ? 47.253  315.170 223.515 1.00 29.42  ? 401  SER A O   1 
ATOM   3149  C  CB  . SER A  1  401 ? 47.159  314.314 220.654 1.00 28.36  ? 401  SER A CB  1 
ATOM   3150  O  OG  . SER A  1  401 ? 46.606  313.014 220.849 1.00 28.57  ? 401  SER A OG  1 
ATOM   3151  N  N   . GLY A  1  402 ? 48.168  313.130 223.504 1.00 26.09  ? 402  GLY A N   1 
ATOM   3152  C  CA  . GLY A  1  402 ? 47.581  312.698 224.795 1.00 29.24  ? 402  GLY A CA  1 
ATOM   3153  C  C   . GLY A  1  402 ? 46.209  312.049 224.654 1.00 32.35  ? 402  GLY A C   1 
ATOM   3154  O  O   . GLY A  1  402 ? 45.624  311.705 225.665 1.00 28.33  ? 402  GLY A O   1 
ATOM   3155  N  N   . TYR A  1  403 ? 45.646  311.936 223.440 1.00 26.09  ? 403  TYR A N   1 
ATOM   3156  C  CA  . TYR A  1  403 ? 44.278  311.469 223.244 1.00 29.31  ? 403  TYR A CA  1 
ATOM   3157  C  C   . TYR A  1  403 ? 44.261  310.231 222.352 1.00 33.78  ? 403  TYR A C   1 
ATOM   3158  O  O   . TYR A  1  403 ? 45.169  309.985 221.517 1.00 30.06  ? 403  TYR A O   1 
ATOM   3159  C  CB  . TYR A  1  403 ? 43.429  312.544 222.608 1.00 27.67  ? 403  TYR A CB  1 
ATOM   3160  C  CG  . TYR A  1  403 ? 43.299  313.849 223.366 1.00 29.73  ? 403  TYR A CG  1 
ATOM   3161  C  CD1 . TYR A  1  403 ? 42.790  313.882 224.702 1.00 30.35  ? 403  TYR A CD1 1 
ATOM   3162  C  CD2 . TYR A  1  403 ? 43.614  315.052 222.745 1.00 31.02  ? 403  TYR A CD2 1 
ATOM   3163  C  CE1 . TYR A  1  403 ? 42.630  315.082 225.371 1.00 30.32  ? 403  TYR A CE1 1 
ATOM   3164  C  CE2 . TYR A  1  403 ? 43.453  316.272 223.398 1.00 30.90  ? 403  TYR A CE2 1 
ATOM   3165  C  CZ  . TYR A  1  403 ? 42.912  316.277 224.730 1.00 31.53  ? 403  TYR A CZ  1 
ATOM   3166  O  OH  . TYR A  1  403 ? 42.757  317.448 225.403 1.00 32.33  ? 403  TYR A OH  1 
ATOM   3167  N  N   . THR A  1  404 ? 43.266  309.391 222.536 1.00 26.91  ? 404  THR A N   1 
ATOM   3168  C  CA  . THR A  1  404 ? 43.212  308.225 221.660 1.00 28.87  ? 404  THR A CA  1 
ATOM   3169  C  C   . THR A  1  404 ? 42.282  308.472 220.479 1.00 42.35  ? 404  THR A C   1 
ATOM   3170  O  O   . THR A  1  404 ? 41.353  309.280 220.530 1.00 27.50  ? 404  THR A O   1 
ATOM   3171  C  CB  . THR A  1  404 ? 42.736  306.974 222.383 1.00 29.99  ? 404  THR A CB  1 
ATOM   3172  O  OG1 . THR A  1  404 ? 41.385  307.227 222.861 1.00 30.99  ? 404  THR A OG1 1 
ATOM   3173  C  CG2 . THR A  1  404 ? 43.726  306.631 223.531 1.00 27.02  ? 404  THR A CG2 1 
ATOM   3174  N  N   . LEU A  1  405 ? 42.513  307.718 219.422 1.00 29.34  ? 405  LEU A N   1 
ATOM   3175  C  CA  . LEU A  1  405 ? 41.595  307.717 218.279 1.00 24.21  ? 405  LEU A CA  1 
ATOM   3176  C  C   . LEU A  1  405 ? 40.499  306.692 218.534 1.00 30.10  ? 405  LEU A C   1 
ATOM   3177  O  O   . LEU A  1  405 ? 40.593  305.822 219.402 1.00 30.10  ? 405  LEU A O   1 
ATOM   3178  C  CB  . LEU A  1  405 ? 42.356  307.382 216.961 1.00 25.07  ? 405  LEU A CB  1 
ATOM   3179  C  CG  . LEU A  1  405 ? 43.546  308.219 216.572 1.00 31.94  ? 405  LEU A CG  1 
ATOM   3180  C  CD1 . LEU A  1  405 ? 44.335  307.568 215.375 1.00 29.55  ? 405  LEU A CD1 1 
ATOM   3181  C  CD2 . LEU A  1  405 ? 43.063  309.572 216.169 1.00 28.27  ? 405  LEU A CD2 1 
ATOM   3182  N  N   . ASN A  1  406 ? 39.429  306.783 217.768 1.00 29.77  ? 406  ASN A N   1 
ATOM   3183  C  CA  . ASN A  1  406 ? 38.495  305.667 217.810 1.00 27.33  ? 406  ASN A CA  1 
ATOM   3184  C  C   . ASN A  1  406 ? 39.035  304.567 216.884 1.00 28.51  ? 406  ASN A C   1 
ATOM   3185  O  O   . ASN A  1  406 ? 39.081  304.763 215.645 1.00 29.66  ? 406  ASN A O   1 
ATOM   3186  C  CB  . ASN A  1  406 ? 37.101  306.149 217.345 1.00 30.39  ? 406  ASN A CB  1 
ATOM   3187  C  CG  . ASN A  1  406 ? 36.073  305.066 217.346 1.00 31.13  ? 406  ASN A CG  1 
ATOM   3188  O  OD1 . ASN A  1  406 ? 36.266  304.001 216.752 1.00 33.82  ? 406  ASN A OD1 1 
ATOM   3189  N  ND2 . ASN A  1  406 ? 34.945  305.322 218.023 1.00 39.59  ? 406  ASN A ND2 1 
ATOM   3190  N  N   . ASP A  1  407 ? 39.359  303.391 217.447 1.00 28.61  ? 407  ASP A N   1 
ATOM   3191  C  CA  . ASP A  1  407 ? 39.997  302.341 216.643 1.00 31.20  ? 407  ASP A CA  1 
ATOM   3192  C  C   . ASP A  1  407 ? 39.078  301.847 215.546 1.00 30.14  ? 407  ASP A C   1 
ATOM   3193  O  O   . ASP A  1  407 ? 39.543  301.460 214.436 1.00 30.17  ? 407  ASP A O   1 
ATOM   3194  C  CB  . ASP A  1  407 ? 40.411  301.138 217.485 1.00 31.54  ? 407  ASP A CB  1 
ATOM   3195  C  CG  . ASP A  1  407 ? 41.849  301.248 218.056 1.00 50.65  ? 407  ASP A CG  1 
ATOM   3196  O  OD1 . ASP A  1  407 ? 42.473  302.316 217.933 1.00 33.89  ? 407  ASP A OD1 1 
ATOM   3197  O  OD2 . ASP A  1  407 ? 42.336  300.244 218.624 1.00 44.22  ? 407  ASP A OD2 1 
ATOM   3198  N  N   . THR A  1  408 ? 37.768  301.764 215.839 1.00 28.99  ? 408  THR A N   1 
ATOM   3199  C  CA  . THR A  1  408 ? 36.861  301.242 214.822 1.00 28.53  ? 408  THR A CA  1 
ATOM   3200  C  C   . THR A  1  408 ? 36.816  302.164 213.618 1.00 27.76  ? 408  THR A C   1 
ATOM   3201  O  O   . THR A  1  408 ? 36.863  301.709 212.482 1.00 28.88  ? 408  THR A O   1 
ATOM   3202  C  CB  . THR A  1  408 ? 35.444  301.033 215.400 1.00 33.36  ? 408  THR A CB  1 
ATOM   3203  O  OG1 . THR A  1  408 ? 35.489  300.111 216.507 1.00 30.65  ? 408  THR A OG1 1 
ATOM   3204  C  CG2 . THR A  1  408 ? 34.547  300.479 214.325 1.00 32.71  ? 408  THR A CG2 1 
ATOM   3205  N  N   . TRP A  1  409 ? 36.676  303.464 213.857 1.00 28.06  ? 409  TRP A N   1 
ATOM   3206  C  CA  . TRP A  1  409 ? 36.697  304.393 212.736 1.00 29.77  ? 409  TRP A CA  1 
ATOM   3207  C  C   . TRP A  1  409 ? 38.019  304.295 211.993 1.00 32.95  ? 409  TRP A C   1 
ATOM   3208  O  O   . TRP A  1  409 ? 38.061  304.431 210.775 1.00 28.34  ? 409  TRP A O   1 
ATOM   3209  C  CB  . TRP A  1  409 ? 36.523  305.829 213.240 1.00 28.94  ? 409  TRP A CB  1 
ATOM   3210  C  CG  . TRP A  1  409 ? 35.103  306.286 213.430 1.00 31.65  ? 409  TRP A CG  1 
ATOM   3211  C  CD1 . TRP A  1  409 ? 34.529  306.789 214.615 1.00 32.68  ? 409  TRP A CD1 1 
ATOM   3212  C  CD2 . TRP A  1  409 ? 34.082  306.344 212.436 1.00 38.38  ? 409  TRP A CD2 1 
ATOM   3213  N  NE1 . TRP A  1  409 ? 33.233  307.153 214.364 1.00 31.47  ? 409  TRP A NE1 1 
ATOM   3214  C  CE2 . TRP A  1  409 ? 32.911  306.852 213.060 1.00 31.41  ? 409  TRP A CE2 1 
ATOM   3215  C  CE3 . TRP A  1  409 ? 34.030  306.002 211.077 1.00 35.39  ? 409  TRP A CE3 1 
ATOM   3216  C  CZ2 . TRP A  1  409 ? 31.711  307.071 212.349 1.00 33.25  ? 409  TRP A CZ2 1 
ATOM   3217  C  CZ3 . TRP A  1  409 ? 32.791  306.197 210.365 1.00 34.10  ? 409  TRP A CZ3 1 
ATOM   3218  C  CH2 . TRP A  1  409 ? 31.684  306.724 211.006 1.00 36.34  ? 409  TRP A CH2 1 
ATOM   3219  N  N   . ALA A  1  410 ? 39.123  304.083 212.720 1.00 27.53  ? 410  ALA A N   1 
ATOM   3220  C  CA  . ALA A  1  410 ? 40.420  304.027 212.032 1.00 29.20  ? 410  ALA A CA  1 
ATOM   3221  C  C   . ALA A  1  410 ? 40.531  302.762 211.179 1.00 29.61  ? 410  ALA A C   1 
ATOM   3222  O  O   . ALA A  1  410 ? 41.146  302.795 210.091 1.00 28.23  ? 410  ALA A O   1 
ATOM   3223  C  CB  . ALA A  1  410 ? 41.584  304.102 213.069 1.00 22.48  ? 410  ALA A CB  1 
ATOM   3224  N  N   . LYS A  1  411 ? 39.898  301.643 211.618 1.00 30.38  ? 411  LYS A N   1 
ATOM   3225  C  CA  . LYS A  1  411 ? 39.892  300.438 210.772 1.00 26.95  ? 411  LYS A CA  1 
ATOM   3226  C  C   . LYS A  1  411 ? 39.025  300.648 209.515 1.00 29.86  ? 411  LYS A C   1 
ATOM   3227  O  O   . LYS A  1  411 ? 39.335  300.142 208.421 1.00 28.44  ? 411  LYS A O   1 
ATOM   3228  C  CB  . LYS A  1  411 ? 39.400  299.225 211.563 1.00 26.80  ? 411  LYS A CB  1 
ATOM   3229  C  CG  . LYS A  1  411 ? 40.394  298.848 212.745 1.00 27.33  ? 411  LYS A CG  1 
ATOM   3230  C  CD  . LYS A  1  411 ? 39.756  297.713 213.594 1.00 26.49  ? 411  LYS A CD  1 
ATOM   3231  C  CE  . LYS A  1  411 ? 40.661  297.499 214.895 1.00 36.85  ? 411  LYS A CE  1 
ATOM   3232  N  NZ  . LYS A  1  411 ? 40.292  296.253 215.657 1.00 34.12  ? 411  LYS A NZ  1 
ATOM   3233  N  N   . ILE A  1  412 ? 37.925  301.351 209.662 1.00 25.86  ? 412  ILE A N   1 
ATOM   3234  C  CA  . ILE A  1  412 ? 37.048  301.632 208.517 1.00 26.94  ? 412  ILE A CA  1 
ATOM   3235  C  C   . ILE A  1  412 ? 37.820  302.463 207.492 1.00 29.57  ? 412  ILE A C   1 
ATOM   3236  O  O   . ILE A  1  412 ? 37.817  302.190 206.289 1.00 29.17  ? 412  ILE A O   1 
ATOM   3237  C  CB  . ILE A  1  412 ? 35.773  302.352 209.009 1.00 29.75  ? 412  ILE A CB  1 
ATOM   3238  C  CG1 . ILE A  1  412 ? 34.850  301.377 209.823 1.00 29.39  ? 412  ILE A CG1 1 
ATOM   3239  C  CG2 . ILE A  1  412 ? 35.045  303.072 207.829 1.00 27.78  ? 412  ILE A CG2 1 
ATOM   3240  C  CD1 . ILE A  1  412 ? 33.900  302.125 210.763 1.00 27.45  ? 412  ILE A CD1 1 
ATOM   3241  N  N   . HIS A  1  413 ? 38.508  303.492 207.987 1.00 25.79  ? 413  HIS A N   1 
ATOM   3242  C  CA  . HIS A  1  413 ? 39.350  304.335 207.148 1.00 28.99  ? 413  HIS A CA  1 
ATOM   3243  C  C   . HIS A  1  413 ? 40.380  303.521 206.365 1.00 32.96  ? 413  HIS A C   1 
ATOM   3244  O  O   . HIS A  1  413 ? 40.551  303.724 205.146 1.00 28.88  ? 413  HIS A O   1 
ATOM   3245  C  CB  . HIS A  1  413 ? 40.007  305.415 208.047 1.00 28.38  ? 413  HIS A CB  1 
ATOM   3246  C  CG  . HIS A  1  413 ? 41.039  306.215 207.321 1.00 35.35  ? 413  HIS A CG  1 
ATOM   3247  N  ND1 . HIS A  1  413 ? 42.359  306.210 207.683 1.00 33.33  ? 413  HIS A ND1 1 
ATOM   3248  C  CD2 . HIS A  1  413 ? 40.962  306.992 206.200 1.00 33.91  ? 413  HIS A CD2 1 
ATOM   3249  C  CE1 . HIS A  1  413 ? 43.059  306.962 206.844 1.00 39.23  ? 413  HIS A CE1 1 
ATOM   3250  N  NE2 . HIS A  1  413 ? 42.239  307.426 205.921 1.00 31.02  ? 413  HIS A NE2 1 
ATOM   3251  N  N   . PHE A  1  414 ? 41.100  302.618 207.031 1.00 29.93  ? 414  PHE A N   1 
ATOM   3252  C  CA  . PHE A  1  414 ? 42.053  301.774 206.326 1.00 29.28  ? 414  PHE A CA  1 
ATOM   3253  C  C   . PHE A  1  414 ? 41.365  300.967 205.237 1.00 31.93  ? 414  PHE A C   1 
ATOM   3254  O  O   . PHE A  1  414 ? 41.906  300.818 204.119 1.00 30.14  ? 414  PHE A O   1 
ATOM   3255  C  CB  . PHE A  1  414 ? 42.775  300.837 207.312 1.00 27.63  ? 414  PHE A CB  1 
ATOM   3256  C  CG  . PHE A  1  414 ? 43.496  299.706 206.635 1.00 25.99  ? 414  PHE A CG  1 
ATOM   3257  C  CD1 . PHE A  1  414 ? 44.799  299.896 206.125 1.00 24.23  ? 414  PHE A CD1 1 
ATOM   3258  C  CD2 . PHE A  1  414 ? 42.906  298.452 206.562 1.00 24.90  ? 414  PHE A CD2 1 
ATOM   3259  C  CE1 . PHE A  1  414 ? 45.448  298.865 205.447 1.00 27.96  ? 414  PHE A CE1 1 
ATOM   3260  C  CE2 . PHE A  1  414 ? 43.540  297.426 205.922 1.00 26.60  ? 414  PHE A CE2 1 
ATOM   3261  C  CZ  . PHE A  1  414 ? 44.862  297.622 205.394 1.00 29.08  ? 414  PHE A CZ  1 
ATOM   3262  N  N   . ALA A  1  415 ? 40.235  300.339 205.571 1.00 30.93  ? 415  ALA A N   1 
ATOM   3263  C  CA  . ALA A  1  415 ? 39.510  299.513 204.605 1.00 28.42  ? 415  ALA A CA  1 
ATOM   3264  C  C   . ALA A  1  415 ? 39.167  300.327 203.362 1.00 32.37  ? 415  ALA A C   1 
ATOM   3265  O  O   . ALA A  1  415 ? 39.394  299.864 202.231 1.00 27.46  ? 415  ALA A O   1 
ATOM   3266  C  CB  . ALA A  1  415 ? 38.227  298.903 205.256 1.00 26.98  ? 415  ALA A CB  1 
ATOM   3267  N  N   . ILE A  1  416 ? 38.642  301.550 203.536 1.00 24.59  ? 416  ILE A N   1 
ATOM   3268  C  CA  . ILE A  1  416 ? 38.212  302.301 202.352 1.00 27.58  ? 416  ILE A CA  1 
ATOM   3269  C  C   . ILE A  1  416 ? 39.437  302.663 201.523 1.00 31.93  ? 416  ILE A C   1 
ATOM   3270  O  O   . ILE A  1  416 ? 39.425  302.580 200.294 1.00 28.01  ? 416  ILE A O   1 
ATOM   3271  C  CB  . ILE A  1  416 ? 37.441  303.563 202.752 1.00 26.21  ? 416  ILE A CB  1 
ATOM   3272  C  CG1 . ILE A  1  416 ? 36.148  303.165 203.573 1.00 28.59  ? 416  ILE A CG1 1 
ATOM   3273  C  CG2 . ILE A  1  416 ? 37.053  304.437 201.493 1.00 23.79  ? 416  ILE A CG2 1 
ATOM   3274  C  CD1 . ILE A  1  416 ? 35.622  304.331 204.439 1.00 30.37  ? 416  ILE A CD1 1 
ATOM   3275  N  N   . MET A  1  417 ? 40.498  303.117 202.177 1.00 26.73  ? 417  MET A N   1 
ATOM   3276  C  CA  . MET A  1  417 ? 41.706  303.537 201.468 1.00 23.93  ? 417  MET A CA  1 
ATOM   3277  C  C   . MET A  1  417 ? 42.311  302.370 200.712 1.00 28.56  ? 417  MET A C   1 
ATOM   3278  O  O   . MET A  1  417 ? 42.748  302.523 199.578 1.00 27.67  ? 417  MET A O   1 
ATOM   3279  C  CB  . MET A  1  417 ? 42.733  304.124 202.491 1.00 25.18  ? 417  MET A CB  1 
ATOM   3280  C  CG  . MET A  1  417 ? 43.979  304.733 201.724 1.00 31.41  ? 417  MET A CG  1 
ATOM   3281  S  SD  . MET A  1  417 ? 43.465  306.305 201.009 1.00 35.97  ? 417  MET A SD  1 
ATOM   3282  C  CE  . MET A  1  417 ? 45.029  307.047 200.654 1.00 38.32  ? 417  MET A CE  1 
ATOM   3283  N  N   . PHE A  1  418 ? 42.314  301.178 201.309 1.00 23.50  ? 418  PHE A N   1 
ATOM   3284  C  CA  . PHE A  1  418 ? 42.936  300.031 200.656 1.00 25.75  ? 418  PHE A CA  1 
ATOM   3285  C  C   . PHE A  1  418 ? 42.192  299.712 199.353 1.00 31.91  ? 418  PHE A C   1 
ATOM   3286  O  O   . PHE A  1  418 ? 42.802  299.393 198.306 1.00 26.14  ? 418  PHE A O   1 
ATOM   3287  C  CB  . PHE A  1  418 ? 42.855  298.834 201.599 1.00 26.69  ? 418  PHE A CB  1 
ATOM   3288  C  CG  . PHE A  1  418 ? 43.565  297.622 201.067 1.00 28.45  ? 418  PHE A CG  1 
ATOM   3289  C  CD1 . PHE A  1  418 ? 44.906  297.425 201.357 1.00 35.67  ? 418  PHE A CD1 1 
ATOM   3290  C  CD2 . PHE A  1  418 ? 42.894  296.693 200.289 1.00 34.01  ? 418  PHE A CD2 1 
ATOM   3291  C  CE1 . PHE A  1  418 ? 45.593  296.313 200.867 1.00 32.03  ? 418  PHE A CE1 1 
ATOM   3292  C  CE2 . PHE A  1  418 ? 43.571  295.591 199.801 1.00 31.06  ? 418  PHE A CE2 1 
ATOM   3293  C  CZ  . PHE A  1  418 ? 44.929  295.415 200.109 1.00 32.21  ? 418  PHE A CZ  1 
ATOM   3294  N  N   . VAL A  1  419 ? 40.854  299.711 199.431 1.00 26.35  ? 419  VAL A N   1 
ATOM   3295  C  CA  . VAL A  1  419 ? 40.076  299.497 198.189 1.00 25.50  ? 419  VAL A CA  1 
ATOM   3296  C  C   . VAL A  1  419 ? 40.374  300.613 197.176 1.00 26.75  ? 419  VAL A C   1 
ATOM   3297  O  O   . VAL A  1  419 ? 40.595  300.362 195.982 1.00 29.98  ? 419  VAL A O   1 
ATOM   3298  C  CB  . VAL A  1  419 ? 38.566  299.418 198.507 1.00 27.52  ? 419  VAL A CB  1 
ATOM   3299  C  CG1 . VAL A  1  419 ? 37.759  299.374 197.159 1.00 26.94  ? 419  VAL A CG1 1 
ATOM   3300  C  CG2 . VAL A  1  419 ? 38.212  298.234 199.409 1.00 24.09  ? 419  VAL A CG2 1 
ATOM   3301  N  N   . GLY A  1  420 ? 40.357  301.860 197.624 1.00 29.24  ? 420  GLY A N   1 
ATOM   3302  C  CA  . GLY A  1  420 ? 40.505  302.970 196.692 1.00 27.02  ? 420  GLY A CA  1 
ATOM   3303  C  C   . GLY A  1  420 ? 41.826  302.949 195.943 1.00 33.64  ? 420  GLY A C   1 
ATOM   3304  O  O   . GLY A  1  420 ? 41.850  303.100 194.715 1.00 30.76  ? 420  GLY A O   1 
ATOM   3305  N  N   . VAL A  1  421 ? 42.957  302.804 196.663 1.00 25.66  ? 421  VAL A N   1 
ATOM   3306  C  CA  . VAL A  1  421 ? 44.251  302.907 195.960 1.00 26.13  ? 421  VAL A CA  1 
ATOM   3307  C  C   . VAL A  1  421 ? 44.435  301.730 195.044 1.00 26.93  ? 421  VAL A C   1 
ATOM   3308  O  O   . VAL A  1  421 ? 45.015  301.854 193.977 1.00 24.47  ? 421  VAL A O   1 
ATOM   3309  C  CB  . VAL A  1  421 ? 45.428  303.024 196.983 1.00 27.30  ? 421  VAL A CB  1 
ATOM   3310  C  CG1 . VAL A  1  421 ? 45.254  304.327 197.769 1.00 28.10  ? 421  VAL A CG1 1 
ATOM   3311  C  CG2 . VAL A  1  421 ? 45.466  301.799 197.954 1.00 24.67  ? 421  VAL A CG2 1 
ATOM   3312  N  N   . ASN A  1  422 ? 43.907  300.561 195.405 1.00 25.81  ? 422  ASN A N   1 
ATOM   3313  C  CA  . ASN A  1  422 ? 44.122  299.451 194.494 1.00 26.53  ? 422  ASN A CA  1 
ATOM   3314  C  C   . ASN A  1  422 ? 43.227  299.557 193.270 1.00 35.22  ? 422  ASN A C   1 
ATOM   3315  O  O   . ASN A  1  422 ? 43.663  299.253 192.167 1.00 25.75  ? 422  ASN A O   1 
ATOM   3316  C  CB  . ASN A  1  422 ? 43.900  298.125 195.205 1.00 27.19  ? 422  ASN A CB  1 
ATOM   3317  C  CG  . ASN A  1  422 ? 45.129  297.751 196.014 1.00 29.10  ? 422  ASN A CG  1 
ATOM   3318  O  OD1 . ASN A  1  422 ? 46.163  297.394 195.433 1.00 30.52  ? 422  ASN A OD1 1 
ATOM   3319  N  ND2 . ASN A  1  422 ? 45.040  297.866 197.357 1.00 26.47  ? 422  ASN A ND2 1 
ATOM   3320  N  N   . MET A  1  423 ? 41.989  299.994 193.439 1.00 25.99  ? 423  MET A N   1 
ATOM   3321  C  CA  . MET A  1  423 ? 41.134  300.253 192.268 1.00 26.71  ? 423  MET A CA  1 
ATOM   3322  C  C   . MET A  1  423 ? 41.716  301.346 191.382 1.00 27.90  ? 423  MET A C   1 
ATOM   3323  O  O   . MET A  1  423 ? 41.584  301.285 190.135 1.00 27.28  ? 423  MET A O   1 
ATOM   3324  C  CB  . MET A  1  423 ? 39.720  300.637 192.724 1.00 25.58  ? 423  MET A CB  1 
ATOM   3325  C  CG  . MET A  1  423 ? 38.773  300.773 191.478 1.00 25.40  ? 423  MET A CG  1 
ATOM   3326  S  SD  . MET A  1  423 ? 37.101  301.252 192.040 1.00 34.68  ? 423  MET A SD  1 
ATOM   3327  C  CE  . MET A  1  423 ? 36.669  299.757 192.824 1.00 35.92  ? 423  MET A CE  1 
ATOM   3328  N  N   . THR A  1  424 ? 42.368  302.346 191.983 1.00 27.14  ? 424  THR A N   1 
ATOM   3329  C  CA  . THR A  1  424 ? 42.960  303.396 191.166 1.00 24.02  ? 424  THR A CA  1 
ATOM   3330  C  C   . THR A  1  424 ? 44.127  302.866 190.344 1.00 28.04  ? 424  THR A C   1 
ATOM   3331  O  O   . THR A  1  424 ? 44.244  303.135 189.126 1.00 25.53  ? 424  THR A O   1 
ATOM   3332  C  CB  . THR A  1  424 ? 43.452  304.541 192.090 1.00 25.09  ? 424  THR A CB  1 
ATOM   3333  O  OG1 . THR A  1  424 ? 42.362  305.090 192.841 1.00 26.10  ? 424  THR A OG1 1 
ATOM   3334  C  CG2 . THR A  1  424 ? 44.020  305.649 191.246 1.00 25.53  ? 424  THR A CG2 1 
ATOM   3335  N  N   . PHE A  1  425 ? 45.063  302.157 191.013 1.00 27.00  ? 425  PHE A N   1 
ATOM   3336  C  CA  . PHE A  1  425 ? 46.342  302.021 190.338 1.00 28.95  ? 425  PHE A CA  1 
ATOM   3337  C  C   . PHE A  1  425 ? 46.558  300.653 189.714 1.00 25.12  ? 425  PHE A C   1 
ATOM   3338  O  O   . PHE A  1  425 ? 47.342  300.530 188.802 1.00 25.13  ? 425  PHE A O   1 
ATOM   3339  C  CB  . PHE A  1  425 ? 47.494  302.364 191.320 1.00 23.74  ? 425  PHE A CB  1 
ATOM   3340  C  CG  . PHE A  1  425 ? 47.480  303.794 191.729 1.00 23.71  ? 425  PHE A CG  1 
ATOM   3341  C  CD1 . PHE A  1  425 ? 47.740  304.790 190.820 1.00 25.13  ? 425  PHE A CD1 1 
ATOM   3342  C  CD2 . PHE A  1  425 ? 47.144  304.124 193.085 1.00 26.45  ? 425  PHE A CD2 1 
ATOM   3343  C  CE1 . PHE A  1  425 ? 47.682  306.091 191.197 1.00 25.70  ? 425  PHE A CE1 1 
ATOM   3344  C  CE2 . PHE A  1  425 ? 47.062  305.423 193.485 1.00 24.48  ? 425  PHE A CE2 1 
ATOM   3345  C  CZ  . PHE A  1  425 ? 47.287  306.441 192.526 1.00 24.92  ? 425  PHE A CZ  1 
ATOM   3346  N  N   . PHE A  1  426 ? 45.915  299.588 190.220 1.00 25.97  ? 426  PHE A N   1 
ATOM   3347  C  CA  . PHE A  1  426 ? 46.179  298.301 189.603 1.00 24.53  ? 426  PHE A CA  1 
ATOM   3348  C  C   . PHE A  1  426 ? 45.836  298.269 188.104 1.00 24.06  ? 426  PHE A C   1 
ATOM   3349  O  O   . PHE A  1  426 ? 46.633  297.681 187.320 1.00 26.32  ? 426  PHE A O   1 
ATOM   3350  C  CB  . PHE A  1  426 ? 45.405  297.183 190.310 1.00 24.96  ? 426  PHE A CB  1 
ATOM   3351  C  CG  . PHE A  1  426 ? 45.923  295.853 189.903 1.00 31.95  ? 426  PHE A CG  1 
ATOM   3352  C  CD1 . PHE A  1  426 ? 47.154  295.417 190.437 1.00 33.36  ? 426  PHE A CD1 1 
ATOM   3353  C  CD2 . PHE A  1  426 ? 45.276  295.092 188.931 1.00 41.39  ? 426  PHE A CD2 1 
ATOM   3354  C  CE1 . PHE A  1  426 ? 47.707  294.192 190.016 1.00 38.90  ? 426  PHE A CE1 1 
ATOM   3355  C  CE2 . PHE A  1  426 ? 45.800  293.879 188.493 1.00 37.85  ? 426  PHE A CE2 1 
ATOM   3356  C  CZ  . PHE A  1  426 ? 47.011  293.428 189.018 1.00 39.91  ? 426  PHE A CZ  1 
ATOM   3357  N  N   . PRO A  1  427 ? 44.721  298.844 187.640 1.00 23.60  ? 427  PRO A N   1 
ATOM   3358  C  CA  . PRO A  1  427 ? 44.430  298.768 186.184 1.00 27.57  ? 427  PRO A CA  1 
ATOM   3359  C  C   . PRO A  1  427 ? 45.429  299.550 185.353 1.00 33.08  ? 427  PRO A C   1 
ATOM   3360  O  O   . PRO A  1  427 ? 45.481  299.362 184.131 1.00 26.63  ? 427  PRO A O   1 
ATOM   3361  C  CB  . PRO A  1  427 ? 43.006  299.353 186.030 1.00 24.72  ? 427  PRO A CB  1 
ATOM   3362  C  CG  . PRO A  1  427 ? 42.391  299.324 187.442 1.00 29.39  ? 427  PRO A CG  1 
ATOM   3363  C  CD  . PRO A  1  427 ? 43.591  299.393 188.438 1.00 29.65  ? 427  PRO A CD  1 
ATOM   3364  N  N   . GLN A  1  428 ? 46.210  300.448 185.967 1.00 27.47  ? 428  GLN A N   1 
ATOM   3365  C  CA  . GLN A  1  428 ? 47.171  301.229 185.206 1.00 26.46  ? 428  GLN A CA  1 
ATOM   3366  C  C   . GLN A  1  428 ? 48.306  300.345 184.710 1.00 24.25  ? 428  GLN A C   1 
ATOM   3367  O  O   . GLN A  1  428 ? 48.980  300.738 183.752 1.00 28.02  ? 428  GLN A O   1 
ATOM   3368  C  CB  . GLN A  1  428 ? 47.669  302.423 186.061 1.00 24.47  ? 428  GLN A CB  1 
ATOM   3369  C  CG  . GLN A  1  428 ? 46.532  303.498 186.357 1.00 27.11  ? 428  GLN A CG  1 
ATOM   3370  C  CD  . GLN A  1  428 ? 47.071  304.689 187.156 1.00 28.62  ? 428  GLN A CD  1 
ATOM   3371  O  OE1 . GLN A  1  428 ? 48.229  304.711 187.523 1.00 25.74  ? 428  GLN A OE1 1 
ATOM   3372  N  NE2 . GLN A  1  428 ? 46.224  305.666 187.426 1.00 23.56  ? 428  GLN A NE2 1 
ATOM   3373  N  N   . HIS A  1  429 ? 48.531  299.170 185.335 1.00 23.25  ? 429  HIS A N   1 
ATOM   3374  C  CA  . HIS A  1  429 ? 49.501  298.243 184.738 1.00 26.35  ? 429  HIS A CA  1 
ATOM   3375  C  C   . HIS A  1  429 ? 49.038  297.827 183.338 1.00 38.24  ? 429  HIS A C   1 
ATOM   3376  O  O   . HIS A  1  429 ? 49.854  297.666 182.438 1.00 28.09  ? 429  HIS A O   1 
ATOM   3377  C  CB  . HIS A  1  429 ? 49.706  296.977 185.547 1.00 24.73  ? 429  HIS A CB  1 
ATOM   3378  C  CG  . HIS A  1  429 ? 50.277  297.197 186.961 1.00 25.31  ? 429  HIS A CG  1 
ATOM   3379  N  ND1 . HIS A  1  429 ? 49.471  297.292 188.070 1.00 23.94  ? 429  HIS A ND1 1 
ATOM   3380  C  CD2 . HIS A  1  429 ? 51.557  297.307 187.416 1.00 25.86  ? 429  HIS A CD2 1 
ATOM   3381  C  CE1 . HIS A  1  429 ? 50.216  297.450 189.174 1.00 22.94  ? 429  HIS A CE1 1 
ATOM   3382  N  NE2 . HIS A  1  429 ? 51.490  297.455 188.810 1.00 24.29  ? 429  HIS A NE2 1 
ATOM   3383  N  N   . PHE A  1  430 ? 47.743  297.581 183.163 1.00 27.83  ? 430  PHE A N   1 
ATOM   3384  C  CA  . PHE A  1  430 ? 47.195  297.162 181.858 1.00 24.22  ? 430  PHE A CA  1 
ATOM   3385  C  C   . PHE A  1  430 ? 47.348  298.268 180.863 1.00 26.15  ? 430  PHE A C   1 
ATOM   3386  O  O   . PHE A  1  430 ? 47.701  298.028 179.706 1.00 29.00  ? 430  PHE A O   1 
ATOM   3387  C  CB  . PHE A  1  430 ? 45.692  296.817 181.930 1.00 24.11  ? 430  PHE A CB  1 
ATOM   3388  C  CG  . PHE A  1  430 ? 45.371  295.810 183.024 1.00 29.45  ? 430  PHE A CG  1 
ATOM   3389  C  CD1 . PHE A  1  430 ? 46.201  294.718 183.209 1.00 30.82  ? 430  PHE A CD1 1 
ATOM   3390  C  CD2 . PHE A  1  430 ? 44.237  295.921 183.785 1.00 28.96  ? 430  PHE A CD2 1 
ATOM   3391  C  CE1 . PHE A  1  430 ? 45.928  293.770 184.176 1.00 35.94  ? 430  PHE A CE1 1 
ATOM   3392  C  CE2 . PHE A  1  430 ? 43.957  294.965 184.761 1.00 34.32  ? 430  PHE A CE2 1 
ATOM   3393  C  CZ  . PHE A  1  430 ? 44.815  293.905 184.963 1.00 36.86  ? 430  PHE A CZ  1 
ATOM   3394  N  N   . LEU A  1  431 ? 47.019  299.492 181.298 1.00 25.51  ? 431  LEU A N   1 
ATOM   3395  C  CA  . LEU A  1  431 ? 47.176  300.620 180.401 1.00 26.58  ? 431  LEU A CA  1 
ATOM   3396  C  C   . LEU A  1  431 ? 48.615  300.752 179.944 1.00 33.28  ? 431  LEU A C   1 
ATOM   3397  O  O   . LEU A  1  431 ? 48.867  301.035 178.765 1.00 28.00  ? 431  LEU A O   1 
ATOM   3398  C  CB  . LEU A  1  431 ? 46.711  301.884 181.126 1.00 23.60  ? 431  LEU A CB  1 
ATOM   3399  C  CG  . LEU A  1  431 ? 45.225  301.927 181.419 1.00 24.52  ? 431  LEU A CG  1 
ATOM   3400  C  CD1 . LEU A  1  431 ? 44.968  303.212 182.226 1.00 23.43  ? 431  LEU A CD1 1 
ATOM   3401  C  CD2 . LEU A  1  431 ? 44.376  301.995 180.055 1.00 22.24  ? 431  LEU A CD2 1 
ATOM   3402  N  N   . GLY A  1  432 ? 49.581  300.557 180.864 1.00 27.19  ? 432  GLY A N   1 
ATOM   3403  C  CA  . GLY A  1  432 ? 50.989  300.664 180.467 1.00 27.21  ? 432  GLY A CA  1 
ATOM   3404  C  C   . GLY A  1  432 ? 51.454  299.541 179.530 1.00 29.00  ? 432  GLY A C   1 
ATOM   3405  O  O   . GLY A  1  432 ? 52.098  299.811 178.519 1.00 27.61  ? 432  GLY A O   1 
ATOM   3406  N  N   . LEU A  1  433 ? 51.201  298.269 179.898 1.00 27.51  ? 433  LEU A N   1 
ATOM   3407  C  CA  . LEU A  1  433 ? 51.548  297.153 179.003 1.00 25.93  ? 433  LEU A CA  1 
ATOM   3408  C  C   . LEU A  1  433 ? 50.927  297.391 177.631 1.00 30.64  ? 433  LEU A C   1 
ATOM   3409  O  O   . LEU A  1  433 ? 51.557  297.145 176.599 1.00 28.20  ? 433  LEU A O   1 
ATOM   3410  C  CB  . LEU A  1  433 ? 51.029  295.800 179.556 1.00 22.90  ? 433  LEU A CB  1 
ATOM   3411  C  CG  . LEU A  1  433 ? 51.772  295.415 180.890 1.00 27.52  ? 433  LEU A CG  1 
ATOM   3412  C  CD1 . LEU A  1  433 ? 51.128  294.197 181.534 1.00 29.74  ? 433  LEU A CD1 1 
ATOM   3413  C  CD2 . LEU A  1  433 ? 53.291  295.146 180.576 1.00 29.56  ? 433  LEU A CD2 1 
ATOM   3414  N  N   . SER A  1  434 ? 49.684  297.887 177.587 1.00 27.54  ? 434  SER A N   1 
ATOM   3415  C  CA  . SER A  1  434 ? 49.099  298.053 176.248 1.00 28.27  ? 434  SER A CA  1 
ATOM   3416  C  C   . SER A  1  434 ? 49.504  299.364 175.580 1.00 31.75  ? 434  SER A C   1 
ATOM   3417  O  O   . SER A  1  434 ? 49.007  299.650 174.490 1.00 29.81  ? 434  SER A O   1 
ATOM   3418  C  CB  . SER A  1  434 ? 47.561  297.922 176.325 1.00 26.02  ? 434  SER A CB  1 
ATOM   3419  O  OG  . SER A  1  434 ? 46.995  298.891 177.185 1.00 26.11  ? 434  SER A OG  1 
ATOM   3420  N  N   . GLY A  1  435 ? 50.393  300.174 176.173 1.00 26.33  ? 435  GLY A N   1 
ATOM   3421  C  CA  . GLY A  1  435 ? 50.980  301.260 175.414 1.00 23.06  ? 435  GLY A CA  1 
ATOM   3422  C  C   . GLY A  1  435 ? 50.414  302.643 175.690 1.00 29.41  ? 435  GLY A C   1 
ATOM   3423  O  O   . GLY A  1  435 ? 50.804  303.587 175.023 1.00 25.95  ? 435  GLY A O   1 
ATOM   3424  N  N   . MET A  1  436 ? 49.591  302.832 176.696 1.00 29.90  ? 436  MET A N   1 
ATOM   3425  C  CA  . MET A  1  436 ? 49.139  304.208 176.948 1.00 24.79  ? 436  MET A CA  1 
ATOM   3426  C  C   . MET A  1  436 ? 50.277  305.068 177.535 1.00 27.37  ? 436  MET A C   1 
ATOM   3427  O  O   . MET A  1  436 ? 50.787  304.712 178.617 1.00 28.08  ? 436  MET A O   1 
ATOM   3428  C  CB  . MET A  1  436 ? 47.935  304.218 177.922 1.00 24.78  ? 436  MET A CB  1 
ATOM   3429  C  CG  . MET A  1  436 ? 47.372  305.654 178.075 1.00 30.94  ? 436  MET A CG  1 
ATOM   3430  S  SD  . MET A  1  436 ? 46.177  305.773 179.508 1.00 30.14  ? 436  MET A SD  1 
ATOM   3431  C  CE  . MET A  1  436 ? 46.169  307.518 179.686 1.00 23.90  ? 436  MET A CE  1 
ATOM   3432  N  N   . PRO A  1  437 ? 50.640  306.222 176.905 1.00 28.82  ? 437  PRO A N   1 
ATOM   3433  C  CA  . PRO A  1  437 ? 51.682  307.104 177.470 1.00 26.48  ? 437  PRO A CA  1 
ATOM   3434  C  C   . PRO A  1  437 ? 51.227  307.736 178.777 1.00 29.49  ? 437  PRO A C   1 
ATOM   3435  O  O   . PRO A  1  437 ? 50.038  308.017 178.973 1.00 27.33  ? 437  PRO A O   1 
ATOM   3436  C  CB  . PRO A  1  437 ? 51.839  308.199 176.394 1.00 21.21  ? 437  PRO A CB  1 
ATOM   3437  C  CG  . PRO A  1  437 ? 51.460  307.411 175.018 1.00 22.65  ? 437  PRO A CG  1 
ATOM   3438  C  CD  . PRO A  1  437 ? 50.189  306.720 175.594 1.00 26.96  ? 437  PRO A CD  1 
ATOM   3439  N  N   . ARG A  1  438 ? 52.224  308.112 179.599 1.00 22.88  ? 438  ARG A N   1 
ATOM   3440  C  CA  . ARG A  1  438 ? 51.915  308.953 180.757 1.00 24.03  ? 438  ARG A CA  1 
ATOM   3441  C  C   . ARG A  1  438 ? 51.965  310.409 180.290 1.00 27.43  ? 438  ARG A C   1 
ATOM   3442  O  O   . ARG A  1  438 ? 52.356  310.709 179.145 1.00 26.88  ? 438  ARG A O   1 
ATOM   3443  C  CB  . ARG A  1  438 ? 52.908  308.688 181.943 1.00 22.35  ? 438  ARG A CB  1 
ATOM   3444  C  CG  . ARG A  1  438 ? 54.279  309.067 181.544 1.00 23.91  ? 438  ARG A CG  1 
ATOM   3445  C  CD  . ARG A  1  438 ? 55.239  308.599 182.739 1.00 28.73  ? 438  ARG A CD  1 
ATOM   3446  N  NE  . ARG A  1  438 ? 55.247  309.555 183.872 1.00 25.23  ? 438  ARG A NE  1 
ATOM   3447  C  CZ  . ARG A  1  438 ? 56.271  309.633 184.742 1.00 25.07  ? 438  ARG A CZ  1 
ATOM   3448  N  NH1 . ARG A  1  438 ? 57.299  308.746 184.691 1.00 23.27  ? 438  ARG A NH1 1 
ATOM   3449  N  NH2 . ARG A  1  438 ? 56.237  310.548 185.724 1.00 23.51  ? 438  ARG A NH2 1 
ATOM   3450  N  N   . ARG A  1  439 ? 51.447  311.297 181.132 1.00 25.66  ? 439  ARG A N   1 
ATOM   3451  C  CA  . ARG A  1  439 ? 51.434  312.742 180.880 1.00 23.71  ? 439  ARG A CA  1 
ATOM   3452  C  C   . ARG A  1  439 ? 50.488  313.109 179.742 1.00 23.86  ? 439  ARG A C   1 
ATOM   3453  O  O   . ARG A  1  439 ? 50.570  314.179 179.147 1.00 27.83  ? 439  ARG A O   1 
ATOM   3454  C  CB  . ARG A  1  439 ? 52.833  313.293 180.687 1.00 24.78  ? 439  ARG A CB  1 
ATOM   3455  C  CG  . ARG A  1  439 ? 53.570  313.340 182.095 1.00 23.94  ? 439  ARG A CG  1 
ATOM   3456  C  CD  . ARG A  1  439 ? 55.114  313.226 181.797 1.00 24.68  ? 439  ARG A CD  1 
ATOM   3457  N  NE  . ARG A  1  439 ? 55.790  313.438 183.080 1.00 25.05  ? 439  ARG A NE  1 
ATOM   3458  C  CZ  . ARG A  1  439 ? 57.076  313.596 183.193 1.00 25.69  ? 439  ARG A CZ  1 
ATOM   3459  N  NH1 . ARG A  1  439 ? 57.875  313.503 182.153 1.00 21.50  ? 439  ARG A NH1 1 
ATOM   3460  N  NH2 . ARG A  1  439 ? 57.606  313.867 184.378 1.00 24.27  ? 439  ARG A NH2 1 
ATOM   3461  N  N   . TYR A  1  440 ? 49.481  312.279 179.546 1.00 23.30  ? 440  TYR A N   1 
ATOM   3462  C  CA  . TYR A  1  440 ? 48.446  312.516 178.548 1.00 23.00  ? 440  TYR A CA  1 
ATOM   3463  C  C   . TYR A  1  440 ? 47.130  313.017 179.160 1.00 28.94  ? 440  TYR A C   1 
ATOM   3464  O  O   . TYR A  1  440 ? 46.674  312.513 180.200 1.00 25.67  ? 440  TYR A O   1 
ATOM   3465  C  CB  . TYR A  1  440 ? 48.186  311.225 177.783 1.00 24.82  ? 440  TYR A CB  1 
ATOM   3466  C  CG  . TYR A  1  440 ? 49.049  311.066 176.521 1.00 26.29  ? 440  TYR A CG  1 
ATOM   3467  C  CD1 . TYR A  1  440 ? 50.349  311.606 176.462 1.00 26.05  ? 440  TYR A CD1 1 
ATOM   3468  C  CD2 . TYR A  1  440 ? 48.559  310.350 175.416 1.00 23.97  ? 440  TYR A CD2 1 
ATOM   3469  C  CE1 . TYR A  1  440 ? 51.142  311.475 175.251 1.00 23.04  ? 440  TYR A CE1 1 
ATOM   3470  C  CE2 . TYR A  1  440 ? 49.306  310.217 174.218 1.00 26.76  ? 440  TYR A CE2 1 
ATOM   3471  C  CZ  . TYR A  1  440 ? 50.599  310.766 174.161 1.00 25.44  ? 440  TYR A CZ  1 
ATOM   3472  O  OH  . TYR A  1  440 ? 51.365  310.623 173.025 1.00 27.71  ? 440  TYR A OH  1 
ATOM   3473  N  N   . SER A  1  441 ? 46.491  313.987 178.473 1.00 25.15  ? 441  SER A N   1 
ATOM   3474  C  CA  . SER A  1  441 ? 45.201  314.508 178.913 1.00 28.47  ? 441  SER A CA  1 
ATOM   3475  C  C   . SER A  1  441 ? 44.030  313.737 178.334 1.00 30.06  ? 441  SER A C   1 
ATOM   3476  O  O   . SER A  1  441 ? 42.898  313.941 178.779 1.00 29.42  ? 441  SER A O   1 
ATOM   3477  C  CB  . SER A  1  441 ? 45.033  315.971 178.512 1.00 29.65  ? 441  SER A CB  1 
ATOM   3478  O  OG  . SER A  1  441 ? 44.982  316.057 177.048 1.00 34.58  ? 441  SER A OG  1 
ATOM   3479  N  N   . ASP A  1  442 ? 44.272  312.843 177.384 1.00 27.45  ? 442  ASP A N   1 
ATOM   3480  C  CA  . ASP A  1  442 ? 43.212  312.084 176.720 1.00 25.18  ? 442  ASP A CA  1 
ATOM   3481  C  C   . ASP A  1  442 ? 43.909  310.899 176.051 1.00 31.51  ? 442  ASP A C   1 
ATOM   3482  O  O   . ASP A  1  442 ? 45.104  310.929 175.848 1.00 29.32  ? 442  ASP A O   1 
ATOM   3483  C  CB  . ASP A  1  442 ? 42.493  312.992 175.653 1.00 26.70  ? 442  ASP A CB  1 
ATOM   3484  C  CG  . ASP A  1  442 ? 41.134  312.452 175.206 1.00 35.32  ? 442  ASP A CG  1 
ATOM   3485  O  OD1 . ASP A  1  442 ? 40.676  311.373 175.654 1.00 28.13  ? 442  ASP A OD1 1 
ATOM   3486  O  OD2 . ASP A  1  442 ? 40.559  313.122 174.319 1.00 30.36  ? 442  ASP A OD2 1 
ATOM   3487  N  N   . TYR A  1  443 ? 43.153  309.883 175.679 1.00 26.64  ? 443  TYR A N   1 
ATOM   3488  C  CA  . TYR A  1  443 ? 43.726  308.618 175.253 1.00 22.53  ? 443  TYR A CA  1 
ATOM   3489  C  C   . TYR A  1  443 ? 42.909  308.051 174.112 1.00 27.76  ? 443  TYR A C   1 
ATOM   3490  O  O   . TYR A  1  443 ? 41.699  308.307 174.010 1.00 28.85  ? 443  TYR A O   1 
ATOM   3491  C  CB  . TYR A  1  443 ? 43.757  307.566 176.398 1.00 28.48  ? 443  TYR A CB  1 
ATOM   3492  C  CG  . TYR A  1  443 ? 42.478  307.648 177.254 1.00 30.54  ? 443  TYR A CG  1 
ATOM   3493  C  CD1 . TYR A  1  443 ? 41.283  307.012 176.872 1.00 23.86  ? 443  TYR A CD1 1 
ATOM   3494  C  CD2 . TYR A  1  443 ? 42.478  308.382 178.439 1.00 28.81  ? 443  TYR A CD2 1 
ATOM   3495  C  CE1 . TYR A  1  443 ? 40.113  307.130 177.660 1.00 32.45  ? 443  TYR A CE1 1 
ATOM   3496  C  CE2 . TYR A  1  443 ? 41.324  308.500 179.210 1.00 27.70  ? 443  TYR A CE2 1 
ATOM   3497  C  CZ  . TYR A  1  443 ? 40.187  307.861 178.840 1.00 30.89  ? 443  TYR A CZ  1 
ATOM   3498  O  OH  . TYR A  1  443 ? 39.034  307.966 179.613 1.00 28.15  ? 443  TYR A OH  1 
ATOM   3499  N  N   . PRO A  1  444 ? 43.546  307.290 173.213 1.00 33.34  ? 444  PRO A N   1 
ATOM   3500  C  CA  . PRO A  1  444 ? 42.767  306.502 172.214 1.00 28.20  ? 444  PRO A CA  1 
ATOM   3501  C  C   . PRO A  1  444 ? 41.700  305.651 172.907 1.00 36.24  ? 444  PRO A C   1 
ATOM   3502  O  O   . PRO A  1  444 ? 41.867  305.176 174.057 1.00 30.39  ? 444  PRO A O   1 
ATOM   3503  C  CB  . PRO A  1  444 ? 43.835  305.631 171.549 1.00 25.90  ? 444  PRO A CB  1 
ATOM   3504  C  CG  . PRO A  1  444 ? 45.152  306.488 171.617 1.00 26.42  ? 444  PRO A CG  1 
ATOM   3505  C  CD  . PRO A  1  444 ? 45.001  307.097 173.095 1.00 30.03  ? 444  PRO A CD  1 
ATOM   3506  N  N   . ASP A  1  445 ? 40.602  305.418 172.156 1.00 26.96  ? 445  ASP A N   1 
ATOM   3507  C  CA  . ASP A  1  445 ? 39.361  304.896 172.727 1.00 27.40  ? 445  ASP A CA  1 
ATOM   3508  C  C   . ASP A  1  445 ? 39.532  303.544 173.384 1.00 31.82  ? 445  ASP A C   1 
ATOM   3509  O  O   . ASP A  1  445 ? 38.845  303.245 174.366 1.00 30.72  ? 445  ASP A O   1 
ATOM   3510  C  CB  . ASP A  1  445 ? 38.261  304.806 171.638 1.00 25.99  ? 445  ASP A CB  1 
ATOM   3511  C  CG  . ASP A  1  445 ? 37.837  306.164 171.125 1.00 32.41  ? 445  ASP A CG  1 
ATOM   3512  O  OD1 . ASP A  1  445 ? 38.315  307.211 171.636 1.00 32.17  ? 445  ASP A OD1 1 
ATOM   3513  O  OD2 . ASP A  1  445 ? 36.965  306.229 170.196 1.00 31.22  ? 445  ASP A OD2 1 
ATOM   3514  N  N   . ALA A  1  446 ? 40.413  302.700 172.863 1.00 26.12  ? 446  ALA A N   1 
ATOM   3515  C  CA  . ALA A  1  446 ? 40.581  301.360 173.443 1.00 27.61  ? 446  ALA A CA  1 
ATOM   3516  C  C   . ALA A  1  446 ? 40.909  301.420 174.955 1.00 28.19  ? 446  ALA A C   1 
ATOM   3517  O  O   . ALA A  1  446 ? 40.621  300.477 175.692 1.00 28.26  ? 446  ALA A O   1 
ATOM   3518  C  CB  . ALA A  1  446 ? 41.685  300.603 172.698 1.00 30.26  ? 446  ALA A CB  1 
ATOM   3519  N  N   . TYR A  1  447 ? 41.532  302.499 175.426 1.00 25.51  ? 447  TYR A N   1 
ATOM   3520  C  CA  . TYR A  1  447 ? 42.009  302.578 176.823 1.00 23.17  ? 447  TYR A CA  1 
ATOM   3521  C  C   . TYR A  1  447 ? 40.901  303.024 177.778 1.00 32.87  ? 447  TYR A C   1 
ATOM   3522  O  O   . TYR A  1  447 ? 41.169  303.251 178.951 1.00 30.01  ? 447  TYR A O   1 
ATOM   3523  C  CB  . TYR A  1  447 ? 43.174  303.559 176.947 1.00 26.15  ? 447  TYR A CB  1 
ATOM   3524  C  CG  . TYR A  1  447 ? 44.388  303.213 176.095 1.00 29.03  ? 447  TYR A CG  1 
ATOM   3525  C  CD1 . TYR A  1  447 ? 45.098  302.027 176.340 1.00 24.92  ? 447  TYR A CD1 1 
ATOM   3526  C  CD2 . TYR A  1  447 ? 44.797  304.038 175.028 1.00 27.31  ? 447  TYR A CD2 1 
ATOM   3527  C  CE1 . TYR A  1  447 ? 46.198  301.662 175.606 1.00 26.18  ? 447  TYR A CE1 1 
ATOM   3528  C  CE2 . TYR A  1  447 ? 45.900  303.652 174.224 1.00 28.82  ? 447  TYR A CE2 1 
ATOM   3529  C  CZ  . TYR A  1  447 ? 46.608  302.486 174.539 1.00 32.03  ? 447  TYR A CZ  1 
ATOM   3530  O  OH  . TYR A  1  447 ? 47.697  302.111 173.787 1.00 29.88  ? 447  TYR A OH  1 
ATOM   3531  N  N   . THR A  1  448 ? 39.673  303.188 177.288 1.00 27.40  ? 448  THR A N   1 
ATOM   3532  C  CA  . THR A  1  448 ? 38.634  303.829 178.089 1.00 25.48  ? 448  THR A CA  1 
ATOM   3533  C  C   . THR A  1  448 ? 38.308  303.049 179.343 1.00 26.45  ? 448  THR A C   1 
ATOM   3534  O  O   . THR A  1  448 ? 38.171  303.637 180.443 1.00 27.92  ? 448  THR A O   1 
ATOM   3535  C  CB  . THR A  1  448 ? 37.367  304.013 177.217 1.00 30.23  ? 448  THR A CB  1 
ATOM   3536  O  OG1 . THR A  1  448 ? 37.701  304.984 176.223 1.00 29.26  ? 448  THR A OG1 1 
ATOM   3537  C  CG2 . THR A  1  448 ? 36.118  304.478 178.097 1.00 30.25  ? 448  THR A CG2 1 
ATOM   3538  N  N   . MET A  1  449 ? 38.148  301.717 179.223 1.00 26.25  ? 449  MET A N   1 
ATOM   3539  C  CA  . MET A  1  449 ? 37.640  300.995 180.395 1.00 35.91  ? 449  MET A CA  1 
ATOM   3540  C  C   . MET A  1  449 ? 38.579  301.115 181.618 1.00 28.11  ? 449  MET A C   1 
ATOM   3541  O  O   . MET A  1  449 ? 38.116  301.344 182.753 1.00 28.69  ? 449  MET A O   1 
ATOM   3542  C  CB  . MET A  1  449 ? 37.413  299.527 180.080 1.00 28.68  ? 449  MET A CB  1 
ATOM   3543  C  CG  . MET A  1  449 ? 37.033  298.814 181.409 1.00 40.30  ? 449  MET A CG  1 
ATOM   3544  S  SD  . MET A  1  449 ? 36.468  297.178 181.133 1.00 57.11  ? 449  MET A SD  1 
ATOM   3545  C  CE  . MET A  1  449 ? 34.867  297.454 180.356 1.00 49.95  ? 449  MET A CE  1 
ATOM   3546  N  N   . TRP A  1  450 ? 39.881  300.880 181.424 1.00 26.41  ? 450  TRP A N   1 
ATOM   3547  C  CA  . TRP A  1  450 ? 40.759  300.933 182.610 1.00 34.60  ? 450  TRP A CA  1 
ATOM   3548  C  C   . TRP A  1  450 ? 40.866  302.347 183.162 1.00 30.16  ? 450  TRP A C   1 
ATOM   3549  O  O   . TRP A  1  450 ? 40.940  302.546 184.393 1.00 26.74  ? 450  TRP A O   1 
ATOM   3550  C  CB  . TRP A  1  450 ? 42.149  300.364 182.286 1.00 28.51  ? 450  TRP A CB  1 
ATOM   3551  C  CG  . TRP A  1  450 ? 42.091  298.945 181.754 1.00 27.50  ? 450  TRP A CG  1 
ATOM   3552  C  CD1 . TRP A  1  450 ? 42.743  298.448 180.625 1.00 28.09  ? 450  TRP A CD1 1 
ATOM   3553  C  CD2 . TRP A  1  450 ? 41.339  297.848 182.291 1.00 31.60  ? 450  TRP A CD2 1 
ATOM   3554  N  NE1 . TRP A  1  450 ? 42.437  297.111 180.466 1.00 32.12  ? 450  TRP A NE1 1 
ATOM   3555  C  CE2 . TRP A  1  450 ? 41.575  296.725 181.452 1.00 29.74  ? 450  TRP A CE2 1 
ATOM   3556  C  CE3 . TRP A  1  450 ? 40.508  297.694 183.410 1.00 36.88  ? 450  TRP A CE3 1 
ATOM   3557  C  CZ2 . TRP A  1  450 ? 40.998  295.493 181.696 1.00 37.11  ? 450  TRP A CZ2 1 
ATOM   3558  C  CZ3 . TRP A  1  450 ? 39.930  296.478 183.623 1.00 43.62  ? 450  TRP A CZ3 1 
ATOM   3559  C  CH2 . TRP A  1  450 ? 40.183  295.390 182.795 1.00 42.44  ? 450  TRP A CH2 1 
ATOM   3560  N  N   . ASN A  1  451 ? 40.860  303.353 182.275 1.00 28.33  ? 451  ASN A N   1 
ATOM   3561  C  CA  . ASN A  1  451 ? 40.856  304.734 182.772 1.00 28.62  ? 451  ASN A CA  1 
ATOM   3562  C  C   . ASN A  1  451 ? 39.599  305.055 183.578 1.00 39.97  ? 451  ASN A C   1 
ATOM   3563  O  O   . ASN A  1  451 ? 39.666  305.816 184.540 1.00 28.69  ? 451  ASN A O   1 
ATOM   3564  C  CB  . ASN A  1  451 ? 40.985  305.738 181.608 1.00 29.15  ? 451  ASN A CB  1 
ATOM   3565  C  CG  . ASN A  1  451 ? 42.451  305.940 181.231 1.00 26.63  ? 451  ASN A CG  1 
ATOM   3566  O  OD1 . ASN A  1  451 ? 43.246  306.562 181.993 1.00 27.69  ? 451  ASN A OD1 1 
ATOM   3567  N  ND2 . ASN A  1  451 ? 42.833  305.379 180.105 1.00 25.48  ? 451  ASN A ND2 1 
ATOM   3568  N  N   . THR A  1  452 ? 38.446  304.554 183.136 1.00 27.26  ? 452  THR A N   1 
ATOM   3569  C  CA  . THR A  1  452 ? 37.202  304.760 183.870 1.00 31.96  ? 452  THR A CA  1 
ATOM   3570  C  C   . THR A  1  452 ? 37.281  304.125 185.245 1.00 28.13  ? 452  THR A C   1 
ATOM   3571  O  O   . THR A  1  452 ? 36.952  304.765 186.241 1.00 30.49  ? 452  THR A O   1 
ATOM   3572  C  CB  . THR A  1  452 ? 36.034  304.170 183.057 1.00 32.22  ? 452  THR A CB  1 
ATOM   3573  O  OG1 . THR A  1  452 ? 36.045  304.749 181.735 1.00 31.39  ? 452  THR A OG1 1 
ATOM   3574  C  CG2 . THR A  1  452 ? 34.695  304.441 183.727 1.00 27.76  ? 452  THR A CG2 1 
ATOM   3575  N  N   . ILE A  1  453 ? 37.722  302.865 185.323 1.00 25.43  ? 453  ILE A N   1 
ATOM   3576  C  CA  . ILE A  1  453 ? 37.836  302.228 186.639 1.00 23.92  ? 453  ILE A CA  1 
ATOM   3577  C  C   . ILE A  1  453 ? 38.820  302.978 187.524 1.00 33.78  ? 453  ILE A C   1 
ATOM   3578  O  O   . ILE A  1  453 ? 38.552  303.220 188.723 1.00 31.76  ? 453  ILE A O   1 
ATOM   3579  C  CB  . ILE A  1  453 ? 38.219  300.751 186.476 1.00 28.97  ? 453  ILE A CB  1 
ATOM   3580  C  CG1 . ILE A  1  453 ? 37.037  300.045 185.766 1.00 33.94  ? 453  ILE A CG1 1 
ATOM   3581  C  CG2 . ILE A  1  453 ? 38.588  300.132 187.848 1.00 30.22  ? 453  ILE A CG2 1 
ATOM   3582  C  CD1 . ILE A  1  453 ? 37.404  298.665 185.178 1.00 41.36  ? 453  ILE A CD1 1 
ATOM   3583  N  N   . SER A  1  454 ? 39.986  303.343 186.972 1.00 29.15  ? 454  SER A N   1 
ATOM   3584  C  CA  . SER A  1  454 ? 41.016  304.040 187.743 1.00 25.90  ? 454  SER A CA  1 
ATOM   3585  C  C   . SER A  1  454 ? 40.484  305.354 188.341 1.00 31.41  ? 454  SER A C   1 
ATOM   3586  O  O   . SER A  1  454 ? 40.702  305.652 189.526 1.00 27.35  ? 454  SER A O   1 
ATOM   3587  C  CB  . SER A  1  454 ? 42.248  304.311 186.852 1.00 23.67  ? 454  SER A CB  1 
ATOM   3588  O  OG  . SER A  1  454 ? 43.140  305.125 187.644 1.00 26.25  ? 454  SER A OG  1 
ATOM   3589  N  N   . SER A  1  455 ? 39.735  306.134 187.555 1.00 29.87  ? 455  SER A N   1 
ATOM   3590  C  CA  . SER A  1  455 ? 39.160  307.399 188.051 1.00 27.33  ? 455  SER A CA  1 
ATOM   3591  C  C   . SER A  1  455 ? 38.083  307.157 189.115 1.00 34.07  ? 455  SER A C   1 
ATOM   3592  O  O   . SER A  1  455 ? 37.962  307.916 190.091 1.00 26.89  ? 455  SER A O   1 
ATOM   3593  C  CB  . SER A  1  455 ? 38.627  308.212 186.823 1.00 22.63  ? 455  SER A CB  1 
ATOM   3594  O  OG  . SER A  1  455 ? 39.750  308.714 186.050 1.00 27.95  ? 455  SER A OG  1 
ATOM   3595  N  N   . MET A  1  456 ? 37.314  306.094 188.982 1.00 25.72  ? 456  MET A N   1 
ATOM   3596  C  CA  . MET A  1  456 ? 36.333  305.789 190.040 1.00 29.66  ? 456  MET A CA  1 
ATOM   3597  C  C   . MET A  1  456 ? 37.054  305.437 191.340 1.00 40.27  ? 456  MET A C   1 
ATOM   3598  O  O   . MET A  1  456 ? 36.664  305.883 192.426 1.00 26.76  ? 456  MET A O   1 
ATOM   3599  C  CB  . MET A  1  456 ? 35.390  304.649 189.589 1.00 26.22  ? 456  MET A CB  1 
ATOM   3600  C  CG  . MET A  1  456 ? 34.500  305.098 188.379 1.00 24.84  ? 456  MET A CG  1 
ATOM   3601  S  SD  . MET A  1  456 ? 33.650  303.623 187.839 1.00 35.21  ? 456  MET A SD  1 
ATOM   3602  C  CE  . MET A  1  456 ? 32.480  304.362 186.673 1.00 34.23  ? 456  MET A CE  1 
ATOM   3603  N  N   . GLY A  1  457 ? 38.126  304.670 191.239 1.00 29.43  ? 457  GLY A N   1 
ATOM   3604  C  CA  . GLY A  1  457 ? 38.953  304.363 192.419 1.00 26.01  ? 457  GLY A CA  1 
ATOM   3605  C  C   . GLY A  1  457 ? 39.486  305.604 193.113 1.00 27.36  ? 457  GLY A C   1 
ATOM   3606  O  O   . GLY A  1  457 ? 39.522  305.664 194.364 1.00 29.54  ? 457  GLY A O   1 
ATOM   3607  N  N   . SER A  1  458 ? 39.776  306.658 192.357 1.00 28.02  ? 458  SER A N   1 
ATOM   3608  C  CA  . SER A  1  458 ? 40.325  307.851 193.009 1.00 28.43  ? 458  SER A CA  1 
ATOM   3609  C  C   . SER A  1  458 ? 39.277  308.573 193.865 1.00 29.05  ? 458  SER A C   1 
ATOM   3610  O  O   . SER A  1  458 ? 39.653  309.264 194.808 1.00 27.36  ? 458  SER A O   1 
ATOM   3611  C  CB  . SER A  1  458 ? 40.925  308.811 191.947 1.00 32.18  ? 458  SER A CB  1 
ATOM   3612  O  OG  . SER A  1  458 ? 39.853  309.469 191.212 1.00 27.22  ? 458  SER A OG  1 
ATOM   3613  N  N   . PHE A  1  459 ? 37.983  308.485 193.508 1.00 26.53  ? 459  PHE A N   1 
ATOM   3614  C  CA  . PHE A  1  459 ? 36.905  308.989 194.366 1.00 31.16  ? 459  PHE A CA  1 
ATOM   3615  C  C   . PHE A  1  459 ? 36.775  308.174 195.655 1.00 28.91  ? 459  PHE A C   1 
ATOM   3616  O  O   . PHE A  1  459 ? 36.465  308.734 196.705 1.00 29.81  ? 459  PHE A O   1 
ATOM   3617  C  CB  . PHE A  1  459 ? 35.537  309.023 193.621 1.00 25.52  ? 459  PHE A CB  1 
ATOM   3618  C  CG  . PHE A  1  459 ? 35.282  310.315 192.915 1.00 31.81  ? 459  PHE A CG  1 
ATOM   3619  C  CD1 . PHE A  1  459 ? 36.311  310.934 192.174 1.00 33.33  ? 459  PHE A CD1 1 
ATOM   3620  C  CD2 . PHE A  1  459 ? 34.017  310.925 192.961 1.00 32.98  ? 459  PHE A CD2 1 
ATOM   3621  C  CE1 . PHE A  1  459 ? 36.105  312.137 191.477 1.00 35.28  ? 459  PHE A CE1 1 
ATOM   3622  C  CE2 . PHE A  1  459 ? 33.779  312.151 192.216 1.00 31.09  ? 459  PHE A CE2 1 
ATOM   3623  C  CZ  . PHE A  1  459 ? 34.842  312.751 191.489 1.00 33.97  ? 459  PHE A CZ  1 
ATOM   3624  N  N   . ILE A  1  460 ? 37.016  306.860 195.619 1.00 27.79  ? 460  ILE A N   1 
ATOM   3625  C  CA  . ILE A  1  460 ? 36.962  306.089 196.864 1.00 26.86  ? 460  ILE A CA  1 
ATOM   3626  C  C   . ILE A  1  460 ? 38.050  306.571 197.829 1.00 31.92  ? 460  ILE A C   1 
ATOM   3627  O  O   . ILE A  1  460 ? 37.813  306.772 199.034 1.00 28.20  ? 460  ILE A O   1 
ATOM   3628  C  CB  . ILE A  1  460 ? 37.087  304.570 196.557 1.00 27.94  ? 460  ILE A CB  1 
ATOM   3629  C  CG1 . ILE A  1  460 ? 35.874  304.074 195.722 1.00 27.35  ? 460  ILE A CG1 1 
ATOM   3630  C  CG2 . ILE A  1  460 ? 37.223  303.758 197.934 1.00 28.48  ? 460  ILE A CG2 1 
ATOM   3631  C  CD1 . ILE A  1  460 ? 36.014  302.555 195.364 1.00 31.01  ? 460  ILE A CD1 1 
ATOM   3632  N  N   . SER A  1  461 ? 39.253  306.831 197.318 1.00 25.41  ? 461  SER A N   1 
ATOM   3633  C  CA  . SER A  1  461 ? 40.332  307.338 198.195 1.00 27.69  ? 461  SER A CA  1 
ATOM   3634  C  C   . SER A  1  461 ? 39.999  308.736 198.702 1.00 32.47  ? 461  SER A C   1 
ATOM   3635  O  O   . SER A  1  461 ? 40.345  309.053 199.841 1.00 29.39  ? 461  SER A O   1 
ATOM   3636  C  CB  . SER A  1  461 ? 41.693  307.340 197.440 1.00 27.69  ? 461  SER A CB  1 
ATOM   3637  O  OG  . SER A  1  461 ? 42.061  306.008 197.130 1.00 31.87  ? 461  SER A OG  1 
ATOM   3638  N  N   . LEU A  1  462 ? 39.313  309.582 197.901 1.00 26.97  ? 462  LEU A N   1 
ATOM   3639  C  CA  . LEU A  1  462 ? 38.826  310.867 198.441 1.00 32.87  ? 462  LEU A CA  1 
ATOM   3640  C  C   . LEU A  1  462 ? 37.926  310.658 199.655 1.00 31.61  ? 462  LEU A C   1 
ATOM   3641  O  O   . LEU A  1  462 ? 38.029  311.385 200.664 1.00 28.40  ? 462  LEU A O   1 
ATOM   3642  C  CB  . LEU A  1  462 ? 38.058  311.654 197.375 1.00 27.34  ? 462  LEU A CB  1 
ATOM   3643  C  CG  . LEU A  1  462 ? 37.286  312.883 197.875 1.00 30.24  ? 462  LEU A CG  1 
ATOM   3644  C  CD1 . LEU A  1  462 ? 38.205  313.973 198.440 1.00 31.91  ? 462  LEU A CD1 1 
ATOM   3645  C  CD2 . LEU A  1  462 ? 36.346  313.415 196.776 1.00 35.88  ? 462  LEU A CD2 1 
ATOM   3646  N  N   . THR A  1  463 ? 37.030  309.675 199.577 1.00 25.04  ? 463  THR A N   1 
ATOM   3647  C  CA  . THR A  1  463 ? 36.112  309.451 200.690 1.00 27.46  ? 463  THR A CA  1 
ATOM   3648  C  C   . THR A  1  463 ? 36.897  309.077 201.933 1.00 32.83  ? 463  THR A C   1 
ATOM   3649  O  O   . THR A  1  463 ? 36.604  309.562 203.042 1.00 30.39  ? 463  THR A O   1 
ATOM   3650  C  CB  . THR A  1  463 ? 35.095  308.362 200.318 1.00 30.57  ? 463  THR A CB  1 
ATOM   3651  O  OG1 . THR A  1  463 ? 34.321  308.833 199.189 1.00 31.57  ? 463  THR A OG1 1 
ATOM   3652  C  CG2 . THR A  1  463 ? 34.103  308.080 201.555 1.00 25.84  ? 463  THR A CG2 1 
ATOM   3653  N  N   . ALA A  1  464 ? 37.927  308.241 201.767 1.00 25.62  ? 464  ALA A N   1 
ATOM   3654  C  CA  . ALA A  1  464 ? 38.829  307.935 202.876 1.00 29.09  ? 464  ALA A CA  1 
ATOM   3655  C  C   . ALA A  1  464 ? 39.553  309.183 203.396 1.00 30.31  ? 464  ALA A C   1 
ATOM   3656  O  O   . ALA A  1  464 ? 39.667  309.367 204.620 1.00 26.42  ? 464  ALA A O   1 
ATOM   3657  C  CB  . ALA A  1  464 ? 39.806  306.839 202.441 1.00 26.52  ? 464  ALA A CB  1 
ATOM   3658  N  N   . VAL A  1  465 ? 40.029  310.065 202.533 1.00 29.96  ? 465  VAL A N   1 
ATOM   3659  C  CA  . VAL A  1  465 ? 40.688  311.276 203.027 1.00 26.01  ? 465  VAL A CA  1 
ATOM   3660  C  C   . VAL A  1  465 ? 39.733  312.130 203.890 1.00 33.01  ? 465  VAL A C   1 
ATOM   3661  O  O   . VAL A  1  465 ? 40.115  312.660 204.945 1.00 28.81  ? 465  VAL A O   1 
ATOM   3662  C  CB  . VAL A  1  465 ? 41.286  312.078 201.860 1.00 34.02  ? 465  VAL A CB  1 
ATOM   3663  C  CG1 . VAL A  1  465 ? 41.699  313.442 202.360 1.00 34.04  ? 465  VAL A CG1 1 
ATOM   3664  C  CG2 . VAL A  1  465 ? 42.500  311.283 201.317 1.00 31.24  ? 465  VAL A CG2 1 
ATOM   3665  N  N   . MET A  1  466 ? 38.506  312.333 203.426 1.00 30.08  ? 466  MET A N   1 
ATOM   3666  C  CA  . MET A  1  466 ? 37.520  313.096 204.173 1.00 31.03  ? 466  MET A CA  1 
ATOM   3667  C  C   . MET A  1  466 ? 37.255  312.443 205.528 1.00 29.67  ? 466  MET A C   1 
ATOM   3668  O  O   . MET A  1  466 ? 37.242  313.115 206.548 1.00 28.43  ? 466  MET A O   1 
ATOM   3669  C  CB  . MET A  1  466 ? 36.212  313.219 203.370 1.00 28.21  ? 466  MET A CB  1 
ATOM   3670  C  CG  . MET A  1  466 ? 36.480  313.996 201.981 1.00 28.50  ? 466  MET A CG  1 
ATOM   3671  S  SD  . MET A  1  466 ? 34.868  314.414 201.184 1.00 32.13  ? 466  MET A SD  1 
ATOM   3672  C  CE  . MET A  1  466 ? 34.311  312.769 200.820 1.00 28.85  ? 466  MET A CE  1 
ATOM   3673  N  N   . LEU A  1  467 ? 37.112  311.120 205.530 1.00 27.90  ? 467  LEU A N   1 
ATOM   3674  C  CA  . LEU A  1  467 ? 36.873  310.426 206.775 1.00 28.26  ? 467  LEU A CA  1 
ATOM   3675  C  C   . LEU A  1  467 ? 38.045  310.617 207.739 1.00 47.73  ? 467  LEU A C   1 
ATOM   3676  O  O   . LEU A  1  467 ? 37.848  310.787 208.933 1.00 30.27  ? 467  LEU A O   1 
ATOM   3677  C  CB  . LEU A  1  467 ? 36.622  308.945 206.481 1.00 27.78  ? 467  LEU A CB  1 
ATOM   3678  C  CG  . LEU A  1  467 ? 36.203  308.151 207.740 1.00 37.58  ? 467  LEU A CG  1 
ATOM   3679  C  CD1 . LEU A  1  467 ? 34.785  308.638 208.220 1.00 36.45  ? 467  LEU A CD1 1 
ATOM   3680  C  CD2 . LEU A  1  467 ? 36.168  306.637 207.483 1.00 31.27  ? 467  LEU A CD2 1 
ATOM   3681  N  N   . MET A  1  468 ? 39.272  310.614 207.227 1.00 28.65  ? 468  MET A N   1 
ATOM   3682  C  CA  . MET A  1  468 ? 40.437  310.847 208.083 1.00 28.19  ? 468  MET A CA  1 
ATOM   3683  C  C   . MET A  1  468 ? 40.358  312.178 208.810 1.00 24.70  ? 468  MET A C   1 
ATOM   3684  O  O   . MET A  1  468 ? 40.688  312.272 210.020 1.00 30.67  ? 468  MET A O   1 
ATOM   3685  C  CB  . MET A  1  468 ? 41.704  310.822 207.212 1.00 32.62  ? 468  MET A CB  1 
ATOM   3686  C  CG  . MET A  1  468 ? 42.960  311.037 208.053 1.00 32.64  ? 468  MET A CG  1 
ATOM   3687  S  SD  . MET A  1  468 ? 44.476  311.404 207.098 1.00 40.52  ? 468  MET A SD  1 
ATOM   3688  C  CE  . MET A  1  468 ? 43.993  313.019 206.426 1.00 50.81  ? 468  MET A CE  1 
ATOM   3689  N  N   . VAL A  1  469 ? 39.875  313.221 208.125 1.00 27.95  ? 469  VAL A N   1 
ATOM   3690  C  CA  . VAL A  1  469 ? 39.764  314.495 208.805 1.00 27.90  ? 469  VAL A CA  1 
ATOM   3691  C  C   . VAL A  1  469 ? 38.732  314.388 209.938 1.00 30.82  ? 469  VAL A C   1 
ATOM   3692  O  O   . VAL A  1  469 ? 38.937  314.907 211.017 1.00 31.05  ? 469  VAL A O   1 
ATOM   3693  C  CB  . VAL A  1  469 ? 39.382  315.589 207.803 1.00 25.40  ? 469  VAL A CB  1 
ATOM   3694  C  CG1 . VAL A  1  469 ? 39.023  316.891 208.512 1.00 25.00  ? 469  VAL A CG1 1 
ATOM   3695  C  CG2 . VAL A  1  469 ? 40.619  315.829 206.824 1.00 24.31  ? 469  VAL A CG2 1 
ATOM   3696  N  N   . PHE A  1  470 ? 37.601  313.750 209.652 1.00 26.50  ? 470  PHE A N   1 
ATOM   3697  C  CA  . PHE A  1  470 ? 36.587  313.576 210.700 1.00 29.98  ? 470  PHE A CA  1 
ATOM   3698  C  C   . PHE A  1  470 ? 37.131  312.786 211.874 1.00 29.82  ? 470  PHE A C   1 
ATOM   3699  O  O   . PHE A  1  470 ? 36.803  313.062 213.049 1.00 29.10  ? 470  PHE A O   1 
ATOM   3700  C  CB  . PHE A  1  470 ? 35.377  312.862 210.093 1.00 26.21  ? 470  PHE A CB  1 
ATOM   3701  C  CG  . PHE A  1  470 ? 34.544  312.195 211.119 1.00 27.89  ? 470  PHE A CG  1 
ATOM   3702  C  CD1 . PHE A  1  470 ? 33.680  312.958 211.871 1.00 26.73  ? 470  PHE A CD1 1 
ATOM   3703  C  CD2 . PHE A  1  470 ? 34.694  310.823 211.375 1.00 30.13  ? 470  PHE A CD2 1 
ATOM   3704  C  CE1 . PHE A  1  470 ? 32.891  312.345 212.875 1.00 31.96  ? 470  PHE A CE1 1 
ATOM   3705  C  CE2 . PHE A  1  470 ? 33.964  310.201 212.353 1.00 33.34  ? 470  PHE A CE2 1 
ATOM   3706  C  CZ  . PHE A  1  470 ? 33.040  310.967 213.124 1.00 30.08  ? 470  PHE A CZ  1 
ATOM   3707  N  N   . ILE A  1  471 ? 37.936  311.762 211.597 1.00 24.16  ? 471  ILE A N   1 
ATOM   3708  C  CA  . ILE A  1  471 ? 38.481  310.923 212.665 1.00 28.15  ? 471  ILE A CA  1 
ATOM   3709  C  C   . ILE A  1  471 ? 39.389  311.720 213.602 1.00 31.31  ? 471  ILE A C   1 
ATOM   3710  O  O   . ILE A  1  471 ? 39.362  311.552 214.838 1.00 32.95  ? 471  ILE A O   1 
ATOM   3711  C  CB  . ILE A  1  471 ? 39.209  309.727 212.044 1.00 31.56  ? 471  ILE A CB  1 
ATOM   3712  C  CG1 . ILE A  1  471 ? 38.150  308.820 211.433 1.00 28.73  ? 471  ILE A CG1 1 
ATOM   3713  C  CG2 . ILE A  1  471 ? 40.088  309.025 213.145 1.00 34.96  ? 471  ILE A CG2 1 
ATOM   3714  C  CD1 . ILE A  1  471 ? 38.709  307.545 210.649 1.00 27.47  ? 471  ILE A CD1 1 
ATOM   3715  N  N   . ILE A  1  472 ? 40.271  312.529 213.023 1.00 27.26  ? 472  ILE A N   1 
ATOM   3716  C  CA  . ILE A  1  472 ? 41.079  313.411 213.828 1.00 27.65  ? 472  ILE A CA  1 
ATOM   3717  C  C   . ILE A  1  472 ? 40.208  314.356 214.622 1.00 29.33  ? 472  ILE A C   1 
ATOM   3718  O  O   . ILE A  1  472 ? 40.444  314.565 215.818 1.00 30.77  ? 472  ILE A O   1 
ATOM   3719  C  CB  . ILE A  1  472 ? 42.076  314.181 212.970 1.00 29.49  ? 472  ILE A CB  1 
ATOM   3720  C  CG1 . ILE A  1  472 ? 43.021  313.156 212.295 1.00 29.50  ? 472  ILE A CG1 1 
ATOM   3721  C  CG2 . ILE A  1  472 ? 42.832  315.174 213.908 1.00 24.42  ? 472  ILE A CG2 1 
ATOM   3722  C  CD1 . ILE A  1  472 ? 43.855  313.772 211.101 1.00 24.07  ? 472  ILE A CD1 1 
ATOM   3723  N  N   . TRP A  1  473 ? 39.206  314.968 213.979 1.00 24.96  ? 473  TRP A N   1 
ATOM   3724  C  CA  . TRP A  1  473 ? 38.309  315.830 214.732 1.00 28.70  ? 473  TRP A CA  1 
ATOM   3725  C  C   . TRP A  1  473 ? 37.662  315.082 215.900 1.00 30.73  ? 473  TRP A C   1 
ATOM   3726  O  O   . TRP A  1  473 ? 37.602  315.595 217.022 1.00 29.56  ? 473  TRP A O   1 
ATOM   3727  C  CB  . TRP A  1  473 ? 37.202  316.379 213.829 1.00 31.03  ? 473  TRP A CB  1 
ATOM   3728  C  CG  . TRP A  1  473 ? 36.146  317.113 214.653 1.00 30.11  ? 473  TRP A CG  1 
ATOM   3729  C  CD1 . TRP A  1  473 ? 36.255  318.384 215.183 1.00 30.80  ? 473  TRP A CD1 1 
ATOM   3730  C  CD2 . TRP A  1  473 ? 34.856  316.606 215.060 1.00 26.45  ? 473  TRP A CD2 1 
ATOM   3731  N  NE1 . TRP A  1  473 ? 35.100  318.677 215.914 1.00 32.07  ? 473  TRP A NE1 1 
ATOM   3732  C  CE2 . TRP A  1  473 ? 34.228  317.614 215.837 1.00 29.63  ? 473  TRP A CE2 1 
ATOM   3733  C  CE3 . TRP A  1  473 ? 34.170  315.388 214.839 1.00 28.77  ? 473  TRP A CE3 1 
ATOM   3734  C  CZ2 . TRP A  1  473 ? 32.922  317.457 216.393 1.00 31.91  ? 473  TRP A CZ2 1 
ATOM   3735  C  CZ3 . TRP A  1  473 ? 32.862  315.234 215.399 1.00 30.78  ? 473  TRP A CZ3 1 
ATOM   3736  C  CH2 . TRP A  1  473 ? 32.260  316.268 216.133 1.00 33.54  ? 473  TRP A CH2 1 
ATOM   3737  N  N   . GLU A  1  474 ? 37.193  313.854 215.661 1.00 28.90  ? 474  GLU A N   1 
ATOM   3738  C  CA  . GLU A  1  474 ? 36.457  313.151 216.706 1.00 28.38  ? 474  GLU A CA  1 
ATOM   3739  C  C   . GLU A  1  474 ? 37.360  312.889 217.920 1.00 29.92  ? 474  GLU A C   1 
ATOM   3740  O  O   . GLU A  1  474 ? 36.916  312.989 219.082 1.00 27.99  ? 474  GLU A O   1 
ATOM   3741  C  CB  . GLU A  1  474 ? 35.903  311.835 216.151 1.00 30.07  ? 474  GLU A CB  1 
ATOM   3742  C  CG  . GLU A  1  474 ? 34.865  311.134 217.127 1.00 31.63  ? 474  GLU A CG  1 
ATOM   3743  C  CD  . GLU A  1  474 ? 35.561  310.309 218.211 1.00 41.71  ? 474  GLU A CD  1 
ATOM   3744  O  OE1 . GLU A  1  474 ? 35.021  310.140 219.300 1.00 36.45  ? 474  GLU A OE1 1 
ATOM   3745  O  OE2 . GLU A  1  474 ? 36.692  309.830 218.013 1.00 30.55  ? 474  GLU A OE2 1 
ATOM   3746  N  N   . ALA A  1  475 ? 38.653  312.625 217.661 1.00 29.89  ? 475  ALA A N   1 
ATOM   3747  C  CA  . ALA A  1  475 ? 39.577  312.367 218.761 1.00 27.54  ? 475  ALA A CA  1 
ATOM   3748  C  C   . ALA A  1  475 ? 39.733  313.601 219.647 1.00 30.25  ? 475  ALA A C   1 
ATOM   3749  O  O   . ALA A  1  475 ? 39.689  313.527 220.892 1.00 30.01  ? 475  ALA A O   1 
ATOM   3750  C  CB  . ALA A  1  475 ? 40.921  311.942 218.207 1.00 26.19  ? 475  ALA A CB  1 
ATOM   3751  N  N   . PHE A  1  476 ? 39.979  314.742 218.997 1.00 27.89  ? 476  PHE A N   1 
ATOM   3752  C  CA  . PHE A  1  476 ? 40.121  315.970 219.761 1.00 30.82  ? 476  PHE A CA  1 
ATOM   3753  C  C   . PHE A  1  476 ? 38.777  316.411 220.349 1.00 32.03  ? 476  PHE A C   1 
ATOM   3754  O  O   . PHE A  1  476 ? 38.758  317.119 221.362 1.00 31.24  ? 476  PHE A O   1 
ATOM   3755  C  CB  . PHE A  1  476 ? 40.713  317.077 218.881 1.00 27.59  ? 476  PHE A CB  1 
ATOM   3756  C  CG  . PHE A  1  476 ? 42.228  316.989 218.681 1.00 29.23  ? 476  PHE A CG  1 
ATOM   3757  C  CD1 . PHE A  1  476 ? 43.084  317.141 219.723 1.00 30.40  ? 476  PHE A CD1 1 
ATOM   3758  C  CD2 . PHE A  1  476 ? 42.771  316.830 217.388 1.00 26.09  ? 476  PHE A CD2 1 
ATOM   3759  C  CE1 . PHE A  1  476 ? 44.446  317.104 219.558 1.00 32.46  ? 476  PHE A CE1 1 
ATOM   3760  C  CE2 . PHE A  1  476 ? 44.079  316.813 217.216 1.00 32.84  ? 476  PHE A CE2 1 
ATOM   3761  C  CZ  . PHE A  1  476 ? 44.952  316.954 218.307 1.00 33.73  ? 476  PHE A CZ  1 
ATOM   3762  N  N   . ALA A  1  477 ? 37.659  316.063 219.695 1.00 28.11  ? 477  ALA A N   1 
ATOM   3763  C  CA  . ALA A  1  477 ? 36.338  316.417 220.217 1.00 30.93  ? 477  ALA A CA  1 
ATOM   3764  C  C   . ALA A  1  477 ? 35.990  315.631 221.479 1.00 27.22  ? 477  ALA A C   1 
ATOM   3765  O  O   . ALA A  1  477 ? 35.321  316.158 222.355 1.00 29.67  ? 477  ALA A O   1 
ATOM   3766  C  CB  . ALA A  1  477 ? 35.237  316.177 219.159 1.00 27.24  ? 477  ALA A CB  1 
ATOM   3767  N  N   . SER A  1  478 ? 36.382  314.378 221.580 1.00 26.76  ? 478  SER A N   1 
ATOM   3768  C  CA  . SER A  1  478 ? 35.950  313.509 222.659 1.00 28.52  ? 478  SER A CA  1 
ATOM   3769  C  C   . SER A  1  478 ? 36.893  313.513 223.868 1.00 31.29  ? 478  SER A C   1 
ATOM   3770  O  O   . SER A  1  478 ? 36.422  313.327 224.989 1.00 29.71  ? 478  SER A O   1 
ATOM   3771  C  CB  . SER A  1  478 ? 35.781  312.084 222.140 1.00 30.51  ? 478  SER A CB  1 
ATOM   3772  O  OG  . SER A  1  478 ? 34.662  312.125 221.266 1.00 29.17  ? 478  SER A OG  1 
ATOM   3773  N  N   . LYS A  1  479 ? 38.190  313.707 223.643 1.00 32.13  ? 479  LYS A N   1 
ATOM   3774  C  CA  . LYS A  1  479 ? 39.230  313.863 224.667 1.00 33.64  ? 479  LYS A CA  1 
ATOM   3775  C  C   . LYS A  1  479 ? 39.287  312.644 225.566 1.00 37.22  ? 479  LYS A C   1 
ATOM   3776  O  O   . LYS A  1  479 ? 39.043  312.733 226.779 1.00 32.30  ? 479  LYS A O   1 
ATOM   3777  C  CB  . LYS A  1  479 ? 39.009  315.134 225.522 1.00 30.65  ? 479  LYS A CB  1 
ATOM   3778  C  CG  . LYS A  1  479 ? 39.132  316.450 224.774 1.00 29.45  ? 479  LYS A CG  1 
ATOM   3779  C  CD  . LYS A  1  479 ? 38.895  317.675 225.652 1.00 31.11  ? 479  LYS A CD  1 
ATOM   3780  C  CE  . LYS A  1  479 ? 39.590  318.878 225.009 1.00 39.58  ? 479  LYS A CE  1 
ATOM   3781  N  NZ  . LYS A  1  479 ? 39.529  320.166 225.832 1.00 37.67  ? 479  LYS A NZ  1 
ATOM   3782  N  N   . ARG A  1  480 ? 39.558  311.491 224.966 1.00 29.11  ? 480  ARG A N   1 
ATOM   3783  C  CA  . ARG A  1  480 ? 39.914  310.304 225.769 1.00 31.64  ? 480  ARG A CA  1 
ATOM   3784  C  C   . ARG A  1  480 ? 41.405  310.323 226.102 1.00 36.86  ? 480  ARG A C   1 
ATOM   3785  O  O   . ARG A  1  480 ? 42.224  310.010 225.234 1.00 28.56  ? 480  ARG A O   1 
ATOM   3786  C  CB  . ARG A  1  480 ? 39.591  309.047 224.953 1.00 27.04  ? 480  ARG A CB  1 
ATOM   3787  C  CG  . ARG A  1  480 ? 38.136  308.874 224.581 1.00 26.82  ? 480  ARG A CG  1 
ATOM   3788  C  CD  . ARG A  1  480 ? 38.008  307.699 223.646 1.00 24.55  ? 480  ARG A CD  1 
ATOM   3789  N  NE  . ARG A  1  480 ? 38.506  308.121 222.250 1.00 27.20  ? 480  ARG A NE  1 
ATOM   3790  C  CZ  . ARG A  1  480 ? 37.785  308.627 221.235 1.00 28.42  ? 480  ARG A CZ  1 
ATOM   3791  N  NH1 . ARG A  1  480 ? 36.475  308.857 221.374 1.00 28.29  ? 480  ARG A NH1 1 
ATOM   3792  N  NH2 . ARG A  1  480 ? 38.383  308.961 220.057 1.00 26.41  ? 480  ARG A NH2 1 
ATOM   3793  N  N   . GLU A  1  481 ? 41.786  310.622 227.361 1.00 27.81  ? 481  GLU A N   1 
ATOM   3794  C  CA  . GLU A  1  481 ? 43.192  310.786 227.720 1.00 31.61  ? 481  GLU A CA  1 
ATOM   3795  C  C   . GLU A  1  481 ? 43.836  309.438 227.975 1.00 38.73  ? 481  GLU A C   1 
ATOM   3796  O  O   . GLU A  1  481 ? 43.243  308.588 228.633 1.00 30.37  ? 481  GLU A O   1 
ATOM   3797  C  CB  . GLU A  1  481 ? 43.320  311.686 228.957 1.00 31.68  ? 481  GLU A CB  1 
ATOM   3798  C  CG  . GLU A  1  481 ? 42.904  313.094 228.547 1.00 27.13  ? 481  GLU A CG  1 
ATOM   3799  C  CD  . GLU A  1  481 ? 42.939  314.074 229.738 1.00 37.38  ? 481  GLU A CD  1 
ATOM   3800  O  OE1 . GLU A  1  481 ? 42.748  315.297 229.497 1.00 39.96  ? 481  GLU A OE1 1 
ATOM   3801  O  OE2 . GLU A  1  481 ? 43.163  313.620 230.871 1.00 41.92  ? 481  GLU A OE2 1 
ATOM   3802  N  N   . VAL A  1  482 ? 45.032  309.246 227.410 1.00 28.43  ? 482  VAL A N   1 
ATOM   3803  C  CA  . VAL A  1  482 ? 45.817  308.026 227.593 1.00 27.71  ? 482  VAL A CA  1 
ATOM   3804  C  C   . VAL A  1  482 ? 46.116  307.780 229.068 1.00 35.33  ? 482  VAL A C   1 
ATOM   3805  O  O   . VAL A  1  482 ? 46.439  308.703 229.822 1.00 32.96  ? 482  VAL A O   1 
ATOM   3806  C  CB  . VAL A  1  482 ? 47.168  308.145 226.827 1.00 27.48  ? 482  VAL A CB  1 
ATOM   3807  C  CG1 . VAL A  1  482 ? 48.070  306.910 227.125 1.00 29.22  ? 482  VAL A CG1 1 
ATOM   3808  C  CG2 . VAL A  1  482 ? 46.907  308.276 225.369 1.00 30.97  ? 482  VAL A CG2 1 
ATOM   3809  N  N   . LEU A  1  483 ? 46.079  306.516 229.474 1.00 29.11  ? 483  LEU A N   1 
ATOM   3810  C  CA  . LEU A  1  483 ? 46.462  306.104 230.821 1.00 35.49  ? 483  LEU A CA  1 
ATOM   3811  C  C   . LEU A  1  483 ? 47.717  305.237 230.853 1.00 55.18  ? 483  LEU A C   1 
ATOM   3812  O  O   . LEU A  1  483 ? 48.646  305.557 231.595 1.00 48.29  ? 483  LEU A O   1 
ATOM   3813  C  CB  . LEU A  1  483 ? 45.312  305.341 231.509 1.00 33.35  ? 483  LEU A CB  1 
ATOM   3814  C  CG  . LEU A  1  483 ? 44.143  306.206 231.933 1.00 37.58  ? 483  LEU A CG  1 
ATOM   3815  C  CD1 . LEU A  1  483 ? 42.948  305.296 232.336 1.00 35.37  ? 483  LEU A CD1 1 
ATOM   3816  C  CD2 . LEU A  1  483 ? 44.529  307.166 233.058 1.00 39.47  ? 483  LEU A CD2 1 
ATOM   3817  N  N   . THR A  1  484 ? 47.722  304.124 230.112 1.00 28.58  ? 484  THR A N   1 
ATOM   3818  C  CA  . THR A  1  484 ? 48.768  303.104 230.116 1.00 30.21  ? 484  THR A CA  1 
ATOM   3819  C  C   . THR A  1  484 ? 49.196  302.780 228.662 1.00 31.09  ? 484  THR A C   1 
ATOM   3820  O  O   . THR A  1  484 ? 48.367  302.701 227.776 1.00 33.73  ? 484  THR A O   1 
ATOM   3821  C  CB  . THR A  1  484 ? 48.242  301.842 230.800 1.00 28.80  ? 484  THR A CB  1 
ATOM   3822  O  OG1 . THR A  1  484 ? 48.008  302.165 232.267 1.00 38.19  ? 484  THR A OG1 1 
ATOM   3823  C  CG2 . THR A  1  484 ? 49.299  300.759 230.847 1.00 49.51  ? 484  THR A CG2 1 
ATOM   3824  N  N   . VAL A  1  485 ? 50.472  302.514 228.458 1.00 33.15  ? 485  VAL A N   1 
ATOM   3825  C  CA  . VAL A  1  485 ? 50.967  302.078 227.152 1.00 32.24  ? 485  VAL A CA  1 
ATOM   3826  C  C   . VAL A  1  485 ? 51.833  300.851 227.391 1.00 28.37  ? 485  VAL A C   1 
ATOM   3827  O  O   . VAL A  1  485 ? 52.750  300.896 228.220 1.00 30.30  ? 485  VAL A O   1 
ATOM   3828  C  CB  . VAL A  1  485 ? 51.769  303.206 226.459 1.00 43.17  ? 485  VAL A CB  1 
ATOM   3829  C  CG1 . VAL A  1  485 ? 52.441  302.706 225.154 1.00 31.99  ? 485  VAL A CG1 1 
ATOM   3830  C  CG2 . VAL A  1  485 ? 50.851  304.412 226.186 1.00 39.07  ? 485  VAL A CG2 1 
ATOM   3831  N  N   . ASP A  1  486 ? 51.611  299.799 226.636 1.00 31.55  ? 486  ASP A N   1 
ATOM   3832  C  CA  . ASP A  1  486 ? 52.459  298.610 226.750 1.00 31.71  ? 486  ASP A CA  1 
ATOM   3833  C  C   . ASP A  1  486 ? 53.836  298.804 226.101 1.00 37.26  ? 486  ASP A C   1 
ATOM   3834  O  O   . ASP A  1  486 ? 54.023  299.655 225.232 1.00 30.51  ? 486  ASP A O   1 
ATOM   3835  C  CB  . ASP A  1  486 ? 51.795  297.412 226.071 1.00 41.72  ? 486  ASP A CB  1 
ATOM   3836  C  CG  . ASP A  1  486 ? 50.488  297.000 226.743 1.00 57.94  ? 486  ASP A CG  1 
ATOM   3837  O  OD1 . ASP A  1  486 ? 50.399  297.089 227.987 1.00 143.12 ? 486  ASP A OD1 1 
ATOM   3838  O  OD2 . ASP A  1  486 ? 49.573  296.587 225.991 1.00 88.93  ? 486  ASP A OD2 1 
ATOM   3839  N  N   . LEU A  1  487 ? 54.778  297.919 226.484 1.00 29.54  ? 487  LEU A N   1 
ATOM   3840  C  CA  . LEU A  1  487 ? 56.110  297.750 225.856 1.00 28.22  ? 487  LEU A CA  1 
ATOM   3841  C  C   . LEU A  1  487 ? 56.927  299.010 225.968 1.00 31.63  ? 487  LEU A C   1 
ATOM   3842  O  O   . LEU A  1  487 ? 57.800  299.233 225.133 1.00 32.30  ? 487  LEU A O   1 
ATOM   3843  C  CB  . LEU A  1  487 ? 56.007  297.344 224.345 1.00 25.10  ? 487  LEU A CB  1 
ATOM   3844  C  CG  . LEU A  1  487 ? 55.062  296.126 224.107 1.00 28.17  ? 487  LEU A CG  1 
ATOM   3845  C  CD1 . LEU A  1  487 ? 54.951  295.751 222.590 1.00 33.68  ? 487  LEU A CD1 1 
ATOM   3846  C  CD2 . LEU A  1  487 ? 55.489  294.927 224.974 1.00 36.00  ? 487  LEU A CD2 1 
ATOM   3847  N  N   . THR A  1  488 ? 56.703  299.844 227.005 1.00 26.57  ? 488  THR A N   1 
ATOM   3848  C  CA  . THR A  1  488 ? 57.574  301.007 227.092 1.00 30.66  ? 488  THR A CA  1 
ATOM   3849  C  C   . THR A  1  488 ? 59.029  300.619 227.336 1.00 30.81  ? 488  THR A C   1 
ATOM   3850  O  O   . THR A  1  488 ? 59.914  301.435 227.068 1.00 29.79  ? 488  THR A O   1 
ATOM   3851  C  CB  . THR A  1  488 ? 57.130  301.966 228.210 1.00 41.43  ? 488  THR A CB  1 
ATOM   3852  O  OG1 . THR A  1  488 ? 57.153  301.280 229.489 1.00 33.13  ? 488  THR A OG1 1 
ATOM   3853  C  CG2 . THR A  1  488 ? 55.779  302.583 227.902 1.00 33.15  ? 488  THR A CG2 1 
ATOM   3854  N  N   . THR A  1  489 ? 59.308  299.416 227.861 1.00 26.99  ? 489  THR A N   1 
ATOM   3855  C  CA  . THR A  1  489 ? 60.707  299.075 228.093 1.00 29.34  ? 489  THR A CA  1 
ATOM   3856  C  C   . THR A  1  489 ? 61.482  298.984 226.783 1.00 31.33  ? 489  THR A C   1 
ATOM   3857  O  O   . THR A  1  489 ? 62.708  298.984 226.814 1.00 31.92  ? 489  THR A O   1 
ATOM   3858  C  CB  . THR A  1  489 ? 60.836  297.734 228.774 1.00 30.40  ? 489  THR A CB  1 
ATOM   3859  O  OG1 . THR A  1  489 ? 60.060  296.797 228.049 1.00 36.42  ? 489  THR A OG1 1 
ATOM   3860  C  CG2 . THR A  1  489 ? 60.312  297.785 230.336 1.00 27.64  ? 489  THR A CG2 1 
ATOM   3861  N  N   . THR A  1  490 ? 60.809  298.831 225.639 1.00 29.20  ? 490  THR A N   1 
ATOM   3862  C  CA  . THR A  1  490 ? 61.533  298.845 224.367 1.00 28.80  ? 490  THR A CA  1 
ATOM   3863  C  C   . THR A  1  490 ? 61.022  299.910 223.418 1.00 31.99  ? 490  THR A C   1 
ATOM   3864  O  O   . THR A  1  490 ? 61.230  299.793 222.192 1.00 28.30  ? 490  THR A O   1 
ATOM   3865  C  CB  . THR A  1  490 ? 61.513  297.464 223.690 1.00 30.62  ? 490  THR A CB  1 
ATOM   3866  O  OG1 . THR A  1  490 ? 60.163  296.956 223.601 1.00 32.71  ? 490  THR A OG1 1 
ATOM   3867  C  CG2 . THR A  1  490 ? 62.377  296.480 224.524 1.00 26.58  ? 490  THR A CG2 1 
ATOM   3868  N  N   . ASN A  1  491 ? 60.388  300.973 223.946 1.00 27.79  ? 491  ASN A N   1 
ATOM   3869  C  CA  . ASN A  1  491 ? 59.886  302.028 223.104 1.00 32.86  ? 491  ASN A CA  1 
ATOM   3870  C  C   . ASN A  1  491 ? 60.017  303.299 223.945 1.00 31.16  ? 491  ASN A C   1 
ATOM   3871  O  O   . ASN A  1  491 ? 59.012  303.850 224.469 1.00 27.20  ? 491  ASN A O   1 
ATOM   3872  C  CB  . ASN A  1  491 ? 58.445  301.800 222.635 1.00 26.09  ? 491  ASN A CB  1 
ATOM   3873  C  CG  . ASN A  1  491 ? 58.301  300.604 221.755 1.00 32.59  ? 491  ASN A CG  1 
ATOM   3874  O  OD1 . ASN A  1  491 ? 58.414  300.720 220.524 1.00 26.34  ? 491  ASN A OD1 1 
ATOM   3875  N  ND2 . ASN A  1  491 ? 58.078  299.446 222.358 1.00 25.15  ? 491  ASN A ND2 1 
ATOM   3876  N  N   . LEU A  1  492 ? 61.267  303.750 224.060 1.00 28.29  ? 492  LEU A N   1 
ATOM   3877  C  CA  . LEU A  1  492 ? 61.631  304.850 224.976 1.00 27.81  ? 492  LEU A CA  1 
ATOM   3878  C  C   . LEU A  1  492 ? 60.837  306.122 224.716 1.00 29.29  ? 492  LEU A C   1 
ATOM   3879  O  O   . LEU A  1  492 ? 60.590  306.948 225.645 1.00 26.60  ? 492  LEU A O   1 
ATOM   3880  C  CB  . LEU A  1  492 ? 63.136  305.190 224.843 1.00 23.10  ? 492  LEU A CB  1 
ATOM   3881  C  CG  . LEU A  1  492 ? 63.592  306.422 225.645 1.00 26.57  ? 492  LEU A CG  1 
ATOM   3882  C  CD1 . LEU A  1  492 ? 63.368  306.204 227.244 1.00 28.99  ? 492  LEU A CD1 1 
ATOM   3883  C  CD2 . LEU A  1  492 ? 65.102  306.732 225.311 1.00 31.65  ? 492  LEU A CD2 1 
ATOM   3884  N  N   . GLU A  1  493 ? 60.391  306.317 223.475 1.00 30.32  ? 493  GLU A N   1 
ATOM   3885  C  CA  . GLU A  1  493 ? 59.722  307.578 223.210 1.00 24.24  ? 493  GLU A CA  1 
ATOM   3886  C  C   . GLU A  1  493 ? 58.410  307.706 223.999 1.00 26.36  ? 493  GLU A C   1 
ATOM   3887  O  O   . GLU A  1  493 ? 57.912  308.819 224.143 1.00 25.57  ? 493  GLU A O   1 
ATOM   3888  C  CB  . GLU A  1  493 ? 59.472  307.716 221.662 1.00 27.78  ? 493  GLU A CB  1 
ATOM   3889  C  CG  . GLU A  1  493 ? 58.327  306.868 221.120 1.00 26.45  ? 493  GLU A CG  1 
ATOM   3890  C  CD  . GLU A  1  493 ? 58.742  305.447 220.708 1.00 28.18  ? 493  GLU A CD  1 
ATOM   3891  O  OE1 . GLU A  1  493 ? 59.829  304.989 221.156 1.00 29.65  ? 493  GLU A OE1 1 
ATOM   3892  O  OE2 . GLU A  1  493 ? 57.988  304.829 219.902 1.00 30.60  ? 493  GLU A OE2 1 
ATOM   3893  N  N   . TRP A  1  494 ? 57.809  306.603 224.463 1.00 25.79  ? 494  TRP A N   1 
ATOM   3894  C  CA  . TRP A  1  494 ? 56.545  306.673 225.216 1.00 37.02  ? 494  TRP A CA  1 
ATOM   3895  C  C   . TRP A  1  494 ? 56.780  306.915 226.707 1.00 47.62  ? 494  TRP A C   1 
ATOM   3896  O  O   . TRP A  1  494 ? 55.839  307.083 227.481 1.00 26.04  ? 494  TRP A O   1 
ATOM   3897  C  CB  . TRP A  1  494 ? 55.701  305.381 225.085 1.00 25.91  ? 494  TRP A CB  1 
ATOM   3898  C  CG  . TRP A  1  494 ? 55.216  305.103 223.642 1.00 29.66  ? 494  TRP A CG  1 
ATOM   3899  C  CD1 . TRP A  1  494 ? 55.889  304.432 222.655 1.00 26.75  ? 494  TRP A CD1 1 
ATOM   3900  C  CD2 . TRP A  1  494 ? 53.970  305.491 223.118 1.00 27.86  ? 494  TRP A CD2 1 
ATOM   3901  N  NE1 . TRP A  1  494 ? 55.122  304.424 221.457 1.00 27.74  ? 494  TRP A NE1 1 
ATOM   3902  C  CE2 . TRP A  1  494 ? 53.920  305.048 221.744 1.00 24.42  ? 494  TRP A CE2 1 
ATOM   3903  C  CE3 . TRP A  1  494 ? 52.855  306.188 223.666 1.00 24.42  ? 494  TRP A CE3 1 
ATOM   3904  C  CZ2 . TRP A  1  494 ? 52.823  305.301 220.917 1.00 30.96  ? 494  TRP A CZ2 1 
ATOM   3905  C  CZ3 . TRP A  1  494 ? 51.733  306.401 222.832 1.00 33.10  ? 494  TRP A CZ3 1 
ATOM   3906  C  CH2 . TRP A  1  494 ? 51.753  305.979 221.455 1.00 30.18  ? 494  TRP A CH2 1 
ATOM   3907  N  N   . LEU A  1  495 ? 57.999  306.850 227.149 1.00 27.18  ? 495  LEU A N   1 
ATOM   3908  C  CA  . LEU A  1  495 ? 58.192  306.658 228.607 1.00 28.82  ? 495  LEU A CA  1 
ATOM   3909  C  C   . LEU A  1  495 ? 58.094  307.948 229.406 1.00 31.37  ? 495  LEU A C   1 
ATOM   3910  O  O   . LEU A  1  495 ? 57.929  307.877 230.645 1.00 35.35  ? 495  LEU A O   1 
ATOM   3911  C  CB  . LEU A  1  495 ? 59.543  305.952 228.827 1.00 27.00  ? 495  LEU A CB  1 
ATOM   3912  C  CG  . LEU A  1  495 ? 59.904  305.403 230.195 1.00 40.87  ? 495  LEU A CG  1 
ATOM   3913  C  CD1 . LEU A  1  495 ? 58.829  304.494 230.688 1.00 37.74  ? 495  LEU A CD1 1 
ATOM   3914  C  CD2 . LEU A  1  495 ? 61.228  304.621 229.995 1.00 33.94  ? 495  LEU A CD2 1 
ATOM   3915  N  N   . ASN A  1  496 ? 58.059  309.113 228.763 1.00 26.35  ? 496  ASN A N   1 
ATOM   3916  C  CA  . ASN A  1  496 ? 57.766  310.378 229.429 1.00 31.29  ? 496  ASN A CA  1 
ATOM   3917  C  C   . ASN A  1  496 ? 56.302  310.765 229.410 1.00 30.63  ? 496  ASN A C   1 
ATOM   3918  O  O   . ASN A  1  496 ? 55.966  311.925 229.729 1.00 30.28  ? 496  ASN A O   1 
ATOM   3919  C  CB  . ASN A  1  496 ? 58.610  311.476 228.824 1.00 29.09  ? 496  ASN A CB  1 
ATOM   3920  C  CG  . ASN A  1  496 ? 60.046  311.408 229.296 1.00 33.29  ? 496  ASN A CG  1 
ATOM   3921  O  OD1 . ASN A  1  496 ? 60.327  311.742 230.435 1.00 34.47  ? 496  ASN A OD1 1 
ATOM   3922  N  ND2 . ASN A  1  496 ? 60.968  311.022 228.399 1.00 28.85  ? 496  ASN A ND2 1 
ATOM   3923  N  N   . GLY A  1  497 ? 55.408  309.818 229.153 1.00 28.95  ? 497  GLY A N   1 
ATOM   3924  C  CA  . GLY A  1  497 ? 53.984  310.174 229.198 1.00 29.40  ? 497  GLY A CA  1 
ATOM   3925  C  C   . GLY A  1  497 ? 53.445  310.723 227.853 1.00 35.27  ? 497  GLY A C   1 
ATOM   3926  O  O   . GLY A  1  497 ? 54.176  310.911 226.887 1.00 34.39  ? 497  GLY A O   1 
ATOM   3927  N  N   . CYS A  1  498 ? 52.148  311.028 227.830 1.00 28.35  ? 498  CYS A N   1 
ATOM   3928  C  CA  . CYS A  1  498 ? 51.403  311.398 226.607 1.00 31.18  ? 498  CYS A CA  1 
ATOM   3929  C  C   . CYS A  1  498 ? 50.558  312.639 226.855 1.00 29.32  ? 498  CYS A C   1 
ATOM   3930  O  O   . CYS A  1  498 ? 49.545  312.548 227.577 1.00 31.60  ? 498  CYS A O   1 
ATOM   3931  C  CB  . CYS A  1  498 ? 50.514  310.240 226.177 1.00 29.83  ? 498  CYS A CB  1 
ATOM   3932  S  SG  . CYS A  1  498 ? 51.374  308.717 225.888 1.00 30.30  ? 498  CYS A SG  1 
ATOM   3933  N  N   . PRO A  1  499 ? 50.909  313.811 226.314 1.00 32.14  ? 499  PRO A N   1 
ATOM   3934  C  CA  . PRO A  1  499 ? 52.127  314.073 225.522 1.00 29.89  ? 499  PRO A CA  1 
ATOM   3935  C  C   . PRO A  1  499 ? 53.266  314.267 226.524 1.00 34.07  ? 499  PRO A C   1 
ATOM   3936  O  O   . PRO A  1  499 ? 52.985  314.516 227.712 1.00 31.74  ? 499  PRO A O   1 
ATOM   3937  C  CB  . PRO A  1  499 ? 51.808  315.374 224.789 1.00 27.33  ? 499  PRO A CB  1 
ATOM   3938  C  CG  . PRO A  1  499 ? 50.886  316.142 225.849 1.00 33.58  ? 499  PRO A CG  1 
ATOM   3939  C  CD  . PRO A  1  499 ? 50.046  315.006 226.427 1.00 31.20  ? 499  PRO A CD  1 
ATOM   3940  N  N   . PRO A  1  500 ? 54.508  314.076 226.109 1.00 34.99  ? 500  PRO A N   1 
ATOM   3941  C  CA  . PRO A  1  500 ? 55.634  314.332 227.030 1.00 27.77  ? 500  PRO A CA  1 
ATOM   3942  C  C   . PRO A  1  500 ? 55.707  315.802 227.372 1.00 36.97  ? 500  PRO A C   1 
ATOM   3943  O  O   . PRO A  1  500 ? 55.184  316.627 226.626 1.00 33.55  ? 500  PRO A O   1 
ATOM   3944  C  CB  . PRO A  1  500 ? 56.885  313.882 226.234 1.00 28.81  ? 500  PRO A CB  1 
ATOM   3945  C  CG  . PRO A  1  500 ? 56.445  313.886 224.740 1.00 32.58  ? 500  PRO A CG  1 
ATOM   3946  C  CD  . PRO A  1  500 ? 54.913  313.712 224.715 1.00 29.77  ? 500  PRO A CD  1 
ATOM   3947  N  N   . PRO A  1  501 ? 56.349  316.173 228.483 1.00 35.08  ? 501  PRO A N   1 
ATOM   3948  C  CA  . PRO A  1  501 ? 56.555  317.602 228.776 1.00 36.38  ? 501  PRO A CA  1 
ATOM   3949  C  C   . PRO A  1  501 ? 57.349  318.310 227.692 1.00 29.17  ? 501  PRO A C   1 
ATOM   3950  O  O   . PRO A  1  501 ? 58.164  317.695 227.011 1.00 31.10  ? 501  PRO A O   1 
ATOM   3951  C  CB  . PRO A  1  501 ? 57.345  317.595 230.126 1.00 29.52  ? 501  PRO A CB  1 
ATOM   3952  C  CG  . PRO A  1  501 ? 57.255  316.190 230.668 1.00 38.20  ? 501  PRO A CG  1 
ATOM   3953  C  CD  . PRO A  1  501 ? 57.030  315.273 229.432 1.00 30.48  ? 501  PRO A CD  1 
ATOM   3954  N  N   . TYR A  1  502 ? 57.165  319.635 227.588 1.00 29.38  ? 502  TYR A N   1 
ATOM   3955  C  CA  . TYR A  1  502 ? 57.928  320.477 226.687 1.00 37.81  ? 502  TYR A CA  1 
ATOM   3956  C  C   . TYR A  1  502 ? 59.416  320.135 226.672 1.00 39.80  ? 502  TYR A C   1 
ATOM   3957  O  O   . TYR A  1  502 ? 60.013  319.875 225.594 1.00 32.86  ? 502  TYR A O   1 
ATOM   3958  C  CB  . TYR A  1  502 ? 57.715  321.919 227.087 1.00 32.20  ? 502  TYR A CB  1 
ATOM   3959  C  CG  . TYR A  1  502 ? 58.210  322.947 226.050 1.00 39.43  ? 502  TYR A CG  1 
ATOM   3960  C  CD1 . TYR A  1  502 ? 57.454  323.208 224.910 1.00 29.97  ? 502  TYR A CD1 1 
ATOM   3961  C  CD2 . TYR A  1  502 ? 59.412  323.657 226.220 1.00 33.05  ? 502  TYR A CD2 1 
ATOM   3962  C  CE1 . TYR A  1  502 ? 57.861  324.182 223.965 1.00 38.04  ? 502  TYR A CE1 1 
ATOM   3963  C  CE2 . TYR A  1  502 ? 59.837  324.633 225.258 1.00 28.90  ? 502  TYR A CE2 1 
ATOM   3964  C  CZ  . TYR A  1  502 ? 59.035  324.894 224.161 1.00 31.36  ? 502  TYR A CZ  1 
ATOM   3965  O  OH  . TYR A  1  502 ? 59.408  325.841 223.232 1.00 47.35  ? 502  TYR A OH  1 
ATOM   3966  N  N   . HIS A  1  503 ? 60.032  320.110 227.866 1.00 33.34  ? 503  HIS A N   1 
ATOM   3967  C  CA  . HIS A  1  503 ? 61.420  319.664 228.045 1.00 31.84  ? 503  HIS A CA  1 
ATOM   3968  C  C   . HIS A  1  503 ? 61.423  318.232 228.558 1.00 38.67  ? 503  HIS A C   1 
ATOM   3969  O  O   . HIS A  1  503 ? 60.949  317.966 229.671 1.00 34.73  ? 503  HIS A O   1 
ATOM   3970  C  CB  . HIS A  1  503 ? 62.214  320.542 229.052 1.00 32.94  ? 503  HIS A CB  1 
ATOM   3971  C  CG  . HIS A  1  503 ? 62.401  321.974 228.607 1.00 41.26  ? 503  HIS A CG  1 
ATOM   3972  N  ND1 . HIS A  1  503 ? 63.099  322.321 227.464 1.00 50.46  ? 503  HIS A ND1 1 
ATOM   3973  C  CD2 . HIS A  1  503 ? 61.984  323.142 229.155 1.00 34.32  ? 503  HIS A CD2 1 
ATOM   3974  C  CE1 . HIS A  1  503 ? 63.091  323.637 227.326 1.00 43.42  ? 503  HIS A CE1 1 
ATOM   3975  N  NE2 . HIS A  1  503 ? 62.418  324.158 228.335 1.00 55.25  ? 503  HIS A NE2 1 
ATOM   3976  N  N   . THR A  1  504 ? 61.988  317.323 227.790 1.00 31.14  ? 504  THR A N   1 
ATOM   3977  C  CA  . THR A  1  504 ? 62.235  315.981 228.288 1.00 30.72  ? 504  THR A CA  1 
ATOM   3978  C  C   . THR A  1  504 ? 63.727  315.754 228.337 1.00 35.89  ? 504  THR A C   1 
ATOM   3979  O  O   . THR A  1  504 ? 64.511  316.492 227.705 1.00 30.50  ? 504  THR A O   1 
ATOM   3980  C  CB  . THR A  1  504 ? 61.580  314.897 227.402 1.00 31.70  ? 504  THR A CB  1 
ATOM   3981  O  OG1 . THR A  1  504 ? 61.657  315.290 226.019 1.00 29.62  ? 504  THR A OG1 1 
ATOM   3982  C  CG2 . THR A  1  504 ? 60.115  314.711 227.840 1.00 33.02  ? 504  THR A CG2 1 
ATOM   3983  N  N   . PHE A  1  505 ? 64.094  314.743 229.127 1.00 32.84  ? 505  PHE A N   1 
ATOM   3984  C  CA  . PHE A  1  505 ? 65.490  314.371 229.356 1.00 34.20  ? 505  PHE A CA  1 
ATOM   3985  C  C   . PHE A  1  505 ? 66.331  315.565 229.822 1.00 33.16  ? 505  PHE A C   1 
ATOM   3986  O  O   . PHE A  1  505 ? 67.512  315.680 229.493 1.00 29.98  ? 505  PHE A O   1 
ATOM   3987  C  CB  . PHE A  1  505 ? 66.073  313.702 228.063 1.00 31.86  ? 505  PHE A CB  1 
ATOM   3988  C  CG  . PHE A  1  505 ? 65.319  312.492 227.655 1.00 34.00  ? 505  PHE A CG  1 
ATOM   3989  C  CD1 . PHE A  1  505 ? 65.456  311.330 228.380 1.00 29.87  ? 505  PHE A CD1 1 
ATOM   3990  C  CD2 . PHE A  1  505 ? 64.388  312.547 226.568 1.00 25.82  ? 505  PHE A CD2 1 
ATOM   3991  C  CE1 . PHE A  1  505 ? 64.709  310.185 228.090 1.00 28.36  ? 505  PHE A CE1 1 
ATOM   3992  C  CE2 . PHE A  1  505 ? 63.656  311.406 226.209 1.00 27.73  ? 505  PHE A CE2 1 
ATOM   3993  C  CZ  . PHE A  1  505 ? 63.813  310.207 226.911 1.00 26.33  ? 505  PHE A CZ  1 
ATOM   3994  N  N   . GLU A  1  506 ? 65.727  316.460 230.626 1.00 30.16  ? 506  GLU A N   1 
ATOM   3995  C  CA  . GLU A  1  506 ? 66.534  317.505 231.258 1.00 34.20  ? 506  GLU A CA  1 
ATOM   3996  C  C   . GLU A  1  506 ? 67.588  316.888 232.147 1.00 40.88  ? 506  GLU A C   1 
ATOM   3997  O  O   . GLU A  1  506 ? 68.684  317.422 232.299 1.00 30.98  ? 506  GLU A O   1 
ATOM   3998  C  CB  . GLU A  1  506 ? 65.666  318.457 232.099 1.00 32.78  ? 506  GLU A CB  1 
ATOM   3999  C  CG  . GLU A  1  506 ? 64.590  319.143 231.278 1.00 43.43  ? 506  GLU A CG  1 
ATOM   4000  C  CD  . GLU A  1  506 ? 63.789  320.120 232.159 1.00 41.34  ? 506  GLU A CD  1 
ATOM   4001  O  OE1 . GLU A  1  506 ? 62.817  319.657 232.802 1.00 61.16  ? 506  GLU A OE1 1 
ATOM   4002  O  OE2 . GLU A  1  506 ? 64.187  321.310 232.240 1.00 74.38  ? 506  GLU A OE2 1 
ATOM   4003  N  N   . GLU A  1  507 ? 67.246  315.793 232.783 1.00 32.48  ? 507  GLU A N   1 
ATOM   4004  C  CA  . GLU A  1  507 ? 68.225  314.904 233.366 1.00 30.43  ? 507  GLU A CA  1 
ATOM   4005  C  C   . GLU A  1  507 ? 68.345  313.717 232.442 1.00 33.49  ? 507  GLU A C   1 
ATOM   4006  O  O   . GLU A  1  507 ? 67.324  313.057 232.204 1.00 35.43  ? 507  GLU A O   1 
ATOM   4007  C  CB  . GLU A  1  507 ? 67.750  314.441 234.769 1.00 32.60  ? 507  GLU A CB  1 
ATOM   4008  C  CG  . GLU A  1  507 ? 68.631  313.336 235.317 1.00 46.41  ? 507  GLU A CG  1 
ATOM   4009  C  CD  . GLU A  1  507 ? 68.412  313.134 236.807 1.00 134.55 ? 507  GLU A CD  1 
ATOM   4010  O  OE1 . GLU A  1  507 ? 69.258  313.492 237.602 1.00 39.63  ? 507  GLU A OE1 1 
ATOM   4011  O  OE2 . GLU A  1  507 ? 67.367  312.659 237.237 1.00 39.78  ? 507  GLU A OE2 1 
ATOM   4012  N  N   . PRO A  1  508 ? 69.517  313.448 231.849 1.00 32.08  ? 508  PRO A N   1 
ATOM   4013  C  CA  . PRO A  1  508 ? 69.625  312.370 230.871 1.00 35.14  ? 508  PRO A CA  1 
ATOM   4014  C  C   . PRO A  1  508 ? 69.393  311.019 231.513 1.00 54.45  ? 508  PRO A C   1 
ATOM   4015  O  O   . PRO A  1  508 ? 69.454  310.862 232.727 1.00 38.61  ? 508  PRO A O   1 
ATOM   4016  C  CB  . PRO A  1  508 ? 71.067  312.488 230.351 1.00 31.87  ? 508  PRO A CB  1 
ATOM   4017  C  CG  . PRO A  1  508 ? 71.867  313.134 231.534 1.00 33.79  ? 508  PRO A CG  1 
ATOM   4018  C  CD  . PRO A  1  508 ? 70.834  314.071 232.187 1.00 30.12  ? 508  PRO A CD  1 
ATOM   4019  N  N   . THR A  1  509 ? 69.092  310.044 230.673 1.00 33.34  ? 509  THR A N   1 
ATOM   4020  C  CA  . THR A  1  509 ? 68.989  308.659 231.088 1.00 31.44  ? 509  THR A CA  1 
ATOM   4021  C  C   . THR A  1  509 ? 70.318  308.181 231.670 1.00 34.18  ? 509  THR A C   1 
ATOM   4022  O  O   . THR A  1  509 ? 71.389  308.707 231.373 1.00 32.03  ? 509  THR A O   1 
ATOM   4023  C  CB  . THR A  1  509 ? 68.585  307.753 229.905 1.00 31.78  ? 509  THR A CB  1 
ATOM   4024  O  OG1 . THR A  1  509 ? 69.694  307.638 228.976 1.00 27.69  ? 509  THR A OG1 1 
ATOM   4025  C  CG2 . THR A  1  509 ? 67.246  308.221 229.266 1.00 28.51  ? 509  THR A CG2 1 
ATOM   4026  N  N   . TYR A  1  510 ? 70.234  307.139 232.488 1.00 31.77  ? 510  TYR A N   1 
ATOM   4027  C  CA  . TYR A  1  510 ? 71.390  306.451 233.024 1.00 32.05  ? 510  TYR A CA  1 
ATOM   4028  C  C   . TYR A  1  510 ? 71.596  305.163 232.247 1.00 35.28  ? 510  TYR A C   1 
ATOM   4029  O  O   . TYR A  1  510 ? 70.723  304.314 232.254 1.00 31.50  ? 510  TYR A O   1 
ATOM   4030  C  CB  . TYR A  1  510 ? 71.182  306.177 234.545 1.00 28.73  ? 510  TYR A CB  1 
ATOM   4031  C  CG  . TYR A  1  510 ? 72.245  305.290 235.166 1.00 31.46  ? 510  TYR A CG  1 
ATOM   4032  C  CD1 . TYR A  1  510 ? 72.239  303.906 234.990 1.00 30.30  ? 510  TYR A CD1 1 
ATOM   4033  C  CD2 . TYR A  1  510 ? 73.251  305.861 236.009 1.00 32.48  ? 510  TYR A CD2 1 
ATOM   4034  C  CE1 . TYR A  1  510 ? 73.240  303.112 235.604 1.00 34.60  ? 510  TYR A CE1 1 
ATOM   4035  C  CE2 . TYR A  1  510 ? 74.216  305.082 236.615 1.00 40.18  ? 510  TYR A CE2 1 
ATOM   4036  C  CZ  . TYR A  1  510 ? 74.195  303.721 236.394 1.00 44.27  ? 510  TYR A CZ  1 
ATOM   4037  O  OH  . TYR A  1  510 ? 75.160  302.972 236.963 1.00 42.40  ? 510  TYR A OH  1 
ATOM   4038  N  N   . VAL A  1  511 ? 72.769  304.994 231.607 1.00 27.96  ? 511  VAL A N   1 
ATOM   4039  C  CA  . VAL A  1  511 ? 73.087  303.766 230.876 1.00 31.90  ? 511  VAL A CA  1 
ATOM   4040  C  C   . VAL A  1  511 ? 74.523  303.364 231.219 1.00 32.91  ? 511  VAL A C   1 
ATOM   4041  O  O   . VAL A  1  511 ? 75.461  304.122 230.922 1.00 33.80  ? 511  VAL A O   1 
ATOM   4042  C  CB  . VAL A  1  511 ? 72.912  303.941 229.344 1.00 28.00  ? 511  VAL A CB  1 
ATOM   4043  C  CG1 . VAL A  1  511 ? 73.055  302.602 228.664 1.00 27.00  ? 511  VAL A CG1 1 
ATOM   4044  C  CG2 . VAL A  1  511 ? 71.483  304.457 229.089 1.00 30.67  ? 511  VAL A CG2 1 
ATOM   4045  N  N   . ASN A  1  512 ? 74.699  302.188 231.868 1.00 35.63  ? 512  ASN A N   1 
ATOM   4046  C  CA  . ASN A  1  512 ? 76.003  301.628 232.313 1.00 45.85  ? 512  ASN A CA  1 
ATOM   4047  C  C   . ASN A  1  512 ? 76.763  301.088 231.138 1.00 46.49  ? 512  ASN A C   1 
ATOM   4048  O  O   . ASN A  1  512 ? 76.174  300.550 230.202 1.00 37.77  ? 512  ASN A O   1 
ATOM   4049  C  CB  . ASN A  1  512 ? 75.884  300.360 233.222 1.00 35.45  ? 512  ASN A CB  1 
ATOM   4050  C  CG  . ASN A  1  512 ? 75.636  300.673 234.583 1.00 53.84  ? 512  ASN A CG  1 
ATOM   4051  O  OD1 . ASN A  1  512 ? 74.850  300.000 235.215 1.00 50.12  ? 512  ASN A OD1 1 
ATOM   4052  N  ND2 . ASN A  1  512 ? 76.298  301.687 235.100 1.00 117.55 ? 512  ASN A ND2 1 
ATOM   4053  N  N   . LEU A  1  513 ? 78.076  301.034 231.283 1.00 36.26  ? 513  LEU A N   1 
ATOM   4054  C  CA  . LEU A  1  513 ? 78.801  300.305 230.233 1.00 42.11  ? 513  LEU A CA  1 
ATOM   4055  C  C   . LEU A  1  513 ? 79.023  298.833 230.547 1.00 59.95  ? 513  LEU A C   1 
ATOM   4056  O  O   . LEU A  1  513 ? 79.120  298.026 229.611 1.00 150.04 ? 513  LEU A O   1 
ATOM   4057  C  CB  . LEU A  1  513 ? 80.137  300.985 229.937 1.00 51.84  ? 513  LEU A CB  1 
ATOM   4058  C  CG  . LEU A  1  513 ? 79.826  301.833 228.693 1.00 66.76  ? 513  LEU A CG  1 
ATOM   4059  C  CD1 . LEU A  1  513 ? 81.045  302.508 228.234 1.00 47.39  ? 513  LEU A CD1 1 
ATOM   4060  C  CD2 . LEU A  1  513 ? 79.172  301.006 227.535 1.00 45.60  ? 513  LEU A CD2 1 
ATOM   4061  N  N   . LYS A  1  514 ? 79.103  298.466 231.825 1.00 74.95  ? 514  LYS A N   1 
ATOM   4062  C  CA  . LYS A  1  514 ? 79.257  297.063 232.211 1.00 164.56 ? 514  LYS A CA  1 
ATOM   4063  C  C   . LYS A  1  514 ? 80.614  296.570 231.759 1.00 163.11 ? 514  LYS A C   1 
ATOM   4064  O  O   . LYS A  1  514 ? 80.754  295.374 231.514 1.00 63.44  ? 514  LYS A O   1 
ATOM   4065  C  CB  . LYS A  1  514 ? 78.140  296.167 231.627 1.00 65.09  ? 514  LYS A CB  1 
ATOM   4066  C  CG  . LYS A  1  514 ? 76.828  296.180 232.405 1.00 69.35  ? 514  LYS A CG  1 
ATOM   4067  C  CD  . LYS A  1  514 ? 75.725  295.507 231.645 1.00 56.21  ? 514  LYS A CD  1 
ATOM   4068  C  CE  . LYS A  1  514 ? 74.394  296.193 231.928 1.00 56.89  ? 514  LYS A CE  1 
ATOM   4069  N  NZ  . LYS A  1  514 ? 73.666  295.418 232.921 1.00 64.64  ? 514  LYS A NZ  1 
ATOM   4070  O  OXT . LYS A  1  514 ? 81.566  297.350 231.626 1.00 88.63  ? 514  LYS A OXT 1 
HETATM 4071  N  N   . FME B  2  1   ? 47.817  298.237 167.122 1.00 35.65  ? 1    FME B N   1 
HETATM 4072  C  CN  . FME B  2  1   ? 48.899  298.503 166.319 1.00 33.27  ? 1    FME B CN  1 
HETATM 4073  O  O1  . FME B  2  1   ? 49.326  299.640 166.258 1.00 35.04  ? 1    FME B O1  1 
HETATM 4074  C  CA  . FME B  2  1   ? 47.260  299.141 168.117 1.00 36.64  ? 1    FME B CA  1 
HETATM 4075  C  CB  . FME B  2  1   ? 46.145  300.008 167.550 1.00 32.97  ? 1    FME B CB  1 
HETATM 4076  C  CG  . FME B  2  1   ? 45.139  298.972 166.960 1.00 37.44  ? 1    FME B CG  1 
HETATM 4077  S  SD  . FME B  2  1   ? 43.835  299.877 166.301 1.00 41.25  ? 1    FME B SD  1 
HETATM 4078  C  CE  . FME B  2  1   ? 43.251  300.908 167.603 1.00 111.82 ? 1    FME B CE  1 
HETATM 4079  C  C   . FME B  2  1   ? 46.695  298.366 169.284 1.00 31.20  ? 1    FME B C   1 
HETATM 4080  O  O   . FME B  2  1   ? 46.508  297.144 169.221 1.00 37.10  ? 1    FME B O   1 
ATOM   4081  N  N   . ALA B  2  2   ? 46.437  299.082 170.369 1.00 28.93  ? 2    ALA B N   1 
ATOM   4082  C  CA  . ALA B  2  2   ? 45.704  298.498 171.501 1.00 29.83  ? 2    ALA B CA  1 
ATOM   4083  C  C   . ALA B  2  2   ? 44.239  298.346 171.217 1.00 32.59  ? 2    ALA B C   1 
ATOM   4084  O  O   . ALA B  2  2   ? 43.692  299.112 170.406 1.00 31.34  ? 2    ALA B O   1 
ATOM   4085  C  CB  . ALA B  2  2   ? 45.918  299.370 172.766 1.00 25.68  ? 2    ALA B CB  1 
ATOM   4086  N  N   . TYR B  2  3   ? 43.592  297.331 171.818 1.00 31.17  ? 3    TYR B N   1 
ATOM   4087  C  CA  . TYR B  2  3   ? 42.179  297.006 171.644 1.00 31.38  ? 3    TYR B CA  1 
ATOM   4088  C  C   . TYR B  2  3   ? 41.478  297.042 173.000 1.00 34.51  ? 3    TYR B C   1 
ATOM   4089  O  O   . TYR B  2  3   ? 42.140  296.990 174.042 1.00 31.63  ? 3    TYR B O   1 
ATOM   4090  C  CB  . TYR B  2  3   ? 41.987  295.621 170.958 1.00 31.10  ? 3    TYR B CB  1 
ATOM   4091  C  CG  . TYR B  2  3   ? 42.862  294.549 171.571 1.00 37.79  ? 3    TYR B CG  1 
ATOM   4092  C  CD1 . TYR B  2  3   ? 42.528  293.910 172.809 1.00 27.73  ? 3    TYR B CD1 1 
ATOM   4093  C  CD2 . TYR B  2  3   ? 44.086  294.252 170.983 1.00 32.03  ? 3    TYR B CD2 1 
ATOM   4094  C  CE1 . TYR B  2  3   ? 43.397  292.926 173.376 1.00 35.54  ? 3    TYR B CE1 1 
ATOM   4095  C  CE2 . TYR B  2  3   ? 44.944  293.313 171.550 1.00 37.54  ? 3    TYR B CE2 1 
ATOM   4096  C  CZ  . TYR B  2  3   ? 44.613  292.661 172.731 1.00 41.47  ? 3    TYR B CZ  1 
ATOM   4097  O  OH  . TYR B  2  3   ? 45.528  291.751 173.250 1.00 38.58  ? 3    TYR B OH  1 
ATOM   4098  N  N   . PRO B  2  4   ? 40.148  297.213 173.045 1.00 39.06  ? 4    PRO B N   1 
ATOM   4099  C  CA  . PRO B  2  4   ? 39.489  297.460 174.352 1.00 33.06  ? 4    PRO B CA  1 
ATOM   4100  C  C   . PRO B  2  4   ? 39.682  296.320 175.337 1.00 30.13  ? 4    PRO B C   1 
ATOM   4101  O  O   . PRO B  2  4   ? 39.712  295.135 174.956 1.00 34.37  ? 4    PRO B O   1 
ATOM   4102  C  CB  . PRO B  2  4   ? 38.009  297.641 173.984 1.00 33.90  ? 4    PRO B CB  1 
ATOM   4103  C  CG  . PRO B  2  4   ? 38.057  298.125 172.513 1.00 36.65  ? 4    PRO B CG  1 
ATOM   4104  C  CD  . PRO B  2  4   ? 39.248  297.437 171.884 1.00 37.07  ? 4    PRO B CD  1 
ATOM   4105  N  N   . MET B  2  5   ? 39.880  296.703 176.617 1.00 35.20  ? 5    MET B N   1 
ATOM   4106  C  CA  . MET B  2  5   ? 40.107  295.793 177.738 1.00 42.28  ? 5    MET B CA  1 
ATOM   4107  C  C   . MET B  2  5   ? 41.395  294.987 177.598 1.00 36.11  ? 5    MET B C   1 
ATOM   4108  O  O   . MET B  2  5   ? 41.522  293.898 178.168 1.00 44.01  ? 5    MET B O   1 
ATOM   4109  C  CB  . MET B  2  5   ? 38.921  294.845 177.944 1.00 43.18  ? 5    MET B CB  1 
ATOM   4110  C  CG  . MET B  2  5   ? 37.626  295.594 178.111 1.00 61.58  ? 5    MET B CG  1 
ATOM   4111  S  SD  . MET B  2  5   ? 36.319  294.433 178.450 1.00 63.41  ? 5    MET B SD  1 
ATOM   4112  C  CE  . MET B  2  5   ? 37.091  293.563 179.874 1.00 45.75  ? 5    MET B CE  1 
ATOM   4113  N  N   . GLN B  2  6   ? 42.359  295.486 176.852 1.00 36.11  ? 6    GLN B N   1 
ATOM   4114  C  CA  . GLN B  2  6   ? 43.590  294.743 176.716 1.00 27.99  ? 6    GLN B CA  1 
ATOM   4115  C  C   . GLN B  2  6   ? 44.337  294.724 178.055 1.00 36.78  ? 6    GLN B C   1 
ATOM   4116  O  O   . GLN B  2  6   ? 44.382  295.729 178.756 1.00 34.45  ? 6    GLN B O   1 
ATOM   4117  C  CB  . GLN B  2  6   ? 44.441  295.379 175.605 1.00 34.09  ? 6    GLN B CB  1 
ATOM   4118  C  CG  . GLN B  2  6   ? 45.760  294.697 175.378 1.00 32.41  ? 6    GLN B CG  1 
ATOM   4119  C  CD  . GLN B  2  6   ? 46.474  295.327 174.140 1.00 31.91  ? 6    GLN B CD  1 
ATOM   4120  O  OE1 . GLN B  2  6   ? 45.825  295.915 173.337 1.00 35.70  ? 6    GLN B OE1 1 
ATOM   4121  N  NE2 . GLN B  2  6   ? 47.800  295.284 174.091 1.00 32.11  ? 6    GLN B NE2 1 
ATOM   4122  N  N   . LEU B  2  7   ? 44.928  293.582 178.390 1.00 27.78  ? 7    LEU B N   1 
ATOM   4123  C  CA  . LEU B  2  7   ? 45.686  293.398 179.639 1.00 32.21  ? 7    LEU B CA  1 
ATOM   4124  C  C   . LEU B  2  7   ? 47.194  293.455 179.462 1.00 38.38  ? 7    LEU B C   1 
ATOM   4125  O  O   . LEU B  2  7   ? 47.901  294.008 180.324 1.00 34.52  ? 7    LEU B O   1 
ATOM   4126  C  CB  . LEU B  2  7   ? 45.337  292.044 180.243 1.00 35.57  ? 7    LEU B CB  1 
ATOM   4127  C  CG  . LEU B  2  7   ? 43.872  291.743 180.541 1.00 40.17  ? 7    LEU B CG  1 
ATOM   4128  C  CD1 . LEU B  2  7   ? 43.767  290.447 181.350 1.00 46.22  ? 7    LEU B CD1 1 
ATOM   4129  C  CD2 . LEU B  2  7   ? 43.330  292.880 181.372 1.00 32.32  ? 7    LEU B CD2 1 
ATOM   4130  N  N   . GLY B  2  8   ? 47.725  292.842 178.400 1.00 29.56  ? 8    GLY B N   1 
ATOM   4131  C  CA  . GLY B  2  8   ? 49.141  292.757 178.193 1.00 26.65  ? 8    GLY B CA  1 
ATOM   4132  C  C   . GLY B  2  8   ? 49.628  293.573 177.008 1.00 32.19  ? 8    GLY B C   1 
ATOM   4133  O  O   . GLY B  2  8   ? 48.980  294.528 176.567 1.00 29.08  ? 8    GLY B O   1 
ATOM   4134  N  N   . PHE B  2  9   ? 50.800  293.206 176.512 1.00 29.92  ? 9    PHE B N   1 
ATOM   4135  C  CA  . PHE B  2  9   ? 51.407  293.882 175.383 1.00 32.09  ? 9    PHE B CA  1 
ATOM   4136  C  C   . PHE B  2  9   ? 50.589  293.685 174.072 1.00 36.49  ? 9    PHE B C   1 
ATOM   4137  O  O   . PHE B  2  9   ? 49.910  292.676 173.871 1.00 29.64  ? 9    PHE B O   1 
ATOM   4138  C  CB  . PHE B  2  9   ? 52.822  293.357 175.152 1.00 27.81  ? 9    PHE B CB  1 
ATOM   4139  C  CG  . PHE B  2  9   ? 53.888  293.852 176.162 1.00 30.75  ? 9    PHE B CG  1 
ATOM   4140  C  CD1 . PHE B  2  9   ? 54.301  295.178 176.141 1.00 30.98  ? 9    PHE B CD1 1 
ATOM   4141  C  CD2 . PHE B  2  9   ? 54.483  292.980 177.045 1.00 36.44  ? 9    PHE B CD2 1 
ATOM   4142  C  CE1 . PHE B  2  9   ? 55.273  295.644 177.038 1.00 31.97  ? 9    PHE B CE1 1 
ATOM   4143  C  CE2 . PHE B  2  9   ? 55.435  293.443 177.965 1.00 30.29  ? 9    PHE B CE2 1 
ATOM   4144  C  CZ  . PHE B  2  9   ? 55.835  294.772 177.951 1.00 28.08  ? 9    PHE B CZ  1 
ATOM   4145  N  N   . GLN B  2  10  ? 50.703  294.660 173.180 1.00 31.96  ? 10   GLN B N   1 
ATOM   4146  C  CA  . GLN B  2  10  ? 50.257  294.472 171.780 1.00 37.08  ? 10   GLN B CA  1 
ATOM   4147  C  C   . GLN B  2  10  ? 50.988  293.282 171.148 1.00 45.57  ? 10   GLN B C   1 
ATOM   4148  O  O   . GLN B  2  10  ? 52.139  292.978 171.481 1.00 33.04  ? 10   GLN B O   1 
ATOM   4149  C  CB  . GLN B  2  10  ? 50.474  295.758 170.977 1.00 32.33  ? 10   GLN B CB  1 
ATOM   4150  C  CG  . GLN B  2  10  ? 49.651  296.953 171.480 1.00 33.54  ? 10   GLN B CG  1 
ATOM   4151  C  CD  . GLN B  2  10  ? 49.991  298.341 170.871 1.00 38.48  ? 10   GLN B CD  1 
ATOM   4152  O  OE1 . GLN B  2  10  ? 49.945  299.383 171.569 1.00 35.75  ? 10   GLN B OE1 1 
ATOM   4153  N  NE2 . GLN B  2  10  ? 50.318  298.366 169.577 1.00 29.04  ? 10   GLN B NE2 1 
ATOM   4154  N  N   . ASP B  2  11  ? 50.300  292.549 170.281 1.00 31.14  ? 11   ASP B N   1 
ATOM   4155  C  CA  . ASP B  2  11  ? 50.945  291.446 169.562 1.00 32.38  ? 11   ASP B CA  1 
ATOM   4156  C  C   . ASP B  2  11  ? 52.214  291.921 168.869 1.00 32.62  ? 11   ASP B C   1 
ATOM   4157  O  O   . ASP B  2  11  ? 52.272  293.026 168.337 1.00 30.55  ? 11   ASP B O   1 
ATOM   4158  C  CB  . ASP B  2  11  ? 50.009  290.854 168.477 1.00 35.97  ? 11   ASP B CB  1 
ATOM   4159  C  CG  . ASP B  2  11  ? 48.909  289.988 169.049 1.00 40.08  ? 11   ASP B CG  1 
ATOM   4160  O  OD1 . ASP B  2  11  ? 48.707  289.904 170.288 1.00 33.89  ? 11   ASP B OD1 1 
ATOM   4161  O  OD2 . ASP B  2  11  ? 48.222  289.368 168.247 1.00 37.35  ? 11   ASP B OD2 1 
ATOM   4162  N  N   . ALA B  2  12  ? 53.246  291.085 168.909 1.00 30.96  ? 12   ALA B N   1 
ATOM   4163  C  CA  . ALA B  2  12  ? 54.526  291.487 168.362 1.00 39.82  ? 12   ALA B CA  1 
ATOM   4164  C  C   . ALA B  2  12  ? 54.467  291.568 166.830 1.00 71.97  ? 12   ALA B C   1 
ATOM   4165  O  O   . ALA B  2  12  ? 53.902  290.723 166.143 1.00 36.38  ? 12   ALA B O   1 
ATOM   4166  C  CB  . ALA B  2  12  ? 55.622  290.515 168.791 1.00 37.14  ? 12   ALA B CB  1 
ATOM   4167  N  N   . THR B  2  13  ? 55.058  292.607 166.297 1.00 34.53  ? 13   THR B N   1 
ATOM   4168  C  CA  . THR B  2  13  ? 55.165  292.802 164.850 1.00 36.66  ? 13   THR B CA  1 
ATOM   4169  C  C   . THR B  2  13  ? 56.578  292.535 164.352 1.00 40.07  ? 13   THR B C   1 
ATOM   4170  O  O   . THR B  2  13  ? 56.782  292.328 163.148 1.00 41.05  ? 13   THR B O   1 
ATOM   4171  C  CB  . THR B  2  13  ? 54.786  294.245 164.503 1.00 40.57  ? 13   THR B CB  1 
ATOM   4172  O  OG1 . THR B  2  13  ? 53.563  294.581 165.130 1.00 44.19  ? 13   THR B OG1 1 
ATOM   4173  C  CG2 . THR B  2  13  ? 54.619  294.429 162.963 1.00 47.06  ? 13   THR B CG2 1 
ATOM   4174  N  N   . SER B  2  14  ? 57.564  292.650 165.239 1.00 37.84  ? 14   SER B N   1 
ATOM   4175  C  CA  . SER B  2  14  ? 58.960  292.410 164.910 1.00 41.23  ? 14   SER B CA  1 
ATOM   4176  C  C   . SER B  2  14  ? 59.452  291.230 165.733 1.00 45.33  ? 14   SER B C   1 
ATOM   4177  O  O   . SER B  2  14  ? 58.845  290.906 166.773 1.00 34.87  ? 14   SER B O   1 
ATOM   4178  C  CB  . SER B  2  14  ? 59.853  293.632 165.189 1.00 34.58  ? 14   SER B CB  1 
ATOM   4179  O  OG  . SER B  2  14  ? 59.986  293.838 166.606 1.00 47.64  ? 14   SER B OG  1 
ATOM   4180  N  N   . PRO B  2  15  ? 60.483  290.521 165.257 1.00 42.96  ? 15   PRO B N   1 
ATOM   4181  C  CA  . PRO B  2  15  ? 61.043  289.417 166.050 1.00 40.80  ? 15   PRO B CA  1 
ATOM   4182  C  C   . PRO B  2  15  ? 61.602  289.882 167.374 1.00 50.07  ? 15   PRO B C   1 
ATOM   4183  O  O   . PRO B  2  15  ? 61.534  289.126 168.334 1.00 39.51  ? 15   PRO B O   1 
ATOM   4184  C  CB  . PRO B  2  15  ? 62.154  288.835 165.154 1.00 52.27  ? 15   PRO B CB  1 
ATOM   4185  C  CG  . PRO B  2  15  ? 61.712  289.230 163.674 1.00 39.72  ? 15   PRO B CG  1 
ATOM   4186  C  CD  . PRO B  2  15  ? 61.134  290.645 163.927 1.00 49.90  ? 15   PRO B CD  1 
ATOM   4187  N  N   . ILE B  2  16  ? 62.140  291.100 167.465 1.00 36.71  ? 16   ILE B N   1 
ATOM   4188  C  CA  . ILE B  2  16  ? 62.625  291.595 168.752 1.00 42.34  ? 16   ILE B CA  1 
ATOM   4189  C  C   . ILE B  2  16  ? 61.463  291.799 169.708 1.00 58.93  ? 16   ILE B C   1 
ATOM   4190  O  O   . ILE B  2  16  ? 61.543  291.416 170.876 1.00 40.10  ? 16   ILE B O   1 
ATOM   4191  C  CB  . ILE B  2  16  ? 63.452  292.881 168.586 1.00 40.77  ? 16   ILE B CB  1 
ATOM   4192  C  CG1 . ILE B  2  16  ? 64.832  292.512 168.049 1.00 122.48 ? 16   ILE B CG1 1 
ATOM   4193  C  CG2 . ILE B  2  16  ? 63.713  293.534 169.974 1.00 51.52  ? 16   ILE B CG2 1 
ATOM   4194  C  CD1 . ILE B  2  16  ? 65.573  291.547 168.985 1.00 76.38  ? 16   ILE B CD1 1 
ATOM   4195  N  N   . MET B  2  17  ? 60.356  292.384 169.239 1.00 33.06  ? 17   MET B N   1 
ATOM   4196  C  CA  . MET B  2  17  ? 59.209  292.491 170.120 1.00 40.54  ? 17   MET B CA  1 
ATOM   4197  C  C   . MET B  2  17  ? 58.726  291.102 170.556 1.00 38.56  ? 17   MET B C   1 
ATOM   4198  O  O   . MET B  2  17  ? 58.287  290.934 171.699 1.00 38.16  ? 17   MET B O   1 
ATOM   4199  C  CB  . MET B  2  17  ? 58.101  293.326 169.458 1.00 35.90  ? 17   MET B CB  1 
ATOM   4200  C  CG  . MET B  2  17  ? 56.902  293.620 170.358 1.00 34.41  ? 17   MET B CG  1 
ATOM   4201  S  SD  . MET B  2  17  ? 57.411  294.527 171.908 1.00 37.80  ? 17   MET B SD  1 
ATOM   4202  C  CE  . MET B  2  17  ? 56.314  293.780 173.123 1.00 43.99  ? 17   MET B CE  1 
ATOM   4203  N  N   . GLU B  2  18  ? 58.841  290.072 169.706 1.00 35.03  ? 18   GLU B N   1 
ATOM   4204  C  CA  . GLU B  2  18  ? 58.437  288.734 170.167 1.00 38.41  ? 18   GLU B CA  1 
ATOM   4205  C  C   . GLU B  2  18  ? 59.326  288.265 171.307 1.00 38.15  ? 18   GLU B C   1 
ATOM   4206  O  O   . GLU B  2  18  ? 58.851  287.594 172.230 1.00 34.96  ? 18   GLU B O   1 
ATOM   4207  C  CB  . GLU B  2  18  ? 58.544  287.671 169.076 1.00 45.20  ? 18   GLU B CB  1 
ATOM   4208  C  CG  . GLU B  2  18  ? 57.479  287.605 168.082 1.00 73.85  ? 18   GLU B CG  1 
ATOM   4209  C  CD  . GLU B  2  18  ? 57.847  286.585 167.021 1.00 152.79 ? 18   GLU B CD  1 
ATOM   4210  O  OE1 . GLU B  2  18  ? 58.089  286.958 165.838 1.00 59.68  ? 18   GLU B OE1 1 
ATOM   4211  O  OE2 . GLU B  2  18  ? 57.967  285.404 167.414 1.00 43.40  ? 18   GLU B OE2 1 
ATOM   4212  N  N   . GLU B  2  19  ? 60.638  288.490 171.171 1.00 36.01  ? 19   GLU B N   1 
ATOM   4213  C  CA  . GLU B  2  19  ? 61.592  288.174 172.243 1.00 41.07  ? 19   GLU B CA  1 
ATOM   4214  C  C   . GLU B  2  19  ? 61.189  288.831 173.549 1.00 41.56  ? 19   GLU B C   1 
ATOM   4215  O  O   . GLU B  2  19  ? 61.300  288.230 174.630 1.00 36.25  ? 19   GLU B O   1 
ATOM   4216  C  CB  . GLU B  2  19  ? 62.996  288.653 171.852 1.00 38.31  ? 19   GLU B CB  1 
ATOM   4217  C  CG  . GLU B  2  19  ? 63.653  287.860 170.724 1.00 43.72  ? 19   GLU B CG  1 
ATOM   4218  C  CD  . GLU B  2  19  ? 64.151  286.498 171.189 1.00 61.52  ? 19   GLU B CD  1 
ATOM   4219  O  OE1 . GLU B  2  19  ? 64.870  285.820 170.436 1.00 78.52  ? 19   GLU B OE1 1 
ATOM   4220  O  OE2 . GLU B  2  19  ? 63.838  286.102 172.329 1.00 58.18  ? 19   GLU B OE2 1 
ATOM   4221  N  N   . LEU B  2  20  ? 60.755  290.080 173.475 1.00 34.10  ? 20   LEU B N   1 
ATOM   4222  C  CA  . LEU B  2  20  ? 60.378  290.804 174.678 1.00 38.86  ? 20   LEU B CA  1 
ATOM   4223  C  C   . LEU B  2  20  ? 59.137  290.200 175.301 1.00 44.49  ? 20   LEU B C   1 
ATOM   4224  O  O   . LEU B  2  20  ? 59.039  290.145 176.521 1.00 34.74  ? 20   LEU B O   1 
ATOM   4225  C  CB  . LEU B  2  20  ? 60.165  292.307 174.372 1.00 30.69  ? 20   LEU B CB  1 
ATOM   4226  C  CG  . LEU B  2  20  ? 61.404  293.128 174.077 1.00 41.88  ? 20   LEU B CG  1 
ATOM   4227  C  CD1 . LEU B  2  20  ? 60.920  294.547 173.766 1.00 32.61  ? 20   LEU B CD1 1 
ATOM   4228  C  CD2 . LEU B  2  20  ? 62.326  293.073 175.344 1.00 30.98  ? 20   LEU B CD2 1 
ATOM   4229  N  N   . LEU B  2  21  ? 58.179  289.723 174.496 1.00 31.87  ? 21   LEU B N   1 
ATOM   4230  C  CA  . LEU B  2  21  ? 56.991  289.099 175.075 1.00 29.39  ? 21   LEU B CA  1 
ATOM   4231  C  C   . LEU B  2  21  ? 57.368  287.875 175.889 1.00 27.98  ? 21   LEU B C   1 
ATOM   4232  O  O   . LEU B  2  21  ? 56.846  287.664 176.997 1.00 31.72  ? 21   LEU B O   1 
ATOM   4233  C  CB  . LEU B  2  21  ? 55.981  288.683 173.987 1.00 30.04  ? 21   LEU B CB  1 
ATOM   4234  C  CG  . LEU B  2  21  ? 55.325  289.768 173.136 1.00 38.89  ? 21   LEU B CG  1 
ATOM   4235  C  CD1 . LEU B  2  21  ? 54.279  289.140 172.108 1.00 30.75  ? 21   LEU B CD1 1 
ATOM   4236  C  CD2 . LEU B  2  21  ? 54.628  290.741 174.043 1.00 33.95  ? 21   LEU B CD2 1 
ATOM   4237  N  N   . HIS B  2  22  ? 58.257  287.038 175.355 1.00 32.31  ? 22   HIS B N   1 
ATOM   4238  C  CA  . HIS B  2  22  ? 58.625  285.824 176.090 1.00 29.83  ? 22   HIS B CA  1 
ATOM   4239  C  C   . HIS B  2  22  ? 59.423  286.172 177.345 1.00 35.40  ? 22   HIS B C   1 
ATOM   4240  O  O   . HIS B  2  22  ? 59.265  285.529 178.391 1.00 33.71  ? 22   HIS B O   1 
ATOM   4241  C  CB  . HIS B  2  22  ? 59.464  284.898 175.172 1.00 37.73  ? 22   HIS B CB  1 
ATOM   4242  C  CG  . HIS B  2  22  ? 58.746  284.485 173.931 1.00 119.35 ? 22   HIS B CG  1 
ATOM   4243  N  ND1 . HIS B  2  22  ? 57.506  283.881 173.958 1.00 55.23  ? 22   HIS B ND1 1 
ATOM   4244  C  CD2 . HIS B  2  22  ? 59.088  284.596 172.624 1.00 67.05  ? 22   HIS B CD2 1 
ATOM   4245  C  CE1 . HIS B  2  22  ? 57.111  283.647 172.713 1.00 54.76  ? 22   HIS B CE1 1 
ATOM   4246  N  NE2 . HIS B  2  22  ? 58.058  284.060 171.889 1.00 74.83  ? 22   HIS B NE2 1 
ATOM   4247  N  N   . PHE B  2  23  ? 60.322  287.155 177.238 1.00 28.66  ? 23   PHE B N   1 
ATOM   4248  C  CA  . PHE B  2  23  ? 61.059  287.600 178.432 1.00 30.64  ? 23   PHE B CA  1 
ATOM   4249  C  C   . PHE B  2  23  ? 60.120  288.188 179.494 1.00 37.19  ? 23   PHE B C   1 
ATOM   4250  O  O   . PHE B  2  23  ? 60.294  287.947 180.699 1.00 33.32  ? 23   PHE B O   1 
ATOM   4251  C  CB  . PHE B  2  23  ? 62.133  288.610 178.008 1.00 27.99  ? 23   PHE B CB  1 
ATOM   4252  C  CG  . PHE B  2  23  ? 62.850  289.260 179.204 1.00 29.66  ? 23   PHE B CG  1 
ATOM   4253  C  CD1 . PHE B  2  23  ? 63.603  288.477 180.077 1.00 38.74  ? 23   PHE B CD1 1 
ATOM   4254  C  CD2 . PHE B  2  23  ? 62.684  290.601 179.463 1.00 33.59  ? 23   PHE B CD2 1 
ATOM   4255  C  CE1 . PHE B  2  23  ? 64.210  289.036 181.194 1.00 36.84  ? 23   PHE B CE1 1 
ATOM   4256  C  CE2 . PHE B  2  23  ? 63.312  291.191 180.592 1.00 43.28  ? 23   PHE B CE2 1 
ATOM   4257  C  CZ  . PHE B  2  23  ? 64.053  290.390 181.460 1.00 35.13  ? 23   PHE B CZ  1 
ATOM   4258  N  N   . HIS B  2  24  ? 59.099  288.954 179.068 1.00 31.98  ? 24   HIS B N   1 
ATOM   4259  C  CA  . HIS B  2  24  ? 58.108  289.459 180.044 1.00 32.71  ? 24   HIS B CA  1 
ATOM   4260  C  C   . HIS B  2  24  ? 57.335  288.315 180.688 1.00 35.20  ? 24   HIS B C   1 
ATOM   4261  O  O   . HIS B  2  24  ? 57.106  288.325 181.904 1.00 31.24  ? 24   HIS B O   1 
ATOM   4262  C  CB  . HIS B  2  24  ? 57.114  290.448 179.373 1.00 32.67  ? 24   HIS B CB  1 
ATOM   4263  C  CG  . HIS B  2  24  ? 56.101  290.988 180.320 1.00 34.71  ? 24   HIS B CG  1 
ATOM   4264  N  ND1 . HIS B  2  24  ? 54.765  290.661 180.246 1.00 33.91  ? 24   HIS B ND1 1 
ATOM   4265  C  CD2 . HIS B  2  24  ? 56.240  291.779 181.423 1.00 32.31  ? 24   HIS B CD2 1 
ATOM   4266  C  CE1 . HIS B  2  24  ? 54.121  291.235 181.250 1.00 30.89  ? 24   HIS B CE1 1 
ATOM   4267  N  NE2 . HIS B  2  24  ? 54.992  291.916 181.982 1.00 32.21  ? 24   HIS B NE2 1 
ATOM   4268  N  N   . ASP B  2  25  ? 56.909  287.326 179.896 1.00 30.83  ? 25   ASP B N   1 
ATOM   4269  C  CA  . ASP B  2  25  ? 56.246  286.152 180.488 1.00 34.38  ? 25   ASP B CA  1 
ATOM   4270  C  C   . ASP B  2  25  ? 57.109  285.533 181.602 1.00 32.72  ? 25   ASP B C   1 
ATOM   4271  O  O   . ASP B  2  25  ? 56.614  285.228 182.699 1.00 35.71  ? 25   ASP B O   1 
ATOM   4272  C  CB  . ASP B  2  25  ? 55.950  285.084 179.414 1.00 34.47  ? 25   ASP B CB  1 
ATOM   4273  C  CG  . ASP B  2  25  ? 54.823  285.485 178.485 1.00 43.97  ? 25   ASP B CG  1 
ATOM   4274  O  OD1 . ASP B  2  25  ? 54.049  286.410 178.811 1.00 36.36  ? 25   ASP B OD1 1 
ATOM   4275  O  OD2 . ASP B  2  25  ? 54.713  284.857 177.416 1.00 39.50  ? 25   ASP B OD2 1 
ATOM   4276  N  N   . HIS B  2  26  ? 58.375  285.274 181.289 1.00 34.26  ? 26   HIS B N   1 
ATOM   4277  C  CA  . HIS B  2  26  ? 59.347  284.745 182.270 1.00 32.37  ? 26   HIS B CA  1 
ATOM   4278  C  C   . HIS B  2  26  ? 59.391  285.616 183.509 1.00 35.98  ? 26   HIS B C   1 
ATOM   4279  O  O   . HIS B  2  26  ? 59.262  285.123 184.639 1.00 37.33  ? 26   HIS B O   1 
ATOM   4280  C  CB  . HIS B  2  26  ? 60.736  284.679 181.566 1.00 35.81  ? 26   HIS B CB  1 
ATOM   4281  C  CG  . HIS B  2  26  ? 61.901  284.366 182.465 1.00 41.80  ? 26   HIS B CG  1 
ATOM   4282  N  ND1 . HIS B  2  26  ? 62.145  283.104 182.961 1.00 44.33  ? 26   HIS B ND1 1 
ATOM   4283  C  CD2 . HIS B  2  26  ? 62.940  285.136 182.883 1.00 42.24  ? 26   HIS B CD2 1 
ATOM   4284  C  CE1 . HIS B  2  26  ? 63.246  283.112 183.689 1.00 80.51  ? 26   HIS B CE1 1 
ATOM   4285  N  NE2 . HIS B  2  26  ? 63.753  284.329 183.665 1.00 39.04  ? 26   HIS B NE2 1 
ATOM   4286  N  N   . THR B  2  27  ? 59.577  286.923 183.331 1.00 30.70  ? 27   THR B N   1 
ATOM   4287  C  CA  . THR B  2  27  ? 59.731  287.811 184.485 1.00 32.87  ? 27   THR B CA  1 
ATOM   4288  C  C   . THR B  2  27  ? 58.433  287.926 185.277 1.00 36.92  ? 27   THR B C   1 
ATOM   4289  O  O   . THR B  2  27  ? 58.439  287.927 186.531 1.00 39.71  ? 27   THR B O   1 
ATOM   4290  C  CB  . THR B  2  27  ? 60.214  289.183 183.999 1.00 37.47  ? 27   THR B CB  1 
ATOM   4291  O  OG1 . THR B  2  27  ? 61.416  289.006 183.187 1.00 32.62  ? 27   THR B OG1 1 
ATOM   4292  C  CG2 . THR B  2  27  ? 60.559  290.070 185.167 1.00 35.85  ? 27   THR B CG2 1 
ATOM   4293  N  N   . LEU B  2  28  ? 57.294  287.996 184.579 1.00 30.60  ? 28   LEU B N   1 
ATOM   4294  C  CA  . LEU B  2  28  ? 56.034  288.149 185.291 1.00 30.81  ? 28   LEU B CA  1 
ATOM   4295  C  C   . LEU B  2  28  ? 55.721  286.930 186.124 1.00 37.91  ? 28   LEU B C   1 
ATOM   4296  O  O   . LEU B  2  28  ? 55.077  287.040 187.178 1.00 37.18  ? 28   LEU B O   1 
ATOM   4297  C  CB  . LEU B  2  28  ? 54.886  288.428 184.304 1.00 28.97  ? 28   LEU B CB  1 
ATOM   4298  C  CG  . LEU B  2  28  ? 53.498  288.587 184.935 1.00 39.82  ? 28   LEU B CG  1 
ATOM   4299  C  CD1 . LEU B  2  28  ? 53.479  289.753 185.978 1.00 41.23  ? 28   LEU B CD1 1 
ATOM   4300  C  CD2 . LEU B  2  28  ? 52.438  288.788 183.760 1.00 42.16  ? 28   LEU B CD2 1 
ATOM   4301  N  N   . MET B  2  29  ? 56.141  285.756 185.664 1.00 34.55  ? 29   MET B N   1 
ATOM   4302  C  CA  . MET B  2  29  ? 55.900  284.578 186.468 1.00 39.54  ? 29   MET B CA  1 
ATOM   4303  C  C   . MET B  2  29  ? 56.585  284.712 187.823 1.00 30.38  ? 29   MET B C   1 
ATOM   4304  O  O   . MET B  2  29  ? 55.991  284.379 188.857 1.00 32.02  ? 29   MET B O   1 
ATOM   4305  C  CB  . MET B  2  29  ? 56.420  283.355 185.759 1.00 31.91  ? 29   MET B CB  1 
ATOM   4306  C  CG  . MET B  2  29  ? 56.035  282.093 186.514 1.00 55.44  ? 29   MET B CG  1 
ATOM   4307  S  SD  . MET B  2  29  ? 56.841  280.653 185.827 1.00 56.63  ? 29   MET B SD  1 
ATOM   4308  C  CE  . MET B  2  29  ? 58.539  280.963 186.413 1.00 55.81  ? 29   MET B CE  1 
ATOM   4309  N  N   . ILE B  2  30  ? 57.841  285.182 187.792 1.00 34.94  ? 30   ILE B N   1 
ATOM   4310  C  CA  . ILE B  2  30  ? 58.650  285.416 188.995 1.00 32.35  ? 30   ILE B CA  1 
ATOM   4311  C  C   . ILE B  2  30  ? 58.013  286.471 189.882 1.00 34.88  ? 30   ILE B C   1 
ATOM   4312  O  O   . ILE B  2  30  ? 57.900  286.290 191.105 1.00 34.87  ? 30   ILE B O   1 
ATOM   4313  C  CB  . ILE B  2  30  ? 60.086  285.786 188.599 1.00 34.20  ? 30   ILE B CB  1 
ATOM   4314  C  CG1 . ILE B  2  30  ? 60.719  284.562 187.938 1.00 38.87  ? 30   ILE B CG1 1 
ATOM   4315  C  CG2 . ILE B  2  30  ? 60.872  286.211 189.829 1.00 37.75  ? 30   ILE B CG2 1 
ATOM   4316  C  CD1 . ILE B  2  30  ? 61.819  284.897 186.963 1.00 41.28  ? 30   ILE B CD1 1 
ATOM   4317  N  N   . VAL B  2  31  ? 57.543  287.561 189.264 1.00 30.96  ? 31   VAL B N   1 
ATOM   4318  C  CA  . VAL B  2  31  ? 56.831  288.612 190.002 1.00 29.38  ? 31   VAL B CA  1 
ATOM   4319  C  C   . VAL B  2  31  ? 55.585  288.050 190.706 1.00 46.87  ? 31   VAL B C   1 
ATOM   4320  O  O   . VAL B  2  31  ? 55.341  288.306 191.895 1.00 31.95  ? 31   VAL B O   1 
ATOM   4321  C  CB  . VAL B  2  31  ? 56.461  289.760 189.051 1.00 36.94  ? 31   VAL B CB  1 
ATOM   4322  C  CG1 . VAL B  2  31  ? 55.463  290.680 189.704 1.00 41.87  ? 31   VAL B CG1 1 
ATOM   4323  C  CG2 . VAL B  2  31  ? 57.715  290.495 188.684 1.00 37.91  ? 31   VAL B CG2 1 
ATOM   4324  N  N   . PHE B  2  32  ? 54.748  287.335 189.967 1.00 36.70  ? 32   PHE B N   1 
ATOM   4325  C  CA  . PHE B  2  32  ? 53.560  286.734 190.577 1.00 37.28  ? 32   PHE B CA  1 
ATOM   4326  C  C   . PHE B  2  32  ? 53.933  285.800 191.722 1.00 36.30  ? 32   PHE B C   1 
ATOM   4327  O  O   . PHE B  2  32  ? 53.296  285.798 192.780 1.00 35.89  ? 32   PHE B O   1 
ATOM   4328  C  CB  . PHE B  2  32  ? 52.774  285.894 189.542 1.00 37.52  ? 32   PHE B CB  1 
ATOM   4329  C  CG  A PHE B  2  32  ? 51.873  286.672 188.639 0.50 28.07  ? 32   PHE B CG  1 
ATOM   4330  C  CG  B PHE B  2  32  ? 51.400  285.492 190.067 0.50 35.21  ? 32   PHE B CG  1 
ATOM   4331  C  CD1 A PHE B  2  32  ? 51.119  287.743 189.119 0.50 40.28  ? 32   PHE B CD1 1 
ATOM   4332  C  CD1 B PHE B  2  32  ? 50.383  286.423 190.152 0.50 47.14  ? 32   PHE B CD1 1 
ATOM   4333  C  CD2 A PHE B  2  32  ? 51.700  286.277 187.292 0.50 26.81  ? 32   PHE B CD2 1 
ATOM   4334  C  CD2 B PHE B  2  32  ? 51.177  284.234 190.581 0.50 61.05  ? 32   PHE B CD2 1 
ATOM   4335  C  CE1 A PHE B  2  32  ? 50.267  288.441 188.255 0.50 32.93  ? 32   PHE B CE1 1 
ATOM   4336  C  CE1 B PHE B  2  32  ? 49.154  286.073 190.673 0.50 47.23  ? 32   PHE B CE1 1 
ATOM   4337  C  CE2 A PHE B  2  32  ? 50.846  286.966 186.444 0.50 29.12  ? 32   PHE B CE2 1 
ATOM   4338  C  CE2 B PHE B  2  32  ? 49.943  283.887 191.093 0.50 46.57  ? 32   PHE B CE2 1 
ATOM   4339  C  CZ  A PHE B  2  32  ? 50.136  288.047 186.913 0.50 36.53  ? 32   PHE B CZ  1 
ATOM   4340  C  CZ  B PHE B  2  32  ? 48.941  284.807 191.122 0.50 29.39  ? 32   PHE B CZ  1 
ATOM   4341  N  N   . LEU B  2  33  ? 54.897  284.921 191.480 1.00 29.55  ? 33   LEU B N   1 
ATOM   4342  C  CA  . LEU B  2  33  ? 55.303  283.960 192.509 1.00 39.33  ? 33   LEU B CA  1 
ATOM   4343  C  C   . LEU B  2  33  ? 55.781  284.655 193.781 1.00 50.16  ? 33   LEU B C   1 
ATOM   4344  O  O   . LEU B  2  33  ? 55.390  284.280 194.895 1.00 36.76  ? 33   LEU B O   1 
ATOM   4345  C  CB  . LEU B  2  33  ? 56.437  283.101 191.981 1.00 34.30  ? 33   LEU B CB  1 
ATOM   4346  C  CG  . LEU B  2  33  ? 56.267  281.608 191.898 1.00 74.21  ? 33   LEU B CG  1 
ATOM   4347  C  CD1 . LEU B  2  33  ? 54.801  281.232 191.962 1.00 60.99  ? 33   LEU B CD1 1 
ATOM   4348  C  CD2 . LEU B  2  33  ? 56.876  281.213 190.609 1.00 46.39  ? 33   LEU B CD2 1 
ATOM   4349  N  N   . ILE B  2  34  ? 56.697  285.620 193.633 1.00 32.85  ? 34   ILE B N   1 
ATOM   4350  C  CA  . ILE B  2  34  ? 57.261  286.286 194.809 1.00 34.17  ? 34   ILE B CA  1 
ATOM   4351  C  C   . ILE B  2  34  ? 56.189  287.069 195.553 1.00 40.30  ? 34   ILE B C   1 
ATOM   4352  O  O   . ILE B  2  34  ? 56.081  286.987 196.781 1.00 32.60  ? 34   ILE B O   1 
ATOM   4353  C  CB  . ILE B  2  34  ? 58.433  287.186 194.417 1.00 30.31  ? 34   ILE B CB  1 
ATOM   4354  C  CG1 . ILE B  2  34  ? 59.592  286.299 193.923 1.00 28.97  ? 34   ILE B CG1 1 
ATOM   4355  C  CG2 . ILE B  2  34  ? 58.839  288.079 195.651 1.00 30.71  ? 34   ILE B CG2 1 
ATOM   4356  C  CD1 . ILE B  2  34  ? 60.715  287.111 193.296 1.00 33.07  ? 34   ILE B CD1 1 
ATOM   4357  N  N   . SER B  2  35  ? 55.342  287.804 194.821 1.00 34.06  ? 35   SER B N   1 
ATOM   4358  C  CA  . SER B  2  35  ? 54.301  288.582 195.505 1.00 30.72  ? 35   SER B CA  1 
ATOM   4359  C  C   . SER B  2  35  ? 53.269  287.652 196.153 1.00 36.65  ? 35   SER B C   1 
ATOM   4360  O  O   . SER B  2  35  ? 52.789  287.920 197.269 1.00 35.23  ? 35   SER B O   1 
ATOM   4361  C  CB  . SER B  2  35  ? 53.617  289.542 194.492 1.00 34.87  ? 35   SER B CB  1 
ATOM   4362  O  OG  . SER B  2  35  ? 52.977  288.712 193.582 1.00 51.53  ? 35   SER B OG  1 
ATOM   4363  N  N   . SER B  2  36  ? 52.966  286.526 195.496 1.00 31.22  ? 36   SER B N   1 
ATOM   4364  C  CA  . SER B  2  36  ? 52.082  285.503 196.072 1.00 36.18  ? 36   SER B CA  1 
ATOM   4365  C  C   . SER B  2  36  ? 52.681  284.894 197.329 1.00 42.09  ? 36   SER B C   1 
ATOM   4366  O  O   . SER B  2  36  ? 51.976  284.670 198.326 1.00 34.49  ? 36   SER B O   1 
ATOM   4367  C  CB  . SER B  2  36  ? 51.820  284.387 195.041 1.00 39.34  ? 36   SER B CB  1 
ATOM   4368  O  OG  . SER B  2  36  ? 50.840  284.860 194.119 1.00 47.24  ? 36   SER B OG  1 
ATOM   4369  N  N   . LEU B  2  37  ? 53.971  284.557 197.272 1.00 35.19  ? 37   LEU B N   1 
ATOM   4370  C  CA  . LEU B  2  37  ? 54.654  283.993 198.436 1.00 37.47  ? 37   LEU B CA  1 
ATOM   4371  C  C   . LEU B  2  37  ? 54.648  284.962 199.621 1.00 42.77  ? 37   LEU B C   1 
ATOM   4372  O  O   . LEU B  2  37  ? 54.403  284.574 200.770 1.00 40.69  ? 37   LEU B O   1 
ATOM   4373  C  CB  . LEU B  2  37  ? 56.064  283.627 197.999 1.00 38.99  ? 37   LEU B CB  1 
ATOM   4374  C  CG  . LEU B  2  37  ? 56.866  283.113 199.161 1.00 63.85  ? 37   LEU B CG  1 
ATOM   4375  C  CD1 . LEU B  2  37  ? 56.166  281.840 199.586 1.00 58.52  ? 37   LEU B CD1 1 
ATOM   4376  C  CD2 . LEU B  2  37  ? 58.294  282.876 198.696 1.00 49.47  ? 37   LEU B CD2 1 
ATOM   4377  N  N   . VAL B  2  38  ? 54.899  286.236 199.373 1.00 31.04  ? 38   VAL B N   1 
ATOM   4378  C  CA  . VAL B  2  38  ? 54.845  287.220 200.422 1.00 35.73  ? 38   VAL B CA  1 
ATOM   4379  C  C   . VAL B  2  38  ? 53.433  287.318 201.009 1.00 53.78  ? 38   VAL B C   1 
ATOM   4380  O  O   . VAL B  2  38  ? 53.248  287.317 202.236 1.00 36.38  ? 38   VAL B O   1 
ATOM   4381  C  CB  . VAL B  2  38  ? 55.367  288.570 199.904 1.00 31.81  ? 38   VAL B CB  1 
ATOM   4382  C  CG1 . VAL B  2  38  ? 55.057  289.705 200.902 1.00 30.21  ? 38   VAL B CG1 1 
ATOM   4383  C  CG2 . VAL B  2  38  ? 56.884  288.453 199.734 1.00 33.82  ? 38   VAL B CG2 1 
ATOM   4384  N  N   . LEU B  2  39  ? 52.411  287.410 200.158 1.00 32.71  ? 39   LEU B N   1 
ATOM   4385  C  CA  . LEU B  2  39  ? 51.046  287.513 200.672 1.00 36.91  ? 39   LEU B CA  1 
ATOM   4386  C  C   . LEU B  2  39  ? 50.697  286.282 201.496 1.00 36.78  ? 39   LEU B C   1 
ATOM   4387  O  O   . LEU B  2  39  ? 50.059  286.372 202.556 1.00 34.18  ? 39   LEU B O   1 
ATOM   4388  C  CB  . LEU B  2  39  ? 50.072  287.618 199.488 1.00 36.61  ? 39   LEU B CB  1 
ATOM   4389  C  CG  . LEU B  2  39  ? 48.610  287.752 199.925 1.00 35.10  ? 39   LEU B CG  1 
ATOM   4390  C  CD1 . LEU B  2  39  ? 48.446  288.868 200.878 1.00 35.07  ? 39   LEU B CD1 1 
ATOM   4391  C  CD2 . LEU B  2  39  ? 47.738  287.952 198.737 1.00 36.17  ? 39   LEU B CD2 1 
ATOM   4392  N  N   . TYR B  2  40  ? 51.108  285.118 201.006 1.00 32.00  ? 40   TYR B N   1 
ATOM   4393  C  CA  . TYR B  2  40  ? 50.805  283.880 201.693 1.00 32.86  ? 40   TYR B CA  1 
ATOM   4394  C  C   . TYR B  2  40  ? 51.518  283.833 203.064 1.00 36.82  ? 40   TYR B C   1 
ATOM   4395  O  O   . TYR B  2  40  ? 50.904  283.523 204.081 1.00 32.51  ? 40   TYR B O   1 
ATOM   4396  C  CB  . TYR B  2  40  ? 51.260  282.686 200.859 1.00 33.36  ? 40   TYR B CB  1 
ATOM   4397  C  CG  . TYR B  2  40  ? 51.056  281.398 201.683 1.00 33.84  ? 40   TYR B CG  1 
ATOM   4398  C  CD1 . TYR B  2  40  ? 49.768  281.004 202.071 1.00 42.64  ? 40   TYR B CD1 1 
ATOM   4399  C  CD2 . TYR B  2  40  ? 52.138  280.655 202.154 1.00 41.50  ? 40   TYR B CD2 1 
ATOM   4400  C  CE1 . TYR B  2  40  ? 49.577  279.854 202.877 1.00 44.83  ? 40   TYR B CE1 1 
ATOM   4401  C  CE2 . TYR B  2  40  ? 51.956  279.509 202.937 1.00 40.89  ? 40   TYR B CE2 1 
ATOM   4402  C  CZ  . TYR B  2  40  ? 50.682  279.121 203.305 1.00 38.30  ? 40   TYR B CZ  1 
ATOM   4403  O  OH  . TYR B  2  40  ? 50.522  277.982 204.065 1.00 52.04  ? 40   TYR B OH  1 
ATOM   4404  N  N   . ILE B  2  41  ? 52.832  284.042 203.066 1.00 29.54  ? 41   ILE B N   1 
ATOM   4405  C  CA  . ILE B  2  41  ? 53.597  284.066 204.340 1.00 31.94  ? 41   ILE B CA  1 
ATOM   4406  C  C   . ILE B  2  41  ? 53.014  285.064 205.327 1.00 38.12  ? 41   ILE B C   1 
ATOM   4407  O  O   . ILE B  2  41  ? 52.882  284.762 206.523 1.00 34.93  ? 41   ILE B O   1 
ATOM   4408  C  CB  . ILE B  2  41  ? 55.095  284.294 204.056 1.00 34.85  ? 41   ILE B CB  1 
ATOM   4409  C  CG1 . ILE B  2  41  ? 55.591  283.026 203.389 1.00 33.86  ? 41   ILE B CG1 1 
ATOM   4410  C  CG2 . ILE B  2  41  ? 55.912  284.528 205.428 1.00 34.43  ? 41   ILE B CG2 1 
ATOM   4411  C  CD1 . ILE B  2  41  ? 57.003  283.066 203.029 1.00 41.10  ? 41   ILE B CD1 1 
ATOM   4412  N  N   . ILE B  2  42  ? 52.582  286.235 204.855 1.00 36.57  ? 42   ILE B N   1 
ATOM   4413  C  CA  . ILE B  2  42  ? 51.880  287.159 205.747 1.00 37.75  ? 42   ILE B CA  1 
ATOM   4414  C  C   . ILE B  2  42  ? 50.681  286.468 206.367 1.00 46.60  ? 42   ILE B C   1 
ATOM   4415  O  O   . ILE B  2  42  ? 50.491  286.501 207.597 1.00 37.65  ? 42   ILE B O   1 
ATOM   4416  C  CB  . ILE B  2  42  ? 51.440  288.437 205.015 1.00 38.55  ? 42   ILE B CB  1 
ATOM   4417  C  CG1 . ILE B  2  42  ? 52.601  289.440 204.882 1.00 36.28  ? 42   ILE B CG1 1 
ATOM   4418  C  CG2 . ILE B  2  42  ? 50.353  289.144 205.801 1.00 40.87  ? 42   ILE B CG2 1 
ATOM   4419  C  CD1 . ILE B  2  42  ? 52.242  290.586 203.815 1.00 38.59  ? 42   ILE B CD1 1 
ATOM   4420  N  N   . SER B  2  43  ? 49.833  285.838 205.548 1.00 31.05  ? 43   SER B N   1 
ATOM   4421  C  CA  . SER B  2  43  ? 48.630  285.232 206.135 1.00 30.25  ? 43   SER B CA  1 
ATOM   4422  C  C   . SER B  2  43  ? 49.015  284.099 207.095 1.00 35.76  ? 43   SER B C   1 
ATOM   4423  O  O   . SER B  2  43  ? 48.353  283.884 208.092 1.00 39.67  ? 43   SER B O   1 
ATOM   4424  C  CB  . SER B  2  43  ? 47.709  284.702 205.041 1.00 41.09  ? 43   SER B CB  1 
ATOM   4425  O  OG  . SER B  2  43  ? 48.276  283.529 204.490 1.00 37.47  ? 43   SER B OG  1 
ATOM   4426  N  N   . LEU B  2  44  ? 50.091  283.381 206.800 1.00 34.54  ? 44   LEU B N   1 
ATOM   4427  C  CA  . LEU B  2  44  ? 50.506  282.290 207.663 1.00 34.19  ? 44   LEU B CA  1 
ATOM   4428  C  C   . LEU B  2  44  ? 50.982  282.806 209.026 1.00 47.24  ? 44   LEU B C   1 
ATOM   4429  O  O   . LEU B  2  44  ? 50.687  282.201 210.065 1.00 37.99  ? 44   LEU B O   1 
ATOM   4430  C  CB  . LEU B  2  44  ? 51.610  281.524 206.944 1.00 37.70  ? 44   LEU B CB  1 
ATOM   4431  C  CG  . LEU B  2  44  ? 52.224  280.406 207.766 1.00 39.08  ? 44   LEU B CG  1 
ATOM   4432  C  CD1 . LEU B  2  44  ? 51.191  279.283 207.856 1.00 37.58  ? 44   LEU B CD1 1 
ATOM   4433  C  CD2 . LEU B  2  44  ? 53.490  279.892 207.105 1.00 43.85  ? 44   LEU B CD2 1 
ATOM   4434  N  N   . MET B  2  45  ? 51.735  283.907 209.042 1.00 36.52  ? 45   MET B N   1 
ATOM   4435  C  CA  . MET B  2  45  ? 52.253  284.475 210.291 1.00 37.68  ? 45   MET B CA  1 
ATOM   4436  C  C   . MET B  2  45  ? 51.135  284.981 211.179 1.00 36.83  ? 45   MET B C   1 
ATOM   4437  O  O   . MET B  2  45  ? 51.336  285.107 212.396 1.00 35.81  ? 45   MET B O   1 
ATOM   4438  C  CB  . MET B  2  45  ? 53.162  285.667 210.047 1.00 30.80  ? 45   MET B CB  1 
ATOM   4439  C  CG  . MET B  2  45  ? 54.414  285.511 209.187 1.00 33.58  ? 45   MET B CG  1 
ATOM   4440  S  SD  . MET B  2  45  ? 55.587  284.322 209.797 1.00 40.07  ? 45   MET B SD  1 
ATOM   4441  C  CE  . MET B  2  45  ? 54.995  282.721 209.294 1.00 41.28  ? 45   MET B CE  1 
ATOM   4442  N  N   . LEU B  2  46  ? 49.989  285.333 210.586 1.00 36.80  ? 46   LEU B N   1 
ATOM   4443  C  CA  . LEU B  2  46  ? 48.891  286.019 211.250 1.00 36.68  ? 46   LEU B CA  1 
ATOM   4444  C  C   . LEU B  2  46  ? 47.766  285.087 211.698 1.00 38.85  ? 46   LEU B C   1 
ATOM   4445  O  O   . LEU B  2  46  ? 46.788  285.549 212.263 1.00 40.45  ? 46   LEU B O   1 
ATOM   4446  C  CB  . LEU B  2  46  ? 48.300  287.073 210.302 1.00 36.75  ? 46   LEU B CB  1 
ATOM   4447  C  CG  . LEU B  2  46  ? 49.290  288.202 209.976 1.00 45.51  ? 46   LEU B CG  1 
ATOM   4448  C  CD1 . LEU B  2  46  ? 48.598  289.136 208.959 1.00 39.94  ? 46   LEU B CD1 1 
ATOM   4449  C  CD2 . LEU B  2  46  ? 49.688  288.992 211.194 1.00 38.71  ? 46   LEU B CD2 1 
ATOM   4450  N  N   . THR B  2  47  ? 47.856  283.801 211.434 1.00 34.96  ? 47   THR B N   1 
ATOM   4451  C  CA  . THR B  2  47  ? 46.722  282.918 211.664 1.00 33.78  ? 47   THR B CA  1 
ATOM   4452  C  C   . THR B  2  47  ? 47.015  281.833 212.719 1.00 37.88  ? 47   THR B C   1 
ATOM   4453  O  O   . THR B  2  47  ? 46.482  280.719 212.634 1.00 38.49  ? 47   THR B O   1 
ATOM   4454  C  CB  . THR B  2  47  ? 46.332  282.270 210.350 1.00 35.47  ? 47   THR B CB  1 
ATOM   4455  O  OG1 . THR B  2  47  ? 47.524  281.848 209.675 1.00 37.32  ? 47   THR B OG1 1 
ATOM   4456  C  CG2 . THR B  2  47  ? 45.537  283.264 209.396 1.00 37.84  ? 47   THR B CG2 1 
ATOM   4457  N  N   . THR B  2  48  ? 47.876  282.101 213.695 1.00 35.65  ? 48   THR B N   1 
ATOM   4458  C  CA  . THR B  2  48  ? 48.017  281.132 214.788 1.00 34.76  ? 48   THR B CA  1 
ATOM   4459  C  C   . THR B  2  48  ? 48.078  281.813 216.144 1.00 34.93  ? 48   THR B C   1 
ATOM   4460  O  O   . THR B  2  48  ? 48.682  282.885 216.297 1.00 29.86  ? 48   THR B O   1 
ATOM   4461  C  CB  . THR B  2  48  ? 49.249  280.220 214.564 1.00 34.75  ? 48   THR B CB  1 
ATOM   4462  O  OG1 . THR B  2  48  ? 49.354  279.324 215.671 1.00 34.92  ? 48   THR B OG1 1 
ATOM   4463  C  CG2 . THR B  2  48  ? 50.550  281.018 214.450 1.00 31.61  ? 48   THR B CG2 1 
ATOM   4464  N  N   . LYS B  2  49  ? 47.483  281.164 217.150 1.00 34.38  ? 49   LYS B N   1 
ATOM   4465  C  CA  . LYS B  2  49  ? 47.634  281.623 218.543 1.00 37.02  ? 49   LYS B CA  1 
ATOM   4466  C  C   . LYS B  2  49  ? 48.926  281.150 219.194 1.00 38.09  ? 49   LYS B C   1 
ATOM   4467  O  O   . LYS B  2  49  ? 49.278  281.646 220.286 1.00 34.41  ? 49   LYS B O   1 
ATOM   4468  C  CB  . LYS B  2  49  ? 46.441  281.155 219.405 1.00 41.61  ? 49   LYS B CB  1 
ATOM   4469  C  CG  . LYS B  2  49  ? 45.084  281.614 218.942 1.00 51.39  ? 49   LYS B CG  1 
ATOM   4470  C  CD  . LYS B  2  49  ? 44.859  283.087 219.201 1.00 69.22  ? 49   LYS B CD  1 
ATOM   4471  C  CE  . LYS B  2  49  ? 43.404  283.384 219.556 1.00 101.24 ? 49   LYS B CE  1 
ATOM   4472  N  NZ  . LYS B  2  49  ? 42.425  282.688 218.665 1.00 87.22  ? 49   LYS B NZ  1 
ATOM   4473  N  N   . LEU B  2  50  ? 49.636  280.215 218.573 1.00 34.48  ? 50   LEU B N   1 
ATOM   4474  C  CA  . LEU B  2  50  ? 50.945  279.819 219.083 1.00 39.31  ? 50   LEU B CA  1 
ATOM   4475  C  C   . LEU B  2  50  ? 51.899  281.005 219.087 1.00 37.03  ? 50   LEU B C   1 
ATOM   4476  O  O   . LEU B  2  50  ? 51.890  281.825 218.169 1.00 31.44  ? 50   LEU B O   1 
ATOM   4477  C  CB  . LEU B  2  50  ? 51.507  278.697 218.217 1.00 37.59  ? 50   LEU B CB  1 
ATOM   4478  C  CG  . LEU B  2  50  ? 50.623  277.467 218.219 1.00 33.77  ? 50   LEU B CG  1 
ATOM   4479  C  CD1 . LEU B  2  50  ? 51.126  276.441 217.238 1.00 35.73  ? 50   LEU B CD1 1 
ATOM   4480  C  CD2 . LEU B  2  50  ? 50.598  276.847 219.716 1.00 33.86  ? 50   LEU B CD2 1 
ATOM   4481  N  N   . THR B  2  51  ? 52.717  281.129 220.125 1.00 31.16  ? 51   THR B N   1 
ATOM   4482  C  CA  . THR B  2  51  ? 53.621  282.281 220.220 1.00 34.09  ? 51   THR B CA  1 
ATOM   4483  C  C   . THR B  2  51  ? 55.044  281.823 220.446 1.00 32.20  ? 51   THR B C   1 
ATOM   4484  O  O   . THR B  2  51  ? 55.290  280.737 220.974 1.00 39.38  ? 51   THR B O   1 
ATOM   4485  C  CB  . THR B  2  51  ? 53.238  283.250 221.346 1.00 35.57  ? 51   THR B CB  1 
ATOM   4486  O  OG1 . THR B  2  51  ? 53.136  282.496 222.564 1.00 36.65  ? 51   THR B OG1 1 
ATOM   4487  C  CG2 . THR B  2  51  ? 51.847  283.896 221.039 1.00 28.98  ? 51   THR B CG2 1 
ATOM   4488  N  N   . HIS B  2  52  ? 55.987  282.696 220.061 1.00 32.43  ? 52   HIS B N   1 
ATOM   4489  C  CA  . HIS B  2  52  ? 57.419  282.511 220.332 1.00 34.23  ? 52   HIS B CA  1 
ATOM   4490  C  C   . HIS B  2  52  ? 58.010  283.916 220.254 1.00 37.18  ? 52   HIS B C   1 
ATOM   4491  O  O   . HIS B  2  52  ? 58.206  284.433 219.137 1.00 38.90  ? 52   HIS B O   1 
ATOM   4492  C  CB  . HIS B  2  52  ? 58.062  281.594 219.301 1.00 32.28  ? 52   HIS B CB  1 
ATOM   4493  C  CG  . HIS B  2  52  ? 59.548  281.414 219.473 1.00 50.55  ? 52   HIS B CG  1 
ATOM   4494  N  ND1 . HIS B  2  52  ? 60.302  280.630 218.618 1.00 47.37  ? 52   HIS B ND1 1 
ATOM   4495  C  CD2 . HIS B  2  52  ? 60.406  281.871 220.413 1.00 47.42  ? 52   HIS B CD2 1 
ATOM   4496  C  CE1 . HIS B  2  52  ? 61.558  280.614 219.033 1.00 51.75  ? 52   HIS B CE1 1 
ATOM   4497  N  NE2 . HIS B  2  52  ? 61.655  281.388 220.097 1.00 45.92  ? 52   HIS B NE2 1 
ATOM   4498  N  N   . THR B  2  53  ? 58.206  284.546 221.410 1.00 42.36  ? 53   THR B N   1 
ATOM   4499  C  CA  . THR B  2  53  ? 58.632  285.946 221.454 1.00 43.43  ? 53   THR B CA  1 
ATOM   4500  C  C   . THR B  2  53  ? 60.051  286.145 221.966 1.00 50.63  ? 53   THR B C   1 
ATOM   4501  O  O   . THR B  2  53  ? 60.480  287.293 222.122 1.00 44.56  ? 53   THR B O   1 
ATOM   4502  C  CB  . THR B  2  53  ? 57.685  286.776 222.307 1.00 40.83  ? 53   THR B CB  1 
ATOM   4503  O  OG1 . THR B  2  53  ? 57.737  286.296 223.669 1.00 49.77  ? 53   THR B OG1 1 
ATOM   4504  C  CG2 . THR B  2  53  ? 56.266  286.709 221.779 1.00 44.07  ? 53   THR B CG2 1 
ATOM   4505  N  N   . SER B  2  54  ? 60.794  285.082 222.227 1.00 49.37  ? 54   SER B N   1 
ATOM   4506  C  CA  . SER B  2  54  ? 62.141  285.328 222.694 1.00 70.47  ? 54   SER B CA  1 
ATOM   4507  C  C   . SER B  2  54  ? 63.025  285.677 221.502 1.00 73.33  ? 54   SER B C   1 
ATOM   4508  O  O   . SER B  2  54  ? 62.587  285.670 220.346 1.00 51.55  ? 54   SER B O   1 
ATOM   4509  C  CB  . SER B  2  54  ? 62.676  284.132 223.477 1.00 67.34  ? 54   SER B CB  1 
ATOM   4510  O  OG  . SER B  2  54  ? 62.043  282.948 223.056 1.00 46.73  ? 54   SER B OG  1 
ATOM   4511  N  N   . THR B  2  55  ? 64.260  286.072 221.797 1.00 44.62  ? 55   THR B N   1 
ATOM   4512  C  CA  . THR B  2  55  ? 65.176  286.487 220.728 1.00 75.73  ? 55   THR B CA  1 
ATOM   4513  C  C   . THR B  2  55  ? 65.433  285.353 219.737 1.00 120.84 ? 55   THR B C   1 
ATOM   4514  O  O   . THR B  2  55  ? 65.744  284.236 220.137 1.00 49.96  ? 55   THR B O   1 
ATOM   4515  C  CB  . THR B  2  55  ? 66.497  286.975 221.342 1.00 45.16  ? 55   THR B CB  1 
ATOM   4516  O  OG1 . THR B  2  55  ? 66.262  288.227 221.985 1.00 52.54  ? 55   THR B OG1 1 
ATOM   4517  C  CG2 . THR B  2  55  ? 67.660  287.122 220.251 1.00 51.37  ? 55   THR B CG2 1 
ATOM   4518  N  N   . MET B  2  56  ? 65.314  285.645 218.436 1.00 50.61  ? 56   MET B N   1 
ATOM   4519  C  CA  . MET B  2  56  ? 65.567  284.674 217.364 1.00 50.69  ? 56   MET B CA  1 
ATOM   4520  C  C   . MET B  2  56  ? 66.899  284.962 216.663 1.00 61.22  ? 56   MET B C   1 
ATOM   4521  O  O   . MET B  2  56  ? 67.163  286.107 216.280 1.00 54.62  ? 56   MET B O   1 
ATOM   4522  C  CB  . MET B  2  56  ? 64.409  284.692 216.345 1.00 42.76  ? 56   MET B CB  1 
ATOM   4523  C  CG  . MET B  2  56  ? 63.007  284.449 216.972 1.00 51.09  ? 56   MET B CG  1 
ATOM   4524  S  SD  . MET B  2  56  ? 61.666  284.536 215.711 1.00 58.77  ? 56   MET B SD  1 
ATOM   4525  C  CE  . MET B  2  56  ? 60.184  283.895 216.674 1.00 34.85  ? 56   MET B CE  1 
ATOM   4526  N  N   . ASP B  2  57  ? 67.721  283.917 216.468 1.00 46.85  ? 57   ASP B N   1 
ATOM   4527  C  CA  . ASP B  2  57  ? 68.990  284.056 215.749 1.00 189.92 ? 57   ASP B CA  1 
ATOM   4528  C  C   . ASP B  2  57  ? 68.749  284.188 214.246 1.00 182.94 ? 57   ASP B C   1 
ATOM   4529  O  O   . ASP B  2  57  ? 68.013  283.419 213.649 1.00 47.02  ? 57   ASP B O   1 
ATOM   4530  C  CB  . ASP B  2  57  ? 69.898  282.857 216.023 1.00 72.17  ? 57   ASP B CB  1 
ATOM   4531  C  CG  . ASP B  2  57  ? 71.253  282.962 215.317 1.00 137.39 ? 57   ASP B CG  1 
ATOM   4532  O  OD1 . ASP B  2  57  ? 71.681  284.082 214.976 1.00 126.21 ? 57   ASP B OD1 1 
ATOM   4533  O  OD2 . ASP B  2  57  ? 71.897  281.914 215.099 1.00 160.81 ? 57   ASP B OD2 1 
ATOM   4534  N  N   . ALA B  2  58  ? 69.407  285.130 213.616 1.00 40.56  ? 58   ALA B N   1 
ATOM   4535  C  CA  . ALA B  2  58  ? 69.096  285.483 212.231 1.00 53.25  ? 58   ALA B CA  1 
ATOM   4536  C  C   . ALA B  2  58  ? 70.062  284.940 211.183 1.00 94.12  ? 58   ALA B C   1 
ATOM   4537  O  O   . ALA B  2  58  ? 69.691  284.897 210.002 1.00 57.30  ? 58   ALA B O   1 
ATOM   4538  C  CB  . ALA B  2  58  ? 69.052  287.003 212.081 1.00 45.92  ? 58   ALA B CB  1 
ATOM   4539  N  N   . GLN B  2  59  ? 71.272  284.527 211.569 1.00 51.01  ? 59   GLN B N   1 
ATOM   4540  C  CA  . GLN B  2  59  ? 72.344  284.326 210.592 1.00 72.25  ? 59   GLN B CA  1 
ATOM   4541  C  C   . GLN B  2  59  ? 72.000  283.221 209.593 1.00 72.27  ? 59   GLN B C   1 
ATOM   4542  O  O   . GLN B  2  59  ? 72.162  283.398 208.377 1.00 74.99  ? 59   GLN B O   1 
ATOM   4543  C  CB  . GLN B  2  59  ? 73.671  284.045 211.316 1.00 71.10  ? 59   GLN B CB  1 
ATOM   4544  C  CG  . GLN B  2  59  ? 74.011  285.102 212.388 1.00 143.60 ? 59   GLN B CG  1 
ATOM   4545  C  CD  . GLN B  2  59  ? 75.406  284.944 212.964 1.00 169.68 ? 59   GLN B CD  1 
ATOM   4546  O  OE1 . GLN B  2  59  ? 76.299  284.426 212.297 1.00 99.26  ? 59   GLN B OE1 1 
ATOM   4547  N  NE2 . GLN B  2  59  ? 75.599  285.387 214.209 1.00 85.25  ? 59   GLN B NE2 1 
ATOM   4548  N  N   . GLU B  2  60  ? 71.480  282.094 210.080 1.00 90.26  ? 60   GLU B N   1 
ATOM   4549  C  CA  . GLU B  2  60  ? 71.145  280.990 209.181 1.00 72.46  ? 60   GLU B CA  1 
ATOM   4550  C  C   . GLU B  2  60  ? 70.195  281.444 208.081 1.00 71.14  ? 60   GLU B C   1 
ATOM   4551  O  O   . GLU B  2  60  ? 70.467  281.263 206.887 1.00 74.88  ? 60   GLU B O   1 
ATOM   4552  C  CB  . GLU B  2  60  ? 70.530  279.820 209.965 1.00 82.20  ? 60   GLU B CB  1 
ATOM   4553  C  CG  . GLU B  2  60  ? 70.343  280.061 211.482 1.00 156.38 ? 60   GLU B CG  1 
ATOM   4554  C  CD  . GLU B  2  60  ? 68.997  280.694 211.852 1.00 201.90 ? 60   GLU B CD  1 
ATOM   4555  O  OE1 . GLU B  2  60  ? 68.672  281.787 211.326 1.00 87.32  ? 60   GLU B OE1 1 
ATOM   4556  O  OE2 . GLU B  2  60  ? 68.265  280.096 212.680 1.00 158.09 ? 60   GLU B OE2 1 
ATOM   4557  N  N   . VAL B  2  61  ? 69.077  282.060 208.463 1.00 50.59  ? 61   VAL B N   1 
ATOM   4558  C  CA  . VAL B  2  61  ? 68.038  282.300 207.476 1.00 68.38  ? 61   VAL B CA  1 
ATOM   4559  C  C   . VAL B  2  61  ? 68.414  283.441 206.540 1.00 87.37  ? 61   VAL B C   1 
ATOM   4560  O  O   . VAL B  2  61  ? 67.887  283.513 205.428 1.00 46.96  ? 61   VAL B O   1 
ATOM   4561  C  CB  . VAL B  2  61  ? 66.685  282.528 208.182 1.00 70.66  ? 61   VAL B CB  1 
ATOM   4562  C  CG1 . VAL B  2  61  ? 66.646  283.891 208.921 1.00 46.57  ? 61   VAL B CG1 1 
ATOM   4563  C  CG2 . VAL B  2  61  ? 65.521  282.348 207.199 1.00 144.19 ? 61   VAL B CG2 1 
ATOM   4564  N  N   . GLU B  2  62  ? 69.350  284.313 206.932 1.00 39.79  ? 62   GLU B N   1 
ATOM   4565  C  CA  . GLU B  2  62  ? 69.672  285.428 206.047 1.00 49.89  ? 62   GLU B CA  1 
ATOM   4566  C  C   . GLU B  2  62  ? 70.512  284.989 204.859 1.00 50.94  ? 62   GLU B C   1 
ATOM   4567  O  O   . GLU B  2  62  ? 70.517  285.681 203.835 1.00 45.43  ? 62   GLU B O   1 
ATOM   4568  C  CB  . GLU B  2  62  ? 70.344  286.551 206.836 1.00 40.09  ? 62   GLU B CB  1 
ATOM   4569  C  CG  . GLU B  2  62  ? 69.328  287.094 207.869 1.00 44.52  ? 62   GLU B CG  1 
ATOM   4570  C  CD  . GLU B  2  62  ? 69.388  288.604 208.087 1.00 47.10  ? 62   GLU B CD  1 
ATOM   4571  O  OE1 . GLU B  2  62  ? 68.554  289.144 208.862 1.00 43.97  ? 62   GLU B OE1 1 
ATOM   4572  O  OE2 . GLU B  2  62  ? 70.247  289.263 207.487 1.00 41.88  ? 62   GLU B OE2 1 
ATOM   4573  N  N   . THR B  2  63  ? 71.217  283.864 204.981 1.00 35.55  ? 63   THR B N   1 
ATOM   4574  C  CA  . THR B  2  63  ? 71.860  283.240 203.831 1.00 57.95  ? 63   THR B CA  1 
ATOM   4575  C  C   . THR B  2  63  ? 70.836  282.857 202.778 1.00 40.99  ? 63   THR B C   1 
ATOM   4576  O  O   . THR B  2  63  ? 71.003  283.181 201.607 1.00 39.32  ? 63   THR B O   1 
ATOM   4577  C  CB  . THR B  2  63  ? 72.640  281.996 204.256 1.00 42.14  ? 63   THR B CB  1 
ATOM   4578  O  OG1 . THR B  2  63  ? 73.539  282.334 205.325 1.00 62.64  ? 63   THR B OG1 1 
ATOM   4579  C  CG2 . THR B  2  63  ? 73.463  281.474 203.062 1.00 55.67  ? 63   THR B CG2 1 
ATOM   4580  N  N   . ILE B  2  64  ? 69.771  282.155 203.192 1.00 45.22  ? 64   ILE B N   1 
ATOM   4581  C  CA  . ILE B  2  64  ? 68.753  281.704 202.249 1.00 58.45  ? 64   ILE B CA  1 
ATOM   4582  C  C   . ILE B  2  64  ? 68.184  282.890 201.497 1.00 46.66  ? 64   ILE B C   1 
ATOM   4583  O  O   . ILE B  2  64  ? 67.990  282.854 200.279 1.00 56.75  ? 64   ILE B O   1 
ATOM   4584  C  CB  . ILE B  2  64  ? 67.634  280.944 202.984 1.00 50.87  ? 64   ILE B CB  1 
ATOM   4585  C  CG1 . ILE B  2  64  ? 68.182  279.636 203.542 1.00 73.93  ? 64   ILE B CG1 1 
ATOM   4586  C  CG2 . ILE B  2  64  ? 66.408  280.746 202.052 1.00 43.55  ? 64   ILE B CG2 1 
ATOM   4587  C  CD1 . ILE B  2  64  ? 67.566  279.234 204.874 1.00 75.58  ? 64   ILE B CD1 1 
ATOM   4588  N  N   . TRP B  2  65  ? 67.878  283.953 202.214 1.00 44.08  ? 65   TRP B N   1 
ATOM   4589  C  CA  . TRP B  2  65  ? 67.073  284.967 201.588 1.00 117.16 ? 65   TRP B CA  1 
ATOM   4590  C  C   . TRP B  2  65  ? 67.938  286.149 201.123 1.00 47.05  ? 65   TRP B C   1 
ATOM   4591  O  O   . TRP B  2  65  ? 67.438  287.174 200.657 1.00 42.70  ? 65   TRP B O   1 
ATOM   4592  C  CB  . TRP B  2  65  ? 65.901  285.267 202.528 1.00 84.77  ? 65   TRP B CB  1 
ATOM   4593  C  CG  . TRP B  2  65  ? 66.084  285.992 203.792 1.00 48.67  ? 65   TRP B CG  1 
ATOM   4594  C  CD1 . TRP B  2  65  ? 66.948  287.004 204.030 1.00 113.60 ? 65   TRP B CD1 1 
ATOM   4595  C  CD2 . TRP B  2  65  ? 65.276  285.852 204.980 1.00 70.45  ? 65   TRP B CD2 1 
ATOM   4596  N  NE1 . TRP B  2  65  ? 66.756  287.497 205.303 1.00 198.08 ? 65   TRP B NE1 1 
ATOM   4597  C  CE2 . TRP B  2  65  ? 65.735  286.815 205.907 1.00 35.75  ? 65   TRP B CE2 1 
ATOM   4598  C  CE3 . TRP B  2  65  ? 64.224  285.007 205.345 1.00 47.27  ? 65   TRP B CE3 1 
ATOM   4599  C  CZ2 . TRP B  2  65  ? 65.158  286.972 207.207 1.00 45.89  ? 65   TRP B CZ2 1 
ATOM   4600  C  CZ3 . TRP B  2  65  ? 63.674  285.135 206.624 1.00 52.07  ? 65   TRP B CZ3 1 
ATOM   4601  C  CH2 . TRP B  2  65  ? 64.126  286.108 207.533 1.00 30.70  ? 65   TRP B CH2 1 
ATOM   4602  N  N   . THR B  2  66  ? 69.245  285.943 201.097 1.00 37.90  ? 66   THR B N   1 
ATOM   4603  C  CA  . THR B  2  66  ? 70.178  286.663 200.226 1.00 39.15  ? 66   THR B CA  1 
ATOM   4604  C  C   . THR B  2  66  ? 70.492  285.884 198.958 1.00 45.92  ? 66   THR B C   1 
ATOM   4605  O  O   . THR B  2  66  ? 70.421  286.428 197.832 1.00 40.36  ? 66   THR B O   1 
ATOM   4606  C  CB  . THR B  2  66  ? 71.478  286.958 201.027 1.00 41.05  ? 66   THR B CB  1 
ATOM   4607  O  OG1 . THR B  2  66  ? 71.307  288.228 201.665 1.00 56.38  ? 66   THR B OG1 1 
ATOM   4608  C  CG2 . THR B  2  66  ? 72.724  287.011 200.157 1.00 76.21  ? 66   THR B CG2 1 
ATOM   4609  N  N   . ILE B  2  67  ? 70.856  284.609 199.119 1.00 34.55  ? 67   ILE B N   1 
ATOM   4610  C  CA  . ILE B  2  67  ? 71.312  283.809 197.980 1.00 43.62  ? 67   ILE B CA  1 
ATOM   4611  C  C   . ILE B  2  67  ? 70.174  283.482 197.014 1.00 42.44  ? 67   ILE B C   1 
ATOM   4612  O  O   . ILE B  2  67  ? 70.381  283.459 195.789 1.00 41.60  ? 67   ILE B O   1 
ATOM   4613  C  CB  . ILE B  2  67  ? 71.972  282.519 198.473 1.00 48.32  ? 67   ILE B CB  1 
ATOM   4614  C  CG1 . ILE B  2  67  ? 73.229  282.851 199.302 1.00 64.14  ? 67   ILE B CG1 1 
ATOM   4615  C  CG2 . ILE B  2  67  ? 72.298  281.616 197.267 1.00 44.22  ? 67   ILE B CG2 1 
ATOM   4616  C  CD1 . ILE B  2  67  ? 74.242  283.810 198.651 1.00 71.33  ? 67   ILE B CD1 1 
ATOM   4617  N  N   . LEU B  2  68  ? 68.999  283.107 197.536 1.00 37.06  ? 68   LEU B N   1 
ATOM   4618  C  CA  . LEU B  2  68  ? 67.876  282.817 196.643 1.00 40.02  ? 68   LEU B CA  1 
ATOM   4619  C  C   . LEU B  2  68  ? 67.513  284.034 195.810 1.00 36.99  ? 68   LEU B C   1 
ATOM   4620  O  O   . LEU B  2  68  ? 67.489  283.921 194.574 1.00 39.89  ? 68   LEU B O   1 
ATOM   4621  C  CB  . LEU B  2  68  ? 66.652  282.331 197.413 1.00 47.78  ? 68   LEU B CB  1 
ATOM   4622  C  CG  . LEU B  2  68  ? 66.380  280.850 197.267 1.00 83.75  ? 68   LEU B CG  1 
ATOM   4623  C  CD1 . LEU B  2  68  ? 67.637  280.091 197.648 1.00 72.00  ? 68   LEU B CD1 1 
ATOM   4624  C  CD2 . LEU B  2  68  ? 65.235  280.515 198.197 1.00 62.79  ? 68   LEU B CD2 1 
ATOM   4625  N  N   . PRO B  2  69  ? 67.300  285.225 196.396 1.00 38.50  ? 69   PRO B N   1 
ATOM   4626  C  CA  . PRO B  2  69  ? 67.025  286.375 195.520 1.00 35.76  ? 69   PRO B CA  1 
ATOM   4627  C  C   . PRO B  2  69  ? 68.163  286.639 194.570 1.00 33.07  ? 69   PRO B C   1 
ATOM   4628  O  O   . PRO B  2  69  ? 67.902  286.939 193.414 1.00 33.27  ? 69   PRO B O   1 
ATOM   4629  C  CB  . PRO B  2  69  ? 66.759  287.537 196.490 1.00 39.49  ? 69   PRO B CB  1 
ATOM   4630  C  CG  . PRO B  2  69  ? 66.236  286.806 197.778 1.00 38.88  ? 69   PRO B CG  1 
ATOM   4631  C  CD  . PRO B  2  69  ? 67.164  285.579 197.825 1.00 39.05  ? 69   PRO B CD  1 
ATOM   4632  N  N   . ALA B  2  70  ? 69.421  286.512 194.985 1.00 40.13  ? 70   ALA B N   1 
ATOM   4633  C  CA  . ALA B  2  70  ? 70.500  286.766 194.028 1.00 27.34  ? 70   ALA B CA  1 
ATOM   4634  C  C   . ALA B  2  70  ? 70.424  285.814 192.828 1.00 36.23  ? 70   ALA B C   1 
ATOM   4635  O  O   . ALA B  2  70  ? 70.634  286.206 191.682 1.00 36.15  ? 70   ALA B O   1 
ATOM   4636  C  CB  . ALA B  2  70  ? 71.865  286.601 194.736 1.00 34.25  ? 70   ALA B CB  1 
ATOM   4637  N  N   . ILE B  2  71  ? 70.145  284.553 193.091 1.00 33.98  ? 71   ILE B N   1 
ATOM   4638  C  CA  . ILE B  2  71  ? 69.971  283.594 192.008 1.00 40.88  ? 71   ILE B CA  1 
ATOM   4639  C  C   . ILE B  2  71  ? 68.836  284.017 191.083 1.00 44.23  ? 71   ILE B C   1 
ATOM   4640  O  O   . ILE B  2  71  ? 68.958  283.975 189.853 1.00 39.35  ? 71   ILE B O   1 
ATOM   4641  C  CB  . ILE B  2  71  ? 69.703  282.207 192.599 1.00 44.05  ? 71   ILE B CB  1 
ATOM   4642  C  CG1 . ILE B  2  71  ? 70.974  281.734 193.313 1.00 43.80  ? 71   ILE B CG1 1 
ATOM   4643  C  CG2 . ILE B  2  71  ? 69.201  281.281 191.469 1.00 41.79  ? 71   ILE B CG2 1 
ATOM   4644  C  CD1 . ILE B  2  71  ? 70.790  280.462 194.039 1.00 48.87  ? 71   ILE B CD1 1 
ATOM   4645  N  N   . ILE B  2  72  ? 67.708  284.403 191.666 1.00 35.15  ? 72   ILE B N   1 
ATOM   4646  C  CA  . ILE B  2  72  ? 66.566  284.830 190.870 1.00 37.82  ? 72   ILE B CA  1 
ATOM   4647  C  C   . ILE B  2  72  ? 66.925  286.031 190.011 1.00 36.27  ? 72   ILE B C   1 
ATOM   4648  O  O   . ILE B  2  72  ? 66.544  286.103 188.837 1.00 38.75  ? 72   ILE B O   1 
ATOM   4649  C  CB  . ILE B  2  72  ? 65.377  285.124 191.790 1.00 40.58  ? 72   ILE B CB  1 
ATOM   4650  C  CG1 . ILE B  2  72  ? 64.914  283.802 192.432 1.00 36.56  ? 72   ILE B CG1 1 
ATOM   4651  C  CG2 . ILE B  2  72  ? 64.341  285.894 191.035 1.00 35.66  ? 72   ILE B CG2 1 
ATOM   4652  C  CD1 . ILE B  2  72  ? 64.112  283.992 193.698 1.00 35.00  ? 72   ILE B CD1 1 
ATOM   4653  N  N   . LEU B  2  73  ? 67.670  287.000 190.570 1.00 29.09  ? 73   LEU B N   1 
ATOM   4654  C  CA  . LEU B  2  73  ? 68.048  288.146 189.750 1.00 35.19  ? 73   LEU B CA  1 
ATOM   4655  C  C   . LEU B  2  73  ? 68.891  287.694 188.568 1.00 49.17  ? 73   LEU B C   1 
ATOM   4656  O  O   . LEU B  2  73  ? 68.762  288.223 187.456 1.00 36.40  ? 73   LEU B O   1 
ATOM   4657  C  CB  . LEU B  2  73  ? 68.819  289.181 190.580 1.00 31.38  ? 73   LEU B CB  1 
ATOM   4658  C  CG  . LEU B  2  73  ? 68.005  289.726 191.750 1.00 32.97  ? 73   LEU B CG  1 
ATOM   4659  C  CD1 . LEU B  2  73  ? 68.946  290.690 192.536 1.00 36.15  ? 73   LEU B CD1 1 
ATOM   4660  C  CD2 . LEU B  2  73  ? 66.729  290.441 191.260 1.00 33.79  ? 73   LEU B CD2 1 
ATOM   4661  N  N   . ILE B  2  74  ? 69.783  286.732 188.791 1.00 31.98  ? 74   ILE B N   1 
ATOM   4662  C  CA  . ILE B  2  74  ? 70.644  286.304 187.693 1.00 37.15  ? 74   ILE B CA  1 
ATOM   4663  C  C   . ILE B  2  74  ? 69.821  285.616 186.598 1.00 34.13  ? 74   ILE B C   1 
ATOM   4664  O  O   . ILE B  2  74  ? 70.060  285.814 185.396 1.00 39.58  ? 74   ILE B O   1 
ATOM   4665  C  CB  . ILE B  2  74  ? 71.769  285.408 188.235 1.00 35.06  ? 74   ILE B CB  1 
ATOM   4666  C  CG1 . ILE B  2  74  ? 72.747  286.262 189.043 1.00 34.48  ? 74   ILE B CG1 1 
ATOM   4667  C  CG2 . ILE B  2  74  ? 72.565  284.806 187.075 1.00 38.22  ? 74   ILE B CG2 1 
ATOM   4668  C  CD1 . ILE B  2  74  ? 73.716  285.440 189.889 1.00 42.10  ? 74   ILE B CD1 1 
ATOM   4669  N  N   . LEU B  2  75  ? 68.819  284.835 187.003 1.00 37.53  ? 75   LEU B N   1 
ATOM   4670  C  CA  . LEU B  2  75  ? 67.874  284.202 186.091 1.00 46.67  ? 75   LEU B CA  1 
ATOM   4671  C  C   . LEU B  2  75  ? 67.015  285.207 185.342 1.00 45.73  ? 75   LEU B C   1 
ATOM   4672  O  O   . LEU B  2  75  ? 66.427  284.846 184.317 1.00 41.28  ? 75   LEU B O   1 
ATOM   4673  C  CB  . LEU B  2  75  ? 66.953  283.277 186.866 1.00 36.53  ? 75   LEU B CB  1 
ATOM   4674  C  CG  . LEU B  2  75  ? 67.292  281.804 186.959 1.00 63.75  ? 75   LEU B CG  1 
ATOM   4675  C  CD1 . LEU B  2  75  ? 68.744  281.622 186.849 1.00 51.24  ? 75   LEU B CD1 1 
ATOM   4676  C  CD2 . LEU B  2  75  ? 66.795  281.265 188.241 1.00 42.75  ? 75   LEU B CD2 1 
ATOM   4677  N  N   . ILE B  2  76  ? 66.900  286.441 185.839 1.00 32.91  ? 76   ILE B N   1 
ATOM   4678  C  CA  . ILE B  2  76  ? 66.241  287.487 185.068 1.00 34.50  ? 76   ILE B CA  1 
ATOM   4679  C  C   . ILE B  2  76  ? 67.230  288.200 184.149 1.00 46.51  ? 76   ILE B C   1 
ATOM   4680  O  O   . ILE B  2  76  ? 66.956  288.424 182.961 1.00 39.11  ? 76   ILE B O   1 
ATOM   4681  C  CB  . ILE B  2  76  ? 65.542  288.471 186.012 1.00 39.09  ? 76   ILE B CB  1 
ATOM   4682  C  CG1 . ILE B  2  76  ? 64.424  287.755 186.785 1.00 28.88  ? 76   ILE B CG1 1 
ATOM   4683  C  CG2 . ILE B  2  76  ? 64.933  289.634 185.206 1.00 31.61  ? 76   ILE B CG2 1 
ATOM   4684  C  CD1 . ILE B  2  76  ? 63.885  288.679 187.871 1.00 33.24  ? 76   ILE B CD1 1 
ATOM   4685  N  N   . ALA B  2  77  ? 68.390  288.524 184.694 1.00 35.41  ? 77   ALA B N   1 
ATOM   4686  C  CA  . ALA B  2  77  ? 69.379  289.353 184.005 1.00 34.18  ? 77   ALA B CA  1 
ATOM   4687  C  C   . ALA B  2  77  ? 69.918  288.672 182.760 1.00 41.06  ? 77   ALA B C   1 
ATOM   4688  O  O   . ALA B  2  77  ? 70.147  289.329 181.743 1.00 38.98  ? 77   ALA B O   1 
ATOM   4689  C  CB  . ALA B  2  77  ? 70.551  289.671 184.937 1.00 40.23  ? 77   ALA B CB  1 
ATOM   4690  N  N   . LEU B  2  78  ? 70.164  287.370 182.826 1.00 41.00  ? 78   LEU B N   1 
ATOM   4691  C  CA  . LEU B  2  78  ? 70.762  286.703 181.678 1.00 51.40  ? 78   LEU B CA  1 
ATOM   4692  C  C   . LEU B  2  78  ? 69.892  286.820 180.437 1.00 48.93  ? 78   LEU B C   1 
ATOM   4693  O  O   . LEU B  2  78  ? 70.418  287.239 179.392 1.00 39.72  ? 78   LEU B O   1 
ATOM   4694  C  CB  . LEU B  2  78  ? 71.059  285.244 181.998 1.00 35.52  ? 78   LEU B CB  1 
ATOM   4695  C  CG  . LEU B  2  78  ? 72.374  284.954 182.682 1.00 57.35  ? 78   LEU B CG  1 
ATOM   4696  C  CD1 . LEU B  2  78  ? 72.963  286.188 183.347 1.00 71.47  ? 78   LEU B CD1 1 
ATOM   4697  C  CD2 . LEU B  2  78  ? 71.996  283.907 183.678 1.00 47.94  ? 78   LEU B CD2 1 
ATOM   4698  N  N   . PRO B  2  79  ? 68.591  286.510 180.460 1.00 42.92  ? 79   PRO B N   1 
ATOM   4699  C  CA  . PRO B  2  79  ? 67.813  286.672 179.198 1.00 42.19  ? 79   PRO B CA  1 
ATOM   4700  C  C   . PRO B  2  79  ? 67.608  288.121 178.837 1.00 46.13  ? 79   PRO B C   1 
ATOM   4701  O  O   . PRO B  2  79  ? 67.585  288.472 177.646 1.00 34.90  ? 79   PRO B O   1 
ATOM   4702  C  CB  . PRO B  2  79  ? 66.485  285.951 179.476 1.00 40.52  ? 79   PRO B CB  1 
ATOM   4703  C  CG  . PRO B  2  79  ? 66.438  285.828 181.054 1.00 35.91  ? 79   PRO B CG  1 
ATOM   4704  C  CD  . PRO B  2  79  ? 67.875  285.677 181.449 1.00 39.46  ? 79   PRO B CD  1 
ATOM   4705  N  N   . SER B  2  80  ? 67.504  288.969 179.854 1.00 35.95  ? 80   SER B N   1 
ATOM   4706  C  CA  . SER B  2  80  ? 67.429  290.416 179.686 1.00 37.24  ? 80   SER B CA  1 
ATOM   4707  C  C   . SER B  2  80  ? 68.615  290.939 178.889 1.00 36.12  ? 80   SER B C   1 
ATOM   4708  O  O   . SER B  2  80  ? 68.455  291.686 177.918 1.00 39.01  ? 80   SER B O   1 
ATOM   4709  C  CB  . SER B  2  80  ? 67.411  291.081 181.091 1.00 33.44  ? 80   SER B CB  1 
ATOM   4710  O  OG  . SER B  2  80  ? 67.220  292.478 180.975 1.00 32.18  ? 80   SER B OG  1 
ATOM   4711  N  N   . LEU B  2  81  ? 69.822  290.570 179.305 1.00 33.27  ? 81   LEU B N   1 
ATOM   4712  C  CA  . LEU B  2  81  ? 70.993  291.129 178.643 1.00 36.98  ? 81   LEU B CA  1 
ATOM   4713  C  C   . LEU B  2  81  ? 71.188  290.497 177.275 1.00 35.85  ? 81   LEU B C   1 
ATOM   4714  O  O   . LEU B  2  81  ? 71.731  291.121 176.382 1.00 37.34  ? 81   LEU B O   1 
ATOM   4715  C  CB  . LEU B  2  81  ? 72.226  290.911 179.500 1.00 31.85  ? 81   LEU B CB  1 
ATOM   4716  C  CG  . LEU B  2  81  ? 72.088  291.561 180.898 1.00 49.40  ? 81   LEU B CG  1 
ATOM   4717  C  CD1 . LEU B  2  81  ? 73.355  291.363 181.657 1.00 34.92  ? 81   LEU B CD1 1 
ATOM   4718  C  CD2 . LEU B  2  81  ? 71.775  293.068 180.791 1.00 33.61  ? 81   LEU B CD2 1 
ATOM   4719  N  N   . ARG B  2  82  ? 70.788  289.256 177.115 1.00 34.29  ? 82   ARG B N   1 
ATOM   4720  C  CA  . ARG B  2  82  ? 70.863  288.669 175.780 1.00 42.94  ? 82   ARG B CA  1 
ATOM   4721  C  C   . ARG B  2  82  ? 70.008  289.467 174.800 1.00 45.43  ? 82   ARG B C   1 
ATOM   4722  O  O   . ARG B  2  82  ? 70.451  289.794 173.682 1.00 40.78  ? 82   ARG B O   1 
ATOM   4723  C  CB  . ARG B  2  82  ? 70.444  287.201 175.849 1.00 50.12  ? 82   ARG B CB  1 
ATOM   4724  C  CG  . ARG B  2  82  ? 70.636  286.424 174.557 1.00 194.00 ? 82   ARG B CG  1 
ATOM   4725  C  CD  . ARG B  2  82  ? 69.865  285.128 174.591 1.00 57.91  ? 82   ARG B CD  1 
ATOM   4726  N  NE  . ARG B  2  82  ? 68.445  285.406 174.537 1.00 182.56 ? 82   ARG B NE  1 
ATOM   4727  C  CZ  . ARG B  2  82  ? 67.668  285.163 173.492 1.00 123.78 ? 82   ARG B CZ  1 
ATOM   4728  N  NH1 . ARG B  2  82  ? 68.151  284.586 172.397 1.00 91.02  ? 82   ARG B NH1 1 
ATOM   4729  N  NH2 . ARG B  2  82  ? 66.392  285.500 173.566 1.00 51.19  ? 82   ARG B NH2 1 
ATOM   4730  N  N   . ILE B  2  83  ? 68.784  289.823 175.202 1.00 35.33  ? 83   ILE B N   1 
ATOM   4731  C  CA  . ILE B  2  83  ? 67.934  290.604 174.295 1.00 36.62  ? 83   ILE B CA  1 
ATOM   4732  C  C   . ILE B  2  83  ? 68.576  291.954 174.049 1.00 49.73  ? 83   ILE B C   1 
ATOM   4733  O  O   . ILE B  2  83  ? 68.666  292.434 172.903 1.00 37.63  ? 83   ILE B O   1 
ATOM   4734  C  CB  . ILE B  2  83  ? 66.491  290.742 174.845 1.00 31.51  ? 83   ILE B CB  1 
ATOM   4735  C  CG1 . ILE B  2  83  ? 65.900  289.330 174.961 1.00 38.36  ? 83   ILE B CG1 1 
ATOM   4736  C  CG2 . ILE B  2  83  ? 65.648  291.656 173.904 1.00 34.38  ? 83   ILE B CG2 1 
ATOM   4737  C  CD1 . ILE B  2  83  ? 64.530  289.253 175.584 1.00 36.60  ? 83   ILE B CD1 1 
ATOM   4738  N  N   . LEU B  2  84  ? 69.082  292.566 175.114 1.00 33.96  ? 84   LEU B N   1 
ATOM   4739  C  CA  . LEU B  2  84  ? 69.702  293.873 174.960 1.00 30.78  ? 84   LEU B CA  1 
ATOM   4740  C  C   . LEU B  2  84  ? 70.824  293.837 173.915 1.00 34.73  ? 84   LEU B C   1 
ATOM   4741  O  O   . LEU B  2  84  ? 70.955  294.750 173.101 1.00 35.98  ? 84   LEU B O   1 
ATOM   4742  C  CB  . LEU B  2  84  ? 70.307  294.317 176.326 1.00 31.48  ? 84   LEU B CB  1 
ATOM   4743  C  CG  . LEU B  2  84  ? 71.092  295.618 176.281 1.00 38.55  ? 84   LEU B CG  1 
ATOM   4744  C  CD1 . LEU B  2  84  ? 70.175  296.800 176.093 1.00 39.00  ? 84   LEU B CD1 1 
ATOM   4745  C  CD2 . LEU B  2  84  ? 71.913  295.751 177.627 1.00 35.35  ? 84   LEU B CD2 1 
ATOM   4746  N  N   . TYR B  2  85  ? 71.691  292.828 173.982 1.00 39.04  ? 85   TYR B N   1 
ATOM   4747  C  CA  . TYR B  2  85  ? 72.807  292.813 173.037 1.00 43.24  ? 85   TYR B CA  1 
ATOM   4748  C  C   . TYR B  2  85  ? 72.336  292.399 171.651 1.00 64.20  ? 85   TYR B C   1 
ATOM   4749  O  O   . TYR B  2  85  ? 72.817  292.931 170.643 1.00 51.94  ? 85   TYR B O   1 
ATOM   4750  C  CB  . TYR B  2  85  ? 73.914  291.900 173.553 1.00 36.33  ? 85   TYR B CB  1 
ATOM   4751  C  CG  . TYR B  2  85  ? 74.720  292.688 174.544 1.00 39.21  ? 85   TYR B CG  1 
ATOM   4752  C  CD1 . TYR B  2  85  ? 75.647  293.616 174.086 1.00 42.46  ? 85   TYR B CD1 1 
ATOM   4753  C  CD2 . TYR B  2  85  ? 74.460  292.616 175.910 1.00 36.53  ? 85   TYR B CD2 1 
ATOM   4754  C  CE1 . TYR B  2  85  ? 76.375  294.414 174.977 1.00 37.39  ? 85   TYR B CE1 1 
ATOM   4755  C  CE2 . TYR B  2  85  ? 75.184  293.427 176.824 1.00 34.72  ? 85   TYR B CE2 1 
ATOM   4756  C  CZ  . TYR B  2  85  ? 76.129  294.326 176.346 1.00 42.65  ? 85   TYR B CZ  1 
ATOM   4757  O  OH  . TYR B  2  85  ? 76.865  295.122 177.220 1.00 41.91  ? 85   TYR B OH  1 
ATOM   4758  N  N   . MET B  2  86  ? 71.338  291.522 171.585 1.00 37.74  ? 86   MET B N   1 
ATOM   4759  C  CA  . MET B  2  86  ? 70.831  291.104 170.281 1.00 50.53  ? 86   MET B CA  1 
ATOM   4760  C  C   . MET B  2  86  ? 70.251  292.300 169.537 1.00 58.92  ? 86   MET B C   1 
ATOM   4761  O  O   . MET B  2  86  ? 70.593  292.546 168.376 1.00 59.84  ? 86   MET B O   1 
ATOM   4762  C  CB  . MET B  2  86  ? 69.834  289.957 170.485 1.00 36.87  ? 86   MET B CB  1 
ATOM   4763  C  CG  . MET B  2  86  ? 68.635  289.930 169.630 1.00 87.02  ? 86   MET B CG  1 
ATOM   4764  S  SD  . MET B  2  86  ? 67.619  288.545 170.200 1.00 84.91  ? 86   MET B SD  1 
ATOM   4765  C  CE  . MET B  2  86  ? 68.738  287.649 171.265 1.00 46.48  ? 86   MET B CE  1 
ATOM   4766  N  N   . MET B  2  87  ? 69.475  293.130 170.235 1.00 45.42  ? 87   MET B N   1 
ATOM   4767  C  CA  . MET B  2  87  ? 68.993  294.382 169.657 1.00 52.03  ? 87   MET B CA  1 
ATOM   4768  C  C   . MET B  2  87  ? 70.126  295.244 169.132 1.00 76.93  ? 87   MET B C   1 
ATOM   4769  O  O   . MET B  2  87  ? 69.998  295.872 168.078 1.00 81.45  ? 87   MET B O   1 
ATOM   4770  C  CB  . MET B  2  87  ? 68.196  295.184 170.682 1.00 63.37  ? 87   MET B CB  1 
ATOM   4771  C  CG  . MET B  2  87  ? 67.070  294.420 171.338 1.00 96.36  ? 87   MET B CG  1 
ATOM   4772  S  SD  . MET B  2  87  ? 65.875  295.520 172.101 1.00 192.33 ? 87   MET B SD  1 
ATOM   4773  C  CE  . MET B  2  87  ? 66.712  295.959 173.596 1.00 38.13  ? 87   MET B CE  1 
ATOM   4774  N  N   . ASP B  2  88  ? 71.240  295.301 169.862 1.00 44.19  ? 88   ASP B N   1 
ATOM   4775  C  CA  . ASP B  2  88  ? 72.335  296.175 169.483 1.00 95.11  ? 88   ASP B CA  1 
ATOM   4776  C  C   . ASP B  2  88  ? 73.183  295.642 168.320 1.00 45.34  ? 88   ASP B C   1 
ATOM   4777  O  O   . ASP B  2  88  ? 73.953  296.417 167.751 1.00 54.38  ? 88   ASP B O   1 
ATOM   4778  C  CB  . ASP B  2  88  ? 73.193  296.380 170.720 1.00 45.74  ? 88   ASP B CB  1 
ATOM   4779  C  CG  . ASP B  2  88  ? 74.308  297.280 170.507 1.00 145.48 ? 88   ASP B CG  1 
ATOM   4780  O  OD1 . ASP B  2  88  ? 74.098  298.468 170.443 1.00 34.89  ? 88   ASP B OD1 1 
ATOM   4781  O  OD2 . ASP B  2  88  ? 75.418  296.806 170.439 1.00 44.94  ? 88   ASP B OD2 1 
ATOM   4782  N  N   . GLU B  2  89  ? 73.100  294.343 168.019 1.00 41.83  ? 89   GLU B N   1 
ATOM   4783  C  CA  . GLU B  2  89  ? 74.006  293.678 167.092 1.00 57.78  ? 89   GLU B CA  1 
ATOM   4784  C  C   . GLU B  2  89  ? 73.804  294.241 165.689 1.00 75.41  ? 89   GLU B C   1 
ATOM   4785  O  O   . GLU B  2  89  ? 72.721  294.731 165.367 1.00 55.04  ? 89   GLU B O   1 
ATOM   4786  C  CB  . GLU B  2  89  ? 73.762  292.169 167.112 1.00 57.48  ? 89   GLU B CB  1 
ATOM   4787  C  CG  . GLU B  2  89  ? 74.447  291.435 168.260 1.00 117.21 ? 89   GLU B CG  1 
ATOM   4788  C  CD  . GLU B  2  89  ? 73.935  290.009 168.463 1.00 167.29 ? 89   GLU B CD  1 
ATOM   4789  O  OE1 . GLU B  2  89  ? 73.154  289.511 167.607 1.00 80.72  ? 89   GLU B OE1 1 
ATOM   4790  O  OE2 . GLU B  2  89  ? 74.316  289.392 169.493 1.00 115.48 ? 89   GLU B OE2 1 
ATOM   4791  N  N   . ILE B  2  90  ? 74.864  294.148 164.866 1.00 57.76  ? 90   ILE B N   1 
ATOM   4792  C  CA  . ILE B  2  90  ? 74.993  294.898 163.609 1.00 184.35 ? 90   ILE B CA  1 
ATOM   4793  C  C   . ILE B  2  90  ? 74.066  294.318 162.555 1.00 204.15 ? 90   ILE B C   1 
ATOM   4794  O  O   . ILE B  2  90  ? 74.047  293.101 162.313 1.00 69.52  ? 90   ILE B O   1 
ATOM   4795  C  CB  . ILE B  2  90  ? 76.448  294.886 163.107 1.00 86.65  ? 90   ILE B CB  1 
ATOM   4796  C  CG1 . ILE B  2  90  ? 77.389  295.496 164.143 1.00 105.51 ? 90   ILE B CG1 1 
ATOM   4797  C  CG2 . ILE B  2  90  ? 76.588  295.583 161.725 1.00 51.86  ? 90   ILE B CG2 1 
ATOM   4798  C  CD1 . ILE B  2  90  ? 78.853  295.326 163.798 1.00 84.42  ? 90   ILE B CD1 1 
ATOM   4799  N  N   . ASN B  2  91  ? 73.341  295.196 161.874 1.00 57.57  ? 91   ASN B N   1 
ATOM   4800  C  CA  . ASN B  2  91  ? 72.144  294.780 161.152 1.00 100.03 ? 91   ASN B CA  1 
ATOM   4801  C  C   . ASN B  2  91  ? 72.250  294.893 159.641 1.00 141.97 ? 91   ASN B C   1 
ATOM   4802  O  O   . ASN B  2  91  ? 71.727  294.033 158.919 1.00 96.08  ? 91   ASN B O   1 
ATOM   4803  C  CB  . ASN B  2  91  ? 70.949  295.612 161.642 1.00 85.77  ? 91   ASN B CB  1 
ATOM   4804  C  CG  . ASN B  2  91  ? 70.909  295.723 163.160 1.00 150.03 ? 91   ASN B CG  1 
ATOM   4805  O  OD1 . ASN B  2  91  ? 70.377  294.847 163.858 1.00 106.57 ? 91   ASN B OD1 1 
ATOM   4806  N  ND2 . ASN B  2  91  ? 71.485  296.804 163.682 1.00 114.52 ? 91   ASN B ND2 1 
ATOM   4807  N  N   . ASN B  2  92  ? 72.920  295.924 159.157 1.00 57.47  ? 92   ASN B N   1 
ATOM   4808  C  CA  . ASN B  2  92  ? 73.019  296.297 157.750 1.00 61.08  ? 92   ASN B CA  1 
ATOM   4809  C  C   . ASN B  2  92  ? 71.649  296.680 157.188 1.00 55.56  ? 92   ASN B C   1 
ATOM   4810  O  O   . ASN B  2  92  ? 70.967  295.884 156.530 1.00 51.03  ? 92   ASN B O   1 
ATOM   4811  C  CB  . ASN B  2  92  ? 73.695  295.190 156.941 1.00 83.75  ? 92   ASN B CB  1 
ATOM   4812  C  CG  . ASN B  2  92  ? 75.169  295.020 157.307 1.00 187.69 ? 92   ASN B CG  1 
ATOM   4813  O  OD1 . ASN B  2  92  ? 75.823  295.957 157.790 1.00 84.19  ? 92   ASN B OD1 1 
ATOM   4814  N  ND2 . ASN B  2  92  ? 75.695  293.827 157.074 1.00 88.33  ? 92   ASN B ND2 1 
ATOM   4815  N  N   . PRO B  2  93  ? 71.221  297.908 157.433 1.00 48.01  ? 93   PRO B N   1 
ATOM   4816  C  CA  . PRO B  2  93  ? 69.935  298.363 156.892 1.00 46.72  ? 93   PRO B CA  1 
ATOM   4817  C  C   . PRO B  2  93  ? 69.949  298.553 155.376 1.00 39.89  ? 93   PRO B C   1 
ATOM   4818  O  O   . PRO B  2  93  ? 70.953  298.907 154.744 1.00 40.77  ? 93   PRO B O   1 
ATOM   4819  C  CB  . PRO B  2  93  ? 69.726  299.703 157.606 1.00 37.41  ? 93   PRO B CB  1 
ATOM   4820  C  CG  . PRO B  2  93  ? 71.148  300.200 157.796 1.00 52.39  ? 93   PRO B CG  1 
ATOM   4821  C  CD  . PRO B  2  93  ? 71.889  298.969 158.214 1.00 41.16  ? 93   PRO B CD  1 
ATOM   4822  N  N   . SER B  2  94  ? 68.781  298.351 154.787 1.00 34.34  ? 94   SER B N   1 
ATOM   4823  C  CA  . SER B  2  94  ? 68.623  298.638 153.355 1.00 39.08  ? 94   SER B CA  1 
ATOM   4824  C  C   . SER B  2  94  ? 68.199  300.071 153.081 1.00 40.54  ? 94   SER B C   1 
ATOM   4825  O  O   . SER B  2  94  ? 68.215  300.492 151.927 1.00 38.52  ? 94   SER B O   1 
ATOM   4826  C  CB  . SER B  2  94  ? 67.550  297.747 152.722 1.00 38.82  ? 94   SER B CB  1 
ATOM   4827  O  OG  . SER B  2  94  ? 67.602  296.375 153.073 1.00 52.00  ? 94   SER B OG  1 
ATOM   4828  N  N   . LEU B  2  95  ? 67.795  300.805 154.104 1.00 37.61  ? 95   LEU B N   1 
ATOM   4829  C  CA  . LEU B  2  95  ? 67.146  302.091 153.957 1.00 28.99  ? 95   LEU B CA  1 
ATOM   4830  C  C   . LEU B  2  95  ? 67.346  302.884 155.240 1.00 37.10  ? 95   LEU B C   1 
ATOM   4831  O  O   . LEU B  2  95  ? 67.234  302.319 156.335 1.00 34.00  ? 95   LEU B O   1 
ATOM   4832  C  CB  . LEU B  2  95  ? 65.640  301.845 153.741 1.00 39.67  ? 95   LEU B CB  1 
ATOM   4833  C  CG  . LEU B  2  95  ? 64.747  303.052 153.816 1.00 42.35  ? 95   LEU B CG  1 
ATOM   4834  C  CD1 . LEU B  2  95  ? 64.944  303.875 152.568 1.00 47.88  ? 95   LEU B CD1 1 
ATOM   4835  C  CD2 . LEU B  2  95  ? 63.257  302.603 153.952 1.00 34.13  ? 95   LEU B CD2 1 
ATOM   4836  N  N   . THR B  2  96  ? 67.567  304.193 155.124 1.00 30.57  ? 96   THR B N   1 
ATOM   4837  C  CA  . THR B  2  96  ? 67.560  305.081 156.278 1.00 31.76  ? 96   THR B CA  1 
ATOM   4838  C  C   . THR B  2  96  ? 66.460  306.113 156.159 1.00 33.90  ? 96   THR B C   1 
ATOM   4839  O  O   . THR B  2  96  ? 66.321  306.766 155.105 1.00 33.32  ? 96   THR B O   1 
ATOM   4840  C  CB  . THR B  2  96  ? 68.917  305.807 156.447 1.00 32.31  ? 96   THR B CB  1 
ATOM   4841  O  OG1 . THR B  2  96  ? 69.933  304.816 156.571 1.00 32.39  ? 96   THR B OG1 1 
ATOM   4842  C  CG2 . THR B  2  96  ? 68.895  306.699 157.714 1.00 30.22  ? 96   THR B CG2 1 
ATOM   4843  N  N   . VAL B  2  97  ? 65.692  306.264 157.242 1.00 29.67  ? 97   VAL B N   1 
ATOM   4844  C  CA  . VAL B  2  97  ? 64.631  307.267 157.308 1.00 33.96  ? 97   VAL B CA  1 
ATOM   4845  C  C   . VAL B  2  97  ? 64.900  308.130 158.539 1.00 38.38  ? 97   VAL B C   1 
ATOM   4846  O  O   . VAL B  2  97  ? 65.262  307.597 159.580 1.00 34.82  ? 97   VAL B O   1 
ATOM   4847  C  CB  . VAL B  2  97  ? 63.254  306.587 157.384 1.00 32.32  ? 97   VAL B CB  1 
ATOM   4848  C  CG1 . VAL B  2  97  ? 62.105  307.608 157.428 1.00 32.16  ? 97   VAL B CG1 1 
ATOM   4849  C  CG2 . VAL B  2  97  ? 63.044  305.547 156.207 1.00 29.28  ? 97   VAL B CG2 1 
ATOM   4850  N  N   . LYS B  2  98  ? 64.757  309.453 158.435 1.00 28.63  ? 98   LYS B N   1 
ATOM   4851  C  CA  . LYS B  2  98  ? 64.877  310.343 159.594 1.00 28.09  ? 98   LYS B CA  1 
ATOM   4852  C  C   . LYS B  2  98  ? 63.476  310.812 160.014 1.00 35.55  ? 98   LYS B C   1 
ATOM   4853  O  O   . LYS B  2  98  ? 62.612  311.043 159.166 1.00 32.33  ? 98   LYS B O   1 
ATOM   4854  C  CB  . LYS B  2  98  ? 65.701  311.560 159.256 1.00 28.01  ? 98   LYS B CB  1 
ATOM   4855  C  CG  . LYS B  2  98  ? 67.182  311.291 159.054 1.00 35.27  ? 98   LYS B CG  1 
ATOM   4856  C  CD  . LYS B  2  98  ? 67.751  312.446 158.269 1.00 30.04  ? 98   LYS B CD  1 
ATOM   4857  C  CE  . LYS B  2  98  ? 67.562  312.181 156.699 1.00 26.16  ? 98   LYS B CE  1 
ATOM   4858  N  NZ  . LYS B  2  98  ? 67.785  313.539 156.031 1.00 29.72  ? 98   LYS B NZ  1 
ATOM   4859  N  N   . THR B  2  99  ? 63.275  311.050 161.302 1.00 28.34  ? 99   THR B N   1 
ATOM   4860  C  CA  . THR B  2  99  ? 62.034  311.694 161.758 1.00 27.27  ? 99   THR B CA  1 
ATOM   4861  C  C   . THR B  2  99  ? 62.448  312.825 162.685 1.00 36.60  ? 99   THR B C   1 
ATOM   4862  O  O   . THR B  2  99  ? 63.350  312.655 163.499 1.00 30.67  ? 99   THR B O   1 
ATOM   4863  C  CB  . THR B  2  99  ? 61.068  310.727 162.461 1.00 28.22  ? 99   THR B CB  1 
ATOM   4864  O  OG1 . THR B  2  99  ? 59.863  311.477 162.806 1.00 32.88  ? 99   THR B OG1 1 
ATOM   4865  C  CG2 . THR B  2  99  ? 61.678  310.077 163.763 1.00 30.55  ? 99   THR B CG2 1 
ATOM   4866  N  N   . MET B  2  100 ? 61.843  314.001 162.517 1.00 30.70  ? 100  MET B N   1 
ATOM   4867  C  CA  . MET B  2  100 ? 62.093  315.159 163.363 1.00 28.00  ? 100  MET B CA  1 
ATOM   4868  C  C   . MET B  2  100 ? 60.838  315.444 164.154 1.00 30.54  ? 100  MET B C   1 
ATOM   4869  O  O   . MET B  2  100 ? 59.762  315.624 163.570 1.00 24.94  ? 100  MET B O   1 
ATOM   4870  C  CB  . MET B  2  100 ? 62.476  316.404 162.560 1.00 25.21  ? 100  MET B CB  1 
ATOM   4871  C  CG  . MET B  2  100 ? 63.655  316.093 161.522 1.00 29.70  ? 100  MET B CG  1 
ATOM   4872  S  SD  . MET B  2  100 ? 65.262  315.702 162.374 1.00 36.27  ? 100  MET B SD  1 
ATOM   4873  C  CE  . MET B  2  100 ? 65.695  317.298 163.128 1.00 31.44  ? 100  MET B CE  1 
ATOM   4874  N  N   . GLY B  2  101 ? 60.954  315.515 165.492 1.00 27.66  ? 101  GLY B N   1 
ATOM   4875  C  CA  . GLY B  2  101 ? 59.813  315.932 166.285 1.00 28.85  ? 101  GLY B CA  1 
ATOM   4876  C  C   . GLY B  2  101 ? 59.682  317.441 166.287 1.00 29.92  ? 101  GLY B C   1 
ATOM   4877  O  O   . GLY B  2  101 ? 60.657  318.179 166.161 1.00 27.61  ? 101  GLY B O   1 
ATOM   4878  N  N   . HIS B  2  102 ? 58.437  317.890 166.339 1.00 24.93  ? 102  HIS B N   1 
ATOM   4879  C  CA  . HIS B  2  102 ? 58.083  319.302 166.415 1.00 27.34  ? 102  HIS B CA  1 
ATOM   4880  C  C   . HIS B  2  102 ? 56.897  319.442 167.367 1.00 25.55  ? 102  HIS B C   1 
ATOM   4881  O  O   . HIS B  2  102 ? 56.085  318.532 167.497 1.00 25.57  ? 102  HIS B O   1 
ATOM   4882  C  CB  . HIS B  2  102 ? 57.560  319.852 165.060 1.00 24.71  ? 102  HIS B CB  1 
ATOM   4883  C  CG  . HIS B  2  102 ? 58.510  319.634 163.919 1.00 27.17  ? 102  HIS B CG  1 
ATOM   4884  N  ND1 . HIS B  2  102 ? 59.501  320.546 163.607 1.00 31.65  ? 102  HIS B ND1 1 
ATOM   4885  C  CD2 . HIS B  2  102 ? 58.650  318.607 163.054 1.00 29.31  ? 102  HIS B CD2 1 
ATOM   4886  C  CE1 . HIS B  2  102 ? 60.201  320.094 162.568 1.00 30.65  ? 102  HIS B CE1 1 
ATOM   4887  N  NE2 . HIS B  2  102 ? 59.697  318.932 162.196 1.00 29.78  ? 102  HIS B NE2 1 
ATOM   4888  N  N   . GLN B  2  103 ? 56.656  320.648 167.854 1.00 25.53  ? 103  GLN B N   1 
ATOM   4889  C  CA  . GLN B  2  103 ? 55.379  320.982 168.496 1.00 30.65  ? 103  GLN B CA  1 
ATOM   4890  C  C   . GLN B  2  103 ? 54.338  321.389 167.443 1.00 30.83  ? 103  GLN B C   1 
ATOM   4891  O  O   . GLN B  2  103 ? 54.442  322.477 166.871 1.00 30.26  ? 103  GLN B O   1 
ATOM   4892  C  CB  . GLN B  2  103 ? 55.596  322.141 169.479 1.00 25.72  ? 103  GLN B CB  1 
ATOM   4893  C  CG  . GLN B  2  103 ? 56.595  321.821 170.706 1.00 25.09  ? 103  GLN B CG  1 
ATOM   4894  C  CD  . GLN B  2  103 ? 56.707  323.006 171.605 1.00 30.52  ? 103  GLN B CD  1 
ATOM   4895  O  OE1 . GLN B  2  103 ? 57.048  324.072 171.149 1.00 31.46  ? 103  GLN B OE1 1 
ATOM   4896  N  NE2 . GLN B  2  103 ? 56.364  322.843 172.894 1.00 26.84  ? 103  GLN B NE2 1 
ATOM   4897  N  N   . TRP B  2  104 ? 53.293  320.585 167.207 1.00 27.60  ? 104  TRP B N   1 
ATOM   4898  C  CA  . TRP B  2  104 ? 53.132  319.220 167.653 1.00 26.58  ? 104  TRP B CA  1 
ATOM   4899  C  C   . TRP B  2  104 ? 52.785  318.301 166.451 1.00 31.23  ? 104  TRP B C   1 
ATOM   4900  O  O   . TRP B  2  104 ? 51.656  318.157 166.102 1.00 29.73  ? 104  TRP B O   1 
ATOM   4901  C  CB  . TRP B  2  104 ? 52.011  319.144 168.726 1.00 27.06  ? 104  TRP B CB  1 
ATOM   4902  C  CG  . TRP B  2  104 ? 52.444  319.845 170.010 1.00 27.32  ? 104  TRP B CG  1 
ATOM   4903  C  CD1 . TRP B  2  104 ? 53.117  319.294 171.066 1.00 25.61  ? 104  TRP B CD1 1 
ATOM   4904  C  CD2 . TRP B  2  104 ? 52.287  321.236 170.319 1.00 28.84  ? 104  TRP B CD2 1 
ATOM   4905  N  NE1 . TRP B  2  104 ? 53.343  320.264 172.056 1.00 27.09  ? 104  TRP B NE1 1 
ATOM   4906  C  CE2 . TRP B  2  104 ? 52.833  321.455 171.623 1.00 31.65  ? 104  TRP B CE2 1 
ATOM   4907  C  CE3 . TRP B  2  104 ? 51.643  322.302 169.662 1.00 33.16  ? 104  TRP B CE3 1 
ATOM   4908  C  CZ2 . TRP B  2  104 ? 52.839  322.701 172.244 1.00 31.40  ? 104  TRP B CZ2 1 
ATOM   4909  C  CZ3 . TRP B  2  104 ? 51.642  323.561 170.267 1.00 29.44  ? 104  TRP B CZ3 1 
ATOM   4910  C  CH2 . TRP B  2  104 ? 52.223  323.737 171.605 1.00 26.99  ? 104  TRP B CH2 1 
ATOM   4911  N  N   . TYR B  2  105 ? 53.795  317.715 165.835 1.00 26.90  ? 105  TYR B N   1 
ATOM   4912  C  CA  . TYR B  2  105 ? 53.629  316.839 164.683 1.00 28.64  ? 105  TYR B CA  1 
ATOM   4913  C  C   . TYR B  2  105 ? 55.023  316.278 164.429 1.00 30.43  ? 105  TYR B C   1 
ATOM   4914  O  O   . TYR B  2  105 ? 55.999  316.777 164.975 1.00 30.94  ? 105  TYR B O   1 
ATOM   4915  C  CB  . TYR B  2  105 ? 53.117  317.640 163.450 1.00 28.01  ? 105  TYR B CB  1 
ATOM   4916  C  CG  . TYR B  2  105 ? 54.120  318.658 162.953 1.00 28.79  ? 105  TYR B CG  1 
ATOM   4917  C  CD1 . TYR B  2  105 ? 54.188  319.926 163.506 1.00 26.23  ? 105  TYR B CD1 1 
ATOM   4918  C  CD2 . TYR B  2  105 ? 54.976  318.357 161.881 1.00 30.11  ? 105  TYR B CD2 1 
ATOM   4919  C  CE1 . TYR B  2  105 ? 55.118  320.892 162.975 1.00 32.31  ? 105  TYR B CE1 1 
ATOM   4920  C  CE2 . TYR B  2  105 ? 55.901  319.296 161.368 1.00 31.76  ? 105  TYR B CE2 1 
ATOM   4921  C  CZ  . TYR B  2  105 ? 55.954  320.536 161.915 1.00 34.81  ? 105  TYR B CZ  1 
ATOM   4922  O  OH  . TYR B  2  105 ? 56.860  321.430 161.407 1.00 35.40  ? 105  TYR B OH  1 
ATOM   4923  N  N   . TRP B  2  106 ? 55.096  315.238 163.586 1.00 29.56  ? 106  TRP B N   1 
ATOM   4924  C  CA  . TRP B  2  106 ? 56.354  314.647 163.174 1.00 27.29  ? 106  TRP B CA  1 
ATOM   4925  C  C   . TRP B  2  106 ? 56.607  315.001 161.714 1.00 30.56  ? 106  TRP B C   1 
ATOM   4926  O  O   . TRP B  2  106 ? 55.671  314.984 160.893 1.00 29.84  ? 106  TRP B O   1 
ATOM   4927  C  CB  . TRP B  2  106 ? 56.331  313.124 163.326 1.00 27.33  ? 106  TRP B CB  1 
ATOM   4928  C  CG  . TRP B  2  106 ? 56.171  312.707 164.767 1.00 27.57  ? 106  TRP B CG  1 
ATOM   4929  C  CD1 . TRP B  2  106 ? 55.014  312.405 165.382 1.00 24.95  ? 106  TRP B CD1 1 
ATOM   4930  C  CD2 . TRP B  2  106 ? 57.213  312.583 165.722 1.00 22.24  ? 106  TRP B CD2 1 
ATOM   4931  N  NE1 . TRP B  2  106 ? 55.288  312.073 166.745 1.00 27.82  ? 106  TRP B NE1 1 
ATOM   4932  C  CE2 . TRP B  2  106 ? 56.642  312.105 166.921 1.00 25.82  ? 106  TRP B CE2 1 
ATOM   4933  C  CE3 . TRP B  2  106 ? 58.621  312.724 165.656 1.00 25.50  ? 106  TRP B CE3 1 
ATOM   4934  C  CZ2 . TRP B  2  106 ? 57.407  311.878 168.118 1.00 26.55  ? 106  TRP B CZ2 1 
ATOM   4935  C  CZ3 . TRP B  2  106 ? 59.395  312.459 166.889 1.00 27.34  ? 106  TRP B CZ3 1 
ATOM   4936  C  CH2 . TRP B  2  106 ? 58.750  312.046 168.054 1.00 27.90  ? 106  TRP B CH2 1 
ATOM   4937  N  N   . SER B  2  107 ? 57.851  315.317 161.378 1.00 28.70  ? 107  SER B N   1 
ATOM   4938  C  CA  . SER B  2  107 ? 58.198  315.315 159.959 1.00 30.22  ? 107  SER B CA  1 
ATOM   4939  C  C   . SER B  2  107 ? 59.093  314.111 159.672 1.00 32.77  ? 107  SER B C   1 
ATOM   4940  O  O   . SER B  2  107 ? 59.729  313.538 160.567 1.00 30.42  ? 107  SER B O   1 
ATOM   4941  C  CB  . SER B  2  107 ? 58.862  316.628 159.546 1.00 29.82  ? 107  SER B CB  1 
ATOM   4942  O  OG  . SER B  2  107 ? 60.120  316.814 160.179 1.00 35.60  ? 107  SER B OG  1 
ATOM   4943  N  N   . TYR B  2  108 ? 59.135  313.709 158.409 1.00 28.40  ? 108  TYR B N   1 
ATOM   4944  C  CA  . TYR B  2  108 ? 59.917  312.548 158.028 1.00 28.87  ? 108  TYR B CA  1 
ATOM   4945  C  C   . TYR B  2  108 ? 60.728  312.899 156.785 1.00 29.60  ? 108  TYR B C   1 
ATOM   4946  O  O   . TYR B  2  108 ? 60.257  313.627 155.916 1.00 31.70  ? 108  TYR B O   1 
ATOM   4947  C  CB  . TYR B  2  108 ? 59.008  311.329 157.659 1.00 27.75  ? 108  TYR B CB  1 
ATOM   4948  C  CG  . TYR B  2  108 ? 58.233  310.895 158.876 1.00 34.15  ? 108  TYR B CG  1 
ATOM   4949  C  CD1 . TYR B  2  108 ? 56.981  311.439 159.169 1.00 34.66  ? 108  TYR B CD1 1 
ATOM   4950  C  CD2 . TYR B  2  108 ? 58.813  309.993 159.777 1.00 28.23  ? 108  TYR B CD2 1 
ATOM   4951  C  CE1 . TYR B  2  108 ? 56.332  311.074 160.353 1.00 29.25  ? 108  TYR B CE1 1 
ATOM   4952  C  CE2 . TYR B  2  108 ? 58.159  309.617 160.992 1.00 26.68  ? 108  TYR B CE2 1 
ATOM   4953  C  CZ  . TYR B  2  108 ? 56.952  310.144 161.245 1.00 33.09  ? 108  TYR B CZ  1 
ATOM   4954  O  OH  . TYR B  2  108 ? 56.310  309.752 162.415 1.00 29.69  ? 108  TYR B OH  1 
ATOM   4955  N  N   . GLU B  2  109 ? 61.907  312.306 156.678 1.00 30.00  ? 109  GLU B N   1 
ATOM   4956  C  CA  . GLU B  2  109 ? 62.835  312.598 155.589 1.00 36.19  ? 109  GLU B CA  1 
ATOM   4957  C  C   . GLU B  2  109 ? 63.381  311.285 155.070 1.00 32.70  ? 109  GLU B C   1 
ATOM   4958  O  O   . GLU B  2  109 ? 63.922  310.504 155.860 1.00 34.11  ? 109  GLU B O   1 
ATOM   4959  C  CB  . GLU B  2  109 ? 63.988  313.491 156.037 1.00 30.52  ? 109  GLU B CB  1 
ATOM   4960  C  CG  . GLU B  2  109 ? 63.520  314.799 156.701 1.00 33.87  ? 109  GLU B CG  1 
ATOM   4961  C  CD  . GLU B  2  109 ? 64.687  315.620 157.308 1.00 38.92  ? 109  GLU B CD  1 
ATOM   4962  O  OE1 . GLU B  2  109 ? 64.389  316.657 157.918 1.00 34.83  ? 109  GLU B OE1 1 
ATOM   4963  O  OE2 . GLU B  2  109 ? 65.890  315.292 157.104 1.00 34.83  ? 109  GLU B OE2 1 
ATOM   4964  N  N   . TYR B  2  110 ? 63.290  311.054 153.747 1.00 28.37  ? 110  TYR B N   1 
ATOM   4965  C  CA  . TYR B  2  110 ? 63.841  309.828 153.186 1.00 31.89  ? 110  TYR B CA  1 
ATOM   4966  C  C   . TYR B  2  110 ? 64.814  310.360 152.154 1.00 38.36  ? 110  TYR B C   1 
ATOM   4967  O  O   . TYR B  2  110 ? 64.351  310.736 151.074 1.00 33.58  ? 110  TYR B O   1 
ATOM   4968  C  CB  . TYR B  2  110 ? 62.771  308.959 152.496 1.00 30.05  ? 110  TYR B CB  1 
ATOM   4969  C  CG  . TYR B  2  110 ? 61.601  308.417 153.265 1.00 29.53  ? 110  TYR B CG  1 
ATOM   4970  C  CD1 . TYR B  2  110 ? 60.669  309.275 153.907 1.00 30.78  ? 110  TYR B CD1 1 
ATOM   4971  C  CD2 . TYR B  2  110 ? 61.363  307.059 153.289 1.00 34.19  ? 110  TYR B CD2 1 
ATOM   4972  C  CE1 . TYR B  2  110 ? 59.516  308.748 154.589 1.00 27.06  ? 110  TYR B CE1 1 
ATOM   4973  C  CE2 . TYR B  2  110 ? 60.285  306.555 153.956 1.00 29.74  ? 110  TYR B CE2 1 
ATOM   4974  C  CZ  . TYR B  2  110 ? 59.342  307.399 154.562 1.00 33.80  ? 110  TYR B CZ  1 
ATOM   4975  O  OH  . TYR B  2  110 ? 58.219  306.870 155.150 1.00 30.36  ? 110  TYR B OH  1 
ATOM   4976  N  N   . THR B  2  111 ? 66.116  310.442 152.480 1.00 32.60  ? 111  THR B N   1 
ATOM   4977  C  CA  . THR B  2  111 ? 67.057  311.148 151.581 1.00 33.74  ? 111  THR B CA  1 
ATOM   4978  C  C   . THR B  2  111 ? 68.232  310.267 151.186 1.00 36.34  ? 111  THR B C   1 
ATOM   4979  O  O   . THR B  2  111 ? 69.316  310.774 150.874 1.00 34.08  ? 111  THR B O   1 
ATOM   4980  C  CB  . THR B  2  111 ? 67.545  312.458 152.215 1.00 36.38  ? 111  THR B CB  1 
ATOM   4981  O  OG1 . THR B  2  111 ? 68.064  312.155 153.526 1.00 39.97  ? 111  THR B OG1 1 
ATOM   4982  C  CG2 . THR B  2  111 ? 66.355  313.374 152.480 1.00 35.57  ? 111  THR B CG2 1 
ATOM   4983  N  N   . ASP B  2  112 ? 68.028  308.947 151.126 1.00 30.99  ? 112  ASP B N   1 
ATOM   4984  C  CA  . ASP B  2  112 ? 69.059  308.086 150.564 1.00 34.45  ? 112  ASP B CA  1 
ATOM   4985  C  C   . ASP B  2  112 ? 69.292  308.424 149.091 1.00 35.49  ? 112  ASP B C   1 
ATOM   4986  O  O   . ASP B  2  112 ? 70.434  308.422 148.615 1.00 38.73  ? 112  ASP B O   1 
ATOM   4987  C  CB  . ASP B  2  112 ? 68.666  306.615 150.676 1.00 34.57  ? 112  ASP B CB  1 
ATOM   4988  C  CG  . ASP B  2  112 ? 68.908  306.037 152.062 1.00 34.26  ? 112  ASP B CG  1 
ATOM   4989  O  OD1 . ASP B  2  112 ? 69.875  306.404 152.731 1.00 37.12  ? 112  ASP B OD1 1 
ATOM   4990  O  OD2 . ASP B  2  112 ? 68.133  305.153 152.481 1.00 33.93  ? 112  ASP B OD2 1 
ATOM   4991  N  N   . TYR B  2  113 ? 68.224  308.732 148.354 1.00 33.53  ? 113  TYR B N   1 
ATOM   4992  C  CA  . TYR B  2  113 ? 68.339  308.872 146.874 1.00 34.99  ? 113  TYR B CA  1 
ATOM   4993  C  C   . TYR B  2  113 ? 67.777  310.205 146.376 1.00 46.73  ? 113  TYR B C   1 
ATOM   4994  O  O   . TYR B  2  113 ? 68.460  310.958 145.695 1.00 51.81  ? 113  TYR B O   1 
ATOM   4995  C  CB  . TYR B  2  113 ? 67.573  307.761 146.131 1.00 43.09  ? 113  TYR B CB  1 
ATOM   4996  C  CG  . TYR B  2  113 ? 67.793  306.347 146.646 1.00 184.54 ? 113  TYR B CG  1 
ATOM   4997  C  CD1 . TYR B  2  113 ? 69.028  305.717 146.495 1.00 102.47 ? 113  TYR B CD1 1 
ATOM   4998  C  CD2 . TYR B  2  113 ? 66.759  305.634 147.274 1.00 51.49  ? 113  TYR B CD2 1 
ATOM   4999  C  CE1 . TYR B  2  113 ? 69.245  304.429 146.963 1.00 147.02 ? 113  TYR B CE1 1 
ATOM   5000  C  CE2 . TYR B  2  113 ? 66.970  304.343 147.734 1.00 165.97 ? 113  TYR B CE2 1 
ATOM   5001  C  CZ  . TYR B  2  113 ? 68.219  303.748 147.585 1.00 53.63  ? 113  TYR B CZ  1 
ATOM   5002  O  OH  . TYR B  2  113 ? 68.399  302.465 148.047 1.00 133.35 ? 113  TYR B OH  1 
ATOM   5003  N  N   . GLU B  2  114 ? 66.524  310.498 146.685 1.00 39.55  ? 114  GLU B N   1 
ATOM   5004  C  CA  . GLU B  2  114 ? 65.853  311.757 146.366 1.00 49.21  ? 114  GLU B CA  1 
ATOM   5005  C  C   . GLU B  2  114 ? 65.638  312.587 147.627 1.00 56.19  ? 114  GLU B C   1 
ATOM   5006  O  O   . GLU B  2  114 ? 65.808  312.106 148.747 1.00 45.75  ? 114  GLU B O   1 
ATOM   5007  C  CB  . GLU B  2  114 ? 64.487  311.485 145.729 1.00 57.79  ? 114  GLU B CB  1 
ATOM   5008  C  CG  . GLU B  2  114 ? 64.503  310.518 144.564 1.00 54.34  ? 114  GLU B CG  1 
ATOM   5009  C  CD  . GLU B  2  114 ? 65.294  311.042 143.397 1.00 165.93 ? 114  GLU B CD  1 
ATOM   5010  O  OE1 . GLU B  2  114 ? 65.886  310.236 142.655 1.00 89.39  ? 114  GLU B OE1 1 
ATOM   5011  O  OE2 . GLU B  2  114 ? 65.337  312.270 143.231 1.00 52.52  ? 114  GLU B OE2 1 
ATOM   5012  N  N   . ASP B  2  115 ? 65.229  313.854 147.471 1.00 38.67  ? 115  ASP B N   1 
ATOM   5013  C  CA  . ASP B  2  115 ? 64.921  314.633 148.679 1.00 48.52  ? 115  ASP B CA  1 
ATOM   5014  C  C   . ASP B  2  115 ? 63.410  314.569 148.954 1.00 53.09  ? 115  ASP B C   1 
ATOM   5015  O  O   . ASP B  2  115 ? 62.621  315.425 148.573 1.00 48.59  ? 115  ASP B O   1 
ATOM   5016  C  CB  . ASP B  2  115 ? 65.481  316.056 148.573 1.00 57.27  ? 115  ASP B CB  1 
ATOM   5017  C  CG  . ASP B  2  115 ? 66.797  316.218 149.396 1.00 226.94 ? 115  ASP B CG  1 
ATOM   5018  O  OD1 . ASP B  2  115 ? 67.746  315.433 149.125 1.00 62.19  ? 115  ASP B OD1 1 
ATOM   5019  O  OD2 . ASP B  2  115 ? 66.881  317.076 150.326 1.00 87.00  ? 115  ASP B OD2 1 
ATOM   5020  N  N   . LEU B  2  116 ? 63.010  313.507 149.638 1.00 32.99  ? 116  LEU B N   1 
ATOM   5021  C  CA  . LEU B  2  116 ? 61.625  313.283 149.993 1.00 32.39  ? 116  LEU B CA  1 
ATOM   5022  C  C   . LEU B  2  116 ? 61.405  313.680 151.462 1.00 45.52  ? 116  LEU B C   1 
ATOM   5023  O  O   . LEU B  2  116 ? 62.039  313.115 152.361 1.00 32.44  ? 116  LEU B O   1 
ATOM   5024  C  CB  . LEU B  2  116 ? 61.287  311.813 149.761 1.00 34.10  ? 116  LEU B CB  1 
ATOM   5025  C  CG  . LEU B  2  116 ? 59.987  311.300 150.370 1.00 49.37  ? 116  LEU B CG  1 
ATOM   5026  C  CD1 . LEU B  2  116 ? 58.797  312.204 150.108 1.00 58.61  ? 116  LEU B CD1 1 
ATOM   5027  C  CD2 . LEU B  2  116 ? 59.818  309.951 149.737 1.00 43.94  ? 116  LEU B CD2 1 
ATOM   5028  N  N   . SER B  2  117 ? 60.521  314.639 151.720 1.00 30.57  ? 117  SER B N   1 
ATOM   5029  C  CA  . SER B  2  117 ? 60.156  314.908 153.133 1.00 32.59  ? 117  SER B CA  1 
ATOM   5030  C  C   . SER B  2  117 ? 58.722  315.453 153.200 1.00 33.99  ? 117  SER B C   1 
ATOM   5031  O  O   . SER B  2  117 ? 58.212  315.996 152.204 1.00 30.74  ? 117  SER B O   1 
ATOM   5032  C  CB  . SER B  2  117 ? 61.159  315.896 153.768 1.00 37.76  ? 117  SER B CB  1 
ATOM   5033  O  OG  . SER B  2  117 ? 60.912  317.171 153.235 1.00 42.97  ? 117  SER B OG  1 
ATOM   5034  N  N   . PHE B  2  118 ? 58.067  315.269 154.348 1.00 31.00  ? 118  PHE B N   1 
ATOM   5035  C  CA  . PHE B  2  118 ? 56.671  315.666 154.558 1.00 34.51  ? 118  PHE B CA  1 
ATOM   5036  C  C   . PHE B  2  118 ? 56.384  315.695 156.047 1.00 32.08  ? 118  PHE B C   1 
ATOM   5037  O  O   . PHE B  2  118 ? 57.095  315.058 156.849 1.00 29.48  ? 118  PHE B O   1 
ATOM   5038  C  CB  . PHE B  2  118 ? 55.675  314.707 153.897 1.00 31.33  ? 118  PHE B CB  1 
ATOM   5039  C  CG  . PHE B  2  118 ? 55.837  313.272 154.307 1.00 32.91  ? 118  PHE B CG  1 
ATOM   5040  C  CD1 . PHE B  2  118 ? 55.143  312.745 155.433 1.00 29.91  ? 118  PHE B CD1 1 
ATOM   5041  C  CD2 . PHE B  2  118 ? 56.674  312.423 153.576 1.00 32.75  ? 118  PHE B CD2 1 
ATOM   5042  C  CE1 . PHE B  2  118 ? 55.298  311.426 155.789 1.00 38.24  ? 118  PHE B CE1 1 
ATOM   5043  C  CE2 . PHE B  2  118 ? 56.824  311.085 153.941 1.00 33.78  ? 118  PHE B CE2 1 
ATOM   5044  C  CZ  . PHE B  2  118 ? 56.118  310.596 155.054 1.00 32.43  ? 118  PHE B CZ  1 
ATOM   5045  N  N   . ASP B  2  119 ? 55.294  316.375 156.400 1.00 35.52  ? 119  ASP B N   1 
ATOM   5046  C  CA  . ASP B  2  119 ? 54.805  316.556 157.770 1.00 32.28  ? 119  ASP B CA  1 
ATOM   5047  C  C   . ASP B  2  119 ? 53.689  315.541 158.008 1.00 34.26  ? 119  ASP B C   1 
ATOM   5048  O  O   . ASP B  2  119 ? 52.935  315.207 157.088 1.00 33.51  ? 119  ASP B O   1 
ATOM   5049  C  CB  . ASP B  2  119 ? 54.273  317.980 157.968 1.00 33.43  ? 119  ASP B CB  1 
ATOM   5050  C  CG  . ASP B  2  119 ? 55.364  319.043 157.879 1.00 32.76  ? 119  ASP B CG  1 
ATOM   5051  O  OD1 . ASP B  2  119 ? 56.552  318.675 158.082 1.00 32.09  ? 119  ASP B OD1 1 
ATOM   5052  O  OD2 . ASP B  2  119 ? 55.030  320.252 157.690 1.00 39.13  ? 119  ASP B OD2 1 
ATOM   5053  N  N   . SER B  2  120 ? 53.545  315.104 159.262 1.00 32.83  ? 120  SER B N   1 
ATOM   5054  C  CA  . SER B  2  120 ? 52.567  314.076 159.640 1.00 28.18  ? 120  SER B CA  1 
ATOM   5055  C  C   . SER B  2  120 ? 51.853  314.576 160.876 1.00 33.04  ? 120  SER B C   1 
ATOM   5056  O  O   . SER B  2  120 ? 52.465  314.681 161.955 1.00 30.44  ? 120  SER B O   1 
ATOM   5057  C  CB  . SER B  2  120 ? 53.264  312.731 159.859 1.00 30.10  ? 120  SER B CB  1 
ATOM   5058  O  OG  . SER B  2  120 ? 52.337  311.727 160.168 1.00 29.25  ? 120  SER B OG  1 
ATOM   5059  N  N   . TYR B  2  121 ? 50.575  314.948 160.685 1.00 29.48  ? 121  TYR B N   1 
ATOM   5060  C  CA  . TYR B  2  121 ? 49.709  315.534 161.710 1.00 29.88  ? 121  TYR B CA  1 
ATOM   5061  C  C   . TYR B  2  121 ? 48.556  314.606 162.060 1.00 30.63  ? 121  TYR B C   1 
ATOM   5062  O  O   . TYR B  2  121 ? 48.001  313.942 161.170 1.00 31.39  ? 121  TYR B O   1 
ATOM   5063  C  CB  . TYR B  2  121 ? 49.069  316.826 161.201 1.00 34.40  ? 121  TYR B CB  1 
ATOM   5064  C  CG  . TYR B  2  121 ? 49.881  318.076 161.342 1.00 31.77  ? 121  TYR B CG  1 
ATOM   5065  C  CD1 . TYR B  2  121 ? 50.846  318.413 160.370 1.00 35.47  ? 121  TYR B CD1 1 
ATOM   5066  C  CD2 . TYR B  2  121 ? 49.725  318.912 162.498 1.00 32.27  ? 121  TYR B CD2 1 
ATOM   5067  C  CE1 . TYR B  2  121 ? 51.607  319.558 160.505 1.00 38.92  ? 121  TYR B CE1 1 
ATOM   5068  C  CE2 . TYR B  2  121 ? 50.475  320.093 162.639 1.00 26.37  ? 121  TYR B CE2 1 
ATOM   5069  C  CZ  . TYR B  2  121 ? 51.406  320.404 161.635 1.00 30.42  ? 121  TYR B CZ  1 
ATOM   5070  O  OH  . TYR B  2  121 ? 52.116  321.569 161.697 1.00 34.68  ? 121  TYR B OH  1 
ATOM   5071  N  N   . MET B  2  122 ? 48.124  314.642 163.338 1.00 28.13  ? 122  MET B N   1 
ATOM   5072  C  CA  . MET B  2  122 ? 46.949  313.921 163.789 1.00 28.67  ? 122  MET B CA  1 
ATOM   5073  C  C   . MET B  2  122 ? 45.735  314.356 162.969 1.00 32.22  ? 122  MET B C   1 
ATOM   5074  O  O   . MET B  2  122 ? 45.534  315.542 162.709 1.00 30.37  ? 122  MET B O   1 
ATOM   5075  C  CB  . MET B  2  122 ? 46.688  314.245 165.290 1.00 28.33  ? 122  MET B CB  1 
ATOM   5076  C  CG  . MET B  2  122 ? 45.653  313.304 165.892 1.00 28.44  ? 122  MET B CG  1 
ATOM   5077  S  SD  . MET B  2  122 ? 45.311  313.685 167.616 1.00 30.69  ? 122  MET B SD  1 
ATOM   5078  C  CE  . MET B  2  122 ? 44.182  315.111 167.380 1.00 31.08  ? 122  MET B CE  1 
ATOM   5079  N  N   . ILE B  2  123 ? 44.876  313.411 162.602 1.00 29.65  ? 123  ILE B N   1 
ATOM   5080  C  CA  . ILE B  2  123 ? 43.566  313.767 162.050 1.00 32.21  ? 123  ILE B CA  1 
ATOM   5081  C  C   . ILE B  2  123 ? 42.699  314.282 163.194 1.00 33.80  ? 123  ILE B C   1 
ATOM   5082  O  O   . ILE B  2  123 ? 42.461  313.538 164.155 1.00 29.89  ? 123  ILE B O   1 
ATOM   5083  C  CB  . ILE B  2  123 ? 42.870  312.572 161.368 1.00 34.22  ? 123  ILE B CB  1 
ATOM   5084  C  CG1 . ILE B  2  123 ? 43.717  312.049 160.164 1.00 32.73  ? 123  ILE B CG1 1 
ATOM   5085  C  CG2 . ILE B  2  123 ? 41.471  312.979 160.916 1.00 31.34  ? 123  ILE B CG2 1 
ATOM   5086  C  CD1 . ILE B  2  123 ? 43.868  313.045 158.988 1.00 35.91  ? 123  ILE B CD1 1 
ATOM   5087  N  N   . PRO B  2  124 ? 42.195  315.516 163.141 1.00 35.66  ? 124  PRO B N   1 
ATOM   5088  C  CA  . PRO B  2  124 ? 41.289  315.977 164.210 1.00 37.64  ? 124  PRO B CA  1 
ATOM   5089  C  C   . PRO B  2  124 ? 40.026  315.115 164.266 1.00 33.37  ? 124  PRO B C   1 
ATOM   5090  O  O   . PRO B  2  124 ? 39.539  314.592 163.258 1.00 35.27  ? 124  PRO B O   1 
ATOM   5091  C  CB  . PRO B  2  124 ? 40.981  317.433 163.809 1.00 41.33  ? 124  PRO B CB  1 
ATOM   5092  C  CG  . PRO B  2  124 ? 42.133  317.785 162.732 1.00 37.90  ? 124  PRO B CG  1 
ATOM   5093  C  CD  . PRO B  2  124 ? 42.369  316.510 162.065 1.00 35.68  ? 124  PRO B CD  1 
ATOM   5094  N  N   . THR B  2  125 ? 39.479  314.984 165.477 1.00 30.41  ? 125  THR B N   1 
ATOM   5095  C  CA  . THR B  2  125 ? 38.359  314.057 165.675 1.00 28.05  ? 125  THR B CA  1 
ATOM   5096  C  C   . THR B  2  125 ? 37.194  314.379 164.766 1.00 37.94  ? 125  THR B C   1 
ATOM   5097  O  O   . THR B  2  125 ? 36.479  313.485 164.281 1.00 36.75  ? 125  THR B O   1 
ATOM   5098  C  CB  . THR B  2  125 ? 37.936  314.141 167.157 1.00 30.00  ? 125  THR B CB  1 
ATOM   5099  O  OG1 . THR B  2  125 ? 39.056  313.734 167.931 1.00 35.23  ? 125  THR B OG1 1 
ATOM   5100  C  CG2 . THR B  2  125 ? 36.727  313.212 167.515 1.00 28.88  ? 125  THR B CG2 1 
ATOM   5101  N  N   . SER B  2  126 ? 36.955  315.655 164.565 1.00 32.95  ? 126  SER B N   1 
ATOM   5102  C  CA  . SER B  2  126 ? 35.795  316.051 163.759 1.00 51.10  ? 126  SER B CA  1 
ATOM   5103  C  C   . SER B  2  126 ? 35.988  315.757 162.270 1.00 49.54  ? 126  SER B C   1 
ATOM   5104  O  O   . SER B  2  126 ? 35.036  315.886 161.495 1.00 44.32  ? 126  SER B O   1 
ATOM   5105  C  CB  . SER B  2  126 ? 35.512  317.545 163.967 1.00 37.96  ? 126  SER B CB  1 
ATOM   5106  O  OG  . SER B  2  126 ? 36.579  318.304 163.360 1.00 48.41  ? 126  SER B OG  1 
ATOM   5107  N  N   . GLU B  2  127 ? 37.194  315.356 161.850 1.00 35.89  ? 127  GLU B N   1 
ATOM   5108  C  CA  . GLU B  2  127 ? 37.469  315.071 160.455 1.00 43.07  ? 127  GLU B CA  1 
ATOM   5109  C  C   . GLU B  2  127 ? 37.733  313.600 160.211 1.00 36.21  ? 127  GLU B C   1 
ATOM   5110  O  O   . GLU B  2  127 ? 38.075  313.241 159.080 1.00 38.94  ? 127  GLU B O   1 
ATOM   5111  C  CB  . GLU B  2  127 ? 38.673  315.904 160.005 1.00 37.62  ? 127  GLU B CB  1 
ATOM   5112  C  CG  . GLU B  2  127 ? 38.392  317.379 160.181 1.00 52.55  ? 127  GLU B CG  1 
ATOM   5113  C  CD  . GLU B  2  127 ? 39.557  318.239 159.732 1.00 47.26  ? 127  GLU B CD  1 
ATOM   5114  O  OE1 . GLU B  2  127 ? 39.574  319.444 160.054 1.00 68.92  ? 127  GLU B OE1 1 
ATOM   5115  O  OE2 . GLU B  2  127 ? 40.468  317.685 159.066 1.00 61.84  ? 127  GLU B OE2 1 
ATOM   5116  N  N   . LEU B  2  128 ? 37.664  312.750 161.254 1.00 33.63  ? 128  LEU B N   1 
ATOM   5117  C  CA  . LEU B  2  128 ? 37.852  311.317 161.041 1.00 36.35  ? 128  LEU B CA  1 
ATOM   5118  C  C   . LEU B  2  128 ? 36.885  310.787 159.989 1.00 41.58  ? 128  LEU B C   1 
ATOM   5119  O  O   . LEU B  2  128 ? 35.694  311.084 160.018 1.00 38.41  ? 128  LEU B O   1 
ATOM   5120  C  CB  . LEU B  2  128 ? 37.618  310.543 162.321 1.00 32.00  ? 128  LEU B CB  1 
ATOM   5121  C  CG  . LEU B  2  128 ? 38.666  310.867 163.429 1.00 31.83  ? 128  LEU B CG  1 
ATOM   5122  C  CD1 . LEU B  2  128 ? 38.126  310.411 164.839 1.00 31.52  ? 128  LEU B CD1 1 
ATOM   5123  C  CD2 . LEU B  2  128 ? 40.069  310.288 163.112 1.00 31.35  ? 128  LEU B CD2 1 
ATOM   5124  N  N   . LYS B  2  129 ? 37.382  309.963 159.130 1.00 36.63  ? 129  LYS B N   1 
ATOM   5125  C  CA  . LYS B  2  129 ? 36.502  309.225 158.227 1.00 34.53  ? 129  LYS B CA  1 
ATOM   5126  C  C   . LYS B  2  129 ? 35.946  308.022 158.985 1.00 49.98  ? 129  LYS B C   1 
ATOM   5127  O  O   . LYS B  2  129 ? 36.563  307.569 159.949 1.00 37.65  ? 129  LYS B O   1 
ATOM   5128  C  CB  . LYS B  2  129 ? 37.263  308.773 156.983 1.00 34.26  ? 129  LYS B CB  1 
ATOM   5129  C  CG  . LYS B  2  129 ? 37.949  309.925 156.179 1.00 45.12  ? 129  LYS B CG  1 
ATOM   5130  C  CD  . LYS B  2  129 ? 37.072  310.663 155.170 1.00 191.39 ? 129  LYS B CD  1 
ATOM   5131  C  CE  . LYS B  2  129 ? 37.926  311.502 154.190 1.00 75.02  ? 129  LYS B CE  1 
ATOM   5132  N  NZ  . LYS B  2  129 ? 38.586  312.748 154.781 1.00 59.32  ? 129  LYS B NZ  1 
ATOM   5133  N  N   . PRO B  2  130 ? 34.781  307.504 158.588 1.00 44.45  ? 130  PRO B N   1 
ATOM   5134  C  CA  . PRO B  2  130 ? 34.099  306.474 159.397 1.00 42.12  ? 130  PRO B CA  1 
ATOM   5135  C  C   . PRO B  2  130 ? 34.978  305.260 159.610 1.00 47.92  ? 130  PRO B C   1 
ATOM   5136  O  O   . PRO B  2  130 ? 35.590  304.781 158.677 1.00 37.31  ? 130  PRO B O   1 
ATOM   5137  C  CB  . PRO B  2  130 ? 32.865  306.131 158.556 1.00 54.88  ? 130  PRO B CB  1 
ATOM   5138  C  CG  . PRO B  2  130 ? 32.566  307.405 157.854 1.00 85.99  ? 130  PRO B CG  1 
ATOM   5139  C  CD  . PRO B  2  130 ? 33.899  308.015 157.506 1.00 49.59  ? 130  PRO B CD  1 
ATOM   5140  N  N   . GLY B  2  131 ? 35.084  304.807 160.871 1.00 46.33  ? 131  GLY B N   1 
ATOM   5141  C  CA  . GLY B  2  131 ? 35.903  303.673 161.231 1.00 43.87  ? 131  GLY B CA  1 
ATOM   5142  C  C   . GLY B  2  131 ? 37.355  304.008 161.535 1.00 42.21  ? 131  GLY B C   1 
ATOM   5143  O  O   . GLY B  2  131 ? 38.124  303.108 161.845 1.00 42.25  ? 131  GLY B O   1 
ATOM   5144  N  N   . GLU B  2  132 ? 37.779  305.249 161.361 1.00 31.16  ? 132  GLU B N   1 
ATOM   5145  C  CA  . GLU B  2  132 ? 39.138  305.634 161.713 1.00 29.83  ? 132  GLU B CA  1 
ATOM   5146  C  C   . GLU B  2  132 ? 39.197  305.884 163.218 1.00 30.80  ? 132  GLU B C   1 
ATOM   5147  O  O   . GLU B  2  132 ? 38.162  306.108 163.861 1.00 32.18  ? 132  GLU B O   1 
ATOM   5148  C  CB  . GLU B  2  132 ? 39.556  306.888 160.963 1.00 30.67  ? 132  GLU B CB  1 
ATOM   5149  C  CG  . GLU B  2  132 ? 39.903  306.648 159.516 1.00 40.44  ? 132  GLU B CG  1 
ATOM   5150  C  CD  . GLU B  2  132 ? 40.524  307.869 158.826 1.00 65.42  ? 132  GLU B CD  1 
ATOM   5151  O  OE1 . GLU B  2  132 ? 41.301  307.639 157.894 1.00 57.98  ? 132  GLU B OE1 1 
ATOM   5152  O  OE2 . GLU B  2  132 ? 40.244  309.051 159.186 1.00 37.03  ? 132  GLU B OE2 1 
ATOM   5153  N  N   . LEU B  2  133 ? 40.414  305.876 163.757 1.00 35.18  ? 133  LEU B N   1 
ATOM   5154  C  CA  . LEU B  2  133 ? 40.675  305.830 165.194 1.00 34.87  ? 133  LEU B CA  1 
ATOM   5155  C  C   . LEU B  2  133 ? 40.974  307.218 165.772 1.00 33.02  ? 133  LEU B C   1 
ATOM   5156  O  O   . LEU B  2  133 ? 41.947  307.868 165.377 1.00 31.19  ? 133  LEU B O   1 
ATOM   5157  C  CB  . LEU B  2  133 ? 41.865  304.888 165.429 1.00 26.69  ? 133  LEU B CB  1 
ATOM   5158  C  CG  . LEU B  2  133 ? 41.522  303.452 164.979 1.00 38.65  ? 133  LEU B CG  1 
ATOM   5159  C  CD1 . LEU B  2  133 ? 42.793  302.770 164.696 1.00 49.20  ? 133  LEU B CD1 1 
ATOM   5160  C  CD2 . LEU B  2  133 ? 40.695  302.772 166.149 1.00 40.78  ? 133  LEU B CD2 1 
ATOM   5161  N  N   . ARG B  2  134 ? 40.151  307.639 166.726 1.00 30.97  ? 134  ARG B N   1 
ATOM   5162  C  CA  . ARG B  2  134 ? 40.364  308.907 167.433 1.00 31.98  ? 134  ARG B CA  1 
ATOM   5163  C  C   . ARG B  2  134 ? 41.771  308.948 168.054 1.00 33.43  ? 134  ARG B C   1 
ATOM   5164  O  O   . ARG B  2  134 ? 42.233  307.963 168.658 1.00 28.08  ? 134  ARG B O   1 
ATOM   5165  C  CB  . ARG B  2  134 ? 39.282  309.048 168.520 1.00 27.54  ? 134  ARG B CB  1 
ATOM   5166  C  CG  . ARG B  2  134 ? 39.003  310.497 169.011 1.00 28.04  ? 134  ARG B CG  1 
ATOM   5167  C  CD  . ARG B  2  134 ? 37.858  310.501 170.072 1.00 28.03  ? 134  ARG B CD  1 
ATOM   5168  N  NE  . ARG B  2  134 ? 38.333  309.819 171.267 1.00 30.12  ? 134  ARG B NE  1 
ATOM   5169  C  CZ  . ARG B  2  134 ? 38.928  310.451 172.283 1.00 37.44  ? 134  ARG B CZ  1 
ATOM   5170  N  NH1 . ARG B  2  134 ? 39.089  311.781 172.290 1.00 27.39  ? 134  ARG B NH1 1 
ATOM   5171  N  NH2 . ARG B  2  134 ? 39.347  309.740 173.313 1.00 31.54  ? 134  ARG B NH2 1 
ATOM   5172  N  N   . LEU B  2  135 ? 42.465  310.061 167.826 1.00 27.10  ? 135  LEU B N   1 
ATOM   5173  C  CA  . LEU B  2  135 ? 43.770  310.469 168.327 1.00 30.14  ? 135  LEU B CA  1 
ATOM   5174  C  C   . LEU B  2  135 ? 44.916  309.666 167.729 1.00 29.16  ? 135  LEU B C   1 
ATOM   5175  O  O   . LEU B  2  135 ? 46.085  309.917 168.098 1.00 28.22  ? 135  LEU B O   1 
ATOM   5176  C  CB  . LEU B  2  135 ? 43.869  310.371 169.897 1.00 29.23  ? 135  LEU B CB  1 
ATOM   5177  C  CG  . LEU B  2  135 ? 42.703  311.040 170.652 1.00 30.69  ? 135  LEU B CG  1 
ATOM   5178  C  CD1 . LEU B  2  135 ? 42.991  311.040 172.271 1.00 24.87  ? 135  LEU B CD1 1 
ATOM   5179  C  CD2 . LEU B  2  135 ? 42.340  312.480 170.096 1.00 29.42  ? 135  LEU B CD2 1 
ATOM   5180  N  N   . LEU B  2  136 ? 44.642  308.704 166.842 1.00 29.44  ? 136  LEU B N   1 
ATOM   5181  C  CA  . LEU B  2  136 ? 45.695  307.830 166.305 1.00 29.86  ? 136  LEU B CA  1 
ATOM   5182  C  C   . LEU B  2  136 ? 45.992  308.044 164.819 1.00 29.26  ? 136  LEU B C   1 
ATOM   5183  O  O   . LEU B  2  136 ? 47.142  307.844 164.407 1.00 28.09  ? 136  LEU B O   1 
ATOM   5184  C  CB  . LEU B  2  136 ? 45.329  306.363 166.506 1.00 26.45  ? 136  LEU B CB  1 
ATOM   5185  C  CG  . LEU B  2  136 ? 45.465  305.922 168.014 1.00 29.30  ? 136  LEU B CG  1 
ATOM   5186  C  CD1 . LEU B  2  136 ? 44.964  304.519 168.062 1.00 30.07  ? 136  LEU B CD1 1 
ATOM   5187  C  CD2 . LEU B  2  136 ? 46.898  306.048 168.553 1.00 27.98  ? 136  LEU B CD2 1 
ATOM   5188  N  N   . GLU B  2  137 ? 45.006  308.417 164.016 1.00 29.96  ? 137  GLU B N   1 
ATOM   5189  C  CA  . GLU B  2  137 ? 45.270  308.558 162.580 1.00 27.55  ? 137  GLU B CA  1 
ATOM   5190  C  C   . GLU B  2  137 ? 46.059  309.828 162.304 1.00 32.98  ? 137  GLU B C   1 
ATOM   5191  O  O   . GLU B  2  137 ? 45.894  310.852 163.002 1.00 29.68  ? 137  GLU B O   1 
ATOM   5192  C  CB  . GLU B  2  137 ? 43.951  308.630 161.774 1.00 31.55  ? 137  GLU B CB  1 
ATOM   5193  C  CG  . GLU B  2  137 ? 42.920  307.567 162.085 1.00 33.64  ? 137  GLU B CG  1 
ATOM   5194  C  CD  . GLU B  2  137 ? 43.348  306.151 161.687 1.00 34.65  ? 137  GLU B CD  1 
ATOM   5195  O  OE1 . GLU B  2  137 ? 42.649  305.202 162.040 1.00 35.57  ? 137  GLU B OE1 1 
ATOM   5196  O  OE2 . GLU B  2  137 ? 44.394  305.944 161.051 1.00 32.54  ? 137  GLU B OE2 1 
ATOM   5197  N  N   . VAL B  2  138 ? 46.879  309.778 161.240 1.00 28.98  ? 138  VAL B N   1 
ATOM   5198  C  CA  . VAL B  2  138 ? 47.565  310.969 160.739 1.00 29.06  ? 138  VAL B CA  1 
ATOM   5199  C  C   . VAL B  2  138 ? 47.150  311.222 159.275 1.00 28.62  ? 138  VAL B C   1 
ATOM   5200  O  O   . VAL B  2  138 ? 46.642  310.344 158.577 1.00 29.14  ? 138  VAL B O   1 
ATOM   5201  C  CB  . VAL B  2  138 ? 49.106  310.862 160.830 1.00 33.25  ? 138  VAL B CB  1 
ATOM   5202  C  CG1 . VAL B  2  138 ? 49.534  310.641 162.335 1.00 26.16  ? 138  VAL B CG1 1 
ATOM   5203  C  CG2 . VAL B  2  138 ? 49.605  309.751 160.017 1.00 26.31  ? 138  VAL B CG2 1 
ATOM   5204  N  N   . ASP B  2  139 ? 47.384  312.442 158.797 1.00 29.40  ? 139  ASP B N   1 
ATOM   5205  C  CA  . ASP B  2  139 ? 47.161  312.714 157.351 1.00 31.61  ? 139  ASP B CA  1 
ATOM   5206  C  C   . ASP B  2  139 ? 48.147  311.963 156.435 1.00 34.69  ? 139  ASP B C   1 
ATOM   5207  O  O   . ASP B  2  139 ? 47.727  311.439 155.392 1.00 34.04  ? 139  ASP B O   1 
ATOM   5208  C  CB  . ASP B  2  139 ? 47.169  314.228 157.064 1.00 28.99  ? 139  ASP B CB  1 
ATOM   5209  C  CG  . ASP B  2  139 ? 48.437  314.939 157.562 1.00 35.72  ? 139  ASP B CG  1 
ATOM   5210  O  OD1 . ASP B  2  139 ? 49.405  314.299 158.073 1.00 33.82  ? 139  ASP B OD1 1 
ATOM   5211  O  OD2 . ASP B  2  139 ? 48.484  316.182 157.412 1.00 39.16  ? 139  ASP B OD2 1 
ATOM   5212  N  N   . ASN B  2  140 ? 49.480  311.967 156.753 1.00 30.41  ? 140  ASN B N   1 
ATOM   5213  C  CA  . ASN B  2  140 ? 50.526  311.364 155.917 1.00 38.75  ? 140  ASN B CA  1 
ATOM   5214  C  C   . ASN B  2  140 ? 51.240  310.302 156.731 1.00 29.93  ? 140  ASN B C   1 
ATOM   5215  O  O   . ASN B  2  140 ? 52.014  310.638 157.647 1.00 30.56  ? 140  ASN B O   1 
ATOM   5216  C  CB  . ASN B  2  140 ? 51.535  312.427 155.407 1.00 27.41  ? 140  ASN B CB  1 
ATOM   5217  C  CG  . ASN B  2  140 ? 50.806  313.540 154.673 1.00 45.69  ? 140  ASN B CG  1 
ATOM   5218  O  OD1 . ASN B  2  140 ? 49.867  313.250 153.986 1.00 40.95  ? 140  ASN B OD1 1 
ATOM   5219  N  ND2 . ASN B  2  140 ? 51.195  314.780 154.864 1.00 32.94  ? 140  ASN B ND2 1 
ATOM   5220  N  N   . ARG B  2  141 ? 51.021  309.027 156.377 1.00 29.89  ? 141  ARG B N   1 
ATOM   5221  C  CA  . ARG B  2  141 ? 51.631  307.907 157.069 1.00 35.28  ? 141  ARG B CA  1 
ATOM   5222  C  C   . ARG B  2  141 ? 53.091  307.726 156.649 1.00 34.13  ? 141  ARG B C   1 
ATOM   5223  O  O   . ARG B  2  141 ? 53.532  308.226 155.622 1.00 31.18  ? 141  ARG B O   1 
ATOM   5224  C  CB  . ARG B  2  141 ? 50.846  306.620 156.824 1.00 35.36  ? 141  ARG B CB  1 
ATOM   5225  C  CG  . ARG B  2  141 ? 49.378  306.696 157.271 1.00 33.05  ? 141  ARG B CG  1 
ATOM   5226  C  CD  . ARG B  2  141 ? 48.620  305.407 156.983 1.00 32.96  ? 141  ARG B CD  1 
ATOM   5227  N  NE  . ARG B  2  141 ? 47.186  305.563 157.239 1.00 34.90  ? 141  ARG B NE  1 
ATOM   5228  C  CZ  . ARG B  2  141 ? 46.217  304.877 156.653 1.00 40.53  ? 141  ARG B CZ  1 
ATOM   5229  N  NH1 . ARG B  2  141 ? 46.536  303.935 155.799 1.00 33.36  ? 141  ARG B NH1 1 
ATOM   5230  N  NH2 . ARG B  2  141 ? 44.933  305.126 156.982 1.00 35.18  ? 141  ARG B NH2 1 
ATOM   5231  N  N   . VAL B  2  142 ? 53.843  307.038 157.506 1.00 28.95  ? 142  VAL B N   1 
ATOM   5232  C  CA  . VAL B  2  142 ? 55.257  306.702 157.282 1.00 33.44  ? 142  VAL B CA  1 
ATOM   5233  C  C   . VAL B  2  142 ? 55.241  305.389 156.512 1.00 32.22  ? 142  VAL B C   1 
ATOM   5234  O  O   . VAL B  2  142 ? 55.213  304.301 157.105 1.00 29.58  ? 142  VAL B O   1 
ATOM   5235  C  CB  . VAL B  2  142 ? 56.002  306.569 158.611 1.00 35.41  ? 142  VAL B CB  1 
ATOM   5236  C  CG1 . VAL B  2  142 ? 57.498  306.360 158.368 1.00 27.84  ? 142  VAL B CG1 1 
ATOM   5237  C  CG2 . VAL B  2  142 ? 55.702  307.777 159.451 1.00 29.99  ? 142  VAL B CG2 1 
ATOM   5238  N  N   . VAL B  2  143 ? 55.174  305.470 155.191 1.00 30.11  ? 143  VAL B N   1 
ATOM   5239  C  CA  . VAL B  2  143 ? 55.153  304.250 154.380 1.00 30.20  ? 143  VAL B CA  1 
ATOM   5240  C  C   . VAL B  2  143 ? 56.560  303.625 154.380 1.00 28.41  ? 143  VAL B C   1 
ATOM   5241  O  O   . VAL B  2  143 ? 57.557  304.318 154.224 1.00 27.40  ? 143  VAL B O   1 
ATOM   5242  C  CB  . VAL B  2  143 ? 54.684  304.620 152.951 1.00 35.62  ? 143  VAL B CB  1 
ATOM   5243  C  CG1 . VAL B  2  143 ? 54.618  303.390 152.060 1.00 32.98  ? 143  VAL B CG1 1 
ATOM   5244  C  CG2 . VAL B  2  143 ? 53.306  305.258 153.031 1.00 33.55  ? 143  VAL B CG2 1 
ATOM   5245  N  N   . LEU B  2  144 ? 56.656  302.314 154.537 1.00 32.07  ? 144  LEU B N   1 
ATOM   5246  C  CA  . LEU B  2  144 ? 57.946  301.672 154.715 1.00 28.79  ? 144  LEU B CA  1 
ATOM   5247  C  C   . LEU B  2  144 ? 57.857  300.305 154.068 1.00 29.73  ? 144  LEU B C   1 
ATOM   5248  O  O   . LEU B  2  144 ? 56.770  299.705 154.038 1.00 32.74  ? 144  LEU B O   1 
ATOM   5249  C  CB  . LEU B  2  144 ? 58.302  301.478 156.220 1.00 27.43  ? 144  LEU B CB  1 
ATOM   5250  C  CG  . LEU B  2  144 ? 58.532  302.758 157.011 1.00 28.27  ? 144  LEU B CG  1 
ATOM   5251  C  CD1 . LEU B  2  144 ? 58.631  302.356 158.563 1.00 29.62  ? 144  LEU B CD1 1 
ATOM   5252  C  CD2 . LEU B  2  144 ? 59.858  303.449 156.504 1.00 28.26  ? 144  LEU B CD2 1 
ATOM   5253  N  N   . PRO B  2  145 ? 58.955  299.794 153.517 1.00 33.26  ? 145  PRO B N   1 
ATOM   5254  C  CA  . PRO B  2  145 ? 58.922  298.438 152.922 1.00 36.74  ? 145  PRO B CA  1 
ATOM   5255  C  C   . PRO B  2  145 ? 58.922  297.396 154.039 1.00 35.30  ? 145  PRO B C   1 
ATOM   5256  O  O   . PRO B  2  145 ? 59.665  297.519 155.014 1.00 34.45  ? 145  PRO B O   1 
ATOM   5257  C  CB  . PRO B  2  145 ? 60.202  298.379 152.066 1.00 34.21  ? 145  PRO B CB  1 
ATOM   5258  C  CG  . PRO B  2  145 ? 61.188  299.406 152.825 1.00 36.69  ? 145  PRO B CG  1 
ATOM   5259  C  CD  . PRO B  2  145 ? 60.248  300.495 153.343 1.00 32.62  ? 145  PRO B CD  1 
ATOM   5260  N  N   . MET B  2  146 ? 58.039  296.398 153.928 1.00 41.28  ? 146  MET B N   1 
ATOM   5261  C  CA  . MET B  2  146 ? 57.954  295.347 154.930 1.00 39.14  ? 146  MET B CA  1 
ATOM   5262  C  C   . MET B  2  146 ? 59.076  294.329 154.712 1.00 45.02  ? 146  MET B C   1 
ATOM   5263  O  O   . MET B  2  146 ? 59.694  294.266 153.652 1.00 37.72  ? 146  MET B O   1 
ATOM   5264  C  CB  . MET B  2  146 ? 56.584  294.664 154.861 1.00 34.50  ? 146  MET B CB  1 
ATOM   5265  C  CG  . MET B  2  146 ? 56.463  293.915 153.449 1.00 39.92  ? 146  MET B CG  1 
ATOM   5266  S  SD  . MET B  2  146 ? 54.808  293.156 153.160 1.00 45.85  ? 146  MET B SD  1 
ATOM   5267  C  CE  . MET B  2  146 ? 55.233  291.778 152.126 1.00 47.87  ? 146  MET B CE  1 
ATOM   5268  N  N   . GLU B  2  147 ? 59.337  293.529 155.748 1.00 40.32  ? 147  GLU B N   1 
ATOM   5269  C  CA  . GLU B  2  147 ? 60.379  292.488 155.737 1.00 42.77  ? 147  GLU B CA  1 
ATOM   5270  C  C   . GLU B  2  147 ? 61.765  293.030 155.389 1.00 39.86  ? 147  GLU B C   1 
ATOM   5271  O  O   . GLU B  2  147 ? 62.581  292.319 154.805 1.00 43.12  ? 147  GLU B O   1 
ATOM   5272  C  CB  . GLU B  2  147 ? 60.011  291.344 154.775 1.00 35.14  ? 147  GLU B CB  1 
ATOM   5273  C  CG  . GLU B  2  147 ? 58.690  290.673 155.263 1.00 40.03  ? 147  GLU B CG  1 
ATOM   5274  C  CD  . GLU B  2  147 ? 58.099  289.806 154.156 1.00 53.47  ? 147  GLU B CD  1 
ATOM   5275  O  OE1 . GLU B  2  147 ? 57.711  288.646 154.384 1.00 43.22  ? 147  GLU B OE1 1 
ATOM   5276  O  OE2 . GLU B  2  147 ? 58.040  290.300 153.034 1.00 55.42  ? 147  GLU B OE2 1 
ATOM   5277  N  N   . MET B  2  148 ? 62.069  294.271 155.753 1.00 36.37  ? 148  MET B N   1 
ATOM   5278  C  CA  . MET B  2  148 ? 63.375  294.860 155.470 1.00 41.77  ? 148  MET B CA  1 
ATOM   5279  C  C   . MET B  2  148 ? 63.916  295.596 156.694 1.00 38.75  ? 148  MET B C   1 
ATOM   5280  O  O   . MET B  2  148 ? 63.169  296.237 157.446 1.00 36.36  ? 148  MET B O   1 
ATOM   5281  C  CB  . MET B  2  148 ? 63.317  295.838 154.324 1.00 35.29  ? 148  MET B CB  1 
ATOM   5282  C  CG  . MET B  2  148 ? 62.780  295.189 153.067 1.00 116.29 ? 148  MET B CG  1 
ATOM   5283  S  SD  . MET B  2  148 ? 63.221  296.094 151.603 1.00 64.35  ? 148  MET B SD  1 
ATOM   5284  C  CE  . MET B  2  148 ? 64.958  295.626 151.412 1.00 42.51  ? 148  MET B CE  1 
ATOM   5285  N  N   . THR B  2  149 ? 65.224  295.538 156.847 1.00 40.81  ? 149  THR B N   1 
ATOM   5286  C  CA  . THR B  2  149 ? 65.885  296.215 157.955 1.00 42.45  ? 149  THR B CA  1 
ATOM   5287  C  C   . THR B  2  149 ? 66.005  297.696 157.648 1.00 42.75  ? 149  THR B C   1 
ATOM   5288  O  O   . THR B  2  149 ? 66.690  298.083 156.709 1.00 35.98  ? 149  THR B O   1 
ATOM   5289  C  CB  . THR B  2  149 ? 67.246  295.581 158.226 1.00 39.39  ? 149  THR B CB  1 
ATOM   5290  O  OG1 . THR B  2  149 ? 66.988  294.243 158.627 1.00 38.93  ? 149  THR B OG1 1 
ATOM   5291  C  CG2 . THR B  2  149 ? 67.981  296.324 159.446 1.00 35.91  ? 149  THR B CG2 1 
ATOM   5292  N  N   . ILE B  2  150 ? 65.363  298.524 158.460 1.00 32.49  ? 150  ILE B N   1 
ATOM   5293  C  CA  . ILE B  2  150 ? 65.386  299.967 158.268 1.00 29.78  ? 150  ILE B CA  1 
ATOM   5294  C  C   . ILE B  2  150 ? 66.095  300.637 159.431 1.00 35.07  ? 150  ILE B C   1 
ATOM   5295  O  O   . ILE B  2  150 ? 65.808  300.330 160.591 1.00 34.07  ? 150  ILE B O   1 
ATOM   5296  C  CB  . ILE B  2  150 ? 63.934  300.455 158.133 1.00 31.71  ? 150  ILE B CB  1 
ATOM   5297  C  CG1 . ILE B  2  150 ? 63.326  299.718 156.910 1.00 28.72  ? 150  ILE B CG1 1 
ATOM   5298  C  CG2 . ILE B  2  150 ? 63.879  301.988 158.083 1.00 31.19  ? 150  ILE B CG2 1 
ATOM   5299  C  CD1 . ILE B  2  150 ? 61.756  299.691 156.984 1.00 35.66  ? 150  ILE B CD1 1 
ATOM   5300  N  N   . ARG B  2  151 ? 66.965  301.599 159.130 1.00 32.20  ? 151  ARG B N   1 
ATOM   5301  C  CA  . ARG B  2  151 ? 67.549  302.486 160.125 1.00 34.31  ? 151  ARG B CA  1 
ATOM   5302  C  C   . ARG B  2  151 ? 66.640  303.703 160.288 1.00 31.31  ? 151  ARG B C   1 
ATOM   5303  O  O   . ARG B  2  151 ? 66.460  304.449 159.341 1.00 37.54  ? 151  ARG B O   1 
ATOM   5304  C  CB  . ARG B  2  151 ? 68.963  302.925 159.692 1.00 28.57  ? 151  ARG B CB  1 
ATOM   5305  C  CG  . ARG B  2  151 ? 69.616  303.933 160.664 1.00 32.01  ? 151  ARG B CG  1 
ATOM   5306  C  CD  . ARG B  2  151 ? 70.879  304.484 160.056 1.00 34.75  ? 151  ARG B CD  1 
ATOM   5307  N  NE  . ARG B  2  151 ? 71.904  303.451 159.958 1.00 29.70  ? 151  ARG B NE  1 
ATOM   5308  C  CZ  . ARG B  2  151 ? 72.581  303.240 158.822 1.00 33.13  ? 151  ARG B CZ  1 
ATOM   5309  N  NH1 . ARG B  2  151 ? 72.235  303.887 157.721 1.00 33.85  ? 151  ARG B NH1 1 
ATOM   5310  N  NH2 . ARG B  2  151 ? 73.552  302.336 158.807 1.00 33.10  ? 151  ARG B NH2 1 
ATOM   5311  N  N   . MET B  2  152 ? 66.104  303.931 161.508 1.00 27.08  ? 152  MET B N   1 
ATOM   5312  C  CA  . MET B  2  152 ? 65.392  305.178 161.809 1.00 31.06  ? 152  MET B CA  1 
ATOM   5313  C  C   . MET B  2  152 ? 66.325  306.088 162.576 1.00 36.96  ? 152  MET B C   1 
ATOM   5314  O  O   . MET B  2  152 ? 66.936  305.653 163.562 1.00 38.01  ? 152  MET B O   1 
ATOM   5315  C  CB  . MET B  2  152 ? 64.150  304.967 162.705 1.00 30.99  ? 152  MET B CB  1 
ATOM   5316  C  CG  . MET B  2  152 ? 63.123  304.147 162.152 1.00 46.03  ? 152  MET B CG  1 
ATOM   5317  S  SD  . MET B  2  152 ? 62.327  304.924 160.700 1.00 42.73  ? 152  MET B SD  1 
ATOM   5318  C  CE  . MET B  2  152 ? 62.115  306.708 161.179 1.00 26.50  ? 152  MET B CE  1 
ATOM   5319  N  N   . LEU B  2  153 ? 66.450  307.329 162.140 1.00 28.78  ? 153  LEU B N   1 
ATOM   5320  C  CA  . LEU B  2  153 ? 67.207  308.327 162.903 1.00 28.02  ? 153  LEU B CA  1 
ATOM   5321  C  C   . LEU B  2  153 ? 66.206  309.335 163.438 1.00 32.61  ? 153  LEU B C   1 
ATOM   5322  O  O   . LEU B  2  153 ? 65.313  309.764 162.699 1.00 31.88  ? 153  LEU B O   1 
ATOM   5323  C  CB  . LEU B  2  153 ? 68.252  309.050 162.008 1.00 30.86  ? 153  LEU B CB  1 
ATOM   5324  C  CG  . LEU B  2  153 ? 69.295  308.075 161.451 1.00 29.18  ? 153  LEU B CG  1 
ATOM   5325  C  CD1 . LEU B  2  153 ? 70.129  308.823 160.433 1.00 27.67  ? 153  LEU B CD1 1 
ATOM   5326  C  CD2 . LEU B  2  153 ? 70.189  307.492 162.582 1.00 25.64  ? 153  LEU B CD2 1 
ATOM   5327  N  N   . VAL B  2  154 ? 66.350  309.720 164.709 1.00 31.58  ? 154  VAL B N   1 
ATOM   5328  C  CA  . VAL B  2  154 ? 65.321  310.483 165.417 1.00 23.72  ? 154  VAL B CA  1 
ATOM   5329  C  C   . VAL B  2  154 ? 65.975  311.712 166.001 1.00 33.05  ? 154  VAL B C   1 
ATOM   5330  O  O   . VAL B  2  154 ? 66.977  311.605 166.731 1.00 27.18  ? 154  VAL B O   1 
ATOM   5331  C  CB  . VAL B  2  154 ? 64.694  309.645 166.550 1.00 24.95  ? 154  VAL B CB  1 
ATOM   5332  C  CG1 . VAL B  2  154 ? 63.568  310.431 167.291 1.00 24.27  ? 154  VAL B CG1 1 
ATOM   5333  C  CG2 . VAL B  2  154 ? 64.114  308.325 165.997 1.00 26.20  ? 154  VAL B CG2 1 
ATOM   5334  N  N   . SER B  2  155 ? 65.407  312.878 165.722 1.00 25.00  ? 155  SER B N   1 
ATOM   5335  C  CA  . SER B  2  155 ? 65.855  314.095 166.405 1.00 29.24  ? 155  SER B CA  1 
ATOM   5336  C  C   . SER B  2  155 ? 64.653  315.014 166.589 1.00 29.45  ? 155  SER B C   1 
ATOM   5337  O  O   . SER B  2  155 ? 63.505  314.645 166.318 1.00 27.10  ? 155  SER B O   1 
ATOM   5338  C  CB  . SER B  2  155 ? 67.008  314.747 165.596 1.00 25.77  ? 155  SER B CB  1 
ATOM   5339  O  OG  . SER B  2  155 ? 67.562  315.873 166.297 1.00 28.96  ? 155  SER B OG  1 
ATOM   5340  N  N   . SER B  2  156 ? 64.919  316.258 166.921 1.00 26.94  ? 156  SER B N   1 
ATOM   5341  C  CA  . SER B  2  156 ? 63.861  317.223 167.168 1.00 26.73  ? 156  SER B CA  1 
ATOM   5342  C  C   . SER B  2  156 ? 64.337  318.571 166.693 1.00 22.52  ? 156  SER B C   1 
ATOM   5343  O  O   . SER B  2  156 ? 65.529  318.867 166.812 1.00 28.09  ? 156  SER B O   1 
ATOM   5344  C  CB  . SER B  2  156 ? 63.575  317.341 168.709 1.00 29.76  ? 156  SER B CB  1 
ATOM   5345  O  OG  . SER B  2  156 ? 62.662  318.417 168.939 1.00 27.44  ? 156  SER B OG  1 
ATOM   5346  N  N   . GLU B  2  157 ? 63.398  319.423 166.235 1.00 27.52  ? 157  GLU B N   1 
ATOM   5347  C  CA  . GLU B  2  157 ? 63.747  320.829 165.980 1.00 29.19  ? 157  GLU B CA  1 
ATOM   5348  C  C   . GLU B  2  157 ? 63.253  321.830 167.040 1.00 31.75  ? 157  GLU B C   1 
ATOM   5349  O  O   . GLU B  2  157 ? 63.325  323.038 166.805 1.00 28.36  ? 157  GLU B O   1 
ATOM   5350  C  CB  . GLU B  2  157 ? 63.242  321.229 164.548 1.00 31.27  ? 157  GLU B CB  1 
ATOM   5351  C  CG  . GLU B  2  157 ? 64.152  320.537 163.546 1.00 35.51  ? 157  GLU B CG  1 
ATOM   5352  C  CD  . GLU B  2  157 ? 63.799  320.767 162.116 1.00 49.56  ? 157  GLU B CD  1 
ATOM   5353  O  OE1 . GLU B  2  157 ? 64.109  319.916 161.295 1.00 44.04  ? 157  GLU B OE1 1 
ATOM   5354  O  OE2 . GLU B  2  157 ? 63.206  321.784 161.803 1.00 36.44  ? 157  GLU B OE2 1 
ATOM   5355  N  N   . ASP B  2  158 ? 62.716  321.387 168.185 1.00 27.16  ? 158  ASP B N   1 
ATOM   5356  C  CA  . ASP B  2  158 ? 62.370  322.354 169.239 1.00 24.53  ? 158  ASP B CA  1 
ATOM   5357  C  C   . ASP B  2  158 ? 62.580  321.661 170.637 1.00 25.18  ? 158  ASP B C   1 
ATOM   5358  O  O   . ASP B  2  158 ? 63.716  321.555 171.073 1.00 27.54  ? 158  ASP B O   1 
ATOM   5359  C  CB  . ASP B  2  158 ? 60.938  322.959 169.085 1.00 23.57  ? 158  ASP B CB  1 
ATOM   5360  C  CG  . ASP B  2  158 ? 59.811  321.922 168.765 1.00 31.17  ? 158  ASP B CG  1 
ATOM   5361  O  OD1 . ASP B  2  158 ? 59.728  320.785 169.328 1.00 29.03  ? 158  ASP B OD1 1 
ATOM   5362  O  OD2 . ASP B  2  158 ? 58.935  322.279 167.843 1.00 30.67  ? 158  ASP B OD2 1 
ATOM   5363  N  N   . VAL B  2  159 ? 61.580  321.088 171.260 1.00 26.23  ? 159  VAL B N   1 
ATOM   5364  C  CA  . VAL B  2  159 ? 61.734  320.531 172.622 1.00 23.86  ? 159  VAL B CA  1 
ATOM   5365  C  C   . VAL B  2  159 ? 61.949  319.030 172.510 1.00 33.58  ? 159  VAL B C   1 
ATOM   5366  O  O   . VAL B  2  159 ? 61.972  318.484 171.404 1.00 31.11  ? 159  VAL B O   1 
ATOM   5367  C  CB  . VAL B  2  159 ? 60.493  320.871 173.486 1.00 28.72  ? 159  VAL B CB  1 
ATOM   5368  C  CG1 . VAL B  2  159 ? 60.334  322.374 173.534 1.00 23.35  ? 159  VAL B CG1 1 
ATOM   5369  C  CG2 . VAL B  2  159 ? 59.181  320.195 172.903 1.00 24.24  ? 159  VAL B CG2 1 
ATOM   5370  N  N   . LEU B  2  160 ? 62.061  318.334 173.627 1.00 23.82  ? 160  LEU B N   1 
ATOM   5371  C  CA  . LEU B  2  160 ? 62.149  316.874 173.538 1.00 20.51  ? 160  LEU B CA  1 
ATOM   5372  C  C   . LEU B  2  160 ? 60.803  316.308 173.084 1.00 26.22  ? 160  LEU B C   1 
ATOM   5373  O  O   . LEU B  2  160 ? 59.751  316.753 173.509 1.00 30.53  ? 160  LEU B O   1 
ATOM   5374  C  CB  . LEU B  2  160 ? 62.446  316.266 174.887 1.00 20.23  ? 160  LEU B CB  1 
ATOM   5375  C  CG  . LEU B  2  160 ? 63.680  316.871 175.634 1.00 28.97  ? 160  LEU B CG  1 
ATOM   5376  C  CD1 . LEU B  2  160 ? 63.789  316.266 177.022 1.00 26.67  ? 160  LEU B CD1 1 
ATOM   5377  C  CD2 . LEU B  2  160 ? 64.989  316.576 174.884 1.00 31.42  ? 160  LEU B CD2 1 
ATOM   5378  N  N   . HIS B  2  161 ? 60.861  315.244 172.284 1.00 23.13  ? 161  HIS B N   1 
ATOM   5379  C  CA  . HIS B  2  161 ? 59.713  314.374 171.989 1.00 22.07  ? 161  HIS B CA  1 
ATOM   5380  C  C   . HIS B  2  161 ? 60.245  312.975 172.110 1.00 23.49  ? 161  HIS B C   1 
ATOM   5381  O  O   . HIS B  2  161 ? 61.419  312.761 172.467 1.00 26.77  ? 161  HIS B O   1 
ATOM   5382  C  CB  . HIS B  2  161 ? 59.126  314.626 170.567 1.00 23.07  ? 161  HIS B CB  1 
ATOM   5383  C  CG  . HIS B  2  161 ? 58.771  316.056 170.311 1.00 24.02  ? 161  HIS B CG  1 
ATOM   5384  N  ND1 . HIS B  2  161 ? 57.491  316.560 170.542 1.00 24.22  ? 161  HIS B ND1 1 
ATOM   5385  C  CD2 . HIS B  2  161 ? 59.536  317.095 169.878 1.00 24.99  ? 161  HIS B CD2 1 
ATOM   5386  C  CE1 . HIS B  2  161 ? 57.490  317.848 170.241 1.00 29.38  ? 161  HIS B CE1 1 
ATOM   5387  N  NE2 . HIS B  2  161 ? 58.710  318.195 169.832 1.00 24.68  ? 161  HIS B NE2 1 
ATOM   5388  N  N   . SER B  2  162 ? 59.407  312.006 171.813 1.00 22.47  ? 162  SER B N   1 
ATOM   5389  C  CA  . SER B  2  162 ? 59.956  310.663 171.784 1.00 27.37  ? 162  SER B CA  1 
ATOM   5390  C  C   . SER B  2  162 ? 59.153  309.834 170.810 1.00 30.80  ? 162  SER B C   1 
ATOM   5391  O  O   . SER B  2  162 ? 57.909  309.789 170.875 1.00 23.98  ? 162  SER B O   1 
ATOM   5392  C  CB  . SER B  2  162 ? 59.976  309.993 173.188 1.00 28.72  ? 162  SER B CB  1 
ATOM   5393  O  OG  . SER B  2  162 ? 60.571  308.717 173.082 1.00 25.11  ? 162  SER B OG  1 
ATOM   5394  N  N   . TRP B  2  163 ? 59.840  309.124 169.938 1.00 26.90  ? 163  TRP B N   1 
ATOM   5395  C  CA  . TRP B  2  163 ? 59.213  308.465 168.800 1.00 24.12  ? 163  TRP B CA  1 
ATOM   5396  C  C   . TRP B  2  163 ? 59.005  307.003 169.158 1.00 27.70  ? 163  TRP B C   1 
ATOM   5397  O  O   . TRP B  2  163 ? 59.969  306.289 169.408 1.00 26.42  ? 163  TRP B O   1 
ATOM   5398  C  CB  . TRP B  2  163 ? 60.113  308.620 167.556 1.00 24.07  ? 163  TRP B CB  1 
ATOM   5399  C  CG  . TRP B  2  163 ? 59.403  308.277 166.247 1.00 27.80  ? 163  TRP B CG  1 
ATOM   5400  C  CD1 . TRP B  2  163 ? 58.620  309.113 165.512 1.00 25.63  ? 163  TRP B CD1 1 
ATOM   5401  C  CD2 . TRP B  2  163 ? 59.510  307.040 165.498 1.00 26.62  ? 163  TRP B CD2 1 
ATOM   5402  N  NE1 . TRP B  2  163 ? 58.212  308.460 164.348 1.00 25.28  ? 163  TRP B NE1 1 
ATOM   5403  C  CE2 . TRP B  2  163 ? 58.774  307.206 164.306 1.00 32.31  ? 163  TRP B CE2 1 
ATOM   5404  C  CE3 . TRP B  2  163 ? 60.158  305.802 165.733 1.00 30.86  ? 163  TRP B CE3 1 
ATOM   5405  C  CZ2 . TRP B  2  163 ? 58.620  306.180 163.342 1.00 32.01  ? 163  TRP B CZ2 1 
ATOM   5406  C  CZ3 . TRP B  2  163 ? 60.055  304.789 164.763 1.00 31.13  ? 163  TRP B CZ3 1 
ATOM   5407  C  CH2 . TRP B  2  163 ? 59.271  304.985 163.581 1.00 31.85  ? 163  TRP B CH2 1 
ATOM   5408  N  N   . ALA B  2  164 ? 57.749  306.580 169.284 1.00 23.23  ? 164  ALA B N   1 
ATOM   5409  C  CA  . ALA B  2  164 ? 57.469  305.243 169.818 1.00 25.08  ? 164  ALA B CA  1 
ATOM   5410  C  C   . ALA B  2  164 ? 56.523  304.495 168.889 1.00 27.32  ? 164  ALA B C   1 
ATOM   5411  O  O   . ALA B  2  164 ? 55.558  305.073 168.397 1.00 25.56  ? 164  ALA B O   1 
ATOM   5412  C  CB  . ALA B  2  164 ? 56.822  305.313 171.250 1.00 25.50  ? 164  ALA B CB  1 
ATOM   5413  N  N   . VAL B  2  165 ? 56.673  303.177 168.814 1.00 27.39  ? 165  VAL B N   1 
ATOM   5414  C  CA  . VAL B  2  165 ? 55.724  302.278 168.147 1.00 20.65  ? 165  VAL B CA  1 
ATOM   5415  C  C   . VAL B  2  165 ? 55.719  300.992 168.981 1.00 31.67  ? 165  VAL B C   1 
ATOM   5416  O  O   . VAL B  2  165 ? 56.560  300.105 168.764 1.00 29.52  ? 165  VAL B O   1 
ATOM   5417  C  CB  . VAL B  2  165 ? 56.115  301.952 166.693 1.00 29.32  ? 165  VAL B CB  1 
ATOM   5418  C  CG1 . VAL B  2  165 ? 54.983  301.072 166.068 1.00 28.65  ? 165  VAL B CG1 1 
ATOM   5419  C  CG2 . VAL B  2  165 ? 56.380  303.236 165.838 1.00 30.77  ? 165  VAL B CG2 1 
ATOM   5420  N  N   . PRO B  2  166 ? 54.781  300.840 169.937 1.00 30.67  ? 166  PRO B N   1 
ATOM   5421  C  CA  . PRO B  2  166 ? 54.820  299.688 170.870 1.00 31.72  ? 166  PRO B CA  1 
ATOM   5422  C  C   . PRO B  2  166 ? 54.889  298.307 170.213 1.00 27.47  ? 166  PRO B C   1 
ATOM   5423  O  O   . PRO B  2  166 ? 55.648  297.442 170.677 1.00 34.03  ? 166  PRO B O   1 
ATOM   5424  C  CB  . PRO B  2  166 ? 53.515  299.861 171.684 1.00 27.07  ? 166  PRO B CB  1 
ATOM   5425  C  CG  . PRO B  2  166 ? 53.335  301.463 171.730 1.00 27.26  ? 166  PRO B CG  1 
ATOM   5426  C  CD  . PRO B  2  166 ? 53.814  301.886 170.312 1.00 22.93  ? 166  PRO B CD  1 
ATOM   5427  N  N   . SER B  2  167 ? 54.168  298.089 169.096 1.00 28.34  ? 167  SER B N   1 
ATOM   5428  C  CA  . SER B  2  167 ? 54.127  296.726 168.584 1.00 48.21  ? 167  SER B CA  1 
ATOM   5429  C  C   . SER B  2  167 ? 55.411  296.346 167.867 1.00 38.49  ? 167  SER B C   1 
ATOM   5430  O  O   . SER B  2  167 ? 55.674  295.153 167.685 1.00 34.43  ? 167  SER B O   1 
ATOM   5431  C  CB  . SER B  2  167 ? 52.929  296.507 167.649 1.00 38.35  ? 167  SER B CB  1 
ATOM   5432  O  OG  . SER B  2  167 ? 53.026  297.404 166.607 1.00 37.30  ? 167  SER B OG  1 
ATOM   5433  N  N   . LEU B  2  168 ? 56.252  297.309 167.540 1.00 31.07  ? 168  LEU B N   1 
ATOM   5434  C  CA  . LEU B  2  168 ? 57.583  296.995 167.037 1.00 35.14  ? 168  LEU B CA  1 
ATOM   5435  C  C   . LEU B  2  168 ? 58.649  297.037 168.127 1.00 38.91  ? 168  LEU B C   1 
ATOM   5436  O  O   . LEU B  2  168 ? 59.833  296.829 167.829 1.00 39.82  ? 168  LEU B O   1 
ATOM   5437  C  CB  . LEU B  2  168 ? 57.994  297.955 165.911 1.00 35.49  ? 168  LEU B CB  1 
ATOM   5438  C  CG  . LEU B  2  168 ? 57.318  297.683 164.536 1.00 50.15  ? 168  LEU B CG  1 
ATOM   5439  C  CD1 . LEU B  2  168 ? 57.629  298.783 163.572 1.00 46.66  ? 168  LEU B CD1 1 
ATOM   5440  C  CD2 . LEU B  2  168 ? 57.884  296.410 163.949 1.00 53.74  ? 168  LEU B CD2 1 
ATOM   5441  N  N   . GLY B  2  169 ? 58.261  297.329 169.369 1.00 34.87  ? 169  GLY B N   1 
ATOM   5442  C  CA  . GLY B  2  169 ? 59.201  297.474 170.470 1.00 36.76  ? 169  GLY B CA  1 
ATOM   5443  C  C   . GLY B  2  169 ? 60.065  298.713 170.400 1.00 44.09  ? 169  GLY B C   1 
ATOM   5444  O  O   . GLY B  2  169 ? 61.215  298.667 170.816 1.00 43.78  ? 169  GLY B O   1 
ATOM   5445  N  N   . LEU B  2  170 ? 59.566  299.810 169.837 1.00 27.84  ? 170  LEU B N   1 
ATOM   5446  C  CA  . LEU B  2  170 ? 60.399  300.962 169.554 1.00 27.12  ? 170  LEU B CA  1 
ATOM   5447  C  C   . LEU B  2  170 ? 60.029  302.121 170.451 1.00 24.26  ? 170  LEU B C   1 
ATOM   5448  O  O   . LEU B  2  170 ? 58.852  302.462 170.590 1.00 28.66  ? 170  LEU B O   1 
ATOM   5449  C  CB  . LEU B  2  170 ? 60.257  301.442 168.102 1.00 30.83  ? 170  LEU B CB  1 
ATOM   5450  C  CG  . LEU B  2  170 ? 60.620  300.427 167.034 1.00 44.94  ? 170  LEU B CG  1 
ATOM   5451  C  CD1 . LEU B  2  170 ? 60.386  301.073 165.609 1.00 34.50  ? 170  LEU B CD1 1 
ATOM   5452  C  CD2 . LEU B  2  170 ? 62.038  299.986 167.250 1.00 44.40  ? 170  LEU B CD2 1 
ATOM   5453  N  N   . LYS B  2  171 ? 61.056  302.742 171.033 1.00 28.36  ? 171  LYS B N   1 
ATOM   5454  C  CA  . LYS B  2  171 ? 60.895  304.067 171.633 1.00 30.51  ? 171  LYS B CA  1 
ATOM   5455  C  C   . LYS B  2  171 ? 62.268  304.707 171.710 1.00 28.85  ? 171  LYS B C   1 
ATOM   5456  O  O   . LYS B  2  171 ? 63.151  304.224 172.442 1.00 30.56  ? 171  LYS B O   1 
ATOM   5457  C  CB  . LYS B  2  171 ? 60.238  303.992 173.064 1.00 26.22  ? 171  LYS B CB  1 
ATOM   5458  C  CG  . LYS B  2  171 ? 60.060  305.395 173.749 1.00 25.62  ? 171  LYS B CG  1 
ATOM   5459  C  CD  . LYS B  2  171 ? 59.231  305.381 175.104 1.00 25.74  ? 171  LYS B CD  1 
ATOM   5460  C  CE  . LYS B  2  171 ? 57.862  304.720 174.939 1.00 25.53  ? 171  LYS B CE  1 
ATOM   5461  N  NZ  . LYS B  2  171 ? 57.763  303.435 175.716 1.00 28.17  ? 171  LYS B NZ  1 
ATOM   5462  N  N   . THR B  2  172 ? 62.435  305.827 171.009 1.00 24.31  ? 172  THR B N   1 
ATOM   5463  C  CA  . THR B  2  172 ? 63.706  306.537 170.934 1.00 26.67  ? 172  THR B CA  1 
ATOM   5464  C  C   . THR B  2  172 ? 63.435  308.014 171.140 1.00 26.50  ? 172  THR B C   1 
ATOM   5465  O  O   . THR B  2  172 ? 62.642  308.611 170.405 1.00 27.71  ? 172  THR B O   1 
ATOM   5466  C  CB  . THR B  2  172 ? 64.346  306.298 169.523 1.00 31.00  ? 172  THR B CB  1 
ATOM   5467  O  OG1 . THR B  2  172 ? 64.782  304.953 169.512 1.00 31.93  ? 172  THR B OG1 1 
ATOM   5468  C  CG2 . THR B  2  172 ? 65.508  307.180 169.326 1.00 21.75  ? 172  THR B CG2 1 
ATOM   5469  N  N   . ASP B  2  173 ? 64.063  308.597 172.158 1.00 24.65  ? 173  ASP B N   1 
ATOM   5470  C  CA  . ASP B  2  173 ? 63.821  310.006 172.402 1.00 23.31  ? 173  ASP B CA  1 
ATOM   5471  C  C   . ASP B  2  173 ? 64.339  310.852 171.257 1.00 26.64  ? 173  ASP B C   1 
ATOM   5472  O  O   . ASP B  2  173 ? 65.358  310.529 170.635 1.00 28.29  ? 173  ASP B O   1 
ATOM   5473  C  CB  . ASP B  2  173 ? 64.480  310.451 173.716 1.00 22.45  ? 173  ASP B CB  1 
ATOM   5474  C  CG  . ASP B  2  173 ? 63.726  309.925 174.966 1.00 27.57  ? 173  ASP B CG  1 
ATOM   5475  O  OD1 . ASP B  2  173 ? 62.691  309.180 174.850 1.00 28.51  ? 173  ASP B OD1 1 
ATOM   5476  O  OD2 . ASP B  2  173 ? 64.216  310.274 176.069 1.00 29.06  ? 173  ASP B OD2 1 
ATOM   5477  N  N   . ALA B  2  174 ? 63.666  312.009 171.065 1.00 24.79  ? 174  ALA B N   1 
ATOM   5478  C  CA  . ALA B  2  174 ? 63.890  312.987 170.021 1.00 28.14  ? 174  ALA B CA  1 
ATOM   5479  C  C   . ALA B  2  174 ? 64.456  314.253 170.675 1.00 25.86  ? 174  ALA B C   1 
ATOM   5480  O  O   . ALA B  2  174 ? 63.734  315.051 171.270 1.00 25.94  ? 174  ALA B O   1 
ATOM   5481  C  CB  . ALA B  2  174 ? 62.595  313.270 169.203 1.00 26.14  ? 174  ALA B CB  1 
ATOM   5482  N  N   . ILE B  2  175 ? 65.749  314.478 170.491 1.00 27.67  ? 175  ILE B N   1 
ATOM   5483  C  CA  . ILE B  2  175 ? 66.487  315.484 171.244 1.00 27.90  ? 175  ILE B CA  1 
ATOM   5484  C  C   . ILE B  2  175 ? 67.104  316.446 170.248 1.00 30.96  ? 175  ILE B C   1 
ATOM   5485  O  O   . ILE B  2  175 ? 67.880  316.016 169.396 1.00 28.59  ? 175  ILE B O   1 
ATOM   5486  C  CB  . ILE B  2  175 ? 67.572  314.850 172.141 1.00 26.46  ? 175  ILE B CB  1 
ATOM   5487  C  CG1 . ILE B  2  175 ? 66.885  313.858 173.112 1.00 28.87  ? 175  ILE B CG1 1 
ATOM   5488  C  CG2 . ILE B  2  175 ? 68.309  315.943 172.943 1.00 22.70  ? 175  ILE B CG2 1 
ATOM   5489  C  CD1 . ILE B  2  175 ? 67.718  312.694 173.503 1.00 35.60  ? 175  ILE B CD1 1 
ATOM   5490  N  N   . PRO B  2  176 ? 66.868  317.739 170.363 1.00 27.91  ? 176  PRO B N   1 
ATOM   5491  C  CA  . PRO B  2  176 ? 67.451  318.675 169.416 1.00 28.75  ? 176  PRO B CA  1 
ATOM   5492  C  C   . PRO B  2  176 ? 68.959  318.685 169.535 1.00 33.85  ? 176  PRO B C   1 
ATOM   5493  O  O   . PRO B  2  176 ? 69.517  318.587 170.618 1.00 29.25  ? 176  PRO B O   1 
ATOM   5494  C  CB  . PRO B  2  176 ? 66.837  320.015 169.821 1.00 28.15  ? 176  PRO B CB  1 
ATOM   5495  C  CG  . PRO B  2  176 ? 66.709  319.882 171.282 1.00 30.33  ? 176  PRO B CG  1 
ATOM   5496  C  CD  . PRO B  2  176 ? 66.148  318.434 171.431 1.00 26.45  ? 176  PRO B CD  1 
ATOM   5497  N  N   . GLY B  2  177 ? 69.633  318.717 168.378 1.00 27.35  ? 177  GLY B N   1 
ATOM   5498  C  CA  . GLY B  2  177 ? 71.074  318.687 168.431 1.00 28.63  ? 177  GLY B CA  1 
ATOM   5499  C  C   . GLY B  2  177 ? 71.648  317.300 168.462 1.00 34.76  ? 177  GLY B C   1 
ATOM   5500  O  O   . GLY B  2  177 ? 72.860  317.147 168.391 1.00 28.18  ? 177  GLY B O   1 
ATOM   5501  N  N   . ARG B  2  178 ? 70.821  316.288 168.511 1.00 25.53  ? 178  ARG B N   1 
ATOM   5502  C  CA  . ARG B  2  178 ? 71.285  314.915 168.648 1.00 25.48  ? 178  ARG B CA  1 
ATOM   5503  C  C   . ARG B  2  178 ? 70.611  314.075 167.598 1.00 28.78  ? 178  ARG B C   1 
ATOM   5504  O  O   . ARG B  2  178 ? 69.465  314.320 167.282 1.00 30.78  ? 178  ARG B O   1 
ATOM   5505  C  CB  . ARG B  2  178 ? 70.908  314.326 170.032 1.00 26.72  ? 178  ARG B CB  1 
ATOM   5506  C  CG  . ARG B  2  178 ? 71.592  312.977 170.420 1.00 29.79  ? 178  ARG B CG  1 
ATOM   5507  C  CD  . ARG B  2  178 ? 70.831  312.456 171.675 1.00 31.67  ? 178  ARG B CD  1 
ATOM   5508  N  NE  . ARG B  2  178 ? 71.445  311.230 172.198 1.00 28.34  ? 178  ARG B NE  1 
ATOM   5509  C  CZ  . ARG B  2  178 ? 72.462  311.210 173.057 1.00 37.71  ? 178  ARG B CZ  1 
ATOM   5510  N  NH1 . ARG B  2  178 ? 72.964  312.334 173.507 1.00 31.34  ? 178  ARG B NH1 1 
ATOM   5511  N  NH2 . ARG B  2  178 ? 72.955  310.073 173.512 1.00 31.75  ? 178  ARG B NH2 1 
ATOM   5512  N  N   . LEU B  2  179 ? 71.267  313.001 167.151 1.00 24.07  ? 179  LEU B N   1 
ATOM   5513  C  CA  . LEU B  2  179 ? 70.704  312.153 166.101 1.00 25.64  ? 179  LEU B CA  1 
ATOM   5514  C  C   . LEU B  2  179 ? 70.690  310.719 166.609 1.00 27.12  ? 179  LEU B C   1 
ATOM   5515  O  O   . LEU B  2  179 ? 71.715  310.028 166.557 1.00 36.03  ? 179  LEU B O   1 
ATOM   5516  C  CB  . LEU B  2  179 ? 71.566  312.328 164.843 1.00 28.81  ? 179  LEU B CB  1 
ATOM   5517  C  CG  . LEU B  2  179 ? 71.024  311.738 163.530 1.00 30.60  ? 179  LEU B CG  1 
ATOM   5518  C  CD1 . LEU B  2  179 ? 69.773  312.470 163.146 1.00 30.35  ? 179  LEU B CD1 1 
ATOM   5519  C  CD2 . LEU B  2  179 ? 72.146  311.948 162.407 1.00 26.97  ? 179  LEU B CD2 1 
ATOM   5520  N  N   . ASN B  2  180 ? 69.562  310.272 167.199 1.00 30.40  ? 180  ASN B N   1 
ATOM   5521  C  CA  . ASN B  2  180 ? 69.501  308.934 167.788 1.00 25.92  ? 180  ASN B CA  1 
ATOM   5522  C  C   . ASN B  2  180 ? 69.079  307.871 166.780 1.00 34.47  ? 180  ASN B C   1 
ATOM   5523  O  O   . ASN B  2  180 ? 68.057  308.016 166.097 1.00 31.27  ? 180  ASN B O   1 
ATOM   5524  C  CB  . ASN B  2  180 ? 68.473  308.891 168.914 1.00 22.59  ? 180  ASN B CB  1 
ATOM   5525  C  CG  . ASN B  2  180 ? 69.068  309.309 170.229 1.00 31.63  ? 180  ASN B CG  1 
ATOM   5526  O  OD1 . ASN B  2  180 ? 70.261  309.208 170.417 1.00 26.81  ? 180  ASN B OD1 1 
ATOM   5527  N  ND2 . ASN B  2  180 ? 68.225  309.802 171.149 1.00 24.19  ? 180  ASN B ND2 1 
ATOM   5528  N  N   . GLN B  2  181 ? 69.766  306.740 166.799 1.00 25.92  ? 181  GLN B N   1 
ATOM   5529  C  CA  . GLN B  2  181 ? 69.513  305.657 165.870 1.00 31.45  ? 181  GLN B CA  1 
ATOM   5530  C  C   . GLN B  2  181 ? 68.758  304.499 166.508 1.00 33.44  ? 181  GLN B C   1 
ATOM   5531  O  O   . GLN B  2  181 ? 68.995  304.141 167.669 1.00 31.55  ? 181  GLN B O   1 
ATOM   5532  C  CB  . GLN B  2  181 ? 70.845  305.159 165.322 1.00 37.66  ? 181  GLN B CB  1 
ATOM   5533  C  CG  . GLN B  2  181 ? 70.794  304.006 164.330 1.00 32.76  ? 181  GLN B CG  1 
ATOM   5534  C  CD  . GLN B  2  181 ? 72.238  303.667 163.863 1.00 40.26  ? 181  GLN B CD  1 
ATOM   5535  O  OE1 . GLN B  2  181 ? 73.071  303.098 164.612 1.00 40.91  ? 181  GLN B OE1 1 
ATOM   5536  N  NE2 . GLN B  2  181 ? 72.546  304.082 162.673 1.00 34.44  ? 181  GLN B NE2 1 
ATOM   5537  N  N   . THR B  2  182 ? 67.879  303.887 165.735 1.00 28.99  ? 182  THR B N   1 
ATOM   5538  C  CA  . THR B  2  182 ? 67.258  302.633 166.139 1.00 32.34  ? 182  THR B CA  1 
ATOM   5539  C  C   . THR B  2  182 ? 66.941  301.894 164.841 1.00 40.02  ? 182  THR B C   1 
ATOM   5540  O  O   . THR B  2  182 ? 66.958  302.487 163.758 1.00 37.12  ? 182  THR B O   1 
ATOM   5541  C  CB  . THR B  2  182 ? 65.981  302.852 167.020 1.00 31.47  ? 182  THR B CB  1 
ATOM   5542  O  OG1 . THR B  2  182 ? 65.545  301.568 167.524 1.00 37.44  ? 182  THR B OG1 1 
ATOM   5543  C  CG2 . THR B  2  182 ? 64.786  303.417 166.193 1.00 33.16  ? 182  THR B CG2 1 
ATOM   5544  N  N   . THR B  2  183 ? 66.681  300.595 164.935 1.00 32.64  ? 183  THR B N   1 
ATOM   5545  C  CA  . THR B  2  183 ? 66.355  299.834 163.729 1.00 39.70  ? 183  THR B CA  1 
ATOM   5546  C  C   . THR B  2  183 ? 64.968  299.226 163.832 1.00 40.83  ? 183  THR B C   1 
ATOM   5547  O  O   . THR B  2  183 ? 64.466  298.941 164.899 1.00 37.42  ? 183  THR B O   1 
ATOM   5548  C  CB  . THR B  2  183 ? 67.356  298.706 163.461 1.00 53.36  ? 183  THR B CB  1 
ATOM   5549  O  OG1 . THR B  2  183 ? 67.243  297.781 164.529 1.00 59.64  ? 183  THR B OG1 1 
ATOM   5550  C  CG2 . THR B  2  183 ? 68.764  299.244 163.438 1.00 44.14  ? 183  THR B CG2 1 
ATOM   5551  N  N   . LEU B  2  184 ? 64.358  298.971 162.687 1.00 31.49  ? 184  LEU B N   1 
ATOM   5552  C  CA  . LEU B  2  184 ? 62.953  298.609 162.643 1.00 31.15  ? 184  LEU B CA  1 
ATOM   5553  C  C   . LEU B  2  184 ? 62.877  297.519 161.576 1.00 37.58  ? 184  LEU B C   1 
ATOM   5554  O  O   . LEU B  2  184 ? 63.517  297.652 160.519 1.00 35.74  ? 184  LEU B O   1 
ATOM   5555  C  CB  . LEU B  2  184 ? 62.185  299.876 162.210 1.00 41.45  ? 184  LEU B CB  1 
ATOM   5556  C  CG  . LEU B  2  184 ? 60.723  299.966 161.940 1.00 53.26  ? 184  LEU B CG  1 
ATOM   5557  C  CD1 . LEU B  2  184 ? 60.361  301.424 162.042 1.00 41.72  ? 184  LEU B CD1 1 
ATOM   5558  C  CD2 . LEU B  2  184 ? 60.460  299.454 160.568 1.00 42.47  ? 184  LEU B CD2 1 
ATOM   5559  N  N   . MET B  2  185 ? 62.169  296.432 161.855 1.00 37.68  ? 185  MET B N   1 
ATOM   5560  C  CA  . MET B  2  185 ? 61.965  295.400 160.838 1.00 45.70  ? 185  MET B CA  1 
ATOM   5561  C  C   . MET B  2  185 ? 60.580  294.784 161.038 1.00 48.28  ? 185  MET B C   1 
ATOM   5562  O  O   . MET B  2  185 ? 60.359  294.104 162.035 1.00 43.45  ? 185  MET B O   1 
ATOM   5563  C  CB  . MET B  2  185 ? 63.082  294.354 160.971 1.00 42.48  ? 185  MET B CB  1 
ATOM   5564  C  CG  . MET B  2  185 ? 63.368  293.579 159.705 1.00 50.95  ? 185  MET B CG  1 
ATOM   5565  S  SD  . MET B  2  185 ? 62.029  292.526 159.123 1.00 48.71  ? 185  MET B SD  1 
ATOM   5566  C  CE  . MET B  2  185 ? 61.718  291.486 160.585 1.00 55.50  ? 185  MET B CE  1 
ATOM   5567  N  N   . SER B  2  186 ? 59.619  295.028 160.136 1.00 34.89  ? 186  SER B N   1 
ATOM   5568  C  CA  . SER B  2  186 ? 58.274  294.454 160.322 1.00 35.62  ? 186  SER B CA  1 
ATOM   5569  C  C   . SER B  2  186 ? 58.169  293.110 159.619 1.00 47.22  ? 186  SER B C   1 
ATOM   5570  O  O   . SER B  2  186 ? 58.525  292.981 158.449 1.00 39.79  ? 186  SER B O   1 
ATOM   5571  C  CB  . SER B  2  186 ? 57.160  295.362 159.806 1.00 39.06  ? 186  SER B CB  1 
ATOM   5572  O  OG  . SER B  2  186 ? 55.897  294.759 160.063 1.00 35.10  ? 186  SER B OG  1 
ATOM   5573  N  N   . SER B  2  187 ? 57.666  292.111 160.344 1.00 38.14  ? 187  SER B N   1 
ATOM   5574  C  CA  . SER B  2  187 ? 57.435  290.805 159.747 1.00 33.99  ? 187  SER B CA  1 
ATOM   5575  C  C   . SER B  2  187 ? 56.197  290.798 158.882 1.00 40.15  ? 187  SER B C   1 
ATOM   5576  O  O   . SER B  2  187 ? 55.960  289.818 158.175 1.00 39.48  ? 187  SER B O   1 
ATOM   5577  C  CB  . SER B  2  187 ? 57.309  289.717 160.822 1.00 43.09  ? 187  SER B CB  1 
ATOM   5578  O  OG  . SER B  2  187 ? 58.492  289.623 161.607 1.00 46.05  ? 187  SER B OG  1 
ATOM   5579  N  N   . ARG B  2  188 ? 55.396  291.846 158.941 1.00 35.43  ? 188  ARG B N   1 
ATOM   5580  C  CA  . ARG B  2  188 ? 54.069  291.792 158.347 1.00 41.45  ? 188  ARG B CA  1 
ATOM   5581  C  C   . ARG B  2  188 ? 53.748  293.127 157.692 1.00 35.67  ? 188  ARG B C   1 
ATOM   5582  O  O   . ARG B  2  188 ? 54.218  294.183 158.158 1.00 34.28  ? 188  ARG B O   1 
ATOM   5583  C  CB  . ARG B  2  188 ? 53.002  291.423 159.394 1.00 35.39  ? 188  ARG B CB  1 
ATOM   5584  C  CG  . ARG B  2  188 ? 53.271  290.103 160.092 1.00 35.35  ? 188  ARG B CG  1 
ATOM   5585  C  CD  . ARG B  2  188 ? 52.044  289.546 160.786 1.00 43.39  ? 188  ARG B CD  1 
ATOM   5586  N  NE  . ARG B  2  188 ? 51.301  290.558 161.560 1.00 39.51  ? 188  ARG B NE  1 
ATOM   5587  C  CZ  . ARG B  2  188 ? 51.610  290.992 162.779 1.00 46.14  ? 188  ARG B CZ  1 
ATOM   5588  N  NH1 . ARG B  2  188 ? 52.658  290.480 163.416 1.00 31.74  ? 188  ARG B NH1 1 
ATOM   5589  N  NH2 . ARG B  2  188 ? 50.861  291.919 163.360 1.00 32.52  ? 188  ARG B NH2 1 
ATOM   5590  N  N   . PRO B  2  189 ? 52.950  293.122 156.606 1.00 32.92  ? 189  PRO B N   1 
ATOM   5591  C  CA  . PRO B  2  189 ? 52.355  294.372 156.145 1.00 30.35  ? 189  PRO B CA  1 
ATOM   5592  C  C   . PRO B  2  189 ? 51.360  294.863 157.182 1.00 38.33  ? 189  PRO B C   1 
ATOM   5593  O  O   . PRO B  2  189 ? 50.940  294.127 158.103 1.00 33.83  ? 189  PRO B O   1 
ATOM   5594  C  CB  . PRO B  2  189 ? 51.649  293.967 154.787 1.00 30.19  ? 189  PRO B CB  1 
ATOM   5595  C  CG  . PRO B  2  189 ? 51.031  292.608 155.167 1.00 33.15  ? 189  PRO B CG  1 
ATOM   5596  C  CD  . PRO B  2  189 ? 52.195  291.947 156.094 1.00 32.27  ? 189  PRO B CD  1 
ATOM   5597  N  N   . GLY B  2  190 ? 50.974  296.137 157.043 1.00 30.95  ? 190  GLY B N   1 
ATOM   5598  C  CA  . GLY B  2  190 ? 49.843  296.591 157.855 1.00 32.23  ? 190  GLY B CA  1 
ATOM   5599  C  C   . GLY B  2  190 ? 50.043  298.004 158.334 1.00 34.74  ? 190  GLY B C   1 
ATOM   5600  O  O   . GLY B  2  190 ? 50.915  298.712 157.848 1.00 34.76  ? 190  GLY B O   1 
ATOM   5601  N  N   . LEU B  2  191 ? 49.212  298.438 159.288 1.00 30.98  ? 191  LEU B N   1 
ATOM   5602  C  CA  . LEU B  2  191 ? 49.347  299.757 159.889 1.00 33.09  ? 191  LEU B CA  1 
ATOM   5603  C  C   . LEU B  2  191 ? 49.731  299.608 161.351 1.00 32.04  ? 191  LEU B C   1 
ATOM   5604  O  O   . LEU B  2  191 ? 49.099  298.854 162.086 1.00 32.67  ? 191  LEU B O   1 
ATOM   5605  C  CB  . LEU B  2  191 ? 48.043  300.534 159.796 1.00 28.38  ? 191  LEU B CB  1 
ATOM   5606  C  CG  . LEU B  2  191 ? 47.547  300.642 158.326 1.00 34.52  ? 191  LEU B CG  1 
ATOM   5607  C  CD1 . LEU B  2  191 ? 46.189  301.343 158.386 1.00 36.14  ? 191  LEU B CD1 1 
ATOM   5608  C  CD2 . LEU B  2  191 ? 48.593  301.440 157.588 1.00 36.25  ? 191  LEU B CD2 1 
ATOM   5609  N  N   . TYR B  2  192 ? 50.778  300.319 161.800 1.00 32.71  ? 192  TYR B N   1 
ATOM   5610  C  CA  . TYR B  2  192 ? 51.272  300.137 163.174 1.00 31.53  ? 192  TYR B CA  1 
ATOM   5611  C  C   . TYR B  2  192 ? 51.389  301.506 163.802 1.00 30.28  ? 192  TYR B C   1 
ATOM   5612  O  O   . TYR B  2  192 ? 52.051  302.359 163.221 1.00 31.27  ? 192  TYR B O   1 
ATOM   5613  C  CB  . TYR B  2  192 ? 52.611  299.389 163.204 1.00 29.79  ? 192  TYR B CB  1 
ATOM   5614  C  CG  . TYR B  2  192 ? 52.374  298.041 162.549 1.00 37.43  ? 192  TYR B CG  1 
ATOM   5615  C  CD1 . TYR B  2  192 ? 51.786  297.016 163.278 1.00 38.46  ? 192  TYR B CD1 1 
ATOM   5616  C  CD2 . TYR B  2  192 ? 52.634  297.841 161.156 1.00 32.32  ? 192  TYR B CD2 1 
ATOM   5617  C  CE1 . TYR B  2  192 ? 51.458  295.811 162.721 1.00 33.02  ? 192  TYR B CE1 1 
ATOM   5618  C  CE2 . TYR B  2  192 ? 52.356  296.578 160.573 1.00 29.02  ? 192  TYR B CE2 1 
ATOM   5619  C  CZ  . TYR B  2  192 ? 51.736  295.586 161.335 1.00 33.11  ? 192  TYR B CZ  1 
ATOM   5620  O  OH  . TYR B  2  192 ? 51.393  294.349 160.807 1.00 37.05  ? 192  TYR B OH  1 
ATOM   5621  N  N   . TYR B  2  193 ? 50.809  301.669 165.014 1.00 31.35  ? 193  TYR B N   1 
ATOM   5622  C  CA  . TYR B  2  193 ? 50.535  302.971 165.607 1.00 29.97  ? 193  TYR B CA  1 
ATOM   5623  C  C   . TYR B  2  193 ? 51.391  303.183 166.855 1.00 29.45  ? 193  TYR B C   1 
ATOM   5624  O  O   . TYR B  2  193 ? 51.730  302.221 167.536 1.00 28.86  ? 193  TYR B O   1 
ATOM   5625  C  CB  . TYR B  2  193 ? 49.060  303.062 166.010 1.00 29.24  ? 193  TYR B CB  1 
ATOM   5626  C  CG  . TYR B  2  193 ? 48.108  303.093 164.828 1.00 29.01  ? 193  TYR B CG  1 
ATOM   5627  C  CD1 . TYR B  2  193 ? 47.765  301.926 164.151 1.00 31.28  ? 193  TYR B CD1 1 
ATOM   5628  C  CD2 . TYR B  2  193 ? 47.569  304.303 164.420 1.00 32.45  ? 193  TYR B CD2 1 
ATOM   5629  C  CE1 . TYR B  2  193 ? 46.880  301.970 163.018 1.00 34.30  ? 193  TYR B CE1 1 
ATOM   5630  C  CE2 . TYR B  2  193 ? 46.666  304.383 163.319 1.00 28.87  ? 193  TYR B CE2 1 
ATOM   5631  C  CZ  . TYR B  2  193 ? 46.335  303.205 162.650 1.00 35.60  ? 193  TYR B CZ  1 
ATOM   5632  O  OH  . TYR B  2  193 ? 45.461  303.315 161.593 1.00 33.18  ? 193  TYR B OH  1 
ATOM   5633  N  N   . GLY B  2  194 ? 51.798  304.441 167.108 1.00 26.74  ? 194  GLY B N   1 
ATOM   5634  C  CA  . GLY B  2  194 ? 52.418  304.854 168.357 1.00 29.60  ? 194  GLY B CA  1 
ATOM   5635  C  C   . GLY B  2  194 ? 52.136  306.320 168.632 1.00 33.17  ? 194  GLY B C   1 
ATOM   5636  O  O   . GLY B  2  194 ? 51.453  306.996 167.876 1.00 26.82  ? 194  GLY B O   1 
ATOM   5637  N  N   . GLN B  2  195 ? 52.676  306.828 169.723 1.00 28.34  ? 195  GLN B N   1 
ATOM   5638  C  CA  . GLN B  2  195 ? 52.298  308.146 170.195 1.00 31.35  ? 195  GLN B CA  1 
ATOM   5639  C  C   . GLN B  2  195 ? 53.514  308.808 170.826 1.00 27.62  ? 195  GLN B C   1 
ATOM   5640  O  O   . GLN B  2  195 ? 54.397  308.127 171.360 1.00 26.08  ? 195  GLN B O   1 
ATOM   5641  C  CB  . GLN B  2  195 ? 51.136  307.992 171.223 1.00 22.29  ? 195  GLN B CB  1 
ATOM   5642  C  CG  . GLN B  2  195 ? 49.846  307.428 170.528 1.00 26.01  ? 195  GLN B CG  1 
ATOM   5643  C  CD  . GLN B  2  195 ? 48.704  307.515 171.505 1.00 29.92  ? 195  GLN B CD  1 
ATOM   5644  O  OE1 . GLN B  2  195 ? 47.940  308.473 171.508 1.00 29.88  ? 195  GLN B OE1 1 
ATOM   5645  N  NE2 . GLN B  2  195 ? 48.601  306.526 172.334 1.00 24.30  ? 195  GLN B NE2 1 
ATOM   5646  N  N   . CYS B  2  196 ? 53.579  310.125 170.722 1.00 27.89  ? 196  CYS B N   1 
ATOM   5647  C  CA  . CYS B  2  196 ? 54.696  310.859 171.325 1.00 25.81  ? 196  CYS B CA  1 
ATOM   5648  C  C   . CYS B  2  196 ? 54.841  310.508 172.805 1.00 27.87  ? 196  CYS B C   1 
ATOM   5649  O  O   . CYS B  2  196 ? 53.874  310.583 173.582 1.00 23.95  ? 196  CYS B O   1 
ATOM   5650  C  CB  . CYS B  2  196 ? 54.525  312.357 171.134 1.00 26.93  ? 196  CYS B CB  1 
ATOM   5651  S  SG  . CYS B  2  196 ? 55.986  313.409 171.747 1.00 27.88  ? 196  CYS B SG  1 
ATOM   5652  N  N   . SER B  2  197 ? 56.074  310.175 173.188 1.00 24.76  ? 197  SER B N   1 
ATOM   5653  C  CA  . SER B  2  197 ? 56.392  309.577 174.496 1.00 27.78  ? 197  SER B CA  1 
ATOM   5654  C  C   . SER B  2  197 ? 57.403  310.378 175.336 1.00 29.35  ? 197  SER B C   1 
ATOM   5655  O  O   . SER B  2  197 ? 58.075  309.828 176.217 1.00 25.62  ? 197  SER B O   1 
ATOM   5656  C  CB  . SER B  2  197 ? 56.859  308.140 174.268 1.00 31.18  ? 197  SER B CB  1 
ATOM   5657  O  OG  . SER B  2  197 ? 55.727  307.341 173.841 1.00 26.51  ? 197  SER B OG  1 
ATOM   5658  N  N   . GLU B  2  198 ? 57.479  311.692 175.130 1.00 23.56  ? 198  GLU B N   1 
ATOM   5659  C  CA  . GLU B  2  198 ? 58.142  312.602 176.084 1.00 24.14  ? 198  GLU B CA  1 
ATOM   5660  C  C   . GLU B  2  198 ? 57.367  313.921 176.103 1.00 30.10  ? 198  GLU B C   1 
ATOM   5661  O  O   . GLU B  2  198 ? 57.063  314.502 175.033 1.00 26.93  ? 198  GLU B O   1 
ATOM   5662  C  CB  . GLU B  2  198 ? 59.626  312.871 175.692 1.00 23.76  ? 198  GLU B CB  1 
ATOM   5663  C  CG  . GLU B  2  198 ? 60.335  313.843 176.713 1.00 23.22  ? 198  GLU B CG  1 
ATOM   5664  C  CD  . GLU B  2  198 ? 60.411  313.228 178.103 1.00 42.49  ? 198  GLU B CD  1 
ATOM   5665  O  OE1 . GLU B  2  198 ? 60.496  311.998 178.315 1.00 27.49  ? 198  GLU B OE1 1 
ATOM   5666  O  OE2 . GLU B  2  198 ? 60.355  314.036 179.008 1.00 34.30  ? 198  GLU B OE2 1 
ATOM   5667  N  N   . ILE B  2  199 ? 56.934  314.318 177.325 1.00 24.42  ? 199  ILE B N   1 
ATOM   5668  C  CA  . ILE B  2  199 ? 56.032  315.468 177.431 1.00 25.10  ? 199  ILE B CA  1 
ATOM   5669  C  C   . ILE B  2  199 ? 56.675  316.662 176.775 1.00 27.06  ? 199  ILE B C   1 
ATOM   5670  O  O   . ILE B  2  199 ? 57.831  317.028 177.087 1.00 27.97  ? 199  ILE B O   1 
ATOM   5671  C  CB  . ILE B  2  199 ? 55.659  315.794 178.905 1.00 24.61  ? 199  ILE B CB  1 
ATOM   5672  C  CG1 . ILE B  2  199 ? 54.688  317.003 178.907 1.00 26.17  ? 199  ILE B CG1 1 
ATOM   5673  C  CG2 . ILE B  2  199 ? 56.987  316.105 179.691 1.00 25.38  ? 199  ILE B CG2 1 
ATOM   5674  C  CD1 . ILE B  2  199 ? 54.047  317.295 180.454 1.00 23.38  ? 199  ILE B CD1 1 
ATOM   5675  N  N   . CYS B  2  200 ? 55.937  317.286 175.821 1.00 27.73  ? 200  CYS B N   1 
ATOM   5676  C  CA  . CYS B  2  200 ? 56.474  318.302 174.922 1.00 24.73  ? 200  CYS B CA  1 
ATOM   5677  C  C   . CYS B  2  200 ? 55.548  319.503 174.926 1.00 26.92  ? 200  CYS B C   1 
ATOM   5678  O  O   . CYS B  2  200 ? 55.619  320.376 174.030 1.00 30.69  ? 200  CYS B O   1 
ATOM   5679  C  CB  . CYS B  2  200 ? 56.623  317.779 173.469 1.00 22.82  ? 200  CYS B CB  1 
ATOM   5680  S  SG  . CYS B  2  200 ? 55.081  316.838 172.972 1.00 25.48  ? 200  CYS B SG  1 
ATOM   5681  N  N   . GLY B  2  201 ? 54.654  319.541 175.894 1.00 28.53  ? 201  GLY B N   1 
ATOM   5682  C  CA  . GLY B  2  201 ? 53.803  320.707 175.999 1.00 25.71  ? 201  GLY B CA  1 
ATOM   5683  C  C   . GLY B  2  201 ? 52.335  320.389 175.831 1.00 29.63  ? 201  GLY B C   1 
ATOM   5684  O  O   . GLY B  2  201 ? 51.884  319.248 176.002 1.00 28.09  ? 201  GLY B O   1 
ATOM   5685  N  N   . SER B  2  202 ? 51.569  321.407 175.455 1.00 24.54  ? 202  SER B N   1 
ATOM   5686  C  CA  . SER B  2  202 ? 50.119  321.233 175.572 1.00 36.42  ? 202  SER B CA  1 
ATOM   5687  C  C   . SER B  2  202 ? 49.521  320.242 174.558 1.00 38.31  ? 202  SER B C   1 
ATOM   5688  O  O   . SER B  2  202 ? 48.391  319.763 174.767 1.00 35.15  ? 202  SER B O   1 
ATOM   5689  C  CB  . SER B  2  202 ? 49.456  322.599 175.471 1.00 37.13  ? 202  SER B CB  1 
ATOM   5690  O  OG  . SER B  2  202 ? 49.627  323.065 174.157 1.00 39.63  ? 202  SER B OG  1 
ATOM   5691  N  N   . ASN B  2  203 ? 50.204  319.882 173.463 1.00 30.14  ? 203  ASN B N   1 
ATOM   5692  C  CA  . ASN B  2  203 ? 49.585  318.924 172.546 1.00 26.97  ? 203  ASN B CA  1 
ATOM   5693  C  C   . ASN B  2  203 ? 50.382  317.635 172.464 1.00 29.19  ? 203  ASN B C   1 
ATOM   5694  O  O   . ASN B  2  203 ? 50.333  316.899 171.487 1.00 29.75  ? 203  ASN B O   1 
ATOM   5695  C  CB  . ASN B  2  203 ? 49.341  319.566 171.169 1.00 28.29  ? 203  ASN B CB  1 
ATOM   5696  C  CG  . ASN B  2  203 ? 48.050  320.509 171.254 1.00 39.42  ? 203  ASN B CG  1 
ATOM   5697  O  OD1 . ASN B  2  203 ? 47.441  320.753 170.247 1.00 76.49  ? 203  ASN B OD1 1 
ATOM   5698  N  ND2 . ASN B  2  203 ? 47.671  320.938 172.439 1.00 136.20 ? 203  ASN B ND2 1 
ATOM   5699  N  N   . HIS B  2  204 ? 51.092  317.345 173.560 1.00 27.34  ? 204  HIS B N   1 
ATOM   5700  C  CA  . HIS B  2  204 ? 51.783  316.080 173.720 1.00 25.56  ? 204  HIS B CA  1 
ATOM   5701  C  C   . HIS B  2  204 ? 50.898  314.891 173.403 1.00 28.32  ? 204  HIS B C   1 
ATOM   5702  O  O   . HIS B  2  204 ? 51.385  313.892 172.870 1.00 25.98  ? 204  HIS B O   1 
ATOM   5703  C  CB  . HIS B  2  204 ? 52.290  316.059 175.200 1.00 23.37  ? 204  HIS B CB  1 
ATOM   5704  C  CG  . HIS B  2  204 ? 52.905  314.773 175.660 1.00 27.82  ? 204  HIS B CG  1 
ATOM   5705  N  ND1 . HIS B  2  204 ? 53.919  314.113 174.953 1.00 25.25  ? 204  HIS B ND1 1 
ATOM   5706  C  CD2 . HIS B  2  204 ? 52.713  314.077 176.803 1.00 25.37  ? 204  HIS B CD2 1 
ATOM   5707  C  CE1 . HIS B  2  204 ? 54.265  313.038 175.651 1.00 29.46  ? 204  HIS B CE1 1 
ATOM   5708  N  NE2 . HIS B  2  204 ? 53.557  312.991 176.771 1.00 25.72  ? 204  HIS B NE2 1 
ATOM   5709  N  N   . SER B  2  205 ? 49.619  314.932 173.827 1.00 25.22  ? 205  SER B N   1 
ATOM   5710  C  CA  . SER B  2  205 ? 48.715  313.792 173.642 1.00 22.74  ? 205  SER B CA  1 
ATOM   5711  C  C   . SER B  2  205 ? 48.325  313.579 172.183 1.00 25.10  ? 205  SER B C   1 
ATOM   5712  O  O   . SER B  2  205 ? 47.619  312.595 171.906 1.00 26.13  ? 205  SER B O   1 
ATOM   5713  C  CB  . SER B  2  205 ? 47.399  314.023 174.373 1.00 24.26  ? 205  SER B CB  1 
ATOM   5714  O  OG  . SER B  2  205 ? 47.685  314.269 175.785 1.00 26.80  ? 205  SER B OG  1 
ATOM   5715  N  N   . PHE B  2  206 ? 48.688  314.506 171.287 1.00 29.13  ? 206  PHE B N   1 
ATOM   5716  C  CA  . PHE B  2  206 ? 48.025  314.594 169.984 1.00 29.84  ? 206  PHE B CA  1 
ATOM   5717  C  C   . PHE B  2  206 ? 49.005  314.705 168.840 1.00 31.53  ? 206  PHE B C   1 
ATOM   5718  O  O   . PHE B  2  206 ? 48.769  315.490 167.910 1.00 28.65  ? 206  PHE B O   1 
ATOM   5719  C  CB  . PHE B  2  206 ? 47.068  315.790 169.937 1.00 30.18  ? 206  PHE B CB  1 
ATOM   5720  C  CG  . PHE B  2  206 ? 46.111  315.859 171.111 1.00 33.40  ? 206  PHE B CG  1 
ATOM   5721  C  CD1 . PHE B  2  206 ? 45.148  314.887 171.289 1.00 26.18  ? 206  PHE B CD1 1 
ATOM   5722  C  CD2 . PHE B  2  206 ? 46.209  316.905 172.037 1.00 28.14  ? 206  PHE B CD2 1 
ATOM   5723  C  CE1 . PHE B  2  206 ? 44.276  314.899 172.377 1.00 30.51  ? 206  PHE B CE1 1 
ATOM   5724  C  CE2 . PHE B  2  206 ? 45.309  316.972 173.171 1.00 32.68  ? 206  PHE B CE2 1 
ATOM   5725  C  CZ  . PHE B  2  206 ? 44.337  315.943 173.345 1.00 28.97  ? 206  PHE B CZ  1 
ATOM   5726  N  N   . MET B  2  207 ? 50.151  314.005 168.904 1.00 26.55  ? 207  MET B N   1 
ATOM   5727  C  CA  . MET B  2  207 ? 51.045  313.909 167.723 1.00 27.51  ? 207  MET B CA  1 
ATOM   5728  C  C   . MET B  2  207 ? 51.441  312.448 167.532 1.00 27.27  ? 207  MET B C   1 
ATOM   5729  O  O   . MET B  2  207 ? 52.552  312.023 167.839 1.00 26.07  ? 207  MET B O   1 
ATOM   5730  C  CB  . MET B  2  207 ? 52.224  314.857 167.853 1.00 26.12  ? 207  MET B CB  1 
ATOM   5731  C  CG  . MET B  2  207 ? 52.946  314.773 169.251 1.00 26.76  ? 207  MET B CG  1 
ATOM   5732  S  SD  . MET B  2  207 ? 54.306  315.962 169.313 1.00 26.83  ? 207  MET B SD  1 
ATOM   5733  C  CE  . MET B  2  207 ? 55.412  315.236 168.137 1.00 23.87  ? 207  MET B CE  1 
ATOM   5734  N  N   . PRO B  2  208 ? 50.550  311.652 166.959 1.00 26.22  ? 208  PRO B N   1 
ATOM   5735  C  CA  . PRO B  2  208 ? 50.796  310.214 166.852 1.00 29.72  ? 208  PRO B CA  1 
ATOM   5736  C  C   . PRO B  2  208 ? 51.665  309.811 165.653 1.00 30.98  ? 208  PRO B C   1 
ATOM   5737  O  O   . PRO B  2  208 ? 52.066  310.629 164.822 1.00 27.95  ? 208  PRO B O   1 
ATOM   5738  C  CB  . PRO B  2  208 ? 49.374  309.651 166.755 1.00 25.10  ? 208  PRO B CB  1 
ATOM   5739  C  CG  . PRO B  2  208 ? 48.628  310.789 165.921 1.00 26.81  ? 208  PRO B CG  1 
ATOM   5740  C  CD  . PRO B  2  208 ? 49.225  312.077 166.489 1.00 28.74  ? 208  PRO B CD  1 
ATOM   5741  N  N   . ILE B  2  209 ? 51.990  308.529 165.605 1.00 32.43  ? 209  ILE B N   1 
ATOM   5742  C  CA  . ILE B  2  209 ? 52.877  307.951 164.606 1.00 32.62  ? 209  ILE B CA  1 
ATOM   5743  C  C   . ILE B  2  209 ? 52.122  306.834 163.933 1.00 28.56  ? 209  ILE B C   1 
ATOM   5744  O  O   . ILE B  2  209 ? 51.562  305.986 164.640 1.00 27.30  ? 209  ILE B O   1 
ATOM   5745  C  CB  . ILE B  2  209 ? 54.143  307.394 165.259 1.00 29.11  ? 209  ILE B CB  1 
ATOM   5746  C  CG1 . ILE B  2  209 ? 54.979  308.535 165.854 1.00 33.37  ? 209  ILE B CG1 1 
ATOM   5747  C  CG2 . ILE B  2  209 ? 55.020  306.664 164.225 1.00 30.81  ? 209  ILE B CG2 1 
ATOM   5748  C  CD1 . ILE B  2  209 ? 55.294  308.293 167.285 1.00 34.73  ? 209  ILE B CD1 1 
ATOM   5749  N  N   . VAL B  2  210 ? 52.074  306.801 162.599 1.00 27.84  ? 210  VAL B N   1 
ATOM   5750  C  CA  . VAL B  2  210 ? 51.443  305.672 161.925 1.00 30.73  ? 210  VAL B CA  1 
ATOM   5751  C  C   . VAL B  2  210 ? 52.409  305.169 160.864 1.00 30.31  ? 210  VAL B C   1 
ATOM   5752  O  O   . VAL B  2  210 ? 52.748  305.918 159.955 1.00 31.21  ? 210  VAL B O   1 
ATOM   5753  C  CB  . VAL B  2  210 ? 50.102  306.046 161.251 1.00 32.32  ? 210  VAL B CB  1 
ATOM   5754  C  CG1 . VAL B  2  210 ? 49.463  304.802 160.693 1.00 32.12  ? 210  VAL B CG1 1 
ATOM   5755  C  CG2 . VAL B  2  210 ? 49.181  306.779 162.295 1.00 29.05  ? 210  VAL B CG2 1 
ATOM   5756  N  N   . LEU B  2  211 ? 52.827  303.926 160.980 1.00 28.84  ? 211  LEU B N   1 
ATOM   5757  C  CA  . LEU B  2  211 ? 53.670  303.295 159.969 1.00 29.77  ? 211  LEU B CA  1 
ATOM   5758  C  C   . LEU B  2  211 ? 52.782  302.494 159.033 1.00 32.42  ? 211  LEU B C   1 
ATOM   5759  O  O   . LEU B  2  211 ? 51.854  301.798 159.466 1.00 30.91  ? 211  LEU B O   1 
ATOM   5760  C  CB  . LEU B  2  211 ? 54.682  302.330 160.584 1.00 31.37  ? 211  LEU B CB  1 
ATOM   5761  C  CG  . LEU B  2  211 ? 55.465  302.850 161.826 1.00 40.62  ? 211  LEU B CG  1 
ATOM   5762  C  CD1 . LEU B  2  211 ? 56.474  301.780 162.201 1.00 30.44  ? 211  LEU B CD1 1 
ATOM   5763  C  CD2 . LEU B  2  211 ? 56.171  304.180 161.485 1.00 28.47  ? 211  LEU B CD2 1 
ATOM   5764  N  N   . GLU B  2  212 ? 53.070  302.548 157.745 1.00 30.28  ? 212  GLU B N   1 
ATOM   5765  C  CA  . GLU B  2  212 ? 52.298  301.752 156.780 1.00 31.37  ? 212  GLU B CA  1 
ATOM   5766  C  C   . GLU B  2  212 ? 53.313  300.830 156.112 1.00 31.59  ? 212  GLU B C   1 
ATOM   5767  O  O   . GLU B  2  212 ? 54.180  301.320 155.401 1.00 33.66  ? 212  GLU B O   1 
ATOM   5768  C  CB  . GLU B  2  212 ? 51.596  302.648 155.744 1.00 33.18  ? 212  GLU B CB  1 
ATOM   5769  C  CG  . GLU B  2  212 ? 50.858  301.847 154.652 1.00 32.99  ? 212  GLU B CG  1 
ATOM   5770  C  CD  . GLU B  2  212 ? 49.944  302.733 153.813 1.00 45.61  ? 212  GLU B CD  1 
ATOM   5771  O  OE1 . GLU B  2  212 ? 48.927  303.291 154.337 1.00 35.59  ? 212  GLU B OE1 1 
ATOM   5772  O  OE2 . GLU B  2  212 ? 50.244  302.870 152.624 1.00 38.50  ? 212  GLU B OE2 1 
ATOM   5773  N  N   . LEU B  2  213 ? 53.202  299.520 156.335 1.00 34.41  ? 213  LEU B N   1 
ATOM   5774  C  CA  . LEU B  2  213 ? 54.217  298.552 155.914 1.00 30.70  ? 213  LEU B CA  1 
ATOM   5775  C  C   . LEU B  2  213 ? 53.673  297.833 154.683 1.00 28.21  ? 213  LEU B C   1 
ATOM   5776  O  O   . LEU B  2  213 ? 52.633  297.175 154.745 1.00 33.48  ? 213  LEU B O   1 
ATOM   5777  C  CB  . LEU B  2  213 ? 54.555  297.523 157.013 1.00 30.24  ? 213  LEU B CB  1 
ATOM   5778  C  CG  . LEU B  2  213 ? 55.622  297.989 158.038 1.00 38.11  ? 213  LEU B CG  1 
ATOM   5779  C  CD1 . LEU B  2  213 ? 56.996  298.066 157.398 1.00 31.87  ? 213  LEU B CD1 1 
ATOM   5780  C  CD2 . LEU B  2  213 ? 55.272  299.307 158.557 1.00 33.14  ? 213  LEU B CD2 1 
ATOM   5781  N  N   . VAL B  2  214 ? 54.377  297.957 153.572 1.00 29.13  ? 214  VAL B N   1 
ATOM   5782  C  CA  . VAL B  2  214 ? 53.874  297.407 152.296 1.00 34.12  ? 214  VAL B CA  1 
ATOM   5783  C  C   . VAL B  2  214 ? 55.037  296.766 151.543 1.00 37.98  ? 214  VAL B C   1 
ATOM   5784  O  O   . VAL B  2  214 ? 56.193  296.958 151.938 1.00 33.74  ? 214  VAL B O   1 
ATOM   5785  C  CB  . VAL B  2  214 ? 53.227  298.493 151.407 1.00 34.75  ? 214  VAL B CB  1 
ATOM   5786  C  CG1 . VAL B  2  214 ? 51.956  299.083 152.058 1.00 33.70  ? 214  VAL B CG1 1 
ATOM   5787  C  CG2 . VAL B  2  214 ? 54.328  299.562 150.971 1.00 31.51  ? 214  VAL B CG2 1 
ATOM   5788  N  N   . PRO B  2  215 ? 54.791  296.010 150.461 1.00 38.92  ? 215  PRO B N   1 
ATOM   5789  C  CA  . PRO B  2  215 ? 55.893  295.437 149.680 1.00 34.44  ? 215  PRO B CA  1 
ATOM   5790  C  C   . PRO B  2  215 ? 56.769  296.525 149.104 1.00 39.45  ? 215  PRO B C   1 
ATOM   5791  O  O   . PRO B  2  215 ? 56.296  297.616 148.742 1.00 38.06  ? 215  PRO B O   1 
ATOM   5792  C  CB  . PRO B  2  215 ? 55.168  294.664 148.539 1.00 33.65  ? 215  PRO B CB  1 
ATOM   5793  C  CG  . PRO B  2  215 ? 53.828  294.260 149.241 1.00 35.58  ? 215  PRO B CG  1 
ATOM   5794  C  CD  . PRO B  2  215 ? 53.492  295.508 149.989 1.00 36.84  ? 215  PRO B CD  1 
ATOM   5795  N  N   . LEU B  2  216 ? 58.042  296.164 148.933 1.00 35.40  ? 216  LEU B N   1 
ATOM   5796  C  CA  . LEU B  2  216 ? 59.032  297.080 148.364 1.00 38.88  ? 216  LEU B CA  1 
ATOM   5797  C  C   . LEU B  2  216 ? 58.553  297.828 147.090 1.00 41.94  ? 216  LEU B C   1 
ATOM   5798  O  O   . LEU B  2  216 ? 58.757  299.046 146.962 1.00 32.57  ? 216  LEU B O   1 
ATOM   5799  C  CB  . LEU B  2  216 ? 60.329  296.308 148.099 1.00 39.28  ? 216  LEU B CB  1 
ATOM   5800  C  CG  . LEU B  2  216 ? 61.416  297.207 147.478 1.00 46.53  ? 216  LEU B CG  1 
ATOM   5801  C  CD1 . LEU B  2  216 ? 61.808  298.358 148.466 1.00 38.17  ? 216  LEU B CD1 1 
ATOM   5802  C  CD2 . LEU B  2  216 ? 62.634  296.373 147.072 1.00 37.02  ? 216  LEU B CD2 1 
ATOM   5803  N  N   . LYS B  2  217 ? 57.971  297.127 146.097 1.00 32.80  ? 217  LYS B N   1 
ATOM   5804  C  CA  . LYS B  2  217 ? 57.692  297.854 144.845 1.00 34.00  ? 217  LYS B CA  1 
ATOM   5805  C  C   . LYS B  2  217 ? 56.580  298.878 145.038 1.00 45.16  ? 217  LYS B C   1 
ATOM   5806  O  O   . LYS B  2  217 ? 56.595  299.942 144.406 1.00 38.94  ? 217  LYS B O   1 
ATOM   5807  C  CB  . LYS B  2  217 ? 57.313  296.877 143.740 1.00 37.63  ? 217  LYS B CB  1 
ATOM   5808  C  CG  . LYS B  2  217 ? 58.520  296.151 143.155 1.00 172.56 ? 217  LYS B CG  1 
ATOM   5809  C  CD  . LYS B  2  217 ? 58.092  294.987 142.297 1.00 124.83 ? 217  LYS B CD  1 
ATOM   5810  C  CE  . LYS B  2  217 ? 59.237  294.026 142.061 1.00 156.80 ? 217  LYS B CE  1 
ATOM   5811  N  NZ  . LYS B  2  217 ? 58.758  292.714 141.540 1.00 125.00 ? 217  LYS B NZ  1 
ATOM   5812  N  N   . TYR B  2  218 ? 55.665  298.611 145.977 1.00 36.43  ? 218  TYR B N   1 
ATOM   5813  C  CA  . TYR B  2  218 ? 54.697  299.629 146.387 1.00 38.63  ? 218  TYR B CA  1 
ATOM   5814  C  C   . TYR B  2  218 ? 55.364  300.793 147.072 1.00 38.63  ? 218  TYR B C   1 
ATOM   5815  O  O   . TYR B  2  218 ? 55.046  301.948 146.767 1.00 37.16  ? 218  TYR B O   1 
ATOM   5816  C  CB  . TYR B  2  218 ? 53.606  299.052 147.286 1.00 36.13  ? 218  TYR B CB  1 
ATOM   5817  C  CG  . TYR B  2  218 ? 52.571  298.253 146.470 1.00 39.86  ? 218  TYR B CG  1 
ATOM   5818  C  CD1 . TYR B  2  218 ? 52.731  296.902 146.296 1.00 34.10  ? 218  TYR B CD1 1 
ATOM   5819  C  CD2 . TYR B  2  218 ? 51.439  298.854 145.903 1.00 40.42  ? 218  TYR B CD2 1 
ATOM   5820  C  CE1 . TYR B  2  218 ? 51.801  296.138 145.563 1.00 34.82  ? 218  TYR B CE1 1 
ATOM   5821  C  CE2 . TYR B  2  218 ? 50.486  298.091 145.145 1.00 45.83  ? 218  TYR B CE2 1 
ATOM   5822  C  CZ  . TYR B  2  218 ? 50.677  296.732 145.015 1.00 40.91  ? 218  TYR B CZ  1 
ATOM   5823  O  OH  . TYR B  2  218 ? 49.808  295.889 144.331 1.00 46.85  ? 218  TYR B OH  1 
ATOM   5824  N  N   . PHE B  2  219 ? 56.319  300.516 147.978 1.00 36.07  ? 219  PHE B N   1 
ATOM   5825  C  CA  . PHE B  2  219 ? 57.053  301.591 148.619 1.00 31.44  ? 219  PHE B CA  1 
ATOM   5826  C  C   . PHE B  2  219 ? 57.796  302.441 147.604 1.00 33.35  ? 219  PHE B C   1 
ATOM   5827  O  O   . PHE B  2  219 ? 57.845  303.676 147.718 1.00 31.04  ? 219  PHE B O   1 
ATOM   5828  C  CB  . PHE B  2  219 ? 58.016  301.014 149.709 1.00 32.44  ? 219  PHE B CB  1 
ATOM   5829  C  CG  . PHE B  2  219 ? 59.018  302.005 150.199 1.00 33.70  ? 219  PHE B CG  1 
ATOM   5830  C  CD1 . PHE B  2  219 ? 58.644  302.969 151.151 1.00 29.10  ? 219  PHE B CD1 1 
ATOM   5831  C  CD2 . PHE B  2  219 ? 60.322  302.010 149.707 1.00 37.27  ? 219  PHE B CD2 1 
ATOM   5832  C  CE1 . PHE B  2  219 ? 59.583  303.928 151.558 1.00 30.98  ? 219  PHE B CE1 1 
ATOM   5833  C  CE2 . PHE B  2  219 ? 61.251  302.936 150.130 1.00 38.66  ? 219  PHE B CE2 1 
ATOM   5834  C  CZ  . PHE B  2  219 ? 60.908  303.887 151.079 1.00 33.98  ? 219  PHE B CZ  1 
ATOM   5835  N  N   . GLU B  2  220 ? 58.428  301.816 146.611 1.00 32.03  ? 220  GLU B N   1 
ATOM   5836  C  CA  . GLU B  2  220 ? 59.174  302.594 145.628 1.00 36.28  ? 220  GLU B CA  1 
ATOM   5837  C  C   . GLU B  2  220 ? 58.266  303.572 144.872 1.00 44.19  ? 220  GLU B C   1 
ATOM   5838  O  O   . GLU B  2  220 ? 58.623  304.734 144.657 1.00 33.15  ? 220  GLU B O   1 
ATOM   5839  C  CB  . GLU B  2  220 ? 59.890  301.632 144.649 1.00 42.66  ? 220  GLU B CB  1 
ATOM   5840  C  CG  . GLU B  2  220 ? 61.086  300.864 145.334 1.00 39.47  ? 220  GLU B CG  1 
ATOM   5841  C  CD  . GLU B  2  220 ? 61.583  299.632 144.467 1.00 40.56  ? 220  GLU B CD  1 
ATOM   5842  O  OE1 . GLU B  2  220 ? 62.740  299.228 144.629 1.00 76.57  ? 220  GLU B OE1 1 
ATOM   5843  O  OE2 . GLU B  2  220 ? 60.776  299.075 143.672 1.00 49.68  ? 220  GLU B OE2 1 
ATOM   5844  N  N   . LYS B  2  221 ? 57.106  303.108 144.440 1.00 36.58  ? 221  LYS B N   1 
ATOM   5845  C  CA  . LYS B  2  221 ? 56.212  303.958 143.653 1.00 39.17  ? 221  LYS B CA  1 
ATOM   5846  C  C   . LYS B  2  221 ? 55.606  305.060 144.511 1.00 35.33  ? 221  LYS B C   1 
ATOM   5847  O  O   . LYS B  2  221 ? 55.508  306.218 144.082 1.00 35.38  ? 221  LYS B O   1 
ATOM   5848  C  CB  . LYS B  2  221 ? 55.135  303.086 143.032 1.00 35.67  ? 221  LYS B CB  1 
ATOM   5849  C  CG  . LYS B  2  221 ? 55.708  302.280 141.829 1.00 31.66  ? 221  LYS B CG  1 
ATOM   5850  C  CD  . LYS B  2  221 ? 54.730  301.197 141.355 1.00 45.25  ? 221  LYS B CD  1 
ATOM   5851  C  CE  . LYS B  2  221 ? 55.241  300.448 140.067 1.00 49.42  ? 221  LYS B CE  1 
ATOM   5852  N  NZ  . LYS B  2  221 ? 54.280  299.348 139.772 1.00 135.74 ? 221  LYS B NZ  1 
ATOM   5853  N  N   . TRP B  2  222 ? 55.291  304.731 145.757 1.00 33.15  ? 222  TRP B N   1 
ATOM   5854  C  CA  . TRP B  2  222 ? 54.833  305.732 146.710 1.00 37.95  ? 222  TRP B CA  1 
ATOM   5855  C  C   . TRP B  2  222 ? 55.872  306.815 146.905 1.00 33.25  ? 222  TRP B C   1 
ATOM   5856  O  O   . TRP B  2  222 ? 55.562  308.013 146.800 1.00 34.06  ? 222  TRP B O   1 
ATOM   5857  C  CB  . TRP B  2  222 ? 54.520  305.054 148.046 1.00 38.66  ? 222  TRP B CB  1 
ATOM   5858  C  CG  . TRP B  2  222 ? 54.263  306.072 149.167 1.00 32.33  ? 222  TRP B CG  1 
ATOM   5859  C  CD1 . TRP B  2  222 ? 53.078  306.750 149.416 1.00 30.51  ? 222  TRP B CD1 1 
ATOM   5860  C  CD2 . TRP B  2  222 ? 55.223  306.565 150.126 1.00 28.80  ? 222  TRP B CD2 1 
ATOM   5861  N  NE1 . TRP B  2  222 ? 53.243  307.585 150.528 1.00 36.25  ? 222  TRP B NE1 1 
ATOM   5862  C  CE2 . TRP B  2  222 ? 54.559  307.530 150.943 1.00 47.94  ? 222  TRP B CE2 1 
ATOM   5863  C  CE3 . TRP B  2  222 ? 56.600  306.329 150.320 1.00 31.72  ? 222  TRP B CE3 1 
ATOM   5864  C  CZ2 . TRP B  2  222 ? 55.213  308.194 152.021 1.00 35.39  ? 222  TRP B CZ2 1 
ATOM   5865  C  CZ3 . TRP B  2  222 ? 57.260  306.981 151.363 1.00 34.21  ? 222  TRP B CZ3 1 
ATOM   5866  C  CH2 . TRP B  2  222 ? 56.572  307.919 152.213 1.00 33.95  ? 222  TRP B CH2 1 
ATOM   5867  N  N   . SER B  2  223 ? 57.142  306.408 147.080 1.00 31.48  ? 223  SER B N   1 
ATOM   5868  C  CA  . SER B  2  223 ? 58.227  307.374 147.230 1.00 33.16  ? 223  SER B CA  1 
ATOM   5869  C  C   . SER B  2  223 ? 58.318  308.291 146.042 1.00 40.90  ? 223  SER B C   1 
ATOM   5870  O  O   . SER B  2  223 ? 58.475  309.512 146.202 1.00 31.49  ? 223  SER B O   1 
ATOM   5871  C  CB  . SER B  2  223 ? 59.602  306.683 147.410 1.00 34.96  ? 223  SER B CB  1 
ATOM   5872  O  OG  . SER B  2  223 ? 59.533  305.961 148.633 1.00 40.89  ? 223  SER B OG  1 
ATOM   5873  N  N   . ALA B  2  224 ? 58.354  307.706 144.842 1.00 31.84  ? 224  ALA B N   1 
ATOM   5874  C  CA  . ALA B  2  224 ? 58.442  308.496 143.616 1.00 31.95  ? 224  ALA B CA  1 
ATOM   5875  C  C   . ALA B  2  224 ? 57.310  309.520 143.561 1.00 40.90  ? 224  ALA B C   1 
ATOM   5876  O  O   . ALA B  2  224 ? 57.535  310.688 143.229 1.00 34.06  ? 224  ALA B O   1 
ATOM   5877  C  CB  . ALA B  2  224 ? 58.364  307.554 142.398 1.00 34.81  ? 224  ALA B CB  1 
ATOM   5878  N  N   . SER B  2  225 ? 56.084  309.086 143.922 1.00 33.84  ? 225  SER B N   1 
ATOM   5879  C  CA  . SER B  2  225 ? 54.889  309.931 143.857 1.00 46.25  ? 225  SER B CA  1 
ATOM   5880  C  C   . SER B  2  225 ? 54.895  311.033 144.922 1.00 50.17  ? 225  SER B C   1 
ATOM   5881  O  O   . SER B  2  225 ? 54.103  311.978 144.810 1.00 37.55  ? 225  SER B O   1 
ATOM   5882  C  CB  . SER B  2  225 ? 53.594  309.066 143.992 1.00 33.39  ? 225  SER B CB  1 
ATOM   5883  O  OG  . SER B  2  225 ? 53.381  308.783 145.390 1.00 42.26  ? 225  SER B OG  1 
ATOM   5884  N  N   . MET B  2  226 ? 55.720  310.921 145.981 1.00 33.40  ? 226  MET B N   1 
ATOM   5885  C  CA  . MET B  2  226 ? 55.748  311.928 147.034 1.00 33.41  ? 226  MET B CA  1 
ATOM   5886  C  C   . MET B  2  226 ? 56.790  313.012 146.798 1.00 49.77  ? 226  MET B C   1 
ATOM   5887  O  O   . MET B  2  226 ? 56.907  313.914 147.623 1.00 45.20  ? 226  MET B O   1 
ATOM   5888  C  CB  . MET B  2  226 ? 56.015  311.246 148.386 1.00 31.82  ? 226  MET B CB  1 
ATOM   5889  C  CG  . MET B  2  226 ? 54.826  310.449 148.923 1.00 35.84  ? 226  MET B CG  1 
ATOM   5890  S  SD  . MET B  2  226 ? 53.489  311.524 149.507 1.00 40.61  ? 226  MET B SD  1 
ATOM   5891  C  CE  . MET B  2  226 ? 54.108  311.993 151.209 1.00 35.76  ? 226  MET B CE  1 
ATOM   5892  N  N   . LEU B  2  227 ? 57.538  312.966 145.693 1.00 39.75  ? 227  LEU B N   1 
ATOM   5893  C  CA  . LEU B  2  227 ? 58.577  313.950 145.472 1.00 39.75  ? 227  LEU B CA  1 
ATOM   5894  C  C   . LEU B  2  227 ? 58.014  315.331 145.213 1.00 69.35  ? 227  LEU B C   1 
ATOM   5895  O  O   . LEU B  2  227 ? 58.766  316.295 145.180 1.00 51.23  ? 227  LEU B O   1 
ATOM   5896  C  CB  . LEU B  2  227 ? 59.477  313.547 144.327 1.00 38.05  ? 227  LEU B CB  1 
ATOM   5897  C  CG  . LEU B  2  227 ? 60.252  312.281 144.626 1.00 50.51  ? 227  LEU B CG  1 
ATOM   5898  C  CD1 . LEU B  2  227 ? 61.275  312.085 143.504 1.00 44.19  ? 227  LEU B CD1 1 
ATOM   5899  C  CD2 . LEU B  2  227 ? 60.940  312.435 145.988 1.00 42.66  ? 227  LEU B CD2 1 
ATOM   5900  O  OXT . LEU B  2  227 ? 56.803  315.530 145.034 1.00 47.13  ? 227  LEU B OXT 1 
ATOM   5901  N  N   . HIS C  3  3   ? 66.389  322.344 236.395 1.00 66.23  ? 3    HIS C N   1 
ATOM   5902  C  CA  . HIS C  3  3   ? 67.788  322.494 236.025 1.00 124.71 ? 3    HIS C CA  1 
ATOM   5903  C  C   . HIS C  3  3   ? 68.283  321.268 235.233 1.00 56.33  ? 3    HIS C C   1 
ATOM   5904  O  O   . HIS C  3  3   ? 68.085  320.123 235.595 1.00 54.79  ? 3    HIS C O   1 
ATOM   5905  C  CB  . HIS C  3  3   ? 68.676  322.724 237.264 1.00 71.55  ? 3    HIS C CB  1 
ATOM   5906  C  CG  . HIS C  3  3   ? 70.127  322.923 236.925 1.00 174.55 ? 3    HIS C CG  1 
ATOM   5907  N  ND1 . HIS C  3  3   ? 71.153  322.630 237.798 1.00 148.97 ? 3    HIS C ND1 1 
ATOM   5908  C  CD2 . HIS C  3  3   ? 70.719  323.370 235.790 1.00 195.08 ? 3    HIS C CD2 1 
ATOM   5909  C  CE1 . HIS C  3  3   ? 72.312  322.889 237.217 1.00 148.65 ? 3    HIS C CE1 1 
ATOM   5910  N  NE2 . HIS C  3  3   ? 72.076  323.336 235.996 1.00 91.43  ? 3    HIS C NE2 1 
ATOM   5911  N  N   . GLN C  3  4   ? 68.952  321.511 234.129 1.00 38.94  ? 4    GLN C N   1 
ATOM   5912  C  CA  . GLN C  3  4   ? 69.428  320.384 233.324 1.00 34.54  ? 4    GLN C CA  1 
ATOM   5913  C  C   . GLN C  3  4   ? 70.649  319.755 233.982 1.00 32.66  ? 4    GLN C C   1 
ATOM   5914  O  O   . GLN C  3  4   ? 71.453  320.426 234.613 1.00 31.67  ? 4    GLN C O   1 
ATOM   5915  C  CB  . GLN C  3  4   ? 69.750  320.850 231.880 1.00 37.03  ? 4    GLN C CB  1 
ATOM   5916  C  CG  . GLN C  3  4   ? 71.006  321.742 231.751 1.00 33.86  ? 4    GLN C CG  1 
ATOM   5917  C  CD  . GLN C  3  4   ? 71.275  322.262 230.339 1.00 31.39  ? 4    GLN C CD  1 
ATOM   5918  O  OE1 . GLN C  3  4   ? 70.493  323.052 229.822 1.00 35.47  ? 4    GLN C OE1 1 
ATOM   5919  N  NE2 . GLN C  3  4   ? 72.435  321.882 229.750 1.00 33.53  ? 4    GLN C NE2 1 
ATOM   5920  N  N   . THR C  3  5   ? 70.812  318.465 233.805 1.00 30.46  ? 5    THR C N   1 
ATOM   5921  C  CA  . THR C  3  5   ? 72.111  317.872 234.090 1.00 33.96  ? 5    THR C CA  1 
ATOM   5922  C  C   . THR C  3  5   ? 72.702  317.117 232.886 1.00 30.09  ? 5    THR C C   1 
ATOM   5923  O  O   . THR C  3  5   ? 73.455  316.154 233.042 1.00 37.70  ? 5    THR C O   1 
ATOM   5924  C  CB  . THR C  3  5   ? 72.001  316.953 235.290 1.00 39.70  ? 5    THR C CB  1 
ATOM   5925  O  OG1 . THR C  3  5   ? 71.007  315.971 235.001 1.00 33.89  ? 5    THR C OG1 1 
ATOM   5926  C  CG2 . THR C  3  5   ? 71.600  317.769 236.603 1.00 38.68  ? 5    THR C CG2 1 
ATOM   5927  N  N   . HIS C  3  6   ? 72.377  317.528 231.658 1.00 29.20  ? 6    HIS C N   1 
ATOM   5928  C  CA  . HIS C  3  6   ? 73.241  317.205 230.523 1.00 31.59  ? 6    HIS C CA  1 
ATOM   5929  C  C   . HIS C  3  6   ? 74.044  318.459 230.144 1.00 38.97  ? 6    HIS C C   1 
ATOM   5930  O  O   . HIS C  3  6   ? 73.789  319.561 230.631 1.00 32.15  ? 6    HIS C O   1 
ATOM   5931  C  CB  . HIS C  3  6   ? 72.354  316.737 229.335 1.00 24.25  ? 6    HIS C CB  1 
ATOM   5932  C  CG  . HIS C  3  6   ? 71.372  317.802 228.950 1.00 29.62  ? 6    HIS C CG  1 
ATOM   5933  N  ND1 . HIS C  3  6   ? 71.752  318.944 228.261 1.00 29.39  ? 6    HIS C ND1 1 
ATOM   5934  C  CD2 . HIS C  3  6   ? 70.057  317.935 229.209 1.00 27.61  ? 6    HIS C CD2 1 
ATOM   5935  C  CE1 . HIS C  3  6   ? 70.694  319.736 228.109 1.00 26.86  ? 6    HIS C CE1 1 
ATOM   5936  N  NE2 . HIS C  3  6   ? 69.650  319.133 228.657 1.00 30.14  ? 6    HIS C NE2 1 
ATOM   5937  N  N   . ALA C  3  7   ? 74.973  318.308 229.197 1.00 31.23  ? 7    ALA C N   1 
ATOM   5938  C  CA  . ALA C  3  7   ? 75.818  319.437 228.778 1.00 33.11  ? 7    ALA C CA  1 
ATOM   5939  C  C   . ALA C  3  7   ? 75.340  320.185 227.518 1.00 35.48  ? 7    ALA C C   1 
ATOM   5940  O  O   . ALA C  3  7   ? 76.087  321.068 227.018 1.00 31.48  ? 7    ALA C O   1 
ATOM   5941  C  CB  . ALA C  3  7   ? 77.260  318.960 228.590 1.00 33.38  ? 7    ALA C CB  1 
ATOM   5942  N  N   . TYR C  3  8   ? 74.129  319.905 227.015 1.00 30.84  ? 8    TYR C N   1 
ATOM   5943  C  CA  . TYR C  3  8   ? 73.720  320.448 225.713 1.00 27.76  ? 8    TYR C CA  1 
ATOM   5944  C  C   . TYR C  3  8   ? 73.013  321.786 225.853 1.00 34.98  ? 8    TYR C C   1 
ATOM   5945  O  O   . TYR C  3  8   ? 72.588  322.177 226.936 1.00 35.79  ? 8    TYR C O   1 
ATOM   5946  C  CB  . TYR C  3  8   ? 72.842  319.472 224.955 1.00 25.54  ? 8    TYR C CB  1 
ATOM   5947  C  CG  . TYR C  3  8   ? 73.650  318.240 224.638 1.00 28.97  ? 8    TYR C CG  1 
ATOM   5948  C  CD1 . TYR C  3  8   ? 74.590  318.212 223.556 1.00 27.59  ? 8    TYR C CD1 1 
ATOM   5949  C  CD2 . TYR C  3  8   ? 73.475  317.078 225.397 1.00 32.59  ? 8    TYR C CD2 1 
ATOM   5950  C  CE1 . TYR C  3  8   ? 75.379  317.026 223.310 1.00 26.29  ? 8    TYR C CE1 1 
ATOM   5951  C  CE2 . TYR C  3  8   ? 74.253  315.933 225.169 1.00 37.14  ? 8    TYR C CE2 1 
ATOM   5952  C  CZ  . TYR C  3  8   ? 75.148  315.900 224.106 1.00 37.77  ? 8    TYR C CZ  1 
ATOM   5953  O  OH  . TYR C  3  8   ? 75.856  314.733 223.954 1.00 39.04  ? 8    TYR C OH  1 
ATOM   5954  N  N   . HIS C  3  9   ? 72.865  322.488 224.721 1.00 31.19  ? 9    HIS C N   1 
ATOM   5955  C  CA  . HIS C  3  9   ? 72.442  323.885 224.764 1.00 31.90  ? 9    HIS C CA  1 
ATOM   5956  C  C   . HIS C  3  9   ? 70.972  324.007 224.350 1.00 40.30  ? 9    HIS C C   1 
ATOM   5957  O  O   . HIS C  3  9   ? 70.620  323.794 223.184 1.00 32.04  ? 9    HIS C O   1 
ATOM   5958  C  CB  . HIS C  3  9   ? 73.355  324.719 223.851 1.00 30.54  ? 9    HIS C CB  1 
ATOM   5959  C  CG  . HIS C  3  9   ? 73.015  326.179 223.828 1.00 38.19  ? 9    HIS C CG  1 
ATOM   5960  N  ND1 . HIS C  3  9   ? 73.465  327.039 222.840 1.00 32.28  ? 9    HIS C ND1 1 
ATOM   5961  C  CD2 . HIS C  3  9   ? 72.340  326.945 224.705 1.00 31.33  ? 9    HIS C CD2 1 
ATOM   5962  C  CE1 . HIS C  3  9   ? 73.008  328.257 223.079 1.00 32.37  ? 9    HIS C CE1 1 
ATOM   5963  N  NE2 . HIS C  3  9   ? 72.334  328.232 224.222 1.00 34.21  ? 9    HIS C NE2 1 
ATOM   5964  N  N   . MET C  3  10  ? 70.117  324.388 225.295 1.00 33.26  ? 10   MET C N   1 
ATOM   5965  C  CA  . MET C  3  10  ? 68.724  324.741 225.002 1.00 35.95  ? 10   MET C CA  1 
ATOM   5966  C  C   . MET C  3  10  ? 68.691  326.221 224.609 1.00 38.95  ? 10   MET C C   1 
ATOM   5967  O  O   . MET C  3  10  ? 69.021  327.093 225.408 1.00 35.53  ? 10   MET C O   1 
ATOM   5968  C  CB  . MET C  3  10  ? 67.829  324.443 226.212 1.00 38.29  ? 10   MET C CB  1 
ATOM   5969  C  CG  . MET C  3  10  ? 67.891  322.941 226.657 1.00 38.64  ? 10   MET C CG  1 
ATOM   5970  S  SD  . MET C  3  10  ? 67.171  321.747 225.454 1.00 39.86  ? 10   MET C SD  1 
ATOM   5971  C  CE  . MET C  3  10  ? 68.609  321.146 224.591 1.00 36.87  ? 10   MET C CE  1 
ATOM   5972  N  N   . VAL C  3  11  ? 68.330  326.505 223.396 1.00 33.60  ? 11   VAL C N   1 
ATOM   5973  C  CA  . VAL C  3  11  ? 68.446  327.870 222.876 1.00 32.70  ? 11   VAL C CA  1 
ATOM   5974  C  C   . VAL C  3  11  ? 67.189  328.657 223.229 1.00 32.62  ? 11   VAL C C   1 
ATOM   5975  O  O   . VAL C  3  11  ? 66.080  328.120 223.206 1.00 31.29  ? 11   VAL C O   1 
ATOM   5976  C  CB  . VAL C  3  11  ? 68.685  327.810 221.353 1.00 35.35  ? 11   VAL C CB  1 
ATOM   5977  C  CG1 . VAL C  3  11  ? 68.735  329.226 220.739 1.00 28.88  ? 11   VAL C CG1 1 
ATOM   5978  C  CG2 . VAL C  3  11  ? 69.947  326.926 221.117 1.00 30.20  ? 11   VAL C CG2 1 
ATOM   5979  N  N   . ASN C  3  12  ? 67.362  329.939 223.534 1.00 30.16  ? 12   ASN C N   1 
ATOM   5980  C  CA  . ASN C  3  12  ? 66.206  330.790 223.781 1.00 29.95  ? 12   ASN C CA  1 
ATOM   5981  C  C   . ASN C  3  12  ? 65.361  330.910 222.511 1.00 33.79  ? 12   ASN C C   1 
ATOM   5982  O  O   . ASN C  3  12  ? 65.920  331.008 221.411 1.00 30.97  ? 12   ASN C O   1 
ATOM   5983  C  CB  . ASN C  3  12  ? 66.620  332.217 224.159 1.00 26.21  ? 12   ASN C CB  1 
ATOM   5984  C  CG  . ASN C  3  12  ? 67.411  332.335 225.498 1.00 40.29  ? 12   ASN C CG  1 
ATOM   5985  O  OD1 . ASN C  3  12  ? 68.004  333.388 225.727 1.00 33.42  ? 12   ASN C OD1 1 
ATOM   5986  N  ND2 . ASN C  3  12  ? 67.441  331.285 226.329 1.00 32.20  ? 12   ASN C ND2 1 
ATOM   5987  N  N   . PRO C  3  13  ? 64.030  331.011 222.647 1.00 31.56  ? 13   PRO C N   1 
ATOM   5988  C  CA  . PRO C  3  13  ? 63.184  331.203 221.460 1.00 29.92  ? 13   PRO C CA  1 
ATOM   5989  C  C   . PRO C  3  13  ? 63.697  332.400 220.688 1.00 34.57  ? 13   PRO C C   1 
ATOM   5990  O  O   . PRO C  3  13  ? 64.032  333.432 221.273 1.00 30.51  ? 13   PRO C O   1 
ATOM   5991  C  CB  . PRO C  3  13  ? 61.772  331.461 222.040 1.00 28.99  ? 13   PRO C CB  1 
ATOM   5992  C  CG  . PRO C  3  13  ? 61.765  330.820 223.430 1.00 30.30  ? 13   PRO C CG  1 
ATOM   5993  C  CD  . PRO C  3  13  ? 63.260  330.902 223.928 1.00 34.22  ? 13   PRO C CD  1 
ATOM   5994  N  N   . SER C  3  14  ? 63.816  332.242 219.368 1.00 30.13  ? 14   SER C N   1 
ATOM   5995  C  CA  . SER C  3  14  ? 64.498  333.219 218.523 1.00 31.50  ? 14   SER C CA  1 
ATOM   5996  C  C   . SER C  3  14  ? 63.624  333.596 217.328 1.00 28.51  ? 14   SER C C   1 
ATOM   5997  O  O   . SER C  3  14  ? 63.010  332.722 216.719 1.00 32.57  ? 14   SER C O   1 
ATOM   5998  C  CB  . SER C  3  14  ? 65.839  332.642 218.027 1.00 29.45  ? 14   SER C CB  1 
ATOM   5999  O  OG  . SER C  3  14  ? 66.478  333.583 217.121 1.00 30.54  ? 14   SER C OG  1 
ATOM   6000  N  N   . PRO C  3  15  ? 63.580  334.880 216.943 1.00 30.83  ? 15   PRO C N   1 
ATOM   6001  C  CA  . PRO C  3  15  ? 62.917  335.268 215.682 1.00 33.31  ? 15   PRO C CA  1 
ATOM   6002  C  C   . PRO C  3  15  ? 63.750  335.062 214.421 1.00 32.87  ? 15   PRO C C   1 
ATOM   6003  O  O   . PRO C  3  15  ? 63.207  335.271 213.326 1.00 30.29  ? 15   PRO C O   1 
ATOM   6004  C  CB  . PRO C  3  15  ? 62.680  336.766 215.854 1.00 27.93  ? 15   PRO C CB  1 
ATOM   6005  C  CG  . PRO C  3  15  ? 63.948  337.197 216.700 1.00 39.20  ? 15   PRO C CG  1 
ATOM   6006  C  CD  . PRO C  3  15  ? 64.285  336.020 217.580 1.00 29.97  ? 15   PRO C CD  1 
ATOM   6007  N  N   . TRP C  3  16  ? 65.055  334.742 214.527 1.00 30.31  ? 16   TRP C N   1 
ATOM   6008  C  CA  . TRP C  3  16  ? 65.877  334.787 213.314 1.00 27.27  ? 16   TRP C CA  1 
ATOM   6009  C  C   . TRP C  3  16  ? 65.579  333.673 212.322 1.00 26.71  ? 16   TRP C C   1 
ATOM   6010  O  O   . TRP C  3  16  ? 65.775  333.893 211.120 1.00 30.23  ? 16   TRP C O   1 
ATOM   6011  C  CB  . TRP C  3  16  ? 67.388  334.813 213.667 1.00 34.13  ? 16   TRP C CB  1 
ATOM   6012  C  CG  . TRP C  3  16  ? 67.701  335.886 214.747 1.00 33.90  ? 16   TRP C CG  1 
ATOM   6013  C  CD1 . TRP C  3  16  ? 68.491  335.715 215.840 1.00 26.84  ? 16   TRP C CD1 1 
ATOM   6014  C  CD2 . TRP C  3  16  ? 67.209  337.245 214.809 1.00 38.11  ? 16   TRP C CD2 1 
ATOM   6015  N  NE1 . TRP C  3  16  ? 68.526  336.885 216.591 1.00 33.25  ? 16   TRP C NE1 1 
ATOM   6016  C  CE2 . TRP C  3  16  ? 67.725  337.822 215.997 1.00 27.17  ? 16   TRP C CE2 1 
ATOM   6017  C  CE3 . TRP C  3  16  ? 66.362  338.013 213.999 1.00 31.62  ? 16   TRP C CE3 1 
ATOM   6018  C  CZ2 . TRP C  3  16  ? 67.453  339.159 216.375 1.00 30.64  ? 16   TRP C CZ2 1 
ATOM   6019  C  CZ3 . TRP C  3  16  ? 66.069  339.345 214.376 1.00 32.21  ? 16   TRP C CZ3 1 
ATOM   6020  C  CH2 . TRP C  3  16  ? 66.630  339.899 215.568 1.00 28.45  ? 16   TRP C CH2 1 
ATOM   6021  N  N   . PRO C  3  17  ? 65.193  332.457 212.753 1.00 32.50  ? 17   PRO C N   1 
ATOM   6022  C  CA  . PRO C  3  17  ? 64.734  331.467 211.762 1.00 32.32  ? 17   PRO C CA  1 
ATOM   6023  C  C   . PRO C  3  17  ? 63.636  332.042 210.874 1.00 32.70  ? 17   PRO C C   1 
ATOM   6024  O  O   . PRO C  3  17  ? 63.652  331.869 209.651 1.00 30.75  ? 17   PRO C O   1 
ATOM   6025  C  CB  . PRO C  3  17  ? 64.222  330.310 212.636 1.00 28.35  ? 17   PRO C CB  1 
ATOM   6026  C  CG  . PRO C  3  17  ? 65.240  330.330 213.792 1.00 26.97  ? 17   PRO C CG  1 
ATOM   6027  C  CD  . PRO C  3  17  ? 65.390  331.860 214.089 1.00 24.82  ? 17   PRO C CD  1 
ATOM   6028  N  N   . LEU C  3  18  ? 62.691  332.761 211.465 1.00 28.63  ? 18   LEU C N   1 
ATOM   6029  C  CA  . LEU C  3  18  ? 61.583  333.289 210.675 1.00 26.11  ? 18   LEU C CA  1 
ATOM   6030  C  C   . LEU C  3  18  ? 62.043  334.434 209.786 1.00 33.69  ? 18   LEU C C   1 
ATOM   6031  O  O   . LEU C  3  18  ? 61.678  334.483 208.609 1.00 32.57  ? 18   LEU C O   1 
ATOM   6032  C  CB  . LEU C  3  18  ? 60.434  333.743 211.595 1.00 28.68  ? 18   LEU C CB  1 
ATOM   6033  C  CG  . LEU C  3  18  ? 59.285  334.433 210.857 1.00 31.69  ? 18   LEU C CG  1 
ATOM   6034  C  CD1 . LEU C  3  18  ? 58.613  333.435 209.952 1.00 35.99  ? 18   LEU C CD1 1 
ATOM   6035  C  CD2 . LEU C  3  18  ? 58.295  335.022 211.813 1.00 33.61  ? 18   LEU C CD2 1 
ATOM   6036  N  N   . THR C  3  19  ? 62.881  335.350 210.307 1.00 29.88  ? 19   THR C N   1 
ATOM   6037  C  CA  . THR C  3  19  ? 63.296  336.447 209.439 1.00 31.87  ? 19   THR C CA  1 
ATOM   6038  C  C   . THR C  3  19  ? 64.227  335.918 208.341 1.00 30.36  ? 19   THR C C   1 
ATOM   6039  O  O   . THR C  3  19  ? 64.220  336.425 207.232 1.00 32.62  ? 19   THR C O   1 
ATOM   6040  C  CB  . THR C  3  19  ? 63.953  337.603 210.225 1.00 30.24  ? 19   THR C CB  1 
ATOM   6041  O  OG1 . THR C  3  19  ? 65.186  337.152 210.807 1.00 29.72  ? 19   THR C OG1 1 
ATOM   6042  C  CG2 . THR C  3  19  ? 63.026  338.105 211.369 1.00 27.53  ? 19   THR C CG2 1 
ATOM   6043  N  N   . GLY C  3  20  ? 64.959  334.845 208.599 1.00 29.81  ? 20   GLY C N   1 
ATOM   6044  C  CA  . GLY C  3  20  ? 65.786  334.269 207.543 1.00 29.46  ? 20   GLY C CA  1 
ATOM   6045  C  C   . GLY C  3  20  ? 64.942  333.607 206.459 1.00 28.67  ? 20   GLY C C   1 
ATOM   6046  O  O   . GLY C  3  20  ? 65.250  333.720 205.261 1.00 31.12  ? 20   GLY C O   1 
ATOM   6047  N  N   . ALA C  3  21  ? 63.935  332.850 206.873 1.00 26.91  ? 21   ALA C N   1 
ATOM   6048  C  CA  . ALA C  3  21  ? 63.001  332.248 205.922 1.00 25.99  ? 21   ALA C CA  1 
ATOM   6049  C  C   . ALA C  3  21  ? 62.305  333.310 205.091 1.00 35.66  ? 21   ALA C C   1 
ATOM   6050  O  O   . ALA C  3  21  ? 62.139  333.144 203.874 1.00 31.53  ? 21   ALA C O   1 
ATOM   6051  C  CB  . ALA C  3  21  ? 61.959  331.399 206.675 1.00 26.27  ? 21   ALA C CB  1 
ATOM   6052  N  N   . LEU C  3  22  ? 61.899  334.407 205.716 1.00 31.28  ? 22   LEU C N   1 
ATOM   6053  C  CA  . LEU C  3  22  ? 61.229  335.452 204.955 1.00 32.89  ? 22   LEU C CA  1 
ATOM   6054  C  C   . LEU C  3  22  ? 62.211  336.132 204.050 1.00 36.83  ? 22   LEU C C   1 
ATOM   6055  O  O   . LEU C  3  22  ? 61.864  336.495 202.937 1.00 34.19  ? 22   LEU C O   1 
ATOM   6056  C  CB  . LEU C  3  22  ? 60.544  336.494 205.865 1.00 30.31  ? 22   LEU C CB  1 
ATOM   6057  C  CG  . LEU C  3  22  ? 59.372  335.793 206.592 1.00 33.20  ? 22   LEU C CG  1 
ATOM   6058  C  CD1 . LEU C  3  22  ? 58.704  336.728 207.580 1.00 32.58  ? 22   LEU C CD1 1 
ATOM   6059  C  CD2 . LEU C  3  22  ? 58.329  335.306 205.616 1.00 34.99  ? 22   LEU C CD2 1 
ATOM   6060  N  N   . SER C  3  23  ? 63.451  336.276 204.503 1.00 30.29  ? 23   SER C N   1 
ATOM   6061  C  CA  . SER C  3  23  ? 64.434  336.911 203.645 1.00 34.12  ? 23   SER C CA  1 
ATOM   6062  C  C   . SER C  3  23  ? 64.661  336.043 202.409 1.00 35.58  ? 23   SER C C   1 
ATOM   6063  O  O   . SER C  3  23  ? 64.810  336.573 201.307 1.00 30.11  ? 23   SER C O   1 
ATOM   6064  C  CB  . SER C  3  23  ? 65.714  337.202 204.484 1.00 38.15  ? 23   SER C CB  1 
ATOM   6065  O  OG  . SER C  3  23  ? 66.612  336.132 204.402 1.00 55.42  ? 23   SER C OG  1 
ATOM   6066  N  N   . ALA C  3  24  ? 64.550  334.718 202.548 1.00 28.34  ? 24   ALA C N   1 
ATOM   6067  C  CA  . ALA C  3  24  ? 64.700  333.826 201.377 1.00 35.25  ? 24   ALA C CA  1 
ATOM   6068  C  C   . ALA C  3  24  ? 63.541  333.989 200.409 1.00 28.88  ? 24   ALA C C   1 
ATOM   6069  O  O   . ALA C  3  24  ? 63.753  334.025 199.187 1.00 31.87  ? 24   ALA C O   1 
ATOM   6070  C  CB  . ALA C  3  24  ? 64.757  332.364 201.793 1.00 28.66  ? 24   ALA C CB  1 
ATOM   6071  N  N   . LEU C  3  25  ? 62.341  334.150 200.940 1.00 28.11  ? 25   LEU C N   1 
ATOM   6072  C  CA  . LEU C  3  25  ? 61.195  334.465 200.086 1.00 29.01  ? 25   LEU C CA  1 
ATOM   6073  C  C   . LEU C  3  25  ? 61.408  335.777 199.350 1.00 32.57  ? 25   LEU C C   1 
ATOM   6074  O  O   . LEU C  3  25  ? 61.154  335.862 198.147 1.00 32.97  ? 25   LEU C O   1 
ATOM   6075  C  CB  . LEU C  3  25  ? 59.908  334.516 200.941 1.00 29.52  ? 25   LEU C CB  1 
ATOM   6076  C  CG  . LEU C  3  25  ? 58.623  334.980 200.227 1.00 32.69  ? 25   LEU C CG  1 
ATOM   6077  C  CD1 . LEU C  3  25  ? 58.232  333.892 199.204 1.00 22.80  ? 25   LEU C CD1 1 
ATOM   6078  C  CD2 . LEU C  3  25  ? 57.505  335.129 201.228 1.00 32.12  ? 25   LEU C CD2 1 
ATOM   6079  N  N   . LEU C  3  26  ? 61.914  336.799 200.041 1.00 33.19  ? 26   LEU C N   1 
ATOM   6080  C  CA  . LEU C  3  26  ? 62.063  338.101 199.402 1.00 31.73  ? 26   LEU C CA  1 
ATOM   6081  C  C   . LEU C  3  26  ? 63.178  338.093 198.359 1.00 32.65  ? 26   LEU C C   1 
ATOM   6082  O  O   . LEU C  3  26  ? 63.027  338.702 197.294 1.00 32.56  ? 26   LEU C O   1 
ATOM   6083  C  CB  . LEU C  3  26  ? 62.323  339.186 200.451 1.00 29.30  ? 26   LEU C CB  1 
ATOM   6084  C  CG  . LEU C  3  26  ? 61.190  339.320 201.486 1.00 34.86  ? 26   LEU C CG  1 
ATOM   6085  C  CD1 . LEU C  3  26  ? 61.542  340.403 202.503 1.00 34.35  ? 26   LEU C CD1 1 
ATOM   6086  C  CD2 . LEU C  3  26  ? 59.883  339.646 200.788 1.00 35.48  ? 26   LEU C CD2 1 
ATOM   6087  N  N   . MET C  3  27  ? 64.278  337.371 198.612 1.00 27.20  ? 27   MET C N   1 
ATOM   6088  C  CA  . MET C  3  27  ? 65.349  337.273 197.610 1.00 28.65  ? 27   MET C CA  1 
ATOM   6089  C  C   . MET C  3  27  ? 64.918  336.496 196.371 1.00 27.17  ? 27   MET C C   1 
ATOM   6090  O  O   . MET C  3  27  ? 65.270  336.887 195.249 1.00 33.97  ? 27   MET C O   1 
ATOM   6091  C  CB  . MET C  3  27  ? 66.606  336.622 198.225 1.00 28.63  ? 27   MET C CB  1 
ATOM   6092  C  CG  . MET C  3  27  ? 67.290  337.537 199.249 1.00 32.74  ? 27   MET C CG  1 
ATOM   6093  S  SD  . MET C  3  27  ? 68.838  336.816 199.844 1.00 38.43  ? 27   MET C SD  1 
ATOM   6094  C  CE  . MET C  3  27  ? 68.304  335.435 200.799 1.00 32.52  ? 27   MET C CE  1 
ATOM   6095  N  N   . THR C  3  28  ? 64.207  335.360 196.542 1.00 31.41  ? 28   THR C N   1 
ATOM   6096  C  CA  . THR C  3  28  ? 63.778  334.592 195.359 1.00 34.69  ? 28   THR C CA  1 
ATOM   6097  C  C   . THR C  3  28  ? 62.655  335.309 194.596 1.00 35.03  ? 28   THR C C   1 
ATOM   6098  O  O   . THR C  3  28  ? 62.695  335.388 193.356 1.00 33.58  ? 28   THR C O   1 
ATOM   6099  C  CB  . THR C  3  28  ? 63.315  333.179 195.763 1.00 32.86  ? 28   THR C CB  1 
ATOM   6100  O  OG1 . THR C  3  28  ? 62.326  333.263 196.819 1.00 29.26  ? 28   THR C OG1 1 
ATOM   6101  C  CG2 . THR C  3  28  ? 64.504  332.279 196.221 1.00 29.37  ? 28   THR C CG2 1 
ATOM   6102  N  N   . SER C  3  29  ? 61.601  335.745 195.318 1.00 31.06  ? 29   SER C N   1 
ATOM   6103  C  CA  . SER C  3  29  ? 60.607  336.682 194.796 1.00 37.92  ? 29   SER C CA  1 
ATOM   6104  C  C   . SER C  3  29  ? 61.283  337.847 194.116 1.00 33.98  ? 29   SER C C   1 
ATOM   6105  O  O   . SER C  3  29  ? 60.880  338.268 193.018 1.00 36.08  ? 29   SER C O   1 
ATOM   6106  C  CB  . SER C  3  29  ? 59.690  337.223 195.952 1.00 32.89  ? 29   SER C CB  1 
ATOM   6107  O  OG  . SER C  3  29  ? 58.816  336.210 196.357 1.00 84.51  ? 29   SER C OG  1 
ATOM   6108  N  N   . GLY C  3  30  ? 62.303  338.404 194.777 1.00 33.50  ? 30   GLY C N   1 
ATOM   6109  C  CA  . GLY C  3  30  ? 62.975  339.581 194.237 1.00 32.53  ? 30   GLY C CA  1 
ATOM   6110  C  C   . GLY C  3  30  ? 63.691  339.306 192.930 1.00 35.68  ? 30   GLY C C   1 
ATOM   6111  O  O   . GLY C  3  30  ? 63.620  340.115 191.983 1.00 32.02  ? 30   GLY C O   1 
ATOM   6112  N  N   . LEU C  3  31  ? 64.388  338.159 192.854 1.00 29.54  ? 31   LEU C N   1 
ATOM   6113  C  CA  . LEU C  3  31  ? 65.052  337.787 191.611 1.00 33.39  ? 31   LEU C CA  1 
ATOM   6114  C  C   . LEU C  3  31  ? 64.029  337.576 190.498 1.00 33.41  ? 31   LEU C C   1 
ATOM   6115  O  O   . LEU C  3  31  ? 64.262  337.985 189.362 1.00 33.94  ? 31   LEU C O   1 
ATOM   6116  C  CB  . LEU C  3  31  ? 65.861  336.506 191.805 1.00 33.97  ? 31   LEU C CB  1 
ATOM   6117  C  CG  . LEU C  3  31  ? 67.238  336.600 192.486 1.00 43.60  ? 31   LEU C CG  1 
ATOM   6118  C  CD1 . LEU C  3  31  ? 67.797  335.186 192.712 1.00 36.60  ? 31   LEU C CD1 1 
ATOM   6119  C  CD2 . LEU C  3  31  ? 68.141  337.393 191.576 1.00 39.65  ? 31   LEU C CD2 1 
ATOM   6120  N  N   . THR C  3  32  ? 62.888  336.924 190.820 1.00 33.82  ? 32   THR C N   1 
ATOM   6121  C  CA  . THR C  3  32  ? 61.813  336.796 189.836 1.00 34.48  ? 32   THR C CA  1 
ATOM   6122  C  C   . THR C  3  32  ? 61.376  338.175 189.328 1.00 37.21  ? 32   THR C C   1 
ATOM   6123  O  O   . THR C  3  32  ? 61.230  338.400 188.119 1.00 37.98  ? 32   THR C O   1 
ATOM   6124  C  CB  . THR C  3  32  ? 60.615  336.037 190.433 1.00 33.06  ? 32   THR C CB  1 
ATOM   6125  O  OG1 . THR C  3  32  ? 61.056  334.765 190.934 1.00 32.74  ? 32   THR C OG1 1 
ATOM   6126  C  CG2 . THR C  3  32  ? 59.555  335.797 189.332 1.00 27.77  ? 32   THR C CG2 1 
ATOM   6127  N  N   . MET C  3  33  ? 61.219  339.115 190.240 1.00 33.29  ? 33   MET C N   1 
ATOM   6128  C  CA  . MET C  3  33  ? 60.731  340.436 189.885 1.00 33.55  ? 33   MET C CA  1 
ATOM   6129  C  C   . MET C  3  33  ? 61.753  341.164 189.029 1.00 38.30  ? 33   MET C C   1 
ATOM   6130  O  O   . MET C  3  33  ? 61.387  341.884 188.090 1.00 33.81  ? 33   MET C O   1 
ATOM   6131  C  CB  . MET C  3  33  ? 60.374  341.199 191.182 1.00 36.79  ? 33   MET C CB  1 
ATOM   6132  C  CG  . MET C  3  33  ? 60.146  342.697 191.025 1.00 143.08 ? 33   MET C CG  1 
ATOM   6133  S  SD  . MET C  3  33  ? 59.710  343.525 192.577 1.00 77.10  ? 33   MET C SD  1 
ATOM   6134  C  CE  . MET C  3  33  ? 58.451  344.668 192.040 1.00 142.86 ? 33   MET C CE  1 
ATOM   6135  N  N   . TRP C  3  34  ? 63.032  340.944 189.329 1.00 33.43  ? 34   TRP C N   1 
ATOM   6136  C  CA  . TRP C  3  34  ? 64.126  341.532 188.597 1.00 34.64  ? 34   TRP C CA  1 
ATOM   6137  C  C   . TRP C  3  34  ? 64.215  340.938 187.206 1.00 40.69  ? 34   TRP C C   1 
ATOM   6138  O  O   . TRP C  3  34  ? 64.297  341.676 186.220 1.00 36.57  ? 34   TRP C O   1 
ATOM   6139  C  CB  . TRP C  3  34  ? 65.436  341.303 189.362 1.00 34.99  ? 34   TRP C CB  1 
ATOM   6140  C  CG  . TRP C  3  34  ? 66.612  341.997 188.741 1.00 34.57  ? 34   TRP C CG  1 
ATOM   6141  C  CD1 . TRP C  3  34  ? 66.650  343.248 188.235 1.00 43.72  ? 34   TRP C CD1 1 
ATOM   6142  C  CD2 . TRP C  3  34  ? 67.919  341.441 188.551 1.00 31.87  ? 34   TRP C CD2 1 
ATOM   6143  N  NE1 . TRP C  3  34  ? 67.908  343.531 187.768 1.00 41.38  ? 34   TRP C NE1 1 
ATOM   6144  C  CE2 . TRP C  3  34  ? 68.710  342.440 187.960 1.00 37.23  ? 34   TRP C CE2 1 
ATOM   6145  C  CE3 . TRP C  3  34  ? 68.494  340.210 188.854 1.00 42.84  ? 34   TRP C CE3 1 
ATOM   6146  C  CZ2 . TRP C  3  34  ? 70.046  342.234 187.639 1.00 40.30  ? 34   TRP C CZ2 1 
ATOM   6147  C  CZ3 . TRP C  3  34  ? 69.827  340.007 188.538 1.00 53.56  ? 34   TRP C CZ3 1 
ATOM   6148  C  CH2 . TRP C  3  34  ? 70.584  341.014 187.934 1.00 47.98  ? 34   TRP C CH2 1 
ATOM   6149  N  N   . PHE C  3  35  ? 64.142  339.596 187.103 1.00 38.16  ? 35   PHE C N   1 
ATOM   6150  C  CA  . PHE C  3  35  ? 64.279  338.913 185.805 1.00 42.46  ? 35   PHE C CA  1 
ATOM   6151  C  C   . PHE C  3  35  ? 63.093  339.193 184.874 1.00 43.31  ? 35   PHE C C   1 
ATOM   6152  O  O   . PHE C  3  35  ? 63.238  339.155 183.651 1.00 40.94  ? 35   PHE C O   1 
ATOM   6153  C  CB  . PHE C  3  35  ? 64.381  337.377 186.015 1.00 35.88  ? 35   PHE C CB  1 
ATOM   6154  C  CG  . PHE C  3  35  ? 65.737  336.870 186.533 1.00 31.76  ? 35   PHE C CG  1 
ATOM   6155  C  CD1 . PHE C  3  35  ? 66.892  337.599 186.355 1.00 38.80  ? 35   PHE C CD1 1 
ATOM   6156  C  CD2 . PHE C  3  35  ? 65.835  335.614 187.179 1.00 31.91  ? 35   PHE C CD2 1 
ATOM   6157  C  CE1 . PHE C  3  35  ? 68.110  337.098 186.798 1.00 42.92  ? 35   PHE C CE1 1 
ATOM   6158  C  CE2 . PHE C  3  35  ? 67.066  335.129 187.605 1.00 34.64  ? 35   PHE C CE2 1 
ATOM   6159  C  CZ  . PHE C  3  35  ? 68.174  335.855 187.431 1.00 39.55  ? 35   PHE C CZ  1 
ATOM   6160  N  N   . HIS C  3  36  ? 61.901  339.413 185.420 1.00 36.19  ? 36   HIS C N   1 
ATOM   6161  C  CA  . HIS C  3  36  ? 60.692  339.411 184.603 1.00 39.12  ? 36   HIS C CA  1 
ATOM   6162  C  C   . HIS C  3  36  ? 59.827  340.639 184.730 1.00 69.46  ? 36   HIS C C   1 
ATOM   6163  O  O   . HIS C  3  36  ? 58.880  340.775 183.954 1.00 49.12  ? 36   HIS C O   1 
ATOM   6164  C  CB  . HIS C  3  36  ? 59.787  338.237 184.946 1.00 33.03  ? 36   HIS C CB  1 
ATOM   6165  C  CG  . HIS C  3  36  ? 60.381  336.919 184.648 1.00 36.78  ? 36   HIS C CG  1 
ATOM   6166  N  ND1 . HIS C  3  36  ? 60.467  336.436 183.361 1.00 33.10  ? 36   HIS C ND1 1 
ATOM   6167  C  CD2 . HIS C  3  36  ? 60.951  335.992 185.455 1.00 32.63  ? 36   HIS C CD2 1 
ATOM   6168  C  CE1 . HIS C  3  36  ? 61.051  335.251 183.388 1.00 42.37  ? 36   HIS C CE1 1 
ATOM   6169  N  NE2 . HIS C  3  36  ? 61.346  334.951 184.644 1.00 37.39  ? 36   HIS C NE2 1 
ATOM   6170  N  N   . PHE C  3  37  ? 60.032  341.478 185.724 1.00 51.26  ? 37   PHE C N   1 
ATOM   6171  C  CA  . PHE C  3  37  ? 59.141  342.620 185.861 1.00 75.31  ? 37   PHE C CA  1 
ATOM   6172  C  C   . PHE C  3  37  ? 59.923  343.893 186.118 1.00 40.83  ? 37   PHE C C   1 
ATOM   6173  O  O   . PHE C  3  37  ? 59.399  344.824 186.726 1.00 66.37  ? 37   PHE C O   1 
ATOM   6174  C  CB  . PHE C  3  37  ? 58.112  342.362 186.954 1.00 47.53  ? 37   PHE C CB  1 
ATOM   6175  C  CG  . PHE C  3  37  ? 57.294  341.106 186.732 1.00 180.51 ? 37   PHE C CG  1 
ATOM   6176  C  CD1 . PHE C  3  37  ? 56.277  341.064 185.803 1.00 73.91  ? 37   PHE C CD1 1 
ATOM   6177  C  CD2 . PHE C  3  37  ? 57.547  339.970 187.464 1.00 44.48  ? 37   PHE C CD2 1 
ATOM   6178  C  CE1 . PHE C  3  37  ? 55.542  339.904 185.624 1.00 78.88  ? 37   PHE C CE1 1 
ATOM   6179  C  CE2 . PHE C  3  37  ? 56.806  338.792 187.282 1.00 54.73  ? 37   PHE C CE2 1 
ATOM   6180  C  CZ  . PHE C  3  37  ? 55.818  338.781 186.379 1.00 37.84  ? 37   PHE C CZ  1 
ATOM   6181  N  N   . ASN C  3  38  ? 61.188  343.911 185.695 1.00 39.53  ? 38   ASN C N   1 
ATOM   6182  C  CA  . ASN C  3  38  ? 61.972  345.109 185.585 1.00 51.41  ? 38   ASN C CA  1 
ATOM   6183  C  C   . ASN C  3  38  ? 61.966  345.904 186.889 1.00 79.25  ? 38   ASN C C   1 
ATOM   6184  O  O   . ASN C  3  38  ? 61.676  347.103 186.907 1.00 100.70 ? 38   ASN C O   1 
ATOM   6185  C  CB  . ASN C  3  38  ? 61.464  345.955 184.422 1.00 54.89  ? 38   ASN C CB  1 
ATOM   6186  C  CG  . ASN C  3  38  ? 62.555  346.844 183.859 1.00 213.14 ? 38   ASN C CG  1 
ATOM   6187  O  OD1 . ASN C  3  38  ? 63.706  346.417 183.707 1.00 74.47  ? 38   ASN C OD1 1 
ATOM   6188  N  ND2 . ASN C  3  38  ? 62.214  348.095 183.586 1.00 153.96 ? 38   ASN C ND2 1 
ATOM   6189  N  N   . SER C  3  39  ? 62.293  345.229 187.997 1.00 42.76  ? 39   SER C N   1 
ATOM   6190  C  CA  . SER C  3  39  ? 62.290  345.943 189.266 1.00 58.77  ? 39   SER C CA  1 
ATOM   6191  C  C   . SER C  3  39  ? 63.156  345.226 190.288 1.00 60.81  ? 39   SER C C   1 
ATOM   6192  O  O   . SER C  3  39  ? 63.051  344.011 190.456 1.00 43.36  ? 39   SER C O   1 
ATOM   6193  C  CB  . SER C  3  39  ? 60.879  346.100 189.800 1.00 41.76  ? 39   SER C CB  1 
ATOM   6194  O  OG  . SER C  3  39  ? 60.925  346.594 191.137 1.00 58.98  ? 39   SER C OG  1 
ATOM   6195  N  N   . MET C  3  40  ? 63.979  345.994 190.994 1.00 39.84  ? 40   MET C N   1 
ATOM   6196  C  CA  . MET C  3  40  ? 64.901  345.431 191.960 1.00 48.97  ? 40   MET C CA  1 
ATOM   6197  C  C   . MET C  3  40  ? 64.453  345.621 193.404 1.00 44.64  ? 40   MET C C   1 
ATOM   6198  O  O   . MET C  3  40  ? 65.219  345.314 194.329 1.00 47.37  ? 40   MET C O   1 
ATOM   6199  C  CB  . MET C  3  40  ? 66.268  346.040 191.738 1.00 43.27  ? 40   MET C CB  1 
ATOM   6200  C  CG  . MET C  3  40  ? 66.973  345.286 190.673 1.00 63.28  ? 40   MET C CG  1 
ATOM   6201  S  SD  . MET C  3  40  ? 68.681  345.598 190.885 1.00 100.91 ? 40   MET C SD  1 
ATOM   6202  C  CE  . MET C  3  40  ? 68.611  347.387 190.966 1.00 70.39  ? 40   MET C CE  1 
ATOM   6203  N  N   . THR C  3  41  ? 63.212  346.047 193.617 1.00 48.31  ? 41   THR C N   1 
ATOM   6204  C  CA  . THR C  3  41  ? 62.764  346.465 194.946 1.00 45.36  ? 41   THR C CA  1 
ATOM   6205  C  C   . THR C  3  41  ? 62.690  345.301 195.932 1.00 41.55  ? 41   THR C C   1 
ATOM   6206  O  O   . THR C  3  41  ? 63.244  345.373 197.031 1.00 41.10  ? 41   THR C O   1 
ATOM   6207  C  CB  . THR C  3  41  ? 61.401  347.152 194.837 1.00 95.61  ? 41   THR C CB  1 
ATOM   6208  O  OG1 . THR C  3  41  ? 61.550  348.361 194.092 1.00 68.25  ? 41   THR C OG1 1 
ATOM   6209  C  CG2 . THR C  3  41  ? 60.855  347.491 196.217 1.00 52.22  ? 41   THR C CG2 1 
ATOM   6210  N  N   . LEU C  3  42  ? 61.926  344.266 195.599 1.00 39.77  ? 42   LEU C N   1 
ATOM   6211  C  CA  . LEU C  3  42  ? 61.872  343.103 196.457 1.00 38.54  ? 42   LEU C CA  1 
ATOM   6212  C  C   . LEU C  3  42  ? 63.263  342.573 196.736 1.00 38.58  ? 42   LEU C C   1 
ATOM   6213  O  O   . LEU C  3  42  ? 63.579  342.215 197.876 1.00 38.42  ? 42   LEU C O   1 
ATOM   6214  C  CB  . LEU C  3  42  ? 61.032  342.017 195.822 1.00 40.90  ? 42   LEU C CB  1 
ATOM   6215  C  CG  . LEU C  3  42  ? 59.595  341.953 196.248 1.00 62.67  ? 42   LEU C CG  1 
ATOM   6216  C  CD1 . LEU C  3  42  ? 59.059  340.773 195.565 1.00 42.72  ? 42   LEU C CD1 1 
ATOM   6217  C  CD2 . LEU C  3  42  ? 59.571  341.784 197.748 1.00 47.98  ? 42   LEU C CD2 1 
ATOM   6218  N  N   . LEU C  3  43  ? 64.100  342.475 195.699 1.00 34.36  ? 43   LEU C N   1 
ATOM   6219  C  CA  . LEU C  3  43  ? 65.407  341.846 195.869 1.00 31.89  ? 43   LEU C CA  1 
ATOM   6220  C  C   . LEU C  3  43  ? 66.267  342.628 196.848 1.00 44.51  ? 43   LEU C C   1 
ATOM   6221  O  O   . LEU C  3  43  ? 66.956  342.044 197.704 1.00 36.97  ? 43   LEU C O   1 
ATOM   6222  C  CB  . LEU C  3  43  ? 66.109  341.719 194.517 1.00 33.57  ? 43   LEU C CB  1 
ATOM   6223  C  CG  . LEU C  3  43  ? 67.521  341.159 194.541 1.00 36.28  ? 43   LEU C CG  1 
ATOM   6224  C  CD1 . LEU C  3  43  ? 67.598  339.755 195.185 1.00 38.24  ? 43   LEU C CD1 1 
ATOM   6225  C  CD2 . LEU C  3  43  ? 68.086  341.128 193.085 1.00 37.81  ? 43   LEU C CD2 1 
ATOM   6226  N  N   . MET C  3  44  ? 66.260  343.957 196.730 1.00 34.42  ? 44   MET C N   1 
ATOM   6227  C  CA  . MET C  3  44  ? 67.022  344.774 197.687 1.00 41.37  ? 44   MET C CA  1 
ATOM   6228  C  C   . MET C  3  44  ? 66.541  344.578 199.123 1.00 40.11  ? 44   MET C C   1 
ATOM   6229  O  O   . MET C  3  44  ? 67.363  344.540 200.044 1.00 39.48  ? 44   MET C O   1 
ATOM   6230  C  CB  . MET C  3  44  ? 66.948  346.259 197.333 1.00 40.54  ? 44   MET C CB  1 
ATOM   6231  C  CG  . MET C  3  44  ? 67.627  346.628 195.983 1.00 44.72  ? 44   MET C CG  1 
ATOM   6232  S  SD  . MET C  3  44  ? 69.312  345.981 195.807 1.00 85.51  ? 44   MET C SD  1 
ATOM   6233  C  CE  . MET C  3  44  ? 69.072  344.632 194.642 1.00 149.88 ? 44   MET C CE  1 
ATOM   6234  N  N   . ILE C  3  45  ? 65.223  344.435 199.340 1.00 34.43  ? 45   ILE C N   1 
ATOM   6235  C  CA  . ILE C  3  45  ? 64.716  344.208 200.697 1.00 47.45  ? 45   ILE C CA  1 
ATOM   6236  C  C   . ILE C  3  45  ? 65.171  342.848 201.219 1.00 35.32  ? 45   ILE C C   1 
ATOM   6237  O  O   . ILE C  3  45  ? 65.584  342.718 202.377 1.00 40.64  ? 45   ILE C O   1 
ATOM   6238  C  CB  . ILE C  3  45  ? 63.179  344.319 200.727 1.00 41.45  ? 45   ILE C CB  1 
ATOM   6239  C  CG1 . ILE C  3  45  ? 62.730  345.760 200.481 1.00 41.55  ? 45   ILE C CG1 1 
ATOM   6240  C  CG2 . ILE C  3  45  ? 62.606  343.834 202.063 1.00 37.26  ? 45   ILE C CG2 1 
ATOM   6241  C  CD1 . ILE C  3  45  ? 61.310  345.804 200.033 1.00 48.83  ? 45   ILE C CD1 1 
ATOM   6242  N  N   . GLY C  3  46  ? 65.099  341.812 200.364 1.00 37.61  ? 46   GLY C N   1 
ATOM   6243  C  CA  . GLY C  3  46  ? 65.508  340.480 200.786 1.00 33.27  ? 46   GLY C CA  1 
ATOM   6244  C  C   . GLY C  3  46  ? 66.988  340.423 201.080 1.00 29.28  ? 46   GLY C C   1 
ATOM   6245  O  O   . GLY C  3  46  ? 67.410  339.819 202.082 1.00 37.48  ? 46   GLY C O   1 
ATOM   6246  N  N   . LEU C  3  47  ? 67.816  341.044 200.242 1.00 29.24  ? 47   LEU C N   1 
ATOM   6247  C  CA  . LEU C  3  47  ? 69.241  341.036 200.573 1.00 34.53  ? 47   LEU C CA  1 
ATOM   6248  C  C   . LEU C  3  47  ? 69.482  341.751 201.905 1.00 34.33  ? 47   LEU C C   1 
ATOM   6249  O  O   . LEU C  3  47  ? 70.306  341.308 202.725 1.00 33.38  ? 47   LEU C O   1 
ATOM   6250  C  CB  . LEU C  3  47  ? 70.057  341.679 199.449 1.00 39.63  ? 47   LEU C CB  1 
ATOM   6251  C  CG  . LEU C  3  47  ? 70.108  340.905 198.138 1.00 44.84  ? 47   LEU C CG  1 
ATOM   6252  C  CD1 . LEU C  3  47  ? 70.636  341.850 197.062 1.00 37.91  ? 47   LEU C CD1 1 
ATOM   6253  C  CD2 . LEU C  3  47  ? 70.997  339.689 198.316 1.00 33.37  ? 47   LEU C CD2 1 
ATOM   6254  N  N   . THR C  3  48  ? 68.733  342.824 202.162 1.00 38.12  ? 48   THR C N   1 
ATOM   6255  C  CA  . THR C  3  48  ? 68.900  343.570 203.400 1.00 36.35  ? 48   THR C CA  1 
ATOM   6256  C  C   . THR C  3  48  ? 68.475  342.756 204.610 1.00 38.12  ? 48   THR C C   1 
ATOM   6257  O  O   . THR C  3  48  ? 69.206  342.701 205.596 1.00 34.62  ? 48   THR C O   1 
ATOM   6258  C  CB  . THR C  3  48  ? 68.117  344.867 203.354 1.00 39.35  ? 48   THR C CB  1 
ATOM   6259  O  OG1 . THR C  3  48  ? 68.646  345.682 202.296 1.00 40.00  ? 48   THR C OG1 1 
ATOM   6260  C  CG2 . THR C  3  48  ? 68.263  345.594 204.696 1.00 43.28  ? 48   THR C CG2 1 
ATOM   6261  N  N   . THR C  3  49  ? 67.285  342.139 204.561 1.00 32.62  ? 49   THR C N   1 
ATOM   6262  C  CA  . THR C  3  49  ? 66.841  341.334 205.685 1.00 32.46  ? 49   THR C CA  1 
ATOM   6263  C  C   . THR C  3  49  ? 67.705  340.096 205.846 1.00 35.05  ? 49   THR C C   1 
ATOM   6264  O  O   . THR C  3  49  ? 67.901  339.615 206.968 1.00 35.35  ? 49   THR C O   1 
ATOM   6265  C  CB  . THR C  3  49  ? 65.351  340.951 205.521 1.00 33.95  ? 49   THR C CB  1 
ATOM   6266  O  OG1 . THR C  3  49  ? 65.166  340.290 204.281 1.00 36.14  ? 49   THR C OG1 1 
ATOM   6267  C  CG2 . THR C  3  49  ? 64.488  342.197 205.564 1.00 36.77  ? 49   THR C CG2 1 
ATOM   6268  N  N   . ASN C  3  50  ? 68.277  339.596 204.757 1.00 32.51  ? 50   ASN C N   1 
ATOM   6269  C  CA  . ASN C  3  50  ? 69.169  338.448 204.910 1.00 33.89  ? 50   ASN C CA  1 
ATOM   6270  C  C   . ASN C  3  50  ? 70.442  338.824 205.700 1.00 29.12  ? 50   ASN C C   1 
ATOM   6271  O  O   . ASN C  3  50  ? 70.900  338.071 206.560 1.00 34.85  ? 50   ASN C O   1 
ATOM   6272  C  CB  . ASN C  3  50  ? 69.525  337.888 203.539 1.00 32.74  ? 50   ASN C CB  1 
ATOM   6273  C  CG  . ASN C  3  50  ? 70.369  336.620 203.648 1.00 35.99  ? 50   ASN C CG  1 
ATOM   6274  O  OD1 . ASN C  3  50  ? 69.850  335.578 203.970 1.00 40.72  ? 50   ASN C OD1 1 
ATOM   6275  N  ND2 . ASN C  3  50  ? 71.672  336.735 203.459 1.00 40.64  ? 50   ASN C ND2 1 
ATOM   6276  N  N   . MET C  3  51  ? 71.051  339.971 205.367 1.00 30.44  ? 51   MET C N   1 
ATOM   6277  C  CA  . MET C  3  51  ? 72.262  340.411 206.072 1.00 34.78  ? 51   MET C CA  1 
ATOM   6278  C  C   . MET C  3  51  ? 71.945  340.704 207.549 1.00 33.26  ? 51   MET C C   1 
ATOM   6279  O  O   . MET C  3  51  ? 72.709  340.322 208.455 1.00 34.04  ? 51   MET C O   1 
ATOM   6280  C  CB  . MET C  3  51  ? 72.868  341.666 205.403 1.00 28.81  ? 51   MET C CB  1 
ATOM   6281  C  CG  . MET C  3  51  ? 73.427  341.508 203.892 1.00 40.30  ? 51   MET C CG  1 
ATOM   6282  S  SD  . MET C  3  51  ? 74.011  339.907 203.308 1.00 105.87 ? 51   MET C SD  1 
ATOM   6283  C  CE  . MET C  3  51  ? 73.409  339.836 201.593 1.00 83.81  ? 51   MET C CE  1 
ATOM   6284  N  N   . LEU C  3  52  ? 70.808  341.365 207.805 1.00 34.91  ? 52   LEU C N   1 
ATOM   6285  C  CA  . LEU C  3  52  ? 70.391  341.620 209.197 1.00 37.49  ? 52   LEU C CA  1 
ATOM   6286  C  C   . LEU C  3  52  ? 70.183  340.327 209.966 1.00 39.12  ? 52   LEU C C   1 
ATOM   6287  O  O   . LEU C  3  52  ? 70.491  340.252 211.165 1.00 32.11  ? 52   LEU C O   1 
ATOM   6288  C  CB  . LEU C  3  52  ? 69.090  342.433 209.238 1.00 38.01  ? 52   LEU C CB  1 
ATOM   6289  C  CG  . LEU C  3  52  ? 69.190  343.890 208.762 1.00 42.85  ? 52   LEU C CG  1 
ATOM   6290  C  CD1 . LEU C  3  52  ? 67.805  344.505 208.404 1.00 36.09  ? 52   LEU C CD1 1 
ATOM   6291  C  CD2 . LEU C  3  52  ? 69.881  344.749 209.844 1.00 41.03  ? 52   LEU C CD2 1 
ATOM   6292  N  N   . THR C  3  53  ? 69.571  339.330 209.329 1.00 32.69  ? 53   THR C N   1 
ATOM   6293  C  CA  . THR C  3  53  ? 69.340  338.043 209.997 1.00 37.48  ? 53   THR C CA  1 
ATOM   6294  C  C   . THR C  3  53  ? 70.656  337.378 210.319 1.00 34.74  ? 53   THR C C   1 
ATOM   6295  O  O   . THR C  3  53  ? 70.861  336.893 211.427 1.00 32.20  ? 53   THR C O   1 
ATOM   6296  C  CB  . THR C  3  53  ? 68.518  337.119 209.092 1.00 38.62  ? 53   THR C CB  1 
ATOM   6297  O  OG1 . THR C  3  53  ? 67.224  337.715 208.888 1.00 35.02  ? 53   THR C OG1 1 
ATOM   6298  C  CG2 . THR C  3  53  ? 68.436  335.630 209.643 1.00 27.63  ? 53   THR C CG2 1 
ATOM   6299  N  N   . MET C  3  54  ? 71.565  337.302 209.326 1.00 30.08  ? 54   MET C N   1 
ATOM   6300  C  CA  . MET C  3  54  ? 72.851  336.654 209.570 1.00 30.72  ? 54   MET C CA  1 
ATOM   6301  C  C   . MET C  3  54  ? 73.575  337.358 210.687 1.00 34.91  ? 54   MET C C   1 
ATOM   6302  O  O   . MET C  3  54  ? 74.146  336.727 211.564 1.00 31.17  ? 54   MET C O   1 
ATOM   6303  C  CB  . MET C  3  54  ? 73.724  336.662 208.302 1.00 31.71  ? 54   MET C CB  1 
ATOM   6304  C  CG  . MET C  3  54  ? 73.242  335.632 207.319 1.00 35.72  ? 54   MET C CG  1 
ATOM   6305  S  SD  . MET C  3  54  ? 74.258  335.508 205.806 1.00 40.22  ? 54   MET C SD  1 
ATOM   6306  C  CE  . MET C  3  54  ? 74.335  337.180 205.236 1.00 55.17  ? 54   MET C CE  1 
ATOM   6307  N  N   . TYR C  3  55  ? 73.585  338.677 210.644 1.00 30.78  ? 55   TYR C N   1 
ATOM   6308  C  CA  . TYR C  3  55  ? 74.300  339.436 211.671 1.00 37.13  ? 55   TYR C CA  1 
ATOM   6309  C  C   . TYR C  3  55  ? 73.771  339.119 213.071 1.00 33.22  ? 55   TYR C C   1 
ATOM   6310  O  O   . TYR C  3  55  ? 74.550  338.829 213.980 1.00 34.27  ? 55   TYR C O   1 
ATOM   6311  C  CB  . TYR C  3  55  ? 74.197  340.941 211.379 1.00 34.13  ? 55   TYR C CB  1 
ATOM   6312  C  CG  . TYR C  3  55  ? 74.770  341.799 212.488 1.00 38.59  ? 55   TYR C CG  1 
ATOM   6313  C  CD1 . TYR C  3  55  ? 76.142  341.992 212.596 1.00 50.92  ? 55   TYR C CD1 1 
ATOM   6314  C  CD2 . TYR C  3  55  ? 73.941  342.357 213.459 1.00 44.25  ? 55   TYR C CD2 1 
ATOM   6315  C  CE1 . TYR C  3  55  ? 76.680  342.737 213.633 1.00 71.01  ? 55   TYR C CE1 1 
ATOM   6316  C  CE2 . TYR C  3  55  ? 74.473  343.106 214.516 1.00 48.55  ? 55   TYR C CE2 1 
ATOM   6317  C  CZ  . TYR C  3  55  ? 75.839  343.289 214.586 1.00 66.13  ? 55   TYR C CZ  1 
ATOM   6318  O  OH  . TYR C  3  55  ? 76.355  344.038 215.604 1.00 90.80  ? 55   TYR C OH  1 
ATOM   6319  N  N   . GLN C  3  56  ? 72.454  339.220 213.277 1.00 35.48  ? 56   GLN C N   1 
ATOM   6320  C  CA  . GLN C  3  56  ? 71.943  339.043 214.638 1.00 36.77  ? 56   GLN C CA  1 
ATOM   6321  C  C   . GLN C  3  56  ? 72.034  337.602 215.072 1.00 34.23  ? 56   GLN C C   1 
ATOM   6322  O  O   . GLN C  3  56  ? 72.229  337.328 216.251 1.00 32.60  ? 56   GLN C O   1 
ATOM   6323  C  CB  . GLN C  3  56  ? 70.483  339.524 214.733 1.00 33.87  ? 56   GLN C CB  1 
ATOM   6324  C  CG  . GLN C  3  56  ? 70.445  341.054 214.691 1.00 37.04  ? 56   GLN C CG  1 
ATOM   6325  C  CD  . GLN C  3  56  ? 69.110  341.661 214.262 1.00 48.09  ? 56   GLN C CD  1 
ATOM   6326  O  OE1 . GLN C  3  56  ? 68.461  342.295 215.063 1.00 35.55  ? 56   GLN C OE1 1 
ATOM   6327  N  NE2 . GLN C  3  56  ? 68.713  341.501 212.977 1.00 35.04  ? 56   GLN C NE2 1 
ATOM   6328  N  N   . TRP C  3  57  ? 71.821  336.662 214.130 1.00 33.10  ? 57   TRP C N   1 
ATOM   6329  C  CA  . TRP C  3  57  ? 71.879  335.253 214.483 1.00 30.95  ? 57   TRP C CA  1 
ATOM   6330  C  C   . TRP C  3  57  ? 73.287  334.896 214.950 1.00 30.48  ? 57   TRP C C   1 
ATOM   6331  O  O   . TRP C  3  57  ? 73.479  334.299 216.019 1.00 29.53  ? 57   TRP C O   1 
ATOM   6332  C  CB  . TRP C  3  57  ? 71.483  334.398 213.246 1.00 29.03  ? 57   TRP C CB  1 
ATOM   6333  C  CG  . TRP C  3  57  ? 71.274  332.918 213.475 1.00 24.88  ? 57   TRP C CG  1 
ATOM   6334  C  CD1 . TRP C  3  57  ? 72.002  332.054 214.246 1.00 28.55  ? 57   TRP C CD1 1 
ATOM   6335  C  CD2 . TRP C  3  57  ? 70.286  332.128 212.800 1.00 25.75  ? 57   TRP C CD2 1 
ATOM   6336  N  NE1 . TRP C  3  57  ? 71.498  330.756 214.129 1.00 28.08  ? 57   TRP C NE1 1 
ATOM   6337  C  CE2 . TRP C  3  57  ? 70.457  330.782 213.234 1.00 24.48  ? 57   TRP C CE2 1 
ATOM   6338  C  CE3 . TRP C  3  57  ? 69.317  332.430 211.821 1.00 28.72  ? 57   TRP C CE3 1 
ATOM   6339  C  CZ2 . TRP C  3  57  ? 69.636  329.739 212.781 1.00 27.79  ? 57   TRP C CZ2 1 
ATOM   6340  C  CZ3 . TRP C  3  57  ? 68.482  331.382 211.356 1.00 29.86  ? 57   TRP C CZ3 1 
ATOM   6341  C  CH2 . TRP C  3  57  ? 68.641  330.055 211.857 1.00 28.53  ? 57   TRP C CH2 1 
ATOM   6342  N  N   . TRP C  3  58  ? 74.298  335.227 214.143 1.00 31.08  ? 58   TRP C N   1 
ATOM   6343  C  CA  . TRP C  3  58  ? 75.660  334.866 214.568 1.00 27.76  ? 58   TRP C CA  1 
ATOM   6344  C  C   . TRP C  3  58  ? 76.129  335.711 215.751 1.00 34.54  ? 58   TRP C C   1 
ATOM   6345  O  O   . TRP C  3  58  ? 76.885  335.218 216.596 1.00 32.53  ? 58   TRP C O   1 
ATOM   6346  C  CB  . TRP C  3  58  ? 76.635  334.951 213.386 1.00 28.89  ? 58   TRP C CB  1 
ATOM   6347  C  CG  . TRP C  3  58  ? 76.384  333.755 212.456 1.00 30.99  ? 58   TRP C CG  1 
ATOM   6348  C  CD1 . TRP C  3  58  ? 76.133  332.442 212.832 1.00 27.07  ? 58   TRP C CD1 1 
ATOM   6349  C  CD2 . TRP C  3  58  ? 76.388  333.775 211.031 1.00 28.60  ? 58   TRP C CD2 1 
ATOM   6350  N  NE1 . TRP C  3  58  ? 75.988  331.645 211.687 1.00 31.95  ? 58   TRP C NE1 1 
ATOM   6351  C  CE2 . TRP C  3  58  ? 76.152  332.441 210.582 1.00 28.54  ? 58   TRP C CE2 1 
ATOM   6352  C  CE3 . TRP C  3  58  ? 76.562  334.789 210.084 1.00 29.05  ? 58   TRP C CE3 1 
ATOM   6353  C  CZ2 . TRP C  3  58  ? 76.072  332.098 209.192 1.00 30.76  ? 58   TRP C CZ2 1 
ATOM   6354  C  CZ3 . TRP C  3  58  ? 76.493  334.435 208.659 1.00 28.03  ? 58   TRP C CZ3 1 
ATOM   6355  C  CH2 . TRP C  3  58  ? 76.254  333.106 208.266 1.00 31.78  ? 58   TRP C CH2 1 
ATOM   6356  N  N   . ARG C  3  59  ? 75.684  336.971 215.831 1.00 32.09  ? 59   ARG C N   1 
ATOM   6357  C  CA  . ARG C  3  59  ? 75.885  337.746 217.050 1.00 31.19  ? 59   ARG C CA  1 
ATOM   6358  C  C   . ARG C  3  59  ? 75.401  336.988 218.273 1.00 36.86  ? 59   ARG C C   1 
ATOM   6359  O  O   . ARG C  3  59  ? 76.100  336.943 219.296 1.00 37.24  ? 59   ARG C O   1 
ATOM   6360  C  CB  . ARG C  3  59  ? 75.155  339.093 216.964 1.00 26.08  ? 59   ARG C CB  1 
ATOM   6361  C  CG  . ARG C  3  59  ? 75.248  339.958 218.340 1.00 31.70  ? 59   ARG C CG  1 
ATOM   6362  C  CD  . ARG C  3  59  ? 74.070  340.914 218.337 1.00 35.58  ? 59   ARG C CD  1 
ATOM   6363  N  NE  . ARG C  3  59  ? 72.794  340.216 218.509 1.00 32.57  ? 59   ARG C NE  1 
ATOM   6364  C  CZ  . ARG C  3  59  ? 71.604  340.800 218.444 1.00 40.62  ? 59   ARG C CZ  1 
ATOM   6365  N  NH1 . ARG C  3  59  ? 71.519  342.100 218.205 1.00 35.41  ? 59   ARG C NH1 1 
ATOM   6366  N  NH2 . ARG C  3  59  ? 70.491  340.103 218.628 1.00 34.46  ? 59   ARG C NH2 1 
ATOM   6367  N  N   . ASP C  3  60  ? 74.171  336.461 218.215 1.00 31.14  ? 60   ASP C N   1 
ATOM   6368  C  CA  . ASP C  3  60  ? 73.624  335.726 219.342 1.00 32.27  ? 60   ASP C CA  1 
ATOM   6369  C  C   . ASP C  3  60  ? 74.416  334.472 219.637 1.00 34.29  ? 60   ASP C C   1 
ATOM   6370  O  O   . ASP C  3  60  ? 74.623  334.134 220.794 1.00 34.18  ? 60   ASP C O   1 
ATOM   6371  C  CB  . ASP C  3  60  ? 72.168  335.369 219.087 1.00 29.89  ? 60   ASP C CB  1 
ATOM   6372  C  CG  . ASP C  3  60  ? 71.275  336.557 219.136 1.00 42.32  ? 60   ASP C CG  1 
ATOM   6373  O  OD1 . ASP C  3  60  ? 71.725  337.680 219.482 1.00 33.63  ? 60   ASP C OD1 1 
ATOM   6374  O  OD2 . ASP C  3  60  ? 70.114  336.368 218.771 1.00 32.09  ? 60   ASP C OD2 1 
ATOM   6375  N  N   . VAL C  3  61  ? 74.922  333.798 218.601 1.00 27.43  ? 61   VAL C N   1 
ATOM   6376  C  CA  . VAL C  3  61  ? 75.766  332.621 218.880 1.00 26.21  ? 61   VAL C CA  1 
ATOM   6377  C  C   . VAL C  3  61  ? 77.024  333.036 219.646 1.00 30.43  ? 61   VAL C C   1 
ATOM   6378  O  O   . VAL C  3  61  ? 77.521  332.301 220.504 1.00 31.80  ? 61   VAL C O   1 
ATOM   6379  C  CB  . VAL C  3  61  ? 76.154  331.904 217.568 1.00 31.87  ? 61   VAL C CB  1 
ATOM   6380  C  CG1 . VAL C  3  61  ? 77.162  330.787 217.858 1.00 28.77  ? 61   VAL C CG1 1 
ATOM   6381  C  CG2 . VAL C  3  61  ? 74.880  331.382 216.877 1.00 28.03  ? 61   VAL C CG2 1 
ATOM   6382  N  N   . ILE C  3  62  ? 77.587  334.199 219.309 1.00 30.41  ? 62   ILE C N   1 
ATOM   6383  C  CA  . ILE C  3  62  ? 78.746  334.722 220.047 1.00 33.63  ? 62   ILE C CA  1 
ATOM   6384  C  C   . ILE C  3  62  ? 78.356  335.062 221.485 1.00 36.86  ? 62   ILE C C   1 
ATOM   6385  O  O   . ILE C  3  62  ? 79.088  334.740 222.428 1.00 32.33  ? 62   ILE C O   1 
ATOM   6386  C  CB  . ILE C  3  62  ? 79.367  335.927 219.307 1.00 33.22  ? 62   ILE C CB  1 
ATOM   6387  C  CG1 . ILE C  3  62  ? 79.981  335.466 217.960 1.00 31.69  ? 62   ILE C CG1 1 
ATOM   6388  C  CG2 . ILE C  3  62  ? 80.403  336.682 220.223 1.00 33.22  ? 62   ILE C CG2 1 
ATOM   6389  C  CD1 . ILE C  3  62  ? 80.236  336.672 217.024 1.00 34.29  ? 62   ILE C CD1 1 
ATOM   6390  N  N   . ARG C  3  63  ? 77.206  335.698 221.680 1.00 29.70  ? 63   ARG C N   1 
ATOM   6391  C  CA  . ARG C  3  63  ? 76.678  335.948 223.029 1.00 32.68  ? 63   ARG C CA  1 
ATOM   6392  C  C   . ARG C  3  63  ? 76.577  334.663 223.837 1.00 38.94  ? 63   ARG C C   1 
ATOM   6393  O  O   . ARG C  3  63  ? 76.957  334.621 225.020 1.00 36.72  ? 63   ARG C O   1 
ATOM   6394  C  CB  . ARG C  3  63  ? 75.296  336.623 222.934 1.00 34.43  ? 63   ARG C CB  1 
ATOM   6395  C  CG  . ARG C  3  63  ? 75.366  338.076 222.505 1.00 37.30  ? 63   ARG C CG  1 
ATOM   6396  C  CD  . ARG C  3  63  ? 74.032  338.678 222.176 1.00 31.32  ? 63   ARG C CD  1 
ATOM   6397  N  NE  . ARG C  3  63  ? 74.214  340.085 221.856 1.00 37.81  ? 63   ARG C NE  1 
ATOM   6398  C  CZ  . ARG C  3  63  ? 73.195  340.926 221.749 1.00 39.82  ? 63   ARG C CZ  1 
ATOM   6399  N  NH1 . ARG C  3  63  ? 71.976  340.474 221.926 1.00 35.85  ? 63   ARG C NH1 1 
ATOM   6400  N  NH2 . ARG C  3  63  ? 73.374  342.215 221.476 1.00 41.36  ? 63   ARG C NH2 1 
ATOM   6401  N  N   . GLU C  3  64  ? 76.060  333.610 223.209 1.00 33.19  ? 64   GLU C N   1 
ATOM   6402  C  CA  . GLU C  3  64  ? 75.776  332.343 223.885 1.00 30.13  ? 64   GLU C CA  1 
ATOM   6403  C  C   . GLU C  3  64  ? 77.043  331.617 224.276 1.00 32.50  ? 64   GLU C C   1 
ATOM   6404  O  O   . GLU C  3  64  ? 77.039  330.832 225.227 1.00 30.76  ? 64   GLU C O   1 
ATOM   6405  C  CB  . GLU C  3  64  ? 74.924  331.444 222.949 1.00 27.78  ? 64   GLU C CB  1 
ATOM   6406  C  CG  . GLU C  3  64  ? 73.489  332.014 222.747 1.00 38.96  ? 64   GLU C CG  1 
ATOM   6407  C  CD  . GLU C  3  64  ? 72.762  331.383 221.558 1.00 56.71  ? 64   GLU C CD  1 
ATOM   6408  O  OE1 . GLU C  3  64  ? 71.562  331.575 221.445 1.00 30.31  ? 64   GLU C OE1 1 
ATOM   6409  O  OE2 . GLU C  3  64  ? 73.377  330.689 220.727 1.00 32.65  ? 64   GLU C OE2 1 
ATOM   6410  N  N   . SER C  3  65  ? 78.123  331.850 223.554 1.00 29.77  ? 65   SER C N   1 
ATOM   6411  C  CA  . SER C  3  65  ? 79.346  331.075 223.733 1.00 29.94  ? 65   SER C CA  1 
ATOM   6412  C  C   . SER C  3  65  ? 80.394  331.874 224.514 1.00 31.69  ? 65   SER C C   1 
ATOM   6413  O  O   . SER C  3  65  ? 80.706  331.544 225.659 1.00 35.29  ? 65   SER C O   1 
ATOM   6414  C  CB  . SER C  3  65  ? 79.856  330.607 222.318 1.00 23.99  ? 65   SER C CB  1 
ATOM   6415  O  OG  . SER C  3  65  ? 80.044  331.755 221.469 1.00 29.49  ? 65   SER C OG  1 
ATOM   6416  N  N   . THR C  3  66  ? 80.875  332.961 223.941 1.00 33.24  ? 66   THR C N   1 
ATOM   6417  C  CA  . THR C  3  66  ? 81.870  333.789 224.604 1.00 29.00  ? 66   THR C CA  1 
ATOM   6418  C  C   . THR C  3  66  ? 81.290  334.407 225.868 1.00 38.97  ? 66   THR C C   1 
ATOM   6419  O  O   . THR C  3  66  ? 81.935  334.406 226.916 1.00 35.22  ? 66   THR C O   1 
ATOM   6420  C  CB  . THR C  3  66  ? 82.356  334.900 223.655 1.00 33.41  ? 66   THR C CB  1 
ATOM   6421  O  OG1 . THR C  3  66  ? 82.767  334.285 222.427 1.00 34.37  ? 66   THR C OG1 1 
ATOM   6422  C  CG2 . THR C  3  66  ? 83.583  335.659 224.295 1.00 28.62  ? 66   THR C CG2 1 
ATOM   6423  N  N   . PHE C  3  67  ? 80.063  334.927 225.786 1.00 33.22  ? 67   PHE C N   1 
ATOM   6424  C  CA  . PHE C  3  67  ? 79.565  335.691 226.934 1.00 32.49  ? 67   PHE C CA  1 
ATOM   6425  C  C   . PHE C  3  67  ? 78.796  334.854 227.941 1.00 34.17  ? 67   PHE C C   1 
ATOM   6426  O  O   . PHE C  3  67  ? 78.835  335.171 229.147 1.00 35.04  ? 67   PHE C O   1 
ATOM   6427  C  CB  . PHE C  3  67  ? 78.727  336.876 226.462 1.00 34.90  ? 67   PHE C CB  1 
ATOM   6428  C  CG  . PHE C  3  67  ? 79.462  337.812 225.498 1.00 38.61  ? 67   PHE C CG  1 
ATOM   6429  C  CD1 . PHE C  3  67  ? 80.837  337.899 225.532 1.00 36.75  ? 67   PHE C CD1 1 
ATOM   6430  C  CD2 . PHE C  3  67  ? 78.760  338.611 224.608 1.00 38.54  ? 67   PHE C CD2 1 
ATOM   6431  C  CE1 . PHE C  3  67  ? 81.540  338.752 224.638 1.00 43.63  ? 67   PHE C CE1 1 
ATOM   6432  C  CE2 . PHE C  3  67  ? 79.419  339.461 223.731 1.00 41.56  ? 67   PHE C CE2 1 
ATOM   6433  C  CZ  . PHE C  3  67  ? 80.828  339.541 223.733 1.00 35.46  ? 67   PHE C CZ  1 
ATOM   6434  N  N   . GLN C  3  68  ? 78.105  333.786 227.517 1.00 32.29  ? 68   GLN C N   1 
ATOM   6435  C  CA  . GLN C  3  68  ? 77.254  333.051 228.453 1.00 31.17  ? 68   GLN C CA  1 
ATOM   6436  C  C   . GLN C  3  68  ? 77.760  331.664 228.775 1.00 34.97  ? 68   GLN C C   1 
ATOM   6437  O  O   . GLN C  3  68  ? 77.214  331.037 229.675 1.00 33.25  ? 68   GLN C O   1 
ATOM   6438  C  CB  . GLN C  3  68  ? 75.804  332.921 227.950 1.00 29.48  ? 68   GLN C CB  1 
ATOM   6439  C  CG  . GLN C  3  68  ? 75.122  334.283 227.654 1.00 34.52  ? 68   GLN C CG  1 
ATOM   6440  C  CD  . GLN C  3  68  ? 73.702  334.068 227.151 1.00 44.07  ? 68   GLN C CD  1 
ATOM   6441  O  OE1 . GLN C  3  68  ? 73.474  333.112 226.465 1.00 34.33  ? 68   GLN C OE1 1 
ATOM   6442  N  NE2 . GLN C  3  68  ? 72.744  334.897 227.545 1.00 32.72  ? 68   GLN C NE2 1 
ATOM   6443  N  N   . GLY C  3  69  ? 78.760  331.162 228.055 1.00 33.61  ? 69   GLY C N   1 
ATOM   6444  C  CA  . GLY C  3  69  ? 79.373  329.881 228.375 1.00 29.11  ? 69   GLY C CA  1 
ATOM   6445  C  C   . GLY C  3  69  ? 78.595  328.631 228.008 1.00 35.67  ? 69   GLY C C   1 
ATOM   6446  O  O   . GLY C  3  69  ? 78.911  327.566 228.538 1.00 31.04  ? 69   GLY C O   1 
ATOM   6447  N  N   . HIS C  3  70  ? 77.649  328.700 227.043 1.00 34.58  ? 70   HIS C N   1 
ATOM   6448  C  CA  . HIS C  3  70  ? 76.930  327.483 226.661 1.00 35.26  ? 70   HIS C CA  1 
ATOM   6449  C  C   . HIS C  3  70  ? 77.711  326.493 225.827 1.00 27.15  ? 70   HIS C C   1 
ATOM   6450  O  O   . HIS C  3  70  ? 77.240  325.367 225.642 1.00 30.52  ? 70   HIS C O   1 
ATOM   6451  C  CB  . HIS C  3  70  ? 75.644  327.845 225.935 1.00 31.27  ? 70   HIS C CB  1 
ATOM   6452  C  CG  . HIS C  3  70  ? 74.670  328.515 226.882 1.00 30.79  ? 70   HIS C CG  1 
ATOM   6453  N  ND1 . HIS C  3  70  ? 73.999  327.806 227.856 1.00 34.73  ? 70   HIS C ND1 1 
ATOM   6454  C  CD2 . HIS C  3  70  ? 74.305  329.810 227.033 1.00 30.97  ? 70   HIS C CD2 1 
ATOM   6455  C  CE1 . HIS C  3  70  ? 73.236  328.639 228.564 1.00 35.43  ? 70   HIS C CE1 1 
ATOM   6456  N  NE2 . HIS C  3  70  ? 73.379  329.853 228.076 1.00 33.56  ? 70   HIS C NE2 1 
ATOM   6457  N  N   . HIS C  3  71  ? 78.894  326.824 225.344 1.00 29.96  ? 71   HIS C N   1 
ATOM   6458  C  CA  . HIS C  3  71  ? 79.565  325.860 224.482 1.00 30.58  ? 71   HIS C CA  1 
ATOM   6459  C  C   . HIS C  3  71  ? 80.492  324.989 225.326 1.00 27.77  ? 71   HIS C C   1 
ATOM   6460  O  O   . HIS C  3  71  ? 81.717  325.127 225.334 1.00 29.56  ? 71   HIS C O   1 
ATOM   6461  C  CB  . HIS C  3  71  ? 80.301  326.555 223.330 1.00 25.54  ? 71   HIS C CB  1 
ATOM   6462  C  CG  . HIS C  3  71  ? 79.380  327.145 222.289 1.00 34.71  ? 71   HIS C CG  1 
ATOM   6463  N  ND1 . HIS C  3  71  ? 79.793  327.446 221.007 1.00 28.12  ? 71   HIS C ND1 1 
ATOM   6464  C  CD2 . HIS C  3  71  ? 78.066  327.493 222.360 1.00 32.09  ? 71   HIS C CD2 1 
ATOM   6465  C  CE1 . HIS C  3  71  ? 78.780  327.970 220.329 1.00 27.85  ? 71   HIS C CE1 1 
ATOM   6466  N  NE2 . HIS C  3  71  ? 77.724  328.025 221.136 1.00 27.45  ? 71   HIS C NE2 1 
ATOM   6467  N  N   . THR C  3  72  ? 79.888  324.000 225.957 1.00 32.99  ? 72   THR C N   1 
ATOM   6468  C  CA  . THR C  3  72  ? 80.633  322.889 226.540 1.00 25.65  ? 72   THR C CA  1 
ATOM   6469  C  C   . THR C  3  72  ? 81.352  322.071 225.429 1.00 29.67  ? 72   THR C C   1 
ATOM   6470  O  O   . THR C  3  72  ? 81.060  322.268 224.229 1.00 32.06  ? 72   THR C O   1 
ATOM   6471  C  CB  . THR C  3  72  ? 79.652  321.981 227.261 1.00 30.98  ? 72   THR C CB  1 
ATOM   6472  O  OG1 . THR C  3  72  ? 78.686  321.571 226.266 1.00 31.23  ? 72   THR C OG1 1 
ATOM   6473  C  CG2 . THR C  3  72  ? 78.901  322.748 228.428 1.00 24.94  ? 72   THR C CG2 1 
ATOM   6474  N  N   . PRO C  3  73  ? 82.215  321.102 225.792 1.00 32.40  ? 73   PRO C N   1 
ATOM   6475  C  CA  . PRO C  3  73  ? 82.852  320.264 224.756 1.00 34.32  ? 73   PRO C CA  1 
ATOM   6476  C  C   . PRO C  3  73  ? 81.841  319.528 223.906 1.00 33.32  ? 73   PRO C C   1 
ATOM   6477  O  O   . PRO C  3  73  ? 82.064  319.360 222.694 1.00 30.84  ? 73   PRO C O   1 
ATOM   6478  C  CB  . PRO C  3  73  ? 83.736  319.284 225.564 1.00 29.82  ? 73   PRO C CB  1 
ATOM   6479  C  CG  . PRO C  3  73  ? 84.176  320.161 226.793 1.00 36.07  ? 73   PRO C CG  1 
ATOM   6480  C  CD  . PRO C  3  73  ? 82.838  320.893 227.138 1.00 32.92  ? 73   PRO C CD  1 
ATOM   6481  N  N   . ALA C  3  74  ? 80.743  319.061 224.507 1.00 32.22  ? 74   ALA C N   1 
ATOM   6482  C  CA  . ALA C  3  74  ? 79.756  318.336 223.689 1.00 34.05  ? 74   ALA C CA  1 
ATOM   6483  C  C   . ALA C  3  74  ? 79.135  319.251 222.645 1.00 30.37  ? 74   ALA C C   1 
ATOM   6484  O  O   . ALA C  3  74  ? 78.913  318.833 221.492 1.00 33.09  ? 74   ALA C O   1 
ATOM   6485  C  CB  . ALA C  3  74  ? 78.666  317.736 224.584 1.00 38.18  ? 74   ALA C CB  1 
ATOM   6486  N  N   . VAL C  3  75  ? 78.841  320.494 223.027 1.00 30.95  ? 75   VAL C N   1 
ATOM   6487  C  CA  . VAL C  3  75  ? 78.229  321.423 222.062 1.00 29.49  ? 75   VAL C CA  1 
ATOM   6488  C  C   . VAL C  3  75  ? 79.237  321.775 220.980 1.00 35.64  ? 75   VAL C C   1 
ATOM   6489  O  O   . VAL C  3  75  ? 78.922  321.840 219.777 1.00 27.39  ? 75   VAL C O   1 
ATOM   6490  C  CB  . VAL C  3  75  ? 77.720  322.668 222.821 1.00 28.65  ? 75   VAL C CB  1 
ATOM   6491  C  CG1 . VAL C  3  75  ? 77.400  323.818 221.856 1.00 30.22  ? 75   VAL C CG1 1 
ATOM   6492  C  CG2 . VAL C  3  75  ? 76.455  322.298 223.699 1.00 31.77  ? 75   VAL C CG2 1 
ATOM   6493  N  N   . GLN C  3  76  ? 80.472  322.001 221.381 1.00 30.79  ? 76   GLN C N   1 
ATOM   6494  C  CA  . GLN C  3  76  ? 81.514  322.280 220.399 1.00 28.89  ? 76   GLN C CA  1 
ATOM   6495  C  C   . GLN C  3  76  ? 81.691  321.106 219.444 1.00 34.19  ? 76   GLN C C   1 
ATOM   6496  O  O   . GLN C  3  76  ? 81.826  321.306 218.228 1.00 29.94  ? 76   GLN C O   1 
ATOM   6497  C  CB  . GLN C  3  76  ? 82.835  322.650 221.161 1.00 30.82  ? 76   GLN C CB  1 
ATOM   6498  C  CG  . GLN C  3  76  ? 83.831  323.195 220.296 1.00 42.90  ? 76   GLN C CG  1 
ATOM   6499  C  CD  . GLN C  3  76  ? 85.043  323.845 220.949 1.00 46.05  ? 76   GLN C CD  1 
ATOM   6500  O  OE1 . GLN C  3  76  ? 85.259  323.876 222.198 1.00 42.01  ? 76   GLN C OE1 1 
ATOM   6501  N  NE2 . GLN C  3  76  ? 85.889  324.340 220.075 1.00 38.03  ? 76   GLN C NE2 1 
ATOM   6502  N  N   . LYS C  3  77  ? 81.691  319.871 219.949 1.00 27.18  ? 77   LYS C N   1 
ATOM   6503  C  CA  . LYS C  3  77  ? 81.797  318.702 219.074 1.00 24.51  ? 77   LYS C CA  1 
ATOM   6504  C  C   . LYS C  3  77  ? 80.670  318.662 218.018 1.00 32.21  ? 77   LYS C C   1 
ATOM   6505  O  O   . LYS C  3  77  ? 80.901  318.295 216.847 1.00 28.44  ? 77   LYS C O   1 
ATOM   6506  C  CB  . LYS C  3  77  ? 81.746  317.433 219.922 1.00 34.26  ? 77   LYS C CB  1 
ATOM   6507  C  CG  . LYS C  3  77  ? 82.801  316.427 219.614 1.00 77.97  ? 77   LYS C CG  1 
ATOM   6508  C  CD  . LYS C  3  77  ? 82.184  315.113 219.179 1.00 50.28  ? 77   LYS C CD  1 
ATOM   6509  C  CE  . LYS C  3  77  ? 83.192  313.965 219.205 1.00 73.24  ? 77   LYS C CE  1 
ATOM   6510  N  NZ  . LYS C  3  77  ? 84.380  314.217 218.338 1.00 140.47 ? 77   LYS C NZ  1 
ATOM   6511  N  N   . GLY C  3  78  ? 79.441  318.971 218.436 1.00 32.68  ? 78   GLY C N   1 
ATOM   6512  C  CA  . GLY C  3  78  ? 78.338  319.060 217.482 1.00 28.20  ? 78   GLY C CA  1 
ATOM   6513  C  C   . GLY C  3  78  ? 78.581  320.110 216.418 1.00 29.66  ? 78   GLY C C   1 
ATOM   6514  O  O   . GLY C  3  78  ? 78.260  319.887 215.239 1.00 26.24  ? 78   GLY C O   1 
ATOM   6515  N  N   . LEU C  3  79  ? 79.074  321.299 216.808 1.00 26.43  ? 79   LEU C N   1 
ATOM   6516  C  CA  . LEU C  3  79  ? 79.332  322.330 215.787 1.00 28.95  ? 79   LEU C CA  1 
ATOM   6517  C  C   . LEU C  3  79  ? 80.416  321.905 214.804 1.00 35.51  ? 79   LEU C C   1 
ATOM   6518  O  O   . LEU C  3  79  ? 80.358  322.287 213.608 1.00 27.19  ? 79   LEU C O   1 
ATOM   6519  C  CB  . LEU C  3  79  ? 79.717  323.672 216.491 1.00 25.77  ? 79   LEU C CB  1 
ATOM   6520  C  CG  . LEU C  3  79  ? 78.541  324.345 217.247 1.00 30.81  ? 79   LEU C CG  1 
ATOM   6521  C  CD1 . LEU C  3  79  ? 79.071  325.404 218.228 1.00 37.24  ? 79   LEU C CD1 1 
ATOM   6522  C  CD2 . LEU C  3  79  ? 77.503  324.984 216.254 1.00 26.12  ? 79   LEU C CD2 1 
ATOM   6523  N  N   . ARG C  3  80  ? 81.407  321.118 215.271 1.00 26.51  ? 80   ARG C N   1 
ATOM   6524  C  CA  . ARG C  3  80  ? 82.405  320.587 214.345 1.00 28.95  ? 80   ARG C CA  1 
ATOM   6525  C  C   . ARG C  3  80  ? 81.760  319.701 213.302 1.00 32.40  ? 80   ARG C C   1 
ATOM   6526  O  O   . ARG C  3  80  ? 82.044  319.838 212.099 1.00 26.95  ? 80   ARG C O   1 
ATOM   6527  C  CB  . ARG C  3  80  ? 83.470  319.766 215.055 1.00 27.65  ? 80   ARG C CB  1 
ATOM   6528  C  CG  . ARG C  3  80  ? 84.279  320.611 216.074 1.00 29.47  ? 80   ARG C CG  1 
ATOM   6529  C  CD  . ARG C  3  80  ? 85.309  319.765 216.839 1.00 40.53  ? 80   ARG C CD  1 
ATOM   6530  N  NE  . ARG C  3  80  ? 86.004  320.774 217.645 1.00 48.19  ? 80   ARG C NE  1 
ATOM   6531  C  CZ  . ARG C  3  80  ? 87.086  321.419 217.257 1.00 165.07 ? 80   ARG C CZ  1 
ATOM   6532  N  NH1 . ARG C  3  80  ? 87.682  321.079 216.109 1.00 37.92  ? 80   ARG C NH1 1 
ATOM   6533  N  NH2 . ARG C  3  80  ? 87.554  322.387 218.029 1.00 52.61  ? 80   ARG C NH2 1 
ATOM   6534  N  N   . TYR C  3  81  ? 80.913  318.743 213.740 1.00 28.19  ? 81   TYR C N   1 
ATOM   6535  C  CA  . TYR C  3  81  ? 80.153  317.927 212.770 1.00 29.56  ? 81   TYR C CA  1 
ATOM   6536  C  C   . TYR C  3  81  ? 79.329  318.791 211.841 1.00 26.33  ? 81   TYR C C   1 
ATOM   6537  O  O   . TYR C  3  81  ? 79.330  318.578 210.605 1.00 31.74  ? 81   TYR C O   1 
ATOM   6538  C  CB  . TYR C  3  81  ? 79.209  316.941 213.482 1.00 26.77  ? 81   TYR C CB  1 
ATOM   6539  C  CG  . TYR C  3  81  ? 79.902  315.797 214.145 1.00 34.82  ? 81   TYR C CG  1 
ATOM   6540  C  CD1 . TYR C  3  81  ? 80.671  314.875 213.430 1.00 45.66  ? 81   TYR C CD1 1 
ATOM   6541  C  CD2 . TYR C  3  81  ? 79.722  315.581 215.489 1.00 38.09  ? 81   TYR C CD2 1 
ATOM   6542  C  CE1 . TYR C  3  81  ? 81.284  313.808 214.087 1.00 49.76  ? 81   TYR C CE1 1 
ATOM   6543  C  CE2 . TYR C  3  81  ? 80.317  314.547 216.132 1.00 43.05  ? 81   TYR C CE2 1 
ATOM   6544  C  CZ  . TYR C  3  81  ? 81.101  313.674 215.468 1.00 66.03  ? 81   TYR C CZ  1 
ATOM   6545  O  OH  . TYR C  3  81  ? 81.646  312.672 216.247 1.00 52.27  ? 81   TYR C OH  1 
ATOM   6546  N  N   . GLY C  3  82  ? 78.611  319.778 212.395 1.00 26.18  ? 82   GLY C N   1 
ATOM   6547  C  CA  . GLY C  3  82  ? 77.761  320.592 211.549 1.00 27.81  ? 82   GLY C CA  1 
ATOM   6548  C  C   . GLY C  3  82  ? 78.550  321.290 210.464 1.00 31.00  ? 82   GLY C C   1 
ATOM   6549  O  O   . GLY C  3  82  ? 78.096  321.380 209.320 1.00 26.73  ? 82   GLY C O   1 
ATOM   6550  N  N   . MET C  3  83  ? 79.732  321.824 210.809 1.00 29.75  ? 83   MET C N   1 
ATOM   6551  C  CA  . MET C  3  83  ? 80.534  322.536 209.831 1.00 34.33  ? 83   MET C CA  1 
ATOM   6552  C  C   . MET C  3  83  ? 81.110  321.589 208.794 1.00 27.79  ? 83   MET C C   1 
ATOM   6553  O  O   . MET C  3  83  ? 81.124  321.906 207.595 1.00 26.77  ? 83   MET C O   1 
ATOM   6554  C  CB  . MET C  3  83  ? 81.671  323.295 210.492 1.00 27.87  ? 83   MET C CB  1 
ATOM   6555  C  CG  . MET C  3  83  ? 82.370  324.230 209.514 1.00 28.05  ? 83   MET C CG  1 
ATOM   6556  S  SD  . MET C  3  83  ? 81.303  325.642 209.110 1.00 31.95  ? 83   MET C SD  1 
ATOM   6557  C  CE  . MET C  3  83  ? 82.248  326.286 207.746 1.00 28.18  ? 83   MET C CE  1 
ATOM   6558  N  N   . ILE C  3  84  ? 81.507  320.407 209.211 1.00 24.25  ? 84   ILE C N   1 
ATOM   6559  C  CA  . ILE C  3  84  ? 82.047  319.430 208.280 1.00 27.02  ? 84   ILE C CA  1 
ATOM   6560  C  C   . ILE C  3  84  ? 80.966  319.037 207.262 1.00 31.70  ? 84   ILE C C   1 
ATOM   6561  O  O   . ILE C  3  84  ? 81.221  318.989 206.057 1.00 24.99  ? 84   ILE C O   1 
ATOM   6562  C  CB  . ILE C  3  84  ? 82.556  318.215 209.066 1.00 26.73  ? 84   ILE C CB  1 
ATOM   6563  C  CG1 . ILE C  3  84  ? 83.919  318.614 209.774 1.00 29.55  ? 84   ILE C CG1 1 
ATOM   6564  C  CG2 . ILE C  3  84  ? 82.810  317.029 208.156 1.00 31.91  ? 84   ILE C CG2 1 
ATOM   6565  C  CD1 . ILE C  3  84  ? 84.353  317.537 210.787 1.00 38.32  ? 84   ILE C CD1 1 
ATOM   6566  N  N   . LEU C  3  85  ? 79.776  318.714 207.756 1.00 24.30  ? 85   LEU C N   1 
ATOM   6567  C  CA  . LEU C  3  85  ? 78.653  318.343 206.901 1.00 22.64  ? 85   LEU C CA  1 
ATOM   6568  C  C   . LEU C  3  85  ? 78.294  319.458 205.956 1.00 28.36  ? 85   LEU C C   1 
ATOM   6569  O  O   . LEU C  3  85  ? 77.990  319.203 204.789 1.00 27.59  ? 85   LEU C O   1 
ATOM   6570  C  CB  . LEU C  3  85  ? 77.440  317.961 207.770 1.00 21.75  ? 85   LEU C CB  1 
ATOM   6571  C  CG  . LEU C  3  85  ? 77.775  316.741 208.615 1.00 26.34  ? 85   LEU C CG  1 
ATOM   6572  C  CD1 . LEU C  3  85  ? 76.700  316.585 209.747 1.00 25.50  ? 85   LEU C CD1 1 
ATOM   6573  C  CD2 . LEU C  3  85  ? 77.868  315.437 207.757 1.00 24.06  ? 85   LEU C CD2 1 
ATOM   6574  N  N   . PHE C  3  86  ? 78.260  320.698 206.433 1.00 24.78  ? 86   PHE C N   1 
ATOM   6575  C  CA  . PHE C  3  86  ? 77.960  321.805 205.547 1.00 29.16  ? 86   PHE C CA  1 
ATOM   6576  C  C   . PHE C  3  86  ? 78.959  321.888 204.384 1.00 35.10  ? 86   PHE C C   1 
ATOM   6577  O  O   . PHE C  3  86  ? 78.571  322.088 203.198 1.00 26.83  ? 86   PHE C O   1 
ATOM   6578  C  CB  . PHE C  3  86  ? 77.985  323.071 206.373 1.00 23.03  ? 86   PHE C CB  1 
ATOM   6579  C  CG  . PHE C  3  86  ? 77.776  324.319 205.533 1.00 32.66  ? 86   PHE C CG  1 
ATOM   6580  C  CD1 . PHE C  3  86  ? 76.541  324.566 204.926 1.00 35.44  ? 86   PHE C CD1 1 
ATOM   6581  C  CD2 . PHE C  3  86  ? 78.807  325.201 205.335 1.00 31.32  ? 86   PHE C CD2 1 
ATOM   6582  C  CE1 . PHE C  3  86  ? 76.352  325.703 204.139 1.00 42.19  ? 86   PHE C CE1 1 
ATOM   6583  C  CE2 . PHE C  3  86  ? 78.617  326.366 204.533 1.00 38.95  ? 86   PHE C CE2 1 
ATOM   6584  C  CZ  . PHE C  3  86  ? 77.375  326.597 203.954 1.00 36.25  ? 86   PHE C CZ  1 
ATOM   6585  N  N   . ILE C  3  87  ? 80.250  321.762 204.714 1.00 28.36  ? 87   ILE C N   1 
ATOM   6586  C  CA  . ILE C  3  87  ? 81.299  321.770 203.683 1.00 26.88  ? 87   ILE C CA  1 
ATOM   6587  C  C   . ILE C  3  87  ? 81.120  320.625 202.711 1.00 23.32  ? 87   ILE C C   1 
ATOM   6588  O  O   . ILE C  3  87  ? 81.272  320.825 201.486 1.00 27.88  ? 87   ILE C O   1 
ATOM   6589  C  CB  . ILE C  3  87  ? 82.706  321.772 204.319 1.00 23.40  ? 87   ILE C CB  1 
ATOM   6590  C  CG1 . ILE C  3  87  ? 82.907  323.141 205.017 1.00 22.10  ? 87   ILE C CG1 1 
ATOM   6591  C  CG2 . ILE C  3  87  ? 83.812  321.531 203.232 1.00 22.43  ? 87   ILE C CG2 1 
ATOM   6592  C  CD1 . ILE C  3  87  ? 84.265  323.172 205.919 1.00 25.40  ? 87   ILE C CD1 1 
ATOM   6593  N  N   . ILE C  3  88  ? 80.769  319.429 203.191 1.00 24.91  ? 88   ILE C N   1 
ATOM   6594  C  CA  . ILE C  3  88  ? 80.497  318.329 202.258 1.00 25.73  ? 88   ILE C CA  1 
ATOM   6595  C  C   . ILE C  3  88  ? 79.382  318.717 201.266 1.00 31.66  ? 88   ILE C C   1 
ATOM   6596  O  O   . ILE C  3  88  ? 79.482  318.464 200.038 1.00 26.89  ? 88   ILE C O   1 
ATOM   6597  C  CB  . ILE C  3  88  ? 80.124  317.038 203.006 1.00 23.95  ? 88   ILE C CB  1 
ATOM   6598  C  CG1 . ILE C  3  88  ? 81.397  316.455 203.674 1.00 25.46  ? 88   ILE C CG1 1 
ATOM   6599  C  CG2 . ILE C  3  88  ? 79.501  316.011 202.012 1.00 25.17  ? 88   ILE C CG2 1 
ATOM   6600  C  CD1 . ILE C  3  88  ? 81.051  315.467 204.824 1.00 26.74  ? 88   ILE C CD1 1 
ATOM   6601  N  N   . SER C  3  89  ? 78.304  319.331 201.778 1.00 24.36  ? 89   SER C N   1 
ATOM   6602  C  CA  . SER C  3  89  ? 77.221  319.689 200.847 1.00 25.91  ? 89   SER C CA  1 
ATOM   6603  C  C   . SER C  3  89  ? 77.690  320.730 199.816 1.00 28.23  ? 89   SER C C   1 
ATOM   6604  O  O   . SER C  3  89  ? 77.246  320.710 198.664 1.00 27.66  ? 89   SER C O   1 
ATOM   6605  C  CB  . SER C  3  89  ? 75.967  320.197 201.619 1.00 27.86  ? 89   SER C CB  1 
ATOM   6606  O  OG  . SER C  3  89  ? 76.180  321.542 202.103 1.00 31.57  ? 89   SER C OG  1 
ATOM   6607  N  N   . GLU C  3  90  ? 78.563  321.658 200.210 1.00 25.20  ? 90   GLU C N   1 
ATOM   6608  C  CA  . GLU C  3  90  ? 79.122  322.624 199.274 1.00 25.95  ? 90   GLU C CA  1 
ATOM   6609  C  C   . GLU C  3  90  ? 80.039  321.962 198.263 1.00 26.18  ? 90   GLU C C   1 
ATOM   6610  O  O   . GLU C  3  90  ? 80.075  322.395 197.125 1.00 27.51  ? 90   GLU C O   1 
ATOM   6611  C  CB  . GLU C  3  90  ? 79.925  323.677 200.030 1.00 28.73  ? 90   GLU C CB  1 
ATOM   6612  C  CG  . GLU C  3  90  ? 78.984  324.503 200.908 1.00 32.52  ? 90   GLU C CG  1 
ATOM   6613  C  CD  . GLU C  3  90  ? 78.822  325.853 200.336 1.00 131.54 ? 90   GLU C CD  1 
ATOM   6614  O  OE1 . GLU C  3  90  ? 78.285  325.958 199.212 1.00 61.89  ? 90   GLU C OE1 1 
ATOM   6615  O  OE2 . GLU C  3  90  ? 79.307  326.792 201.001 1.00 48.65  ? 90   GLU C OE2 1 
ATOM   6616  N  N   . VAL C  3  91  ? 80.729  320.894 198.653 1.00 27.84  ? 91   VAL C N   1 
ATOM   6617  C  CA  . VAL C  3  91  ? 81.549  320.158 197.705 1.00 27.88  ? 91   VAL C CA  1 
ATOM   6618  C  C   . VAL C  3  91  ? 80.665  319.523 196.635 1.00 28.69  ? 91   VAL C C   1 
ATOM   6619  O  O   . VAL C  3  91  ? 80.974  319.576 195.420 1.00 27.67  ? 91   VAL C O   1 
ATOM   6620  C  CB  . VAL C  3  91  ? 82.381  319.076 198.423 1.00 28.95  ? 91   VAL C CB  1 
ATOM   6621  C  CG1 . VAL C  3  91  ? 83.068  318.156 197.366 1.00 27.13  ? 91   VAL C CG1 1 
ATOM   6622  C  CG2 . VAL C  3  91  ? 83.451  319.709 199.390 1.00 30.31  ? 91   VAL C CG2 1 
ATOM   6623  N  N   . LEU C  3  92  ? 79.586  318.868 197.062 1.00 25.65  ? 92   LEU C N   1 
ATOM   6624  C  CA  . LEU C  3  92  ? 78.688  318.266 196.075 1.00 28.39  ? 92   LEU C CA  1 
ATOM   6625  C  C   . LEU C  3  92  ? 78.068  319.320 195.168 1.00 26.49  ? 92   LEU C C   1 
ATOM   6626  O  O   . LEU C  3  92  ? 77.790  319.045 193.983 1.00 26.47  ? 92   LEU C O   1 
ATOM   6627  C  CB  . LEU C  3  92  ? 77.616  317.448 196.774 1.00 24.04  ? 92   LEU C CB  1 
ATOM   6628  C  CG  . LEU C  3  92  ? 77.991  316.005 197.097 1.00 27.10  ? 92   LEU C CG  1 
ATOM   6629  C  CD1 . LEU C  3  92  ? 78.059  315.243 195.701 1.00 26.73  ? 92   LEU C CD1 1 
ATOM   6630  C  CD2 . LEU C  3  92  ? 79.361  315.952 197.756 1.00 26.20  ? 92   LEU C CD2 1 
ATOM   6631  N  N   . PHE C  3  93  ? 77.761  320.499 195.692 1.00 24.59  ? 93   PHE C N   1 
ATOM   6632  C  CA  . PHE C  3  93  ? 77.238  321.561 194.825 1.00 28.13  ? 93   PHE C CA  1 
ATOM   6633  C  C   . PHE C  3  93  ? 78.245  321.903 193.723 1.00 29.75  ? 93   PHE C C   1 
ATOM   6634  O  O   . PHE C  3  93  ? 77.885  321.991 192.535 1.00 27.52  ? 93   PHE C O   1 
ATOM   6635  C  CB  . PHE C  3  93  ? 76.965  322.790 195.666 1.00 27.32  ? 93   PHE C CB  1 
ATOM   6636  C  CG  . PHE C  3  93  ? 76.369  323.960 194.926 1.00 32.97  ? 93   PHE C CG  1 
ATOM   6637  C  CD1 . PHE C  3  93  ? 75.097  323.885 194.412 1.00 25.46  ? 93   PHE C CD1 1 
ATOM   6638  C  CD2 . PHE C  3  93  ? 77.045  325.159 194.856 1.00 31.73  ? 93   PHE C CD2 1 
ATOM   6639  C  CE1 . PHE C  3  93  ? 74.507  324.945 193.769 1.00 28.75  ? 93   PHE C CE1 1 
ATOM   6640  C  CE2 . PHE C  3  93  ? 76.475  326.257 194.268 1.00 42.64  ? 93   PHE C CE2 1 
ATOM   6641  C  CZ  . PHE C  3  93  ? 75.166  326.164 193.702 1.00 32.95  ? 93   PHE C CZ  1 
ATOM   6642  N  N   . PHE C  3  94  ? 79.521  322.114 194.095 1.00 30.38  ? 94   PHE C N   1 
ATOM   6643  C  CA  . PHE C  3  94  ? 80.507  322.363 193.027 1.00 24.80  ? 94   PHE C CA  1 
ATOM   6644  C  C   . PHE C  3  94  ? 80.655  321.164 192.116 1.00 31.47  ? 94   PHE C C   1 
ATOM   6645  O  O   . PHE C  3  94  ? 80.894  321.319 190.911 1.00 28.05  ? 94   PHE C O   1 
ATOM   6646  C  CB  . PHE C  3  94  ? 81.856  322.731 193.661 1.00 24.19  ? 94   PHE C CB  1 
ATOM   6647  C  CG  . PHE C  3  94  ? 81.926  324.185 193.964 1.00 29.37  ? 94   PHE C CG  1 
ATOM   6648  C  CD1 . PHE C  3  94  ? 82.193  325.103 192.910 1.00 30.99  ? 94   PHE C CD1 1 
ATOM   6649  C  CD2 . PHE C  3  94  ? 81.656  324.673 195.235 1.00 29.47  ? 94   PHE C CD2 1 
ATOM   6650  C  CE1 . PHE C  3  94  ? 82.278  326.519 193.187 1.00 29.22  ? 94   PHE C CE1 1 
ATOM   6651  C  CE2 . PHE C  3  94  ? 81.682  326.085 195.502 1.00 29.87  ? 94   PHE C CE2 1 
ATOM   6652  C  CZ  . PHE C  3  94  ? 81.985  326.987 194.477 1.00 31.41  ? 94   PHE C CZ  1 
ATOM   6653  N  N   . THR C  3  95  ? 80.522  319.959 192.656 1.00 25.50  ? 95   THR C N   1 
ATOM   6654  C  CA  . THR C  3  95  ? 80.629  318.768 191.813 1.00 24.12  ? 95   THR C CA  1 
ATOM   6655  C  C   . THR C  3  95  ? 79.629  318.807 190.633 1.00 28.22  ? 95   THR C C   1 
ATOM   6656  O  O   . THR C  3  95  ? 79.963  318.389 189.522 1.00 27.32  ? 95   THR C O   1 
ATOM   6657  C  CB  . THR C  3  95  ? 80.409  317.541 192.697 1.00 33.36  ? 95   THR C CB  1 
ATOM   6658  O  OG1 . THR C  3  95  ? 81.591  317.352 193.534 1.00 33.08  ? 95   THR C OG1 1 
ATOM   6659  C  CG2 . THR C  3  95  ? 80.252  316.349 191.921 1.00 36.44  ? 95   THR C CG2 1 
ATOM   6660  N  N   . GLY C  3  96  ? 78.445  319.379 190.829 1.00 24.70  ? 96   GLY C N   1 
ATOM   6661  C  CA  . GLY C  3  96  ? 77.516  319.495 189.720 1.00 22.93  ? 96   GLY C CA  1 
ATOM   6662  C  C   . GLY C  3  96  ? 78.025  320.403 188.625 1.00 33.09  ? 96   GLY C C   1 
ATOM   6663  O  O   . GLY C  3  96  ? 77.772  320.152 187.438 1.00 28.38  ? 96   GLY C O   1 
ATOM   6664  N  N   . PHE C  3  97  ? 78.725  321.478 188.983 1.00 23.99  ? 97   PHE C N   1 
ATOM   6665  C  CA  . PHE C  3  97  ? 79.288  322.340 187.937 1.00 28.32  ? 97   PHE C CA  1 
ATOM   6666  C  C   . PHE C  3  97  ? 80.505  321.745 187.242 1.00 25.89  ? 97   PHE C C   1 
ATOM   6667  O  O   . PHE C  3  97  ? 80.706  321.981 186.031 1.00 28.26  ? 97   PHE C O   1 
ATOM   6668  C  CB  . PHE C  3  97  ? 79.623  323.686 188.559 1.00 30.22  ? 97   PHE C CB  1 
ATOM   6669  C  CG  . PHE C  3  97  ? 78.419  324.391 189.045 1.00 35.26  ? 97   PHE C CG  1 
ATOM   6670  C  CD1 . PHE C  3  97  ? 77.510  324.904 188.140 1.00 37.36  ? 97   PHE C CD1 1 
ATOM   6671  C  CD2 . PHE C  3  97  ? 78.153  324.498 190.400 1.00 37.96  ? 97   PHE C CD2 1 
ATOM   6672  C  CE1 . PHE C  3  97  ? 76.372  325.530 188.607 1.00 35.43  ? 97   PHE C CE1 1 
ATOM   6673  C  CE2 . PHE C  3  97  ? 76.993  325.137 190.853 1.00 45.75  ? 97   PHE C CE2 1 
ATOM   6674  C  CZ  . PHE C  3  97  ? 76.123  325.653 189.947 1.00 36.57  ? 97   PHE C CZ  1 
ATOM   6675  N  N   . PHE C  3  98  ? 81.309  320.962 187.965 1.00 27.05  ? 98   PHE C N   1 
ATOM   6676  C  CA  . PHE C  3  98  ? 82.414  320.261 187.336 1.00 33.63  ? 98   PHE C CA  1 
ATOM   6677  C  C   . PHE C  3  98  ? 81.890  319.205 186.407 1.00 41.23  ? 98   PHE C C   1 
ATOM   6678  O  O   . PHE C  3  98  ? 82.468  318.971 185.341 1.00 27.98  ? 98   PHE C O   1 
ATOM   6679  C  CB  . PHE C  3  98  ? 83.355  319.627 188.381 1.00 24.67  ? 98   PHE C CB  1 
ATOM   6680  C  CG  . PHE C  3  98  ? 84.321  320.606 188.991 1.00 30.07  ? 98   PHE C CG  1 
ATOM   6681  C  CD1 . PHE C  3  98  ? 85.536  320.872 188.361 1.00 31.26  ? 98   PHE C CD1 1 
ATOM   6682  C  CD2 . PHE C  3  98  ? 84.048  321.219 190.221 1.00 31.03  ? 98   PHE C CD2 1 
ATOM   6683  C  CE1 . PHE C  3  98  ? 86.458  321.768 188.900 1.00 37.01  ? 98   PHE C CE1 1 
ATOM   6684  C  CE2 . PHE C  3  98  ? 84.934  322.149 190.757 1.00 38.43  ? 98   PHE C CE2 1 
ATOM   6685  C  CZ  . PHE C  3  98  ? 86.156  322.432 190.080 1.00 33.45  ? 98   PHE C CZ  1 
ATOM   6686  N  N   . TRP C  3  99  ? 80.797  318.539 186.796 1.00 30.14  ? 99   TRP C N   1 
ATOM   6687  C  CA  . TRP C  3  99  ? 80.174  317.575 185.887 1.00 31.06  ? 99   TRP C CA  1 
ATOM   6688  C  C   . TRP C  3  99  ? 79.725  318.266 184.587 1.00 30.29  ? 99   TRP C C   1 
ATOM   6689  O  O   . TRP C  3  99  ? 79.995  317.779 183.476 1.00 28.01  ? 99   TRP C O   1 
ATOM   6690  C  CB  . TRP C  3  99  ? 79.002  316.897 186.627 1.00 22.22  ? 99   TRP C CB  1 
ATOM   6691  C  CG  . TRP C  3  99  ? 78.329  315.700 185.951 1.00 28.20  ? 99   TRP C CG  1 
ATOM   6692  C  CD1 . TRP C  3  99  ? 78.349  315.348 184.606 1.00 32.09  ? 99   TRP C CD1 1 
ATOM   6693  C  CD2 . TRP C  3  99  ? 77.515  314.711 186.609 1.00 28.75  ? 99   TRP C CD2 1 
ATOM   6694  N  NE1 . TRP C  3  99  ? 77.669  314.174 184.420 1.00 28.76  ? 99   TRP C NE1 1 
ATOM   6695  C  CE2 . TRP C  3  99  ? 77.086  313.796 185.605 1.00 26.70  ? 99   TRP C CE2 1 
ATOM   6696  C  CE3 . TRP C  3  99  ? 77.083  314.544 187.947 1.00 35.73  ? 99   TRP C CE3 1 
ATOM   6697  C  CZ2 . TRP C  3  99  ? 76.268  312.707 185.893 1.00 27.63  ? 99   TRP C CZ2 1 
ATOM   6698  C  CZ3 . TRP C  3  99  ? 76.261  313.464 188.254 1.00 33.62  ? 99   TRP C CZ3 1 
ATOM   6699  C  CH2 . TRP C  3  99  ? 75.854  312.545 187.245 1.00 27.12  ? 99   TRP C CH2 1 
ATOM   6700  N  N   . ALA C  3  100 ? 79.072  319.424 184.713 1.00 25.62  ? 100  ALA C N   1 
ATOM   6701  C  CA  . ALA C  3  100 ? 78.644  320.192 183.532 1.00 26.70  ? 100  ALA C CA  1 
ATOM   6702  C  C   . ALA C  3  100 ? 79.851  320.547 182.658 1.00 32.45  ? 100  ALA C C   1 
ATOM   6703  O  O   . ALA C  3  100 ? 79.840  320.332 181.429 1.00 28.33  ? 100  ALA C O   1 
ATOM   6704  C  CB  . ALA C  3  100 ? 77.905  321.455 184.018 1.00 23.66  ? 100  ALA C CB  1 
ATOM   6705  N  N   . PHE C  3  101 ? 80.953  320.967 183.292 1.00 25.74  ? 101  PHE C N   1 
ATOM   6706  C  CA  . PHE C  3  101 ? 82.160  321.345 182.556 1.00 28.98  ? 101  PHE C CA  1 
ATOM   6707  C  C   . PHE C  3  101 ? 82.723  320.180 181.766 1.00 27.84  ? 101  PHE C C   1 
ATOM   6708  O  O   . PHE C  3  101 ? 82.978  320.281 180.556 1.00 28.63  ? 101  PHE C O   1 
ATOM   6709  C  CB  . PHE C  3  101 ? 83.243  321.866 183.514 1.00 25.71  ? 101  PHE C CB  1 
ATOM   6710  C  CG  . PHE C  3  101 ? 84.545  322.054 182.820 1.00 30.95  ? 101  PHE C CG  1 
ATOM   6711  C  CD1 . PHE C  3  101 ? 84.635  323.044 181.812 1.00 27.02  ? 101  PHE C CD1 1 
ATOM   6712  C  CD2 . PHE C  3  101 ? 85.614  321.161 183.036 1.00 29.52  ? 101  PHE C CD2 1 
ATOM   6713  C  CE1 . PHE C  3  101 ? 85.867  323.207 181.076 1.00 30.39  ? 101  PHE C CE1 1 
ATOM   6714  C  CE2 . PHE C  3  101 ? 86.825  321.311 182.326 1.00 33.20  ? 101  PHE C CE2 1 
ATOM   6715  C  CZ  . PHE C  3  101 ? 86.962  322.297 181.371 1.00 30.74  ? 101  PHE C CZ  1 
ATOM   6716  N  N   . TYR C  3  102 ? 82.939  319.050 182.440 1.00 25.10  ? 102  TYR C N   1 
ATOM   6717  C  CA  . TYR C  3  102 ? 83.532  317.914 181.752 1.00 25.58  ? 102  TYR C CA  1 
ATOM   6718  C  C   . TYR C  3  102 ? 82.579  317.319 180.709 1.00 32.29  ? 102  TYR C C   1 
ATOM   6719  O  O   . TYR C  3  102 ? 83.025  316.810 179.672 1.00 28.59  ? 102  TYR C O   1 
ATOM   6720  C  CB  . TYR C  3  102 ? 83.940  316.841 182.777 1.00 31.31  ? 102  TYR C CB  1 
ATOM   6721  C  CG  . TYR C  3  102 ? 85.335  317.211 183.383 1.00 29.69  ? 102  TYR C CG  1 
ATOM   6722  C  CD1 . TYR C  3  102 ? 86.479  317.139 182.535 1.00 40.07  ? 102  TYR C CD1 1 
ATOM   6723  C  CD2 . TYR C  3  102 ? 85.496  317.667 184.663 1.00 35.17  ? 102  TYR C CD2 1 
ATOM   6724  C  CE1 . TYR C  3  102 ? 87.718  317.494 183.013 1.00 59.24  ? 102  TYR C CE1 1 
ATOM   6725  C  CE2 . TYR C  3  102 ? 86.751  318.022 185.159 1.00 35.05  ? 102  TYR C CE2 1 
ATOM   6726  C  CZ  . TYR C  3  102 ? 87.855  317.923 184.334 1.00 42.72  ? 102  TYR C CZ  1 
ATOM   6727  O  OH  . TYR C  3  102 ? 89.155  318.251 184.758 1.00 41.78  ? 102  TYR C OH  1 
ATOM   6728  N  N   . HIS C  3  103 ? 81.280  317.338 180.978 1.00 26.82  ? 103  HIS C N   1 
ATOM   6729  C  CA  . HIS C  3  103 ? 80.314  316.820 180.003 1.00 29.32  ? 103  HIS C CA  1 
ATOM   6730  C  C   . HIS C  3  103 ? 80.426  317.565 178.667 1.00 28.06  ? 103  HIS C C   1 
ATOM   6731  O  O   . HIS C  3  103 ? 80.449  316.958 177.581 1.00 30.45  ? 103  HIS C O   1 
ATOM   6732  C  CB  . HIS C  3  103 ? 78.893  316.952 180.575 1.00 24.12  ? 103  HIS C CB  1 
ATOM   6733  C  CG  . HIS C  3  103 ? 77.853  316.463 179.626 1.00 23.60  ? 103  HIS C CG  1 
ATOM   6734  N  ND1 . HIS C  3  103 ? 77.331  315.185 179.716 1.00 25.70  ? 103  HIS C ND1 1 
ATOM   6735  C  CD2 . HIS C  3  103 ? 77.258  317.055 178.551 1.00 27.76  ? 103  HIS C CD2 1 
ATOM   6736  C  CE1 . HIS C  3  103 ? 76.474  315.006 178.711 1.00 24.79  ? 103  HIS C CE1 1 
ATOM   6737  N  NE2 . HIS C  3  103 ? 76.437  316.117 177.977 1.00 29.19  ? 103  HIS C NE2 1 
ATOM   6738  N  N   . SER C  3  104 ? 80.527  318.872 178.727 1.00 24.02  ? 104  SER C N   1 
ATOM   6739  C  CA  . SER C  3  104 ? 80.557  319.706 177.538 1.00 32.58  ? 104  SER C CA  1 
ATOM   6740  C  C   . SER C  3  104 ? 81.902  319.660 176.846 1.00 33.97  ? 104  SER C C   1 
ATOM   6741  O  O   . SER C  3  104 ? 81.969  319.717 175.619 1.00 31.85  ? 104  SER C O   1 
ATOM   6742  C  CB  . SER C  3  104 ? 80.271  321.153 177.911 1.00 33.46  ? 104  SER C CB  1 
ATOM   6743  O  OG  . SER C  3  104 ? 79.123  321.208 178.741 1.00 49.24  ? 104  SER C OG  1 
ATOM   6744  N  N   . SER C  3  105 ? 82.979  319.638 177.611 1.00 30.78  ? 105  SER C N   1 
ATOM   6745  C  CA  . SER C  3  105 ? 84.319  319.763 177.047 1.00 29.00  ? 105  SER C CA  1 
ATOM   6746  C  C   . SER C  3  105 ? 84.907  318.444 176.598 1.00 39.97  ? 105  SER C C   1 
ATOM   6747  O  O   . SER C  3  105 ? 85.803  318.434 175.742 1.00 33.51  ? 105  SER C O   1 
ATOM   6748  C  CB  . SER C  3  105 ? 85.257  320.434 178.048 1.00 25.42  ? 105  SER C CB  1 
ATOM   6749  O  OG  . SER C  3  105 ? 85.405  319.643 179.273 1.00 31.23  ? 105  SER C OG  1 
ATOM   6750  N  N   . LEU C  3  106 ? 84.478  317.337 177.182 1.00 31.11  ? 106  LEU C N   1 
ATOM   6751  C  CA  . LEU C  3  106 ? 84.935  316.051 176.711 1.00 33.48  ? 106  LEU C CA  1 
ATOM   6752  C  C   . LEU C  3  106 ? 84.194  315.597 175.453 1.00 44.76  ? 106  LEU C C   1 
ATOM   6753  O  O   . LEU C  3  106 ? 84.619  314.635 174.825 1.00 39.38  ? 106  LEU C O   1 
ATOM   6754  C  CB  . LEU C  3  106 ? 84.763  314.980 177.778 1.00 32.42  ? 106  LEU C CB  1 
ATOM   6755  C  CG  . LEU C  3  106 ? 85.660  315.145 178.997 1.00 37.24  ? 106  LEU C CG  1 
ATOM   6756  C  CD1 . LEU C  3  106 ? 85.227  314.128 180.058 1.00 37.70  ? 106  LEU C CD1 1 
ATOM   6757  C  CD2 . LEU C  3  106 ? 87.059  314.806 178.431 1.00 36.94  ? 106  LEU C CD2 1 
ATOM   6758  N  N   . ALA C  3  107 ? 83.066  316.205 175.087 1.00 36.05  ? 107  ALA C N   1 
ATOM   6759  C  CA  . ALA C  3  107 ? 82.285  315.733 173.940 1.00 47.95  ? 107  ALA C CA  1 
ATOM   6760  C  C   . ALA C  3  107 ? 81.779  316.924 173.140 1.00 33.92  ? 107  ALA C C   1 
ATOM   6761  O  O   . ALA C  3  107 ? 80.566  317.153 173.033 1.00 39.17  ? 107  ALA C O   1 
ATOM   6762  C  CB  . ALA C  3  107 ? 81.137  314.836 174.431 1.00 38.30  ? 107  ALA C CB  1 
ATOM   6763  N  N   . PRO C  3  108 ? 82.695  317.756 172.614 1.00 33.01  ? 108  PRO C N   1 
ATOM   6764  C  CA  . PRO C  3  108 ? 82.261  319.069 172.111 1.00 33.91  ? 108  PRO C CA  1 
ATOM   6765  C  C   . PRO C  3  108 ? 81.379  318.851 170.903 1.00 36.47  ? 108  PRO C C   1 
ATOM   6766  O  O   . PRO C  3  108 ? 81.689  318.031 170.029 1.00 36.56  ? 108  PRO C O   1 
ATOM   6767  C  CB  . PRO C  3  108 ? 83.585  319.821 171.790 1.00 35.86  ? 108  PRO C CB  1 
ATOM   6768  C  CG  . PRO C  3  108 ? 84.657  318.721 171.705 1.00 34.37  ? 108  PRO C CG  1 
ATOM   6769  C  CD  . PRO C  3  108 ? 84.172  317.598 172.638 1.00 31.92  ? 108  PRO C CD  1 
ATOM   6770  N  N   . THR C  3  109 ? 80.227  319.521 170.886 1.00 32.87  ? 109  THR C N   1 
ATOM   6771  C  CA  . THR C  3  109 ? 79.243  319.254 169.849 1.00 33.08  ? 109  THR C CA  1 
ATOM   6772  C  C   . THR C  3  109 ? 79.627  319.957 168.528 1.00 40.65  ? 109  THR C C   1 
ATOM   6773  O  O   . THR C  3  109 ? 80.498  320.837 168.488 1.00 32.12  ? 109  THR C O   1 
ATOM   6774  C  CB  . THR C  3  109 ? 77.869  319.735 170.310 1.00 32.22  ? 109  THR C CB  1 
ATOM   6775  O  OG1 . THR C  3  109 ? 77.913  321.160 170.349 1.00 35.51  ? 109  THR C OG1 1 
ATOM   6776  C  CG2 . THR C  3  109 ? 77.474  319.143 171.706 1.00 32.10  ? 109  THR C CG2 1 
ATOM   6777  N  N   . PRO C  3  110 ? 78.936  319.659 167.425 1.00 35.83  ? 110  PRO C N   1 
ATOM   6778  C  CA  . PRO C  3  110 ? 79.299  320.352 166.142 1.00 34.39  ? 110  PRO C CA  1 
ATOM   6779  C  C   . PRO C  3  110 ? 79.159  321.866 166.207 1.00 37.04  ? 110  PRO C C   1 
ATOM   6780  O  O   . PRO C  3  110 ? 79.897  322.591 165.521 1.00 34.48  ? 110  PRO C O   1 
ATOM   6781  C  CB  . PRO C  3  110 ? 78.305  319.768 165.110 1.00 26.33  ? 110  PRO C CB  1 
ATOM   6782  C  CG  . PRO C  3  110 ? 78.099  318.282 165.624 1.00 30.37  ? 110  PRO C CG  1 
ATOM   6783  C  CD  . PRO C  3  110 ? 78.033  318.494 167.214 1.00 31.84  ? 110  PRO C CD  1 
ATOM   6784  N  N   . GLU C  3  111 ? 78.220  322.371 167.011 1.00 28.12  ? 111  GLU C N   1 
ATOM   6785  C  CA  . GLU C  3  111 ? 78.009  323.820 167.064 1.00 28.90  ? 111  GLU C CA  1 
ATOM   6786  C  C   . GLU C  3  111 ? 79.237  324.558 167.540 1.00 35.54  ? 111  GLU C C   1 
ATOM   6787  O  O   . GLU C  3  111 ? 79.350  325.763 167.304 1.00 38.82  ? 111  GLU C O   1 
ATOM   6788  C  CB  . GLU C  3  111 ? 76.839  324.170 168.013 1.00 29.84  ? 111  GLU C CB  1 
ATOM   6789  C  CG  . GLU C  3  111 ? 75.436  323.812 167.533 1.00 32.54  ? 111  GLU C CG  1 
ATOM   6790  C  CD  . GLU C  3  111 ? 74.990  322.382 167.880 1.00 35.87  ? 111  GLU C CD  1 
ATOM   6791  O  OE1 . GLU C  3  111 ? 75.837  321.581 168.325 1.00 38.41  ? 111  GLU C OE1 1 
ATOM   6792  O  OE2 . GLU C  3  111 ? 73.803  322.049 167.672 1.00 38.85  ? 111  GLU C OE2 1 
ATOM   6793  N  N   . LEU C  3  112 ? 80.109  323.884 168.292 1.00 29.85  ? 112  LEU C N   1 
ATOM   6794  C  CA  . LEU C  3  112 ? 81.339  324.482 168.786 1.00 35.41  ? 112  LEU C CA  1 
ATOM   6795  C  C   . LEU C  3  112 ? 82.450  324.367 167.771 1.00 36.00  ? 112  LEU C C   1 
ATOM   6796  O  O   . LEU C  3  112 ? 83.540  324.818 168.061 1.00 31.73  ? 112  LEU C O   1 
ATOM   6797  C  CB  . LEU C  3  112 ? 81.871  323.776 170.082 1.00 29.31  ? 112  LEU C CB  1 
ATOM   6798  C  CG  . LEU C  3  112 ? 80.838  323.686 171.221 1.00 38.12  ? 112  LEU C CG  1 
ATOM   6799  C  CD1 . LEU C  3  112 ? 81.350  322.857 172.433 1.00 33.76  ? 112  LEU C CD1 1 
ATOM   6800  C  CD2 . LEU C  3  112 ? 80.455  325.059 171.608 1.00 33.48  ? 112  LEU C CD2 1 
ATOM   6801  N  N   . GLY C  3  113 ? 82.225  323.663 166.668 1.00 35.25  ? 113  GLY C N   1 
ATOM   6802  C  CA  . GLY C  3  113 ? 83.335  323.258 165.806 1.00 34.25  ? 113  GLY C CA  1 
ATOM   6803  C  C   . GLY C  3  113 ? 83.819  321.866 166.127 1.00 35.79  ? 113  GLY C C   1 
ATOM   6804  O  O   . GLY C  3  113 ? 84.835  321.436 165.594 1.00 40.96  ? 113  GLY C O   1 
ATOM   6805  N  N   . GLY C  3  114 ? 83.116  321.145 166.985 1.00 35.86  ? 114  GLY C N   1 
ATOM   6806  C  CA  . GLY C  3  114 ? 83.561  319.806 167.314 1.00 31.73  ? 114  GLY C CA  1 
ATOM   6807  C  C   . GLY C  3  114 ? 84.851  319.728 168.078 1.00 41.37  ? 114  GLY C C   1 
ATOM   6808  O  O   . GLY C  3  114 ? 85.469  318.668 168.098 1.00 38.29  ? 114  GLY C O   1 
ATOM   6809  N  N   . CYS C  3  115 ? 85.256  320.808 168.741 1.00 33.96  ? 115  CYS C N   1 
ATOM   6810  C  CA  . CYS C  3  115 ? 86.554  320.917 169.390 1.00 29.18  ? 115  CYS C CA  1 
ATOM   6811  C  C   . CYS C  3  115 ? 86.421  321.705 170.691 1.00 33.88  ? 115  CYS C C   1 
ATOM   6812  O  O   . CYS C  3  115 ? 85.502  322.504 170.857 1.00 33.75  ? 115  CYS C O   1 
ATOM   6813  C  CB  . CYS C  3  115 ? 87.590  321.644 168.462 1.00 35.22  ? 115  CYS C CB  1 
ATOM   6814  S  SG  . CYS C  3  115 ? 87.063  323.343 167.962 1.00 43.52  ? 115  CYS C SG  1 
ATOM   6815  N  N   . TRP C  3  116 ? 87.388  321.512 171.593 1.00 35.07  ? 116  TRP C N   1 
ATOM   6816  C  CA  . TRP C  3  116 ? 87.474  322.295 172.820 1.00 34.29  ? 116  TRP C CA  1 
ATOM   6817  C  C   . TRP C  3  116 ? 88.875  322.868 172.958 1.00 38.56  ? 116  TRP C C   1 
ATOM   6818  O  O   . TRP C  3  116 ? 89.846  322.115 172.867 1.00 42.51  ? 116  TRP C O   1 
ATOM   6819  C  CB  . TRP C  3  116 ? 87.163  321.472 174.110 1.00 31.01  ? 116  TRP C CB  1 
ATOM   6820  C  CG  . TRP C  3  116 ? 86.932  322.363 175.308 1.00 30.14  ? 116  TRP C CG  1 
ATOM   6821  C  CD1 . TRP C  3  116 ? 87.850  322.848 176.211 1.00 28.34  ? 116  TRP C CD1 1 
ATOM   6822  C  CD2 . TRP C  3  116 ? 85.669  322.896 175.696 1.00 33.11  ? 116  TRP C CD2 1 
ATOM   6823  N  NE1 . TRP C  3  116 ? 87.231  323.678 177.111 1.00 31.97  ? 116  TRP C NE1 1 
ATOM   6824  C  CE2 . TRP C  3  116 ? 85.883  323.722 176.815 1.00 31.04  ? 116  TRP C CE2 1 
ATOM   6825  C  CE3 . TRP C  3  116 ? 84.358  322.759 175.183 1.00 36.63  ? 116  TRP C CE3 1 
ATOM   6826  C  CZ2 . TRP C  3  116 ? 84.820  324.350 177.511 1.00 33.83  ? 116  TRP C CZ2 1 
ATOM   6827  C  CZ3 . TRP C  3  116 ? 83.299  323.413 175.857 1.00 33.47  ? 116  TRP C CZ3 1 
ATOM   6828  C  CH2 . TRP C  3  116 ? 83.543  324.198 177.009 1.00 30.46  ? 116  TRP C CH2 1 
ATOM   6829  N  N   . PRO C  3  117 ? 89.031  324.164 173.265 1.00 32.96  ? 117  PRO C N   1 
ATOM   6830  C  CA  . PRO C  3  117 ? 88.019  325.219 173.356 1.00 35.27  ? 117  PRO C CA  1 
ATOM   6831  C  C   . PRO C  3  117 ? 87.261  325.402 172.036 1.00 41.11  ? 117  PRO C C   1 
ATOM   6832  O  O   . PRO C  3  117 ? 87.859  325.049 171.019 1.00 34.42  ? 117  PRO C O   1 
ATOM   6833  C  CB  . PRO C  3  117 ? 88.842  326.487 173.669 1.00 38.34  ? 117  PRO C CB  1 
ATOM   6834  C  CG  . PRO C  3  117 ? 90.173  325.994 174.119 1.00 38.87  ? 117  PRO C CG  1 
ATOM   6835  C  CD  . PRO C  3  117 ? 90.385  324.659 173.575 1.00 37.12  ? 117  PRO C CD  1 
ATOM   6836  N  N   . PRO C  3  118 ? 86.008  325.875 172.097 1.00 33.59  ? 118  PRO C N   1 
ATOM   6837  C  CA  . PRO C  3  118 ? 85.213  326.068 170.881 1.00 32.99  ? 118  PRO C CA  1 
ATOM   6838  C  C   . PRO C  3  118 ? 85.921  327.002 169.904 1.00 39.84  ? 118  PRO C C   1 
ATOM   6839  O  O   . PRO C  3  118 ? 86.714  327.873 170.278 1.00 31.40  ? 118  PRO C O   1 
ATOM   6840  C  CB  . PRO C  3  118 ? 83.919  326.700 171.383 1.00 29.56  ? 118  PRO C CB  1 
ATOM   6841  C  CG  . PRO C  3  118 ? 83.810  326.220 172.891 1.00 32.73  ? 118  PRO C CG  1 
ATOM   6842  C  CD  . PRO C  3  118 ? 85.248  326.153 173.358 1.00 30.68  ? 118  PRO C CD  1 
ATOM   6843  N  N   . THR C  3  119 ? 85.568  326.858 168.632 1.00 29.90  ? 119  THR C N   1 
ATOM   6844  C  CA  . THR C  3  119 ? 85.980  327.845 167.665 1.00 30.32  ? 119  THR C CA  1 
ATOM   6845  C  C   . THR C  3  119 ? 85.577  329.231 168.129 1.00 27.33  ? 119  THR C C   1 
ATOM   6846  O  O   . THR C  3  119 ? 84.464  329.442 168.635 1.00 34.39  ? 119  THR C O   1 
ATOM   6847  C  CB  . THR C  3  119 ? 85.374  327.520 166.288 1.00 29.67  ? 119  THR C CB  1 
ATOM   6848  O  OG1 . THR C  3  119 ? 85.880  326.250 165.865 1.00 31.24  ? 119  THR C OG1 1 
ATOM   6849  C  CG2 . THR C  3  119 ? 85.807  328.603 165.242 1.00 36.78  ? 119  THR C CG2 1 
ATOM   6850  N  N   . GLY C  3  120 ? 86.522  330.166 168.008 1.00 34.51  ? 120  GLY C N   1 
ATOM   6851  C  CA  . GLY C  3  120 ? 86.224  331.546 168.325 1.00 31.79  ? 120  GLY C CA  1 
ATOM   6852  C  C   . GLY C  3  120 ? 86.425  331.903 169.786 1.00 37.77  ? 120  GLY C C   1 
ATOM   6853  O  O   . GLY C  3  120 ? 86.170  333.054 170.177 1.00 35.21  ? 120  GLY C O   1 
ATOM   6854  N  N   . ILE C  3  121 ? 86.824  330.944 170.614 1.00 31.97  ? 121  ILE C N   1 
ATOM   6855  C  CA  . ILE C  3  121 ? 87.144  331.220 172.027 1.00 31.37  ? 121  ILE C CA  1 
ATOM   6856  C  C   . ILE C  3  121 ? 88.648  331.312 172.144 1.00 36.44  ? 121  ILE C C   1 
ATOM   6857  O  O   . ILE C  3  121 ? 89.362  330.390 171.734 1.00 33.69  ? 121  ILE C O   1 
ATOM   6858  C  CB  . ILE C  3  121 ? 86.570  330.122 172.950 1.00 31.43  ? 121  ILE C CB  1 
ATOM   6859  C  CG1 . ILE C  3  121 ? 85.017  330.172 172.957 1.00 35.47  ? 121  ILE C CG1 1 
ATOM   6860  C  CG2 . ILE C  3  121 ? 87.171  330.173 174.434 1.00 30.96  ? 121  ILE C CG2 1 
ATOM   6861  C  CD1 . ILE C  3  121 ? 84.321  331.237 173.873 1.00 31.51  ? 121  ILE C CD1 1 
ATOM   6862  N  N   . HIS C  3  122 ? 89.130  332.381 172.779 1.00 32.41  ? 122  HIS C N   1 
ATOM   6863  C  CA  . HIS C  3  122 ? 90.546  332.478 173.113 1.00 42.54  ? 122  HIS C CA  1 
ATOM   6864  C  C   . HIS C  3  122 ? 90.751  332.489 174.628 1.00 39.47  ? 122  HIS C C   1 
ATOM   6865  O  O   . HIS C  3  122 ? 90.518  333.514 175.285 1.00 39.54  ? 122  HIS C O   1 
ATOM   6866  C  CB  . HIS C  3  122 ? 91.135  333.727 172.457 1.00 50.20  ? 122  HIS C CB  1 
ATOM   6867  C  CG  . HIS C  3  122 ? 90.919  333.744 170.973 1.00 101.81 ? 122  HIS C CG  1 
ATOM   6868  N  ND1 . HIS C  3  122 ? 91.776  333.128 170.090 1.00 75.25  ? 122  HIS C ND1 1 
ATOM   6869  C  CD2 . HIS C  3  122 ? 89.893  334.217 170.227 1.00 56.63  ? 122  HIS C CD2 1 
ATOM   6870  C  CE1 . HIS C  3  122 ? 91.319  333.263 168.859 1.00 159.97 ? 122  HIS C CE1 1 
ATOM   6871  N  NE2 . HIS C  3  122 ? 90.172  333.914 168.914 1.00 59.48  ? 122  HIS C NE2 1 
ATOM   6872  N  N   . PRO C  3  123 ? 91.116  331.362 175.230 1.00 38.07  ? 123  PRO C N   1 
ATOM   6873  C  CA  . PRO C  3  123 ? 91.167  331.282 176.701 1.00 36.87  ? 123  PRO C CA  1 
ATOM   6874  C  C   . PRO C  3  123 ? 92.267  332.163 177.260 1.00 50.29  ? 123  PRO C C   1 
ATOM   6875  O  O   . PRO C  3  123 ? 93.216  332.541 176.563 1.00 36.95  ? 123  PRO C O   1 
ATOM   6876  C  CB  . PRO C  3  123 ? 91.478  329.809 176.977 1.00 39.04  ? 123  PRO C CB  1 
ATOM   6877  C  CG  . PRO C  3  123 ? 91.204  329.081 175.657 1.00 47.11  ? 123  PRO C CG  1 
ATOM   6878  C  CD  . PRO C  3  123 ? 91.506  330.098 174.583 1.00 36.30  ? 123  PRO C CD  1 
ATOM   6879  N  N   . LEU C  3  124 ? 92.122  332.484 178.540 1.00 42.47  ? 124  LEU C N   1 
ATOM   6880  C  CA  . LEU C  3  124 ? 93.190  333.170 179.264 1.00 43.74  ? 124  LEU C CA  1 
ATOM   6881  C  C   . LEU C  3  124 ? 94.406  332.262 179.308 1.00 35.72  ? 124  LEU C C   1 
ATOM   6882  O  O   . LEU C  3  124 ? 94.292  331.031 179.283 1.00 40.04  ? 124  LEU C O   1 
ATOM   6883  C  CB  . LEU C  3  124 ? 92.725  333.522 180.695 1.00 44.57  ? 124  LEU C CB  1 
ATOM   6884  C  CG  . LEU C  3  124 ? 91.377  334.259 180.789 1.00 41.35  ? 124  LEU C CG  1 
ATOM   6885  C  CD1 . LEU C  3  124 ? 90.929  334.449 182.273 1.00 42.51  ? 124  LEU C CD1 1 
ATOM   6886  C  CD2 . LEU C  3  124 ? 91.466  335.591 180.060 1.00 50.22  ? 124  LEU C CD2 1 
ATOM   6887  N  N   . ASN C  3  125 ? 95.573  332.864 179.379 1.00 39.10  ? 125  ASN C N   1 
ATOM   6888  C  CA  . ASN C  3  125 ? 96.789  332.097 179.615 1.00 41.67  ? 125  ASN C CA  1 
ATOM   6889  C  C   . ASN C  3  125 ? 96.837  331.636 181.067 1.00 38.22  ? 125  ASN C C   1 
ATOM   6890  O  O   . ASN C  3  125 ? 96.963  332.470 181.974 1.00 38.02  ? 125  ASN C O   1 
ATOM   6891  C  CB  . ASN C  3  125 ? 97.999  332.983 179.257 1.00 36.27  ? 125  ASN C CB  1 
ATOM   6892  C  CG  . ASN C  3  125 ? 99.350  332.216 179.295 1.00 47.70  ? 125  ASN C CG  1 
ATOM   6893  O  OD1 . ASN C  3  125 ? 99.470  331.154 179.923 1.00 36.89  ? 125  ASN C OD1 1 
ATOM   6894  N  ND2 . ASN C  3  125 ? 100.353 332.757 178.614 1.00 66.29  ? 125  ASN C ND2 1 
ATOM   6895  N  N   . PRO C  3  126 ? 96.800  330.332 181.338 1.00 34.22  ? 126  PRO C N   1 
ATOM   6896  C  CA  . PRO C  3  126 ? 96.817  329.864 182.734 1.00 36.79  ? 126  PRO C CA  1 
ATOM   6897  C  C   . PRO C  3  126 ? 98.122  330.155 183.451 1.00 50.82  ? 126  PRO C C   1 
ATOM   6898  O  O   . PRO C  3  126 ? 98.161  330.025 184.681 1.00 35.14  ? 126  PRO C O   1 
ATOM   6899  C  CB  . PRO C  3  126 ? 96.577  328.351 182.597 1.00 35.51  ? 126  PRO C CB  1 
ATOM   6900  C  CG  . PRO C  3  126 ? 97.123  328.016 181.211 1.00 39.04  ? 126  PRO C CG  1 
ATOM   6901  C  CD  . PRO C  3  126 ? 96.714  329.211 180.385 1.00 29.82  ? 126  PRO C CD  1 
ATOM   6902  N  N   . LEU C  3  127 ? 99.176  330.577 182.738 1.00 33.09  ? 127  LEU C N   1 
ATOM   6903  C  CA  . LEU C  3  127 ? 100.435 330.903 183.405 1.00 34.97  ? 127  LEU C CA  1 
ATOM   6904  C  C   . LEU C  3  127 ? 100.513 332.353 183.824 1.00 47.43  ? 127  LEU C C   1 
ATOM   6905  O  O   . LEU C  3  127 ? 101.498 332.761 184.444 1.00 39.76  ? 127  LEU C O   1 
ATOM   6906  C  CB  . LEU C  3  127 ? 101.626 330.592 182.505 1.00 36.92  ? 127  LEU C CB  1 
ATOM   6907  C  CG  . LEU C  3  127 ? 102.001 329.175 182.080 1.00 45.16  ? 127  LEU C CG  1 
ATOM   6908  C  CD1 . LEU C  3  127 ? 102.028 328.296 183.253 1.00 47.76  ? 127  LEU C CD1 1 
ATOM   6909  C  CD2 . LEU C  3  127 ? 101.095 328.611 180.993 1.00 111.12 ? 127  LEU C CD2 1 
ATOM   6910  N  N   . GLU C  3  128 ? 99.526  333.153 183.491 1.00 32.65  ? 128  GLU C N   1 
ATOM   6911  C  CA  . GLU C  3  128 ? 99.590  334.554 183.886 1.00 37.97  ? 128  GLU C CA  1 
ATOM   6912  C  C   . GLU C  3  128 ? 98.763  334.750 185.143 1.00 37.71  ? 128  GLU C C   1 
ATOM   6913  O  O   . GLU C  3  128 ? 99.113  334.172 186.187 1.00 38.01  ? 128  GLU C O   1 
ATOM   6914  C  CB  . GLU C  3  128 ? 99.152  335.440 182.706 1.00 39.86  ? 128  GLU C CB  1 
ATOM   6915  C  CG  . GLU C  3  128 ? 100.093 335.152 181.557 1.00 56.14  ? 128  GLU C CG  1 
ATOM   6916  C  CD  . GLU C  3  128 ? 99.803  335.926 180.292 1.00 112.39 ? 128  GLU C CD  1 
ATOM   6917  O  OE1 . GLU C  3  128 ? 100.593 335.797 179.348 1.00 76.01  ? 128  GLU C OE1 1 
ATOM   6918  O  OE2 . GLU C  3  128 ? 98.802  336.651 180.209 1.00 53.80  ? 128  GLU C OE2 1 
ATOM   6919  N  N   . VAL C  3  129 ? 97.683  335.550 185.094 1.00 37.70  ? 129  VAL C N   1 
ATOM   6920  C  CA  . VAL C  3  129 ? 96.908  335.826 186.315 1.00 35.53  ? 129  VAL C CA  1 
ATOM   6921  C  C   . VAL C  3  129 ? 96.343  334.558 186.958 1.00 35.43  ? 129  VAL C C   1 
ATOM   6922  O  O   . VAL C  3  129 ? 96.309  334.488 188.198 1.00 38.13  ? 129  VAL C O   1 
ATOM   6923  C  CB  . VAL C  3  129 ? 95.851  336.896 186.070 1.00 43.86  ? 129  VAL C CB  1 
ATOM   6924  C  CG1 . VAL C  3  129 ? 95.060  337.106 187.372 1.00 36.34  ? 129  VAL C CG1 1 
ATOM   6925  C  CG2 . VAL C  3  129 ? 96.472  338.222 185.677 1.00 40.80  ? 129  VAL C CG2 1 
ATOM   6926  N  N   . PRO C  3  130 ? 95.918  333.534 186.218 1.00 31.40  ? 130  PRO C N   1 
ATOM   6927  C  CA  . PRO C  3  130 ? 95.395  332.356 186.945 1.00 29.16  ? 130  PRO C CA  1 
ATOM   6928  C  C   . PRO C  3  130 ? 96.453  331.713 187.812 1.00 33.56  ? 130  PRO C C   1 
ATOM   6929  O  O   . PRO C  3  130 ? 96.156  331.204 188.899 1.00 32.28  ? 130  PRO C O   1 
ATOM   6930  C  CB  . PRO C  3  130 ? 94.918  331.411 185.809 1.00 30.84  ? 130  PRO C CB  1 
ATOM   6931  C  CG  . PRO C  3  130 ? 94.321  332.479 184.796 1.00 31.55  ? 130  PRO C CG  1 
ATOM   6932  C  CD  . PRO C  3  130 ? 95.434  333.559 184.809 1.00 35.46  ? 130  PRO C CD  1 
ATOM   6933  N  N   . LEU C  3  131 ? 97.696  331.680 187.335 1.00 29.50  ? 131  LEU C N   1 
ATOM   6934  C  CA  . LEU C  3  131 ? 98.764  331.104 188.158 1.00 31.86  ? 131  LEU C CA  1 
ATOM   6935  C  C   . LEU C  3  131 ? 99.028  331.984 189.377 1.00 35.54  ? 131  LEU C C   1 
ATOM   6936  O  O   . LEU C  3  131 ? 99.280  331.477 190.461 1.00 32.44  ? 131  LEU C O   1 
ATOM   6937  C  CB  . LEU C  3  131 ? 100.060 330.953 187.338 1.00 31.51  ? 131  LEU C CB  1 
ATOM   6938  C  CG  . LEU C  3  131 ? 101.260 330.405 188.133 1.00 34.62  ? 131  LEU C CG  1 
ATOM   6939  C  CD1 . LEU C  3  131 ? 101.036 328.964 188.640 1.00 30.86  ? 131  LEU C CD1 1 
ATOM   6940  C  CD2 . LEU C  3  131 ? 102.493 330.412 187.264 1.00 36.14  ? 131  LEU C CD2 1 
ATOM   6941  N  N   . LEU C  3  132 ? 98.957  333.301 189.215 1.00 32.78  ? 132  LEU C N   1 
ATOM   6942  C  CA  . LEU C  3  132 ? 99.174  334.183 190.349 1.00 33.42  ? 132  LEU C CA  1 
ATOM   6943  C  C   . LEU C  3  132 ? 98.091  333.965 191.397 1.00 41.32  ? 132  LEU C C   1 
ATOM   6944  O  O   . LEU C  3  132 ? 98.386  333.802 192.594 1.00 36.80  ? 132  LEU C O   1 
ATOM   6945  C  CB  . LEU C  3  132 ? 99.191  335.654 189.872 1.00 32.31  ? 132  LEU C CB  1 
ATOM   6946  C  CG  . LEU C  3  132 ? 99.158  336.767 190.941 1.00 38.30  ? 132  LEU C CG  1 
ATOM   6947  C  CD1 . LEU C  3  132 ? 100.318 336.674 191.927 1.00 37.93  ? 132  LEU C CD1 1 
ATOM   6948  C  CD2 . LEU C  3  132 ? 99.125  338.180 190.285 1.00 35.13  ? 132  LEU C CD2 1 
ATOM   6949  N  N   . ASN C  3  133 ? 96.836  333.896 190.942 1.00 30.03  ? 133  ASN C N   1 
ATOM   6950  C  CA  . ASN C  3  133 ? 95.696  333.587 191.796 1.00 37.37  ? 133  ASN C CA  1 
ATOM   6951  C  C   . ASN C  3  133 ? 95.941  332.315 192.581 1.00 38.41  ? 133  ASN C C   1 
ATOM   6952  O  O   . ASN C  3  133 ? 95.579  332.222 193.746 1.00 32.46  ? 133  ASN C O   1 
ATOM   6953  C  CB  . ASN C  3  133 ? 94.420  333.417 190.967 1.00 34.79  ? 133  ASN C CB  1 
ATOM   6954  C  CG  . ASN C  3  133 ? 93.761  334.751 190.630 1.00 34.91  ? 133  ASN C CG  1 
ATOM   6955  O  OD1 . ASN C  3  133 ? 93.821  335.682 191.443 1.00 65.08  ? 133  ASN C OD1 1 
ATOM   6956  N  ND2 . ASN C  3  133 ? 93.079  334.823 189.491 1.00 94.65  ? 133  ASN C ND2 1 
ATOM   6957  N  N   . THR C  3  134 ? 96.473  331.297 191.917 1.00 29.79  ? 134  THR C N   1 
ATOM   6958  C  CA  . THR C  3  134 ? 96.785  330.032 192.582 1.00 27.54  ? 134  THR C CA  1 
ATOM   6959  C  C   . THR C  3  134 ? 97.824  330.240 193.685 1.00 34.79  ? 134  THR C C   1 
ATOM   6960  O  O   . THR C  3  134 ? 97.686  329.716 194.782 1.00 29.78  ? 134  THR C O   1 
ATOM   6961  C  CB  . THR C  3  134 ? 97.300  329.050 191.503 1.00 30.14  ? 134  THR C CB  1 
ATOM   6962  O  OG1 . THR C  3  134 ? 96.274  328.922 190.480 1.00 30.44  ? 134  THR C OG1 1 
ATOM   6963  C  CG2 . THR C  3  134 ? 97.637  327.644 192.124 1.00 29.61  ? 134  THR C CG2 1 
ATOM   6964  N  N   . SER C  3  135 ? 98.887  330.992 193.400 1.00 32.93  ? 135  SER C N   1 
ATOM   6965  C  CA  . SER C  3  135 ? 99.888  331.187 194.447 1.00 30.46  ? 135  SER C CA  1 
ATOM   6966  C  C   . SER C  3  135 ? 99.349  332.031 195.598 1.00 29.33  ? 135  SER C C   1 
ATOM   6967  O  O   . SER C  3  135 ? 99.722  331.811 196.768 1.00 32.02  ? 135  SER C O   1 
ATOM   6968  C  CB  . SER C  3  135 ? 101.149 331.816 193.869 1.00 31.70  ? 135  SER C CB  1 
ATOM   6969  O  OG  . SER C  3  135 ? 100.958 333.189 193.623 1.00 37.89  ? 135  SER C OG  1 
ATOM   6970  N  N   . VAL C  3  136 ? 98.442  332.952 195.309 1.00 32.34  ? 136  VAL C N   1 
ATOM   6971  C  CA  . VAL C  3  136 ? 97.831  333.773 196.342 1.00 31.03  ? 136  VAL C CA  1 
ATOM   6972  C  C   . VAL C  3  136 ? 96.998  332.926 197.308 1.00 37.74  ? 136  VAL C C   1 
ATOM   6973  O  O   . VAL C  3  136 ? 97.168  333.026 198.536 1.00 32.81  ? 136  VAL C O   1 
ATOM   6974  C  CB  . VAL C  3  136 ? 97.013  334.903 195.693 1.00 33.47  ? 136  VAL C CB  1 
ATOM   6975  C  CG1 . VAL C  3  136 ? 96.042  335.598 196.697 1.00 30.15  ? 136  VAL C CG1 1 
ATOM   6976  C  CG2 . VAL C  3  136 ? 98.018  335.931 195.188 1.00 34.98  ? 136  VAL C CG2 1 
ATOM   6977  N  N   . LEU C  3  137 ? 96.127  332.055 196.780 1.00 36.06  ? 137  LEU C N   1 
ATOM   6978  C  CA  . LEU C  3  137 ? 95.301  331.238 197.694 1.00 33.35  ? 137  LEU C CA  1 
ATOM   6979  C  C   . LEU C  3  137 ? 96.141  330.188 198.430 1.00 33.90  ? 137  LEU C C   1 
ATOM   6980  O  O   . LEU C  3  137 ? 95.881  329.906 199.610 1.00 32.45  ? 137  LEU C O   1 
ATOM   6981  C  CB  . LEU C  3  137 ? 94.126  330.543 196.955 1.00 30.56  ? 137  LEU C CB  1 
ATOM   6982  C  CG  . LEU C  3  137 ? 92.962  331.460 196.514 1.00 31.22  ? 137  LEU C CG  1 
ATOM   6983  C  CD1 . LEU C  3  137 ? 91.727  330.588 196.123 1.00 32.78  ? 137  LEU C CD1 1 
ATOM   6984  C  CD2 . LEU C  3  137 ? 92.561  332.375 197.665 1.00 31.71  ? 137  LEU C CD2 1 
ATOM   6985  N  N   . LEU C  3  138 ? 97.080  329.533 197.729 1.00 28.36  ? 138  LEU C N   1 
ATOM   6986  C  CA  . LEU C  3  138 ? 98.010  328.625 198.399 1.00 30.28  ? 138  LEU C CA  1 
ATOM   6987  C  C   . LEU C  3  138 ? 98.766  329.323 199.533 1.00 35.71  ? 138  LEU C C   1 
ATOM   6988  O  O   . LEU C  3  138 ? 98.877  328.780 200.633 1.00 30.56  ? 138  LEU C O   1 
ATOM   6989  C  CB  . LEU C  3  138 ? 99.025  328.015 197.408 1.00 29.61  ? 138  LEU C CB  1 
ATOM   6990  C  CG  . LEU C  3  138 ? 98.378  326.950 196.519 1.00 37.37  ? 138  LEU C CG  1 
ATOM   6991  C  CD1 . LEU C  3  138 ? 99.353  326.578 195.432 1.00 36.12  ? 138  LEU C CD1 1 
ATOM   6992  C  CD2 . LEU C  3  138 ? 97.978  325.702 197.391 1.00 33.86  ? 138  LEU C CD2 1 
ATOM   6993  N  N   . ALA C  3  139 ? 99.303  330.523 199.281 1.00 31.74  ? 139  ALA C N   1 
ATOM   6994  C  CA  . ALA C  3  139 ? 99.979  331.247 200.344 1.00 35.33  ? 139  ALA C CA  1 
ATOM   6995  C  C   . ALA C  3  139 ? 99.032  331.537 201.515 1.00 31.51  ? 139  ALA C C   1 
ATOM   6996  O  O   . ALA C  3  139 ? 99.443  331.489 202.674 1.00 30.17  ? 139  ALA C O   1 
ATOM   6997  C  CB  . ALA C  3  139 ? 100.561 332.549 199.798 1.00 28.49  ? 139  ALA C CB  1 
ATOM   6998  N  N   . SER C  3  140 ? 97.801  331.947 201.209 1.00 28.68  ? 140  SER C N   1 
ATOM   6999  C  CA  . SER C  3  140 ? 96.842  332.266 202.269 1.00 26.58  ? 140  SER C CA  1 
ATOM   7000  C  C   . SER C  3  140 ? 96.542  331.021 203.086 1.00 42.41  ? 140  SER C C   1 
ATOM   7001  O  O   . SER C  3  140 ? 96.210  331.118 204.254 1.00 30.87  ? 140  SER C O   1 
ATOM   7002  C  CB  . SER C  3  140 ? 95.541  332.862 201.674 1.00 27.67  ? 140  SER C CB  1 
ATOM   7003  O  OG  . SER C  3  140 ? 94.744  331.809 201.068 1.00 28.22  ? 140  SER C OG  1 
ATOM   7004  N  N   . GLY C  3  141 ? 96.689  329.843 202.500 1.00 31.49  ? 141  GLY C N   1 
ATOM   7005  C  CA  . GLY C  3  141 ? 96.538  328.606 203.270 1.00 26.18  ? 141  GLY C CA  1 
ATOM   7006  C  C   . GLY C  3  141 ? 97.703  328.383 204.203 1.00 35.11  ? 141  GLY C C   1 
ATOM   7007  O  O   . GLY C  3  141 ? 97.531  327.833 205.303 1.00 31.12  ? 141  GLY C O   1 
ATOM   7008  N  N   . VAL C  3  142 ? 98.895  328.852 203.806 1.00 27.51  ? 142  VAL C N   1 
ATOM   7009  C  CA  . VAL C  3  142 ? 100.038 328.804 204.728 1.00 29.06  ? 142  VAL C CA  1 
ATOM   7010  C  C   . VAL C  3  142 ? 99.843  329.814 205.841 1.00 34.87  ? 142  VAL C C   1 
ATOM   7011  O  O   . VAL C  3  142 ? 100.044 329.512 207.019 1.00 28.73  ? 142  VAL C O   1 
ATOM   7012  C  CB  . VAL C  3  142 ? 101.366 329.062 203.988 1.00 25.88  ? 142  VAL C CB  1 
ATOM   7013  C  CG1 . VAL C  3  142 ? 102.614 329.123 204.983 1.00 28.61  ? 142  VAL C CG1 1 
ATOM   7014  C  CG2 . VAL C  3  142 ? 101.552 327.987 202.873 1.00 25.76  ? 142  VAL C CG2 1 
ATOM   7015  N  N   . SER C  3  143 ? 99.480  331.052 205.485 1.00 28.55  ? 143  SER C N   1 
ATOM   7016  C  CA  . SER C  3  143 ? 99.457  332.059 206.544 1.00 25.72  ? 143  SER C CA  1 
ATOM   7017  C  C   . SER C  3  143 ? 98.298  331.798 207.531 1.00 35.43  ? 143  SER C C   1 
ATOM   7018  O  O   . SER C  3  143 ? 98.412  332.140 208.703 1.00 29.15  ? 143  SER C O   1 
ATOM   7019  C  CB  . SER C  3  143 ? 99.346  333.464 205.964 1.00 32.78  ? 143  SER C CB  1 
ATOM   7020  O  OG  . SER C  3  143 ? 98.172  333.556 205.132 1.00 32.01  ? 143  SER C OG  1 
ATOM   7021  N  N   . ILE C  3  144 ? 97.191  331.194 207.105 1.00 33.21  ? 144  ILE C N   1 
ATOM   7022  C  CA  . ILE C  3  144 ? 96.139  330.964 208.107 1.00 32.66  ? 144  ILE C CA  1 
ATOM   7023  C  C   . ILE C  3  144 ? 96.513  329.820 209.054 1.00 30.12  ? 144  ILE C C   1 
ATOM   7024  O  O   . ILE C  3  144 ? 96.066  329.787 210.205 1.00 31.06  ? 144  ILE C O   1 
ATOM   7025  C  CB  . ILE C  3  144 ? 94.768  330.710 207.447 1.00 29.80  ? 144  ILE C CB  1 
ATOM   7026  C  CG1 . ILE C  3  144 ? 93.642  330.992 208.481 1.00 31.21  ? 144  ILE C CG1 1 
ATOM   7027  C  CG2 . ILE C  3  144 ? 94.710  329.271 206.849 1.00 30.50  ? 144  ILE C CG2 1 
ATOM   7028  C  CD1 . ILE C  3  144 ? 92.349  330.602 207.879 1.00 50.41  ? 144  ILE C CD1 1 
ATOM   7029  N  N   . THR C  3  145 ? 97.308  328.853 208.599 1.00 28.28  ? 145  THR C N   1 
ATOM   7030  C  CA  . THR C  3  145 ? 97.879  327.849 209.500 1.00 38.97  ? 145  THR C CA  1 
ATOM   7031  C  C   . THR C  3  145 ? 98.857  328.479 210.496 1.00 33.15  ? 145  THR C C   1 
ATOM   7032  O  O   . THR C  3  145 ? 98.902  328.111 211.684 1.00 32.44  ? 145  THR C O   1 
ATOM   7033  C  CB  . THR C  3  145 ? 98.571  326.767 208.656 1.00 37.16  ? 145  THR C CB  1 
ATOM   7034  O  OG1 . THR C  3  145 ? 97.646  326.303 207.660 1.00 35.54  ? 145  THR C OG1 1 
ATOM   7035  C  CG2 . THR C  3  145 ? 99.063  325.598 209.534 1.00 31.93  ? 145  THR C CG2 1 
ATOM   7036  N  N   . TRP C  3  146 ? 99.659  329.439 210.038 1.00 30.17  ? 146  TRP C N   1 
ATOM   7037  C  CA  . TRP C  3  146 ? 100.453 330.198 210.994 1.00 30.81  ? 146  TRP C CA  1 
ATOM   7038  C  C   . TRP C  3  146 ? 99.543  330.891 212.016 1.00 30.88  ? 146  TRP C C   1 
ATOM   7039  O  O   . TRP C  3  146 ? 99.818  330.859 213.240 1.00 29.56  ? 146  TRP C O   1 
ATOM   7040  C  CB  . TRP C  3  146 ? 101.346 331.198 210.237 1.00 29.27  ? 146  TRP C CB  1 
ATOM   7041  C  CG  . TRP C  3  146 ? 102.028 332.254 211.131 1.00 28.97  ? 146  TRP C CG  1 
ATOM   7042  C  CD1 . TRP C  3  146 ? 102.381 332.153 212.447 1.00 31.74  ? 146  TRP C CD1 1 
ATOM   7043  C  CD2 . TRP C  3  146 ? 102.348 333.571 210.712 1.00 36.46  ? 146  TRP C CD2 1 
ATOM   7044  N  NE1 . TRP C  3  146 ? 102.924 333.375 212.889 1.00 31.92  ? 146  TRP C NE1 1 
ATOM   7045  C  CE2 . TRP C  3  146 ? 102.917 334.243 211.822 1.00 32.46  ? 146  TRP C CE2 1 
ATOM   7046  C  CE3 . TRP C  3  146 ? 102.222 334.247 209.473 1.00 32.42  ? 146  TRP C CE3 1 
ATOM   7047  C  CZ2 . TRP C  3  146 ? 103.333 335.580 211.762 1.00 33.72  ? 146  TRP C CZ2 1 
ATOM   7048  C  CZ3 . TRP C  3  146 ? 102.640 335.564 209.390 1.00 32.54  ? 146  TRP C CZ3 1 
ATOM   7049  C  CH2 . TRP C  3  146 ? 103.170 336.234 210.556 1.00 35.94  ? 146  TRP C CH2 1 
ATOM   7050  N  N   . ALA C  3  147 ? 98.455  331.499 211.557 1.00 30.90  ? 147  ALA C N   1 
ATOM   7051  C  CA  . ALA C  3  147 ? 97.523  332.169 212.486 1.00 30.13  ? 147  ALA C CA  1 
ATOM   7052  C  C   . ALA C  3  147 ? 96.991  331.195 213.518 1.00 30.74  ? 147  ALA C C   1 
ATOM   7053  O  O   . ALA C  3  147 ? 96.882  331.516 214.712 1.00 30.78  ? 147  ALA C O   1 
ATOM   7054  C  CB  . ALA C  3  147 ? 96.352  332.771 211.689 1.00 28.25  ? 147  ALA C CB  1 
ATOM   7055  N  N   . HIS C  3  148 ? 96.625  329.999 213.066 1.00 29.94  ? 148  HIS C N   1 
ATOM   7056  C  CA  . HIS C  3  148 ? 96.065  329.021 213.986 1.00 28.30  ? 148  HIS C CA  1 
ATOM   7057  C  C   . HIS C  3  148 ? 97.102  328.615 215.050 1.00 37.68  ? 148  HIS C C   1 
ATOM   7058  O  O   . HIS C  3  148 ? 96.803  328.545 216.240 1.00 31.23  ? 148  HIS C O   1 
ATOM   7059  C  CB  . HIS C  3  148 ? 95.610  327.798 213.207 1.00 32.01  ? 148  HIS C CB  1 
ATOM   7060  C  CG  . HIS C  3  148 ? 94.860  326.819 214.043 1.00 41.63  ? 148  HIS C CG  1 
ATOM   7061  N  ND1 . HIS C  3  148 ? 94.859  325.468 213.801 1.00 47.35  ? 148  HIS C ND1 1 
ATOM   7062  C  CD2 . HIS C  3  148 ? 94.073  327.012 215.131 1.00 43.45  ? 148  HIS C CD2 1 
ATOM   7063  C  CE1 . HIS C  3  148 ? 94.108  324.865 214.707 1.00 49.03  ? 148  HIS C CE1 1 
ATOM   7064  N  NE2 . HIS C  3  148 ? 93.608  325.781 215.507 1.00 43.13  ? 148  HIS C NE2 1 
ATOM   7065  N  N   . HIS C  3  149 ? 98.325  328.312 214.630 1.00 34.91  ? 149  HIS C N   1 
ATOM   7066  C  CA  . HIS C  3  149 ? 99.344  327.934 215.623 1.00 25.89  ? 149  HIS C CA  1 
ATOM   7067  C  C   . HIS C  3  149 ? 99.685  329.074 216.564 1.00 29.00  ? 149  HIS C C   1 
ATOM   7068  O  O   . HIS C  3  149 ? 99.908  328.848 217.773 1.00 32.91  ? 149  HIS C O   1 
ATOM   7069  C  CB  . HIS C  3  149 ? 100.587 327.424 214.925 1.00 30.84  ? 149  HIS C CB  1 
ATOM   7070  C  CG  . HIS C  3  149 ? 100.397 326.063 214.381 1.00 37.73  ? 149  HIS C CG  1 
ATOM   7071  N  ND1 . HIS C  3  149 ? 100.562 324.931 215.144 1.00 38.89  ? 149  HIS C ND1 1 
ATOM   7072  C  CD2 . HIS C  3  149 ? 99.959  325.646 213.172 1.00 36.28  ? 149  HIS C CD2 1 
ATOM   7073  C  CE1 . HIS C  3  149 ? 100.299 323.866 214.408 1.00 39.00  ? 149  HIS C CE1 1 
ATOM   7074  N  NE2 . HIS C  3  149 ? 99.897  324.277 213.222 1.00 36.26  ? 149  HIS C NE2 1 
ATOM   7075  N  N   . SER C  3  150 ? 99.709  330.301 216.065 1.00 30.16  ? 150  SER C N   1 
ATOM   7076  C  CA  . SER C  3  150 ? 99.932  331.417 216.967 1.00 28.20  ? 150  SER C CA  1 
ATOM   7077  C  C   . SER C  3  150 ? 98.850  331.493 218.022 1.00 41.31  ? 150  SER C C   1 
ATOM   7078  O  O   . SER C  3  150 ? 99.158  331.709 219.196 1.00 34.60  ? 150  SER C O   1 
ATOM   7079  C  CB  . SER C  3  150 ? 100.042 332.753 216.227 1.00 42.52  ? 150  SER C CB  1 
ATOM   7080  O  OG  . SER C  3  150 ? 101.221 332.725 215.432 1.00 42.48  ? 150  SER C OG  1 
ATOM   7081  N  N   . LEU C  3  151 ? 97.586  331.351 217.623 1.00 36.13  ? 151  LEU C N   1 
ATOM   7082  C  CA  . LEU C  3  151 ? 96.493  331.412 218.599 1.00 29.79  ? 151  LEU C CA  1 
ATOM   7083  C  C   . LEU C  3  151 ? 96.604  330.299 219.648 1.00 32.46  ? 151  LEU C C   1 
ATOM   7084  O  O   . LEU C  3  151 ? 96.429  330.534 220.856 1.00 30.48  ? 151  LEU C O   1 
ATOM   7085  C  CB  . LEU C  3  151 ? 95.133  331.309 217.844 1.00 32.38  ? 151  LEU C CB  1 
ATOM   7086  C  CG  . LEU C  3  151 ? 93.864  331.322 218.740 1.00 32.77  ? 151  LEU C CG  1 
ATOM   7087  C  CD1 . LEU C  3  151 ? 93.871  332.554 219.626 1.00 30.76  ? 151  LEU C CD1 1 
ATOM   7088  C  CD2 . LEU C  3  151 ? 92.573  331.265 217.838 1.00 33.31  ? 151  LEU C CD2 1 
ATOM   7089  N  N   . MET C  3  152 ? 96.901  329.080 219.204 1.00 31.42  ? 152  MET C N   1 
ATOM   7090  C  CA  . MET C  3  152 ? 97.028  327.976 220.154 1.00 37.36  ? 152  MET C CA  1 
ATOM   7091  C  C   . MET C  3  152 ? 98.224  328.173 221.075 1.00 50.50  ? 152  MET C C   1 
ATOM   7092  O  O   . MET C  3  152 ? 98.204  327.718 222.217 1.00 37.33  ? 152  MET C O   1 
ATOM   7093  C  CB  . MET C  3  152 ? 97.154  326.657 219.391 1.00 28.88  ? 152  MET C CB  1 
ATOM   7094  C  CG  . MET C  3  152 ? 95.793  326.282 218.640 1.00 33.70  ? 152  MET C CG  1 
ATOM   7095  S  SD  . MET C  3  152 ? 96.075  324.645 217.978 1.00 50.85  ? 152  MET C SD  1 
ATOM   7096  C  CE  . MET C  3  152 ? 97.366  324.937 216.753 1.00 38.89  ? 152  MET C CE  1 
ATOM   7097  N  N   . GLU C  3  153 ? 99.265  328.853 220.605 1.00 35.91  ? 153  GLU C N   1 
ATOM   7098  C  CA  . GLU C  3  153 ? 100.425 329.150 221.424 1.00 41.07  ? 153  GLU C CA  1 
ATOM   7099  C  C   . GLU C  3  153 ? 100.246 330.429 222.239 1.00 38.35  ? 153  GLU C C   1 
ATOM   7100  O  O   . GLU C  3  153 ? 101.181 330.850 222.900 1.00 44.07  ? 153  GLU C O   1 
ATOM   7101  C  CB  . GLU C  3  153 ? 101.705 329.211 220.555 1.00 38.20  ? 153  GLU C CB  1 
ATOM   7102  C  CG  . GLU C  3  153 ? 101.939 327.856 219.889 1.00 39.21  ? 153  GLU C CG  1 
ATOM   7103  C  CD  . GLU C  3  153 ? 103.139 327.819 218.927 1.00 45.62  ? 153  GLU C CD  1 
ATOM   7104  O  OE1 . GLU C  3  153 ? 103.189 326.919 218.062 1.00 43.34  ? 153  GLU C OE1 1 
ATOM   7105  O  OE2 . GLU C  3  153 ? 104.033 328.665 219.044 1.00 38.72  ? 153  GLU C OE2 1 
ATOM   7106  N  N   . GLY C  3  154 ? 99.078  331.058 222.182 1.00 34.01  ? 154  GLY C N   1 
ATOM   7107  C  CA  . GLY C  3  154 ? 98.795  332.178 223.050 1.00 32.61  ? 154  GLY C CA  1 
ATOM   7108  C  C   . GLY C  3  154 ? 99.356  333.492 222.564 1.00 37.06  ? 154  GLY C C   1 
ATOM   7109  O  O   . GLY C  3  154 ? 99.437  334.433 223.351 1.00 41.30  ? 154  GLY C O   1 
ATOM   7110  N  N   . ASP C  3  155 ? 99.675  333.619 221.268 1.00 34.89  ? 155  ASP C N   1 
ATOM   7111  C  CA  . ASP C  3  155 ? 100.430 334.779 220.770 1.00 33.41  ? 155  ASP C CA  1 
ATOM   7112  C  C   . ASP C  3  155 ? 99.443  335.677 220.003 1.00 36.74  ? 155  ASP C C   1 
ATOM   7113  O  O   . ASP C  3  155 ? 99.115  335.433 218.832 1.00 35.24  ? 155  ASP C O   1 
ATOM   7114  C  CB  . ASP C  3  155 ? 101.630 334.288 219.940 1.00 33.08  ? 155  ASP C CB  1 
ATOM   7115  C  CG  . ASP C  3  155 ? 102.470 335.408 219.353 1.00 40.13  ? 155  ASP C CG  1 
ATOM   7116  O  OD1 . ASP C  3  155 ? 102.043 336.581 219.316 1.00 39.56  ? 155  ASP C OD1 1 
ATOM   7117  O  OD2 . ASP C  3  155 ? 103.581 335.107 218.857 1.00 39.93  ? 155  ASP C OD2 1 
ATOM   7118  N  N   . ARG C  3  156 ? 98.962  336.713 220.687 1.00 35.07  ? 156  ARG C N   1 
ATOM   7119  C  CA  . ARG C  3  156 ? 97.916  337.563 220.130 1.00 35.57  ? 156  ARG C CA  1 
ATOM   7120  C  C   . ARG C  3  156 ? 98.415  338.340 218.917 1.00 43.64  ? 156  ARG C C   1 
ATOM   7121  O  O   . ARG C  3  156 ? 97.746  338.417 217.870 1.00 38.44  ? 156  ARG C O   1 
ATOM   7122  C  CB  . ARG C  3  156 ? 97.439  338.510 221.243 1.00 37.64  ? 156  ARG C CB  1 
ATOM   7123  C  CG  . ARG C  3  156 ? 96.650  339.740 220.771 1.00 34.86  ? 156  ARG C CG  1 
ATOM   7124  C  CD  . ARG C  3  156 ? 96.242  340.620 221.991 1.00 34.19  ? 156  ARG C CD  1 
ATOM   7125  N  NE  . ARG C  3  156 ? 95.481  341.771 221.535 1.00 36.31  ? 156  ARG C NE  1 
ATOM   7126  C  CZ  . ARG C  3  156 ? 94.207  341.704 221.173 1.00 34.81  ? 156  ARG C CZ  1 
ATOM   7127  N  NH1 . ARG C  3  156 ? 93.564  340.532 221.199 1.00 33.97  ? 156  ARG C NH1 1 
ATOM   7128  N  NH2 . ARG C  3  156 ? 93.570  342.804 220.783 1.00 36.58  ? 156  ARG C NH2 1 
ATOM   7129  N  N   . LYS C  3  157 ? 99.609  338.904 219.026 1.00 40.25  ? 157  LYS C N   1 
ATOM   7130  C  CA  . LYS C  3  157 ? 100.090 339.787 217.981 1.00 36.28  ? 157  LYS C CA  1 
ATOM   7131  C  C   . LYS C  3  157 ? 100.339 339.028 216.681 1.00 44.10  ? 157  LYS C C   1 
ATOM   7132  O  O   . LYS C  3  157 ? 99.998  339.504 215.602 1.00 33.01  ? 157  LYS C O   1 
ATOM   7133  C  CB  . LYS C  3  157 ? 101.370 340.474 218.473 1.00 46.67  ? 157  LYS C CB  1 
ATOM   7134  C  CG  . LYS C  3  157 ? 102.058 341.256 217.381 1.00 40.94  ? 157  LYS C CG  1 
ATOM   7135  C  CD  . LYS C  3  157 ? 103.276 342.031 217.896 1.00 71.08  ? 157  LYS C CD  1 
ATOM   7136  C  CE  . LYS C  3  157 ? 104.446 341.106 218.164 1.00 61.66  ? 157  LYS C CE  1 
ATOM   7137  N  NZ  . LYS C  3  157 ? 105.752 341.830 218.022 1.00 102.49 ? 157  LYS C NZ  1 
ATOM   7138  N  N   . HIS C  3  158 ? 100.951 337.855 216.752 1.00 31.25  ? 158  HIS C N   1 
ATOM   7139  C  CA  . HIS C  3  158 ? 101.244 337.122 215.535 1.00 36.78  ? 158  HIS C CA  1 
ATOM   7140  C  C   . HIS C  3  158 ? 100.003 336.469 214.968 1.00 36.02  ? 158  HIS C C   1 
ATOM   7141  O  O   . HIS C  3  158 ? 99.913  336.325 213.750 1.00 33.70  ? 158  HIS C O   1 
ATOM   7142  C  CB  . HIS C  3  158 ? 102.357 336.108 215.775 1.00 32.11  ? 158  HIS C CB  1 
ATOM   7143  C  CG  . HIS C  3  158 ? 103.682 336.769 215.952 1.00 34.86  ? 158  HIS C CG  1 
ATOM   7144  N  ND1 . HIS C  3  158 ? 104.437 336.595 217.094 1.00 42.45  ? 158  HIS C ND1 1 
ATOM   7145  C  CD2 . HIS C  3  158 ? 104.322 337.712 215.220 1.00 38.93  ? 158  HIS C CD2 1 
ATOM   7146  C  CE1 . HIS C  3  158 ? 105.539 337.318 217.003 1.00 42.38  ? 158  HIS C CE1 1 
ATOM   7147  N  NE2 . HIS C  3  158 ? 105.490 338.024 215.889 1.00 38.75  ? 158  HIS C NE2 1 
ATOM   7148  N  N   . MET C  3  159 ? 99.041  336.103 215.829 1.00 35.38  ? 159  MET C N   1 
ATOM   7149  C  CA  . MET C  3  159 ? 97.738  335.646 215.334 1.00 35.75  ? 159  MET C CA  1 
ATOM   7150  C  C   . MET C  3  159 ? 97.128  336.723 214.449 1.00 33.60  ? 159  MET C C   1 
ATOM   7151  O  O   . MET C  3  159 ? 96.773  336.478 213.294 1.00 31.85  ? 159  MET C O   1 
ATOM   7152  C  CB  . MET C  3  159 ? 96.803  335.323 216.526 1.00 33.11  ? 159  MET C CB  1 
ATOM   7153  C  CG  . MET C  3  159 ? 95.541  334.517 216.155 1.00 40.12  ? 159  MET C CG  1 
ATOM   7154  S  SD  . MET C  3  159 ? 94.386  335.459 215.104 1.00 40.68  ? 159  MET C SD  1 
ATOM   7155  C  CE  . MET C  3  159 ? 92.855  334.501 215.492 1.00 38.78  ? 159  MET C CE  1 
ATOM   7156  N  N   . LEU C  3  160 ? 97.063  337.950 214.962 1.00 30.88  ? 160  LEU C N   1 
ATOM   7157  C  CA  . LEU C  3  160 ? 96.473  339.046 214.202 1.00 31.87  ? 160  LEU C CA  1 
ATOM   7158  C  C   . LEU C  3  160 ? 97.261  339.337 212.924 1.00 38.51  ? 160  LEU C C   1 
ATOM   7159  O  O   . LEU C  3  160 ? 96.669  339.612 211.873 1.00 35.20  ? 160  LEU C O   1 
ATOM   7160  C  CB  . LEU C  3  160 ? 96.424  340.299 215.088 1.00 34.20  ? 160  LEU C CB  1 
ATOM   7161  C  CG  . LEU C  3  160 ? 95.344  340.178 216.168 1.00 31.55  ? 160  LEU C CG  1 
ATOM   7162  C  CD1 . LEU C  3  160 ? 95.641  341.121 217.313 1.00 35.46  ? 160  LEU C CD1 1 
ATOM   7163  C  CD2 . LEU C  3  160 ? 93.942  340.551 215.578 1.00 28.86  ? 160  LEU C CD2 1 
ATOM   7164  N  N   . GLN C  3  161 ? 98.594  339.319 213.003 1.00 33.54  ? 161  GLN C N   1 
ATOM   7165  C  CA  . GLN C  3  161 ? 99.397  339.565 211.803 1.00 33.82  ? 161  GLN C CA  1 
ATOM   7166  C  C   . GLN C  3  161 ? 99.131  338.498 210.743 1.00 36.31  ? 161  GLN C C   1 
ATOM   7167  O  O   . GLN C  3  161 ? 98.861  338.811 209.577 1.00 35.71  ? 161  GLN C O   1 
ATOM   7168  C  CB  . GLN C  3  161 ? 100.892 339.641 212.183 1.00 33.45  ? 161  GLN C CB  1 
ATOM   7169  C  CG  . GLN C  3  161 ? 101.810 340.048 211.052 1.00 60.33  ? 161  GLN C CG  1 
ATOM   7170  C  CD  . GLN C  3  161 ? 103.297 339.842 211.396 1.00 44.63  ? 161  GLN C CD  1 
ATOM   7171  O  OE1 . GLN C  3  161 ? 103.635 339.386 212.495 1.00 48.73  ? 161  GLN C OE1 1 
ATOM   7172  N  NE2 . GLN C  3  161 ? 104.168 340.163 210.461 1.00 136.94 ? 161  GLN C NE2 1 
ATOM   7173  N  N   . ALA C  3  162 ? 99.180  337.219 211.132 1.00 33.09  ? 162  ALA C N   1 
ATOM   7174  C  CA  . ALA C  3  162 ? 98.949  336.139 210.181 1.00 34.88  ? 162  ALA C CA  1 
ATOM   7175  C  C   . ALA C  3  162 ? 97.526  336.175 209.617 1.00 32.77  ? 162  ALA C C   1 
ATOM   7176  O  O   . ALA C  3  162 ? 97.313  335.948 208.404 1.00 32.59  ? 162  ALA C O   1 
ATOM   7177  C  CB  . ALA C  3  162 ? 99.217  334.793 210.865 1.00 31.31  ? 162  ALA C CB  1 
ATOM   7178  N  N   . LEU C  3  163 ? 96.533  336.436 210.475 1.00 34.38  ? 163  LEU C N   1 
ATOM   7179  C  CA  . LEU C  3  163 ? 95.155  336.484 209.993 1.00 31.64  ? 163  LEU C CA  1 
ATOM   7180  C  C   . LEU C  3  163 ? 94.954  337.663 209.040 1.00 31.82  ? 163  LEU C C   1 
ATOM   7181  O  O   . LEU C  3  163 ? 94.269  337.546 208.016 1.00 29.44  ? 163  LEU C O   1 
ATOM   7182  C  CB  . LEU C  3  163 ? 94.214  336.587 211.205 1.00 29.91  ? 163  LEU C CB  1 
ATOM   7183  C  CG  . LEU C  3  163 ? 92.700  336.537 210.937 1.00 31.99  ? 163  LEU C CG  1 
ATOM   7184  C  CD1 . LEU C  3  163 ? 92.321  335.449 209.919 1.00 31.84  ? 163  LEU C CD1 1 
ATOM   7185  C  CD2 . LEU C  3  163 ? 91.979  336.318 212.303 1.00 30.21  ? 163  LEU C CD2 1 
ATOM   7186  N  N   . PHE C  3  164 ? 95.599  338.804 209.335 1.00 33.26  ? 164  PHE C N   1 
ATOM   7187  C  CA  . PHE C  3  164 ? 95.524  339.957 208.438 1.00 34.44  ? 164  PHE C CA  1 
ATOM   7188  C  C   . PHE C  3  164 ? 96.159  339.682 207.077 1.00 34.58  ? 164  PHE C C   1 
ATOM   7189  O  O   . PHE C  3  164 ? 95.637  340.111 206.028 1.00 35.74  ? 164  PHE C O   1 
ATOM   7190  C  CB  . PHE C  3  164 ? 96.204  341.165 209.100 1.00 28.96  ? 164  PHE C CB  1 
ATOM   7191  C  CG  . PHE C  3  164 ? 96.247  342.390 208.212 1.00 38.92  ? 164  PHE C CG  1 
ATOM   7192  C  CD1 . PHE C  3  164 ? 95.186  343.248 208.149 1.00 42.85  ? 164  PHE C CD1 1 
ATOM   7193  C  CD2 . PHE C  3  164 ? 97.339  342.636 207.409 1.00 41.57  ? 164  PHE C CD2 1 
ATOM   7194  C  CE1 . PHE C  3  164 ? 95.225  344.357 207.322 1.00 51.91  ? 164  PHE C CE1 1 
ATOM   7195  C  CE2 . PHE C  3  164 ? 97.385  343.761 206.585 1.00 54.75  ? 164  PHE C CE2 1 
ATOM   7196  C  CZ  . PHE C  3  164 ? 96.308  344.610 206.552 1.00 46.26  ? 164  PHE C CZ  1 
ATOM   7197  N  N   . ILE C  3  165 ? 97.292  338.988 207.073 1.00 34.23  ? 165  ILE C N   1 
ATOM   7198  C  CA  . ILE C  3  165 ? 97.918  338.584 205.816 1.00 31.27  ? 165  ILE C CA  1 
ATOM   7199  C  C   . ILE C  3  165 ? 96.985  337.668 205.031 1.00 35.49  ? 165  ILE C C   1 
ATOM   7200  O  O   . ILE C  3  165 ? 96.834  337.795 203.806 1.00 30.12  ? 165  ILE C O   1 
ATOM   7201  C  CB  . ILE C  3  165 ? 99.263  337.905 206.104 1.00 28.38  ? 165  ILE C CB  1 
ATOM   7202  C  CG1 . ILE C  3  165 ? 100.297 338.998 206.501 1.00 32.67  ? 165  ILE C CG1 1 
ATOM   7203  C  CG2 . ILE C  3  165 ? 99.722  337.141 204.867 1.00 28.84  ? 165  ILE C CG2 1 
ATOM   7204  C  CD1 . ILE C  3  165 ? 101.572 338.414 207.161 1.00 32.36  ? 165  ILE C CD1 1 
ATOM   7205  N  N   . THR C  3  166 ? 96.367  336.718 205.721 1.00 31.40  ? 166  THR C N   1 
ATOM   7206  C  CA  . THR C  3  166 ? 95.425  335.804 205.073 1.00 32.41  ? 166  THR C CA  1 
ATOM   7207  C  C   . THR C  3  166 ? 94.280  336.575 204.394 1.00 36.00  ? 166  THR C C   1 
ATOM   7208  O  O   . THR C  3  166 ? 93.922  336.299 203.243 1.00 31.37  ? 166  THR C O   1 
ATOM   7209  C  CB  . THR C  3  166 ? 94.827  334.812 206.104 1.00 31.62  ? 166  THR C CB  1 
ATOM   7210  O  OG1 . THR C  3  166 ? 95.853  334.078 206.780 1.00 29.44  ? 166  THR C OG1 1 
ATOM   7211  C  CG2 . THR C  3  166 ? 93.969  333.778 205.360 1.00 30.85  ? 166  THR C CG2 1 
ATOM   7212  N  N   . ILE C  3  167 ? 93.669  337.527 205.109 1.00 31.48  ? 167  ILE C N   1 
ATOM   7213  C  CA  . ILE C  3  167 ? 92.555  338.282 204.541 1.00 32.27  ? 167  ILE C CA  1 
ATOM   7214  C  C   . ILE C  3  167 ? 93.038  339.100 203.351 1.00 36.92  ? 167  ILE C C   1 
ATOM   7215  O  O   . ILE C  3  167 ? 92.361  339.200 202.319 1.00 37.85  ? 167  ILE C O   1 
ATOM   7216  C  CB  . ILE C  3  167 ? 91.950  339.170 205.636 1.00 36.34  ? 167  ILE C CB  1 
ATOM   7217  C  CG1 . ILE C  3  167 ? 91.344  338.270 206.723 1.00 29.83  ? 167  ILE C CG1 1 
ATOM   7218  C  CG2 . ILE C  3  167 ? 90.977  340.189 205.040 1.00 29.17  ? 167  ILE C CG2 1 
ATOM   7219  C  CD1 . ILE C  3  167 ? 91.054  338.989 208.116 1.00 28.69  ? 167  ILE C CD1 1 
ATOM   7220  N  N   . THR C  3  168 ? 94.202  339.727 203.490 1.00 31.84  ? 168  THR C N   1 
ATOM   7221  C  CA  . THR C  3  168 ? 94.722  340.563 202.430 1.00 33.45  ? 168  THR C CA  1 
ATOM   7222  C  C   . THR C  3  168 ? 94.898  339.743 201.159 1.00 31.90  ? 168  THR C C   1 
ATOM   7223  O  O   . THR C  3  168 ? 94.610  340.203 200.042 1.00 37.32  ? 168  THR C O   1 
ATOM   7224  C  CB  . THR C  3  168 ? 96.055  341.158 202.906 1.00 36.88  ? 168  THR C CB  1 
ATOM   7225  O  OG1 . THR C  3  168 ? 95.831  342.112 203.944 1.00 36.82  ? 168  THR C OG1 1 
ATOM   7226  C  CG2 . THR C  3  168 ? 96.783  341.824 201.803 1.00 40.98  ? 168  THR C CG2 1 
ATOM   7227  N  N   . LEU C  3  169 ? 95.414  338.528 201.307 1.00 31.37  ? 169  LEU C N   1 
ATOM   7228  C  CA  . LEU C  3  169 ? 95.532  337.667 200.146 1.00 31.15  ? 169  LEU C CA  1 
ATOM   7229  C  C   . LEU C  3  169 ? 94.148  337.310 199.582 1.00 36.28  ? 169  LEU C C   1 
ATOM   7230  O  O   . LEU C  3  169 ? 93.948  337.300 198.362 1.00 33.54  ? 169  LEU C O   1 
ATOM   7231  C  CB  . LEU C  3  169 ? 96.314  336.425 200.551 1.00 31.53  ? 169  LEU C CB  1 
ATOM   7232  C  CG  . LEU C  3  169 ? 97.796  336.749 200.849 1.00 37.70  ? 169  LEU C CG  1 
ATOM   7233  C  CD1 . LEU C  3  169 ? 98.419  335.577 201.629 1.00 35.18  ? 169  LEU C CD1 1 
ATOM   7234  C  CD2 . LEU C  3  169 ? 98.622  336.993 199.607 1.00 35.92  ? 169  LEU C CD2 1 
ATOM   7235  N  N   . GLY C  3  170 ? 93.173  337.028 200.450 1.00 31.69  ? 170  GLY C N   1 
ATOM   7236  C  CA  . GLY C  3  170 ? 91.824  336.753 199.954 1.00 29.35  ? 170  GLY C CA  1 
ATOM   7237  C  C   . GLY C  3  170 ? 91.275  337.912 199.146 1.00 38.54  ? 170  GLY C C   1 
ATOM   7238  O  O   . GLY C  3  170 ? 90.689  337.728 198.068 1.00 32.83  ? 170  GLY C O   1 
ATOM   7239  N  N   . VAL C  3  171 ? 91.479  339.121 199.646 1.00 32.13  ? 171  VAL C N   1 
ATOM   7240  C  CA  . VAL C  3  171 ? 91.042  340.318 198.955 1.00 43.44  ? 171  VAL C CA  1 
ATOM   7241  C  C   . VAL C  3  171 ? 91.797  340.491 197.646 1.00 42.11  ? 171  VAL C C   1 
ATOM   7242  O  O   . VAL C  3  171 ? 91.210  340.913 196.650 1.00 36.39  ? 171  VAL C O   1 
ATOM   7243  C  CB  . VAL C  3  171 ? 91.236  341.538 199.865 1.00 46.76  ? 171  VAL C CB  1 
ATOM   7244  C  CG1 . VAL C  3  171 ? 91.067  342.813 199.055 1.00 45.50  ? 171  VAL C CG1 1 
ATOM   7245  C  CG2 . VAL C  3  171 ? 90.242  341.465 201.009 1.00 34.61  ? 171  VAL C CG2 1 
ATOM   7246  N  N   . TYR C  3  172 ? 93.123  340.248 197.651 1.00 33.07  ? 172  TYR C N   1 
ATOM   7247  C  CA  . TYR C  3  172 ? 93.921  340.338 196.432 1.00 34.81  ? 172  TYR C CA  1 
ATOM   7248  C  C   . TYR C  3  172 ? 93.360  339.390 195.360 1.00 39.24  ? 172  TYR C C   1 
ATOM   7249  O  O   . TYR C  3  172 ? 93.213  339.766 194.196 1.00 37.71  ? 172  TYR C O   1 
ATOM   7250  C  CB  . TYR C  3  172 ? 95.389  340.010 196.779 1.00 34.28  ? 172  TYR C CB  1 
ATOM   7251  C  CG  . TYR C  3  172 ? 96.484  340.209 195.693 1.00 39.50  ? 172  TYR C CG  1 
ATOM   7252  C  CD1 . TYR C  3  172 ? 96.369  341.203 194.707 1.00 61.89  ? 172  TYR C CD1 1 
ATOM   7253  C  CD2 . TYR C  3  172 ? 97.667  339.455 195.726 1.00 46.99  ? 172  TYR C CD2 1 
ATOM   7254  C  CE1 . TYR C  3  172 ? 97.400  341.406 193.733 1.00 36.02  ? 172  TYR C CE1 1 
ATOM   7255  C  CE2 . TYR C  3  172 ? 98.712  339.639 194.752 1.00 44.47  ? 172  TYR C CE2 1 
ATOM   7256  C  CZ  . TYR C  3  172 ? 98.563  340.623 193.766 1.00 39.94  ? 172  TYR C CZ  1 
ATOM   7257  O  OH  . TYR C  3  172 ? 99.579  340.810 192.856 1.00 45.56  ? 172  TYR C OH  1 
ATOM   7258  N  N   . PHE C  3  173 ? 93.030  338.155 195.752 1.00 34.20  ? 173  PHE C N   1 
ATOM   7259  C  CA  . PHE C  3  173 ? 92.476  337.192 194.810 1.00 34.01  ? 173  PHE C CA  1 
ATOM   7260  C  C   . PHE C  3  173 ? 91.197  337.749 194.169 1.00 30.82  ? 173  PHE C C   1 
ATOM   7261  O  O   . PHE C  3  173 ? 90.982  337.623 192.944 1.00 34.77  ? 173  PHE C O   1 
ATOM   7262  C  CB  . PHE C  3  173 ? 92.182  335.868 195.523 1.00 33.36  ? 173  PHE C CB  1 
ATOM   7263  C  CG  . PHE C  3  173 ? 91.462  334.881 194.645 1.00 33.24  ? 173  PHE C CG  1 
ATOM   7264  C  CD1 . PHE C  3  173 ? 90.063  334.929 194.511 1.00 33.96  ? 173  PHE C CD1 1 
ATOM   7265  C  CD2 . PHE C  3  173 ? 92.188  333.931 193.956 1.00 28.62  ? 173  PHE C CD2 1 
ATOM   7266  C  CE1 . PHE C  3  173 ? 89.374  334.033 193.654 1.00 33.13  ? 173  PHE C CE1 1 
ATOM   7267  C  CE2 . PHE C  3  173 ? 91.542  333.013 193.099 1.00 37.66  ? 173  PHE C CE2 1 
ATOM   7268  C  CZ  . PHE C  3  173 ? 90.108  333.056 192.947 1.00 33.84  ? 173  PHE C CZ  1 
ATOM   7269  N  N   . THR C  3  174 ? 90.342  338.355 195.002 1.00 36.97  ? 174  THR C N   1 
ATOM   7270  C  CA  . THR C  3  174 ? 89.037  338.846 194.561 1.00 33.42  ? 174  THR C CA  1 
ATOM   7271  C  C   . THR C  3  174 ? 89.222  339.997 193.595 1.00 41.38  ? 174  THR C C   1 
ATOM   7272  O  O   . THR C  3  174 ? 88.560  340.058 192.558 1.00 36.55  ? 174  THR C O   1 
ATOM   7273  C  CB  . THR C  3  174 ? 88.236  339.264 195.777 1.00 36.02  ? 174  THR C CB  1 
ATOM   7274  O  OG1 . THR C  3  174 ? 88.025  338.082 196.579 1.00 37.66  ? 174  THR C OG1 1 
ATOM   7275  C  CG2 . THR C  3  174 ? 86.888  339.867 195.368 1.00 41.80  ? 174  THR C CG2 1 
ATOM   7276  N  N   . LEU C  3  175 ? 90.153  340.894 193.910 1.00 35.30  ? 175  LEU C N   1 
ATOM   7277  C  CA  . LEU C  3  175 ? 90.483  341.979 192.998 1.00 37.03  ? 175  LEU C CA  1 
ATOM   7278  C  C   . LEU C  3  175 ? 91.067  341.448 191.698 1.00 39.38  ? 175  LEU C C   1 
ATOM   7279  O  O   . LEU C  3  175 ? 90.709  341.920 190.613 1.00 39.50  ? 175  LEU C O   1 
ATOM   7280  C  CB  . LEU C  3  175 ? 91.478  342.935 193.680 1.00 37.42  ? 175  LEU C CB  1 
ATOM   7281  C  CG  . LEU C  3  175 ? 90.818  343.678 194.850 1.00 52.29  ? 175  LEU C CG  1 
ATOM   7282  C  CD1 . LEU C  3  175 ? 91.797  344.659 195.477 1.00 49.90  ? 175  LEU C CD1 1 
ATOM   7283  C  CD2 . LEU C  3  175 ? 89.542  344.379 194.420 1.00 52.11  ? 175  LEU C CD2 1 
ATOM   7284  N  N   . LEU C  3  176 ? 92.000  340.499 191.779 1.00 34.97  ? 176  LEU C N   1 
ATOM   7285  C  CA  . LEU C  3  176 ? 92.577  339.935 190.559 1.00 34.49  ? 176  LEU C CA  1 
ATOM   7286  C  C   . LEU C  3  176 ? 91.490  339.288 189.731 1.00 37.30  ? 176  LEU C C   1 
ATOM   7287  O  O   . LEU C  3  176 ? 91.441  339.458 188.503 1.00 35.86  ? 176  LEU C O   1 
ATOM   7288  C  CB  . LEU C  3  176 ? 93.655  338.896 190.897 1.00 29.74  ? 176  LEU C CB  1 
ATOM   7289  C  CG  . LEU C  3  176 ? 94.925  339.488 191.492 1.00 33.40  ? 176  LEU C CG  1 
ATOM   7290  C  CD1 . LEU C  3  176 ? 95.765  338.395 192.102 1.00 34.98  ? 176  LEU C CD1 1 
ATOM   7291  C  CD2 . LEU C  3  176 ? 95.675  340.195 190.330 1.00 40.07  ? 176  LEU C CD2 1 
ATOM   7292  N  N   . GLN C  3  177 ? 90.546  338.617 190.407 1.00 34.40  ? 177  GLN C N   1 
ATOM   7293  C  CA  . GLN C  3  177 ? 89.525  337.898 189.664 1.00 37.67  ? 177  GLN C CA  1 
ATOM   7294  C  C   . GLN C  3  177 ? 88.560  338.875 189.018 1.00 42.62  ? 177  GLN C C   1 
ATOM   7295  O  O   . GLN C  3  177 ? 88.137  338.679 187.868 1.00 36.11  ? 177  GLN C O   1 
ATOM   7296  C  CB  . GLN C  3  177 ? 88.805  336.892 190.571 1.00 32.64  ? 177  GLN C CB  1 
ATOM   7297  C  CG  . GLN C  3  177 ? 88.095  335.801 189.819 1.00 49.64  ? 177  GLN C CG  1 
ATOM   7298  C  CD  . GLN C  3  177 ? 89.023  334.780 189.147 1.00 59.74  ? 177  GLN C CD  1 
ATOM   7299  O  OE1 . GLN C  3  177 ? 90.008  335.128 188.475 1.00 42.48  ? 177  GLN C OE1 1 
ATOM   7300  N  NE2 . GLN C  3  177 ? 88.673  333.509 189.288 1.00 41.28  ? 177  GLN C NE2 1 
ATOM   7301  N  N   . ALA C  3  178 ? 88.256  339.960 189.713 1.00 31.60  ? 178  ALA C N   1 
ATOM   7302  C  CA  . ALA C  3  178 ? 87.382  340.974 189.146 1.00 39.65  ? 178  ALA C CA  1 
ATOM   7303  C  C   . ALA C  3  178 ? 88.035  341.617 187.941 1.00 41.65  ? 178  ALA C C   1 
ATOM   7304  O  O   . ALA C  3  178 ? 87.377  341.846 186.911 1.00 37.14  ? 178  ALA C O   1 
ATOM   7305  C  CB  . ALA C  3  178 ? 87.045  342.037 190.197 1.00 39.63  ? 178  ALA C CB  1 
ATOM   7306  N  N   . SER C  3  179 ? 89.345  341.871 188.027 1.00 38.04  ? 179  SER C N   1 
ATOM   7307  C  CA  . SER C  3  179 ? 90.034  342.413 186.870 1.00 38.44  ? 179  SER C CA  1 
ATOM   7308  C  C   . SER C  3  179 ? 90.073  341.410 185.720 1.00 42.95  ? 179  SER C C   1 
ATOM   7309  O  O   . SER C  3  179 ? 89.889  341.797 184.559 1.00 43.96  ? 179  SER C O   1 
ATOM   7310  C  CB  . SER C  3  179 ? 91.428  342.867 187.278 1.00 33.28  ? 179  SER C CB  1 
ATOM   7311  O  OG  . SER C  3  179 ? 92.293  342.882 186.177 1.00 44.62  ? 179  SER C OG  1 
ATOM   7312  N  N   . GLU C  3  180 ? 90.327  340.127 186.005 1.00 36.41  ? 180  GLU C N   1 
ATOM   7313  C  CA  . GLU C  3  180 ? 90.290  339.106 184.953 1.00 36.31  ? 180  GLU C CA  1 
ATOM   7314  C  C   . GLU C  3  180 ? 88.916  339.034 184.268 1.00 37.34  ? 180  GLU C C   1 
ATOM   7315  O  O   . GLU C  3  180 ? 88.826  338.850 183.044 1.00 35.27  ? 180  GLU C O   1 
ATOM   7316  C  CB  . GLU C  3  180 ? 90.641  337.732 185.519 1.00 35.04  ? 180  GLU C CB  1 
ATOM   7317  C  CG  . GLU C  3  180 ? 92.089  337.586 185.749 1.00 64.64  ? 180  GLU C CG  1 
ATOM   7318  C  CD  . GLU C  3  180 ? 92.707  336.680 184.739 1.00 151.46 ? 180  GLU C CD  1 
ATOM   7319  O  OE1 . GLU C  3  180 ? 92.573  335.437 184.906 1.00 70.12  ? 180  GLU C OE1 1 
ATOM   7320  O  OE2 . GLU C  3  180 ? 93.297  337.225 183.778 1.00 50.12  ? 180  GLU C OE2 1 
ATOM   7321  N  N   . TYR C  3  181 ? 87.854  339.147 185.054 1.00 33.92  ? 181  TYR C N   1 
ATOM   7322  C  CA  . TYR C  3  181 ? 86.498  339.151 184.512 1.00 33.61  ? 181  TYR C CA  1 
ATOM   7323  C  C   . TYR C  3  181 ? 86.311  340.298 183.539 1.00 44.19  ? 181  TYR C C   1 
ATOM   7324  O  O   . TYR C  3  181 ? 85.781  340.111 182.444 1.00 37.54  ? 181  TYR C O   1 
ATOM   7325  C  CB  . TYR C  3  181 ? 85.476  339.258 185.643 1.00 36.19  ? 181  TYR C CB  1 
ATOM   7326  C  CG  . TYR C  3  181 ? 85.070  337.922 186.258 1.00 30.99  ? 181  TYR C CG  1 
ATOM   7327  C  CD1 . TYR C  3  181 ? 85.900  336.803 186.165 1.00 37.35  ? 181  TYR C CD1 1 
ATOM   7328  C  CD2 . TYR C  3  181 ? 83.869  337.807 186.927 1.00 37.65  ? 181  TYR C CD2 1 
ATOM   7329  C  CE1 . TYR C  3  181 ? 85.511  335.610 186.719 1.00 35.24  ? 181  TYR C CE1 1 
ATOM   7330  C  CE2 . TYR C  3  181 ? 83.464  336.630 187.477 1.00 34.60  ? 181  TYR C CE2 1 
ATOM   7331  C  CZ  . TYR C  3  181 ? 84.279  335.536 187.367 1.00 32.86  ? 181  TYR C CZ  1 
ATOM   7332  O  OH  . TYR C  3  181 ? 83.824  334.349 187.898 1.00 35.51  ? 181  TYR C OH  1 
ATOM   7333  N  N   . TYR C  3  182 ? 86.716  341.495 183.931 1.00 34.58  ? 182  TYR C N   1 
ATOM   7334  C  CA  . TYR C  3  182 ? 86.597  342.651 183.047 1.00 37.38  ? 182  TYR C CA  1 
ATOM   7335  C  C   . TYR C  3  182 ? 87.418  342.503 181.776 1.00 41.29  ? 182  TYR C C   1 
ATOM   7336  O  O   . TYR C  3  182 ? 86.940  342.833 180.678 1.00 38.85  ? 182  TYR C O   1 
ATOM   7337  C  CB  . TYR C  3  182 ? 87.028  343.931 183.773 1.00 35.98  ? 182  TYR C CB  1 
ATOM   7338  C  CG  . TYR C  3  182 ? 86.752  345.134 182.888 1.00 43.06  ? 182  TYR C CG  1 
ATOM   7339  C  CD1 . TYR C  3  182 ? 85.443  345.486 182.573 1.00 43.10  ? 182  TYR C CD1 1 
ATOM   7340  C  CD2 . TYR C  3  182 ? 87.790  345.880 182.326 1.00 42.51  ? 182  TYR C CD2 1 
ATOM   7341  C  CE1 . TYR C  3  182 ? 85.152  346.568 181.748 1.00 40.02  ? 182  TYR C CE1 1 
ATOM   7342  C  CE2 . TYR C  3  182 ? 87.509  346.976 181.481 1.00 57.87  ? 182  TYR C CE2 1 
ATOM   7343  C  CZ  . TYR C  3  182 ? 86.194  347.314 181.212 1.00 52.48  ? 182  TYR C CZ  1 
ATOM   7344  O  OH  . TYR C  3  182 ? 85.910  348.390 180.404 1.00 53.03  ? 182  TYR C OH  1 
ATOM   7345  N  N   . GLU C  3  183 ? 88.635  341.969 181.882 1.00 35.85  ? 183  GLU C N   1 
ATOM   7346  C  CA  . GLU C  3  183 ? 89.530  341.854 180.722 1.00 31.65  ? 183  GLU C CA  1 
ATOM   7347  C  C   . GLU C  3  183 ? 89.229  340.665 179.835 1.00 39.57  ? 183  GLU C C   1 
ATOM   7348  O  O   . GLU C  3  183 ? 89.679  340.642 178.687 1.00 38.22  ? 183  GLU C O   1 
ATOM   7349  C  CB  . GLU C  3  183 ? 90.977  341.712 181.209 1.00 39.26  ? 183  GLU C CB  1 
ATOM   7350  C  CG  . GLU C  3  183 ? 91.457  342.915 182.018 1.00 41.53  ? 183  GLU C CG  1 
ATOM   7351  C  CD  . GLU C  3  183 ? 91.560  344.186 181.187 1.00 71.67  ? 183  GLU C CD  1 
ATOM   7352  O  OE1 . GLU C  3  183 ? 91.401  345.264 181.768 1.00 48.29  ? 183  GLU C OE1 1 
ATOM   7353  O  OE2 . GLU C  3  183 ? 91.808  344.127 179.963 1.00 55.38  ? 183  GLU C OE2 1 
ATOM   7354  N  N   . ALA C  3  184 ? 88.519  339.662 180.331 1.00 31.88  ? 184  ALA C N   1 
ATOM   7355  C  CA  . ALA C  3  184 ? 88.279  338.468 179.522 1.00 34.09  ? 184  ALA C CA  1 
ATOM   7356  C  C   . ALA C  3  184 ? 87.615  338.831 178.178 1.00 34.19  ? 184  ALA C C   1 
ATOM   7357  O  O   . ALA C  3  184 ? 86.608  339.551 178.164 1.00 37.62  ? 184  ALA C O   1 
ATOM   7358  C  CB  . ALA C  3  184 ? 87.414  337.458 180.284 1.00 35.31  ? 184  ALA C CB  1 
ATOM   7359  N  N   . PRO C  3  185 ? 88.134  338.337 177.047 1.00 37.18  ? 185  PRO C N   1 
ATOM   7360  C  CA  . PRO C  3  185 ? 87.476  338.598 175.745 1.00 35.81  ? 185  PRO C CA  1 
ATOM   7361  C  C   . PRO C  3  185 ? 86.268  337.726 175.486 1.00 45.79  ? 185  PRO C C   1 
ATOM   7362  O  O   . PRO C  3  185 ? 85.591  337.943 174.486 1.00 40.23  ? 185  PRO C O   1 
ATOM   7363  C  CB  . PRO C  3  185 ? 88.580  338.276 174.706 1.00 37.39  ? 185  PRO C CB  1 
ATOM   7364  C  CG  . PRO C  3  185 ? 89.381  337.186 175.390 1.00 39.75  ? 185  PRO C CG  1 
ATOM   7365  C  CD  . PRO C  3  185 ? 89.323  337.485 176.899 1.00 33.80  ? 185  PRO C CD  1 
ATOM   7366  N  N   . PHE C  3  186 ? 85.995  336.731 176.317 1.00 35.70  ? 186  PHE C N   1 
ATOM   7367  C  CA  . PHE C  3  186 ? 84.757  335.963 176.230 1.00 32.82  ? 186  PHE C CA  1 
ATOM   7368  C  C   . PHE C  3  186 ? 83.862  336.336 177.420 1.00 42.72  ? 186  PHE C C   1 
ATOM   7369  O  O   . PHE C  3  186 ? 84.314  336.954 178.389 1.00 32.19  ? 186  PHE C O   1 
ATOM   7370  C  CB  . PHE C  3  186 ? 85.089  334.464 176.221 1.00 36.85  ? 186  PHE C CB  1 
ATOM   7371  C  CG  . PHE C  3  186 ? 85.966  334.041 177.362 1.00 38.52  ? 186  PHE C CG  1 
ATOM   7372  C  CD1 . PHE C  3  186 ? 85.416  333.634 178.579 1.00 31.60  ? 186  PHE C CD1 1 
ATOM   7373  C  CD2 . PHE C  3  186 ? 87.354  334.080 177.238 1.00 32.26  ? 186  PHE C CD2 1 
ATOM   7374  C  CE1 . PHE C  3  186 ? 86.228  333.237 179.673 1.00 31.92  ? 186  PHE C CE1 1 
ATOM   7375  C  CE2 . PHE C  3  186 ? 88.208  333.696 178.338 1.00 35.93  ? 186  PHE C CE2 1 
ATOM   7376  C  CZ  . PHE C  3  186 ? 87.636  333.284 179.566 1.00 34.10  ? 186  PHE C CZ  1 
ATOM   7377  N  N   . THR C  3  187 ? 82.571  336.015 177.326 1.00 31.22  ? 187  THR C N   1 
ATOM   7378  C  CA  . THR C  3  187 ? 81.575  336.435 178.331 1.00 31.86  ? 187  THR C CA  1 
ATOM   7379  C  C   . THR C  3  187 ? 80.735  335.233 178.753 1.00 29.61  ? 187  THR C C   1 
ATOM   7380  O  O   . THR C  3  187 ? 80.858  334.128 178.209 1.00 34.55  ? 187  THR C O   1 
ATOM   7381  C  CB  . THR C  3  187 ? 80.612  337.504 177.792 1.00 30.77  ? 187  THR C CB  1 
ATOM   7382  O  OG1 . THR C  3  187 ? 79.675  336.862 176.902 1.00 33.89  ? 187  THR C OG1 1 
ATOM   7383  C  CG2 . THR C  3  187 ? 81.378  338.667 177.010 1.00 29.97  ? 187  THR C CG2 1 
ATOM   7384  N  N   . ILE C  3  188 ? 79.842  335.452 179.709 1.00 29.65  ? 188  ILE C N   1 
ATOM   7385  C  CA  . ILE C  3  188 ? 78.974  334.345 180.094 1.00 33.88  ? 188  ILE C CA  1 
ATOM   7386  C  C   . ILE C  3  188 ? 78.066  333.926 178.948 1.00 40.32  ? 188  ILE C C   1 
ATOM   7387  O  O   . ILE C  3  188 ? 77.633  332.782 178.925 1.00 27.81  ? 188  ILE C O   1 
ATOM   7388  C  CB  . ILE C  3  188 ? 78.152  334.684 181.357 1.00 27.56  ? 188  ILE C CB  1 
ATOM   7389  C  CG1 . ILE C  3  188 ? 77.595  333.411 182.021 1.00 29.21  ? 188  ILE C CG1 1 
ATOM   7390  C  CG2 . ILE C  3  188 ? 77.001  335.619 181.056 1.00 27.97  ? 188  ILE C CG2 1 
ATOM   7391  C  CD1 . ILE C  3  188 ? 76.946  333.748 183.398 1.00 30.27  ? 188  ILE C CD1 1 
ATOM   7392  N  N   . SER C  3  189 ? 77.774  334.806 177.975 1.00 28.69  ? 189  SER C N   1 
ATOM   7393  C  CA  . SER C  3  189 ? 76.897  334.423 176.884 1.00 32.72  ? 189  SER C CA  1 
ATOM   7394  C  C   . SER C  3  189 ? 77.646  333.756 175.726 1.00 34.10  ? 189  SER C C   1 
ATOM   7395  O  O   . SER C  3  189 ? 77.038  333.511 174.695 1.00 33.85  ? 189  SER C O   1 
ATOM   7396  C  CB  . SER C  3  189 ? 76.113  335.640 176.352 1.00 31.97  ? 189  SER C CB  1 
ATOM   7397  O  OG  . SER C  3  189 ? 76.986  336.499 175.570 1.00 31.98  ? 189  SER C OG  1 
ATOM   7398  N  N   . ASP C  3  190 ? 78.934  333.443 175.886 1.00 29.42  ? 190  ASP C N   1 
ATOM   7399  C  CA  . ASP C  3  190 ? 79.734  332.810 174.838 1.00 27.46  ? 190  ASP C CA  1 
ATOM   7400  C  C   . ASP C  3  190 ? 79.643  331.280 174.906 1.00 28.03  ? 190  ASP C C   1 
ATOM   7401  O  O   . ASP C  3  190 ? 80.628  330.547 175.062 1.00 30.48  ? 190  ASP C O   1 
ATOM   7402  C  CB  . ASP C  3  190 ? 81.168  333.323 174.875 1.00 30.33  ? 190  ASP C CB  1 
ATOM   7403  C  CG  . ASP C  3  190 ? 81.272  334.710 174.284 1.00 37.78  ? 190  ASP C CG  1 
ATOM   7404  O  OD1 . ASP C  3  190 ? 80.336  335.129 173.618 1.00 33.11  ? 190  ASP C OD1 1 
ATOM   7405  O  OD2 . ASP C  3  190 ? 82.247  335.431 174.483 1.00 33.65  ? 190  ASP C OD2 1 
ATOM   7406  N  N   . GLY C  3  191 ? 78.434  330.806 174.644 1.00 29.70  ? 191  GLY C N   1 
ATOM   7407  C  CA  . GLY C  3  191 ? 78.141  329.403 174.654 1.00 26.32  ? 191  GLY C CA  1 
ATOM   7408  C  C   . GLY C  3  191 ? 78.533  328.716 175.969 1.00 26.26  ? 191  GLY C C   1 
ATOM   7409  O  O   . GLY C  3  191 ? 78.638  329.311 177.045 1.00 28.32  ? 191  GLY C O   1 
ATOM   7410  N  N   . VAL C  3  192 ? 78.739  327.410 175.858 1.00 26.59  ? 192  VAL C N   1 
ATOM   7411  C  CA  . VAL C  3  192 ? 78.968  326.616 177.051 1.00 28.07  ? 192  VAL C CA  1 
ATOM   7412  C  C   . VAL C  3  192 ? 80.356  326.867 177.619 1.00 39.46  ? 192  VAL C C   1 
ATOM   7413  O  O   . VAL C  3  192 ? 80.595  326.646 178.818 1.00 29.17  ? 192  VAL C O   1 
ATOM   7414  C  CB  . VAL C  3  192 ? 78.671  325.158 176.635 1.00 31.99  ? 192  VAL C CB  1 
ATOM   7415  C  CG1 . VAL C  3  192 ? 79.823  324.522 175.791 1.00 31.49  ? 192  VAL C CG1 1 
ATOM   7416  C  CG2 . VAL C  3  192 ? 78.262  324.339 177.771 1.00 34.71  ? 192  VAL C CG2 1 
ATOM   7417  N  N   . TYR C  3  193 ? 81.300  327.333 176.801 1.00 31.52  ? 193  TYR C N   1 
ATOM   7418  C  CA  . TYR C  3  193 ? 82.597  327.703 177.397 1.00 23.61  ? 193  TYR C CA  1 
ATOM   7419  C  C   . TYR C  3  193 ? 82.420  328.841 178.380 1.00 28.73  ? 193  TYR C C   1 
ATOM   7420  O  O   . TYR C  3  193 ? 82.867  328.770 179.536 1.00 28.63  ? 193  TYR C O   1 
ATOM   7421  C  CB  . TYR C  3  193 ? 83.605  328.106 176.283 1.00 25.70  ? 193  TYR C CB  1 
ATOM   7422  C  CG  . TYR C  3  193 ? 84.956  328.448 176.876 1.00 28.53  ? 193  TYR C CG  1 
ATOM   7423  C  CD1 . TYR C  3  193 ? 85.242  329.727 177.336 1.00 28.34  ? 193  TYR C CD1 1 
ATOM   7424  C  CD2 . TYR C  3  193 ? 85.956  327.471 176.974 1.00 27.60  ? 193  TYR C CD2 1 
ATOM   7425  C  CE1 . TYR C  3  193 ? 86.486  330.011 177.918 1.00 32.98  ? 193  TYR C CE1 1 
ATOM   7426  C  CE2 . TYR C  3  193 ? 87.225  327.756 177.550 1.00 35.33  ? 193  TYR C CE2 1 
ATOM   7427  C  CZ  . TYR C  3  193 ? 87.459  329.020 178.021 1.00 44.44  ? 193  TYR C CZ  1 
ATOM   7428  O  OH  . TYR C  3  193 ? 88.676  329.311 178.599 1.00 39.51  ? 193  TYR C OH  1 
ATOM   7429  N  N   . GLY C  3  194 ? 81.776  329.913 177.939 1.00 26.75  ? 194  GLY C N   1 
ATOM   7430  C  CA  . GLY C  3  194 ? 81.552  331.041 178.831 1.00 27.36  ? 194  GLY C CA  1 
ATOM   7431  C  C   . GLY C  3  194 ? 80.627  330.653 179.985 1.00 34.55  ? 194  GLY C C   1 
ATOM   7432  O  O   . GLY C  3  194 ? 80.808  331.119 181.105 1.00 29.46  ? 194  GLY C O   1 
ATOM   7433  N  N   . SER C  3  195 ? 79.625  329.805 179.717 1.00 27.37  ? 195  SER C N   1 
ATOM   7434  C  CA  . SER C  3  195 ? 78.686  329.381 180.778 1.00 30.58  ? 195  SER C CA  1 
ATOM   7435  C  C   . SER C  3  195 ? 79.433  328.677 181.914 1.00 29.46  ? 195  SER C C   1 
ATOM   7436  O  O   . SER C  3  195 ? 79.314  329.027 183.113 1.00 27.27  ? 195  SER C O   1 
ATOM   7437  C  CB  . SER C  3  195 ? 77.617  328.428 180.190 1.00 22.96  ? 195  SER C CB  1 
ATOM   7438  O  OG  . SER C  3  195 ? 76.837  329.029 179.115 1.00 29.55  ? 195  SER C OG  1 
ATOM   7439  N  N   . THR C  3  196 ? 80.158  327.623 181.559 1.00 29.00  ? 196  THR C N   1 
ATOM   7440  C  CA  . THR C  3  196 ? 80.836  326.867 182.589 1.00 33.53  ? 196  THR C CA  1 
ATOM   7441  C  C   . THR C  3  196 ? 81.911  327.705 183.253 1.00 31.17  ? 196  THR C C   1 
ATOM   7442  O  O   . THR C  3  196 ? 82.068  327.653 184.481 1.00 30.27  ? 196  THR C O   1 
ATOM   7443  C  CB  . THR C  3  196 ? 81.457  325.635 181.994 1.00 26.80  ? 196  THR C CB  1 
ATOM   7444  O  OG1 . THR C  3  196 ? 82.352  326.008 180.920 1.00 32.91  ? 196  THR C OG1 1 
ATOM   7445  C  CG2 . THR C  3  196 ? 80.402  324.664 181.555 1.00 27.77  ? 196  THR C CG2 1 
ATOM   7446  N  N   . PHE C  3  197 ? 82.661  328.492 182.467 1.00 28.96  ? 197  PHE C N   1 
ATOM   7447  C  CA  . PHE C  3  197 ? 83.733  329.303 183.040 1.00 28.95  ? 197  PHE C CA  1 
ATOM   7448  C  C   . PHE C  3  197 ? 83.199  330.229 184.124 1.00 31.42  ? 197  PHE C C   1 
ATOM   7449  O  O   . PHE C  3  197 ? 83.663  330.208 185.277 1.00 29.93  ? 197  PHE C O   1 
ATOM   7450  C  CB  . PHE C  3  197 ? 84.445  330.124 181.956 1.00 29.78  ? 197  PHE C CB  1 
ATOM   7451  C  CG  . PHE C  3  197 ? 85.573  330.941 182.515 1.00 30.06  ? 197  PHE C CG  1 
ATOM   7452  C  CD1 . PHE C  3  197 ? 85.327  332.193 183.058 1.00 29.30  ? 197  PHE C CD1 1 
ATOM   7453  C  CD2 . PHE C  3  197 ? 86.871  330.435 182.519 1.00 34.08  ? 197  PHE C CD2 1 
ATOM   7454  C  CE1 . PHE C  3  197 ? 86.350  332.956 183.589 1.00 31.82  ? 197  PHE C CE1 1 
ATOM   7455  C  CE2 . PHE C  3  197 ? 87.923  331.205 183.054 1.00 36.49  ? 197  PHE C CE2 1 
ATOM   7456  C  CZ  . PHE C  3  197 ? 87.662  332.457 183.577 1.00 35.27  ? 197  PHE C CZ  1 
ATOM   7457  N  N   . PHE C  3  198 ? 82.250  331.091 183.754 1.00 27.56  ? 198  PHE C N   1 
ATOM   7458  C  CA  . PHE C  3  198 ? 81.803  332.128 184.664 1.00 33.24  ? 198  PHE C CA  1 
ATOM   7459  C  C   . PHE C  3  198 ? 80.900  331.604 185.768 1.00 28.73  ? 198  PHE C C   1 
ATOM   7460  O  O   . PHE C  3  198 ? 80.970  332.130 186.879 1.00 29.94  ? 198  PHE C O   1 
ATOM   7461  C  CB  . PHE C  3  198 ? 81.123  333.252 183.887 1.00 33.24  ? 198  PHE C CB  1 
ATOM   7462  C  CG  . PHE C  3  198 ? 82.109  334.094 183.150 1.00 34.40  ? 198  PHE C CG  1 
ATOM   7463  C  CD1 . PHE C  3  198 ? 83.048  334.851 183.865 1.00 37.35  ? 198  PHE C CD1 1 
ATOM   7464  C  CD2 . PHE C  3  198 ? 82.192  334.050 181.767 1.00 27.33  ? 198  PHE C CD2 1 
ATOM   7465  C  CE1 . PHE C  3  198 ? 84.015  335.629 183.213 1.00 35.71  ? 198  PHE C CE1 1 
ATOM   7466  C  CE2 . PHE C  3  198 ? 83.199  334.807 181.099 1.00 26.56  ? 198  PHE C CE2 1 
ATOM   7467  C  CZ  . PHE C  3  198 ? 84.104  335.598 181.827 1.00 28.32  ? 198  PHE C CZ  1 
ATOM   7468  N  N   . VAL C  3  199 ? 80.067  330.596 185.524 1.00 26.67  ? 199  VAL C N   1 
ATOM   7469  C  CA  . VAL C  3  199 ? 79.225  330.132 186.649 1.00 28.56  ? 199  VAL C CA  1 
ATOM   7470  C  C   . VAL C  3  199 ? 80.069  329.386 187.684 1.00 27.41  ? 199  VAL C C   1 
ATOM   7471  O  O   . VAL C  3  199 ? 79.874  329.571 188.883 1.00 27.04  ? 199  VAL C O   1 
ATOM   7472  C  CB  . VAL C  3  199 ? 78.063  329.271 186.123 1.00 32.13  ? 199  VAL C CB  1 
ATOM   7473  C  CG1 . VAL C  3  199 ? 77.352  328.571 187.247 1.00 31.99  ? 199  VAL C CG1 1 
ATOM   7474  C  CG2 . VAL C  3  199 ? 77.068  330.194 185.341 1.00 27.05  ? 199  VAL C CG2 1 
ATOM   7475  N  N   . ALA C  3  200 ? 80.986  328.506 187.247 1.00 30.22  ? 200  ALA C N   1 
ATOM   7476  C  CA  . ALA C  3  200 ? 81.860  327.797 188.193 1.00 28.87  ? 200  ALA C CA  1 
ATOM   7477  C  C   . ALA C  3  200 ? 82.816  328.746 188.917 1.00 33.54  ? 200  ALA C C   1 
ATOM   7478  O  O   . ALA C  3  200 ? 82.909  328.718 190.156 1.00 31.72  ? 200  ALA C O   1 
ATOM   7479  C  CB  . ALA C  3  200 ? 82.654  326.691 187.497 1.00 25.63  ? 200  ALA C CB  1 
ATOM   7480  N  N   . THR C  3  201 ? 83.573  329.578 188.166 1.00 30.96  ? 201  THR C N   1 
ATOM   7481  C  CA  . THR C  3  201 ? 84.484  330.481 188.882 1.00 28.57  ? 201  THR C CA  1 
ATOM   7482  C  C   . THR C  3  201 ? 83.708  331.551 189.601 1.00 30.13  ? 201  THR C C   1 
ATOM   7483  O  O   . THR C  3  201 ? 84.227  332.162 190.547 1.00 30.62  ? 201  THR C O   1 
ATOM   7484  C  CB  . THR C  3  201 ? 85.514  331.162 187.943 1.00 28.47  ? 201  THR C CB  1 
ATOM   7485  O  OG1 . THR C  3  201 ? 84.863  332.094 187.028 1.00 31.52  ? 201  THR C OG1 1 
ATOM   7486  C  CG2 . THR C  3  201 ? 86.327  330.095 187.170 1.00 30.96  ? 201  THR C CG2 1 
ATOM   7487  N  N   . GLY C  3  202 ? 82.489  331.845 189.132 1.00 26.28  ? 202  GLY C N   1 
ATOM   7488  C  CA  . GLY C  3  202 ? 81.737  332.900 189.777 1.00 24.67  ? 202  GLY C CA  1 
ATOM   7489  C  C   . GLY C  3  202 ? 81.216  332.410 191.120 1.00 30.98  ? 202  GLY C C   1 
ATOM   7490  O  O   . GLY C  3  202 ? 81.279  333.135 192.115 1.00 31.29  ? 202  GLY C O   1 
ATOM   7491  N  N   . PHE C  3  203 ? 80.700  331.173 191.165 1.00 27.42  ? 203  PHE C N   1 
ATOM   7492  C  CA  . PHE C  3  203 ? 80.305  330.659 192.495 1.00 30.68  ? 203  PHE C CA  1 
ATOM   7493  C  C   . PHE C  3  203 ? 81.516  330.508 193.387 1.00 31.73  ? 203  PHE C C   1 
ATOM   7494  O  O   . PHE C  3  203 ? 81.436  330.708 194.602 1.00 29.00  ? 203  PHE C O   1 
ATOM   7495  C  CB  . PHE C  3  203 ? 79.577  329.323 192.401 1.00 27.42  ? 203  PHE C CB  1 
ATOM   7496  C  CG  . PHE C  3  203 ? 78.083  329.490 192.251 1.00 30.25  ? 203  PHE C CG  1 
ATOM   7497  C  CD1 . PHE C  3  203 ? 77.322  329.987 193.315 1.00 36.91  ? 203  PHE C CD1 1 
ATOM   7498  C  CD2 . PHE C  3  203 ? 77.444  329.181 191.063 1.00 32.73  ? 203  PHE C CD2 1 
ATOM   7499  C  CE1 . PHE C  3  203 ? 75.960  330.188 193.208 1.00 28.59  ? 203  PHE C CE1 1 
ATOM   7500  C  CE2 . PHE C  3  203 ? 76.060  329.384 190.951 1.00 32.14  ? 203  PHE C CE2 1 
ATOM   7501  C  CZ  . PHE C  3  203 ? 75.326  329.879 192.043 1.00 32.95  ? 203  PHE C CZ  1 
ATOM   7502  N  N   . HIS C  3  204 ? 82.653  330.104 192.811 1.00 26.05  ? 204  HIS C N   1 
ATOM   7503  C  CA  . HIS C  3  204 ? 83.852  330.038 193.643 1.00 30.32  ? 204  HIS C CA  1 
ATOM   7504  C  C   . HIS C  3  204 ? 84.195  331.428 194.196 1.00 31.02  ? 204  HIS C C   1 
ATOM   7505  O  O   . HIS C  3  204 ? 84.477  331.601 195.393 1.00 32.95  ? 204  HIS C O   1 
ATOM   7506  C  CB  . HIS C  3  204 ? 85.038  329.469 192.831 1.00 31.27  ? 204  HIS C CB  1 
ATOM   7507  C  CG  . HIS C  3  204 ? 86.295  329.476 193.616 1.00 29.51  ? 204  HIS C CG  1 
ATOM   7508  N  ND1 . HIS C  3  204 ? 87.231  330.491 193.528 1.00 28.77  ? 204  HIS C ND1 1 
ATOM   7509  C  CD2 . HIS C  3  204 ? 86.697  328.670 194.635 1.00 30.43  ? 204  HIS C CD2 1 
ATOM   7510  C  CE1 . HIS C  3  204 ? 88.181  330.265 194.427 1.00 29.55  ? 204  HIS C CE1 1 
ATOM   7511  N  NE2 . HIS C  3  204 ? 87.886  329.158 195.092 1.00 29.76  ? 204  HIS C NE2 1 
ATOM   7512  N  N   . GLY C  3  205 ? 84.128  332.446 193.337 1.00 33.72  ? 205  GLY C N   1 
ATOM   7513  C  CA  . GLY C  3  205 ? 84.408  333.820 193.776 1.00 26.96  ? 205  GLY C CA  1 
ATOM   7514  C  C   . GLY C  3  205 ? 83.502  334.280 194.917 1.00 31.28  ? 205  GLY C C   1 
ATOM   7515  O  O   . GLY C  3  205 ? 83.940  334.951 195.857 1.00 31.42  ? 205  GLY C O   1 
ATOM   7516  N  N   . LEU C  3  206 ? 82.217  333.966 194.821 1.00 31.30  ? 206  LEU C N   1 
ATOM   7517  C  CA  . LEU C  3  206 ? 81.284  334.254 195.893 1.00 31.77  ? 206  LEU C CA  1 
ATOM   7518  C  C   . LEU C  3  206 ? 81.727  333.559 197.166 1.00 34.86  ? 206  LEU C C   1 
ATOM   7519  O  O   . LEU C  3  206 ? 81.681  334.151 198.247 1.00 30.78  ? 206  LEU C O   1 
ATOM   7520  C  CB  . LEU C  3  206 ? 79.881  333.774 195.488 1.00 31.13  ? 206  LEU C CB  1 
ATOM   7521  C  CG  . LEU C  3  206 ? 78.895  333.808 196.646 1.00 43.57  ? 206  LEU C CG  1 
ATOM   7522  C  CD1 . LEU C  3  206 ? 78.795  335.243 197.100 1.00 42.80  ? 206  LEU C CD1 1 
ATOM   7523  C  CD2 . LEU C  3  206 ? 77.557  333.313 196.165 1.00 38.92  ? 206  LEU C CD2 1 
ATOM   7524  N  N   . HIS C  3  207 ? 82.173  332.298 197.056 1.00 32.37  ? 207  HIS C N   1 
ATOM   7525  C  CA  . HIS C  3  207 ? 82.642  331.595 198.262 1.00 33.70  ? 207  HIS C CA  1 
ATOM   7526  C  C   . HIS C  3  207 ? 83.917  332.217 198.824 1.00 34.44  ? 207  HIS C C   1 
ATOM   7527  O  O   . HIS C  3  207 ? 84.103  332.221 200.048 1.00 28.77  ? 207  HIS C O   1 
ATOM   7528  C  CB  . HIS C  3  207 ? 82.842  330.097 197.979 1.00 34.74  ? 207  HIS C CB  1 
ATOM   7529  C  CG  . HIS C  3  207 ? 81.557  329.332 197.964 1.00 36.42  ? 207  HIS C CG  1 
ATOM   7530  N  ND1 . HIS C  3  207 ? 80.634  329.466 196.947 1.00 38.57  ? 207  HIS C ND1 1 
ATOM   7531  C  CD2 . HIS C  3  207 ? 80.976  328.520 198.892 1.00 31.75  ? 207  HIS C CD2 1 
ATOM   7532  C  CE1 . HIS C  3  207 ? 79.572  328.724 197.212 1.00 46.33  ? 207  HIS C CE1 1 
ATOM   7533  N  NE2 . HIS C  3  207 ? 79.764  328.118 198.371 1.00 38.77  ? 207  HIS C NE2 1 
ATOM   7534  N  N   . VAL C  3  208 ? 84.786  332.775 197.964 1.00 29.50  ? 208  VAL C N   1 
ATOM   7535  C  CA  . VAL C  3  208 ? 85.975  333.492 198.456 1.00 34.95  ? 208  VAL C CA  1 
ATOM   7536  C  C   . VAL C  3  208 ? 85.548  334.732 199.242 1.00 35.18  ? 208  VAL C C   1 
ATOM   7537  O  O   . VAL C  3  208 ? 86.104  335.039 200.313 1.00 33.09  ? 208  VAL C O   1 
ATOM   7538  C  CB  . VAL C  3  208 ? 86.915  333.867 197.284 1.00 35.87  ? 208  VAL C CB  1 
ATOM   7539  C  CG1 . VAL C  3  208 ? 88.048  334.806 197.778 1.00 35.01  ? 208  VAL C CG1 1 
ATOM   7540  C  CG2 . VAL C  3  208 ? 87.532  332.617 196.707 1.00 30.52  ? 208  VAL C CG2 1 
ATOM   7541  N  N   . ILE C  3  209 ? 84.549  335.451 198.736 1.00 29.71  ? 209  ILE C N   1 
ATOM   7542  C  CA  . ILE C  3  209 ? 84.044  336.624 199.426 1.00 30.57  ? 209  ILE C CA  1 
ATOM   7543  C  C   . ILE C  3  209 ? 83.440  336.232 200.779 1.00 36.29  ? 209  ILE C C   1 
ATOM   7544  O  O   . ILE C  3  209 ? 83.680  336.894 201.790 1.00 30.52  ? 209  ILE C O   1 
ATOM   7545  C  CB  . ILE C  3  209 ? 83.051  337.381 198.533 1.00 35.21  ? 209  ILE C CB  1 
ATOM   7546  C  CG1 . ILE C  3  209 ? 83.827  338.087 197.409 1.00 34.68  ? 209  ILE C CG1 1 
ATOM   7547  C  CG2 . ILE C  3  209 ? 82.312  338.441 199.292 1.00 33.58  ? 209  ILE C CG2 1 
ATOM   7548  C  CD1 . ILE C  3  209 ? 82.916  338.541 196.262 1.00 36.50  ? 209  ILE C CD1 1 
ATOM   7549  N  N   . ILE C  3  210 ? 82.633  335.166 200.799 1.00 30.65  ? 210  ILE C N   1 
ATOM   7550  C  CA  . ILE C  3  210 ? 82.036  334.690 202.045 1.00 28.90  ? 210  ILE C CA  1 
ATOM   7551  C  C   . ILE C  3  210 ? 83.124  334.263 203.024 1.00 31.03  ? 210  ILE C C   1 
ATOM   7552  O  O   . ILE C  3  210 ? 83.066  334.554 204.216 1.00 31.76  ? 210  ILE C O   1 
ATOM   7553  C  CB  . ILE C  3  210 ? 81.079  333.518 201.766 1.00 31.46  ? 210  ILE C CB  1 
ATOM   7554  C  CG1 . ILE C  3  210 ? 79.819  334.045 201.076 1.00 33.42  ? 210  ILE C CG1 1 
ATOM   7555  C  CG2 . ILE C  3  210 ? 80.720  332.741 203.086 1.00 29.10  ? 210  ILE C CG2 1 
ATOM   7556  C  CD1 . ILE C  3  210 ? 79.002  332.913 200.504 1.00 38.46  ? 210  ILE C CD1 1 
ATOM   7557  N  N   . GLY C  3  211 ? 84.112  333.497 202.532 1.00 25.07  ? 211  GLY C N   1 
ATOM   7558  C  CA  . GLY C  3  211 ? 85.186  333.071 203.422 1.00 29.44  ? 211  GLY C CA  1 
ATOM   7559  C  C   . GLY C  3  211 ? 86.015  334.229 203.966 1.00 29.10  ? 211  GLY C C   1 
ATOM   7560  O  O   . GLY C  3  211 ? 86.460  334.194 205.118 1.00 30.50  ? 211  GLY C O   1 
ATOM   7561  N  N   . SER C  3  212 ? 86.272  335.243 203.127 1.00 30.35  ? 212  SER C N   1 
ATOM   7562  C  CA  . SER C  3  212 ? 87.050  336.405 203.574 1.00 26.67  ? 212  SER C CA  1 
ATOM   7563  C  C   . SER C  3  212 ? 86.264  337.149 204.636 1.00 29.61  ? 212  SER C C   1 
ATOM   7564  O  O   . SER C  3  212 ? 86.837  337.649 205.608 1.00 31.40  ? 212  SER C O   1 
ATOM   7565  C  CB  . SER C  3  212 ? 87.337  337.361 202.382 1.00 32.84  ? 212  SER C CB  1 
ATOM   7566  O  OG  . SER C  3  212 ? 88.193  336.711 201.445 1.00 32.49  ? 212  SER C OG  1 
ATOM   7567  N  N   . THR C  3  213 ? 84.945  337.277 204.416 1.00 31.12  ? 213  THR C N   1 
ATOM   7568  C  CA  . THR C  3  213 ? 84.080  337.909 205.426 1.00 31.20  ? 213  THR C CA  1 
ATOM   7569  C  C   . THR C  3  213 ? 84.170  337.161 206.736 1.00 34.10  ? 213  THR C C   1 
ATOM   7570  O  O   . THR C  3  213 ? 84.327  337.759 207.799 1.00 34.31  ? 213  THR C O   1 
ATOM   7571  C  CB  . THR C  3  213 ? 82.627  337.932 204.905 1.00 33.93  ? 213  THR C CB  1 
ATOM   7572  O  OG1 . THR C  3  213 ? 82.598  338.708 203.691 1.00 37.09  ? 213  THR C OG1 1 
ATOM   7573  C  CG2 . THR C  3  213 ? 81.679  338.527 205.912 1.00 31.63  ? 213  THR C CG2 1 
ATOM   7574  N  N   . PHE C  3  214 ? 84.090  335.840 206.666 1.00 28.68  ? 214  PHE C N   1 
ATOM   7575  C  CA  . PHE C  3  214 ? 84.197  335.025 207.875 1.00 27.82  ? 214  PHE C CA  1 
ATOM   7576  C  C   . PHE C  3  214 ? 85.542  335.261 208.572 1.00 30.62  ? 214  PHE C C   1 
ATOM   7577  O  O   . PHE C  3  214 ? 85.611  335.442 209.807 1.00 35.14  ? 214  PHE C O   1 
ATOM   7578  C  CB  . PHE C  3  214 ? 84.017  333.566 207.477 1.00 25.41  ? 214  PHE C CB  1 
ATOM   7579  C  CG  . PHE C  3  214 ? 83.641  332.636 208.610 1.00 31.06  ? 214  PHE C CG  1 
ATOM   7580  C  CD1 . PHE C  3  214 ? 83.550  333.069 209.914 1.00 33.46  ? 214  PHE C CD1 1 
ATOM   7581  C  CD2 . PHE C  3  214 ? 83.447  331.276 208.346 1.00 28.86  ? 214  PHE C CD2 1 
ATOM   7582  C  CE1 . PHE C  3  214 ? 83.260  332.186 210.943 1.00 33.13  ? 214  PHE C CE1 1 
ATOM   7583  C  CE2 . PHE C  3  214 ? 83.133  330.379 209.387 1.00 28.39  ? 214  PHE C CE2 1 
ATOM   7584  C  CZ  . PHE C  3  214 ? 83.059  330.862 210.704 1.00 32.39  ? 214  PHE C CZ  1 
ATOM   7585  N  N   . LEU C  3  215 ? 86.628  335.280 207.806 1.00 27.60  ? 215  LEU C N   1 
ATOM   7586  C  CA  . LEU C  3  215 ? 87.924  335.539 208.414 1.00 27.89  ? 215  LEU C CA  1 
ATOM   7587  C  C   . LEU C  3  215 ? 87.934  336.919 209.034 1.00 32.42  ? 215  LEU C C   1 
ATOM   7588  O  O   . LEU C  3  215 ? 88.549  337.141 210.085 1.00 31.45  ? 215  LEU C O   1 
ATOM   7589  C  CB  . LEU C  3  215 ? 89.043  335.423 207.375 1.00 27.95  ? 215  LEU C CB  1 
ATOM   7590  C  CG  . LEU C  3  215 ? 89.328  334.003 206.853 1.00 36.30  ? 215  LEU C CG  1 
ATOM   7591  C  CD1 . LEU C  3  215 ? 90.371  334.120 205.729 1.00 37.37  ? 215  LEU C CD1 1 
ATOM   7592  C  CD2 . LEU C  3  215 ? 89.815  333.107 207.982 1.00 34.15  ? 215  LEU C CD2 1 
ATOM   7593  N  N   . ILE C  3  216 ? 87.271  337.871 208.391 1.00 30.54  ? 216  ILE C N   1 
ATOM   7594  C  CA  . ILE C  3  216 ? 87.255  339.224 208.959 1.00 26.28  ? 216  ILE C CA  1 
ATOM   7595  C  C   . ILE C  3  216 ? 86.470  339.255 210.282 1.00 33.60  ? 216  ILE C C   1 
ATOM   7596  O  O   . ILE C  3  216 ? 86.833  339.982 211.238 1.00 33.96  ? 216  ILE C O   1 
ATOM   7597  C  CB  . ILE C  3  216 ? 86.677  340.198 207.921 1.00 35.47  ? 216  ILE C CB  1 
ATOM   7598  C  CG1 . ILE C  3  216 ? 87.712  340.481 206.832 1.00 33.19  ? 216  ILE C CG1 1 
ATOM   7599  C  CG2 . ILE C  3  216 ? 86.278  341.549 208.600 1.00 30.03  ? 216  ILE C CG2 1 
ATOM   7600  C  CD1 . ILE C  3  216 ? 87.023  341.118 205.595 1.00 33.20  ? 216  ILE C CD1 1 
ATOM   7601  N  N   . VAL C  3  217 ? 85.373  338.492 210.352 1.00 34.90  ? 217  VAL C N   1 
ATOM   7602  C  CA  . VAL C  3  217 ? 84.655  338.347 211.628 1.00 37.01  ? 217  VAL C CA  1 
ATOM   7603  C  C   . VAL C  3  217 ? 85.608  337.823 212.703 1.00 34.09  ? 217  VAL C C   1 
ATOM   7604  O  O   . VAL C  3  217 ? 85.718  338.404 213.780 1.00 34.26  ? 217  VAL C O   1 
ATOM   7605  C  CB  . VAL C  3  217 ? 83.416  337.433 211.475 1.00 32.92  ? 217  VAL C CB  1 
ATOM   7606  C  CG1 . VAL C  3  217 ? 82.804  337.039 212.904 1.00 33.05  ? 217  VAL C CG1 1 
ATOM   7607  C  CG2 . VAL C  3  217 ? 82.332  338.092 210.560 1.00 38.63  ? 217  VAL C CG2 1 
ATOM   7608  N  N   . CYS C  3  218 ? 86.321  336.713 212.420 1.00 35.42  ? 218  CYS C N   1 
ATOM   7609  C  CA  . CYS C  3  218 ? 87.330  336.208 213.365 1.00 30.82  ? 218  CYS C CA  1 
ATOM   7610  C  C   . CYS C  3  218 ? 88.380  337.262 213.713 1.00 31.17  ? 218  CYS C C   1 
ATOM   7611  O  O   . CYS C  3  218 ? 88.861  337.320 214.847 1.00 33.95  ? 218  CYS C O   1 
ATOM   7612  C  CB  . CYS C  3  218 ? 88.020  334.971 212.784 1.00 35.11  ? 218  CYS C CB  1 
ATOM   7613  S  SG  . CYS C  3  218 ? 86.841  333.630 212.496 1.00 38.34  ? 218  CYS C SG  1 
ATOM   7614  N  N   . PHE C  3  219 ? 88.769  338.091 212.745 1.00 31.96  ? 219  PHE C N   1 
ATOM   7615  C  CA  . PHE C  3  219 ? 89.765  339.102 213.048 1.00 35.83  ? 219  PHE C CA  1 
ATOM   7616  C  C   . PHE C  3  219 ? 89.246  340.066 214.110 1.00 36.64  ? 219  PHE C C   1 
ATOM   7617  O  O   . PHE C  3  219 ? 89.947  340.389 215.074 1.00 32.01  ? 219  PHE C O   1 
ATOM   7618  C  CB  . PHE C  3  219 ? 90.131  339.861 211.772 1.00 33.44  ? 219  PHE C CB  1 
ATOM   7619  C  CG  . PHE C  3  219 ? 91.261  340.821 211.976 1.00 31.83  ? 219  PHE C CG  1 
ATOM   7620  C  CD1 . PHE C  3  219 ? 92.595  340.368 211.885 1.00 31.67  ? 219  PHE C CD1 1 
ATOM   7621  C  CD2 . PHE C  3  219 ? 91.024  342.170 212.248 1.00 41.11  ? 219  PHE C CD2 1 
ATOM   7622  C  CE1 . PHE C  3  219 ? 93.679  341.240 212.097 1.00 37.91  ? 219  PHE C CE1 1 
ATOM   7623  C  CE2 . PHE C  3  219 ? 92.101  343.051 212.426 1.00 51.73  ? 219  PHE C CE2 1 
ATOM   7624  C  CZ  . PHE C  3  219 ? 93.434  342.581 212.353 1.00 39.31  ? 219  PHE C CZ  1 
ATOM   7625  N  N   . PHE C  3  220 ? 88.005  340.524 213.966 1.00 35.25  ? 220  PHE C N   1 
ATOM   7626  C  CA  . PHE C  3  220 ? 87.506  341.448 214.982 1.00 38.28  ? 220  PHE C CA  1 
ATOM   7627  C  C   . PHE C  3  220 ? 87.172  340.745 216.300 1.00 36.46  ? 220  PHE C C   1 
ATOM   7628  O  O   . PHE C  3  220 ? 87.378  341.330 217.370 1.00 34.82  ? 220  PHE C O   1 
ATOM   7629  C  CB  . PHE C  3  220 ? 86.297  342.226 214.441 1.00 30.84  ? 220  PHE C CB  1 
ATOM   7630  C  CG  . PHE C  3  220 ? 86.694  343.312 213.504 1.00 47.92  ? 220  PHE C CG  1 
ATOM   7631  C  CD1 . PHE C  3  220 ? 87.230  344.482 213.994 1.00 43.60  ? 220  PHE C CD1 1 
ATOM   7632  C  CD2 . PHE C  3  220 ? 86.576  343.148 212.135 1.00 40.39  ? 220  PHE C CD2 1 
ATOM   7633  C  CE1 . PHE C  3  220 ? 87.628  345.510 213.131 1.00 58.73  ? 220  PHE C CE1 1 
ATOM   7634  C  CE2 . PHE C  3  220 ? 86.963  344.163 211.249 1.00 45.98  ? 220  PHE C CE2 1 
ATOM   7635  C  CZ  . PHE C  3  220 ? 87.492  345.347 211.749 1.00 55.49  ? 220  PHE C CZ  1 
ATOM   7636  N  N   . ARG C  3  221 ? 86.695  339.502 216.268 1.00 34.84  ? 221  ARG C N   1 
ATOM   7637  C  CA  . ARG C  3  221 ? 86.555  338.781 217.529 1.00 35.73  ? 221  ARG C CA  1 
ATOM   7638  C  C   . ARG C  3  221 ? 87.901  338.647 218.227 1.00 37.55  ? 221  ARG C C   1 
ATOM   7639  O  O   . ARG C  3  221 ? 87.993  338.799 219.445 1.00 38.53  ? 221  ARG C O   1 
ATOM   7640  C  CB  . ARG C  3  221 ? 85.879  337.419 217.290 1.00 31.25  ? 221  ARG C CB  1 
ATOM   7641  C  CG  . ARG C  3  221 ? 84.383  337.562 216.763 1.00 28.08  ? 221  ARG C CG  1 
ATOM   7642  C  CD  . ARG C  3  221 ? 83.788  336.148 216.737 1.00 29.57  ? 221  ARG C CD  1 
ATOM   7643  N  NE  . ARG C  3  221 ? 83.655  335.681 218.125 1.00 28.59  ? 221  ARG C NE  1 
ATOM   7644  C  CZ  . ARG C  3  221 ? 83.622  334.394 218.441 1.00 33.85  ? 221  ARG C CZ  1 
ATOM   7645  N  NH1 . ARG C  3  221 ? 83.739  333.470 217.461 1.00 28.34  ? 221  ARG C NH1 1 
ATOM   7646  N  NH2 . ARG C  3  221 ? 83.453  334.031 219.715 1.00 27.33  ? 221  ARG C NH2 1 
ATOM   7647  N  N   . GLN C  3  222 ? 88.972  338.411 217.469 1.00 35.24  ? 222  GLN C N   1 
ATOM   7648  C  CA  . GLN C  3  222 ? 90.294  338.261 218.080 1.00 31.33  ? 222  GLN C CA  1 
ATOM   7649  C  C   . GLN C  3  222 ? 90.739  339.580 218.702 1.00 33.91  ? 222  GLN C C   1 
ATOM   7650  O  O   . GLN C  3  222 ? 91.226  339.607 219.839 1.00 35.55  ? 222  GLN C O   1 
ATOM   7651  C  CB  . GLN C  3  222 ? 91.316  337.775 217.016 1.00 33.56  ? 222  GLN C CB  1 
ATOM   7652  C  CG  . GLN C  3  222 ? 92.760  337.806 217.501 1.00 33.98  ? 222  GLN C CG  1 
ATOM   7653  C  CD  . GLN C  3  222 ? 93.081  336.871 218.704 1.00 30.53  ? 222  GLN C CD  1 
ATOM   7654  O  OE1 . GLN C  3  222 ? 92.313  336.009 219.088 1.00 35.74  ? 222  GLN C OE1 1 
ATOM   7655  N  NE2 . GLN C  3  222 ? 94.294  337.041 219.259 1.00 31.86  ? 222  GLN C NE2 1 
ATOM   7656  N  N   . LEU C  3  223 ? 90.555  340.695 217.970 1.00 36.62  ? 223  LEU C N   1 
ATOM   7657  C  CA  . LEU C  3  223 ? 90.885  342.006 218.525 1.00 40.93  ? 223  LEU C CA  1 
ATOM   7658  C  C   . LEU C  3  223 ? 90.174  342.258 219.841 1.00 38.54  ? 223  LEU C C   1 
ATOM   7659  O  O   . LEU C  3  223 ? 90.731  342.897 220.732 1.00 36.97  ? 223  LEU C O   1 
ATOM   7660  C  CB  . LEU C  3  223 ? 90.479  343.117 217.587 1.00 37.29  ? 223  LEU C CB  1 
ATOM   7661  C  CG  . LEU C  3  223 ? 91.397  343.421 216.461 1.00 50.14  ? 223  LEU C CG  1 
ATOM   7662  C  CD1 . LEU C  3  223 ? 90.665  344.506 215.772 1.00 46.14  ? 223  LEU C CD1 1 
ATOM   7663  C  CD2 . LEU C  3  223 ? 92.751  343.908 217.026 1.00 41.05  ? 223  LEU C CD2 1 
ATOM   7664  N  N   . LYS C  3  224 ? 88.925  341.792 219.965 1.00 34.10  ? 224  LYS C N   1 
ATOM   7665  C  CA  . LYS C  3  224 ? 88.137  341.908 221.198 1.00 33.03  ? 224  LYS C CA  1 
ATOM   7666  C  C   . LYS C  3  224 ? 88.376  340.786 222.201 1.00 36.55  ? 224  LYS C C   1 
ATOM   7667  O  O   . LYS C  3  224 ? 87.599  340.682 223.158 1.00 38.84  ? 224  LYS C O   1 
ATOM   7668  C  CB  . LYS C  3  224 ? 86.628  341.943 220.860 1.00 40.64  ? 224  LYS C CB  1 
ATOM   7669  C  CG  . LYS C  3  224 ? 86.203  343.108 220.009 1.00 45.27  ? 224  LYS C CG  1 
ATOM   7670  C  CD  . LYS C  3  224 ? 84.699  343.034 219.792 1.00 95.46  ? 224  LYS C CD  1 
ATOM   7671  C  CE  . LYS C  3  224 ? 84.226  343.793 218.564 1.00 60.94  ? 224  LYS C CE  1 
ATOM   7672  N  NZ  . LYS C  3  224 ? 84.268  345.265 218.741 1.00 176.45 ? 224  LYS C NZ  1 
ATOM   7673  N  N   . PHE C  3  225 ? 89.415  339.956 222.008 1.00 33.09  ? 225  PHE C N   1 
ATOM   7674  C  CA  . PHE C  3  225 ? 89.844  338.912 222.964 1.00 33.03  ? 225  PHE C CA  1 
ATOM   7675  C  C   . PHE C  3  225 ? 88.819  337.791 223.134 1.00 40.81  ? 225  PHE C C   1 
ATOM   7676  O  O   . PHE C  3  225 ? 88.825  337.113 224.152 1.00 32.64  ? 225  PHE C O   1 
ATOM   7677  C  CB  . PHE C  3  225 ? 90.166  339.493 224.368 1.00 36.08  ? 225  PHE C CB  1 
ATOM   7678  C  CG  . PHE C  3  225 ? 91.291  340.496 224.363 1.00 33.42  ? 225  PHE C CG  1 
ATOM   7679  C  CD1 . PHE C  3  225 ? 91.044  341.824 223.975 1.00 40.27  ? 225  PHE C CD1 1 
ATOM   7680  C  CD2 . PHE C  3  225 ? 92.603  340.085 224.629 1.00 31.10  ? 225  PHE C CD2 1 
ATOM   7681  C  CE1 . PHE C  3  225 ? 92.089  342.770 223.937 1.00 37.45  ? 225  PHE C CE1 1 
ATOM   7682  C  CE2 . PHE C  3  225 ? 93.665  341.001 224.611 1.00 38.26  ? 225  PHE C CE2 1 
ATOM   7683  C  CZ  . PHE C  3  225 ? 93.412  342.352 224.259 1.00 39.65  ? 225  PHE C CZ  1 
ATOM   7684  N  N   . HIS C  3  226 ? 87.955  337.504 222.151 1.00 36.00  ? 226  HIS C N   1 
ATOM   7685  C  CA  . HIS C  3  226 ? 86.955  336.451 222.380 1.00 31.95  ? 226  HIS C CA  1 
ATOM   7686  C  C   . HIS C  3  226 ? 87.586  335.073 222.466 1.00 34.05  ? 226  HIS C C   1 
ATOM   7687  O  O   . HIS C  3  226 ? 87.039  334.184 223.130 1.00 31.87  ? 226  HIS C O   1 
ATOM   7688  C  CB  . HIS C  3  226 ? 85.908  336.393 221.253 1.00 29.45  ? 226  HIS C CB  1 
ATOM   7689  C  CG  . HIS C  3  226 ? 85.015  337.579 221.212 1.00 38.05  ? 226  HIS C CG  1 
ATOM   7690  N  ND1 . HIS C  3  226 ? 83.977  337.698 220.312 1.00 32.90  ? 226  HIS C ND1 1 
ATOM   7691  C  CD2 . HIS C  3  226 ? 85.002  338.701 221.962 1.00 35.74  ? 226  HIS C CD2 1 
ATOM   7692  C  CE1 . HIS C  3  226 ? 83.366  338.853 220.513 1.00 39.72  ? 226  HIS C CE1 1 
ATOM   7693  N  NE2 . HIS C  3  226 ? 83.966  339.476 221.513 1.00 36.14  ? 226  HIS C NE2 1 
ATOM   7694  N  N   . PHE C  3  227 ? 88.649  334.835 221.697 1.00 32.88  ? 227  PHE C N   1 
ATOM   7695  C  CA  . PHE C  3  227 ? 89.168  333.479 221.559 1.00 32.18  ? 227  PHE C CA  1 
ATOM   7696  C  C   . PHE C  3  227 ? 90.114  333.223 222.694 1.00 40.88  ? 227  PHE C C   1 
ATOM   7697  O  O   . PHE C  3  227 ? 90.944  334.080 222.989 1.00 32.07  ? 227  PHE C O   1 
ATOM   7698  C  CB  . PHE C  3  227 ? 89.932  333.285 220.242 1.00 30.28  ? 227  PHE C CB  1 
ATOM   7699  C  CG  . PHE C  3  227 ? 89.074  333.481 218.997 1.00 33.58  ? 227  PHE C CG  1 
ATOM   7700  C  CD1 . PHE C  3  227 ? 87.880  332.795 218.861 1.00 35.12  ? 227  PHE C CD1 1 
ATOM   7701  C  CD2 . PHE C  3  227 ? 89.508  334.313 217.954 1.00 30.22  ? 227  PHE C CD2 1 
ATOM   7702  C  CE1 . PHE C  3  227 ? 87.102  332.913 217.641 1.00 32.55  ? 227  PHE C CE1 1 
ATOM   7703  C  CE2 . PHE C  3  227 ? 88.739  334.442 216.761 1.00 29.44  ? 227  PHE C CE2 1 
ATOM   7704  C  CZ  . PHE C  3  227 ? 87.542  333.750 216.617 1.00 33.24  ? 227  PHE C CZ  1 
ATOM   7705  N  N   . THR C  3  228 ? 90.037  332.035 223.281 1.00 30.56  ? 228  THR C N   1 
ATOM   7706  C  CA  . THR C  3  228 ? 91.119  331.577 224.151 1.00 30.78  ? 228  THR C CA  1 
ATOM   7707  C  C   . THR C  3  228 ? 92.056  330.692 223.336 1.00 32.77  ? 228  THR C C   1 
ATOM   7708  O  O   . THR C  3  228 ? 91.791  330.335 222.184 1.00 33.44  ? 228  THR C O   1 
ATOM   7709  C  CB  . THR C  3  228 ? 90.586  330.797 225.363 1.00 36.98  ? 228  THR C CB  1 
ATOM   7710  O  OG1 . THR C  3  228 ? 90.155  329.519 224.911 1.00 33.82  ? 228  THR C OG1 1 
ATOM   7711  C  CG2 . THR C  3  228 ? 89.421  331.540 226.037 1.00 32.89  ? 228  THR C CG2 1 
ATOM   7712  N  N   . SER C  3  229 ? 93.170  330.352 223.949 1.00 30.00  ? 229  SER C N   1 
ATOM   7713  C  CA  . SER C  3  229 ? 94.168  329.545 223.271 1.00 31.07  ? 229  SER C CA  1 
ATOM   7714  C  C   . SER C  3  229 ? 93.682  328.118 223.055 1.00 37.96  ? 229  SER C C   1 
ATOM   7715  O  O   . SER C  3  229 ? 94.252  327.390 222.219 1.00 34.68  ? 229  SER C O   1 
ATOM   7716  C  CB  . SER C  3  229 ? 95.486  329.584 224.076 1.00 33.30  ? 229  SER C CB  1 
ATOM   7717  O  OG  . SER C  3  229 ? 95.229  329.125 225.391 1.00 35.84  ? 229  SER C OG  1 
ATOM   7718  N  N   . ASN C  3  230 ? 92.648  327.698 223.773 1.00 32.34  ? 230  ASN C N   1 
ATOM   7719  C  CA  . ASN C  3  230 ? 92.080  326.365 223.576 1.00 32.85  ? 230  ASN C CA  1 
ATOM   7720  C  C   . ASN C  3  230 ? 90.661  326.350 223.017 1.00 34.52  ? 230  ASN C C   1 
ATOM   7721  O  O   . ASN C  3  230 ? 90.178  325.274 222.675 1.00 36.47  ? 230  ASN C O   1 
ATOM   7722  C  CB  . ASN C  3  230 ? 92.025  325.585 224.890 1.00 36.22  ? 230  ASN C CB  1 
ATOM   7723  C  CG  . ASN C  3  230 ? 92.605  324.235 224.760 1.00 80.67  ? 230  ASN C CG  1 
ATOM   7724  O  OD1 . ASN C  3  230 ? 91.885  323.261 224.585 1.00 81.39  ? 230  ASN C OD1 1 
ATOM   7725  N  ND2 . ASN C  3  230 ? 93.930  324.154 224.829 1.00 132.83 ? 230  ASN C ND2 1 
ATOM   7726  N  N   . HIS C  3  231 ? 89.948  327.475 222.988 1.00 32.19  ? 231  HIS C N   1 
ATOM   7727  C  CA  . HIS C  3  231 ? 88.537  327.455 222.580 1.00 26.39  ? 231  HIS C CA  1 
ATOM   7728  C  C   . HIS C  3  231 ? 88.329  328.521 221.537 1.00 31.01  ? 231  HIS C C   1 
ATOM   7729  O  O   . HIS C  3  231 ? 88.352  329.711 221.849 1.00 31.85  ? 231  HIS C O   1 
ATOM   7730  C  CB  . HIS C  3  231 ? 87.600  327.670 223.808 1.00 26.21  ? 231  HIS C CB  1 
ATOM   7731  C  CG  . HIS C  3  231 ? 86.146  327.368 223.530 1.00 34.76  ? 231  HIS C CG  1 
ATOM   7732  N  ND1 . HIS C  3  231 ? 85.240  327.020 224.517 1.00 32.38  ? 231  HIS C ND1 1 
ATOM   7733  C  CD2 . HIS C  3  231 ? 85.443  327.375 222.366 1.00 32.05  ? 231  HIS C CD2 1 
ATOM   7734  C  CE1 . HIS C  3  231 ? 84.057  326.776 223.959 1.00 33.18  ? 231  HIS C CE1 1 
ATOM   7735  N  NE2 . HIS C  3  231 ? 84.145  327.020 222.665 1.00 33.69  ? 231  HIS C NE2 1 
ATOM   7736  N  N   . HIS C  3  232 ? 88.143  328.116 220.265 1.00 28.48  ? 232  HIS C N   1 
ATOM   7737  C  CA  . HIS C  3  232 ? 88.056  329.141 219.247 1.00 30.32  ? 232  HIS C CA  1 
ATOM   7738  C  C   . HIS C  3  232 ? 87.434  328.533 218.010 1.00 28.78  ? 232  HIS C C   1 
ATOM   7739  O  O   . HIS C  3  232 ? 88.050  328.490 216.929 1.00 29.73  ? 232  HIS C O   1 
ATOM   7740  C  CB  . HIS C  3  232 ? 89.438  329.704 218.902 1.00 29.89  ? 232  HIS C CB  1 
ATOM   7741  C  CG  . HIS C  3  232 ? 90.510  328.676 218.881 1.00 30.37  ? 232  HIS C CG  1 
ATOM   7742  N  ND1 . HIS C  3  232 ? 91.453  328.592 219.889 1.00 36.44  ? 232  HIS C ND1 1 
ATOM   7743  C  CD2 . HIS C  3  232 ? 90.813  327.697 217.995 1.00 37.41  ? 232  HIS C CD2 1 
ATOM   7744  C  CE1 . HIS C  3  232 ? 92.279  327.588 219.626 1.00 37.99  ? 232  HIS C CE1 1 
ATOM   7745  N  NE2 . HIS C  3  232 ? 91.922  327.040 218.482 1.00 37.55  ? 232  HIS C NE2 1 
ATOM   7746  N  N   . PHE C  3  233 ? 86.246  327.979 218.191 1.00 31.43  ? 233  PHE C N   1 
ATOM   7747  C  CA  . PHE C  3  233 ? 85.748  327.171 217.093 1.00 30.12  ? 233  PHE C CA  1 
ATOM   7748  C  C   . PHE C  3  233 ? 85.412  328.028 215.887 1.00 35.47  ? 233  PHE C C   1 
ATOM   7749  O  O   . PHE C  3  233 ? 85.552  327.557 214.747 1.00 33.11  ? 233  PHE C O   1 
ATOM   7750  C  CB  . PHE C  3  233 ? 84.516  326.360 217.493 1.00 32.03  ? 233  PHE C CB  1 
ATOM   7751  C  CG  . PHE C  3  233 ? 84.021  325.541 216.330 1.00 30.17  ? 233  PHE C CG  1 
ATOM   7752  C  CD1 . PHE C  3  233 ? 84.844  324.558 215.821 1.00 30.31  ? 233  PHE C CD1 1 
ATOM   7753  C  CD2 . PHE C  3  233 ? 82.842  325.864 215.698 1.00 32.51  ? 233  PHE C CD2 1 
ATOM   7754  C  CE1 . PHE C  3  233 ? 84.436  323.861 214.583 1.00 33.67  ? 233  PHE C CE1 1 
ATOM   7755  C  CE2 . PHE C  3  233 ? 82.410  325.190 214.542 1.00 30.32  ? 233  PHE C CE2 1 
ATOM   7756  C  CZ  . PHE C  3  233 ? 83.205  324.159 214.030 1.00 28.28  ? 233  PHE C CZ  1 
ATOM   7757  N  N   . GLY C  3  234 ? 84.967  329.271 216.096 1.00 31.06  ? 234  GLY C N   1 
ATOM   7758  C  CA  . GLY C  3  234 ? 84.656  330.096 214.930 1.00 32.20  ? 234  GLY C CA  1 
ATOM   7759  C  C   . GLY C  3  234 ? 85.872  330.256 214.024 1.00 34.15  ? 234  GLY C C   1 
ATOM   7760  O  O   . GLY C  3  234 ? 85.750  330.246 212.796 1.00 31.56  ? 234  GLY C O   1 
ATOM   7761  N  N   . PHE C  3  235 ? 87.054  330.409 214.633 1.00 30.83  ? 235  PHE C N   1 
ATOM   7762  C  CA  . PHE C  3  235 ? 88.295  330.497 213.868 1.00 29.08  ? 235  PHE C CA  1 
ATOM   7763  C  C   . PHE C  3  235 ? 88.577  329.182 213.166 1.00 34.12  ? 235  PHE C C   1 
ATOM   7764  O  O   . PHE C  3  235 ? 88.965  329.185 212.014 1.00 30.24  ? 235  PHE C O   1 
ATOM   7765  C  CB  . PHE C  3  235 ? 89.496  330.922 214.775 1.00 28.50  ? 235  PHE C CB  1 
ATOM   7766  C  CG  . PHE C  3  235 ? 90.825  330.868 214.029 1.00 32.09  ? 235  PHE C CG  1 
ATOM   7767  C  CD1 . PHE C  3  235 ? 91.251  331.956 213.272 1.00 41.29  ? 235  PHE C CD1 1 
ATOM   7768  C  CD2 . PHE C  3  235 ? 91.533  329.665 213.951 1.00 35.53  ? 235  PHE C CD2 1 
ATOM   7769  C  CE1 . PHE C  3  235 ? 92.436  331.901 212.509 1.00 36.33  ? 235  PHE C CE1 1 
ATOM   7770  C  CE2 . PHE C  3  235 ? 92.693  329.564 213.145 1.00 38.51  ? 235  PHE C CE2 1 
ATOM   7771  C  CZ  . PHE C  3  235 ? 93.148  330.696 212.431 1.00 38.52  ? 235  PHE C CZ  1 
ATOM   7772  N  N   . GLU C  3  236 ? 88.384  328.038 213.830 1.00 28.35  ? 236  GLU C N   1 
ATOM   7773  C  CA  . GLU C  3  236 ? 88.646  326.763 213.173 1.00 28.63  ? 236  GLU C CA  1 
ATOM   7774  C  C   . GLU C  3  236 ? 87.719  326.542 211.975 1.00 28.13  ? 236  GLU C C   1 
ATOM   7775  O  O   . GLU C  3  236 ? 88.155  326.101 210.888 1.00 29.95  ? 236  GLU C O   1 
ATOM   7776  C  CB  . GLU C  3  236 ? 88.415  325.636 214.186 1.00 29.70  ? 236  GLU C CB  1 
ATOM   7777  C  CG  . GLU C  3  236 ? 89.579  325.492 215.123 1.00 43.74  ? 236  GLU C CG  1 
ATOM   7778  C  CD  . GLU C  3  236 ? 89.349  324.326 216.020 1.00 143.01 ? 236  GLU C CD  1 
ATOM   7779  O  OE1 . GLU C  3  236 ? 88.812  324.509 217.136 1.00 48.51  ? 236  GLU C OE1 1 
ATOM   7780  O  OE2 . GLU C  3  236 ? 89.635  323.210 215.560 1.00 50.18  ? 236  GLU C OE2 1 
ATOM   7781  N  N   . ALA C  3  237 ? 86.427  326.839 212.161 1.00 28.40  ? 237  ALA C N   1 
ATOM   7782  C  CA  . ALA C  3  237 ? 85.463  326.697 211.075 1.00 29.40  ? 237  ALA C CA  1 
ATOM   7783  C  C   . ALA C  3  237 ? 85.829  327.609 209.911 1.00 27.57  ? 237  ALA C C   1 
ATOM   7784  O  O   . ALA C  3  237 ? 85.678  327.231 208.735 1.00 29.76  ? 237  ALA C O   1 
ATOM   7785  C  CB  . ALA C  3  237 ? 84.045  327.015 211.605 1.00 25.39  ? 237  ALA C CB  1 
ATOM   7786  N  N   . ALA C  3  238 ? 86.252  328.843 210.195 1.00 28.07  ? 238  ALA C N   1 
ATOM   7787  C  CA  . ALA C  3  238 ? 86.582  329.730 209.075 1.00 25.71  ? 238  ALA C CA  1 
ATOM   7788  C  C   . ALA C  3  238 ? 87.820  329.225 208.325 1.00 32.17  ? 238  ALA C C   1 
ATOM   7789  O  O   . ALA C  3  238 ? 87.903  329.372 207.076 1.00 29.54  ? 238  ALA C O   1 
ATOM   7790  C  CB  . ALA C  3  238 ? 86.802  331.186 209.578 1.00 29.08  ? 238  ALA C CB  1 
ATOM   7791  N  N   . ALA C  3  239 ? 88.743  328.563 209.061 1.00 31.32  ? 239  ALA C N   1 
ATOM   7792  C  CA  . ALA C  3  239 ? 89.949  327.975 208.465 1.00 30.12  ? 239  ALA C CA  1 
ATOM   7793  C  C   . ALA C  3  239 ? 89.608  326.756 207.619 1.00 35.90  ? 239  ALA C C   1 
ATOM   7794  O  O   . ALA C  3  239 ? 90.118  326.612 206.494 1.00 29.36  ? 239  ALA C O   1 
ATOM   7795  C  CB  . ALA C  3  239 ? 90.982  327.602 209.581 1.00 27.64  ? 239  ALA C CB  1 
ATOM   7796  N  N   . TRP C  3  240 ? 88.712  325.899 208.095 1.00 26.10  ? 240  TRP C N   1 
ATOM   7797  C  CA  . TRP C  3  240 ? 88.279  324.764 207.283 1.00 27.27  ? 240  TRP C CA  1 
ATOM   7798  C  C   . TRP C  3  240 ? 87.582  325.235 206.018 1.00 29.95  ? 240  TRP C C   1 
ATOM   7799  O  O   . TRP C  3  240 ? 87.838  324.711 204.936 1.00 29.57  ? 240  TRP C O   1 
ATOM   7800  C  CB  . TRP C  3  240 ? 87.301  323.854 208.040 1.00 24.86  ? 240  TRP C CB  1 
ATOM   7801  C  CG  . TRP C  3  240 ? 87.831  323.253 209.242 1.00 30.82  ? 240  TRP C CG  1 
ATOM   7802  C  CD1 . TRP C  3  240 ? 89.136  323.222 209.644 1.00 34.60  ? 240  TRP C CD1 1 
ATOM   7803  C  CD2 . TRP C  3  240 ? 87.062  322.564 210.240 1.00 31.72  ? 240  TRP C CD2 1 
ATOM   7804  N  NE1 . TRP C  3  240 ? 89.223  322.515 210.829 1.00 36.10  ? 240  TRP C NE1 1 
ATOM   7805  C  CE2 . TRP C  3  240 ? 87.970  322.112 211.220 1.00 42.70  ? 240  TRP C CE2 1 
ATOM   7806  C  CE3 . TRP C  3  240 ? 85.682  322.297 210.399 1.00 32.98  ? 240  TRP C CE3 1 
ATOM   7807  C  CZ2 . TRP C  3  240 ? 87.549  321.427 212.397 1.00 34.50  ? 240  TRP C CZ2 1 
ATOM   7808  C  CZ3 . TRP C  3  240 ? 85.235  321.565 211.557 1.00 31.83  ? 240  TRP C CZ3 1 
ATOM   7809  C  CH2 . TRP C  3  240 ? 86.191  321.138 212.539 1.00 32.73  ? 240  TRP C CH2 1 
ATOM   7810  N  N   . TYR C  3  241 ? 86.721  326.238 206.151 1.00 26.89  ? 241  TYR C N   1 
ATOM   7811  C  CA  . TYR C  3  241 ? 86.007  326.778 205.001 1.00 27.60  ? 241  TYR C CA  1 
ATOM   7812  C  C   . TYR C  3  241 ? 86.995  327.400 204.002 1.00 34.70  ? 241  TYR C C   1 
ATOM   7813  O  O   . TYR C  3  241 ? 86.851  327.265 202.777 1.00 31.18  ? 241  TYR C O   1 
ATOM   7814  C  CB  . TYR C  3  241 ? 85.028  327.822 205.512 1.00 26.75  ? 241  TYR C CB  1 
ATOM   7815  C  CG  . TYR C  3  241 ? 84.037  328.226 204.478 1.00 31.76  ? 241  TYR C CG  1 
ATOM   7816  C  CD1 . TYR C  3  241 ? 82.965  327.397 204.165 1.00 39.73  ? 241  TYR C CD1 1 
ATOM   7817  C  CD2 . TYR C  3  241 ? 84.178  329.418 203.807 1.00 35.58  ? 241  TYR C CD2 1 
ATOM   7818  C  CE1 . TYR C  3  241 ? 82.023  327.781 203.207 1.00 39.42  ? 241  TYR C CE1 1 
ATOM   7819  C  CE2 . TYR C  3  241 ? 83.264  329.799 202.829 1.00 36.15  ? 241  TYR C CE2 1 
ATOM   7820  C  CZ  . TYR C  3  241 ? 82.198  328.976 202.544 1.00 35.62  ? 241  TYR C CZ  1 
ATOM   7821  O  OH  . TYR C  3  241 ? 81.278  329.399 201.634 1.00 43.90  ? 241  TYR C OH  1 
ATOM   7822  N  N   . TRP C  3  242 ? 88.019  328.061 204.532 1.00 27.65  ? 242  TRP C N   1 
ATOM   7823  C  CA  . TRP C  3  242 ? 89.053  328.715 203.708 1.00 27.26  ? 242  TRP C CA  1 
ATOM   7824  C  C   . TRP C  3  242 ? 89.869  327.687 202.943 1.00 30.01  ? 242  TRP C C   1 
ATOM   7825  O  O   . TRP C  3  242 ? 90.177  327.883 201.759 1.00 29.31  ? 242  TRP C O   1 
ATOM   7826  C  CB  . TRP C  3  242 ? 89.963  329.611 204.587 1.00 25.26  ? 242  TRP C CB  1 
ATOM   7827  C  CG  . TRP C  3  242 ? 90.822  330.504 203.737 1.00 31.30  ? 242  TRP C CG  1 
ATOM   7828  C  CD1 . TRP C  3  242 ? 92.188  330.413 203.491 1.00 29.85  ? 242  TRP C CD1 1 
ATOM   7829  C  CD2 . TRP C  3  242 ? 90.345  331.556 202.923 1.00 30.42  ? 242  TRP C CD2 1 
ATOM   7830  N  NE1 . TRP C  3  242 ? 92.576  331.406 202.621 1.00 32.69  ? 242  TRP C NE1 1 
ATOM   7831  C  CE2 . TRP C  3  242 ? 91.456  332.117 202.246 1.00 28.82  ? 242  TRP C CE2 1 
ATOM   7832  C  CE3 . TRP C  3  242 ? 89.068  332.097 202.695 1.00 27.00  ? 242  TRP C CE3 1 
ATOM   7833  C  CZ2 . TRP C  3  242 ? 91.318  333.182 201.358 1.00 33.20  ? 242  TRP C CZ2 1 
ATOM   7834  C  CZ3 . TRP C  3  242 ? 88.944  333.158 201.813 1.00 33.09  ? 242  TRP C CZ3 1 
ATOM   7835  C  CH2 . TRP C  3  242 ? 90.066  333.692 201.167 1.00 35.51  ? 242  TRP C CH2 1 
ATOM   7836  N  N   . HIS C  3  243 ? 90.170  326.558 203.579 1.00 26.15  ? 243  HIS C N   1 
ATOM   7837  C  CA  . HIS C  3  243 ? 90.896  325.489 202.909 1.00 30.47  ? 243  HIS C CA  1 
ATOM   7838  C  C   . HIS C  3  243 ? 90.026  324.851 201.823 1.00 35.35  ? 243  HIS C C   1 
ATOM   7839  O  O   . HIS C  3  243 ? 90.506  324.510 200.729 1.00 27.92  ? 243  HIS C O   1 
ATOM   7840  C  CB  . HIS C  3  243 ? 91.306  324.436 203.965 1.00 25.73  ? 243  HIS C CB  1 
ATOM   7841  C  CG  . HIS C  3  243 ? 92.465  324.848 204.820 1.00 31.45  ? 243  HIS C CG  1 
ATOM   7842  N  ND1 . HIS C  3  243 ? 93.606  325.452 204.316 1.00 31.64  ? 243  HIS C ND1 1 
ATOM   7843  C  CD2 . HIS C  3  243 ? 92.642  324.778 206.181 1.00 30.81  ? 243  HIS C CD2 1 
ATOM   7844  C  CE1 . HIS C  3  243 ? 94.443  325.713 205.318 1.00 33.12  ? 243  HIS C CE1 1 
ATOM   7845  N  NE2 . HIS C  3  243 ? 93.875  325.312 206.457 1.00 32.29  ? 243  HIS C NE2 1 
ATOM   7846  N  N   . PHE C  3  244 ? 88.734  324.688 202.126 1.00 27.86  ? 244  PHE C N   1 
ATOM   7847  C  CA  . PHE C  3  244 ? 87.783  324.229 201.101 1.00 24.13  ? 244  PHE C CA  1 
ATOM   7848  C  C   . PHE C  3  244 ? 87.800  325.169 199.907 1.00 28.96  ? 244  PHE C C   1 
ATOM   7849  O  O   . PHE C  3  244 ? 87.839  324.730 198.753 1.00 30.92  ? 244  PHE C O   1 
ATOM   7850  C  CB  . PHE C  3  244 ? 86.376  324.120 201.731 1.00 29.87  ? 244  PHE C CB  1 
ATOM   7851  C  CG  . PHE C  3  244 ? 85.234  324.264 200.753 1.00 28.31  ? 244  PHE C CG  1 
ATOM   7852  C  CD1 . PHE C  3  244 ? 84.870  323.208 199.941 1.00 28.98  ? 244  PHE C CD1 1 
ATOM   7853  C  CD2 . PHE C  3  244 ? 84.534  325.448 200.672 1.00 34.32  ? 244  PHE C CD2 1 
ATOM   7854  C  CE1 . PHE C  3  244 ? 83.777  323.360 199.018 1.00 26.28  ? 244  PHE C CE1 1 
ATOM   7855  C  CE2 . PHE C  3  244 ? 83.450  325.600 199.758 1.00 38.14  ? 244  PHE C CE2 1 
ATOM   7856  C  CZ  . PHE C  3  244 ? 83.100  324.549 198.952 1.00 33.17  ? 244  PHE C CZ  1 
ATOM   7857  N  N   . VAL C  3  245 ? 87.773  326.475 200.157 1.00 25.59  ? 245  VAL C N   1 
ATOM   7858  C  CA  . VAL C  3  245 ? 87.766  327.424 199.033 1.00 29.16  ? 245  VAL C CA  1 
ATOM   7859  C  C   . VAL C  3  245 ? 89.065  327.291 198.219 1.00 36.98  ? 245  VAL C C   1 
ATOM   7860  O  O   . VAL C  3  245 ? 89.070  327.381 196.983 1.00 27.51  ? 245  VAL C O   1 
ATOM   7861  C  CB  . VAL C  3  245 ? 87.576  328.842 199.615 1.00 32.23  ? 245  VAL C CB  1 
ATOM   7862  C  CG1 . VAL C  3  245 ? 87.910  329.860 198.657 1.00 44.93  ? 245  VAL C CG1 1 
ATOM   7863  C  CG2 . VAL C  3  245 ? 86.119  329.011 200.064 1.00 42.52  ? 245  VAL C CG2 1 
ATOM   7864  N  N   . ASP C  3  246 ? 90.183  327.045 198.909 1.00 26.93  ? 246  ASP C N   1 
ATOM   7865  C  CA  . ASP C  3  246 ? 91.490  326.822 198.277 1.00 27.88  ? 246  ASP C CA  1 
ATOM   7866  C  C   . ASP C  3  246 ? 91.474  325.591 197.413 1.00 31.37  ? 246  ASP C C   1 
ATOM   7867  O  O   . ASP C  3  246 ? 91.944  325.614 196.270 1.00 30.81  ? 246  ASP C O   1 
ATOM   7868  C  CB  . ASP C  3  246 ? 92.581  326.636 199.351 1.00 27.61  ? 246  ASP C CB  1 
ATOM   7869  C  CG  . ASP C  3  246 ? 93.977  326.657 198.766 1.00 178.35 ? 246  ASP C CG  1 
ATOM   7870  O  OD1 . ASP C  3  246 ? 94.096  327.009 197.585 1.00 64.66  ? 246  ASP C OD1 1 
ATOM   7871  O  OD2 . ASP C  3  246 ? 94.970  326.322 199.449 1.00 53.90  ? 246  ASP C OD2 1 
ATOM   7872  N  N   . VAL C  3  247 ? 90.978  324.484 197.953 1.00 24.50  ? 247  VAL C N   1 
ATOM   7873  C  CA  . VAL C  3  247 ? 90.979  323.240 197.201 1.00 30.84  ? 247  VAL C CA  1 
ATOM   7874  C  C   . VAL C  3  247 ? 90.056  323.329 195.967 1.00 36.24  ? 247  VAL C C   1 
ATOM   7875  O  O   . VAL C  3  247 ? 90.403  322.840 194.877 1.00 27.81  ? 247  VAL C O   1 
ATOM   7876  C  CB  . VAL C  3  247 ? 90.586  322.077 198.115 1.00 31.71  ? 247  VAL C CB  1 
ATOM   7877  C  CG1 . VAL C  3  247 ? 90.357  320.819 197.276 1.00 30.33  ? 247  VAL C CG1 1 
ATOM   7878  C  CG2 . VAL C  3  247 ? 91.670  321.872 199.180 1.00 30.94  ? 247  VAL C CG2 1 
ATOM   7879  N  N   . VAL C  3  248 ? 88.877  323.911 196.118 1.00 31.25  ? 248  VAL C N   1 
ATOM   7880  C  CA  . VAL C  3  248 ? 88.014  324.111 194.949 1.00 30.04  ? 248  VAL C CA  1 
ATOM   7881  C  C   . VAL C  3  248 ? 88.747  324.920 193.878 1.00 34.22  ? 248  VAL C C   1 
ATOM   7882  O  O   . VAL C  3  248 ? 88.655  324.605 192.686 1.00 33.19  ? 248  VAL C O   1 
ATOM   7883  C  CB  . VAL C  3  248 ? 86.699  324.802 195.341 1.00 28.89  ? 248  VAL C CB  1 
ATOM   7884  C  CG1 . VAL C  3  248 ? 85.878  325.201 194.020 1.00 26.18  ? 248  VAL C CG1 1 
ATOM   7885  C  CG2 . VAL C  3  248 ? 85.836  323.894 196.234 1.00 29.78  ? 248  VAL C CG2 1 
ATOM   7886  N  N   . TRP C  3  249 ? 89.470  325.982 194.275 1.00 25.65  ? 249  TRP C N   1 
ATOM   7887  C  CA  . TRP C  3  249 ? 90.267  326.733 193.298 1.00 31.78  ? 249  TRP C CA  1 
ATOM   7888  C  C   . TRP C  3  249 ? 91.265  325.833 192.579 1.00 33.25  ? 249  TRP C C   1 
ATOM   7889  O  O   . TRP C  3  249 ? 91.398  325.898 191.345 1.00 31.12  ? 249  TRP C O   1 
ATOM   7890  C  CB  . TRP C  3  249 ? 91.026  327.905 193.950 1.00 24.21  ? 249  TRP C CB  1 
ATOM   7891  C  CG  . TRP C  3  249 ? 91.912  328.559 192.871 1.00 31.60  ? 249  TRP C CG  1 
ATOM   7892  C  CD1 . TRP C  3  249 ? 93.276  328.426 192.731 1.00 30.70  ? 249  TRP C CD1 1 
ATOM   7893  C  CD2 . TRP C  3  249 ? 91.460  329.316 191.723 1.00 34.59  ? 249  TRP C CD2 1 
ATOM   7894  N  NE1 . TRP C  3  249 ? 93.712  329.117 191.581 1.00 31.75  ? 249  TRP C NE1 1 
ATOM   7895  C  CE2 . TRP C  3  249 ? 92.625  329.666 190.955 1.00 34.82  ? 249  TRP C CE2 1 
ATOM   7896  C  CE3 . TRP C  3  249 ? 90.198  329.749 191.279 1.00 26.90  ? 249  TRP C CE3 1 
ATOM   7897  C  CZ2 . TRP C  3  249 ? 92.539  330.432 189.748 1.00 33.03  ? 249  TRP C CZ2 1 
ATOM   7898  C  CZ3 . TRP C  3  249 ? 90.128  330.545 190.074 1.00 32.44  ? 249  TRP C CZ3 1 
ATOM   7899  C  CH2 . TRP C  3  249 ? 91.277  330.853 189.348 1.00 32.23  ? 249  TRP C CH2 1 
ATOM   7900  N  N   . LEU C  3  250 ? 91.979  324.979 193.322 1.00 28.58  ? 250  LEU C N   1 
ATOM   7901  C  CA  . LEU C  3  250 ? 92.955  324.114 192.664 1.00 30.19  ? 250  LEU C CA  1 
ATOM   7902  C  C   . LEU C  3  250 ? 92.297  323.230 191.600 1.00 34.41  ? 250  LEU C C   1 
ATOM   7903  O  O   . LEU C  3  250 ? 92.901  322.959 190.545 1.00 30.09  ? 250  LEU C O   1 
ATOM   7904  C  CB  . LEU C  3  250 ? 93.696  323.253 193.693 1.00 29.33  ? 250  LEU C CB  1 
ATOM   7905  C  CG  . LEU C  3  250 ? 94.600  324.105 194.580 1.00 37.77  ? 250  LEU C CG  1 
ATOM   7906  C  CD1 . LEU C  3  250 ? 95.136  323.264 195.760 1.00 34.11  ? 250  LEU C CD1 1 
ATOM   7907  C  CD2 . LEU C  3  250 ? 95.778  324.622 193.771 1.00 37.36  ? 250  LEU C CD2 1 
ATOM   7908  N  N   . PHE C  3  251 ? 91.078  322.749 191.868 1.00 29.51  ? 251  PHE C N   1 
ATOM   7909  C  CA  . PHE C  3  251 ? 90.383  321.893 190.905 1.00 27.47  ? 251  PHE C CA  1 
ATOM   7910  C  C   . PHE C  3  251 ? 89.921  322.717 189.700 1.00 29.12  ? 251  PHE C C   1 
ATOM   7911  O  O   . PHE C  3  251 ? 89.983  322.255 188.566 1.00 30.58  ? 251  PHE C O   1 
ATOM   7912  C  CB  . PHE C  3  251 ? 89.181  321.216 191.591 1.00 31.24  ? 251  PHE C CB  1 
ATOM   7913  C  CG  . PHE C  3  251 ? 89.533  319.899 192.247 1.00 36.11  ? 251  PHE C CG  1 
ATOM   7914  C  CD1 . PHE C  3  251 ? 90.020  319.862 193.547 1.00 32.35  ? 251  PHE C CD1 1 
ATOM   7915  C  CD2 . PHE C  3  251 ? 89.431  318.683 191.525 1.00 37.32  ? 251  PHE C CD2 1 
ATOM   7916  C  CE1 . PHE C  3  251 ? 90.375  318.651 194.154 1.00 34.45  ? 251  PHE C CE1 1 
ATOM   7917  C  CE2 . PHE C  3  251 ? 89.777  317.478 192.134 1.00 45.87  ? 251  PHE C CE2 1 
ATOM   7918  C  CZ  . PHE C  3  251 ? 90.246  317.468 193.456 1.00 44.70  ? 251  PHE C CZ  1 
ATOM   7919  N  N   . LEU C  3  252 ? 89.427  323.931 189.945 1.00 26.06  ? 252  LEU C N   1 
ATOM   7920  C  CA  . LEU C  3  252 ? 89.056  324.831 188.856 1.00 32.04  ? 252  LEU C CA  1 
ATOM   7921  C  C   . LEU C  3  252 ? 90.265  325.148 187.983 1.00 31.84  ? 252  LEU C C   1 
ATOM   7922  O  O   . LEU C  3  252 ? 90.180  325.159 186.747 1.00 30.47  ? 252  LEU C O   1 
ATOM   7923  C  CB  . LEU C  3  252 ? 88.485  326.141 189.435 1.00 27.29  ? 252  LEU C CB  1 
ATOM   7924  C  CG  . LEU C  3  252 ? 87.091  326.076 190.055 1.00 34.34  ? 252  LEU C CG  1 
ATOM   7925  C  CD1 . LEU C  3  252 ? 86.868  327.428 190.739 1.00 27.61  ? 252  LEU C CD1 1 
ATOM   7926  C  CD2 . LEU C  3  252 ? 86.086  325.884 188.971 1.00 32.33  ? 252  LEU C CD2 1 
ATOM   7927  N  N   . TYR C  3  253 ? 91.393  325.455 188.630 1.00 31.01  ? 253  TYR C N   1 
ATOM   7928  C  CA  . TYR C  3  253 ? 92.614  325.845 187.908 1.00 26.83  ? 253  TYR C CA  1 
ATOM   7929  C  C   . TYR C  3  253 ? 93.074  324.705 187.020 1.00 30.10  ? 253  TYR C C   1 
ATOM   7930  O  O   . TYR C  3  253 ? 93.238  324.867 185.806 1.00 29.99  ? 253  TYR C O   1 
ATOM   7931  C  CB  . TYR C  3  253 ? 93.698  326.270 188.944 1.00 24.09  ? 253  TYR C CB  1 
ATOM   7932  C  CG  . TYR C  3  253 ? 94.963  326.663 188.220 1.00 30.57  ? 253  TYR C CG  1 
ATOM   7933  C  CD1 . TYR C  3  253 ? 95.038  327.881 187.555 1.00 33.25  ? 253  TYR C CD1 1 
ATOM   7934  C  CD2 . TYR C  3  253 ? 96.037  325.789 188.132 1.00 36.66  ? 253  TYR C CD2 1 
ATOM   7935  C  CE1 . TYR C  3  253 ? 96.188  328.250 186.841 1.00 33.09  ? 253  TYR C CE1 1 
ATOM   7936  C  CE2 . TYR C  3  253 ? 97.208  326.154 187.457 1.00 44.09  ? 253  TYR C CE2 1 
ATOM   7937  C  CZ  . TYR C  3  253 ? 97.261  327.384 186.807 1.00 41.42  ? 253  TYR C CZ  1 
ATOM   7938  O  OH  . TYR C  3  253 ? 98.379  327.797 186.129 1.00 38.59  ? 253  TYR C OH  1 
ATOM   7939  N  N   . VAL C  3  254 ? 93.144  323.503 187.570 1.00 29.89  ? 254  VAL C N   1 
ATOM   7940  C  CA  . VAL C  3  254 ? 93.593  322.357 186.785 1.00 34.18  ? 254  VAL C CA  1 
ATOM   7941  C  C   . VAL C  3  254 ? 92.585  322.031 185.664 1.00 32.93  ? 254  VAL C C   1 
ATOM   7942  O  O   . VAL C  3  254 ? 92.959  321.744 184.518 1.00 36.50  ? 254  VAL C O   1 
ATOM   7943  C  CB  . VAL C  3  254 ? 93.777  321.136 187.703 1.00 38.75  ? 254  VAL C CB  1 
ATOM   7944  C  CG1 . VAL C  3  254 ? 93.997  319.945 186.834 1.00 34.57  ? 254  VAL C CG1 1 
ATOM   7945  C  CG2 . VAL C  3  254 ? 94.997  321.339 188.648 1.00 35.95  ? 254  VAL C CG2 1 
ATOM   7946  N  N   . SER C  3  255 ? 91.297  322.008 186.008 1.00 27.24  ? 255  SER C N   1 
ATOM   7947  C  CA  . SER C  3  255 ? 90.236  321.578 185.072 1.00 25.43  ? 255  SER C CA  1 
ATOM   7948  C  C   . SER C  3  255 ? 89.943  322.618 184.014 1.00 31.33  ? 255  SER C C   1 
ATOM   7949  O  O   . SER C  3  255 ? 90.012  322.342 182.818 1.00 32.52  ? 255  SER C O   1 
ATOM   7950  C  CB  . SER C  3  255 ? 88.920  321.286 185.855 1.00 27.92  ? 255  SER C CB  1 
ATOM   7951  O  OG  . SER C  3  255 ? 89.154  320.140 186.644 1.00 32.22  ? 255  SER C OG  1 
ATOM   7952  N  N   . ILE C  3  256 ? 89.538  323.803 184.431 1.00 33.97  ? 256  ILE C N   1 
ATOM   7953  C  CA  . ILE C  3  256 ? 88.972  324.755 183.480 1.00 28.36  ? 256  ILE C CA  1 
ATOM   7954  C  C   . ILE C  3  256 ? 90.045  325.633 182.855 1.00 39.46  ? 256  ILE C C   1 
ATOM   7955  O  O   . ILE C  3  256 ? 90.064  325.838 181.634 1.00 37.06  ? 256  ILE C O   1 
ATOM   7956  C  CB  . ILE C  3  256 ? 87.889  325.603 184.171 1.00 34.41  ? 256  ILE C CB  1 
ATOM   7957  C  CG1 . ILE C  3  256 ? 86.704  324.715 184.490 1.00 35.01  ? 256  ILE C CG1 1 
ATOM   7958  C  CG2 . ILE C  3  256 ? 87.479  326.801 183.307 1.00 29.60  ? 256  ILE C CG2 1 
ATOM   7959  C  CD1 . ILE C  3  256 ? 85.630  325.475 185.179 1.00 34.37  ? 256  ILE C CD1 1 
ATOM   7960  N  N   . TYR C  3  257 ? 90.975  326.125 183.661 1.00 32.23  ? 257  TYR C N   1 
ATOM   7961  C  CA  . TYR C  3  257 ? 91.987  327.049 183.142 1.00 31.72  ? 257  TYR C CA  1 
ATOM   7962  C  C   . TYR C  3  257 ? 93.098  326.310 182.423 1.00 33.26  ? 257  TYR C C   1 
ATOM   7963  O  O   . TYR C  3  257 ? 93.626  326.801 181.428 1.00 35.17  ? 257  TYR C O   1 
ATOM   7964  C  CB  . TYR C  3  257 ? 92.592  327.861 184.305 1.00 27.88  ? 257  TYR C CB  1 
ATOM   7965  C  CG  . TYR C  3  257 ? 91.706  328.943 184.885 1.00 35.21  ? 257  TYR C CG  1 
ATOM   7966  C  CD1 . TYR C  3  257 ? 91.797  330.248 184.438 1.00 30.24  ? 257  TYR C CD1 1 
ATOM   7967  C  CD2 . TYR C  3  257 ? 90.799  328.653 185.885 1.00 30.57  ? 257  TYR C CD2 1 
ATOM   7968  C  CE1 . TYR C  3  257 ? 90.998  331.260 185.004 1.00 35.58  ? 257  TYR C CE1 1 
ATOM   7969  C  CE2 . TYR C  3  257 ? 90.002  329.616 186.456 1.00 34.19  ? 257  TYR C CE2 1 
ATOM   7970  C  CZ  . TYR C  3  257 ? 90.095  330.932 186.029 1.00 28.63  ? 257  TYR C CZ  1 
ATOM   7971  O  OH  . TYR C  3  257 ? 89.286  331.888 186.616 1.00 33.32  ? 257  TYR C OH  1 
ATOM   7972  N  N   . TRP C  3  258 ? 93.487  325.135 182.915 1.00 34.05  ? 258  TRP C N   1 
ATOM   7973  C  CA  . TRP C  3  258 ? 94.667  324.495 182.368 1.00 35.55  ? 258  TRP C CA  1 
ATOM   7974  C  C   . TRP C  3  258 ? 94.287  323.398 181.379 1.00 36.85  ? 258  TRP C C   1 
ATOM   7975  O  O   . TRP C  3  258 ? 94.477  323.542 180.164 1.00 36.43  ? 258  TRP C O   1 
ATOM   7976  C  CB  . TRP C  3  258 ? 95.521  323.955 183.521 1.00 36.55  ? 258  TRP C CB  1 
ATOM   7977  C  CG  . TRP C  3  258 ? 96.893  323.435 183.179 1.00 46.56  ? 258  TRP C CG  1 
ATOM   7978  C  CD1 . TRP C  3  258 ? 97.558  323.550 181.989 1.00 66.94  ? 258  TRP C CD1 1 
ATOM   7979  C  CD2 . TRP C  3  258 ? 97.760  322.702 184.055 1.00 147.28 ? 258  TRP C CD2 1 
ATOM   7980  N  NE1 . TRP C  3  258 ? 98.784  322.914 182.066 1.00 52.45  ? 258  TRP C NE1 1 
ATOM   7981  C  CE2 . TRP C  3  258 ? 98.933  322.399 183.331 1.00 132.17 ? 258  TRP C CE2 1 
ATOM   7982  C  CE3 . TRP C  3  258 ? 97.655  322.272 185.386 1.00 122.85 ? 258  TRP C CE3 1 
ATOM   7983  C  CZ2 . TRP C  3  258 ? 99.992  321.682 183.897 1.00 69.40  ? 258  TRP C CZ2 1 
ATOM   7984  C  CZ3 . TRP C  3  258 ? 98.703  321.572 185.949 1.00 56.03  ? 258  TRP C CZ3 1 
ATOM   7985  C  CH2 . TRP C  3  258 ? 99.858  321.279 185.204 1.00 72.78  ? 258  TRP C CH2 1 
ATOM   7986  N  N   . TRP C  3  259 ? 93.728  322.305 181.888 1.00 33.95  ? 259  TRP C N   1 
ATOM   7987  C  CA  . TRP C  3  259 ? 93.293  321.222 181.022 1.00 33.37  ? 259  TRP C CA  1 
ATOM   7988  C  C   . TRP C  3  259 ? 92.306  321.703 179.971 1.00 57.28  ? 259  TRP C C   1 
ATOM   7989  O  O   . TRP C  3  259 ? 92.369  321.257 178.816 1.00 38.03  ? 259  TRP C O   1 
ATOM   7990  C  CB  . TRP C  3  259 ? 92.680  320.083 181.834 1.00 35.84  ? 259  TRP C CB  1 
ATOM   7991  C  CG  . TRP C  3  259 ? 92.191  318.991 181.011 1.00 47.15  ? 259  TRP C CG  1 
ATOM   7992  C  CD1 . TRP C  3  259 ? 92.907  317.927 180.545 1.00 52.78  ? 259  TRP C CD1 1 
ATOM   7993  C  CD2 . TRP C  3  259 ? 90.857  318.834 180.517 1.00 51.26  ? 259  TRP C CD2 1 
ATOM   7994  N  NE1 . TRP C  3  259 ? 92.095  317.113 179.781 1.00 56.64  ? 259  TRP C NE1 1 
ATOM   7995  C  CE2 . TRP C  3  259 ? 90.830  317.646 179.748 1.00 59.53  ? 259  TRP C CE2 1 
ATOM   7996  C  CE3 . TRP C  3  259 ? 89.692  319.597 180.628 1.00 39.68  ? 259  TRP C CE3 1 
ATOM   7997  C  CZ2 . TRP C  3  259 ? 89.672  317.196 179.085 1.00 52.57  ? 259  TRP C CZ2 1 
ATOM   7998  C  CZ3 . TRP C  3  259 ? 88.514  319.145 179.959 1.00 40.49  ? 259  TRP C CZ3 1 
ATOM   7999  C  CH2 . TRP C  3  259 ? 88.527  317.953 179.209 1.00 39.60  ? 259  TRP C CH2 1 
ATOM   8000  N  N   . GLY C  3  260 ? 91.401  322.609 180.333 1.00 30.44  ? 260  GLY C N   1 
ATOM   8001  C  CA  . GLY C  3  260 ? 90.370  323.070 179.412 1.00 30.54  ? 260  GLY C CA  1 
ATOM   8002  C  C   . GLY C  3  260 ? 90.839  324.217 178.507 1.00 65.09  ? 260  GLY C C   1 
ATOM   8003  O  O   . GLY C  3  260 ? 90.032  324.900 177.899 1.00 46.78  ? 260  GLY C O   1 
ATOM   8004  N  N   . SER C  3  261 ? 92.133  324.468 178.392 1.00 41.23  ? 261  SER C N   1 
ATOM   8005  C  CA  . SER C  3  261 ? 92.578  325.631 177.605 1.00 36.99  ? 261  SER C CA  1 
ATOM   8006  C  C   . SER C  3  261 ? 93.099  325.211 176.228 1.00 45.09  ? 261  SER C C   1 
ATOM   8007  O  O   . SER C  3  261 ? 93.554  326.025 175.429 1.00 50.41  ? 261  SER C O   1 
ATOM   8008  C  CB  . SER C  3  261 ? 93.691  326.436 178.330 1.00 43.59  ? 261  SER C CB  1 
ATOM   8009  O  OG  . SER C  3  261 ? 94.852  325.629 178.493 1.00 51.38  ? 261  SER C OG  1 
ATOM   8010  O  OXT . SER C  3  261 ? 93.082  324.041 175.866 1.00 41.26  ? 261  SER C OXT 1 
ATOM   8011  N  N   . SER D  4  4   ? 41.710  299.346 240.876 1.00 61.71  ? 4    SER D N   1 
ATOM   8012  C  CA  . SER D  4  4   ? 40.649  300.295 240.556 1.00 76.96  ? 4    SER D CA  1 
ATOM   8013  C  C   . SER D  4  4   ? 41.080  301.464 239.621 1.00 73.79  ? 4    SER D C   1 
ATOM   8014  O  O   . SER D  4  4   ? 41.420  301.230 238.461 1.00 273.10 ? 4    SER D O   1 
ATOM   8015  C  CB  . SER D  4  4   ? 40.048  300.847 241.853 1.00 118.26 ? 4    SER D CB  1 
ATOM   8016  O  OG  . SER D  4  4   ? 38.789  300.237 242.087 1.00 115.36 ? 4    SER D OG  1 
ATOM   8017  N  N   . VAL D  4  5   ? 41.061  302.702 240.128 1.00 43.54  ? 5    VAL D N   1 
ATOM   8018  C  CA  . VAL D  4  5   ? 41.114  303.906 239.296 1.00 124.65 ? 5    VAL D CA  1 
ATOM   8019  C  C   . VAL D  4  5   ? 42.556  304.231 238.913 1.00 54.50  ? 5    VAL D C   1 
ATOM   8020  O  O   . VAL D  4  5   ? 43.376  304.560 239.768 1.00 49.43  ? 5    VAL D O   1 
ATOM   8021  C  CB  . VAL D  4  5   ? 40.481  305.095 240.033 1.00 60.06  ? 5    VAL D CB  1 
ATOM   8022  C  CG1 . VAL D  4  5   ? 40.658  306.388 239.213 1.00 52.03  ? 5    VAL D CG1 1 
ATOM   8023  C  CG2 . VAL D  4  5   ? 39.015  304.836 240.392 1.00 39.23  ? 5    VAL D CG2 1 
ATOM   8024  N  N   . VAL D  4  6   ? 42.871  304.201 237.614 1.00 40.07  ? 6    VAL D N   1 
ATOM   8025  C  CA  . VAL D  4  6   ? 44.211  304.540 237.157 1.00 35.18  ? 6    VAL D CA  1 
ATOM   8026  C  C   . VAL D  4  6   ? 44.291  306.028 236.859 1.00 45.80  ? 6    VAL D C   1 
ATOM   8027  O  O   . VAL D  4  6   ? 43.394  306.602 236.239 1.00 41.68  ? 6    VAL D O   1 
ATOM   8028  C  CB  . VAL D  4  6   ? 44.527  303.705 235.898 1.00 40.74  ? 6    VAL D CB  1 
ATOM   8029  C  CG1 . VAL D  4  6   ? 45.967  303.984 235.362 1.00 41.57  ? 6    VAL D CG1 1 
ATOM   8030  C  CG2 . VAL D  4  6   ? 44.244  302.222 236.202 1.00 48.01  ? 6    VAL D CG2 1 
ATOM   8031  N  N   . LYS D  4  7   ? 45.388  306.648 237.238 1.00 32.83  ? 7    LYS D N   1 
ATOM   8032  C  CA  . LYS D  4  7   ? 45.511  308.095 237.116 1.00 42.28  ? 7    LYS D CA  1 
ATOM   8033  C  C   . LYS D  4  7   ? 46.648  308.423 236.162 1.00 50.65  ? 7    LYS D C   1 
ATOM   8034  O  O   . LYS D  4  7   ? 47.610  307.664 236.072 1.00 43.34  ? 7    LYS D O   1 
ATOM   8035  C  CB  . LYS D  4  7   ? 45.725  308.758 238.540 1.00 41.40  ? 7    LYS D CB  1 
ATOM   8036  C  CG  . LYS D  4  7   ? 44.601  308.377 239.495 1.00 34.78  ? 7    LYS D CG  1 
ATOM   8037  C  CD  . LYS D  4  7   ? 44.773  308.924 241.021 1.00 62.49  ? 7    LYS D CD  1 
ATOM   8038  C  CE  . LYS D  4  7   ? 46.019  308.296 241.642 1.00 142.03 ? 7    LYS D CE  1 
ATOM   8039  N  NZ  . LYS D  4  7   ? 46.301  308.728 243.033 1.00 79.01  ? 7    LYS D NZ  1 
ATOM   8040  N  N   . SER D  4  8   ? 46.494  309.528 235.404 1.00 48.83  ? 8    SER D N   1 
ATOM   8041  C  CA  . SER D  4  8   ? 47.544  309.977 234.492 1.00 64.02  ? 8    SER D CA  1 
ATOM   8042  C  C   . SER D  4  8   ? 48.847  310.257 235.236 1.00 63.25  ? 8    SER D C   1 
ATOM   8043  O  O   . SER D  4  8   ? 49.921  309.936 234.745 1.00 46.38  ? 8    SER D O   1 
ATOM   8044  C  CB  . SER D  4  8   ? 47.110  311.234 233.717 1.00 44.79  ? 8    SER D CB  1 
ATOM   8045  O  OG  . SER D  4  8   ? 45.811  311.127 233.225 1.00 71.11  ? 8    SER D OG  1 
ATOM   8046  N  N   . GLU D  4  9   ? 48.783  310.850 236.424 1.00 60.55  ? 9    GLU D N   1 
ATOM   8047  C  CA  . GLU D  4  9   ? 50.059  311.179 237.053 1.00 89.88  ? 9    GLU D CA  1 
ATOM   8048  C  C   . GLU D  4  9   ? 50.796  309.944 237.578 1.00 90.04  ? 9    GLU D C   1 
ATOM   8049  O  O   . GLU D  4  9   ? 51.884  310.088 238.149 1.00 148.30 ? 9    GLU D O   1 
ATOM   8050  C  CB  . GLU D  4  9   ? 49.833  312.209 238.163 1.00 92.08  ? 9    GLU D CB  1 
ATOM   8051  C  CG  . GLU D  4  9   ? 48.857  311.783 239.255 1.00 58.65  ? 9    GLU D CG  1 
ATOM   8052  C  CD  . GLU D  4  9   ? 47.363  311.960 238.876 1.00 142.04 ? 9    GLU D CD  1 
ATOM   8053  O  OE1 . GLU D  4  9   ? 47.028  312.365 237.732 1.00 83.23  ? 9    GLU D OE1 1 
ATOM   8054  O  OE2 . GLU D  4  9   ? 46.512  311.684 239.749 1.00 117.45 ? 9    GLU D OE2 1 
ATOM   8055  N  N   . ASP D  4  10  ? 50.237  308.744 237.381 1.00 57.73  ? 10   ASP D N   1 
ATOM   8056  C  CA  . ASP D  4  10  ? 50.923  307.490 237.670 1.00 41.80  ? 10   ASP D CA  1 
ATOM   8057  C  C   . ASP D  4  10  ? 51.730  306.933 236.498 1.00 44.99  ? 10   ASP D C   1 
ATOM   8058  O  O   . ASP D  4  10  ? 52.196  305.792 236.587 1.00 38.09  ? 10   ASP D O   1 
ATOM   8059  C  CB  . ASP D  4  10  ? 49.931  306.415 238.116 1.00 41.72  ? 10   ASP D CB  1 
ATOM   8060  C  CG  . ASP D  4  10  ? 49.350  306.710 239.455 1.00 140.84 ? 10   ASP D CG  1 
ATOM   8061  O  OD1 . ASP D  4  10  ? 49.896  307.529 240.156 1.00 42.68  ? 10   ASP D OD1 1 
ATOM   8062  O  OD2 . ASP D  4  10  ? 48.338  306.156 239.843 1.00 50.67  ? 10   ASP D OD2 1 
ATOM   8063  N  N   . TYR D  4  11  ? 51.968  307.707 235.432 1.00 35.31  ? 11   TYR D N   1 
ATOM   8064  C  CA  . TYR D  4  11  ? 52.487  307.076 234.188 1.00 33.56  ? 11   TYR D CA  1 
ATOM   8065  C  C   . TYR D  4  11  ? 53.850  306.409 234.406 1.00 51.72  ? 11   TYR D C   1 
ATOM   8066  O  O   . TYR D  4  11  ? 54.152  305.398 233.762 1.00 41.14  ? 11   TYR D O   1 
ATOM   8067  C  CB  . TYR D  4  11  ? 52.565  308.098 233.018 1.00 49.02  ? 11   TYR D CB  1 
ATOM   8068  C  CG  . TYR D  4  11  ? 53.636  309.211 233.123 1.00 117.88 ? 11   TYR D CG  1 
ATOM   8069  C  CD1 . TYR D  4  11  ? 54.986  308.948 232.889 1.00 41.09  ? 11   TYR D CD1 1 
ATOM   8070  C  CD2 . TYR D  4  11  ? 53.291  310.524 233.406 1.00 78.29  ? 11   TYR D CD2 1 
ATOM   8071  C  CE1 . TYR D  4  11  ? 55.983  309.937 233.009 1.00 35.48  ? 11   TYR D CE1 1 
ATOM   8072  C  CE2 . TYR D  4  11  ? 54.255  311.519 233.477 1.00 51.72  ? 11   TYR D CE2 1 
ATOM   8073  C  CZ  . TYR D  4  11  ? 55.595  311.229 233.319 1.00 76.42  ? 11   TYR D CZ  1 
ATOM   8074  O  OH  . TYR D  4  11  ? 56.540  312.231 233.435 1.00 83.88  ? 11   TYR D OH  1 
ATOM   8075  N  N   . ALA D  4  12  ? 54.712  306.992 235.258 1.00 34.99  ? 12   ALA D N   1 
ATOM   8076  C  CA  . ALA D  4  12  ? 56.081  306.493 235.488 1.00 33.56  ? 12   ALA D CA  1 
ATOM   8077  C  C   . ALA D  4  12  ? 56.162  305.286 236.437 1.00 37.98  ? 12   ALA D C   1 
ATOM   8078  O  O   . ALA D  4  12  ? 57.272  304.788 236.696 1.00 36.88  ? 12   ALA D O   1 
ATOM   8079  C  CB  . ALA D  4  12  ? 56.984  307.593 236.084 1.00 38.62  ? 12   ALA D CB  1 
ATOM   8080  N  N   . LEU D  4  13  ? 54.969  304.816 237.035 1.00 34.36  ? 13   LEU D N   1 
ATOM   8081  C  CA  . LEU D  4  13  ? 54.935  303.668 237.920 1.00 37.70  ? 13   LEU D CA  1 
ATOM   8082  C  C   . LEU D  4  13  ? 54.576  302.395 237.175 1.00 33.71  ? 13   LEU D C   1 
ATOM   8083  O  O   . LEU D  4  13  ? 53.901  302.436 236.136 1.00 36.98  ? 13   LEU D O   1 
ATOM   8084  C  CB  . LEU D  4  13  ? 53.905  303.887 239.051 1.00 35.61  ? 13   LEU D CB  1 
ATOM   8085  C  CG  . LEU D  4  13  ? 54.324  304.999 240.016 1.00 49.09  ? 13   LEU D CG  1 
ATOM   8086  C  CD1 . LEU D  4  13  ? 53.174  305.278 240.991 1.00 40.60  ? 13   LEU D CD1 1 
ATOM   8087  C  CD2 . LEU D  4  13  ? 55.630  304.681 240.744 1.00 44.03  ? 13   LEU D CD2 1 
ATOM   8088  N  N   . PRO D  4  14  ? 55.022  301.254 237.704 1.00 39.85  ? 14   PRO D N   1 
ATOM   8089  C  CA  . PRO D  4  14  ? 54.543  299.971 237.176 1.00 39.24  ? 14   PRO D CA  1 
ATOM   8090  C  C   . PRO D  4  14  ? 53.024  299.950 237.183 1.00 43.24  ? 14   PRO D C   1 
ATOM   8091  O  O   . PRO D  4  14  ? 52.373  300.486 238.083 1.00 35.11  ? 14   PRO D O   1 
ATOM   8092  C  CB  . PRO D  4  14  ? 55.149  298.935 238.138 1.00 43.41  ? 14   PRO D CB  1 
ATOM   8093  C  CG  . PRO D  4  14  ? 56.369  299.605 238.672 1.00 47.20  ? 14   PRO D CG  1 
ATOM   8094  C  CD  . PRO D  4  14  ? 56.052  301.083 238.742 1.00 42.00  ? 14   PRO D CD  1 
ATOM   8095  N  N   . SER D  4  15  ? 52.451  299.348 236.157 1.00 34.29  ? 15   SER D N   1 
ATOM   8096  C  CA  . SER D  4  15  ? 51.026  299.441 235.899 1.00 40.32  ? 15   SER D CA  1 
ATOM   8097  C  C   . SER D  4  15  ? 50.485  298.025 235.714 1.00 37.91  ? 15   SER D C   1 
ATOM   8098  O  O   . SER D  4  15  ? 51.250  297.079 235.512 1.00 41.98  ? 15   SER D O   1 
ATOM   8099  C  CB  . SER D  4  15  ? 50.767  300.340 234.656 1.00 35.76  ? 15   SER D CB  1 
ATOM   8100  O  OG  . SER D  4  15  ? 51.208  299.689 233.480 1.00 42.88  ? 15   SER D OG  1 
ATOM   8101  N  N   . TYR D  4  16  ? 49.161  297.880 235.813 1.00 41.12  ? 16   TYR D N   1 
ATOM   8102  C  CA  . TYR D  4  16  ? 48.494  296.604 235.584 1.00 36.36  ? 16   TYR D CA  1 
ATOM   8103  C  C   . TYR D  4  16  ? 48.164  296.499 234.102 1.00 47.56  ? 16   TYR D C   1 
ATOM   8104  O  O   . TYR D  4  16  ? 47.780  297.498 233.504 1.00 39.75  ? 16   TYR D O   1 
ATOM   8105  C  CB  . TYR D  4  16  ? 47.187  296.502 236.390 1.00 30.67  ? 16   TYR D CB  1 
ATOM   8106  C  CG  . TYR D  4  16  ? 46.535  295.155 236.182 1.00 52.61  ? 16   TYR D CG  1 
ATOM   8107  C  CD1 . TYR D  4  16  ? 46.888  294.069 236.953 1.00 39.80  ? 16   TYR D CD1 1 
ATOM   8108  C  CD2 . TYR D  4  16  ? 45.642  294.937 235.127 1.00 36.91  ? 16   TYR D CD2 1 
ATOM   8109  C  CE1 . TYR D  4  16  ? 46.332  292.800 236.721 1.00 35.13  ? 16   TYR D CE1 1 
ATOM   8110  C  CE2 . TYR D  4  16  ? 45.084  293.682 234.895 1.00 37.75  ? 16   TYR D CE2 1 
ATOM   8111  C  CZ  . TYR D  4  16  ? 45.397  292.613 235.725 1.00 30.79  ? 16   TYR D CZ  1 
ATOM   8112  O  OH  . TYR D  4  16  ? 44.809  291.392 235.464 1.00 37.38  ? 16   TYR D OH  1 
ATOM   8113  N  N   . VAL D  4  17  ? 48.309  295.297 233.520 1.00 37.56  ? 17   VAL D N   1 
ATOM   8114  C  CA  . VAL D  4  17  ? 47.865  295.016 232.153 1.00 36.17  ? 17   VAL D CA  1 
ATOM   8115  C  C   . VAL D  4  17  ? 47.396  293.566 232.099 1.00 40.63  ? 17   VAL D C   1 
ATOM   8116  O  O   . VAL D  4  17  ? 47.938  292.699 232.794 1.00 40.87  ? 17   VAL D O   1 
ATOM   8117  C  CB  . VAL D  4  17  ? 48.947  295.247 231.045 1.00 58.28  ? 17   VAL D CB  1 
ATOM   8118  C  CG1 . VAL D  4  17  ? 49.432  296.702 231.002 1.00 95.57  ? 17   VAL D CG1 1 
ATOM   8119  C  CG2 . VAL D  4  17  ? 50.113  294.298 231.215 1.00 40.65  ? 17   VAL D CG2 1 
ATOM   8120  N  N   . ASP D  4  18  ? 46.368  293.310 231.266 1.00 32.28  ? 18   ASP D N   1 
ATOM   8121  C  CA  . ASP D  4  18  ? 45.958  291.952 230.887 1.00 38.68  ? 18   ASP D CA  1 
ATOM   8122  C  C   . ASP D  4  18  ? 46.511  291.646 229.509 1.00 36.67  ? 18   ASP D C   1 
ATOM   8123  O  O   . ASP D  4  18  ? 46.021  292.193 228.514 1.00 35.47  ? 18   ASP D O   1 
ATOM   8124  C  CB  . ASP D  4  18  ? 44.439  291.797 230.899 1.00 38.80  ? 18   ASP D CB  1 
ATOM   8125  C  CG  . ASP D  4  18  ? 43.909  291.642 232.323 1.00 52.33  ? 18   ASP D CG  1 
ATOM   8126  O  OD1 . ASP D  4  18  ? 44.619  291.030 233.160 1.00 39.78  ? 18   ASP D OD1 1 
ATOM   8127  O  OD2 . ASP D  4  18  ? 42.838  292.168 232.629 1.00 37.91  ? 18   ASP D OD2 1 
ATOM   8128  N  N   . ARG D  4  19  ? 47.539  290.794 229.445 1.00 37.84  ? 19   ARG D N   1 
ATOM   8129  C  CA  . ARG D  4  19  ? 48.121  290.367 228.176 1.00 42.46  ? 19   ARG D CA  1 
ATOM   8130  C  C   . ARG D  4  19  ? 48.395  288.880 228.283 1.00 43.66  ? 19   ARG D C   1 
ATOM   8131  O  O   . ARG D  4  19  ? 49.043  288.447 229.240 1.00 40.45  ? 19   ARG D O   1 
ATOM   8132  C  CB  . ARG D  4  19  ? 49.465  291.070 227.845 1.00 49.28  ? 19   ARG D CB  1 
ATOM   8133  C  CG  . ARG D  4  19  ? 49.499  292.544 227.477 1.00 86.25  ? 19   ARG D CG  1 
ATOM   8134  C  CD  . ARG D  4  19  ? 50.960  292.946 227.071 1.00 62.16  ? 19   ARG D CD  1 
ATOM   8135  N  NE  . ARG D  4  19  ? 51.405  292.223 225.869 1.00 56.57  ? 19   ARG D NE  1 
ATOM   8136  C  CZ  . ARG D  4  19  ? 51.475  292.738 224.626 1.00 235.31 ? 19   ARG D CZ  1 
ATOM   8137  N  NH1 . ARG D  4  19  ? 51.868  291.989 223.603 1.00 40.91  ? 19   ARG D NH1 1 
ATOM   8138  N  NH2 . ARG D  4  19  ? 51.171  294.003 224.362 1.00 44.70  ? 19   ARG D NH2 1 
ATOM   8139  N  N   . ARG D  4  20  ? 47.958  288.101 227.286 1.00 35.63  ? 20   ARG D N   1 
ATOM   8140  C  CA  . ARG D  4  20  ? 48.174  286.652 227.368 1.00 38.79  ? 20   ARG D CA  1 
ATOM   8141  C  C   . ARG D  4  20  ? 49.658  286.298 227.436 1.00 40.35  ? 20   ARG D C   1 
ATOM   8142  O  O   . ARG D  4  20  ? 50.018  285.218 227.917 1.00 42.73  ? 20   ARG D O   1 
ATOM   8143  C  CB  . ARG D  4  20  ? 47.524  285.979 226.141 1.00 50.50  ? 20   ARG D CB  1 
ATOM   8144  C  CG  . ARG D  4  20  ? 47.747  286.716 224.835 1.00 90.31  ? 20   ARG D CG  1 
ATOM   8145  C  CD  . ARG D  4  20  ? 46.824  286.231 223.711 1.00 62.64  ? 20   ARG D CD  1 
ATOM   8146  N  NE  . ARG D  4  20  ? 47.188  284.877 223.410 1.00 67.65  ? 20   ARG D NE  1 
ATOM   8147  C  CZ  . ARG D  4  20  ? 47.746  284.385 222.314 1.00 40.40  ? 20   ARG D CZ  1 
ATOM   8148  N  NH1 . ARG D  4  20  ? 48.035  285.084 221.151 1.00 41.00  ? 20   ARG D NH1 1 
ATOM   8149  N  NH2 . ARG D  4  20  ? 48.026  283.100 222.381 1.00 42.11  ? 20   ARG D NH2 1 
ATOM   8150  N  N   . ASP D  4  21  ? 50.535  287.170 226.921 1.00 36.87  ? 21   ASP D N   1 
ATOM   8151  C  CA  . ASP D  4  21  ? 51.961  286.872 226.869 1.00 42.06  ? 21   ASP D CA  1 
ATOM   8152  C  C   . ASP D  4  21  ? 52.736  287.509 228.023 1.00 44.78  ? 21   ASP D C   1 
ATOM   8153  O  O   . ASP D  4  21  ? 53.953  287.380 228.066 1.00 42.96  ? 21   ASP D O   1 
ATOM   8154  C  CB  . ASP D  4  21  ? 52.556  287.308 225.496 1.00 49.03  ? 21   ASP D CB  1 
ATOM   8155  C  CG  . ASP D  4  21  ? 52.231  288.743 225.111 1.00 40.88  ? 21   ASP D CG  1 
ATOM   8156  O  OD1 . ASP D  4  21  ? 51.395  289.383 225.761 1.00 55.53  ? 21   ASP D OD1 1 
ATOM   8157  O  OD2 . ASP D  4  21  ? 52.822  289.255 224.105 1.00 73.65  ? 21   ASP D OD2 1 
ATOM   8158  N  N   . TYR D  4  22  ? 52.051  288.179 228.960 1.00 42.99  ? 22   TYR D N   1 
ATOM   8159  C  CA  . TYR D  4  22  ? 52.648  288.720 230.191 1.00 32.74  ? 22   TYR D CA  1 
ATOM   8160  C  C   . TYR D  4  22  ? 51.706  288.322 231.322 1.00 36.76  ? 22   TYR D C   1 
ATOM   8161  O  O   . TYR D  4  22  ? 51.023  289.178 231.887 1.00 39.09  ? 22   TYR D O   1 
ATOM   8162  C  CB  . TYR D  4  22  ? 52.781  290.243 230.110 1.00 35.37  ? 22   TYR D CB  1 
ATOM   8163  C  CG  . TYR D  4  22  ? 53.799  290.872 231.006 1.00 42.68  ? 22   TYR D CG  1 
ATOM   8164  C  CD1 . TYR D  4  22  ? 55.167  290.673 230.784 1.00 40.25  ? 22   TYR D CD1 1 
ATOM   8165  C  CD2 . TYR D  4  22  ? 53.405  291.683 232.082 1.00 40.70  ? 22   TYR D CD2 1 
ATOM   8166  C  CE1 . TYR D  4  22  ? 56.082  291.233 231.579 1.00 42.38  ? 22   TYR D CE1 1 
ATOM   8167  C  CE2 . TYR D  4  22  ? 54.348  292.258 232.909 1.00 37.85  ? 22   TYR D CE2 1 
ATOM   8168  C  CZ  . TYR D  4  22  ? 55.677  292.030 232.680 1.00 35.77  ? 22   TYR D CZ  1 
ATOM   8169  O  OH  . TYR D  4  22  ? 56.662  292.610 233.489 1.00 40.63  ? 22   TYR D OH  1 
ATOM   8170  N  N   . PRO D  4  23  ? 51.517  287.021 231.541 1.00 37.67  ? 23   PRO D N   1 
ATOM   8171  C  CA  . PRO D  4  23  ? 50.459  286.557 232.468 1.00 37.47  ? 23   PRO D CA  1 
ATOM   8172  C  C   . PRO D  4  23  ? 50.488  287.170 233.875 1.00 36.95  ? 23   PRO D C   1 
ATOM   8173  O  O   . PRO D  4  23  ? 49.416  287.304 234.481 1.00 35.91  ? 23   PRO D O   1 
ATOM   8174  C  CB  . PRO D  4  23  ? 50.707  285.043 232.533 1.00 34.71  ? 23   PRO D CB  1 
ATOM   8175  C  CG  . PRO D  4  23  ? 52.178  284.855 232.062 1.00 38.12  ? 23   PRO D CG  1 
ATOM   8176  C  CD  . PRO D  4  23  ? 52.255  285.877 230.967 1.00 34.36  ? 23   PRO D CD  1 
ATOM   8177  N  N   . LEU D  4  24  ? 51.647  287.567 234.406 1.00 36.43  ? 24   LEU D N   1 
ATOM   8178  C  CA  . LEU D  4  24  ? 51.744  288.028 235.797 1.00 39.09  ? 24   LEU D CA  1 
ATOM   8179  C  C   . LEU D  4  24  ? 52.207  289.482 235.817 1.00 31.65  ? 24   LEU D C   1 
ATOM   8180  O  O   . LEU D  4  24  ? 53.429  289.759 235.837 1.00 33.12  ? 24   LEU D O   1 
ATOM   8181  C  CB  . LEU D  4  24  ? 52.682  287.120 236.601 1.00 35.79  ? 24   LEU D CB  1 
ATOM   8182  C  CG  . LEU D  4  24  ? 52.220  285.660 236.739 1.00 37.05  ? 24   LEU D CG  1 
ATOM   8183  C  CD1 . LEU D  4  24  ? 53.271  284.860 237.621 1.00 33.53  ? 24   LEU D CD1 1 
ATOM   8184  C  CD2 . LEU D  4  24  ? 50.804  285.542 237.322 1.00 34.79  ? 24   LEU D CD2 1 
ATOM   8185  N  N   . PRO D  4  25  ? 51.273  290.434 235.790 1.00 44.93  ? 25   PRO D N   1 
ATOM   8186  C  CA  . PRO D  4  25  ? 51.646  291.844 235.665 1.00 32.48  ? 25   PRO D CA  1 
ATOM   8187  C  C   . PRO D  4  25  ? 52.418  292.329 236.880 1.00 35.04  ? 25   PRO D C   1 
ATOM   8188  O  O   . PRO D  4  25  ? 52.474  291.688 237.943 1.00 39.45  ? 25   PRO D O   1 
ATOM   8189  C  CB  . PRO D  4  25  ? 50.284  292.564 235.530 1.00 35.24  ? 25   PRO D CB  1 
ATOM   8190  C  CG  . PRO D  4  25  ? 49.271  291.516 235.331 1.00 41.40  ? 25   PRO D CG  1 
ATOM   8191  C  CD  . PRO D  4  25  ? 49.802  290.256 235.837 1.00 34.93  ? 25   PRO D CD  1 
ATOM   8192  N  N   . ASP D  4  26  ? 52.941  293.546 236.737 1.00 34.70  ? 26   ASP D N   1 
ATOM   8193  C  CA  . ASP D  4  26  ? 53.871  294.089 237.716 1.00 31.02  ? 26   ASP D CA  1 
ATOM   8194  C  C   . ASP D  4  26  ? 53.193  294.417 239.047 1.00 38.65  ? 26   ASP D C   1 
ATOM   8195  O  O   . ASP D  4  26  ? 53.882  294.482 240.051 1.00 40.84  ? 26   ASP D O   1 
ATOM   8196  C  CB  . ASP D  4  26  ? 54.516  295.362 237.170 1.00 38.40  ? 26   ASP D CB  1 
ATOM   8197  C  CG  . ASP D  4  26  ? 55.358  295.109 235.947 1.00 72.94  ? 26   ASP D CG  1 
ATOM   8198  O  OD1 . ASP D  4  26  ? 55.614  293.956 235.584 1.00 39.59  ? 26   ASP D OD1 1 
ATOM   8199  O  OD2 . ASP D  4  26  ? 55.749  296.074 235.313 1.00 50.24  ? 26   ASP D OD2 1 
ATOM   8200  N  N   . VAL D  4  27  ? 51.888  294.727 239.057 1.00 39.03  ? 27   VAL D N   1 
ATOM   8201  C  CA  . VAL D  4  27  ? 51.173  295.022 240.297 1.00 39.35  ? 27   VAL D CA  1 
ATOM   8202  C  C   . VAL D  4  27  ? 49.893  294.217 240.335 1.00 43.31  ? 27   VAL D C   1 
ATOM   8203  O  O   . VAL D  4  27  ? 49.437  293.701 239.321 1.00 34.24  ? 27   VAL D O   1 
ATOM   8204  C  CB  . VAL D  4  27  ? 50.826  296.517 240.415 1.00 41.25  ? 27   VAL D CB  1 
ATOM   8205  C  CG1 . VAL D  4  27  ? 52.111  297.360 240.608 1.00 39.51  ? 27   VAL D CG1 1 
ATOM   8206  C  CG2 . VAL D  4  27  ? 50.006  296.960 239.201 1.00 37.64  ? 27   VAL D CG2 1 
ATOM   8207  N  N   . ALA D  4  28  ? 49.287  294.144 241.533 1.00 31.87  ? 28   ALA D N   1 
ATOM   8208  C  CA  . ALA D  4  28  ? 47.961  293.552 241.634 1.00 37.18  ? 28   ALA D CA  1 
ATOM   8209  C  C   . ALA D  4  28  ? 46.925  294.496 241.048 1.00 40.28  ? 28   ALA D C   1 
ATOM   8210  O  O   . ALA D  4  28  ? 47.061  295.713 241.133 1.00 38.67  ? 28   ALA D O   1 
ATOM   8211  C  CB  . ALA D  4  28  ? 47.637  293.256 243.158 1.00 34.23  ? 28   ALA D CB  1 
ATOM   8212  N  N   . HIS D  4  29  ? 45.873  293.927 240.447 1.00 35.32  ? 29   HIS D N   1 
ATOM   8213  C  CA  . HIS D  4  29  ? 44.718  294.723 240.019 1.00 40.39  ? 29   HIS D CA  1 
ATOM   8214  C  C   . HIS D  4  29  ? 44.140  295.589 241.156 1.00 81.67  ? 29   HIS D C   1 
ATOM   8215  O  O   . HIS D  4  29  ? 43.771  296.750 240.952 1.00 39.79  ? 29   HIS D O   1 
ATOM   8216  C  CB  . HIS D  4  29  ? 43.656  293.780 239.473 1.00 37.65  ? 29   HIS D CB  1 
ATOM   8217  C  CG  . HIS D  4  29  ? 42.325  294.404 239.247 1.00 44.76  ? 29   HIS D CG  1 
ATOM   8218  N  ND1 . HIS D  4  29  ? 42.175  295.592 238.564 1.00 47.62  ? 29   HIS D ND1 1 
ATOM   8219  C  CD2 . HIS D  4  29  ? 41.073  293.963 239.524 1.00 40.73  ? 29   HIS D CD2 1 
ATOM   8220  C  CE1 . HIS D  4  29  ? 40.890  295.866 238.440 1.00 40.05  ? 29   HIS D CE1 1 
ATOM   8221  N  NE2 . HIS D  4  29  ? 40.198  294.894 239.018 1.00 57.37  ? 29   HIS D NE2 1 
ATOM   8222  N  N   . VAL D  4  30  ? 44.040  295.054 242.354 1.00 42.72  ? 30   VAL D N   1 
ATOM   8223  C  CA  . VAL D  4  30  ? 43.486  295.796 243.498 1.00 38.91  ? 30   VAL D CA  1 
ATOM   8224  C  C   . VAL D  4  30  ? 44.525  295.890 244.592 1.00 32.61  ? 30   VAL D C   1 
ATOM   8225  O  O   . VAL D  4  30  ? 44.877  294.878 245.200 1.00 44.62  ? 30   VAL D O   1 
ATOM   8226  C  CB  . VAL D  4  30  ? 42.203  295.150 244.024 1.00 40.43  ? 30   VAL D CB  1 
ATOM   8227  C  CG1 . VAL D  4  30  ? 41.636  296.034 245.169 1.00 47.37  ? 30   VAL D CG1 1 
ATOM   8228  C  CG2 . VAL D  4  30  ? 41.211  295.041 242.898 1.00 49.01  ? 30   VAL D CG2 1 
ATOM   8229  N  N   . LYS D  4  31  ? 44.958  297.119 244.898 1.00 37.60  ? 31   LYS D N   1 
ATOM   8230  C  CA  . LYS D  4  31  ? 45.948  297.399 245.931 1.00 53.87  ? 31   LYS D CA  1 
ATOM   8231  C  C   . LYS D  4  31  ? 45.326  297.657 247.321 1.00 45.92  ? 31   LYS D C   1 
ATOM   8232  O  O   . LYS D  4  31  ? 45.817  297.151 248.328 1.00 47.17  ? 31   LYS D O   1 
ATOM   8233  C  CB  . LYS D  4  31  ? 46.773  298.605 245.485 1.00 50.92  ? 31   LYS D CB  1 
ATOM   8234  C  CG  . LYS D  4  31  ? 47.708  299.169 246.499 1.00 129.15 ? 31   LYS D CG  1 
ATOM   8235  C  CD  . LYS D  4  31  ? 48.263  300.496 246.026 1.00 103.39 ? 31   LYS D CD  1 
ATOM   8236  C  CE  . LYS D  4  31  ? 49.222  301.019 247.042 1.00 108.79 ? 31   LYS D CE  1 
ATOM   8237  N  NZ  . LYS D  4  31  ? 48.640  300.989 248.414 1.00 68.19  ? 31   LYS D NZ  1 
ATOM   8238  N  N   . ASN D  4  32  ? 44.231  298.397 247.403 1.00 38.41  ? 32   ASN D N   1 
ATOM   8239  C  CA  . ASN D  4  32  ? 43.644  298.744 248.696 1.00 35.31  ? 32   ASN D CA  1 
ATOM   8240  C  C   . ASN D  4  32  ? 42.619  297.683 249.090 1.00 40.54  ? 32   ASN D C   1 
ATOM   8241  O  O   . ASN D  4  32  ? 41.749  297.327 248.278 1.00 41.59  ? 32   ASN D O   1 
ATOM   8242  C  CB  . ASN D  4  32  ? 42.958  300.103 248.590 1.00 44.71  ? 32   ASN D CB  1 
ATOM   8243  C  CG  . ASN D  4  32  ? 43.928  301.233 248.341 1.00 50.25  ? 32   ASN D CG  1 
ATOM   8244  O  OD1 . ASN D  4  32  ? 43.772  302.008 247.401 1.00 55.13  ? 32   ASN D OD1 1 
ATOM   8245  N  ND2 . ASN D  4  32  ? 44.954  301.312 249.163 1.00 40.97  ? 32   ASN D ND2 1 
ATOM   8246  N  N   . LEU D  4  33  ? 42.652  297.281 250.368 1.00 37.98  ? 33   LEU D N   1 
ATOM   8247  C  CA  . LEU D  4  33  ? 41.885  296.154 250.862 1.00 39.90  ? 33   LEU D CA  1 
ATOM   8248  C  C   . LEU D  4  33  ? 40.943  296.643 251.951 1.00 48.03  ? 33   LEU D C   1 
ATOM   8249  O  O   . LEU D  4  33  ? 41.352  297.392 252.843 1.00 51.96  ? 33   LEU D O   1 
ATOM   8250  C  CB  . LEU D  4  33  ? 42.826  295.060 251.418 1.00 39.45  ? 33   LEU D CB  1 
ATOM   8251  C  CG  . LEU D  4  33  ? 43.626  294.435 250.232 1.00 49.74  ? 33   LEU D CG  1 
ATOM   8252  C  CD1 . LEU D  4  33  ? 44.335  293.198 250.653 1.00 54.13  ? 33   LEU D CD1 1 
ATOM   8253  C  CD2 . LEU D  4  33  ? 42.748  294.151 249.021 1.00 47.41  ? 33   LEU D CD2 1 
ATOM   8254  N  N   . SER D  4  34  ? 39.681  296.237 251.859 1.00 39.45  ? 34   SER D N   1 
ATOM   8255  C  CA  . SER D  4  34  ? 38.735  296.493 252.955 1.00 36.14  ? 34   SER D CA  1 
ATOM   8256  C  C   . SER D  4  34  ? 39.068  295.618 254.151 1.00 36.82  ? 34   SER D C   1 
ATOM   8257  O  O   . SER D  4  34  ? 39.912  294.727 254.098 1.00 46.64  ? 34   SER D O   1 
ATOM   8258  C  CB  . SER D  4  34  ? 37.295  296.217 252.507 1.00 46.12  ? 34   SER D CB  1 
ATOM   8259  O  OG  . SER D  4  34  ? 37.119  294.842 252.185 1.00 43.27  ? 34   SER D OG  1 
ATOM   8260  N  N   . ALA D  4  35  ? 38.339  295.842 255.273 1.00 38.40  ? 35   ALA D N   1 
ATOM   8261  C  CA  . ALA D  4  35  ? 38.407  294.900 256.386 1.00 45.43  ? 35   ALA D CA  1 
ATOM   8262  C  C   . ALA D  4  35  ? 38.195  293.437 255.943 1.00 48.08  ? 35   ALA D C   1 
ATOM   8263  O  O   . ALA D  4  35  ? 38.950  292.556 256.347 1.00 46.84  ? 35   ALA D O   1 
ATOM   8264  C  CB  . ALA D  4  35  ? 37.389  295.279 257.490 1.00 46.92  ? 35   ALA D CB  1 
ATOM   8265  N  N   . SER D  4  36  ? 37.126  293.131 255.199 1.00 37.49  ? 36   SER D N   1 
ATOM   8266  C  CA  . SER D  4  36  ? 36.908  291.727 254.817 1.00 59.69  ? 36   SER D CA  1 
ATOM   8267  C  C   . SER D  4  36  ? 38.026  291.254 253.902 1.00 36.66  ? 36   SER D C   1 
ATOM   8268  O  O   . SER D  4  36  ? 38.541  290.142 254.067 1.00 49.62  ? 36   SER D O   1 
ATOM   8269  C  CB  . SER D  4  36  ? 35.546  291.494 254.124 1.00 44.86  ? 36   SER D CB  1 
ATOM   8270  O  OG  . SER D  4  36  ? 35.292  292.491 253.181 1.00 72.27  ? 36   SER D OG  1 
ATOM   8271  N  N   . GLN D  4  37  ? 38.428  292.099 252.949 1.00 32.86  ? 37   GLN D N   1 
ATOM   8272  C  CA  . GLN D  4  37  ? 39.465  291.664 252.017 1.00 36.62  ? 37   GLN D CA  1 
ATOM   8273  C  C   . GLN D  4  37  ? 40.770  291.384 252.743 1.00 39.82  ? 37   GLN D C   1 
ATOM   8274  O  O   . GLN D  4  37  ? 41.426  290.375 252.462 1.00 50.99  ? 37   GLN D O   1 
ATOM   8275  C  CB  . GLN D  4  37  ? 39.629  292.697 250.888 1.00 39.34  ? 37   GLN D CB  1 
ATOM   8276  C  CG  . GLN D  4  37  ? 38.429  292.692 249.947 1.00 41.72  ? 37   GLN D CG  1 
ATOM   8277  C  CD  . GLN D  4  37  ? 38.358  293.911 249.078 1.00 49.24  ? 37   GLN D CD  1 
ATOM   8278  O  OE1 . GLN D  4  37  ? 38.840  294.974 249.456 1.00 46.85  ? 37   GLN D OE1 1 
ATOM   8279  N  NE2 . GLN D  4  37  ? 37.762  293.765 247.878 1.00 42.76  ? 37   GLN D NE2 1 
ATOM   8280  N  N   . LYS D  4  38  ? 41.133  292.225 253.731 1.00 43.62  ? 38   LYS D N   1 
ATOM   8281  C  CA  . LYS D  4  38  ? 42.304  291.949 254.571 1.00 36.97  ? 38   LYS D CA  1 
ATOM   8282  C  C   . LYS D  4  38  ? 42.200  290.572 255.216 1.00 43.35  ? 38   LYS D C   1 
ATOM   8283  O  O   . LYS D  4  38  ? 43.174  289.803 255.233 1.00 47.65  ? 38   LYS D O   1 
ATOM   8284  C  CB  . LYS D  4  38  ? 42.478  293.009 255.685 1.00 47.46  ? 38   LYS D CB  1 
ATOM   8285  C  CG  . LYS D  4  38  ? 42.896  294.423 255.196 1.00 55.98  ? 38   LYS D CG  1 
ATOM   8286  C  CD  . LYS D  4  38  ? 43.089  295.333 256.412 1.00 164.36 ? 38   LYS D CD  1 
ATOM   8287  C  CE  . LYS D  4  38  ? 42.982  296.801 256.077 1.00 70.83  ? 38   LYS D CE  1 
ATOM   8288  N  NZ  . LYS D  4  38  ? 43.892  297.207 254.956 1.00 115.16 ? 38   LYS D NZ  1 
ATOM   8289  N  N   . ALA D  4  39  ? 41.036  290.253 255.806 1.00 47.17  ? 39   ALA D N   1 
ATOM   8290  C  CA  . ALA D  4  39  ? 40.894  288.925 256.420 1.00 52.69  ? 39   ALA D CA  1 
ATOM   8291  C  C   . ALA D  4  39  ? 40.960  287.793 255.372 1.00 47.07  ? 39   ALA D C   1 
ATOM   8292  O  O   . ALA D  4  39  ? 41.486  286.713 255.666 1.00 40.26  ? 39   ALA D O   1 
ATOM   8293  C  CB  . ALA D  4  39  ? 39.598  288.849 257.251 1.00 44.62  ? 39   ALA D CB  1 
ATOM   8294  N  N   . LEU D  4  40  ? 40.514  288.041 254.140 1.00 45.85  ? 40   LEU D N   1 
ATOM   8295  C  CA  . LEU D  4  40  ? 40.657  287.039 253.070 1.00 47.26  ? 40   LEU D CA  1 
ATOM   8296  C  C   . LEU D  4  40  ? 42.113  286.759 252.788 1.00 119.92 ? 40   LEU D C   1 
ATOM   8297  O  O   . LEU D  4  40  ? 42.517  285.610 252.621 1.00 41.96  ? 40   LEU D O   1 
ATOM   8298  C  CB  . LEU D  4  40  ? 39.999  287.513 251.770 1.00 41.79  ? 40   LEU D CB  1 
ATOM   8299  C  CG  . LEU D  4  40  ? 40.024  286.531 250.585 1.00 58.58  ? 40   LEU D CG  1 
ATOM   8300  C  CD1 . LEU D  4  40  ? 39.602  285.094 250.892 1.00 45.71  ? 40   LEU D CD1 1 
ATOM   8301  C  CD2 . LEU D  4  40  ? 39.152  287.105 249.451 1.00 48.97  ? 40   LEU D CD2 1 
ATOM   8302  N  N   . LYS D  4  41  ? 42.908  287.811 252.690 1.00 42.66  ? 41   LYS D N   1 
ATOM   8303  C  CA  . LYS D  4  41  ? 44.338  287.637 252.473 1.00 50.52  ? 41   LYS D CA  1 
ATOM   8304  C  C   . LYS D  4  41  ? 45.012  286.939 253.643 1.00 56.92  ? 41   LYS D C   1 
ATOM   8305  O  O   . LYS D  4  41  ? 45.969  286.186 253.425 1.00 46.02  ? 41   LYS D O   1 
ATOM   8306  C  CB  . LYS D  4  41  ? 45.003  288.986 252.165 1.00 41.11  ? 41   LYS D CB  1 
ATOM   8307  C  CG  . LYS D  4  41  ? 44.427  289.654 250.887 1.00 49.44  ? 41   LYS D CG  1 
ATOM   8308  C  CD  . LYS D  4  41  ? 44.717  288.813 249.569 1.00 40.88  ? 41   LYS D CD  1 
ATOM   8309  C  CE  . LYS D  4  41  ? 46.234  288.849 249.190 1.00 43.24  ? 41   LYS D CE  1 
ATOM   8310  N  NZ  . LYS D  4  41  ? 46.502  288.003 247.935 1.00 38.12  ? 41   LYS D NZ  1 
ATOM   8311  N  N   . GLU D  4  42  ? 44.542  287.147 254.892 1.00 49.07  ? 42   GLU D N   1 
ATOM   8312  C  CA  . GLU D  4  42  ? 45.092  286.362 255.998 1.00 42.09  ? 42   GLU D CA  1 
ATOM   8313  C  C   . GLU D  4  42  ? 44.706  284.902 255.851 1.00 44.86  ? 42   GLU D C   1 
ATOM   8314  O  O   . GLU D  4  42  ? 45.547  284.010 256.004 1.00 46.45  ? 42   GLU D O   1 
ATOM   8315  C  CB  . GLU D  4  42  ? 44.601  286.902 257.370 1.00 46.77  ? 42   GLU D CB  1 
ATOM   8316  C  CG  . GLU D  4  42  ? 45.376  288.102 257.776 1.00 51.93  ? 42   GLU D CG  1 
ATOM   8317  C  CD  . GLU D  4  42  ? 46.883  287.810 257.845 1.00 60.59  ? 42   GLU D CD  1 
ATOM   8318  O  OE1 . GLU D  4  42  ? 47.678  288.659 257.389 1.00 100.25 ? 42   GLU D OE1 1 
ATOM   8319  O  OE2 . GLU D  4  42  ? 47.259  286.732 258.351 1.00 125.27 ? 42   GLU D OE2 1 
ATOM   8320  N  N   . LYS D  4  43  ? 43.432  284.648 255.559 1.00 41.19  ? 43   LYS D N   1 
ATOM   8321  C  CA  . LYS D  4  43  ? 42.979  283.286 255.298 1.00 56.74  ? 43   LYS D CA  1 
ATOM   8322  C  C   . LYS D  4  43  ? 43.815  282.620 254.219 1.00 97.78  ? 43   LYS D C   1 
ATOM   8323  O  O   . LYS D  4  43  ? 44.133  281.439 254.313 1.00 43.47  ? 43   LYS D O   1 
ATOM   8324  C  CB  . LYS D  4  43  ? 41.504  283.289 254.903 1.00 41.39  ? 43   LYS D CB  1 
ATOM   8325  C  CG  . LYS D  4  43  ? 40.886  281.894 255.034 1.00 52.91  ? 43   LYS D CG  1 
ATOM   8326  C  CD  . LYS D  4  43  ? 39.378  281.932 254.849 1.00 54.72  ? 43   LYS D CD  1 
ATOM   8327  C  CE  . LYS D  4  43  ? 38.761  280.530 254.922 1.00 57.55  ? 43   LYS D CE  1 
ATOM   8328  N  NZ  . LYS D  4  43  ? 37.284  280.524 254.708 1.00 51.78  ? 43   LYS D NZ  1 
ATOM   8329  N  N   . GLU D  4  44  ? 44.222  283.375 253.205 1.00 52.37  ? 44   GLU D N   1 
ATOM   8330  C  CA  . GLU D  4  44  ? 45.026  282.792 252.136 1.00 45.12  ? 44   GLU D CA  1 
ATOM   8331  C  C   . GLU D  4  44  ? 46.376  282.267 252.624 1.00 52.79  ? 44   GLU D C   1 
ATOM   8332  O  O   . GLU D  4  44  ? 46.972  281.419 251.962 1.00 45.01  ? 44   GLU D O   1 
ATOM   8333  C  CB  . GLU D  4  44  ? 45.201  283.856 251.030 1.00 49.77  ? 44   GLU D CB  1 
ATOM   8334  C  CG  . GLU D  4  44  ? 45.883  283.389 249.707 1.00 48.55  ? 44   GLU D CG  1 
ATOM   8335  C  CD  . GLU D  4  44  ? 46.160  284.562 248.773 1.00 62.10  ? 44   GLU D CD  1 
ATOM   8336  O  OE1 . GLU D  4  44  ? 46.410  285.690 249.251 1.00 40.62  ? 44   GLU D OE1 1 
ATOM   8337  O  OE2 . GLU D  4  44  ? 46.128  284.374 247.555 1.00 44.91  ? 44   GLU D OE2 1 
ATOM   8338  N  N   . LYS D  4  45  ? 46.887  282.733 253.763 1.00 42.74  ? 45   LYS D N   1 
ATOM   8339  C  CA  . LYS D  4  45  ? 48.134  282.153 254.266 1.00 47.57  ? 45   LYS D CA  1 
ATOM   8340  C  C   . LYS D  4  45  ? 47.968  280.746 254.855 1.00 48.51  ? 45   LYS D C   1 
ATOM   8341  O  O   . LYS D  4  45  ? 48.981  280.045 255.018 1.00 46.70  ? 45   LYS D O   1 
ATOM   8342  C  CB  . LYS D  4  45  ? 48.788  283.073 255.307 1.00 57.81  ? 45   LYS D CB  1 
ATOM   8343  C  CG  . LYS D  4  45  ? 48.953  284.519 254.805 1.00 58.49  ? 45   LYS D CG  1 
ATOM   8344  C  CD  . LYS D  4  45  ? 49.907  285.297 255.712 1.00 61.79  ? 45   LYS D CD  1 
ATOM   8345  C  CE  . LYS D  4  45  ? 49.635  286.800 255.723 1.00 63.05  ? 45   LYS D CE  1 
ATOM   8346  N  NZ  . LYS D  4  45  ? 49.522  287.460 254.413 1.00 103.62 ? 45   LYS D NZ  1 
ATOM   8347  N  N   . ALA D  4  46  ? 46.737  280.316 255.180 1.00 49.69  ? 46   ALA D N   1 
ATOM   8348  C  CA  . ALA D  4  46  ? 46.451  278.934 255.581 1.00 63.29  ? 46   ALA D CA  1 
ATOM   8349  C  C   . ALA D  4  46  ? 46.183  278.069 254.337 1.00 84.91  ? 46   ALA D C   1 
ATOM   8350  O  O   . ALA D  4  46  ? 46.221  278.552 253.215 1.00 47.23  ? 46   ALA D O   1 
ATOM   8351  C  CB  . ALA D  4  46  ? 45.273  278.887 256.569 1.00 43.85  ? 46   ALA D CB  1 
ATOM   8352  N  N   . SER D  4  47  ? 45.864  276.789 254.527 1.00 43.02  ? 47   SER D N   1 
ATOM   8353  C  CA  . SER D  4  47  ? 45.658  275.872 253.394 1.00 63.09  ? 47   SER D CA  1 
ATOM   8354  C  C   . SER D  4  47  ? 44.555  276.331 252.430 1.00 61.38  ? 47   SER D C   1 
ATOM   8355  O  O   . SER D  4  47  ? 43.427  276.630 252.845 1.00 42.19  ? 47   SER D O   1 
ATOM   8356  C  CB  . SER D  4  47  ? 45.323  274.480 253.939 1.00 58.72  ? 47   SER D CB  1 
ATOM   8357  O  OG  . SER D  4  47  ? 44.640  273.697 252.979 1.00 51.18  ? 47   SER D OG  1 
ATOM   8358  N  N   . TRP D  4  48  ? 44.852  276.318 251.118 1.00 50.64  ? 48   TRP D N   1 
ATOM   8359  C  CA  . TRP D  4  48  ? 43.856  276.760 250.140 1.00 70.03  ? 48   TRP D CA  1 
ATOM   8360  C  C   . TRP D  4  48  ? 42.661  275.817 250.058 1.00 42.87  ? 48   TRP D C   1 
ATOM   8361  O  O   . TRP D  4  48  ? 41.602  276.221 249.528 1.00 43.82  ? 48   TRP D O   1 
ATOM   8362  C  CB  . TRP D  4  48  ? 44.515  276.941 248.751 1.00 41.66  ? 48   TRP D CB  1 
ATOM   8363  C  CG  . TRP D  4  48  ? 45.568  278.012 248.766 1.00 40.00  ? 48   TRP D CG  1 
ATOM   8364  C  CD1 . TRP D  4  48  ? 45.662  279.082 249.644 1.00 44.77  ? 48   TRP D CD1 1 
ATOM   8365  C  CD2 . TRP D  4  48  ? 46.726  278.098 247.907 1.00 37.99  ? 48   TRP D CD2 1 
ATOM   8366  N  NE1 . TRP D  4  48  ? 46.773  279.835 249.340 1.00 46.50  ? 48   TRP D NE1 1 
ATOM   8367  C  CE2 . TRP D  4  48  ? 47.430  279.269 248.272 1.00 42.90  ? 48   TRP D CE2 1 
ATOM   8368  C  CE3 . TRP D  4  48  ? 47.196  277.322 246.830 1.00 39.82  ? 48   TRP D CE3 1 
ATOM   8369  C  CZ2 . TRP D  4  48  ? 48.586  279.687 247.605 1.00 39.09  ? 48   TRP D CZ2 1 
ATOM   8370  C  CZ3 . TRP D  4  48  ? 48.345  277.734 246.151 1.00 40.25  ? 48   TRP D CZ3 1 
ATOM   8371  C  CH2 . TRP D  4  48  ? 49.028  278.900 246.544 1.00 45.32  ? 48   TRP D CH2 1 
ATOM   8372  N  N   . SER D  4  49  ? 42.795  274.578 250.566 1.00 59.35  ? 49   SER D N   1 
ATOM   8373  C  CA  . SER D  4  49  ? 41.663  273.653 250.604 1.00 65.79  ? 49   SER D CA  1 
ATOM   8374  C  C   . SER D  4  49  ? 40.543  274.168 251.499 1.00 55.73  ? 49   SER D C   1 
ATOM   8375  O  O   . SER D  4  49  ? 39.383  273.806 251.309 1.00 53.92  ? 49   SER D O   1 
ATOM   8376  C  CB  . SER D  4  49  ? 42.116  272.271 251.092 1.00 58.32  ? 49   SER D CB  1 
ATOM   8377  O  OG  . SER D  4  49  ? 43.093  271.711 250.226 1.00 61.18  ? 49   SER D OG  1 
ATOM   8378  N  N   . SER D  4  50  ? 40.872  274.997 252.496 1.00 45.22  ? 50   SER D N   1 
ATOM   8379  C  CA  . SER D  4  50  ? 39.845  275.626 253.338 1.00 45.41  ? 50   SER D CA  1 
ATOM   8380  C  C   . SER D  4  50  ? 39.216  276.881 252.741 1.00 85.98  ? 50   SER D C   1 
ATOM   8381  O  O   . SER D  4  50  ? 38.267  277.396 253.335 1.00 47.06  ? 50   SER D O   1 
ATOM   8382  C  CB  . SER D  4  50  ? 40.455  275.983 254.701 1.00 40.54  ? 50   SER D CB  1 
ATOM   8383  O  OG  . SER D  4  50  ? 40.999  274.807 255.263 1.00 60.04  ? 50   SER D OG  1 
ATOM   8384  N  N   . LEU D  4  51  ? 39.749  277.429 251.652 1.00 77.51  ? 51   LEU D N   1 
ATOM   8385  C  CA  . LEU D  4  51  ? 39.051  278.496 250.947 1.00 52.78  ? 51   LEU D CA  1 
ATOM   8386  C  C   . LEU D  4  51  ? 37.834  277.904 250.245 1.00 51.60  ? 51   LEU D C   1 
ATOM   8387  O  O   . LEU D  4  51  ? 37.921  276.845 249.599 1.00 52.80  ? 51   LEU D O   1 
ATOM   8388  C  CB  . LEU D  4  51  ? 39.981  279.173 249.894 1.00 36.80  ? 51   LEU D CB  1 
ATOM   8389  C  CG  . LEU D  4  51  ? 41.352  279.691 250.289 1.00 91.77  ? 51   LEU D CG  1 
ATOM   8390  C  CD1 . LEU D  4  51  ? 42.185  280.007 249.039 1.00 54.75  ? 51   LEU D CD1 1 
ATOM   8391  C  CD2 . LEU D  4  51  ? 41.116  280.889 251.222 1.00 42.14  ? 51   LEU D CD2 1 
ATOM   8392  N  N   . SER D  4  52  ? 36.706  278.605 250.325 1.00 51.33  ? 52   SER D N   1 
ATOM   8393  C  CA  . SER D  4  52  ? 35.578  278.263 249.462 1.00 61.77  ? 52   SER D CA  1 
ATOM   8394  C  C   . SER D  4  52  ? 35.824  278.763 248.037 1.00 131.67 ? 52   SER D C   1 
ATOM   8395  O  O   . SER D  4  52  ? 36.699  279.577 247.784 1.00 44.38  ? 52   SER D O   1 
ATOM   8396  C  CB  . SER D  4  52  ? 34.292  278.864 250.001 1.00 187.62 ? 52   SER D CB  1 
ATOM   8397  O  OG  . SER D  4  52  ? 34.295  280.245 249.731 1.00 50.35  ? 52   SER D OG  1 
ATOM   8398  N  N   . ILE D  4  53  ? 35.016  278.269 247.102 1.00 45.42  ? 53   ILE D N   1 
ATOM   8399  C  CA  . ILE D  4  53  ? 35.075  278.715 245.702 1.00 44.57  ? 53   ILE D CA  1 
ATOM   8400  C  C   . ILE D  4  53  ? 34.902  280.232 245.586 1.00 66.58  ? 53   ILE D C   1 
ATOM   8401  O  O   . ILE D  4  53  ? 35.653  280.920 244.879 1.00 49.20  ? 53   ILE D O   1 
ATOM   8402  C  CB  . ILE D  4  53  ? 33.994  277.992 244.877 1.00 47.06  ? 53   ILE D CB  1 
ATOM   8403  C  CG1 . ILE D  4  53  ? 34.239  276.481 244.831 1.00 56.09  ? 53   ILE D CG1 1 
ATOM   8404  C  CG2 . ILE D  4  53  ? 33.929  278.589 243.489 1.00 47.09  ? 53   ILE D CG2 1 
ATOM   8405  C  CD1 . ILE D  4  53  ? 35.468  276.091 244.015 1.00 58.07  ? 53   ILE D CD1 1 
ATOM   8406  N  N   . ASP D  4  54  ? 33.851  280.777 246.202 1.00 48.28  ? 54   ASP D N   1 
ATOM   8407  C  CA  . ASP D  4  54  ? 33.675  282.232 246.169 1.00 64.65  ? 54   ASP D CA  1 
ATOM   8408  C  C   . ASP D  4  54  ? 34.906  282.957 246.725 1.00 38.94  ? 54   ASP D C   1 
ATOM   8409  O  O   . ASP D  4  54  ? 35.343  283.970 246.156 1.00 48.18  ? 54   ASP D O   1 
ATOM   8410  C  CB  . ASP D  4  54  ? 32.417  282.655 246.942 1.00 72.39  ? 54   ASP D CB  1 
ATOM   8411  C  CG  . ASP D  4  54  ? 31.104  282.298 246.213 1.00 63.70  ? 54   ASP D CG  1 
ATOM   8412  O  OD1 . ASP D  4  54  ? 31.148  281.799 245.063 1.00 57.13  ? 54   ASP D OD1 1 
ATOM   8413  O  OD2 . ASP D  4  54  ? 30.023  282.525 246.802 1.00 160.35 ? 54   ASP D OD2 1 
ATOM   8414  N  N   . GLU D  4  55  ? 35.543  282.406 247.774 1.00 40.84  ? 55   GLU D N   1 
ATOM   8415  C  CA  . GLU D  4  55  ? 36.726  283.067 248.304 1.00 48.67  ? 55   GLU D CA  1 
ATOM   8416  C  C   . GLU D  4  55  ? 37.895  282.964 247.353 1.00 188.62 ? 55   GLU D C   1 
ATOM   8417  O  O   . GLU D  4  55  ? 38.712  283.873 247.305 1.00 42.16  ? 55   GLU D O   1 
ATOM   8418  C  CB  . GLU D  4  55  ? 37.131  282.486 249.652 1.00 45.71  ? 55   GLU D CB  1 
ATOM   8419  C  CG  . GLU D  4  55  ? 36.070  282.794 250.709 1.00 51.44  ? 55   GLU D CG  1 
ATOM   8420  C  CD  . GLU D  4  55  ? 36.487  282.359 252.075 1.00 154.95 ? 55   GLU D CD  1 
ATOM   8421  O  OE1 . GLU D  4  55  ? 36.463  283.167 253.014 1.00 59.41  ? 55   GLU D OE1 1 
ATOM   8422  O  OE2 . GLU D  4  55  ? 36.868  281.206 252.211 1.00 48.59  ? 55   GLU D OE2 1 
ATOM   8423  N  N   . LYS D  4  56  ? 38.001  281.857 246.630 1.00 43.23  ? 56   LYS D N   1 
ATOM   8424  C  CA  . LYS D  4  56  ? 39.048  281.723 245.608 1.00 45.52  ? 56   LYS D CA  1 
ATOM   8425  C  C   . LYS D  4  56  ? 38.841  282.713 244.462 1.00 43.62  ? 56   LYS D C   1 
ATOM   8426  O  O   . LYS D  4  56  ? 39.788  283.357 244.010 1.00 39.76  ? 56   LYS D O   1 
ATOM   8427  C  CB  . LYS D  4  56  ? 39.082  280.284 245.102 1.00 46.28  ? 56   LYS D CB  1 
ATOM   8428  C  CG  . LYS D  4  56  ? 39.721  279.331 246.144 1.00 42.19  ? 56   LYS D CG  1 
ATOM   8429  C  CD  . LYS D  4  56  ? 39.586  277.853 245.758 1.00 47.11  ? 56   LYS D CD  1 
ATOM   8430  C  CE  . LYS D  4  56  ? 40.541  276.999 246.617 1.00 42.79  ? 56   LYS D CE  1 
ATOM   8431  N  NZ  . LYS D  4  56  ? 40.370  275.558 246.236 1.00 43.31  ? 56   LYS D NZ  1 
ATOM   8432  N  N   . VAL D  4  57  ? 37.596  282.857 243.989 1.00 40.51  ? 57   VAL D N   1 
ATOM   8433  C  CA  . VAL D  4  57  ? 37.287  283.825 242.954 1.00 41.17  ? 57   VAL D CA  1 
ATOM   8434  C  C   . VAL D  4  57  ? 37.552  285.242 243.454 1.00 51.84  ? 57   VAL D C   1 
ATOM   8435  O  O   . VAL D  4  57  ? 38.081  286.079 242.717 1.00 43.34  ? 57   VAL D O   1 
ATOM   8436  C  CB  . VAL D  4  57  ? 35.841  283.630 242.454 1.00 44.28  ? 57   VAL D CB  1 
ATOM   8437  C  CG1 . VAL D  4  57  ? 35.415  284.781 241.511 1.00 43.29  ? 57   VAL D CG1 1 
ATOM   8438  C  CG2 . VAL D  4  57  ? 35.704  282.246 241.721 1.00 43.18  ? 57   VAL D CG2 1 
ATOM   8439  N  N   . GLU D  4  58  ? 37.189  285.550 244.701 1.00 46.63  ? 58   GLU D N   1 
ATOM   8440  C  CA  . GLU D  4  58  ? 37.502  286.892 245.198 1.00 39.62  ? 58   GLU D CA  1 
ATOM   8441  C  C   . GLU D  4  58  ? 38.991  287.136 245.190 1.00 50.89  ? 58   GLU D C   1 
ATOM   8442  O  O   . GLU D  4  58  ? 39.428  288.219 244.823 1.00 37.24  ? 58   GLU D O   1 
ATOM   8443  C  CB  . GLU D  4  58  ? 36.952  287.137 246.627 1.00 35.18  ? 58   GLU D CB  1 
ATOM   8444  C  CG  . GLU D  4  58  ? 35.952  288.260 246.666 1.00 125.65 ? 58   GLU D CG  1 
ATOM   8445  C  CD  . GLU D  4  58  ? 36.389  289.398 247.554 1.00 216.90 ? 58   GLU D CD  1 
ATOM   8446  O  OE1 . GLU D  4  58  ? 36.780  290.473 247.013 1.00 57.45  ? 58   GLU D OE1 1 
ATOM   8447  O  OE2 . GLU D  4  58  ? 36.334  289.201 248.791 1.00 96.26  ? 58   GLU D OE2 1 
ATOM   8448  N  N   . LEU D  4  59  ? 39.785  286.162 245.635 1.00 38.31  ? 59   LEU D N   1 
ATOM   8449  C  CA  . LEU D  4  59  ? 41.240  286.315 245.584 1.00 38.68  ? 59   LEU D CA  1 
ATOM   8450  C  C   . LEU D  4  59  ? 41.722  286.575 244.182 1.00 200.49 ? 59   LEU D C   1 
ATOM   8451  O  O   . LEU D  4  59  ? 42.532  287.456 243.951 1.00 40.28  ? 59   LEU D O   1 
ATOM   8452  C  CB  . LEU D  4  59  ? 41.960  285.076 246.113 1.00 43.46  ? 59   LEU D CB  1 
ATOM   8453  C  CG  . LEU D  4  59  ? 41.919  284.889 247.630 1.00 62.20  ? 59   LEU D CG  1 
ATOM   8454  C  CD1 . LEU D  4  59  ? 42.383  283.467 247.922 1.00 44.17  ? 59   LEU D CD1 1 
ATOM   8455  C  CD2 . LEU D  4  59  ? 42.818  285.934 248.303 1.00 41.80  ? 59   LEU D CD2 1 
ATOM   8456  N  N   . TYR D  4  60  ? 41.307  285.756 243.237 1.00 35.78  ? 60   TYR D N   1 
ATOM   8457  C  CA  . TYR D  4  60  ? 41.700  285.948 241.834 1.00 34.20  ? 60   TYR D CA  1 
ATOM   8458  C  C   . TYR D  4  60  ? 41.364  287.355 241.352 1.00 40.42  ? 60   TYR D C   1 
ATOM   8459  O  O   . TYR D  4  60  ? 42.195  288.037 240.752 1.00 38.10  ? 60   TYR D O   1 
ATOM   8460  C  CB  . TYR D  4  60  ? 41.010  284.927 240.951 1.00 33.20  ? 60   TYR D CB  1 
ATOM   8461  C  CG  . TYR D  4  60  ? 41.505  284.998 239.502 1.00 37.20  ? 60   TYR D CG  1 
ATOM   8462  C  CD1 . TYR D  4  60  ? 42.604  284.249 239.064 1.00 45.42  ? 60   TYR D CD1 1 
ATOM   8463  C  CD2 . TYR D  4  60  ? 40.800  285.746 238.571 1.00 39.11  ? 60   TYR D CD2 1 
ATOM   8464  C  CE1 . TYR D  4  60  ? 43.036  284.300 237.677 1.00 36.06  ? 60   TYR D CE1 1 
ATOM   8465  C  CE2 . TYR D  4  60  ? 41.221  285.813 237.197 1.00 39.88  ? 60   TYR D CE2 1 
ATOM   8466  C  CZ  . TYR D  4  60  ? 42.330  285.089 236.775 1.00 40.26  ? 60   TYR D CZ  1 
ATOM   8467  O  OH  . TYR D  4  60  ? 42.710  285.193 235.429 1.00 38.82  ? 60   TYR D OH  1 
ATOM   8468  N  N   . ARG D  4  61  ? 40.166  287.822 241.665 1.00 38.75  ? 61   ARG D N   1 
ATOM   8469  C  CA  . ARG D  4  61  ? 39.759  289.140 241.154 1.00 35.40  ? 61   ARG D CA  1 
ATOM   8470  C  C   . ARG D  4  61  ? 40.438  290.286 241.911 1.00 47.70  ? 61   ARG D C   1 
ATOM   8471  O  O   . ARG D  4  61  ? 40.406  291.426 241.430 1.00 43.47  ? 61   ARG D O   1 
ATOM   8472  C  CB  . ARG D  4  61  ? 38.218  289.301 241.224 1.00 40.62  ? 61   ARG D CB  1 
ATOM   8473  C  CG  . ARG D  4  61  ? 37.414  288.298 240.395 1.00 44.55  ? 61   ARG D CG  1 
ATOM   8474  C  CD  . ARG D  4  61  ? 37.627  288.561 238.870 1.00 45.37  ? 61   ARG D CD  1 
ATOM   8475  N  NE  . ARG D  4  61  ? 36.758  287.682 238.076 1.00 39.90  ? 61   ARG D NE  1 
ATOM   8476  C  CZ  . ARG D  4  61  ? 36.702  287.658 236.747 1.00 40.81  ? 61   ARG D CZ  1 
ATOM   8477  N  NH1 . ARG D  4  61  ? 37.455  288.493 236.037 1.00 37.60  ? 61   ARG D NH1 1 
ATOM   8478  N  NH2 . ARG D  4  61  ? 35.844  286.828 236.134 1.00 38.96  ? 61   ARG D NH2 1 
ATOM   8479  N  N   . LEU D  4  62  ? 41.062  290.031 243.067 1.00 38.44  ? 62   LEU D N   1 
ATOM   8480  C  CA  . LEU D  4  62  ? 41.914  291.053 243.674 1.00 44.39  ? 62   LEU D CA  1 
ATOM   8481  C  C   . LEU D  4  62  ? 43.217  291.187 242.908 1.00 44.94  ? 62   LEU D C   1 
ATOM   8482  O  O   . LEU D  4  62  ? 43.754  292.293 242.752 1.00 41.10  ? 62   LEU D O   1 
ATOM   8483  C  CB  . LEU D  4  62  ? 42.236  290.698 245.139 1.00 40.35  ? 62   LEU D CB  1 
ATOM   8484  C  CG  . LEU D  4  62  ? 41.063  290.784 246.146 1.00 66.51  ? 62   LEU D CG  1 
ATOM   8485  C  CD1 . LEU D  4  62  ? 41.456  290.374 247.568 1.00 42.07  ? 62   LEU D CD1 1 
ATOM   8486  C  CD2 . LEU D  4  62  ? 40.530  292.185 246.187 1.00 37.78  ? 62   LEU D CD2 1 
ATOM   8487  N  N   . LYS D  4  63  ? 43.761  290.060 242.476 1.00 39.21  ? 63   LYS D N   1 
ATOM   8488  C  CA  . LYS D  4  63  ? 45.043  290.016 241.766 1.00 42.53  ? 63   LYS D CA  1 
ATOM   8489  C  C   . LYS D  4  63  ? 44.902  290.517 240.325 1.00 47.51  ? 63   LYS D C   1 
ATOM   8490  O  O   . LYS D  4  63  ? 45.717  291.332 239.852 1.00 34.63  ? 63   LYS D O   1 
ATOM   8491  C  CB  . LYS D  4  63  ? 45.574  288.578 241.785 1.00 41.69  ? 63   LYS D CB  1 
ATOM   8492  C  CG  . LYS D  4  63  ? 46.927  288.350 241.181 1.00 42.63  ? 63   LYS D CG  1 
ATOM   8493  C  CD  . LYS D  4  63  ? 48.022  289.071 241.913 1.00 41.99  ? 63   LYS D CD  1 
ATOM   8494  C  CE  . LYS D  4  63  ? 48.654  288.226 242.989 1.00 52.02  ? 63   LYS D CE  1 
ATOM   8495  N  NZ  . LYS D  4  63  ? 49.938  288.864 243.390 1.00 72.56  ? 63   LYS D NZ  1 
ATOM   8496  N  N   . PHE D  4  64  ? 43.870  290.041 239.626 1.00 43.96  ? 64   PHE D N   1 
ATOM   8497  C  CA  . PHE D  4  64  ? 43.695  290.244 238.194 1.00 38.67  ? 64   PHE D CA  1 
ATOM   8498  C  C   . PHE D  4  64  ? 42.365  290.931 237.898 1.00 43.61  ? 64   PHE D C   1 
ATOM   8499  O  O   . PHE D  4  64  ? 41.397  290.816 238.649 1.00 38.43  ? 64   PHE D O   1 
ATOM   8500  C  CB  . PHE D  4  64  ? 43.756  288.899 237.414 1.00 38.77  ? 64   PHE D CB  1 
ATOM   8501  C  CG  . PHE D  4  64  ? 44.988  288.115 237.695 1.00 40.96  ? 64   PHE D CG  1 
ATOM   8502  C  CD1 . PHE D  4  64  ? 46.226  288.560 237.210 1.00 38.08  ? 64   PHE D CD1 1 
ATOM   8503  C  CD2 . PHE D  4  64  ? 44.944  286.988 238.527 1.00 36.31  ? 64   PHE D CD2 1 
ATOM   8504  C  CE1 . PHE D  4  64  ? 47.397  287.874 237.447 1.00 33.39  ? 64   PHE D CE1 1 
ATOM   8505  C  CE2 . PHE D  4  64  ? 46.137  286.260 238.788 1.00 29.86  ? 64   PHE D CE2 1 
ATOM   8506  C  CZ  . PHE D  4  64  ? 47.382  286.719 238.278 1.00 35.62  ? 64   PHE D CZ  1 
ATOM   8507  N  N   . LYS D  4  65  ? 42.321  291.650 236.786 1.00 40.02  ? 65   LYS D N   1 
ATOM   8508  C  CA  . LYS D  4  65  ? 41.064  292.266 236.342 1.00 39.84  ? 65   LYS D CA  1 
ATOM   8509  C  C   . LYS D  4  65  ? 40.241  291.269 235.516 1.00 37.10  ? 65   LYS D C   1 
ATOM   8510  O  O   . LYS D  4  65  ? 39.189  290.799 235.951 1.00 50.82  ? 65   LYS D O   1 
ATOM   8511  C  CB  . LYS D  4  65  ? 41.384  293.557 235.575 1.00 40.08  ? 65   LYS D CB  1 
ATOM   8512  C  CG  . LYS D  4  65  ? 40.168  294.331 235.035 1.00 42.43  ? 65   LYS D CG  1 
ATOM   8513  C  CD  . LYS D  4  65  ? 40.664  295.707 234.476 1.00 44.88  ? 65   LYS D CD  1 
ATOM   8514  C  CE  . LYS D  4  65  ? 39.562  296.457 233.743 1.00 63.81  ? 65   LYS D CE  1 
ATOM   8515  N  NZ  . LYS D  4  65  ? 39.352  295.888 232.368 1.00 152.69 ? 65   LYS D NZ  1 
ATOM   8516  N  N   . GLU D  4  66  ? 40.719  290.922 234.316 1.00 39.12  ? 66   GLU D N   1 
ATOM   8517  C  CA  . GLU D  4  66  ? 40.040  289.928 233.486 1.00 44.23  ? 66   GLU D CA  1 
ATOM   8518  C  C   . GLU D  4  66  ? 40.790  288.600 233.468 1.00 33.78  ? 66   GLU D C   1 
ATOM   8519  O  O   . GLU D  4  66  ? 42.023  288.563 233.596 1.00 38.02  ? 66   GLU D O   1 
ATOM   8520  C  CB  . GLU D  4  66  ? 39.886  290.453 232.036 1.00 38.93  ? 66   GLU D CB  1 
ATOM   8521  C  CG  . GLU D  4  66  ? 38.925  291.582 231.896 1.00 47.30  ? 66   GLU D CG  1 
ATOM   8522  C  CD  . GLU D  4  66  ? 38.609  291.882 230.412 1.00 67.77  ? 66   GLU D CD  1 
ATOM   8523  O  OE1 . GLU D  4  66  ? 37.430  291.911 230.050 1.00 56.07  ? 66   GLU D OE1 1 
ATOM   8524  O  OE2 . GLU D  4  66  ? 39.538  292.063 229.604 1.00 44.53  ? 66   GLU D OE2 1 
ATOM   8525  N  N   . SER D  4  67  ? 40.026  287.503 233.352 1.00 39.72  ? 67   SER D N   1 
ATOM   8526  C  CA  . SER D  4  67  ? 40.575  286.178 233.071 1.00 42.45  ? 67   SER D CA  1 
ATOM   8527  C  C   . SER D  4  67  ? 41.103  286.100 231.642 1.00 42.52  ? 67   SER D C   1 
ATOM   8528  O  O   . SER D  4  67  ? 40.839  286.978 230.802 1.00 38.81  ? 67   SER D O   1 
ATOM   8529  C  CB  . SER D  4  67  ? 39.520  285.094 233.241 1.00 35.40  ? 67   SER D CB  1 
ATOM   8530  O  OG  . SER D  4  67  ? 38.492  285.312 232.294 1.00 39.36  ? 67   SER D OG  1 
ATOM   8531  N  N   . PHE D  4  68  ? 41.851  285.015 231.364 1.00 38.90  ? 68   PHE D N   1 
ATOM   8532  C  CA  . PHE D  4  68  ? 42.308  284.788 229.997 1.00 36.23  ? 68   PHE D CA  1 
ATOM   8533  C  C   . PHE D  4  68  ? 41.127  284.694 229.043 1.00 40.10  ? 68   PHE D C   1 
ATOM   8534  O  O   . PHE D  4  68  ? 41.130  285.330 227.976 1.00 37.59  ? 68   PHE D O   1 
ATOM   8535  C  CB  . PHE D  4  68  ? 43.174  283.531 229.877 1.00 40.87  ? 68   PHE D CB  1 
ATOM   8536  C  CG  . PHE D  4  68  ? 44.622  283.797 230.029 1.00 36.45  ? 68   PHE D CG  1 
ATOM   8537  C  CD1 . PHE D  4  68  ? 45.110  284.365 231.233 1.00 36.63  ? 68   PHE D CD1 1 
ATOM   8538  C  CD2 . PHE D  4  68  ? 45.526  283.457 228.995 1.00 36.04  ? 68   PHE D CD2 1 
ATOM   8539  C  CE1 . PHE D  4  68  ? 46.487  284.639 231.393 1.00 39.70  ? 68   PHE D CE1 1 
ATOM   8540  C  CE2 . PHE D  4  68  ? 46.875  283.707 229.156 1.00 37.08  ? 68   PHE D CE2 1 
ATOM   8541  C  CZ  . PHE D  4  68  ? 47.360  284.304 230.360 1.00 34.74  ? 68   PHE D CZ  1 
ATOM   8542  N  N   . ALA D  4  69  ? 40.080  283.950 229.443 1.00 41.25  ? 69   ALA D N   1 
ATOM   8543  C  CA  . ALA D  4  69  ? 38.926  283.806 228.538 1.00 35.22  ? 69   ALA D CA  1 
ATOM   8544  C  C   . ALA D  4  69  ? 38.276  285.167 228.263 1.00 34.69  ? 69   ALA D C   1 
ATOM   8545  O  O   . ALA D  4  69  ? 37.868  285.454 227.139 1.00 40.22  ? 69   ALA D O   1 
ATOM   8546  C  CB  . ALA D  4  69  ? 37.893  282.843 229.145 1.00 37.49  ? 69   ALA D CB  1 
ATOM   8547  N  N   . GLU D  4  70  ? 38.122  286.004 229.314 1.00 38.41  ? 70   GLU D N   1 
ATOM   8548  C  CA  . GLU D  4  70  ? 37.555  287.339 229.097 1.00 37.30  ? 70   GLU D CA  1 
ATOM   8549  C  C   . GLU D  4  70  ? 38.437  288.181 228.178 1.00 44.00  ? 70   GLU D C   1 
ATOM   8550  O  O   . GLU D  4  70  ? 37.965  288.759 227.180 1.00 42.93  ? 70   GLU D O   1 
ATOM   8551  C  CB  . GLU D  4  70  ? 37.333  288.039 230.446 1.00 34.69  ? 70   GLU D CB  1 
ATOM   8552  C  CG  . GLU D  4  70  ? 36.163  287.377 231.222 1.00 38.95  ? 70   GLU D CG  1 
ATOM   8553  C  CD  . GLU D  4  70  ? 36.183  287.705 232.717 1.00 58.55  ? 70   GLU D CD  1 
ATOM   8554  O  OE1 . GLU D  4  70  ? 37.169  288.331 233.161 1.00 43.54  ? 70   GLU D OE1 1 
ATOM   8555  O  OE2 . GLU D  4  70  ? 35.225  287.345 233.432 1.00 50.66  ? 70   GLU D OE2 1 
ATOM   8556  N  N   . MET D  4  71  ? 39.735  288.228 228.468 1.00 40.25  ? 71   MET D N   1 
ATOM   8557  C  CA  . MET D  4  71  ? 40.610  289.123 227.730 1.00 37.64  ? 71   MET D CA  1 
ATOM   8558  C  C   . MET D  4  71  ? 40.825  288.671 226.287 1.00 45.30  ? 71   MET D C   1 
ATOM   8559  O  O   . MET D  4  71  ? 41.180  289.496 225.453 1.00 45.81  ? 71   MET D O   1 
ATOM   8560  C  CB  . MET D  4  71  ? 41.970  289.264 228.413 1.00 38.06  ? 71   MET D CB  1 
ATOM   8561  C  CG  . MET D  4  71  ? 42.982  288.180 228.083 1.00 49.31  ? 71   MET D CG  1 
ATOM   8562  S  SD  . MET D  4  71  ? 44.571  288.510 228.905 1.00 45.73  ? 71   MET D SD  1 
ATOM   8563  C  CE  . MET D  4  71  ? 44.214  287.972 230.586 1.00 38.47  ? 71   MET D CE  1 
ATOM   8564  N  N   . ASN D  4  72  ? 40.642  287.391 225.980 1.00 40.21  ? 72   ASN D N   1 
ATOM   8565  C  CA  . ASN D  4  72  ? 40.844  286.881 224.614 1.00 36.75  ? 72   ASN D CA  1 
ATOM   8566  C  C   . ASN D  4  72  ? 39.538  286.742 223.844 1.00 47.69  ? 72   ASN D C   1 
ATOM   8567  O  O   . ASN D  4  72  ? 39.519  286.106 222.784 1.00 43.88  ? 72   ASN D O   1 
ATOM   8568  C  CB  . ASN D  4  72  ? 41.556  285.526 224.620 1.00 37.95  ? 72   ASN D CB  1 
ATOM   8569  C  CG  . ASN D  4  72  ? 42.974  285.596 225.178 1.00 61.50  ? 72   ASN D CG  1 
ATOM   8570  O  OD1 . ASN D  4  72  ? 43.626  286.624 225.097 1.00 43.48  ? 72   ASN D OD1 1 
ATOM   8571  N  ND2 . ASN D  4  72  ? 43.442  284.495 225.779 1.00 42.67  ? 72   ASN D ND2 1 
ATOM   8572  N  N   . ARG D  4  73  ? 38.443  287.288 224.357 1.00 40.93  ? 73   ARG D N   1 
ATOM   8573  C  CA  . ARG D  4  73  ? 37.157  287.050 223.717 1.00 44.05  ? 73   ARG D CA  1 
ATOM   8574  C  C   . ARG D  4  73  ? 37.128  287.736 222.354 1.00 50.82  ? 73   ARG D C   1 
ATOM   8575  O  O   . ARG D  4  73  ? 37.682  288.824 222.173 1.00 41.43  ? 73   ARG D O   1 
ATOM   8576  C  CB  . ARG D  4  73  ? 36.010  287.560 224.586 1.00 47.94  ? 73   ARG D CB  1 
ATOM   8577  C  CG  . ARG D  4  73  ? 35.859  289.076 224.672 1.00 61.22  ? 73   ARG D CG  1 
ATOM   8578  C  CD  . ARG D  4  73  ? 34.678  289.432 225.642 1.00 52.54  ? 73   ARG D CD  1 
ATOM   8579  N  NE  . ARG D  4  73  ? 34.485  290.867 225.845 1.00 102.18 ? 73   ARG D NE  1 
ATOM   8580  C  CZ  . ARG D  4  73  ? 35.127  291.584 226.763 1.00 145.56 ? 73   ARG D CZ  1 
ATOM   8581  N  NH1 . ARG D  4  73  ? 36.029  290.999 227.549 1.00 63.97  ? 73   ARG D NH1 1 
ATOM   8582  N  NH2 . ARG D  4  73  ? 34.873  292.883 226.891 1.00 116.41 ? 73   ARG D NH2 1 
ATOM   8583  N  N   . SER D  4  74  ? 36.523  287.074 221.387 1.00 48.80  ? 74   SER D N   1 
ATOM   8584  C  CA  . SER D  4  74  ? 36.309  287.702 220.099 1.00 53.78  ? 74   SER D CA  1 
ATOM   8585  C  C   . SER D  4  74  ? 35.118  288.672 220.169 1.00 52.67  ? 74   SER D C   1 
ATOM   8586  O  O   . SER D  4  74  ? 34.329  288.659 221.111 1.00 56.21  ? 74   SER D O   1 
ATOM   8587  C  CB  . SER D  4  74  ? 36.075  286.613 219.063 1.00 41.48  ? 74   SER D CB  1 
ATOM   8588  O  OG  . SER D  4  74  ? 34.969  285.825 219.447 1.00 106.00 ? 74   SER D OG  1 
ATOM   8589  N  N   . THR D  4  75  ? 34.998  289.538 219.158 1.00 40.16  ? 75   THR D N   1 
ATOM   8590  C  CA  . THR D  4  75  ? 33.964  290.566 219.178 1.00 35.13  ? 75   THR D CA  1 
ATOM   8591  C  C   . THR D  4  75  ? 33.277  290.608 217.817 1.00 36.89  ? 75   THR D C   1 
ATOM   8592  O  O   . THR D  4  75  ? 33.739  290.008 216.852 1.00 38.73  ? 75   THR D O   1 
ATOM   8593  C  CB  . THR D  4  75  ? 34.519  291.969 219.478 1.00 39.73  ? 75   THR D CB  1 
ATOM   8594  O  OG1 . THR D  4  75  ? 35.141  292.495 218.273 1.00 43.24  ? 75   THR D OG1 1 
ATOM   8595  C  CG2 . THR D  4  75  ? 35.584  291.928 220.613 1.00 42.23  ? 75   THR D CG2 1 
ATOM   8596  N  N   . ASN D  4  76  ? 32.196  291.384 217.755 1.00 36.39  ? 76   ASN D N   1 
ATOM   8597  C  CA  . ASN D  4  76  ? 31.436  291.638 216.528 1.00 44.21  ? 76   ASN D CA  1 
ATOM   8598  C  C   . ASN D  4  76  ? 31.938  292.859 215.766 1.00 39.63  ? 76   ASN D C   1 
ATOM   8599  O  O   . ASN D  4  76  ? 31.274  293.322 214.827 1.00 37.47  ? 76   ASN D O   1 
ATOM   8600  C  CB  . ASN D  4  76  ? 29.947  291.796 216.889 1.00 41.20  ? 76   ASN D CB  1 
ATOM   8601  C  CG  . ASN D  4  76  ? 29.292  290.461 217.146 1.00 44.90  ? 76   ASN D CG  1 
ATOM   8602  O  OD1 . ASN D  4  76  ? 29.421  289.535 216.326 1.00 50.16  ? 76   ASN D OD1 1 
ATOM   8603  N  ND2 . ASN D  4  76  ? 28.618  290.330 218.301 1.00 49.76  ? 76   ASN D ND2 1 
ATOM   8604  N  N   . GLU D  4  77  ? 33.076  293.422 216.169 1.00 36.25  ? 77   GLU D N   1 
ATOM   8605  C  CA  . GLU D  4  77  ? 33.538  294.667 215.551 1.00 33.93  ? 77   GLU D CA  1 
ATOM   8606  C  C   . GLU D  4  77  ? 33.705  294.555 214.028 1.00 37.01  ? 77   GLU D C   1 
ATOM   8607  O  O   . GLU D  4  77  ? 33.519  295.542 213.312 1.00 34.68  ? 77   GLU D O   1 
ATOM   8608  C  CB  . GLU D  4  77  ? 34.864  295.113 216.197 1.00 32.86  ? 77   GLU D CB  1 
ATOM   8609  C  CG  . GLU D  4  77  ? 35.354  296.468 215.634 1.00 31.38  ? 77   GLU D CG  1 
ATOM   8610  C  CD  . GLU D  4  77  ? 36.784  296.770 216.026 1.00 53.89  ? 77   GLU D CD  1 
ATOM   8611  O  OE1 . GLU D  4  77  ? 37.113  297.953 216.170 1.00 31.33  ? 77   GLU D OE1 1 
ATOM   8612  O  OE2 . GLU D  4  77  ? 37.582  295.841 216.239 1.00 39.83  ? 77   GLU D OE2 1 
ATOM   8613  N  N   . TRP D  4  78  ? 34.009  293.366 213.508 1.00 32.11  ? 78   TRP D N   1 
ATOM   8614  C  CA  . TRP D  4  78  ? 34.264  293.252 212.082 1.00 39.49  ? 78   TRP D CA  1 
ATOM   8615  C  C   . TRP D  4  78  ? 33.024  293.594 211.276 1.00 48.55  ? 78   TRP D C   1 
ATOM   8616  O  O   . TRP D  4  78  ? 33.137  294.183 210.189 1.00 37.31  ? 78   TRP D O   1 
ATOM   8617  C  CB  . TRP D  4  78  ? 34.758  291.839 211.729 1.00 38.03  ? 78   TRP D CB  1 
ATOM   8618  C  CG  . TRP D  4  78  ? 33.748  290.755 211.878 1.00 46.51  ? 78   TRP D CG  1 
ATOM   8619  C  CD1 . TRP D  4  78  ? 33.548  289.948 212.976 1.00 50.60  ? 78   TRP D CD1 1 
ATOM   8620  C  CD2 . TRP D  4  78  ? 32.791  290.329 210.891 1.00 41.09  ? 78   TRP D CD2 1 
ATOM   8621  N  NE1 . TRP D  4  78  ? 32.543  289.052 212.722 1.00 52.49  ? 78   TRP D NE1 1 
ATOM   8622  C  CE2 . TRP D  4  78  ? 32.061  289.266 211.454 1.00 55.33  ? 78   TRP D CE2 1 
ATOM   8623  C  CE3 . TRP D  4  78  ? 32.486  290.750 209.578 1.00 42.67  ? 78   TRP D CE3 1 
ATOM   8624  C  CZ2 . TRP D  4  78  ? 31.059  288.616 210.773 1.00 48.98  ? 78   TRP D CZ2 1 
ATOM   8625  C  CZ3 . TRP D  4  78  ? 31.503  290.114 208.914 1.00 49.89  ? 78   TRP D CZ3 1 
ATOM   8626  C  CH2 . TRP D  4  78  ? 30.784  289.055 209.512 1.00 58.62  ? 78   TRP D CH2 1 
ATOM   8627  N  N   . LYS D  4  79  ? 31.839  293.256 211.809 1.00 33.90  ? 79   LYS D N   1 
ATOM   8628  C  CA  . LYS D  4  79  ? 30.586  293.573 211.137 1.00 36.25  ? 79   LYS D CA  1 
ATOM   8629  C  C   . LYS D  4  79  ? 30.432  295.068 210.977 1.00 33.89  ? 79   LYS D C   1 
ATOM   8630  O  O   . LYS D  4  79  ? 30.067  295.556 209.883 1.00 35.37  ? 79   LYS D O   1 
ATOM   8631  C  CB  . LYS D  4  79  ? 29.405  293.014 211.941 1.00 36.83  ? 79   LYS D CB  1 
ATOM   8632  C  CG  . LYS D  4  79  ? 29.406  291.500 212.040 1.00 44.17  ? 79   LYS D CG  1 
ATOM   8633  C  CD  . LYS D  4  79  ? 28.154  291.029 212.848 1.00 39.19  ? 79   LYS D CD  1 
ATOM   8634  C  CE  . LYS D  4  79  ? 28.298  289.567 213.164 1.00 51.37  ? 79   LYS D CE  1 
ATOM   8635  N  NZ  . LYS D  4  79  ? 27.189  289.242 214.084 1.00 43.52  ? 79   LYS D NZ  1 
ATOM   8636  N  N   . THR D  4  80  ? 30.732  295.810 212.045 1.00 33.69  ? 80   THR D N   1 
ATOM   8637  C  CA  . THR D  4  80  ? 30.672  297.274 211.980 1.00 31.17  ? 80   THR D CA  1 
ATOM   8638  C  C   . THR D  4  80  ? 31.690  297.804 210.978 1.00 45.85  ? 80   THR D C   1 
ATOM   8639  O  O   . THR D  4  80  ? 31.387  298.700 210.198 1.00 31.02  ? 80   THR D O   1 
ATOM   8640  C  CB  . THR D  4  80  ? 30.962  297.876 213.360 1.00 43.04  ? 80   THR D CB  1 
ATOM   8641  O  OG1 . THR D  4  80  ? 30.043  297.351 214.327 1.00 37.60  ? 80   THR D OG1 1 
ATOM   8642  C  CG2 . THR D  4  80  ? 30.873  299.407 213.316 1.00 30.93  ? 80   THR D CG2 1 
ATOM   8643  N  N   . VAL D  4  81  ? 32.923  297.305 211.032 1.00 30.04  ? 81   VAL D N   1 
ATOM   8644  C  CA  . VAL D  4  81  ? 33.972  297.830 210.140 1.00 29.46  ? 81   VAL D CA  1 
ATOM   8645  C  C   . VAL D  4  81  ? 33.611  297.545 208.674 1.00 32.23  ? 81   VAL D C   1 
ATOM   8646  O  O   . VAL D  4  81  ? 33.652  298.434 207.828 1.00 29.71  ? 81   VAL D O   1 
ATOM   8647  C  CB  . VAL D  4  81  ? 35.349  297.240 210.488 1.00 27.92  ? 81   VAL D CB  1 
ATOM   8648  C  CG1 . VAL D  4  81  ? 36.378  297.640 209.481 1.00 29.04  ? 81   VAL D CG1 1 
ATOM   8649  C  CG2 . VAL D  4  81  ? 35.861  297.724 211.925 1.00 28.36  ? 81   VAL D CG2 1 
ATOM   8650  N  N   . VAL D  4  82  ? 33.265  296.304 208.369 1.00 31.11  ? 82   VAL D N   1 
ATOM   8651  C  CA  . VAL D  4  82  ? 33.013  295.936 206.970 1.00 31.67  ? 82   VAL D CA  1 
ATOM   8652  C  C   . VAL D  4  82  ? 31.769  296.646 206.478 1.00 38.30  ? 82   VAL D C   1 
ATOM   8653  O  O   . VAL D  4  82  ? 31.730  297.162 205.361 1.00 36.71  ? 82   VAL D O   1 
ATOM   8654  C  CB  . VAL D  4  82  ? 32.875  294.410 206.813 1.00 35.63  ? 82   VAL D CB  1 
ATOM   8655  C  CG1 . VAL D  4  82  ? 32.289  294.057 205.370 1.00 35.75  ? 82   VAL D CG1 1 
ATOM   8656  C  CG2 . VAL D  4  82  ? 34.217  293.781 207.000 1.00 35.89  ? 82   VAL D CG2 1 
ATOM   8657  N  N   . GLY D  4  83  ? 30.720  296.687 207.306 1.00 33.25  ? 83   GLY D N   1 
ATOM   8658  C  CA  . GLY D  4  83  ? 29.494  297.327 206.863 1.00 34.18  ? 83   GLY D CA  1 
ATOM   8659  C  C   . GLY D  4  83  ? 29.654  298.817 206.659 1.00 34.17  ? 83   GLY D C   1 
ATOM   8660  O  O   . GLY D  4  83  ? 29.133  299.380 205.702 1.00 32.84  ? 83   GLY D O   1 
ATOM   8661  N  N   . ALA D  4  84  ? 30.411  299.480 207.544 1.00 30.08  ? 84   ALA D N   1 
ATOM   8662  C  CA  . ALA D  4  84  ? 30.575  300.917 207.413 1.00 30.22  ? 84   ALA D CA  1 
ATOM   8663  C  C   . ALA D  4  84  ? 31.440  301.229 206.196 1.00 29.42  ? 84   ALA D C   1 
ATOM   8664  O  O   . ALA D  4  84  ? 31.248  302.260 205.532 1.00 27.51  ? 84   ALA D O   1 
ATOM   8665  C  CB  . ALA D  4  84  ? 31.221  301.524 208.679 1.00 29.87  ? 84   ALA D CB  1 
ATOM   8666  N  N   . ALA D  4  85  ? 32.469  300.430 205.978 1.00 28.93  ? 85   ALA D N   1 
ATOM   8667  C  CA  . ALA D  4  85  ? 33.321  300.679 204.820 1.00 26.78  ? 85   ALA D CA  1 
ATOM   8668  C  C   . ALA D  4  85  ? 32.480  300.552 203.528 1.00 35.23  ? 85   ALA D C   1 
ATOM   8669  O  O   . ALA D  4  85  ? 32.564  301.384 202.626 1.00 34.54  ? 85   ALA D O   1 
ATOM   8670  C  CB  . ALA D  4  85  ? 34.493  299.697 204.811 1.00 25.73  ? 85   ALA D CB  1 
ATOM   8671  N  N   . MET D  4  86  ? 31.620  299.552 203.466 1.00 37.56  ? 86   MET D N   1 
ATOM   8672  C  CA  . MET D  4  86  ? 30.708  299.410 202.318 1.00 31.73  ? 86   MET D CA  1 
ATOM   8673  C  C   . MET D  4  86  ? 29.777  300.593 202.199 1.00 34.91  ? 86   MET D C   1 
ATOM   8674  O  O   . MET D  4  86  ? 29.502  301.069 201.094 1.00 30.86  ? 86   MET D O   1 
ATOM   8675  C  CB  . MET D  4  86  ? 29.920  298.115 202.446 1.00 36.16  ? 86   MET D CB  1 
ATOM   8676  C  CG  . MET D  4  86  ? 30.838  296.997 202.165 1.00 38.51  ? 86   MET D CG  1 
ATOM   8677  S  SD  . MET D  4  86  ? 30.000  295.420 202.121 1.00 48.41  ? 86   MET D SD  1 
ATOM   8678  C  CE  . MET D  4  86  ? 29.515  295.521 200.371 1.00 82.43  ? 86   MET D CE  1 
ATOM   8679  N  N   . PHE D  4  87  ? 29.246  301.067 203.319 1.00 29.50  ? 87   PHE D N   1 
ATOM   8680  C  CA  A PHE D  4  87  ? 28.430  302.275 203.258 0.70 34.93  ? 87   PHE D CA  1 
ATOM   8681  C  CA  B PHE D  4  87  ? 28.431  302.275 203.277 0.30 28.48  ? 87   PHE D CA  1 
ATOM   8682  C  C   . PHE D  4  87  ? 29.215  303.428 202.634 1.00 33.15  ? 87   PHE D C   1 
ATOM   8683  O  O   . PHE D  4  87  ? 28.681  304.161 201.800 1.00 32.14  ? 87   PHE D O   1 
ATOM   8684  C  CB  A PHE D  4  87  ? 27.898  302.705 204.640 0.70 33.00  ? 87   PHE D CB  1 
ATOM   8685  C  CB  B PHE D  4  87  ? 27.965  302.634 204.699 0.30 32.94  ? 87   PHE D CB  1 
ATOM   8686  C  CG  A PHE D  4  87  ? 27.297  304.093 204.613 0.70 30.54  ? 87   PHE D CG  1 
ATOM   8687  C  CG  B PHE D  4  87  ? 26.487  302.382 204.978 0.30 24.46  ? 87   PHE D CG  1 
ATOM   8688  C  CD1 A PHE D  4  87  ? 25.965  304.277 204.179 0.70 44.16  ? 87   PHE D CD1 1 
ATOM   8689  C  CD1 B PHE D  4  87  ? 25.514  302.859 204.131 0.30 23.44  ? 87   PHE D CD1 1 
ATOM   8690  C  CD2 A PHE D  4  87  ? 28.061  305.235 204.907 0.70 43.76  ? 87   PHE D CD2 1 
ATOM   8691  C  CD2 B PHE D  4  87  ? 26.085  301.722 206.149 0.30 39.11  ? 87   PHE D CD2 1 
ATOM   8692  C  CE1 A PHE D  4  87  ? 25.406  305.556 204.064 0.70 38.47  ? 87   PHE D CE1 1 
ATOM   8693  C  CE1 B PHE D  4  87  ? 24.183  302.660 204.388 0.30 31.55  ? 87   PHE D CE1 1 
ATOM   8694  C  CE2 A PHE D  4  87  ? 27.512  306.527 204.786 0.70 45.14  ? 87   PHE D CE2 1 
ATOM   8695  C  CE2 B PHE D  4  87  ? 24.746  301.518 206.429 0.30 24.48  ? 87   PHE D CE2 1 
ATOM   8696  C  CZ  A PHE D  4  87  ? 26.170  306.681 204.372 0.70 41.85  ? 87   PHE D CZ  1 
ATOM   8697  C  CZ  B PHE D  4  87  ? 23.784  301.996 205.530 0.30 38.24  ? 87   PHE D CZ  1 
ATOM   8698  N  N   . PHE D  4  88  ? 30.470  303.645 203.052 1.00 30.49  ? 88   PHE D N   1 
ATOM   8699  C  CA  . PHE D  4  88  ? 31.167  304.823 202.540 1.00 28.01  ? 88   PHE D CA  1 
ATOM   8700  C  C   . PHE D  4  88  ? 31.587  304.600 201.096 1.00 32.83  ? 88   PHE D C   1 
ATOM   8701  O  O   . PHE D  4  88  ? 31.609  305.541 200.303 1.00 31.23  ? 88   PHE D O   1 
ATOM   8702  C  CB  . PHE D  4  88  ? 32.420  305.142 203.400 1.00 26.57  ? 88   PHE D CB  1 
ATOM   8703  C  CG  . PHE D  4  88  ? 32.070  305.864 204.698 1.00 32.89  ? 88   PHE D CG  1 
ATOM   8704  C  CD1 . PHE D  4  88  ? 31.831  307.224 204.696 1.00 34.29  ? 88   PHE D CD1 1 
ATOM   8705  C  CD2 . PHE D  4  88  ? 31.864  305.157 205.862 1.00 32.82  ? 88   PHE D CD2 1 
ATOM   8706  C  CE1 . PHE D  4  88  ? 31.469  307.888 205.845 1.00 50.87  ? 88   PHE D CE1 1 
ATOM   8707  C  CE2 . PHE D  4  88  ? 31.476  305.835 207.041 1.00 34.65  ? 88   PHE D CE2 1 
ATOM   8708  C  CZ  . PHE D  4  88  ? 31.275  307.180 207.014 1.00 42.38  ? 88   PHE D CZ  1 
ATOM   8709  N  N   . ILE D  4  89  ? 31.858  303.354 200.722 1.00 28.64  ? 89   ILE D N   1 
ATOM   8710  C  CA  . ILE D  4  89  ? 32.129  303.074 199.325 1.00 31.25  ? 89   ILE D CA  1 
ATOM   8711  C  C   . ILE D  4  89  ? 30.866  303.279 198.486 1.00 32.04  ? 89   ILE D C   1 
ATOM   8712  O  O   . ILE D  4  89  ? 30.916  303.811 197.356 1.00 31.30  ? 89   ILE D O   1 
ATOM   8713  C  CB  . ILE D  4  89  ? 32.723  301.660 199.201 1.00 32.98  ? 89   ILE D CB  1 
ATOM   8714  C  CG1 . ILE D  4  89  ? 34.151  301.716 199.782 1.00 34.07  ? 89   ILE D CG1 1 
ATOM   8715  C  CG2 . ILE D  4  89  ? 32.722  301.204 197.693 1.00 34.20  ? 89   ILE D CG2 1 
ATOM   8716  C  CD1 . ILE D  4  89  ? 34.801  300.358 199.977 1.00 31.58  ? 89   ILE D CD1 1 
ATOM   8717  N  N   . GLY D  4  90  ? 29.710  302.899 199.049 1.00 33.74  ? 90   GLY D N   1 
ATOM   8718  C  CA  . GLY D  4  90  ? 28.448  303.208 198.426 1.00 27.34  ? 90   GLY D CA  1 
ATOM   8719  C  C   . GLY D  4  90  ? 28.224  304.697 198.275 1.00 36.29  ? 90   GLY D C   1 
ATOM   8720  O  O   . GLY D  4  90  ? 27.838  305.160 197.202 1.00 35.25  ? 90   GLY D O   1 
ATOM   8721  N  N   . PHE D  4  91  ? 28.465  305.472 199.344 1.00 29.71  ? 91   PHE D N   1 
ATOM   8722  C  CA  . PHE D  4  91  ? 28.405  306.933 199.225 1.00 30.75  ? 91   PHE D CA  1 
ATOM   8723  C  C   . PHE D  4  91  ? 29.296  307.460 198.068 1.00 31.51  ? 91   PHE D C   1 
ATOM   8724  O  O   . PHE D  4  91  ? 28.976  308.468 197.409 1.00 31.91  ? 91   PHE D O   1 
ATOM   8725  C  CB  . PHE D  4  91  ? 28.790  307.562 200.588 1.00 28.77  ? 91   PHE D CB  1 
ATOM   8726  C  CG  . PHE D  4  91  ? 28.973  309.042 200.529 1.00 31.68  ? 91   PHE D CG  1 
ATOM   8727  C  CD1 . PHE D  4  91  ? 27.873  309.879 200.616 1.00 36.59  ? 91   PHE D CD1 1 
ATOM   8728  C  CD2 . PHE D  4  91  ? 30.233  309.593 200.306 1.00 34.19  ? 91   PHE D CD2 1 
ATOM   8729  C  CE1 . PHE D  4  91  ? 28.006  311.259 200.495 1.00 32.52  ? 91   PHE D CE1 1 
ATOM   8730  C  CE2 . PHE D  4  91  ? 30.394  310.961 200.220 1.00 35.17  ? 91   PHE D CE2 1 
ATOM   8731  C  CZ  . PHE D  4  91  ? 29.275  311.800 200.301 1.00 30.71  ? 91   PHE D CZ  1 
ATOM   8732  N  N   . THR D  4  92  ? 30.444  306.809 197.834 1.00 32.15  ? 92   THR D N   1 
ATOM   8733  C  CA  . THR D  4  92  ? 31.355  307.279 196.792 1.00 28.15  ? 92   THR D CA  1 
ATOM   8734  C  C   . THR D  4  92  ? 30.693  307.178 195.421 1.00 27.24  ? 92   THR D C   1 
ATOM   8735  O  O   . THR D  4  92  ? 30.846  308.066 194.568 1.00 29.55  ? 92   THR D O   1 
ATOM   8736  C  CB  . THR D  4  92  ? 32.651  306.457 196.796 1.00 30.17  ? 92   THR D CB  1 
ATOM   8737  O  OG1 . THR D  4  92  ? 33.307  306.554 198.105 1.00 31.24  ? 92   THR D OG1 1 
ATOM   8738  C  CG2 . THR D  4  92  ? 33.552  306.979 195.742 1.00 30.15  ? 92   THR D CG2 1 
ATOM   8739  N  N   . ALA D  4  93  ? 29.905  306.115 195.204 1.00 26.85  ? 93   ALA D N   1 
ATOM   8740  C  CA  . ALA D  4  93  ? 29.152  306.020 193.929 1.00 25.93  ? 93   ALA D CA  1 
ATOM   8741  C  C   . ALA D  4  93  ? 28.149  307.163 193.767 1.00 30.34  ? 93   ALA D C   1 
ATOM   8742  O  O   . ALA D  4  93  ? 27.856  307.576 192.639 1.00 31.44  ? 93   ALA D O   1 
ATOM   8743  C  CB  . ALA D  4  93  ? 28.419  304.686 193.858 1.00 28.13  ? 93   ALA D CB  1 
ATOM   8744  N  N   . LEU D  4  94  ? 27.573  307.657 194.861 1.00 29.54  ? 94   LEU D N   1 
ATOM   8745  C  CA  . LEU D  4  94  ? 26.731  308.849 194.763 1.00 30.82  ? 94   LEU D CA  1 
ATOM   8746  C  C   . LEU D  4  94  ? 27.513  310.019 194.200 1.00 34.97  ? 94   LEU D C   1 
ATOM   8747  O  O   . LEU D  4  94  ? 26.993  310.776 193.364 1.00 36.28  ? 94   LEU D O   1 
ATOM   8748  C  CB  . LEU D  4  94  ? 26.145  309.222 196.153 1.00 32.17  ? 94   LEU D CB  1 
ATOM   8749  C  CG  . LEU D  4  94  ? 25.185  308.183 196.724 1.00 32.81  ? 94   LEU D CG  1 
ATOM   8750  C  CD1 . LEU D  4  94  ? 24.668  308.762 198.108 1.00 30.81  ? 94   LEU D CD1 1 
ATOM   8751  C  CD2 . LEU D  4  94  ? 24.035  307.856 195.762 1.00 36.86  ? 94   LEU D CD2 1 
ATOM   8752  N  N   . LEU D  4  95  ? 28.753  310.233 194.684 1.00 29.24  ? 95   LEU D N   1 
ATOM   8753  C  CA  . LEU D  4  95  ? 29.575  311.318 194.142 1.00 26.69  ? 95   LEU D CA  1 
ATOM   8754  C  C   . LEU D  4  95  ? 29.830  311.121 192.650 1.00 31.51  ? 95   LEU D C   1 
ATOM   8755  O  O   . LEU D  4  95  ? 29.898  312.091 191.887 1.00 29.53  ? 95   LEU D O   1 
ATOM   8756  C  CB  . LEU D  4  95  ? 30.946  311.393 194.865 1.00 29.42  ? 95   LEU D CB  1 
ATOM   8757  C  CG  . LEU D  4  95  ? 30.850  311.617 196.398 1.00 34.96  ? 95   LEU D CG  1 
ATOM   8758  C  CD1 . LEU D  4  95  ? 32.256  311.836 196.945 1.00 32.20  ? 95   LEU D CD1 1 
ATOM   8759  C  CD2 . LEU D  4  95  ? 29.951  312.806 196.749 1.00 34.14  ? 95   LEU D CD2 1 
ATOM   8760  N  N   . LEU D  4  96  ? 30.022  309.888 192.245 1.00 29.65  ? 96   LEU D N   1 
ATOM   8761  C  CA  . LEU D  4  96  ? 30.313  309.582 190.850 1.00 37.54  ? 96   LEU D CA  1 
ATOM   8762  C  C   . LEU D  4  96  ? 29.071  309.799 189.972 1.00 38.76  ? 96   LEU D C   1 
ATOM   8763  O  O   . LEU D  4  96  ? 29.185  310.224 188.821 1.00 34.30  ? 96   LEU D O   1 
ATOM   8764  C  CB  . LEU D  4  96  ? 30.828  308.144 190.751 1.00 27.70  ? 96   LEU D CB  1 
ATOM   8765  C  CG  . LEU D  4  96  ? 32.262  307.961 191.334 1.00 32.46  ? 96   LEU D CG  1 
ATOM   8766  C  CD1 . LEU D  4  96  ? 32.502  306.481 191.442 1.00 30.62  ? 96   LEU D CD1 1 
ATOM   8767  C  CD2 . LEU D  4  96  ? 33.202  308.601 190.345 1.00 28.40  ? 96   LEU D CD2 1 
ATOM   8768  N  N   . ILE D  4  97  ? 27.878  309.476 190.499 1.00 34.74  ? 97   ILE D N   1 
ATOM   8769  C  CA  . ILE D  4  97  ? 26.633  309.786 189.791 1.00 35.21  ? 97   ILE D CA  1 
ATOM   8770  C  C   . ILE D  4  97  ? 26.507  311.286 189.622 1.00 31.49  ? 97   ILE D C   1 
ATOM   8771  O  O   . ILE D  4  97  ? 26.266  311.797 188.521 1.00 32.22  ? 97   ILE D O   1 
ATOM   8772  C  CB  . ILE D  4  97  ? 25.423  309.205 190.546 1.00 34.36  ? 97   ILE D CB  1 
ATOM   8773  C  CG1 . ILE D  4  97  ? 25.495  307.685 190.512 1.00 31.00  ? 97   ILE D CG1 1 
ATOM   8774  C  CG2 . ILE D  4  97  ? 24.100  309.663 189.842 1.00 32.17  ? 97   ILE D CG2 1 
ATOM   8775  C  CD1 . ILE D  4  97  ? 24.673  307.053 191.627 1.00 35.76  ? 97   ILE D CD1 1 
ATOM   8776  N  N   . TRP D  4  98  ? 26.779  312.026 190.676 1.00 31.56  ? 98   TRP D N   1 
ATOM   8777  C  CA  . TRP D  4  98  ? 26.754  313.492 190.570 1.00 29.50  ? 98   TRP D CA  1 
ATOM   8778  C  C   . TRP D  4  98  ? 27.726  313.984 189.500 1.00 35.56  ? 98   TRP D C   1 
ATOM   8779  O  O   . TRP D  4  98  ? 27.393  314.848 188.660 1.00 36.36  ? 98   TRP D O   1 
ATOM   8780  C  CB  . TRP D  4  98  ? 27.103  314.098 191.953 1.00 31.67  ? 98   TRP D CB  1 
ATOM   8781  C  CG  . TRP D  4  98  ? 26.993  315.610 191.992 1.00 28.12  ? 98   TRP D CG  1 
ATOM   8782  C  CD1 . TRP D  4  98  ? 25.860  316.335 192.369 1.00 33.81  ? 98   TRP D CD1 1 
ATOM   8783  C  CD2 . TRP D  4  98  ? 27.967  316.587 191.594 1.00 31.81  ? 98   TRP D CD2 1 
ATOM   8784  N  NE1 . TRP D  4  98  ? 26.109  317.674 192.247 1.00 37.67  ? 98   TRP D NE1 1 
ATOM   8785  C  CE2 . TRP D  4  98  ? 27.375  317.858 191.744 1.00 31.52  ? 98   TRP D CE2 1 
ATOM   8786  C  CE3 . TRP D  4  98  ? 29.298  316.518 191.160 1.00 28.14  ? 98   TRP D CE3 1 
ATOM   8787  C  CZ2 . TRP D  4  98  ? 28.073  319.051 191.499 1.00 32.06  ? 98   TRP D CZ2 1 
ATOM   8788  C  CZ3 . TRP D  4  98  ? 29.984  317.705 190.904 1.00 35.99  ? 98   TRP D CZ3 1 
ATOM   8789  C  CH2 . TRP D  4  98  ? 29.373  318.952 191.089 1.00 33.78  ? 98   TRP D CH2 1 
ATOM   8790  N  N   . GLU D  4  99  ? 28.971  313.509 189.562 1.00 34.18  ? 99   GLU D N   1 
ATOM   8791  C  CA  . GLU D  4  99  ? 29.967  313.953 188.578 1.00 29.73  ? 99   GLU D CA  1 
ATOM   8792  C  C   . GLU D  4  99  ? 29.492  313.652 187.155 1.00 36.59  ? 99   GLU D C   1 
ATOM   8793  O  O   . GLU D  4  99  ? 29.614  314.487 186.247 1.00 32.39  ? 99   GLU D O   1 
ATOM   8794  C  CB  . GLU D  4  99  ? 31.307  313.268 188.867 1.00 30.51  ? 99   GLU D CB  1 
ATOM   8795  C  CG  . GLU D  4  99  ? 32.435  313.672 187.946 1.00 33.69  ? 99   GLU D CG  1 
ATOM   8796  C  CD  . GLU D  4  99  ? 33.674  312.805 188.078 1.00 35.02  ? 99   GLU D CD  1 
ATOM   8797  O  OE1 . GLU D  4  99  ? 34.755  313.401 188.210 1.00 33.80  ? 99   GLU D OE1 1 
ATOM   8798  O  OE2 . GLU D  4  99  ? 33.575  311.542 188.070 1.00 33.76  ? 99   GLU D OE2 1 
ATOM   8799  N  N   . LYS D  4  100 ? 28.972  312.457 186.944 1.00 30.83  ? 100  LYS D N   1 
ATOM   8800  C  CA  . LYS D  4  100 ? 28.515  312.107 185.598 1.00 36.33  ? 100  LYS D CA  1 
ATOM   8801  C  C   . LYS D  4  100 ? 27.371  313.023 185.163 1.00 38.06  ? 100  LYS D C   1 
ATOM   8802  O  O   . LYS D  4  100 ? 27.338  313.487 184.020 1.00 35.55  ? 100  LYS D O   1 
ATOM   8803  C  CB  . LYS D  4  100 ? 28.085  310.641 185.571 1.00 32.18  ? 100  LYS D CB  1 
ATOM   8804  C  CG  . LYS D  4  100 ? 27.463  310.173 184.221 1.00 32.71  ? 100  LYS D CG  1 
ATOM   8805  C  CD  . LYS D  4  100 ? 28.439  310.445 183.044 1.00 35.53  ? 100  LYS D CD  1 
ATOM   8806  C  CE  . LYS D  4  100 ? 27.747  310.041 181.692 1.00 50.93  ? 100  LYS D CE  1 
ATOM   8807  N  NZ  . LYS D  4  100 ? 28.143  311.008 180.568 1.00 71.70  ? 100  LYS D NZ  1 
ATOM   8808  N  N   . HIS D  4  101 ? 26.478  313.373 186.083 1.00 33.64  ? 101  HIS D N   1 
ATOM   8809  C  CA  . HIS D  4  101 ? 25.292  314.134 185.701 1.00 38.09  ? 101  HIS D CA  1 
ATOM   8810  C  C   . HIS D  4  101 ? 25.615  315.595 185.515 1.00 40.92  ? 101  HIS D C   1 
ATOM   8811  O  O   . HIS D  4  101 ? 25.065  316.246 184.629 1.00 38.71  ? 101  HIS D O   1 
ATOM   8812  C  CB  . HIS D  4  101 ? 24.226  313.980 186.775 1.00 37.32  ? 101  HIS D CB  1 
ATOM   8813  C  CG  . HIS D  4  101 ? 22.962  314.708 186.491 1.00 170.55 ? 101  HIS D CG  1 
ATOM   8814  N  ND1 . HIS D  4  101 ? 21.892  314.115 185.860 1.00 72.52  ? 101  HIS D ND1 1 
ATOM   8815  C  CD2 . HIS D  4  101 ? 22.583  315.976 186.772 1.00 53.41  ? 101  HIS D CD2 1 
ATOM   8816  C  CE1 . HIS D  4  101 ? 20.907  314.989 185.761 1.00 58.67  ? 101  HIS D CE1 1 
ATOM   8817  N  NE2 . HIS D  4  101 ? 21.304  316.127 186.297 1.00 76.30  ? 101  HIS D NE2 1 
ATOM   8818  N  N   . TYR D  4  102 ? 26.499  316.145 186.322 1.00 36.38  ? 102  TYR D N   1 
ATOM   8819  C  CA  . TYR D  4  102 ? 26.668  317.591 186.307 1.00 36.07  ? 102  TYR D CA  1 
ATOM   8820  C  C   . TYR D  4  102 ? 27.983  318.073 185.735 1.00 36.26  ? 102  TYR D C   1 
ATOM   8821  O  O   . TYR D  4  102 ? 28.100  319.257 185.393 1.00 47.26  ? 102  TYR D O   1 
ATOM   8822  C  CB  . TYR D  4  102 ? 26.548  318.166 187.729 1.00 44.70  ? 102  TYR D CB  1 
ATOM   8823  C  CG  . TYR D  4  102 ? 25.165  318.220 188.289 1.00 43.91  ? 102  TYR D CG  1 
ATOM   8824  C  CD1 . TYR D  4  102 ? 24.233  319.133 187.768 1.00 61.94  ? 102  TYR D CD1 1 
ATOM   8825  C  CD2 . TYR D  4  102 ? 24.764  317.367 189.327 1.00 45.60  ? 102  TYR D CD2 1 
ATOM   8826  C  CE1 . TYR D  4  102 ? 22.968  319.197 188.251 1.00 54.86  ? 102  TYR D CE1 1 
ATOM   8827  C  CE2 . TYR D  4  102 ? 23.477  317.431 189.827 1.00 51.49  ? 102  TYR D CE2 1 
ATOM   8828  C  CZ  . TYR D  4  102 ? 22.592  318.360 189.277 1.00 67.19  ? 102  TYR D CZ  1 
ATOM   8829  O  OH  . TYR D  4  102 ? 21.309  318.459 189.707 1.00 50.27  ? 102  TYR D OH  1 
ATOM   8830  N  N   . VAL D  4  103 ? 28.999  317.238 185.684 1.00 38.61  ? 103  VAL D N   1 
ATOM   8831  C  CA  . VAL D  4  103 ? 30.326  317.694 185.282 1.00 42.68  ? 103  VAL D CA  1 
ATOM   8832  C  C   . VAL D  4  103 ? 30.676  317.229 183.876 1.00 35.59  ? 103  VAL D C   1 
ATOM   8833  O  O   . VAL D  4  103 ? 31.154  318.013 183.050 1.00 44.45  ? 103  VAL D O   1 
ATOM   8834  C  CB  . VAL D  4  103 ? 31.410  317.245 186.288 1.00 35.67  ? 103  VAL D CB  1 
ATOM   8835  C  CG1 . VAL D  4  103 ? 32.833  317.717 185.738 1.00 36.78  ? 103  VAL D CG1 1 
ATOM   8836  C  CG2 . VAL D  4  103 ? 31.087  317.716 187.756 1.00 33.94  ? 103  VAL D CG2 1 
ATOM   8837  N  N   . TYR D  4  104 ? 30.475  315.944 183.594 1.00 36.65  ? 104  TYR D N   1 
ATOM   8838  C  CA  . TYR D  4  104 ? 30.911  315.381 182.312 1.00 33.59  ? 104  TYR D CA  1 
ATOM   8839  C  C   . TYR D  4  104 ? 29.903  315.743 181.232 1.00 41.07  ? 104  TYR D C   1 
ATOM   8840  O  O   . TYR D  4  104 ? 28.693  315.578 181.418 1.00 41.09  ? 104  TYR D O   1 
ATOM   8841  C  CB  . TYR D  4  104 ? 31.026  313.859 182.393 1.00 34.99  ? 104  TYR D CB  1 
ATOM   8842  C  CG  . TYR D  4  104 ? 32.330  313.384 183.117 1.00 35.08  ? 104  TYR D CG  1 
ATOM   8843  C  CD1 . TYR D  4  104 ? 33.544  314.001 182.834 1.00 38.02  ? 104  TYR D CD1 1 
ATOM   8844  C  CD2 . TYR D  4  104 ? 32.319  312.323 184.038 1.00 28.81  ? 104  TYR D CD2 1 
ATOM   8845  C  CE1 . TYR D  4  104 ? 34.747  313.566 183.468 1.00 39.39  ? 104  TYR D CE1 1 
ATOM   8846  C  CE2 . TYR D  4  104 ? 33.501  311.869 184.666 1.00 39.43  ? 104  TYR D CE2 1 
ATOM   8847  C  CZ  . TYR D  4  104 ? 34.703  312.525 184.391 1.00 29.28  ? 104  TYR D CZ  1 
ATOM   8848  O  OH  . TYR D  4  104 ? 35.907  312.127 184.950 1.00 34.24  ? 104  TYR D OH  1 
ATOM   8849  N  N   . GLY D  4  105 ? 30.407  316.215 180.111 1.00 35.83  ? 105  GLY D N   1 
ATOM   8850  C  CA  . GLY D  4  105 ? 29.612  316.312 178.894 1.00 37.59  ? 105  GLY D CA  1 
ATOM   8851  C  C   . GLY D  4  105 ? 29.584  315.015 178.108 1.00 48.65  ? 105  GLY D C   1 
ATOM   8852  O  O   . GLY D  4  105 ? 29.953  313.933 178.572 1.00 38.71  ? 105  GLY D O   1 
ATOM   8853  N  N   . PRO D  4  106 ? 29.090  315.117 176.891 1.00 39.28  ? 106  PRO D N   1 
ATOM   8854  C  CA  . PRO D  4  106 ? 29.037  313.952 175.996 1.00 42.71  ? 106  PRO D CA  1 
ATOM   8855  C  C   . PRO D  4  106 ? 30.424  313.453 175.615 1.00 33.90  ? 106  PRO D C   1 
ATOM   8856  O  O   . PRO D  4  106 ? 31.367  314.230 175.476 1.00 35.11  ? 106  PRO D O   1 
ATOM   8857  C  CB  . PRO D  4  106 ? 28.330  314.506 174.749 1.00 52.39  ? 106  PRO D CB  1 
ATOM   8858  C  CG  . PRO D  4  106 ? 27.797  315.862 175.159 1.00 49.54  ? 106  PRO D CG  1 
ATOM   8859  C  CD  . PRO D  4  106 ? 28.712  316.370 176.207 1.00 56.49  ? 106  PRO D CD  1 
ATOM   8860  N  N   . ILE D  4  107 ? 30.552  312.147 175.480 1.00 35.83  ? 107  ILE D N   1 
ATOM   8861  C  CA  . ILE D  4  107 ? 31.835  311.610 175.051 1.00 45.02  ? 107  ILE D CA  1 
ATOM   8862  C  C   . ILE D  4  107 ? 31.898  311.698 173.528 1.00 41.65  ? 107  ILE D C   1 
ATOM   8863  O  O   . ILE D  4  107 ? 30.880  312.014 172.892 1.00 37.75  ? 107  ILE D O   1 
ATOM   8864  C  CB  . ILE D  4  107 ? 32.028  310.178 175.555 1.00 38.82  ? 107  ILE D CB  1 
ATOM   8865  C  CG1 . ILE D  4  107 ? 30.930  309.290 174.993 1.00 36.09  ? 107  ILE D CG1 1 
ATOM   8866  C  CG2 . ILE D  4  107 ? 32.131  310.153 177.146 1.00 37.36  ? 107  ILE D CG2 1 
ATOM   8867  C  CD1 . ILE D  4  107 ? 31.347  307.819 175.123 1.00 39.21  ? 107  ILE D CD1 1 
ATOM   8868  N  N   . PRO D  4  108 ? 33.063  311.455 172.921 1.00 35.38  ? 108  PRO D N   1 
ATOM   8869  C  CA  . PRO D  4  108 ? 33.217  311.674 171.481 1.00 34.46  ? 108  PRO D CA  1 
ATOM   8870  C  C   . PRO D  4  108 ? 32.311  310.804 170.604 1.00 33.18  ? 108  PRO D C   1 
ATOM   8871  O  O   . PRO D  4  108 ? 31.851  309.721 170.987 1.00 30.04  ? 108  PRO D O   1 
ATOM   8872  C  CB  . PRO D  4  108 ? 34.686  311.360 171.229 1.00 34.06  ? 108  PRO D CB  1 
ATOM   8873  C  CG  . PRO D  4  108 ? 35.406  311.722 172.604 1.00 32.07  ? 108  PRO D CG  1 
ATOM   8874  C  CD  . PRO D  4  108 ? 34.364  311.295 173.634 1.00 33.51  ? 108  PRO D CD  1 
ATOM   8875  N  N   . HIS D  4  109 ? 32.067  311.287 169.381 1.00 34.68  ? 109  HIS D N   1 
ATOM   8876  C  CA  . HIS D  4  109 ? 31.148  310.546 168.507 1.00 36.12  ? 109  HIS D CA  1 
ATOM   8877  C  C   . HIS D  4  109 ? 31.690  309.187 168.065 1.00 35.95  ? 109  HIS D C   1 
ATOM   8878  O  O   . HIS D  4  109 ? 30.918  308.382 167.537 1.00 33.21  ? 109  HIS D O   1 
ATOM   8879  C  CB  . HIS D  4  109 ? 30.836  311.384 167.262 1.00 32.64  ? 109  HIS D CB  1 
ATOM   8880  C  CG  . HIS D  4  109 ? 32.028  311.575 166.349 1.00 43.73  ? 109  HIS D CG  1 
ATOM   8881  N  ND1 . HIS D  4  109 ? 32.330  310.701 165.330 1.00 46.14  ? 109  HIS D ND1 1 
ATOM   8882  C  CD2 . HIS D  4  109 ? 32.974  312.545 166.301 1.00 67.17  ? 109  HIS D CD2 1 
ATOM   8883  C  CE1 . HIS D  4  109 ? 33.419  311.113 164.697 1.00 45.84  ? 109  HIS D CE1 1 
ATOM   8884  N  NE2 . HIS D  4  109 ? 33.835  312.226 165.275 1.00 54.85  ? 109  HIS D NE2 1 
ATOM   8885  N  N   . THR D  4  110 ? 32.974  308.881 168.321 1.00 35.86  ? 110  THR D N   1 
ATOM   8886  C  CA  . THR D  4  110 ? 33.569  307.593 167.928 1.00 27.23  ? 110  THR D CA  1 
ATOM   8887  C  C   . THR D  4  110 ? 33.079  306.417 168.753 1.00 30.60  ? 110  THR D C   1 
ATOM   8888  O  O   . THR D  4  110 ? 33.451  305.267 168.457 1.00 32.83  ? 110  THR D O   1 
ATOM   8889  C  CB  . THR D  4  110 ? 35.112  307.701 168.009 1.00 30.37  ? 110  THR D CB  1 
ATOM   8890  O  OG1 . THR D  4  110 ? 35.471  308.237 169.311 1.00 30.56  ? 110  THR D OG1 1 
ATOM   8891  C  CG2 . THR D  4  110 ? 35.608  308.632 166.904 1.00 34.30  ? 110  THR D CG2 1 
ATOM   8892  N  N   . PHE D  4  111 ? 32.329  306.668 169.831 1.00 30.82  ? 111  PHE D N   1 
ATOM   8893  C  CA  . PHE D  4  111 ? 31.783  305.592 170.628 1.00 32.57  ? 111  PHE D CA  1 
ATOM   8894  C  C   . PHE D  4  111 ? 30.358  305.227 170.213 1.00 41.08  ? 111  PHE D C   1 
ATOM   8895  O  O   . PHE D  4  111 ? 29.770  304.335 170.812 1.00 35.73  ? 111  PHE D O   1 
ATOM   8896  C  CB  . PHE D  4  111 ? 31.805  305.974 172.141 1.00 31.62  ? 111  PHE D CB  1 
ATOM   8897  C  CG  . PHE D  4  111 ? 33.211  306.093 172.693 1.00 33.31  ? 111  PHE D CG  1 
ATOM   8898  C  CD1 . PHE D  4  111 ? 33.955  307.274 172.545 1.00 29.92  ? 111  PHE D CD1 1 
ATOM   8899  C  CD2 . PHE D  4  111 ? 33.806  304.989 173.244 1.00 29.90  ? 111  PHE D CD2 1 
ATOM   8900  C  CE1 . PHE D  4  111 ? 35.305  307.365 173.038 1.00 32.08  ? 111  PHE D CE1 1 
ATOM   8901  C  CE2 . PHE D  4  111 ? 35.167  305.072 173.739 1.00 32.30  ? 111  PHE D CE2 1 
ATOM   8902  C  CZ  . PHE D  4  111 ? 35.885  306.261 173.649 1.00 29.21  ? 111  PHE D CZ  1 
ATOM   8903  N  N   . GLU D  4  112 ? 29.777  305.920 169.241 1.00 40.28  ? 112  GLU D N   1 
ATOM   8904  C  CA  . GLU D  4  112 ? 28.444  305.563 168.762 1.00 40.49  ? 112  GLU D CA  1 
ATOM   8905  C  C   . GLU D  4  112 ? 28.521  304.173 168.179 1.00 39.99  ? 112  GLU D C   1 
ATOM   8906  O  O   . GLU D  4  112 ? 29.545  303.787 167.589 1.00 34.89  ? 112  GLU D O   1 
ATOM   8907  C  CB  . GLU D  4  112 ? 27.977  306.554 167.701 1.00 41.18  ? 112  GLU D CB  1 
ATOM   8908  C  CG  . GLU D  4  112 ? 27.701  307.944 168.222 1.00 49.53  ? 112  GLU D CG  1 
ATOM   8909  C  CD  . GLU D  4  112 ? 27.602  308.993 167.104 1.00 67.10  ? 112  GLU D CD  1 
ATOM   8910  O  OE1 . GLU D  4  112 ? 27.691  308.628 165.916 1.00 72.96  ? 112  GLU D OE1 1 
ATOM   8911  O  OE2 . GLU D  4  112 ? 27.438  310.196 167.414 1.00 63.02  ? 112  GLU D OE2 1 
ATOM   8912  N  N   . GLU D  4  113 ? 27.419  303.442 168.308 1.00 38.21  ? 113  GLU D N   1 
ATOM   8913  C  CA  . GLU D  4  113 ? 27.357  302.042 167.895 1.00 38.71  ? 113  GLU D CA  1 
ATOM   8914  C  C   . GLU D  4  113 ? 27.794  301.839 166.439 1.00 36.28  ? 113  GLU D C   1 
ATOM   8915  O  O   . GLU D  4  113 ? 28.547  300.904 166.132 1.00 36.49  ? 113  GLU D O   1 
ATOM   8916  C  CB  . GLU D  4  113 ? 25.927  301.484 168.094 1.00 38.85  ? 113  GLU D CB  1 
ATOM   8917  C  CG  . GLU D  4  113 ? 25.822  300.043 167.667 1.00 57.55  ? 113  GLU D CG  1 
ATOM   8918  C  CD  . GLU D  4  113 ? 24.504  299.405 168.039 1.00 106.30 ? 113  GLU D CD  1 
ATOM   8919  O  OE1 . GLU D  4  113 ? 23.561  300.154 168.333 1.00 65.71  ? 113  GLU D OE1 1 
ATOM   8920  O  OE2 . GLU D  4  113 ? 24.414  298.158 168.040 1.00 152.06 ? 113  GLU D OE2 1 
ATOM   8921  N  N   . GLU D  4  114 ? 27.290  302.673 165.508 1.00 39.11  ? 114  GLU D N   1 
ATOM   8922  C  CA  . GLU D  4  114 ? 27.652  302.471 164.110 1.00 34.18  ? 114  GLU D CA  1 
ATOM   8923  C  C   . GLU D  4  114 ? 29.145  302.755 163.884 1.00 38.89  ? 114  GLU D C   1 
ATOM   8924  O  O   . GLU D  4  114 ? 29.834  302.025 163.151 1.00 35.83  ? 114  GLU D O   1 
ATOM   8925  C  CB  . GLU D  4  114 ? 26.766  303.352 163.189 1.00 38.49  ? 114  GLU D CB  1 
ATOM   8926  C  CG  . GLU D  4  114 ? 27.083  303.181 161.653 1.00 38.71  ? 114  GLU D CG  1 
ATOM   8927  C  CD  . GLU D  4  114 ? 26.190  304.102 160.677 1.00 51.34  ? 114  GLU D CD  1 
ATOM   8928  O  OE1 . GLU D  4  114 ? 24.943  303.956 160.654 1.00 151.16 ? 114  GLU D OE1 1 
ATOM   8929  O  OE2 . GLU D  4  114 ? 26.769  304.963 159.977 1.00 186.56 ? 114  GLU D OE2 1 
ATOM   8930  N  N   . TRP D  4  115 ? 29.666  303.815 164.492 1.00 41.04  ? 115  TRP D N   1 
ATOM   8931  C  CA  . TRP D  4  115 ? 31.116  304.046 164.412 1.00 39.74  ? 115  TRP D CA  1 
ATOM   8932  C  C   . TRP D  4  115 ? 31.888  302.821 164.888 1.00 40.84  ? 115  TRP D C   1 
ATOM   8933  O  O   . TRP D  4  115 ? 32.836  302.376 164.228 1.00 31.61  ? 115  TRP D O   1 
ATOM   8934  C  CB  . TRP D  4  115 ? 31.536  305.292 165.210 1.00 36.38  ? 115  TRP D CB  1 
ATOM   8935  C  CG  . TRP D  4  115 ? 32.951  305.721 164.852 1.00 39.28  ? 115  TRP D CG  1 
ATOM   8936  C  CD1 . TRP D  4  115 ? 34.129  305.165 165.288 1.00 41.00  ? 115  TRP D CD1 1 
ATOM   8937  C  CD2 . TRP D  4  115 ? 33.300  306.745 163.937 1.00 38.61  ? 115  TRP D CD2 1 
ATOM   8938  N  NE1 . TRP D  4  115 ? 35.203  305.806 164.673 1.00 35.48  ? 115  TRP D NE1 1 
ATOM   8939  C  CE2 . TRP D  4  115 ? 34.711  306.781 163.847 1.00 34.17  ? 115  TRP D CE2 1 
ATOM   8940  C  CE3 . TRP D  4  115 ? 32.544  307.634 163.142 1.00 45.79  ? 115  TRP D CE3 1 
ATOM   8941  C  CZ2 . TRP D  4  115 ? 35.387  307.686 163.003 1.00 35.32  ? 115  TRP D CZ2 1 
ATOM   8942  C  CZ3 . TRP D  4  115 ? 33.208  308.547 162.324 1.00 43.21  ? 115  TRP D CZ3 1 
ATOM   8943  C  CH2 . TRP D  4  115 ? 34.620  308.570 162.281 1.00 41.40  ? 115  TRP D CH2 1 
ATOM   8944  N  N   . VAL D  4  116 ? 31.508  302.274 166.048 1.00 37.07  ? 116  VAL D N   1 
ATOM   8945  C  CA  . VAL D  4  116 ? 32.265  301.162 166.627 1.00 35.22  ? 116  VAL D CA  1 
ATOM   8946  C  C   . VAL D  4  116 ? 32.197  299.946 165.705 1.00 34.68  ? 116  VAL D C   1 
ATOM   8947  O  O   . VAL D  4  116 ? 33.178  299.204 165.542 1.00 36.45  ? 116  VAL D O   1 
ATOM   8948  C  CB  . VAL D  4  116 ? 31.720  300.830 168.046 1.00 33.47  ? 116  VAL D CB  1 
ATOM   8949  C  CG1 . VAL D  4  116 ? 32.238  299.456 168.504 1.00 40.86  ? 116  VAL D CG1 1 
ATOM   8950  C  CG2 . VAL D  4  116 ? 32.117  301.959 169.039 1.00 36.98  ? 116  VAL D CG2 1 
ATOM   8951  N  N   . ALA D  4  117 ? 31.019  299.683 165.130 1.00 37.94  ? 117  ALA D N   1 
ATOM   8952  C  CA  . ALA D  4  117 ? 30.915  298.552 164.207 1.00 34.84  ? 117  ALA D CA  1 
ATOM   8953  C  C   . ALA D  4  117 ? 31.818  298.733 162.992 1.00 37.59  ? 117  ALA D C   1 
ATOM   8954  O  O   . ALA D  4  117 ? 32.441  297.764 162.520 1.00 32.07  ? 117  ALA D O   1 
ATOM   8955  C  CB  . ALA D  4  117 ? 29.447  298.329 163.757 1.00 35.91  ? 117  ALA D CB  1 
ATOM   8956  N  N   . LYS D  4  118 ? 31.885  299.943 162.448 1.00 34.66  ? 118  LYS D N   1 
ATOM   8957  C  CA  . LYS D  4  118 ? 32.755  300.178 161.279 1.00 35.37  ? 118  LYS D CA  1 
ATOM   8958  C  C   . LYS D  4  118 ? 34.240  300.125 161.643 1.00 33.78  ? 118  LYS D C   1 
ATOM   8959  O  O   . LYS D  4  118 ? 35.076  299.592 160.906 1.00 34.00  ? 118  LYS D O   1 
ATOM   8960  C  CB  . LYS D  4  118 ? 32.433  301.543 160.675 1.00 29.66  ? 118  LYS D CB  1 
ATOM   8961  C  CG  . LYS D  4  118 ? 31.056  301.511 159.882 1.00 32.98  ? 118  LYS D CG  1 
ATOM   8962  C  CD  . LYS D  4  118 ? 30.712  302.908 159.319 1.00 38.86  ? 118  LYS D CD  1 
ATOM   8963  C  CE  . LYS D  4  118 ? 29.393  302.881 158.436 1.00 39.45  ? 118  LYS D CE  1 
ATOM   8964  N  NZ  . LYS D  4  118 ? 29.237  304.284 157.908 1.00 49.16  ? 118  LYS D NZ  1 
ATOM   8965  N  N   . GLN D  4  119 ? 34.592  300.707 162.796 1.00 35.50  ? 119  GLN D N   1 
ATOM   8966  C  CA  . GLN D  4  119 ? 35.963  300.664 163.272 1.00 34.95  ? 119  GLN D CA  1 
ATOM   8967  C  C   . GLN D  4  119 ? 36.381  299.235 163.580 1.00 33.65  ? 119  GLN D C   1 
ATOM   8968  O  O   . GLN D  4  119 ? 37.509  298.840 163.286 1.00 32.67  ? 119  GLN D O   1 
ATOM   8969  C  CB  . GLN D  4  119 ? 36.033  301.613 164.475 1.00 30.33  ? 119  GLN D CB  1 
ATOM   8970  C  CG  . GLN D  4  119 ? 37.317  301.747 165.267 1.00 33.92  ? 119  GLN D CG  1 
ATOM   8971  C  CD  . GLN D  4  119 ? 37.050  302.738 166.382 1.00 32.77  ? 119  GLN D CD  1 
ATOM   8972  O  OE1 . GLN D  4  119 ? 37.171  303.964 166.162 1.00 36.53  ? 119  GLN D OE1 1 
ATOM   8973  N  NE2 . GLN D  4  119 ? 36.717  302.225 167.592 1.00 36.69  ? 119  GLN D NE2 1 
ATOM   8974  N  N   . THR D  4  120 ? 35.473  298.438 164.154 1.00 31.25  ? 120  THR D N   1 
ATOM   8975  C  CA  . THR D  4  120 ? 35.774  297.026 164.386 1.00 33.46  ? 120  THR D CA  1 
ATOM   8976  C  C   . THR D  4  120 ? 36.085  296.304 163.066 1.00 39.16  ? 120  THR D C   1 
ATOM   8977  O  O   . THR D  4  120 ? 37.061  295.548 162.953 1.00 34.45  ? 120  THR D O   1 
ATOM   8978  C  CB  . THR D  4  120 ? 34.605  296.341 165.108 1.00 29.27  ? 120  THR D CB  1 
ATOM   8979  O  OG1 . THR D  4  120 ? 34.415  296.922 166.441 1.00 37.91  ? 120  THR D OG1 1 
ATOM   8980  C  CG2 . THR D  4  120 ? 34.893  294.831 165.302 1.00 34.45  ? 120  THR D CG2 1 
ATOM   8981  N  N   . LYS D  4  121 ? 35.257  296.492 162.039 1.00 36.98  ? 121  LYS D N   1 
ATOM   8982  C  CA  . LYS D  4  121 ? 35.608  295.861 160.758 1.00 32.90  ? 121  LYS D CA  1 
ATOM   8983  C  C   . LYS D  4  121 ? 36.971  296.337 160.241 1.00 35.78  ? 121  LYS D C   1 
ATOM   8984  O  O   . LYS D  4  121 ? 37.788  295.545 159.750 1.00 35.93  ? 121  LYS D O   1 
ATOM   8985  C  CB  . LYS D  4  121 ? 34.534  296.140 159.705 1.00 32.70  ? 121  LYS D CB  1 
ATOM   8986  C  CG  . LYS D  4  121 ? 35.008  295.467 158.386 1.00 33.33  ? 121  LYS D CG  1 
ATOM   8987  C  CD  . LYS D  4  121 ? 33.911  295.464 157.307 1.00 42.41  ? 121  LYS D CD  1 
ATOM   8988  C  CE  . LYS D  4  121 ? 34.418  294.870 155.964 1.00 39.54  ? 121  LYS D CE  1 
ATOM   8989  N  NZ  . LYS D  4  121 ? 35.257  293.653 156.147 1.00 51.82  ? 121  LYS D NZ  1 
ATOM   8990  N  N   . ARG D  4  122 ? 37.231  297.643 160.311 1.00 30.07  ? 122  ARG D N   1 
ATOM   8991  C  CA  . ARG D  4  122 ? 38.517  298.130 159.821 1.00 35.37  ? 122  ARG D CA  1 
ATOM   8992  C  C   . ARG D  4  122 ? 39.685  297.517 160.595 1.00 35.61  ? 122  ARG D C   1 
ATOM   8993  O  O   . ARG D  4  122 ? 40.715  297.171 159.993 1.00 32.03  ? 122  ARG D O   1 
ATOM   8994  C  CB  . ARG D  4  122 ? 38.577  299.657 159.883 1.00 40.20  ? 122  ARG D CB  1 
ATOM   8995  C  CG  . ARG D  4  122 ? 39.916  300.272 159.399 1.00 45.82  ? 122  ARG D CG  1 
ATOM   8996  C  CD  . ARG D  4  122 ? 39.765  301.771 159.017 1.00 35.04  ? 122  ARG D CD  1 
ATOM   8997  N  NE  . ARG D  4  122 ? 41.072  302.419 158.744 1.00 32.71  ? 122  ARG D NE  1 
ATOM   8998  C  CZ  . ARG D  4  122 ? 41.876  302.979 159.646 1.00 29.44  ? 122  ARG D CZ  1 
ATOM   8999  N  NH1 . ARG D  4  122 ? 41.556  303.046 160.964 1.00 29.20  ? 122  ARG D NH1 1 
ATOM   9000  N  NH2 . ARG D  4  122 ? 43.003  303.546 159.223 1.00 31.59  ? 122  ARG D NH2 1 
ATOM   9001  N  N   . MET D  4  123 ? 39.549  297.364 161.943 1.00 35.43  ? 123  MET D N   1 
ATOM   9002  C  CA  . MET D  4  123 ? 40.605  296.722 162.715 1.00 33.19  ? 123  MET D CA  1 
ATOM   9003  C  C   . MET D  4  123 ? 40.822  295.305 162.270 1.00 32.49  ? 123  MET D C   1 
ATOM   9004  O  O   . MET D  4  123 ? 41.975  294.876 162.189 1.00 31.37  ? 123  MET D O   1 
ATOM   9005  C  CB  . MET D  4  123 ? 40.274  296.739 164.238 1.00 29.07  ? 123  MET D CB  1 
ATOM   9006  C  CG  . MET D  4  123 ? 40.346  298.131 164.759 1.00 29.08  ? 123  MET D CG  1 
ATOM   9007  S  SD  . MET D  4  123 ? 39.678  298.284 166.473 1.00 38.06  ? 123  MET D SD  1 
ATOM   9008  C  CE  . MET D  4  123 ? 40.853  297.213 167.379 1.00 32.63  ? 123  MET D CE  1 
ATOM   9009  N  N   . LEU D  4  124 ? 39.734  294.569 161.990 1.00 35.60  ? 124  LEU D N   1 
ATOM   9010  C  CA  . LEU D  4  124 ? 39.837  293.222 161.422 1.00 35.52  ? 124  LEU D CA  1 
ATOM   9011  C  C   . LEU D  4  124 ? 40.453  293.242 160.037 1.00 50.25  ? 124  LEU D C   1 
ATOM   9012  O  O   . LEU D  4  124 ? 41.201  292.328 159.678 1.00 37.25  ? 124  LEU D O   1 
ATOM   9013  C  CB  . LEU D  4  124 ? 38.454  292.566 161.351 1.00 34.00  ? 124  LEU D CB  1 
ATOM   9014  C  CG  . LEU D  4  124 ? 37.930  292.379 162.771 1.00 44.33  ? 124  LEU D CG  1 
ATOM   9015  C  CD1 . LEU D  4  124 ? 36.470  291.952 162.710 1.00 39.20  ? 124  LEU D CD1 1 
ATOM   9016  C  CD2 . LEU D  4  124 ? 38.778  291.338 163.563 1.00 35.37  ? 124  LEU D CD2 1 
ATOM   9017  N  N   . ASP D  4  125 ? 40.109  294.249 159.222 1.00 33.08  ? 125  ASP D N   1 
ATOM   9018  C  CA  . ASP D  4  125 ? 40.717  294.366 157.892 1.00 36.71  ? 125  ASP D CA  1 
ATOM   9019  C  C   . ASP D  4  125 ? 42.212  294.609 157.966 1.00 43.44  ? 125  ASP D C   1 
ATOM   9020  O  O   . ASP D  4  125 ? 42.967  294.183 157.081 1.00 42.41  ? 125  ASP D O   1 
ATOM   9021  C  CB  . ASP D  4  125 ? 40.083  295.502 157.104 1.00 29.47  ? 125  ASP D CB  1 
ATOM   9022  C  CG  . ASP D  4  125 ? 38.714  295.132 156.573 1.00 40.87  ? 125  ASP D CG  1 
ATOM   9023  O  OD1 . ASP D  4  125 ? 38.442  293.923 156.513 1.00 44.74  ? 125  ASP D OD1 1 
ATOM   9024  O  OD2 . ASP D  4  125 ? 37.928  296.049 156.300 1.00 36.54  ? 125  ASP D OD2 1 
ATOM   9025  N  N   . MET D  4  126 ? 42.657  295.381 158.950 1.00 36.70  ? 126  MET D N   1 
ATOM   9026  C  CA  . MET D  4  126 ? 44.099  295.557 159.055 1.00 33.38  ? 126  MET D CA  1 
ATOM   9027  C  C   . MET D  4  126 ? 44.723  294.501 159.942 1.00 32.93  ? 126  MET D C   1 
ATOM   9028  O  O   . MET D  4  126 ? 45.918  294.590 160.239 1.00 40.85  ? 126  MET D O   1 
ATOM   9029  C  CB  . MET D  4  126 ? 44.461  296.974 159.549 1.00 39.34  ? 126  MET D CB  1 
ATOM   9030  C  CG  . MET D  4  126 ? 43.935  297.444 160.800 1.00 43.76  ? 126  MET D CG  1 
ATOM   9031  S  SD  . MET D  4  126 ? 44.549  299.106 161.290 1.00 50.16  ? 126  MET D SD  1 
ATOM   9032  C  CE  . MET D  4  126 ? 43.346  300.138 160.566 1.00 44.18  ? 126  MET D CE  1 
ATOM   9033  N  N   . LYS D  4  127 ? 43.938  293.491 160.341 1.00 32.03  ? 127  LYS D N   1 
ATOM   9034  C  CA  . LYS D  4  127 ? 44.434  292.379 161.134 1.00 31.69  ? 127  LYS D CA  1 
ATOM   9035  C  C   . LYS D  4  127 ? 45.135  292.883 162.418 1.00 36.93  ? 127  LYS D C   1 
ATOM   9036  O  O   . LYS D  4  127 ? 46.237  292.444 162.781 1.00 31.13  ? 127  LYS D O   1 
ATOM   9037  C  CB  . LYS D  4  127 ? 45.351  291.484 160.313 1.00 34.56  ? 127  LYS D CB  1 
ATOM   9038  C  CG  . LYS D  4  127 ? 44.665  291.118 158.876 1.00 37.85  ? 127  LYS D CG  1 
ATOM   9039  C  CD  . LYS D  4  127 ? 44.473  289.646 158.704 1.00 67.58  ? 127  LYS D CD  1 
ATOM   9040  C  CE  . LYS D  4  127 ? 43.879  289.308 157.339 1.00 48.70  ? 127  LYS D CE  1 
ATOM   9041  N  NZ  . LYS D  4  127 ? 44.605  289.850 156.110 1.00 37.51  ? 127  LYS D NZ  1 
ATOM   9042  N  N   . VAL D  4  128 ? 44.503  293.843 163.108 1.00 34.33  ? 128  VAL D N   1 
ATOM   9043  C  CA  . VAL D  4  128 ? 44.993  294.181 164.473 1.00 31.88  ? 128  VAL D CA  1 
ATOM   9044  C  C   . VAL D  4  128 ? 45.136  292.929 165.316 1.00 35.94  ? 128  VAL D C   1 
ATOM   9045  O  O   . VAL D  4  128 ? 44.190  292.135 165.437 1.00 36.04  ? 128  VAL D O   1 
ATOM   9046  C  CB  . VAL D  4  128 ? 44.068  295.194 165.149 1.00 33.05  ? 128  VAL D CB  1 
ATOM   9047  C  CG1 . VAL D  4  128 ? 44.485  295.330 166.649 1.00 30.88  ? 128  VAL D CG1 1 
ATOM   9048  C  CG2 . VAL D  4  128 ? 44.095  296.516 164.403 1.00 32.43  ? 128  VAL D CG2 1 
ATOM   9049  N  N   . ALA D  4  129 ? 46.341  292.758 165.931 1.00 34.95  ? 129  ALA D N   1 
ATOM   9050  C  CA  . ALA D  4  129 ? 46.664  291.683 166.877 1.00 34.70  ? 129  ALA D CA  1 
ATOM   9051  C  C   . ALA D  4  129 ? 46.184  290.332 166.325 1.00 32.65  ? 129  ALA D C   1 
ATOM   9052  O  O   . ALA D  4  129 ? 45.309  289.684 166.905 1.00 35.85  ? 129  ALA D O   1 
ATOM   9053  C  CB  . ALA D  4  129 ? 46.052  291.977 168.273 1.00 31.30  ? 129  ALA D CB  1 
ATOM   9054  N  N   . PRO D  4  130 ? 46.785  289.870 165.223 1.00 34.66  ? 130  PRO D N   1 
ATOM   9055  C  CA  . PRO D  4  130 ? 46.280  288.679 164.522 1.00 29.47  ? 130  PRO D CA  1 
ATOM   9056  C  C   . PRO D  4  130 ? 46.834  287.404 165.121 1.00 42.18  ? 130  PRO D C   1 
ATOM   9057  O  O   . PRO D  4  130 ? 46.377  286.318 164.749 1.00 32.83  ? 130  PRO D O   1 
ATOM   9058  C  CB  . PRO D  4  130 ? 46.824  288.886 163.080 1.00 33.63  ? 130  PRO D CB  1 
ATOM   9059  C  CG  . PRO D  4  130 ? 48.211  289.538 163.345 1.00 35.34  ? 130  PRO D CG  1 
ATOM   9060  C  CD  . PRO D  4  130 ? 47.962  290.458 164.539 1.00 33.93  ? 130  PRO D CD  1 
ATOM   9061  N  N   . ILE D  4  131 ? 47.803  287.489 166.026 1.00 33.35  ? 131  ILE D N   1 
ATOM   9062  C  CA  . ILE D  4  131 ? 48.369  286.255 166.588 1.00 44.46  ? 131  ILE D CA  1 
ATOM   9063  C  C   . ILE D  4  131 ? 47.574  285.785 167.807 1.00 34.12  ? 131  ILE D C   1 
ATOM   9064  O  O   . ILE D  4  131 ? 47.246  284.603 167.947 1.00 39.27  ? 131  ILE D O   1 
ATOM   9065  C  CB  . ILE D  4  131 ? 49.870  286.447 166.917 1.00 45.46  ? 131  ILE D CB  1 
ATOM   9066  C  CG1 . ILE D  4  131 ? 50.646  286.764 165.638 1.00 45.49  ? 131  ILE D CG1 1 
ATOM   9067  C  CG2 . ILE D  4  131 ? 50.449  285.161 167.400 1.00 37.47  ? 131  ILE D CG2 1 
ATOM   9068  C  CD1 . ILE D  4  131 ? 51.179  288.103 165.622 1.00 44.59  ? 131  ILE D CD1 1 
ATOM   9069  N  N   . GLN D  4  132 ? 47.250  286.698 168.728 1.00 35.34  ? 132  GLN D N   1 
ATOM   9070  C  CA  . GLN D  4  132 ? 46.410  286.328 169.861 1.00 30.85  ? 132  GLN D CA  1 
ATOM   9071  C  C   . GLN D  4  132 ? 45.367  287.363 170.228 1.00 38.43  ? 132  GLN D C   1 
ATOM   9072  O  O   . GLN D  4  132 ? 44.364  286.992 170.831 1.00 39.26  ? 132  GLN D O   1 
ATOM   9073  C  CB  . GLN D  4  132 ? 47.294  286.138 171.119 1.00 33.52  ? 132  GLN D CB  1 
ATOM   9074  C  CG  . GLN D  4  132 ? 48.374  285.103 170.977 1.00 34.56  ? 132  GLN D CG  1 
ATOM   9075  C  CD  . GLN D  4  132 ? 49.156  284.972 172.262 1.00 45.57  ? 132  GLN D CD  1 
ATOM   9076  O  OE1 . GLN D  4  132 ? 49.933  285.851 172.605 1.00 39.38  ? 132  GLN D OE1 1 
ATOM   9077  N  NE2 . GLN D  4  132 ? 48.940  283.888 172.990 1.00 33.82  ? 132  GLN D NE2 1 
ATOM   9078  N  N   . GLY D  4  133 ? 45.612  288.652 170.026 1.00 36.01  ? 133  GLY D N   1 
ATOM   9079  C  CA  . GLY D  4  133 ? 44.858  289.628 170.812 1.00 32.26  ? 133  GLY D CA  1 
ATOM   9080  C  C   . GLY D  4  133 ? 43.441  289.955 170.354 1.00 46.07  ? 133  GLY D C   1 
ATOM   9081  O  O   . GLY D  4  133 ? 42.547  290.177 171.186 1.00 37.53  ? 133  GLY D O   1 
ATOM   9082  N  N   . PHE D  4  134 ? 43.234  290.057 169.040 1.00 34.69  ? 134  PHE D N   1 
ATOM   9083  C  CA  . PHE D  4  134 ? 42.011  290.654 168.521 1.00 37.01  ? 134  PHE D CA  1 
ATOM   9084  C  C   . PHE D  4  134 ? 41.549  289.929 167.243 1.00 36.51  ? 134  PHE D C   1 
ATOM   9085  O  O   . PHE D  4  134 ? 40.621  289.119 167.279 1.00 42.62  ? 134  PHE D O   1 
ATOM   9086  C  CB  . PHE D  4  134 ? 42.217  292.178 168.300 1.00 27.50  ? 134  PHE D CB  1 
ATOM   9087  C  CG  . PHE D  4  134 ? 40.953  292.917 167.953 1.00 42.10  ? 134  PHE D CG  1 
ATOM   9088  C  CD1 . PHE D  4  134 ? 40.069  293.310 168.964 1.00 42.24  ? 134  PHE D CD1 1 
ATOM   9089  C  CD2 . PHE D  4  134 ? 40.578  293.127 166.604 1.00 37.17  ? 134  PHE D CD2 1 
ATOM   9090  C  CE1 . PHE D  4  134 ? 38.879  293.997 168.637 1.00 45.34  ? 134  PHE D CE1 1 
ATOM   9091  C  CE2 . PHE D  4  134 ? 39.382  293.790 166.264 1.00 37.23  ? 134  PHE D CE2 1 
ATOM   9092  C  CZ  . PHE D  4  134 ? 38.523  294.228 167.303 1.00 35.93  ? 134  PHE D CZ  1 
ATOM   9093  N  N   . SER D  4  135 ? 42.197  290.193 166.113 1.00 34.30  ? 135  SER D N   1 
ATOM   9094  C  CA  . SER D  4  135 ? 41.829  289.495 164.866 1.00 37.53  ? 135  SER D CA  1 
ATOM   9095  C  C   . SER D  4  135 ? 41.982  288.002 164.995 1.00 45.96  ? 135  SER D C   1 
ATOM   9096  O  O   . SER D  4  135 ? 41.269  287.268 164.326 1.00 39.79  ? 135  SER D O   1 
ATOM   9097  C  CB  . SER D  4  135 ? 42.684  289.979 163.685 1.00 35.28  ? 135  SER D CB  1 
ATOM   9098  O  OG  . SER D  4  135 ? 42.383  291.346 163.525 1.00 47.31  ? 135  SER D OG  1 
ATOM   9099  N  N   . ALA D  4  136 ? 42.943  287.530 165.792 1.00 38.42  ? 136  ALA D N   1 
ATOM   9100  C  CA  . ALA D  4  136 ? 43.037  286.097 166.105 1.00 40.36  ? 136  ALA D CA  1 
ATOM   9101  C  C   . ALA D  4  136 ? 41.708  285.525 166.545 1.00 45.82  ? 136  ALA D C   1 
ATOM   9102  O  O   . ALA D  4  136 ? 41.512  284.309 166.489 1.00 40.68  ? 136  ALA D O   1 
ATOM   9103  C  CB  . ALA D  4  136 ? 44.029  285.820 167.290 1.00 34.45  ? 136  ALA D CB  1 
ATOM   9104  N  N   . LYS D  4  137 ? 40.842  286.351 167.128 1.00 35.69  ? 137  LYS D N   1 
ATOM   9105  C  CA  . LYS D  4  137 ? 39.593  285.829 167.647 1.00 37.34  ? 137  LYS D CA  1 
ATOM   9106  C  C   . LYS D  4  137 ? 38.483  285.916 166.623 1.00 48.67  ? 137  LYS D C   1 
ATOM   9107  O  O   . LYS D  4  137 ? 37.363  285.534 166.922 1.00 40.11  ? 137  LYS D O   1 
ATOM   9108  C  CB  . LYS D  4  137 ? 39.190  286.553 168.941 1.00 37.18  ? 137  LYS D CB  1 
ATOM   9109  C  CG  . LYS D  4  137 ? 40.318  286.509 169.939 1.00 34.32  ? 137  LYS D CG  1 
ATOM   9110  C  CD  . LYS D  4  137 ? 39.922  287.172 171.256 1.00 35.92  ? 137  LYS D CD  1 
ATOM   9111  C  CE  . LYS D  4  137 ? 41.025  286.997 172.352 1.00 38.28  ? 137  LYS D CE  1 
ATOM   9112  N  NZ  . LYS D  4  137 ? 40.627  287.842 173.512 1.00 54.55  ? 137  LYS D NZ  1 
ATOM   9113  N  N   . TRP D  4  138 ? 38.773  286.390 165.429 1.00 36.55  ? 138  TRP D N   1 
ATOM   9114  C  CA  . TRP D  4  138 ? 37.774  286.458 164.363 1.00 36.32  ? 138  TRP D CA  1 
ATOM   9115  C  C   . TRP D  4  138 ? 38.034  285.336 163.361 1.00 35.40  ? 138  TRP D C   1 
ATOM   9116  O  O   . TRP D  4  138 ? 39.190  285.058 163.003 1.00 44.54  ? 138  TRP D O   1 
ATOM   9117  C  CB  . TRP D  4  138 ? 37.827  287.824 163.656 1.00 39.10  ? 138  TRP D CB  1 
ATOM   9118  C  CG  . TRP D  4  138 ? 36.892  287.974 162.446 1.00 36.00  ? 138  TRP D CG  1 
ATOM   9119  C  CD1 . TRP D  4  138 ? 37.221  287.842 161.157 1.00 41.98  ? 138  TRP D CD1 1 
ATOM   9120  C  CD2 . TRP D  4  138 ? 35.507  288.318 162.492 1.00 47.49  ? 138  TRP D CD2 1 
ATOM   9121  N  NE1 . TRP D  4  138 ? 36.113  288.057 160.351 1.00 39.25  ? 138  TRP D NE1 1 
ATOM   9122  C  CE2 . TRP D  4  138 ? 35.043  288.356 161.157 1.00 44.61  ? 138  TRP D CE2 1 
ATOM   9123  C  CE3 . TRP D  4  138 ? 34.606  288.590 163.537 1.00 36.62  ? 138  TRP D CE3 1 
ATOM   9124  C  CZ2 . TRP D  4  138 ? 33.708  288.674 160.824 1.00 48.15  ? 138  TRP D CZ2 1 
ATOM   9125  C  CZ3 . TRP D  4  138 ? 33.256  288.904 163.210 1.00 45.96  ? 138  TRP D CZ3 1 
ATOM   9126  C  CH2 . TRP D  4  138 ? 32.829  288.928 161.857 1.00 49.06  ? 138  TRP D CH2 1 
ATOM   9127  N  N   . ASP D  4  139 ? 36.957  284.694 162.905 1.00 40.07  ? 139  ASP D N   1 
ATOM   9128  C  CA  . ASP D  4  139 ? 37.053  283.623 161.915 1.00 42.36  ? 139  ASP D CA  1 
ATOM   9129  C  C   . ASP D  4  139 ? 36.848  284.249 160.536 1.00 46.32  ? 139  ASP D C   1 
ATOM   9130  O  O   . ASP D  4  139 ? 35.742  284.663 160.188 1.00 47.34  ? 139  ASP D O   1 
ATOM   9131  C  CB  . ASP D  4  139 ? 36.020  282.535 162.205 1.00 74.00  ? 139  ASP D CB  1 
ATOM   9132  C  CG  . ASP D  4  139 ? 36.236  281.263 161.377 1.00 48.95  ? 139  ASP D CG  1 
ATOM   9133  O  OD1 . ASP D  4  139 ? 36.635  281.361 160.174 1.00 50.50  ? 139  ASP D OD1 1 
ATOM   9134  O  OD2 . ASP D  4  139 ? 36.014  280.166 161.950 1.00 80.72  ? 139  ASP D OD2 1 
ATOM   9135  N  N   . TYR D  4  140 ? 37.923  284.361 159.771 1.00 40.70  ? 140  TYR D N   1 
ATOM   9136  C  CA  . TYR D  4  140 ? 37.878  285.055 158.493 1.00 45.36  ? 140  TYR D CA  1 
ATOM   9137  C  C   . TYR D  4  140 ? 37.217  284.200 157.445 1.00 90.15  ? 140  TYR D C   1 
ATOM   9138  O  O   . TYR D  4  140 ? 36.794  284.715 156.412 1.00 54.02  ? 140  TYR D O   1 
ATOM   9139  C  CB  . TYR D  4  140 ? 39.286  285.429 158.054 1.00 46.20  ? 140  TYR D CB  1 
ATOM   9140  C  CG  . TYR D  4  140 ? 39.808  286.651 158.774 1.00 54.84  ? 140  TYR D CG  1 
ATOM   9141  C  CD1 . TYR D  4  140 ? 39.595  287.908 158.245 1.00 41.21  ? 140  TYR D CD1 1 
ATOM   9142  C  CD2 . TYR D  4  140 ? 40.472  286.549 160.006 1.00 49.18  ? 140  TYR D CD2 1 
ATOM   9143  C  CE1 . TYR D  4  140 ? 40.039  289.056 158.913 1.00 44.92  ? 140  TYR D CE1 1 
ATOM   9144  C  CE2 . TYR D  4  140 ? 40.918  287.684 160.678 1.00 44.85  ? 140  TYR D CE2 1 
ATOM   9145  C  CZ  . TYR D  4  140 ? 40.714  288.936 160.126 1.00 37.90  ? 140  TYR D CZ  1 
ATOM   9146  O  OH  . TYR D  4  140 ? 41.156  290.073 160.784 1.00 39.57  ? 140  TYR D OH  1 
ATOM   9147  N  N   . ASP D  4  141 ? 37.142  282.901 157.691 1.00 44.81  ? 141  ASP D N   1 
ATOM   9148  C  CA  . ASP D  4  141 ? 36.478  281.985 156.770 1.00 72.84  ? 141  ASP D CA  1 
ATOM   9149  C  C   . ASP D  4  141 ? 34.980  281.907 157.014 1.00 60.59  ? 141  ASP D C   1 
ATOM   9150  O  O   . ASP D  4  141 ? 34.202  281.972 156.068 1.00 71.80  ? 141  ASP D O   1 
ATOM   9151  C  CB  . ASP D  4  141 ? 37.112  280.602 156.875 1.00 57.99  ? 141  ASP D CB  1 
ATOM   9152  C  CG  . ASP D  4  141 ? 38.516  280.584 156.329 1.00 159.49 ? 141  ASP D CG  1 
ATOM   9153  O  OD1 . ASP D  4  141 ? 38.778  281.331 155.371 1.00 71.84  ? 141  ASP D OD1 1 
ATOM   9154  O  OD2 . ASP D  4  141 ? 39.358  279.841 156.856 1.00 66.19  ? 141  ASP D OD2 1 
ATOM   9155  N  N   . LYS D  4  142 ? 34.544  281.819 158.266 1.00 56.87  ? 142  LYS D N   1 
ATOM   9156  C  CA  . LYS D  4  142 ? 33.114  281.828 158.532 1.00 48.95  ? 142  LYS D CA  1 
ATOM   9157  C  C   . LYS D  4  142 ? 32.546  283.232 158.683 1.00 62.86  ? 142  LYS D C   1 
ATOM   9158  O  O   . LYS D  4  142 ? 31.326  283.369 158.825 1.00 49.59  ? 142  LYS D O   1 
ATOM   9159  C  CB  . LYS D  4  142 ? 32.779  280.977 159.777 1.00 87.93  ? 142  LYS D CB  1 
ATOM   9160  C  CG  . LYS D  4  142 ? 33.123  279.476 159.629 1.00 77.71  ? 142  LYS D CG  1 
ATOM   9161  C  CD  . LYS D  4  142 ? 32.498  278.596 160.734 1.00 67.68  ? 142  LYS D CD  1 
ATOM   9162  C  CE  . LYS D  4  142 ? 31.006  278.356 160.516 1.00 120.46 ? 142  LYS D CE  1 
ATOM   9163  N  NZ  . LYS D  4  142 ? 30.404  277.499 161.586 1.00 96.95  ? 142  LYS D NZ  1 
ATOM   9164  N  N   . ASN D  4  143 ? 33.384  284.278 158.623 1.00 58.47  ? 143  ASN D N   1 
ATOM   9165  C  CA  . ASN D  4  143 ? 32.918  285.666 158.747 1.00 69.91  ? 143  ASN D CA  1 
ATOM   9166  C  C   . ASN D  4  143 ? 32.141  285.892 160.055 1.00 57.44  ? 143  ASN D C   1 
ATOM   9167  O  O   . ASN D  4  143 ? 31.079  286.520 160.075 1.00 49.71  ? 143  ASN D O   1 
ATOM   9168  C  CB  . ASN D  4  143 ? 32.079  286.059 157.521 1.00 67.38  ? 143  ASN D CB  1 
ATOM   9169  C  CG  . ASN D  4  143 ? 31.886  287.568 157.386 1.00 92.13  ? 143  ASN D CG  1 
ATOM   9170  O  OD1 . ASN D  4  143 ? 32.749  288.366 157.778 1.00 63.16  ? 143  ASN D OD1 1 
ATOM   9171  N  ND2 . ASN D  4  143 ? 30.750  287.966 156.824 1.00 130.05 ? 143  ASN D ND2 1 
ATOM   9172  N  N   . GLU D  4  144 ? 32.681  285.387 161.168 1.00 47.66  ? 144  GLU D N   1 
ATOM   9173  C  CA  . GLU D  4  144 ? 32.050  285.588 162.477 1.00 43.49  ? 144  GLU D CA  1 
ATOM   9174  C  C   . GLU D  4  144 ? 33.102  285.505 163.582 1.00 41.26  ? 144  GLU D C   1 
ATOM   9175  O  O   . GLU D  4  144 ? 34.225  285.047 163.364 1.00 48.47  ? 144  GLU D O   1 
ATOM   9176  C  CB  . GLU D  4  144 ? 30.976  284.550 162.724 1.00 69.19  ? 144  GLU D CB  1 
ATOM   9177  C  CG  . GLU D  4  144 ? 31.570  283.178 162.898 1.00 50.68  ? 144  GLU D CG  1 
ATOM   9178  C  CD  . GLU D  4  144 ? 30.496  282.097 162.982 1.00 172.04 ? 144  GLU D CD  1 
ATOM   9179  O  OE1 . GLU D  4  144 ? 30.843  280.914 163.144 1.00 82.43  ? 144  GLU D OE1 1 
ATOM   9180  O  OE2 . GLU D  4  144 ? 29.301  282.422 162.874 1.00 69.20  ? 144  GLU D OE2 1 
ATOM   9181  N  N   . TRP D  4  145 ? 32.727  285.934 164.787 1.00 39.86  ? 145  TRP D N   1 
ATOM   9182  C  CA  . TRP D  4  145 ? 33.617  285.721 165.935 1.00 37.39  ? 145  TRP D CA  1 
ATOM   9183  C  C   . TRP D  4  145 ? 33.764  284.227 166.186 1.00 50.42  ? 145  TRP D C   1 
ATOM   9184  O  O   . TRP D  4  145 ? 32.779  283.491 166.179 1.00 49.88  ? 145  TRP D O   1 
ATOM   9185  C  CB  . TRP D  4  145 ? 33.060  286.408 167.187 1.00 39.33  ? 145  TRP D CB  1 
ATOM   9186  C  CG  . TRP D  4  145 ? 33.050  287.887 167.038 1.00 46.89  ? 145  TRP D CG  1 
ATOM   9187  C  CD1 . TRP D  4  145 ? 31.960  288.683 166.880 1.00 39.58  ? 145  TRP D CD1 1 
ATOM   9188  C  CD2 . TRP D  4  145 ? 34.201  288.739 166.985 1.00 38.70  ? 145  TRP D CD2 1 
ATOM   9189  N  NE1 . TRP D  4  145 ? 32.364  290.000 166.745 1.00 44.01  ? 145  TRP D NE1 1 
ATOM   9190  C  CE2 . TRP D  4  145 ? 33.734  290.058 166.786 1.00 41.12  ? 145  TRP D CE2 1 
ATOM   9191  C  CE3 . TRP D  4  145 ? 35.597  288.503 167.061 1.00 32.65  ? 145  TRP D CE3 1 
ATOM   9192  C  CZ2 . TRP D  4  145 ? 34.605  291.167 166.663 1.00 34.61  ? 145  TRP D CZ2 1 
ATOM   9193  C  CZ3 . TRP D  4  145 ? 36.476  289.608 166.993 1.00 36.84  ? 145  TRP D CZ3 1 
ATOM   9194  C  CH2 . TRP D  4  145 ? 35.957  290.933 166.796 1.00 38.80  ? 145  TRP D CH2 1 
ATOM   9195  N  N   . LYS D  4  146 ? 34.986  283.777 166.441 1.00 41.97  ? 146  LYS D N   1 
ATOM   9196  C  CA  . LYS D  4  146 ? 35.196  282.368 166.774 1.00 55.02  ? 146  LYS D CA  1 
ATOM   9197  C  C   . LYS D  4  146 ? 34.402  281.963 168.012 1.00 51.30  ? 146  LYS D C   1 
ATOM   9198  O  O   . LYS D  4  146 ? 34.331  282.705 169.000 1.00 55.18  ? 146  LYS D O   1 
ATOM   9199  C  CB  . LYS D  4  146 ? 36.684  282.092 167.013 1.00 46.77  ? 146  LYS D CB  1 
ATOM   9200  C  CG  . LYS D  4  146 ? 37.525  282.290 165.742 1.00 49.05  ? 146  LYS D CG  1 
ATOM   9201  C  CD  . LYS D  4  146 ? 38.964  281.939 165.991 1.00 39.93  ? 146  LYS D CD  1 
ATOM   9202  C  CE  . LYS D  4  146 ? 39.781  282.153 164.686 1.00 42.23  ? 146  LYS D CE  1 
ATOM   9203  N  NZ  . LYS D  4  146 ? 41.188  281.909 165.004 1.00 46.80  ? 146  LYS D NZ  1 
ATOM   9204  N  N   . LYS D  4  147 ? 33.802  280.786 167.963 1.00 116.09 ? 147  LYS D N   1 
ATOM   9205  C  CA  . LYS D  4  147 ? 33.048  280.336 169.116 1.00 59.32  ? 147  LYS D CA  1 
ATOM   9206  C  C   . LYS D  4  147 ? 33.979  279.505 169.984 1.00 106.79 ? 147  LYS D C   1 
ATOM   9207  O  O   . LYS D  4  147 ? 34.222  278.327 169.725 1.00 146.61 ? 147  LYS D O   1 
ATOM   9208  C  CB  . LYS D  4  147 ? 31.801  279.562 168.684 1.00 87.09  ? 147  LYS D CB  1 
ATOM   9209  C  CG  . LYS D  4  147 ? 30.732  280.453 168.052 1.00 90.30  ? 147  LYS D CG  1 
ATOM   9210  C  CD  . LYS D  4  147 ? 30.156  279.849 166.784 1.00 76.89  ? 147  LYS D CD  1 
ATOM   9211  C  CE  . LYS D  4  147 ? 29.071  280.744 166.191 1.00 168.82 ? 147  LYS D CE  1 
ATOM   9212  N  NZ  . LYS D  4  147 ? 28.468  280.182 164.949 1.00 170.87 ? 147  LYS D NZ  1 
ATOM   9213  O  OXT . LYS D  4  147 ? 34.533  280.035 170.957 1.00 76.00  ? 147  LYS D OXT 1 
ATOM   9214  N  N   . HIS E  5  5   ? 71.705  275.449 222.850 1.00 137.79 ? 5    HIS E N   1 
ATOM   9215  C  CA  . HIS E  5  5   ? 71.964  274.135 222.268 1.00 159.61 ? 5    HIS E CA  1 
ATOM   9216  C  C   . HIS E  5  5   ? 71.999  273.028 223.329 1.00 159.53 ? 5    HIS E C   1 
ATOM   9217  O  O   . HIS E  5  5   ? 72.773  272.077 223.214 1.00 108.06 ? 5    HIS E O   1 
ATOM   9218  C  CB  . HIS E  5  5   ? 73.277  274.164 221.485 1.00 165.63 ? 5    HIS E CB  1 
ATOM   9219  C  CG  . HIS E  5  5   ? 74.260  275.164 222.009 1.00 220.93 ? 5    HIS E CG  1 
ATOM   9220  N  ND1 . HIS E  5  5   ? 75.157  274.871 223.013 1.00 240.18 ? 5    HIS E ND1 1 
ATOM   9221  C  CD2 . HIS E  5  5   ? 74.469  276.462 221.685 1.00 122.35 ? 5    HIS E CD2 1 
ATOM   9222  C  CE1 . HIS E  5  5   ? 75.885  275.941 223.277 1.00 139.85 ? 5    HIS E CE1 1 
ATOM   9223  N  NE2 . HIS E  5  5   ? 75.487  276.921 222.485 1.00 143.82 ? 5    HIS E NE2 1 
ATOM   9224  N  N   . GLU E  5  6   ? 71.151  273.156 224.349 1.00 129.61 ? 6    GLU E N   1 
ATOM   9225  C  CA  . GLU E  5  6   ? 71.004  272.171 225.413 1.00 90.06  ? 6    GLU E CA  1 
ATOM   9226  C  C   . GLU E  5  6   ? 69.793  271.282 225.155 1.00 59.13  ? 6    GLU E C   1 
ATOM   9227  O  O   . GLU E  5  6   ? 68.858  271.660 224.444 1.00 77.65  ? 6    GLU E O   1 
ATOM   9228  C  CB  . GLU E  5  6   ? 70.852  272.859 226.769 1.00 133.98 ? 6    GLU E CB  1 
ATOM   9229  C  CG  . GLU E  5  6   ? 69.597  273.712 226.873 1.00 149.85 ? 6    GLU E CG  1 
ATOM   9230  C  CD  . GLU E  5  6   ? 69.501  274.432 228.200 1.00 187.63 ? 6    GLU E CD  1 
ATOM   9231  O  OE1 . GLU E  5  6   ? 68.738  275.415 228.291 1.00 71.49  ? 6    GLU E OE1 1 
ATOM   9232  O  OE2 . GLU E  5  6   ? 70.196  274.019 229.152 1.00 100.28 ? 6    GLU E OE2 1 
ATOM   9233  N  N   . THR E  5  7   ? 69.819  270.092 225.757 1.00 61.26  ? 7    THR E N   1 
ATOM   9234  C  CA  . THR E  5  7   ? 68.747  269.123 225.569 1.00 65.28  ? 7    THR E CA  1 
ATOM   9235  C  C   . THR E  5  7   ? 67.455  269.598 226.230 1.00 171.51 ? 7    THR E C   1 
ATOM   9236  O  O   . THR E  5  7   ? 67.440  270.496 227.077 1.00 64.14  ? 7    THR E O   1 
ATOM   9237  C  CB  . THR E  5  7   ? 69.123  267.745 226.134 1.00 81.57  ? 7    THR E CB  1 
ATOM   9238  O  OG1 . THR E  5  7   ? 68.726  267.648 227.510 1.00 84.96  ? 7    THR E OG1 1 
ATOM   9239  C  CG2 . THR E  5  7   ? 70.615  267.516 226.042 1.00 89.93  ? 7    THR E CG2 1 
ATOM   9240  N  N   . ASP E  5  8   ? 66.354  268.979 225.809 1.00 50.43  ? 8    ASP E N   1 
ATOM   9241  C  CA  . ASP E  5  8   ? 65.062  269.176 226.462 1.00 58.54  ? 8    ASP E CA  1 
ATOM   9242  C  C   . ASP E  5  8   ? 65.157  268.937 227.962 1.00 70.37  ? 8    ASP E C   1 
ATOM   9243  O  O   . ASP E  5  8   ? 64.602  269.698 228.765 1.00 55.77  ? 8    ASP E O   1 
ATOM   9244  C  CB  . ASP E  5  8   ? 64.021  268.220 225.873 1.00 56.82  ? 8    ASP E CB  1 
ATOM   9245  C  CG  . ASP E  5  8   ? 63.672  268.529 224.430 1.00 48.78  ? 8    ASP E CG  1 
ATOM   9246  O  OD1 . ASP E  5  8   ? 64.147  269.543 223.862 1.00 54.03  ? 8    ASP E OD1 1 
ATOM   9247  O  OD2 . ASP E  5  8   ? 62.912  267.717 223.875 1.00 69.22  ? 8    ASP E OD2 1 
ATOM   9248  N  N   . GLU E  5  9   ? 65.813  267.840 228.354 1.00 57.97  ? 9    GLU E N   1 
ATOM   9249  C  CA  . GLU E  5  9   ? 65.850  267.478 229.767 1.00 63.09  ? 9    GLU E CA  1 
ATOM   9250  C  C   . GLU E  5  9   ? 66.658  268.492 230.552 1.00 62.13  ? 9    GLU E C   1 
ATOM   9251  O  O   . GLU E  5  9   ? 66.281  268.865 231.665 1.00 53.60  ? 9    GLU E O   1 
ATOM   9252  C  CB  . GLU E  5  9   ? 66.418  266.069 229.950 1.00 85.72  ? 9    GLU E CB  1 
ATOM   9253  C  CG  . GLU E  5  9   ? 65.491  264.937 229.497 1.00 106.38 ? 9    GLU E CG  1 
ATOM   9254  C  CD  . GLU E  5  9   ? 65.452  264.763 227.978 1.00 213.97 ? 9    GLU E CD  1 
ATOM   9255  O  OE1 . GLU E  5  9   ? 64.461  264.184 227.475 1.00 109.05 ? 9    GLU E OE1 1 
ATOM   9256  O  OE2 . GLU E  5  9   ? 66.407  265.199 227.287 1.00 112.63 ? 9    GLU E OE2 1 
ATOM   9257  N  N   . GLU E  5  10  ? 67.733  269.001 229.962 1.00 50.32  ? 10   GLU E N   1 
ATOM   9258  C  CA  . GLU E  5  10  ? 68.516  270.032 230.633 1.00 64.07  ? 10   GLU E CA  1 
ATOM   9259  C  C   . GLU E  5  10  ? 67.741  271.343 230.753 1.00 141.44 ? 10   GLU E C   1 
ATOM   9260  O  O   . GLU E  5  10  ? 67.825  272.020 231.783 1.00 54.25  ? 10   GLU E O   1 
ATOM   9261  C  CB  . GLU E  5  10  ? 69.840  270.219 229.892 1.00 73.05  ? 10   GLU E CB  1 
ATOM   9262  C  CG  . GLU E  5  10  ? 70.680  268.935 229.924 1.00 161.42 ? 10   GLU E CG  1 
ATOM   9263  C  CD  . GLU E  5  10  ? 71.896  268.978 229.025 1.00 96.85  ? 10   GLU E CD  1 
ATOM   9264  O  OE1 . GLU E  5  10  ? 72.133  270.025 228.385 1.00 69.64  ? 10   GLU E OE1 1 
ATOM   9265  O  OE2 . GLU E  5  10  ? 72.611  267.954 228.959 1.00 108.71 ? 10   GLU E OE2 1 
ATOM   9266  N  N   . PHE E  5  11  ? 66.987  271.718 229.715 1.00 53.86  ? 11   PHE E N   1 
ATOM   9267  C  CA  . PHE E  5  11  ? 66.108  272.888 229.792 1.00 47.87  ? 11   PHE E CA  1 
ATOM   9268  C  C   . PHE E  5  11  ? 65.096  272.729 230.915 1.00 63.99  ? 11   PHE E C   1 
ATOM   9269  O  O   . PHE E  5  11  ? 64.952  273.607 231.763 1.00 52.31  ? 11   PHE E O   1 
ATOM   9270  C  CB  . PHE E  5  11  ? 65.395  273.101 228.439 1.00 49.66  ? 11   PHE E CB  1 
ATOM   9271  C  CG  . PHE E  5  11  ? 64.357  274.223 228.436 1.00 49.97  ? 11   PHE E CG  1 
ATOM   9272  C  CD1 . PHE E  5  11  ? 63.047  273.975 228.815 1.00 56.39  ? 11   PHE E CD1 1 
ATOM   9273  C  CD2 . PHE E  5  11  ? 64.694  275.508 228.015 1.00 54.54  ? 11   PHE E CD2 1 
ATOM   9274  C  CE1 . PHE E  5  11  ? 62.090  274.990 228.802 1.00 47.84  ? 11   PHE E CE1 1 
ATOM   9275  C  CE2 . PHE E  5  11  ? 63.746  276.534 227.967 1.00 44.21  ? 11   PHE E CE2 1 
ATOM   9276  C  CZ  . PHE E  5  11  ? 62.439  276.276 228.358 1.00 50.24  ? 11   PHE E CZ  1 
ATOM   9277  N  N   . ASP E  5  12  ? 64.394  271.607 230.944 1.00 38.26  ? 12   ASP E N   1 
ATOM   9278  C  CA  . ASP E  5  12  ? 63.345  271.429 231.942 1.00 41.55  ? 12   ASP E CA  1 
ATOM   9279  C  C   . ASP E  5  12  ? 63.923  271.513 233.342 1.00 46.99  ? 12   ASP E C   1 
ATOM   9280  O  O   . ASP E  5  12  ? 63.326  272.113 234.250 1.00 49.18  ? 12   ASP E O   1 
ATOM   9281  C  CB  . ASP E  5  12  ? 62.649  270.084 231.740 1.00 41.28  ? 12   ASP E CB  1 
ATOM   9282  C  CG  . ASP E  5  12  ? 61.910  270.019 230.420 1.00 49.71  ? 12   ASP E CG  1 
ATOM   9283  O  OD1 . ASP E  5  12  ? 61.721  271.104 229.862 1.00 47.37  ? 12   ASP E OD1 1 
ATOM   9284  O  OD2 . ASP E  5  12  ? 61.535  268.926 229.953 1.00 58.36  ? 12   ASP E OD2 1 
ATOM   9285  N  N   . ALA E  5  13  ? 65.118  270.967 233.515 1.00 49.23  ? 13   ALA E N   1 
ATOM   9286  C  CA  . ALA E  5  13  ? 65.672  270.820 234.851 1.00 52.54  ? 13   ALA E CA  1 
ATOM   9287  C  C   . ALA E  5  13  ? 66.152  272.163 235.387 1.00 43.41  ? 13   ALA E C   1 
ATOM   9288  O  O   . ALA E  5  13  ? 65.936  272.479 236.563 1.00 48.31  ? 13   ALA E O   1 
ATOM   9289  C  CB  . ALA E  5  13  ? 66.793  269.779 234.811 1.00 46.43  ? 13   ALA E CB  1 
ATOM   9290  N  N   . ARG E  5  14  ? 66.780  272.976 234.534 1.00 42.41  ? 14   ARG E N   1 
ATOM   9291  C  CA  . ARG E  5  14  ? 67.054  274.375 234.864 1.00 52.71  ? 14   ARG E CA  1 
ATOM   9292  C  C   . ARG E  5  14  ? 65.806  275.100 235.364 1.00 57.60  ? 14   ARG E C   1 
ATOM   9293  O  O   . ARG E  5  14  ? 65.876  275.875 236.321 1.00 46.82  ? 14   ARG E O   1 
ATOM   9294  C  CB  . ARG E  5  14  ? 67.582  275.132 233.633 1.00 50.41  ? 14   ARG E CB  1 
ATOM   9295  C  CG  . ARG E  5  14  ? 69.032  275.011 233.283 1.00 80.53  ? 14   ARG E CG  1 
ATOM   9296  C  CD  . ARG E  5  14  ? 69.462  276.226 232.421 1.00 224.68 ? 14   ARG E CD  1 
ATOM   9297  N  NE  . ARG E  5  14  ? 68.653  276.453 231.211 1.00 86.29  ? 14   ARG E NE  1 
ATOM   9298  C  CZ  . ARG E  5  14  ? 67.798  277.466 231.034 1.00 67.01  ? 14   ARG E CZ  1 
ATOM   9299  N  NH1 . ARG E  5  14  ? 67.596  278.362 231.996 1.00 110.23 ? 14   ARG E NH1 1 
ATOM   9300  N  NH2 . ARG E  5  14  ? 67.125  277.573 229.895 1.00 100.16 ? 14   ARG E NH2 1 
ATOM   9301  N  N   . TRP E  5  15  ? 64.663  274.901 234.697 1.00 41.40  ? 15   TRP E N   1 
ATOM   9302  C  CA  . TRP E  5  15  ? 63.448  275.627 235.079 1.00 37.03  ? 15   TRP E CA  1 
ATOM   9303  C  C   . TRP E  5  15  ? 62.851  275.093 236.370 1.00 42.79  ? 15   TRP E C   1 
ATOM   9304  O  O   . TRP E  5  15  ? 62.390  275.885 237.207 1.00 44.83  ? 15   TRP E O   1 
ATOM   9305  C  CB  . TRP E  5  15  ? 62.416  275.598 233.939 1.00 35.30  ? 15   TRP E CB  1 
ATOM   9306  C  CG  . TRP E  5  15  ? 62.712  276.726 232.984 1.00 36.70  ? 15   TRP E CG  1 
ATOM   9307  C  CD1 . TRP E  5  15  ? 63.340  276.634 231.780 1.00 46.29  ? 15   TRP E CD1 1 
ATOM   9308  C  CD2 . TRP E  5  15  ? 62.468  278.118 233.206 1.00 44.64  ? 15   TRP E CD2 1 
ATOM   9309  N  NE1 . TRP E  5  15  ? 63.488  277.871 231.237 1.00 42.01  ? 15   TRP E NE1 1 
ATOM   9310  C  CE2 . TRP E  5  15  ? 62.950  278.805 232.076 1.00 47.13  ? 15   TRP E CE2 1 
ATOM   9311  C  CE3 . TRP E  5  15  ? 61.860  278.850 234.240 1.00 37.41  ? 15   TRP E CE3 1 
ATOM   9312  C  CZ2 . TRP E  5  15  ? 62.834  280.190 231.933 1.00 35.38  ? 15   TRP E CZ2 1 
ATOM   9313  C  CZ3 . TRP E  5  15  ? 61.751  280.231 234.096 1.00 48.35  ? 15   TRP E CZ3 1 
ATOM   9314  C  CH2 . TRP E  5  15  ? 62.238  280.884 232.952 1.00 85.33  ? 15   TRP E CH2 1 
ATOM   9315  N  N   . VAL E  5  16  ? 62.827  273.767 236.545 1.00 41.93  ? 16   VAL E N   1 
ATOM   9316  C  CA  . VAL E  5  16  ? 62.421  273.175 237.832 1.00 43.97  ? 16   VAL E CA  1 
ATOM   9317  C  C   . VAL E  5  16  ? 63.252  273.745 238.973 1.00 57.83  ? 16   VAL E C   1 
ATOM   9318  O  O   . VAL E  5  16  ? 62.726  274.203 239.995 1.00 46.26  ? 16   VAL E O   1 
ATOM   9319  C  CB  . VAL E  5  16  ? 62.510  271.636 237.774 1.00 44.60  ? 16   VAL E CB  1 
ATOM   9320  C  CG1 . VAL E  5  16  ? 62.440  271.001 239.196 1.00 46.43  ? 16   VAL E CG1 1 
ATOM   9321  C  CG2 . VAL E  5  16  ? 61.369  271.092 236.873 1.00 41.86  ? 16   VAL E CG2 1 
ATOM   9322  N  N   . THR E  5  17  ? 64.563  273.732 238.808 1.00 44.07  ? 17   THR E N   1 
ATOM   9323  C  CA  . THR E  5  17  ? 65.438  274.286 239.830 1.00 44.05  ? 17   THR E CA  1 
ATOM   9324  C  C   . THR E  5  17  ? 65.118  275.747 240.112 1.00 106.20 ? 17   THR E C   1 
ATOM   9325  O  O   . THR E  5  17  ? 65.163  276.186 241.255 1.00 44.74  ? 17   THR E O   1 
ATOM   9326  C  CB  . THR E  5  17  ? 66.888  274.102 239.371 1.00 53.37  ? 17   THR E CB  1 
ATOM   9327  O  OG1 . THR E  5  17  ? 67.153  272.699 239.271 1.00 49.63  ? 17   THR E OG1 1 
ATOM   9328  C  CG2 . THR E  5  17  ? 67.865  274.721 240.345 1.00 50.17  ? 17   THR E CG2 1 
ATOM   9329  N  N   . TYR E  5  18  ? 64.777  276.506 239.086 1.00 41.23  ? 18   TYR E N   1 
ATOM   9330  C  CA  . TYR E  5  18  ? 64.476  277.922 239.234 1.00 52.29  ? 18   TYR E CA  1 
ATOM   9331  C  C   . TYR E  5  18  ? 63.293  278.131 240.171 1.00 35.58  ? 18   TYR E C   1 
ATOM   9332  O  O   . TYR E  5  18  ? 63.356  278.913 241.138 1.00 43.97  ? 18   TYR E O   1 
ATOM   9333  C  CB  . TYR E  5  18  ? 64.182  278.511 237.831 1.00 42.44  ? 18   TYR E CB  1 
ATOM   9334  C  CG  . TYR E  5  18  ? 63.835  279.990 237.872 1.00 41.91  ? 18   TYR E CG  1 
ATOM   9335  C  CD1 . TYR E  5  18  ? 64.837  280.961 237.718 1.00 39.59  ? 18   TYR E CD1 1 
ATOM   9336  C  CD2 . TYR E  5  18  ? 62.521  280.413 238.123 1.00 36.83  ? 18   TYR E CD2 1 
ATOM   9337  C  CE1 . TYR E  5  18  ? 64.519  282.327 237.757 1.00 45.21  ? 18   TYR E CE1 1 
ATOM   9338  C  CE2 . TYR E  5  18  ? 62.195  281.766 238.183 1.00 34.84  ? 18   TYR E CE2 1 
ATOM   9339  C  CZ  . TYR E  5  18  ? 63.190  282.714 238.008 1.00 40.43  ? 18   TYR E CZ  1 
ATOM   9340  O  OH  . TYR E  5  18  ? 62.860  284.050 238.084 1.00 37.50  ? 18   TYR E OH  1 
ATOM   9341  N  N   . PHE E  5  19  ? 62.186  277.449 239.888 1.00 38.75  ? 19   PHE E N   1 
ATOM   9342  C  CA  . PHE E  5  19  ? 60.994  277.667 240.690 1.00 50.29  ? 19   PHE E CA  1 
ATOM   9343  C  C   . PHE E  5  19  ? 61.078  276.998 242.039 1.00 82.06  ? 19   PHE E C   1 
ATOM   9344  O  O   . PHE E  5  19  ? 60.404  277.446 242.959 1.00 43.39  ? 19   PHE E O   1 
ATOM   9345  C  CB  . PHE E  5  19  ? 59.760  277.169 239.966 1.00 34.51  ? 19   PHE E CB  1 
ATOM   9346  C  CG  . PHE E  5  19  ? 59.376  278.043 238.785 1.00 38.92  ? 19   PHE E CG  1 
ATOM   9347  C  CD1 . PHE E  5  19  ? 58.993  279.366 238.993 1.00 37.56  ? 19   PHE E CD1 1 
ATOM   9348  C  CD2 . PHE E  5  19  ? 59.405  277.537 237.506 1.00 36.51  ? 19   PHE E CD2 1 
ATOM   9349  C  CE1 . PHE E  5  19  ? 58.590  280.184 237.920 1.00 38.67  ? 19   PHE E CE1 1 
ATOM   9350  C  CE2 . PHE E  5  19  ? 59.010  278.340 236.405 1.00 41.24  ? 19   PHE E CE2 1 
ATOM   9351  C  CZ  . PHE E  5  19  ? 58.610  279.678 236.627 1.00 38.56  ? 19   PHE E CZ  1 
ATOM   9352  N  N   . ASN E  5  20  ? 61.884  275.948 242.172 1.00 40.99  ? 20   ASN E N   1 
ATOM   9353  C  CA  . ASN E  5  20  ? 62.043  275.255 243.455 1.00 55.12  ? 20   ASN E CA  1 
ATOM   9354  C  C   . ASN E  5  20  ? 62.888  276.020 244.469 1.00 42.34  ? 20   ASN E C   1 
ATOM   9355  O  O   . ASN E  5  20  ? 62.944  275.605 245.624 1.00 46.09  ? 20   ASN E O   1 
ATOM   9356  C  CB  . ASN E  5  20  ? 62.648  273.860 243.246 1.00 41.55  ? 20   ASN E CB  1 
ATOM   9357  C  CG  . ASN E  5  20  ? 61.591  272.793 242.913 1.00 47.46  ? 20   ASN E CG  1 
ATOM   9358  O  OD1 . ASN E  5  20  ? 60.402  273.001 243.123 1.00 47.87  ? 20   ASN E OD1 1 
ATOM   9359  N  ND2 . ASN E  5  20  ? 62.040  271.631 242.417 1.00 48.54  ? 20   ASN E ND2 1 
ATOM   9360  N  N   . LYS E  5  21  ? 63.564  277.103 244.108 1.00 52.78  ? 21   LYS E N   1 
ATOM   9361  C  CA  . LYS E  5  21  ? 64.336  277.820 245.128 1.00 46.16  ? 21   LYS E CA  1 
ATOM   9362  C  C   . LYS E  5  21  ? 63.463  278.210 246.335 1.00 64.20  ? 21   LYS E C   1 
ATOM   9363  O  O   . LYS E  5  21  ? 62.481  278.944 246.171 1.00 42.45  ? 21   LYS E O   1 
ATOM   9364  C  CB  . LYS E  5  21  ? 64.976  279.077 244.531 1.00 41.66  ? 21   LYS E CB  1 
ATOM   9365  C  CG  . LYS E  5  21  ? 65.927  279.708 245.553 1.00 46.18  ? 21   LYS E CG  1 
ATOM   9366  C  CD  . LYS E  5  21  ? 66.642  280.882 244.920 1.00 62.93  ? 21   LYS E CD  1 
ATOM   9367  C  CE  . LYS E  5  21  ? 65.717  282.081 244.882 1.00 49.68  ? 21   LYS E CE  1 
ATOM   9368  N  NZ  . LYS E  5  21  ? 66.455  283.375 244.845 1.00 60.11  ? 21   LYS E NZ  1 
ATOM   9369  N  N   . PRO E  5  22  ? 63.784  277.748 247.547 1.00 46.68  ? 22   PRO E N   1 
ATOM   9370  C  CA  . PRO E  5  22  ? 62.797  277.888 248.637 1.00 41.85  ? 22   PRO E CA  1 
ATOM   9371  C  C   . PRO E  5  22  ? 62.409  279.337 248.913 1.00 49.90  ? 22   PRO E C   1 
ATOM   9372  O  O   . PRO E  5  22  ? 61.225  279.633 249.133 1.00 48.74  ? 22   PRO E O   1 
ATOM   9373  C  CB  . PRO E  5  22  ? 63.511  277.244 249.859 1.00 51.93  ? 22   PRO E CB  1 
ATOM   9374  C  CG  . PRO E  5  22  ? 64.492  276.281 249.264 1.00 50.41  ? 22   PRO E CG  1 
ATOM   9375  C  CD  . PRO E  5  22  ? 64.927  276.898 247.921 1.00 43.17  ? 22   PRO E CD  1 
ATOM   9376  N  N   . ASP E  5  23  ? 63.382  280.252 248.914 1.00 42.53  ? 23   ASP E N   1 
ATOM   9377  C  CA  . ASP E  5  23  ? 63.138  281.667 249.189 1.00 62.79  ? 23   ASP E CA  1 
ATOM   9378  C  C   . ASP E  5  23  ? 62.937  282.476 247.912 1.00 51.57  ? 23   ASP E C   1 
ATOM   9379  O  O   . ASP E  5  23  ? 63.220  283.683 247.884 1.00 48.45  ? 23   ASP E O   1 
ATOM   9380  C  CB  . ASP E  5  23  ? 64.275  282.258 250.027 1.00 48.48  ? 23   ASP E CB  1 
ATOM   9381  C  CG  . ASP E  5  23  ? 65.635  282.162 249.342 1.00 62.18  ? 23   ASP E CG  1 
ATOM   9382  O  OD1 . ASP E  5  23  ? 65.878  281.190 248.587 1.00 70.04  ? 23   ASP E OD1 1 
ATOM   9383  O  OD2 . ASP E  5  23  ? 66.464  283.057 249.564 1.00 97.23  ? 23   ASP E OD2 1 
ATOM   9384  N  N   . ILE E  5  24  ? 62.463  281.832 246.848 1.00 40.59  ? 24   ILE E N   1 
ATOM   9385  C  CA  . ILE E  5  24  ? 62.066  282.576 245.637 1.00 41.59  ? 24   ILE E CA  1 
ATOM   9386  C  C   . ILE E  5  24  ? 61.089  283.694 246.007 1.00 40.79  ? 24   ILE E C   1 
ATOM   9387  O  O   . ILE E  5  24  ? 60.108  283.474 246.719 1.00 45.07  ? 24   ILE E O   1 
ATOM   9388  C  CB  . ILE E  5  24  ? 61.485  281.616 244.587 1.00 44.51  ? 24   ILE E CB  1 
ATOM   9389  C  CG1 . ILE E  5  24  ? 61.240  282.378 243.265 1.00 47.95  ? 24   ILE E CG1 1 
ATOM   9390  C  CG2 . ILE E  5  24  ? 60.190  280.983 245.069 1.00 39.02  ? 24   ILE E CG2 1 
ATOM   9391  C  CD1 . ILE E  5  24  ? 60.691  281.522 242.168 1.00 41.33  ? 24   ILE E CD1 1 
ATOM   9392  N  N   . ASP E  5  25  ? 61.343  284.909 245.516 1.00 39.75  ? 25   ASP E N   1 
ATOM   9393  C  CA  . ASP E  5  25  ? 60.442  286.001 245.840 1.00 49.79  ? 25   ASP E CA  1 
ATOM   9394  C  C   . ASP E  5  25  ? 59.440  286.244 244.711 1.00 42.26  ? 25   ASP E C   1 
ATOM   9395  O  O   . ASP E  5  25  ? 59.455  285.578 243.670 1.00 39.81  ? 25   ASP E O   1 
ATOM   9396  C  CB  . ASP E  5  25  ? 61.227  287.253 246.217 1.00 42.84  ? 25   ASP E CB  1 
ATOM   9397  C  CG  . ASP E  5  25  ? 61.995  287.841 245.067 1.00 85.19  ? 25   ASP E CG  1 
ATOM   9398  O  OD1 . ASP E  5  25  ? 61.773  287.516 243.903 1.00 44.00  ? 25   ASP E OD1 1 
ATOM   9399  O  OD2 . ASP E  5  25  ? 62.840  288.684 245.332 1.00 39.58  ? 25   ASP E OD2 1 
ATOM   9400  N  N   . ALA E  5  26  ? 58.503  287.171 244.960 1.00 39.78  ? 26   ALA E N   1 
ATOM   9401  C  CA  . ALA E  5  26  ? 57.385  287.336 244.029 1.00 35.44  ? 26   ALA E CA  1 
ATOM   9402  C  C   . ALA E  5  26  ? 57.903  287.819 242.680 1.00 45.14  ? 26   ALA E C   1 
ATOM   9403  O  O   . ALA E  5  26  ? 57.450  287.368 241.621 1.00 39.05  ? 26   ALA E O   1 
ATOM   9404  C  CB  . ALA E  5  26  ? 56.370  288.340 244.592 1.00 39.00  ? 26   ALA E CB  1 
ATOM   9405  N  N   . TRP E  5  27  ? 58.841  288.758 242.704 1.00 40.60  ? 27   TRP E N   1 
ATOM   9406  C  CA  . TRP E  5  27  ? 59.447  289.236 241.472 1.00 43.21  ? 27   TRP E CA  1 
ATOM   9407  C  C   . TRP E  5  27  ? 60.012  288.091 240.635 1.00 39.75  ? 27   TRP E C   1 
ATOM   9408  O  O   . TRP E  5  27  ? 59.861  288.063 239.419 1.00 37.79  ? 27   TRP E O   1 
ATOM   9409  C  CB  . TRP E  5  27  ? 60.557  290.231 241.789 1.00 47.20  ? 27   TRP E CB  1 
ATOM   9410  C  CG  . TRP E  5  27  ? 61.128  290.885 240.513 1.00 104.70 ? 27   TRP E CG  1 
ATOM   9411  C  CD1 . TRP E  5  27  ? 60.768  292.085 240.003 1.00 38.49  ? 27   TRP E CD1 1 
ATOM   9412  C  CD2 . TRP E  5  27  ? 62.141  290.358 239.614 1.00 45.42  ? 27   TRP E CD2 1 
ATOM   9413  N  NE1 . TRP E  5  27  ? 61.503  292.372 238.802 1.00 34.63  ? 27   TRP E NE1 1 
ATOM   9414  C  CE2 . TRP E  5  27  ? 62.343  291.317 238.574 1.00 73.75  ? 27   TRP E CE2 1 
ATOM   9415  C  CE3 . TRP E  5  27  ? 62.908  289.184 239.586 1.00 40.14  ? 27   TRP E CE3 1 
ATOM   9416  C  CZ2 . TRP E  5  27  ? 63.253  291.132 237.559 1.00 33.91  ? 27   TRP E CZ2 1 
ATOM   9417  C  CZ3 . TRP E  5  27  ? 63.845  289.009 238.551 1.00 40.51  ? 27   TRP E CZ3 1 
ATOM   9418  C  CH2 . TRP E  5  27  ? 63.983  289.972 237.543 1.00 43.64  ? 27   TRP E CH2 1 
ATOM   9419  N  N   . GLU E  5  28  ? 60.731  287.175 241.276 1.00 38.14  ? 28   GLU E N   1 
ATOM   9420  C  CA  . GLU E  5  28  ? 61.320  286.043 240.568 1.00 38.83  ? 28   GLU E CA  1 
ATOM   9421  C  C   . GLU E  5  28  ? 60.271  285.096 240.031 1.00 40.36  ? 28   GLU E C   1 
ATOM   9422  O  O   . GLU E  5  28  ? 60.439  284.548 238.939 1.00 36.89  ? 28   GLU E O   1 
ATOM   9423  C  CB  . GLU E  5  28  ? 62.292  285.301 241.505 1.00 38.20  ? 28   GLU E CB  1 
ATOM   9424  C  CG  . GLU E  5  28  ? 63.505  286.122 241.719 1.00 44.37  ? 28   GLU E CG  1 
ATOM   9425  C  CD  . GLU E  5  28  ? 64.374  285.634 242.828 1.00 138.93 ? 28   GLU E CD  1 
ATOM   9426  O  OE1 . GLU E  5  28  ? 65.528  285.982 242.848 1.00 41.55  ? 28   GLU E OE1 1 
ATOM   9427  O  OE2 . GLU E  5  28  ? 63.944  284.923 243.710 1.00 42.71  ? 28   GLU E OE2 1 
ATOM   9428  N  N   . LEU E  5  29  ? 59.188  284.871 240.788 1.00 37.94  ? 29   LEU E N   1 
ATOM   9429  C  CA  . LEU E  5  29  ? 58.067  284.081 240.269 1.00 41.26  ? 29   LEU E CA  1 
ATOM   9430  C  C   . LEU E  5  29  ? 57.525  284.660 238.954 1.00 40.92  ? 29   LEU E C   1 
ATOM   9431  O  O   . LEU E  5  29  ? 57.370  283.953 237.942 1.00 34.29  ? 29   LEU E O   1 
ATOM   9432  C  CB  . LEU E  5  29  ? 56.960  284.018 241.332 1.00 34.24  ? 29   LEU E CB  1 
ATOM   9433  C  CG  . LEU E  5  29  ? 55.734  283.337 240.772 1.00 50.69  ? 29   LEU E CG  1 
ATOM   9434  C  CD1 . LEU E  5  29  ? 56.070  281.850 240.602 1.00 37.92  ? 29   LEU E CD1 1 
ATOM   9435  C  CD2 . LEU E  5  29  ? 54.517  283.627 241.671 1.00 44.89  ? 29   LEU E CD2 1 
ATOM   9436  N  N   . ARG E  5  30  ? 57.203  285.948 238.948 1.00 39.84  ? 30   ARG E N   1 
ATOM   9437  C  CA  . ARG E  5  30  ? 56.680  286.588 237.740 1.00 47.20  ? 30   ARG E CA  1 
ATOM   9438  C  C   . ARG E  5  30  ? 57.701  286.568 236.606 1.00 38.01  ? 30   ARG E C   1 
ATOM   9439  O  O   . ARG E  5  30  ? 57.363  286.247 235.456 1.00 39.23  ? 30   ARG E O   1 
ATOM   9440  C  CB  . ARG E  5  30  ? 56.275  288.025 238.058 1.00 39.76  ? 30   ARG E CB  1 
ATOM   9441  C  CG  . ARG E  5  30  ? 55.136  288.113 239.159 1.00 36.59  ? 30   ARG E CG  1 
ATOM   9442  C  CD  . ARG E  5  30  ? 54.549  289.530 239.252 1.00 38.28  ? 30   ARG E CD  1 
ATOM   9443  N  NE  . ARG E  5  30  ? 55.552  290.604 239.409 1.00 40.35  ? 30   ARG E NE  1 
ATOM   9444  C  CZ  . ARG E  5  30  ? 56.078  291.011 240.561 1.00 52.16  ? 30   ARG E CZ  1 
ATOM   9445  N  NH1 . ARG E  5  30  ? 55.729  290.436 241.717 1.00 38.80  ? 30   ARG E NH1 1 
ATOM   9446  N  NH2 . ARG E  5  30  ? 56.957  292.004 240.551 1.00 41.10  ? 30   ARG E NH2 1 
ATOM   9447  N  N   . LYS E  5  31  ? 58.935  286.968 236.905 1.00 37.81  ? 31   LYS E N   1 
ATOM   9448  C  CA  . LYS E  5  31  ? 59.988  286.973 235.895 1.00 38.32  ? 31   LYS E CA  1 
ATOM   9449  C  C   . LYS E  5  31  ? 60.088  285.615 235.249 1.00 36.28  ? 31   LYS E C   1 
ATOM   9450  O  O   . LYS E  5  31  ? 60.105  285.498 234.017 1.00 38.56  ? 31   LYS E O   1 
ATOM   9451  C  CB  . LYS E  5  31  ? 61.327  287.368 236.524 1.00 40.12  ? 31   LYS E CB  1 
ATOM   9452  C  CG  . LYS E  5  31  ? 62.533  287.364 235.506 1.00 35.84  ? 31   LYS E CG  1 
ATOM   9453  C  CD  . LYS E  5  31  ? 62.388  288.489 234.484 1.00 38.39  ? 31   LYS E CD  1 
ATOM   9454  C  CE  . LYS E  5  31  ? 63.597  288.527 233.503 1.00 46.90  ? 31   LYS E CE  1 
ATOM   9455  N  NZ  . LYS E  5  31  ? 63.870  287.175 232.871 1.00 49.97  ? 31   LYS E NZ  1 
ATOM   9456  N  N   . GLY E  5  32  ? 60.031  284.564 236.067 1.00 35.54  ? 32   GLY E N   1 
ATOM   9457  C  CA  . GLY E  5  32  ? 60.173  283.232 235.517 1.00 38.69  ? 32   GLY E CA  1 
ATOM   9458  C  C   . GLY E  5  32  ? 59.017  282.870 234.602 1.00 42.25  ? 32   GLY E C   1 
ATOM   9459  O  O   . GLY E  5  32  ? 59.217  282.421 233.472 1.00 35.65  ? 32   GLY E O   1 
ATOM   9460  N  N   . MET E  5  33  ? 57.789  283.099 235.070 1.00 33.41  ? 33   MET E N   1 
ATOM   9461  C  CA  . MET E  5  33  ? 56.632  282.750 234.253 1.00 37.68  ? 33   MET E CA  1 
ATOM   9462  C  C   . MET E  5  33  ? 56.562  283.611 233.006 1.00 35.89  ? 33   MET E C   1 
ATOM   9463  O  O   . MET E  5  33  ? 56.229  283.121 231.931 1.00 35.70  ? 33   MET E O   1 
ATOM   9464  C  CB  . MET E  5  33  ? 55.324  282.894 235.039 1.00 36.40  ? 33   MET E CB  1 
ATOM   9465  C  CG  . MET E  5  33  ? 55.023  281.694 235.988 1.00 47.24  ? 33   MET E CG  1 
ATOM   9466  S  SD  . MET E  5  33  ? 55.187  280.044 235.249 1.00 42.48  ? 33   MET E SD  1 
ATOM   9467  C  CE  . MET E  5  33  ? 54.073  280.256 233.801 1.00 32.20  ? 33   MET E CE  1 
ATOM   9468  N  N   . ASN E  5  34  ? 56.837  284.908 233.147 1.00 33.32  ? 34   ASN E N   1 
ATOM   9469  C  CA  . ASN E  5  34  ? 56.714  285.789 231.995 1.00 35.19  ? 34   ASN E CA  1 
ATOM   9470  C  C   . ASN E  5  34  ? 57.799  285.491 230.978 1.00 38.22  ? 34   ASN E C   1 
ATOM   9471  O  O   . ASN E  5  34  ? 57.594  285.722 229.789 1.00 38.51  ? 34   ASN E O   1 
ATOM   9472  C  CB  . ASN E  5  34  ? 56.781  287.262 232.436 1.00 38.87  ? 34   ASN E CB  1 
ATOM   9473  C  CG  . ASN E  5  34  ? 55.497  287.701 233.188 1.00 37.16  ? 34   ASN E CG  1 
ATOM   9474  O  OD1 . ASN E  5  34  ? 54.434  287.121 232.989 1.00 36.07  ? 34   ASN E OD1 1 
ATOM   9475  N  ND2 . ASN E  5  34  ? 55.617  288.706 234.055 1.00 33.17  ? 34   ASN E ND2 1 
ATOM   9476  N  N   . THR E  5  35  ? 58.972  285.014 231.420 1.00 34.80  ? 35   THR E N   1 
ATOM   9477  C  CA  . THR E  5  35  ? 60.022  284.639 230.467 1.00 38.79  ? 35   THR E CA  1 
ATOM   9478  C  C   . THR E  5  35  ? 59.686  283.320 229.798 1.00 37.09  ? 35   THR E C   1 
ATOM   9479  O  O   . THR E  5  35  ? 59.848  283.157 228.584 1.00 35.54  ? 35   THR E O   1 
ATOM   9480  C  CB  . THR E  5  35  ? 61.363  284.516 231.199 1.00 39.11  ? 35   THR E CB  1 
ATOM   9481  O  OG1 . THR E  5  35  ? 61.709  285.794 231.749 1.00 36.43  ? 35   THR E OG1 1 
ATOM   9482  C  CG2 . THR E  5  35  ? 62.509  284.060 230.225 1.00 41.83  ? 35   THR E CG2 1 
ATOM   9483  N  N   . LEU E  5  36  ? 59.238  282.359 230.594 1.00 37.85  ? 36   LEU E N   1 
ATOM   9484  C  CA  . LEU E  5  36  ? 59.003  281.005 230.102 1.00 34.62  ? 36   LEU E CA  1 
ATOM   9485  C  C   . LEU E  5  36  ? 57.961  280.977 228.993 1.00 38.70  ? 36   LEU E C   1 
ATOM   9486  O  O   . LEU E  5  36  ? 58.034  280.139 228.086 1.00 37.83  ? 36   LEU E O   1 
ATOM   9487  C  CB  . LEU E  5  36  ? 58.566  280.103 231.276 1.00 36.79  ? 36   LEU E CB  1 
ATOM   9488  C  CG  . LEU E  5  36  ? 58.315  278.601 231.076 1.00 40.77  ? 36   LEU E CG  1 
ATOM   9489  C  CD1 . LEU E  5  36  ? 59.519  277.891 230.513 1.00 44.16  ? 36   LEU E CD1 1 
ATOM   9490  C  CD2 . LEU E  5  36  ? 57.960  277.970 232.435 1.00 45.95  ? 36   LEU E CD2 1 
ATOM   9491  N  N   . VAL E  5  37  ? 56.931  281.817 229.082 1.00 31.31  ? 37   VAL E N   1 
ATOM   9492  C  CA  . VAL E  5  37  ? 55.881  281.715 228.072 1.00 28.76  ? 37   VAL E CA  1 
ATOM   9493  C  C   . VAL E  5  37  ? 56.318  282.370 226.761 1.00 32.49  ? 37   VAL E C   1 
ATOM   9494  O  O   . VAL E  5  37  ? 55.577  282.309 225.778 1.00 39.09  ? 37   VAL E O   1 
ATOM   9495  C  CB  . VAL E  5  37  ? 54.547  282.363 228.496 1.00 42.45  ? 37   VAL E CB  1 
ATOM   9496  C  CG1 . VAL E  5  37  ? 53.996  281.638 229.674 1.00 48.30  ? 37   VAL E CG1 1 
ATOM   9497  C  CG2 . VAL E  5  37  ? 54.767  283.841 228.827 1.00 41.99  ? 37   VAL E CG2 1 
ATOM   9498  N  N   . GLY E  5  38  ? 57.497  282.975 226.728 1.00 38.82  ? 38   GLY E N   1 
ATOM   9499  C  CA  . GLY E  5  38  ? 58.054  283.439 225.449 1.00 34.04  ? 38   GLY E CA  1 
ATOM   9500  C  C   . GLY E  5  38  ? 58.605  282.337 224.569 1.00 42.35  ? 38   GLY E C   1 
ATOM   9501  O  O   . GLY E  5  38  ? 58.814  282.571 223.371 1.00 41.21  ? 38   GLY E O   1 
ATOM   9502  N  N   . TYR E  5  39  ? 58.842  281.146 225.113 1.00 39.90  ? 39   TYR E N   1 
ATOM   9503  C  CA  . TYR E  5  39  ? 59.437  280.087 224.298 1.00 37.80  ? 39   TYR E CA  1 
ATOM   9504  C  C   . TYR E  5  39  ? 58.384  279.347 223.496 1.00 44.25  ? 39   TYR E C   1 
ATOM   9505  O  O   . TYR E  5  39  ? 57.187  279.382 223.791 1.00 36.30  ? 39   TYR E O   1 
ATOM   9506  C  CB  . TYR E  5  39  ? 60.194  279.066 225.144 1.00 36.13  ? 39   TYR E CB  1 
ATOM   9507  C  CG  . TYR E  5  39  ? 61.298  279.674 225.970 1.00 42.51  ? 39   TYR E CG  1 
ATOM   9508  C  CD1 . TYR E  5  39  ? 62.397  280.288 225.369 1.00 57.42  ? 39   TYR E CD1 1 
ATOM   9509  C  CD2 . TYR E  5  39  ? 61.258  279.621 227.349 1.00 43.74  ? 39   TYR E CD2 1 
ATOM   9510  C  CE1 . TYR E  5  39  ? 63.404  280.851 226.121 1.00 84.68  ? 39   TYR E CE1 1 
ATOM   9511  C  CE2 . TYR E  5  39  ? 62.282  280.172 228.111 1.00 59.81  ? 39   TYR E CE2 1 
ATOM   9512  C  CZ  . TYR E  5  39  ? 63.343  280.784 227.495 1.00 64.40  ? 39   TYR E CZ  1 
ATOM   9513  O  OH  . TYR E  5  39  ? 64.351  281.346 228.238 1.00 121.22 ? 39   TYR E OH  1 
ATOM   9514  N  N   . ASP E  5  40  ? 58.861  278.625 222.483 1.00 36.99  ? 40   ASP E N   1 
ATOM   9515  C  CA  . ASP E  5  40  ? 57.988  277.849 221.613 1.00 38.21  ? 40   ASP E CA  1 
ATOM   9516  C  C   . ASP E  5  40  ? 57.814  276.470 222.225 1.00 36.66  ? 40   ASP E C   1 
ATOM   9517  O  O   . ASP E  5  40  ? 58.338  275.474 221.741 1.00 38.62  ? 40   ASP E O   1 
ATOM   9518  C  CB  . ASP E  5  40  ? 58.574  277.774 220.200 1.00 34.89  ? 40   ASP E CB  1 
ATOM   9519  C  CG  . ASP E  5  40  ? 57.694  276.953 219.220 1.00 43.24  ? 40   ASP E CG  1 
ATOM   9520  O  OD1 . ASP E  5  40  ? 56.504  276.631 219.498 1.00 40.51  ? 40   ASP E OD1 1 
ATOM   9521  O  OD2 . ASP E  5  40  ? 58.223  276.620 218.139 1.00 40.46  ? 40   ASP E OD2 1 
ATOM   9522  N  N   . LEU E  5  41  ? 57.055  276.434 223.321 1.00 36.85  ? 41   LEU E N   1 
ATOM   9523  C  CA  . LEU E  5  41  ? 56.700  275.180 223.975 1.00 40.31  ? 41   LEU E CA  1 
ATOM   9524  C  C   . LEU E  5  41  ? 55.611  275.470 224.989 1.00 36.95  ? 41   LEU E C   1 
ATOM   9525  O  O   . LEU E  5  41  ? 55.468  276.603 225.458 1.00 37.21  ? 41   LEU E O   1 
ATOM   9526  C  CB  . LEU E  5  41  ? 57.924  274.552 224.681 1.00 45.43  ? 41   LEU E CB  1 
ATOM   9527  C  CG  . LEU E  5  41  ? 58.697  275.441 225.671 1.00 42.19  ? 41   LEU E CG  1 
ATOM   9528  C  CD1 . LEU E  5  41  ? 58.176  275.357 227.190 1.00 34.05  ? 41   LEU E CD1 1 
ATOM   9529  C  CD2 . LEU E  5  41  ? 60.170  275.122 225.603 1.00 50.08  ? 41   LEU E CD2 1 
ATOM   9530  N  N   . VAL E  5  42  ? 54.881  274.426 225.358 1.00 34.95  ? 42   VAL E N   1 
ATOM   9531  C  CA  . VAL E  5  42  ? 54.063  274.410 226.570 1.00 36.33  ? 42   VAL E CA  1 
ATOM   9532  C  C   . VAL E  5  42  ? 54.923  273.765 227.657 1.00 41.72  ? 42   VAL E C   1 
ATOM   9533  O  O   . VAL E  5  42  ? 55.431  272.664 227.428 1.00 42.15  ? 42   VAL E O   1 
ATOM   9534  C  CB  . VAL E  5  42  ? 52.752  273.633 226.352 1.00 35.52  ? 42   VAL E CB  1 
ATOM   9535  C  CG1 . VAL E  5  42  ? 51.868  273.685 227.634 1.00 38.07  ? 42   VAL E CG1 1 
ATOM   9536  C  CG2 . VAL E  5  42  ? 52.007  274.194 225.078 1.00 39.53  ? 42   VAL E CG2 1 
ATOM   9537  N  N   . PRO E  5  43  ? 55.123  274.402 228.827 1.00 40.20  ? 43   PRO E N   1 
ATOM   9538  C  CA  . PRO E  5  43  ? 56.036  273.838 229.831 1.00 42.44  ? 43   PRO E CA  1 
ATOM   9539  C  C   . PRO E  5  43  ? 55.564  272.477 230.335 1.00 35.40  ? 43   PRO E C   1 
ATOM   9540  O  O   . PRO E  5  43  ? 54.375  272.248 230.536 1.00 39.86  ? 43   PRO E O   1 
ATOM   9541  C  CB  . PRO E  5  43  ? 56.025  274.897 230.952 1.00 44.61  ? 43   PRO E CB  1 
ATOM   9542  C  CG  . PRO E  5  43  ? 55.522  276.152 230.253 1.00 41.48  ? 43   PRO E CG  1 
ATOM   9543  C  CD  . PRO E  5  43  ? 54.508  275.654 229.306 1.00 36.92  ? 43   PRO E CD  1 
ATOM   9544  N  N   . GLU E  5  44  ? 56.523  271.562 230.459 1.00 44.79  ? 44   GLU E N   1 
ATOM   9545  C  CA  . GLU E  5  44  ? 56.326  270.250 231.059 1.00 41.86  ? 44   GLU E CA  1 
ATOM   9546  C  C   . GLU E  5  44  ? 55.578  270.345 232.389 1.00 52.07  ? 44   GLU E C   1 
ATOM   9547  O  O   . GLU E  5  44  ? 55.802  271.280 233.168 1.00 40.61  ? 44   GLU E O   1 
ATOM   9548  C  CB  . GLU E  5  44  ? 57.682  269.588 231.297 1.00 78.61  ? 44   GLU E CB  1 
ATOM   9549  C  CG  . GLU E  5  44  ? 58.298  268.944 230.086 1.00 52.56  ? 44   GLU E CG  1 
ATOM   9550  C  CD  . GLU E  5  44  ? 57.905  267.487 229.957 1.00 70.11  ? 44   GLU E CD  1 
ATOM   9551  O  OE1 . GLU E  5  44  ? 57.843  267.014 228.816 1.00 51.72  ? 44   GLU E OE1 1 
ATOM   9552  O  OE2 . GLU E  5  44  ? 57.668  266.806 230.978 1.00 79.09  ? 44   GLU E OE2 1 
ATOM   9553  N  N   . PRO E  5  45  ? 54.718  269.394 232.687 1.00 44.76  ? 45   PRO E N   1 
ATOM   9554  C  CA  . PRO E  5  45  ? 54.093  269.369 234.026 1.00 62.12  ? 45   PRO E CA  1 
ATOM   9555  C  C   . PRO E  5  45  ? 55.068  269.540 235.171 1.00 46.92  ? 45   PRO E C   1 
ATOM   9556  O  O   . PRO E  5  45  ? 54.725  270.218 236.147 1.00 45.31  ? 45   PRO E O   1 
ATOM   9557  C  CB  . PRO E  5  45  ? 53.419  267.999 234.073 1.00 44.87  ? 45   PRO E CB  1 
ATOM   9558  C  CG  . PRO E  5  45  ? 53.120  267.698 232.574 1.00 51.63  ? 45   PRO E CG  1 
ATOM   9559  C  CD  . PRO E  5  45  ? 54.318  268.246 231.850 1.00 41.02  ? 45   PRO E CD  1 
ATOM   9560  N  N   . LYS E  5  46  ? 56.277  268.967 235.099 1.00 41.48  ? 46   LYS E N   1 
ATOM   9561  C  CA  . LYS E  5  46  ? 57.172  269.094 236.255 1.00 47.76  ? 46   LYS E CA  1 
ATOM   9562  C  C   . LYS E  5  46  ? 57.591  270.543 236.458 1.00 55.48  ? 46   LYS E C   1 
ATOM   9563  O  O   . LYS E  5  46  ? 57.908  270.951 237.575 1.00 42.09  ? 46   LYS E O   1 
ATOM   9564  C  CB  . LYS E  5  46  ? 58.412  268.195 236.110 1.00 42.95  ? 46   LYS E CB  1 
ATOM   9565  C  CG  . LYS E  5  46  ? 59.217  268.377 234.808 1.00 63.30  ? 46   LYS E CG  1 
ATOM   9566  C  CD  . LYS E  5  46  ? 60.422  267.424 234.798 1.00 70.04  ? 46   LYS E CD  1 
ATOM   9567  C  CE  . LYS E  5  46  ? 60.781  267.030 233.379 1.00 107.19 ? 46   LYS E CE  1 
ATOM   9568  N  NZ  . LYS E  5  46  ? 61.740  265.886 233.267 1.00 104.41 ? 46   LYS E NZ  1 
ATOM   9569  N  N   . ILE E  5  47  ? 57.588  271.344 235.399 1.00 42.63  ? 47   ILE E N   1 
ATOM   9570  C  CA  . ILE E  5  47  ? 57.927  272.749 235.581 1.00 37.49  ? 47   ILE E CA  1 
ATOM   9571  C  C   . ILE E  5  47  ? 56.768  273.479 236.241 1.00 42.96  ? 47   ILE E C   1 
ATOM   9572  O  O   . ILE E  5  47  ? 56.963  274.263 237.173 1.00 40.60  ? 47   ILE E O   1 
ATOM   9573  C  CB  . ILE E  5  47  ? 58.280  273.380 234.224 1.00 44.91  ? 47   ILE E CB  1 
ATOM   9574  C  CG1 . ILE E  5  47  ? 59.480  272.671 233.609 1.00 40.95  ? 47   ILE E CG1 1 
ATOM   9575  C  CG2 . ILE E  5  47  ? 58.544  274.882 234.356 1.00 43.05  ? 47   ILE E CG2 1 
ATOM   9576  C  CD1 . ILE E  5  47  ? 59.896  273.322 232.224 1.00 38.74  ? 47   ILE E CD1 1 
ATOM   9577  N  N   . ILE E  5  48  ? 55.551  273.268 235.726 1.00 36.91  ? 48   ILE E N   1 
ATOM   9578  C  CA  . ILE E  5  48  ? 54.368  273.908 236.295 1.00 39.65  ? 48   ILE E CA  1 
ATOM   9579  C  C   . ILE E  5  48  ? 54.251  273.537 237.778 1.00 41.97  ? 48   ILE E C   1 
ATOM   9580  O  O   . ILE E  5  48  ? 53.930  274.373 238.631 1.00 46.10  ? 48   ILE E O   1 
ATOM   9581  C  CB  . ILE E  5  48  ? 53.116  273.496 235.507 1.00 38.07  ? 48   ILE E CB  1 
ATOM   9582  C  CG1 . ILE E  5  48  ? 53.289  273.846 234.004 1.00 39.72  ? 48   ILE E CG1 1 
ATOM   9583  C  CG2 . ILE E  5  48  ? 51.846  274.188 236.083 1.00 35.17  ? 48   ILE E CG2 1 
ATOM   9584  C  CD1 . ILE E  5  48  ? 53.724  275.263 233.817 1.00 42.07  ? 48   ILE E CD1 1 
ATOM   9585  N  N   . ASP E  5  49  ? 54.471  272.270 238.092 1.00 47.18  ? 49   ASP E N   1 
ATOM   9586  C  CA  . ASP E  5  49  ? 54.445  271.795 239.483 1.00 44.62  ? 49   ASP E CA  1 
ATOM   9587  C  C   . ASP E  5  49  ? 55.345  272.667 240.367 1.00 45.08  ? 49   ASP E C   1 
ATOM   9588  O  O   . ASP E  5  49  ? 54.894  273.236 241.366 1.00 43.13  ? 49   ASP E O   1 
ATOM   9589  C  CB  . ASP E  5  49  ? 54.863  270.318 239.471 1.00 49.41  ? 49   ASP E CB  1 
ATOM   9590  C  CG  . ASP E  5  49  ? 54.897  269.674 240.843 1.00 144.60 ? 49   ASP E CG  1 
ATOM   9591  O  OD1 . ASP E  5  49  ? 54.022  269.899 241.660 1.00 49.41  ? 49   ASP E OD1 1 
ATOM   9592  O  OD2 . ASP E  5  49  ? 55.781  268.872 241.107 1.00 59.21  ? 49   ASP E OD2 1 
ATOM   9593  N  N   . ALA E  5  50  ? 56.604  272.856 239.970 1.00 42.25  ? 50   ALA E N   1 
ATOM   9594  C  CA  . ALA E  5  50  ? 57.492  273.708 240.764 1.00 37.45  ? 50   ALA E CA  1 
ATOM   9595  C  C   . ALA E  5  50  ? 56.982  275.150 240.861 1.00 57.62  ? 50   ALA E C   1 
ATOM   9596  O  O   . ALA E  5  50  ? 57.095  275.777 241.923 1.00 44.61  ? 50   ALA E O   1 
ATOM   9597  C  CB  . ALA E  5  50  ? 58.901  273.675 240.189 1.00 38.44  ? 50   ALA E CB  1 
ATOM   9598  N  N   . ALA E  5  51  ? 56.421  275.696 239.776 1.00 41.65  ? 51   ALA E N   1 
ATOM   9599  C  CA  . ALA E  5  51  ? 55.914  277.068 239.844 1.00 44.85  ? 51   ALA E CA  1 
ATOM   9600  C  C   . ALA E  5  51  ? 54.717  277.156 240.773 1.00 37.97  ? 51   ALA E C   1 
ATOM   9601  O  O   . ALA E  5  51  ? 54.591  278.130 241.521 1.00 41.45  ? 51   ALA E O   1 
ATOM   9602  C  CB  . ALA E  5  51  ? 55.543  277.623 238.464 1.00 35.87  ? 51   ALA E CB  1 
ATOM   9603  N  N   . LEU E  5  52  ? 53.824  276.155 240.716 1.00 35.70  ? 52   LEU E N   1 
ATOM   9604  C  CA  . LEU E  5  52  ? 52.652  276.170 241.592 1.00 38.46  ? 52   LEU E CA  1 
ATOM   9605  C  C   . LEU E  5  52  ? 53.081  276.114 243.053 1.00 45.00  ? 52   LEU E C   1 
ATOM   9606  O  O   . LEU E  5  52  ? 52.513  276.802 243.912 1.00 41.63  ? 52   LEU E O   1 
ATOM   9607  C  CB  . LEU E  5  52  ? 51.722  275.001 241.269 1.00 49.31  ? 52   LEU E CB  1 
ATOM   9608  C  CG  . LEU E  5  52  ? 51.079  275.058 239.888 1.00 49.18  ? 52   LEU E CG  1 
ATOM   9609  C  CD1 . LEU E  5  52  ? 50.280  273.802 239.661 1.00 46.98  ? 52   LEU E CD1 1 
ATOM   9610  C  CD2 . LEU E  5  52  ? 50.181  276.302 239.695 1.00 40.97  ? 52   LEU E CD2 1 
ATOM   9611  N  N   . ARG E  5  53  ? 54.102  275.319 243.351 1.00 38.28  ? 53   ARG E N   1 
ATOM   9612  C  CA  . ARG E  5  53  ? 54.564  275.240 244.737 1.00 42.26  ? 53   ARG E CA  1 
ATOM   9613  C  C   . ARG E  5  53  ? 55.245  276.525 245.175 1.00 56.43  ? 53   ARG E C   1 
ATOM   9614  O  O   . ARG E  5  53  ? 55.153  276.909 246.340 1.00 46.87  ? 53   ARG E O   1 
ATOM   9615  C  CB  . ARG E  5  53  ? 55.484  274.045 244.902 1.00 54.09  ? 53   ARG E CB  1 
ATOM   9616  C  CG  . ARG E  5  53  ? 54.682  272.762 244.836 1.00 40.73  ? 53   ARG E CG  1 
ATOM   9617  C  CD  . ARG E  5  53  ? 55.579  271.569 244.760 1.00 109.33 ? 53   ARG E CD  1 
ATOM   9618  N  NE  . ARG E  5  53  ? 54.746  270.401 244.597 1.00 44.13  ? 53   ARG E NE  1 
ATOM   9619  C  CZ  . ARG E  5  53  ? 54.087  269.811 245.590 1.00 150.76 ? 53   ARG E CZ  1 
ATOM   9620  N  NH1 . ARG E  5  53  ? 54.189  270.246 246.833 1.00 46.54  ? 53   ARG E NH1 1 
ATOM   9621  N  NH2 . ARG E  5  53  ? 53.332  268.773 245.345 1.00 43.97  ? 53   ARG E NH2 1 
ATOM   9622  N  N   . ALA E  5  54  ? 55.955  277.184 244.264 1.00 40.23  ? 54   ALA E N   1 
ATOM   9623  C  CA  . ALA E  5  54  ? 56.462  278.526 244.535 1.00 37.51  ? 54   ALA E CA  1 
ATOM   9624  C  C   . ALA E  5  54  ? 55.306  279.494 244.868 1.00 42.61  ? 54   ALA E C   1 
ATOM   9625  O  O   . ALA E  5  54  ? 55.396  280.286 245.826 1.00 44.26  ? 54   ALA E O   1 
ATOM   9626  C  CB  . ALA E  5  54  ? 57.283  279.020 243.299 1.00 35.64  ? 54   ALA E CB  1 
ATOM   9627  N  N   . CYS E  5  55  ? 54.197  279.414 244.113 1.00 38.46  ? 55   CYS E N   1 
ATOM   9628  C  CA  . CYS E  5  55  ? 53.017  280.219 244.458 1.00 40.11  ? 55   CYS E CA  1 
ATOM   9629  C  C   . CYS E  5  55  ? 52.613  279.943 245.881 1.00 61.80  ? 55   CYS E C   1 
ATOM   9630  O  O   . CYS E  5  55  ? 52.288  280.857 246.651 1.00 43.58  ? 55   CYS E O   1 
ATOM   9631  C  CB  . CYS E  5  55  ? 51.808  279.905 243.590 1.00 35.33  ? 55   CYS E CB  1 
ATOM   9632  S  SG  . CYS E  5  55  ? 52.069  280.521 241.877 1.00 39.30  ? 55   CYS E SG  1 
ATOM   9633  N  N   . ARG E  5  56  ? 52.597  278.666 246.240 1.00 42.13  ? 56   ARG E N   1 
ATOM   9634  C  CA  . ARG E  5  56  ? 52.186  278.297 247.601 1.00 58.54  ? 56   ARG E CA  1 
ATOM   9635  C  C   . ARG E  5  56  ? 53.134  278.891 248.643 1.00 46.93  ? 56   ARG E C   1 
ATOM   9636  O  O   . ARG E  5  56  ? 52.691  279.485 249.643 1.00 46.88  ? 56   ARG E O   1 
ATOM   9637  C  CB  . ARG E  5  56  ? 52.078  276.777 247.720 1.00 37.92  ? 56   ARG E CB  1 
ATOM   9638  C  CG  . ARG E  5  56  ? 51.760  276.199 249.211 1.00 42.90  ? 56   ARG E CG  1 
ATOM   9639  C  CD  . ARG E  5  56  ? 50.369  276.551 249.703 1.00 49.02  ? 56   ARG E CD  1 
ATOM   9640  N  NE  . ARG E  5  56  ? 50.380  277.834 250.398 1.00 42.40  ? 56   ARG E NE  1 
ATOM   9641  C  CZ  . ARG E  5  56  ? 49.336  278.346 251.054 1.00 48.28  ? 56   ARG E CZ  1 
ATOM   9642  N  NH1 . ARG E  5  56  ? 48.187  277.698 251.138 1.00 39.93  ? 56   ARG E NH1 1 
ATOM   9643  N  NH2 . ARG E  5  56  ? 49.462  279.527 251.647 1.00 41.26  ? 56   ARG E NH2 1 
ATOM   9644  N  N   . ARG E  5  57  ? 54.452  278.780 248.428 1.00 46.48  ? 57   ARG E N   1 
ATOM   9645  C  CA  . ARG E  5  57  ? 55.380  279.388 249.388 1.00 43.91  ? 57   ARG E CA  1 
ATOM   9646  C  C   . ARG E  5  57  ? 55.254  280.902 249.443 1.00 97.02  ? 57   ARG E C   1 
ATOM   9647  O  O   . ARG E  5  57  ? 55.653  281.519 250.424 1.00 42.34  ? 57   ARG E O   1 
ATOM   9648  C  CB  . ARG E  5  57  ? 56.828  279.016 249.066 1.00 51.73  ? 57   ARG E CB  1 
ATOM   9649  C  CG  . ARG E  5  57  ? 57.083  277.532 249.049 1.00 46.89  ? 57   ARG E CG  1 
ATOM   9650  C  CD  . ARG E  5  57  ? 58.578  277.224 249.143 1.00 47.67  ? 57   ARG E CD  1 
ATOM   9651  N  NE  . ARG E  5  57  ? 59.358  277.638 247.952 1.00 50.25  ? 57   ARG E NE  1 
ATOM   9652  C  CZ  . ARG E  5  57  ? 59.279  277.053 246.764 1.00 68.48  ? 57   ARG E CZ  1 
ATOM   9653  N  NH1 . ARG E  5  57  ? 58.442  276.042 246.573 1.00 39.39  ? 57   ARG E NH1 1 
ATOM   9654  N  NH2 . ARG E  5  57  ? 60.053  277.463 245.776 1.00 45.13  ? 57   ARG E NH2 1 
ATOM   9655  N  N   . LEU E  5  58  ? 54.721  281.523 248.409 1.00 48.11  ? 58   LEU E N   1 
ATOM   9656  C  CA  . LEU E  5  58  ? 54.512  282.960 248.382 1.00 39.98  ? 58   LEU E CA  1 
ATOM   9657  C  C   . LEU E  5  58  ? 53.076  283.334 248.759 1.00 39.95  ? 58   LEU E C   1 
ATOM   9658  O  O   . LEU E  5  58  ? 52.689  284.495 248.572 1.00 42.60  ? 58   LEU E O   1 
ATOM   9659  C  CB  . LEU E  5  58  ? 54.885  283.495 246.949 1.00 39.69  ? 58   LEU E CB  1 
ATOM   9660  C  CG  . LEU E  5  58  ? 56.397  283.465 246.686 1.00 39.30  ? 58   LEU E CG  1 
ATOM   9661  C  CD1 . LEU E  5  58  ? 56.686  283.404 245.162 1.00 37.16  ? 58   LEU E CD1 1 
ATOM   9662  C  CD2 . LEU E  5  58  ? 57.080  284.654 247.318 1.00 42.86  ? 58   LEU E CD2 1 
ATOM   9663  N  N   . ASN E  5  59  ? 52.260  282.372 249.238 1.00 40.33  ? 59   ASN E N   1 
ATOM   9664  C  CA  . ASN E  5  59  ? 50.889  282.633 249.690 1.00 49.90  ? 59   ASN E CA  1 
ATOM   9665  C  C   . ASN E  5  59  ? 50.078  283.318 248.608 1.00 154.92 ? 59   ASN E C   1 
ATOM   9666  O  O   . ASN E  5  59  ? 49.353  284.271 248.860 1.00 41.67  ? 59   ASN E O   1 
ATOM   9667  C  CB  . ASN E  5  59  ? 50.873  283.476 250.979 1.00 41.75  ? 59   ASN E CB  1 
ATOM   9668  C  CG  . ASN E  5  59  ? 51.586  282.800 252.081 1.00 62.15  ? 59   ASN E CG  1 
ATOM   9669  O  OD1 . ASN E  5  59  ? 51.446  281.602 252.233 1.00 38.66  ? 59   ASN E OD1 1 
ATOM   9670  N  ND2 . ASN E  5  59  ? 52.352  283.542 252.868 1.00 45.12  ? 59   ASN E ND2 1 
ATOM   9671  N  N   . ASP E  5  60  ? 50.232  282.876 247.376 1.00 39.91  ? 60   ASP E N   1 
ATOM   9672  C  CA  . ASP E  5  60  ? 49.575  283.568 246.262 1.00 37.04  ? 60   ASP E CA  1 
ATOM   9673  C  C   . ASP E  5  60  ? 48.755  282.559 245.482 1.00 44.76  ? 60   ASP E C   1 
ATOM   9674  O  O   . ASP E  5  60  ? 49.262  281.961 244.530 1.00 41.40  ? 60   ASP E O   1 
ATOM   9675  C  CB  . ASP E  5  60  ? 50.623  284.237 245.425 1.00 32.98  ? 60   ASP E CB  1 
ATOM   9676  C  CG  . ASP E  5  60  ? 50.034  285.049 244.258 1.00 37.61  ? 60   ASP E CG  1 
ATOM   9677  O  OD1 . ASP E  5  60  ? 48.808  285.044 244.024 1.00 45.18  ? 60   ASP E OD1 1 
ATOM   9678  O  OD2 . ASP E  5  60  ? 50.864  285.730 243.596 1.00 46.02  ? 60   ASP E OD2 1 
ATOM   9679  N  N   . PHE E  5  61  ? 47.508  282.390 245.911 1.00 41.20  ? 61   PHE E N   1 
ATOM   9680  C  CA  . PHE E  5  61  ? 46.580  281.493 245.230 1.00 38.82  ? 61   PHE E CA  1 
ATOM   9681  C  C   . PHE E  5  61  ? 46.252  281.986 243.836 1.00 53.68  ? 61   PHE E C   1 
ATOM   9682  O  O   . PHE E  5  61  ? 46.085  281.197 242.884 1.00 37.47  ? 61   PHE E O   1 
ATOM   9683  C  CB  . PHE E  5  61  ? 45.288  281.397 246.048 1.00 34.89  ? 61   PHE E CB  1 
ATOM   9684  C  CG  . PHE E  5  61  ? 44.205  280.666 245.318 1.00 37.26  ? 61   PHE E CG  1 
ATOM   9685  C  CD1 . PHE E  5  61  ? 44.209  279.267 245.286 1.00 44.22  ? 61   PHE E CD1 1 
ATOM   9686  C  CD2 . PHE E  5  61  ? 43.244  281.356 244.564 1.00 35.28  ? 61   PHE E CD2 1 
ATOM   9687  C  CE1 . PHE E  5  61  ? 43.279  278.560 244.549 1.00 41.44  ? 61   PHE E CE1 1 
ATOM   9688  C  CE2 . PHE E  5  61  ? 42.259  280.639 243.807 1.00 37.94  ? 61   PHE E CE2 1 
ATOM   9689  C  CZ  . PHE E  5  61  ? 42.275  279.224 243.809 1.00 39.83  ? 61   PHE E CZ  1 
ATOM   9690  N  N   . ALA E  5  62  ? 46.072  283.290 243.694 1.00 35.04  ? 62   ALA E N   1 
ATOM   9691  C  CA  . ALA E  5  62  ? 45.590  283.765 242.389 1.00 35.49  ? 62   ALA E CA  1 
ATOM   9692  C  C   . ALA E  5  62  ? 46.611  283.495 241.292 1.00 38.80  ? 62   ALA E C   1 
ATOM   9693  O  O   . ALA E  5  62  ? 46.237  283.146 240.160 1.00 38.43  ? 62   ALA E O   1 
ATOM   9694  C  CB  . ALA E  5  62  ? 45.244  285.245 242.425 1.00 39.86  ? 62   ALA E CB  1 
ATOM   9695  N  N   . SER E  5  63  ? 47.900  283.692 241.581 1.00 37.11  ? 63   SER E N   1 
ATOM   9696  C  CA  . SER E  5  63  ? 48.873  283.428 240.513 1.00 41.78  ? 63   SER E CA  1 
ATOM   9697  C  C   . SER E  5  63  ? 48.929  281.944 240.148 1.00 44.57  ? 63   SER E C   1 
ATOM   9698  O  O   . SER E  5  63  ? 49.287  281.619 239.024 1.00 38.98  ? 63   SER E O   1 
ATOM   9699  C  CB  . SER E  5  63  ? 50.279  283.918 240.879 1.00 35.87  ? 63   SER E CB  1 
ATOM   9700  O  OG  . SER E  5  63  ? 50.302  285.301 241.066 1.00 41.45  ? 63   SER E OG  1 
ATOM   9701  N  N   . ALA E  5  64  ? 48.635  281.024 241.081 1.00 37.66  ? 64   ALA E N   1 
ATOM   9702  C  CA  . ALA E  5  64  ? 48.599  279.606 240.708 1.00 33.86  ? 64   ALA E CA  1 
ATOM   9703  C  C   . ALA E  5  64  ? 47.521  279.355 239.651 1.00 42.16  ? 64   ALA E C   1 
ATOM   9704  O  O   . ALA E  5  64  ? 47.747  278.627 238.678 1.00 37.61  ? 64   ALA E O   1 
ATOM   9705  C  CB  . ALA E  5  64  ? 48.388  278.728 241.977 1.00 33.45  ? 64   ALA E CB  1 
ATOM   9706  N  N   . VAL E  5  65  ? 46.365  280.003 239.801 1.00 38.65  ? 65   VAL E N   1 
ATOM   9707  C  CA  . VAL E  5  65  ? 45.297  279.847 238.824 1.00 45.94  ? 65   VAL E CA  1 
ATOM   9708  C  C   . VAL E  5  65  ? 45.737  280.456 237.507 1.00 50.45  ? 65   VAL E C   1 
ATOM   9709  O  O   . VAL E  5  65  ? 45.580  279.859 236.440 1.00 35.65  ? 65   VAL E O   1 
ATOM   9710  C  CB  . VAL E  5  65  ? 43.982  280.493 239.324 1.00 32.71  ? 65   VAL E CB  1 
ATOM   9711  C  CG1 . VAL E  5  65  ? 42.829  280.382 238.245 1.00 38.10  ? 65   VAL E CG1 1 
ATOM   9712  C  CG2 . VAL E  5  65  ? 43.555  279.894 240.768 1.00 30.13  ? 65   VAL E CG2 1 
ATOM   9713  N  N   . ARG E  5  66  ? 46.323  281.644 237.570 1.00 31.67  ? 66   ARG E N   1 
ATOM   9714  C  CA  . ARG E  5  66  ? 46.771  282.321 236.332 1.00 32.12  ? 66   ARG E CA  1 
ATOM   9715  C  C   . ARG E  5  66  ? 47.801  281.478 235.567 1.00 66.70  ? 66   ARG E C   1 
ATOM   9716  O  O   . ARG E  5  66  ? 47.815  281.466 234.335 1.00 38.86  ? 66   ARG E O   1 
ATOM   9717  C  CB  . ARG E  5  66  ? 47.337  283.695 236.711 1.00 35.34  ? 66   ARG E CB  1 
ATOM   9718  C  CG  . ARG E  5  66  ? 47.598  284.650 235.572 1.00 39.26  ? 66   ARG E CG  1 
ATOM   9719  C  CD  . ARG E  5  66  ? 46.324  285.308 235.084 1.00 35.44  ? 66   ARG E CD  1 
ATOM   9720  N  NE  . ARG E  5  66  ? 46.633  286.592 234.428 1.00 40.41  ? 66   ARG E NE  1 
ATOM   9721  C  CZ  . ARG E  5  66  ? 45.723  287.467 234.035 1.00 36.57  ? 66   ARG E CZ  1 
ATOM   9722  N  NH1 . ARG E  5  66  ? 44.447  287.162 234.173 1.00 36.25  ? 66   ARG E NH1 1 
ATOM   9723  N  NH2 . ARG E  5  66  ? 46.080  288.618 233.452 1.00 34.75  ? 66   ARG E NH2 1 
ATOM   9724  N  N   . ILE E  5  67  ? 48.682  280.775 236.284 1.00 40.69  ? 67   ILE E N   1 
ATOM   9725  C  CA  . ILE E  5  67  ? 49.648  279.873 235.644 1.00 38.93  ? 67   ILE E CA  1 
ATOM   9726  C  C   . ILE E  5  67  ? 48.939  278.771 234.867 1.00 36.94  ? 67   ILE E C   1 
ATOM   9727  O  O   . ILE E  5  67  ? 49.345  278.428 233.755 1.00 39.98  ? 67   ILE E O   1 
ATOM   9728  C  CB  . ILE E  5  67  ? 50.625  279.274 236.675 1.00 42.14  ? 67   ILE E CB  1 
ATOM   9729  C  CG1 . ILE E  5  67  ? 51.615  280.364 237.125 1.00 38.97  ? 67   ILE E CG1 1 
ATOM   9730  C  CG2 . ILE E  5  67  ? 51.330  278.025 236.057 1.00 37.37  ? 67   ILE E CG2 1 
ATOM   9731  C  CD1 . ILE E  5  67  ? 52.460  280.022 238.417 1.00 35.73  ? 67   ILE E CD1 1 
ATOM   9732  N  N   . LEU E  5  68  ? 47.905  278.157 235.470 1.00 34.22  ? 68   LEU E N   1 
ATOM   9733  C  CA  . LEU E  5  68  ? 47.151  277.154 234.724 1.00 37.83  ? 68   LEU E CA  1 
ATOM   9734  C  C   . LEU E  5  68  ? 46.544  277.763 233.457 1.00 48.13  ? 68   LEU E C   1 
ATOM   9735  O  O   . LEU E  5  68  ? 46.528  277.131 232.386 1.00 38.01  ? 68   LEU E O   1 
ATOM   9736  C  CB  . LEU E  5  68  ? 46.048  276.569 235.610 1.00 32.26  ? 68   LEU E CB  1 
ATOM   9737  C  CG  . LEU E  5  68  ? 46.569  275.882 236.872 1.00 39.96  ? 68   LEU E CG  1 
ATOM   9738  C  CD1 . LEU E  5  68  ? 45.420  275.220 237.642 1.00 36.89  ? 68   LEU E CD1 1 
ATOM   9739  C  CD2 . LEU E  5  68  ? 47.687  274.878 236.551 1.00 45.13  ? 68   LEU E CD2 1 
ATOM   9740  N  N   . GLU E  5  69  ? 45.995  278.979 233.570 1.00 36.18  ? 69   GLU E N   1 
ATOM   9741  C  CA  . GLU E  5  69  ? 45.437  279.622 232.362 1.00 33.05  ? 69   GLU E CA  1 
ATOM   9742  C  C   . GLU E  5  69  ? 46.500  279.771 231.258 1.00 34.40  ? 69   GLU E C   1 
ATOM   9743  O  O   . GLU E  5  69  ? 46.213  279.586 230.082 1.00 35.82  ? 69   GLU E O   1 
ATOM   9744  C  CB  . GLU E  5  69  ? 44.859  281.000 232.704 1.00 38.53  ? 69   GLU E CB  1 
ATOM   9745  C  CG  . GLU E  5  69  ? 43.581  280.996 233.595 1.00 30.14  ? 69   GLU E CG  1 
ATOM   9746  C  CD  . GLU E  5  69  ? 43.151  282.421 233.863 1.00 47.15  ? 69   GLU E CD  1 
ATOM   9747  O  OE1 . GLU E  5  69  ? 43.821  283.091 234.671 1.00 35.87  ? 69   GLU E OE1 1 
ATOM   9748  O  OE2 . GLU E  5  69  ? 42.194  282.899 233.236 1.00 38.27  ? 69   GLU E OE2 1 
ATOM   9749  N  N   . VAL E  5  70  ? 47.721  280.152 231.621 1.00 36.90  ? 70   VAL E N   1 
ATOM   9750  C  CA  . VAL E  5  70  ? 48.669  280.469 230.558 1.00 36.46  ? 70   VAL E CA  1 
ATOM   9751  C  C   . VAL E  5  70  ? 49.193  279.171 229.920 1.00 35.16  ? 70   VAL E C   1 
ATOM   9752  O  O   . VAL E  5  70  ? 49.501  279.144 228.713 1.00 39.54  ? 70   VAL E O   1 
ATOM   9753  C  CB  . VAL E  5  70  ? 49.797  281.402 231.054 1.00 39.50  ? 70   VAL E CB  1 
ATOM   9754  C  CG1 . VAL E  5  70  ? 50.848  280.669 231.694 1.00 34.14  ? 70   VAL E CG1 1 
ATOM   9755  C  CG2 . VAL E  5  70  ? 50.425  282.177 229.833 1.00 51.10  ? 70   VAL E CG2 1 
ATOM   9756  N  N   . VAL E  5  71  ? 49.198  278.081 230.665 1.00 39.50  ? 71   VAL E N   1 
ATOM   9757  C  CA  . VAL E  5  71  ? 49.477  276.767 230.085 1.00 39.89  ? 71   VAL E CA  1 
ATOM   9758  C  C   . VAL E  5  71  ? 48.485  276.468 228.985 1.00 40.44  ? 71   VAL E C   1 
ATOM   9759  O  O   . VAL E  5  71  ? 48.856  276.112 227.851 1.00 39.28  ? 71   VAL E O   1 
ATOM   9760  C  CB  . VAL E  5  71  ? 49.410  275.680 231.170 1.00 43.67  ? 71   VAL E CB  1 
ATOM   9761  C  CG1 . VAL E  5  71  ? 49.375  274.320 230.490 1.00 37.24  ? 71   VAL E CG1 1 
ATOM   9762  C  CG2 . VAL E  5  71  ? 50.536  275.833 232.150 1.00 36.92  ? 71   VAL E CG2 1 
ATOM   9763  N  N   . LYS E  5  72  ? 47.201  276.663 229.297 1.00 37.48  ? 72   LYS E N   1 
ATOM   9764  C  CA  . LYS E  5  72  ? 46.163  276.432 228.318 1.00 39.39  ? 72   LYS E CA  1 
ATOM   9765  C  C   . LYS E  5  72  ? 46.384  277.337 227.119 1.00 52.47  ? 72   LYS E C   1 
ATOM   9766  O  O   . LYS E  5  72  ? 46.328  276.891 225.976 1.00 35.18  ? 72   LYS E O   1 
ATOM   9767  C  CB  . LYS E  5  72  ? 44.781  276.666 228.929 1.00 33.53  ? 72   LYS E CB  1 
ATOM   9768  C  CG  . LYS E  5  72  ? 43.643  276.403 227.892 1.00 39.96  ? 72   LYS E CG  1 
ATOM   9769  C  CD  . LYS E  5  72  ? 42.247  276.613 228.554 1.00 53.22  ? 72   LYS E CD  1 
ATOM   9770  C  CE  . LYS E  5  72  ? 41.111  276.521 227.496 1.00 61.62  ? 72   LYS E CE  1 
ATOM   9771  N  NZ  . LYS E  5  72  ? 39.741  276.654 228.079 1.00 98.24  ? 72   LYS E NZ  1 
ATOM   9772  N  N   . ASP E  5  73  ? 46.704  278.605 227.374 1.00 37.00  ? 73   ASP E N   1 
ATOM   9773  C  CA  . ASP E  5  73  ? 46.874  279.569 226.273 1.00 41.33  ? 73   ASP E CA  1 
ATOM   9774  C  C   . ASP E  5  73  ? 48.042  279.205 225.357 1.00 38.16  ? 73   ASP E C   1 
ATOM   9775  O  O   . ASP E  5  73  ? 47.944  279.320 224.125 1.00 38.04  ? 73   ASP E O   1 
ATOM   9776  C  CB  . ASP E  5  73  ? 47.077  280.973 226.860 1.00 32.98  ? 73   ASP E CB  1 
ATOM   9777  C  CG  . ASP E  5  73  ? 46.775  282.075 225.830 1.00 38.26  ? 73   ASP E CG  1 
ATOM   9778  O  OD1 . ASP E  5  73  ? 45.612  282.361 225.570 1.00 37.49  ? 73   ASP E OD1 1 
ATOM   9779  O  OD2 . ASP E  5  73  ? 47.698  282.657 225.316 1.00 37.71  ? 73   ASP E OD2 1 
ATOM   9780  N  N   . LYS E  5  74  ? 49.181  278.809 225.939 1.00 37.34  ? 74   LYS E N   1 
ATOM   9781  C  CA  . LYS E  5  74  ? 50.369  278.491 225.149 1.00 36.67  ? 74   LYS E CA  1 
ATOM   9782  C  C   . LYS E  5  74  ? 50.169  277.295 224.212 1.00 35.90  ? 74   LYS E C   1 
ATOM   9783  O  O   . LYS E  5  74  ? 50.939  277.113 223.259 1.00 35.28  ? 74   LYS E O   1 
ATOM   9784  C  CB  . LYS E  5  74  ? 51.576  278.213 226.100 1.00 38.73  ? 74   LYS E CB  1 
ATOM   9785  C  CG  . LYS E  5  74  ? 52.226  279.453 226.656 1.00 42.33  ? 74   LYS E CG  1 
ATOM   9786  C  CD  . LYS E  5  74  ? 52.930  280.272 225.544 1.00 37.50  ? 74   LYS E CD  1 
ATOM   9787  C  CE  . LYS E  5  74  ? 54.086  279.494 224.930 1.00 34.05  ? 74   LYS E CE  1 
ATOM   9788  N  NZ  . LYS E  5  74  ? 54.735  280.421 223.962 1.00 36.21  ? 74   LYS E NZ  1 
ATOM   9789  N  N   . ALA E  5  75  ? 49.174  276.471 224.452 1.00 33.87  ? 75   ALA E N   1 
ATOM   9790  C  CA  . ALA E  5  75  ? 48.917  275.347 223.549 1.00 36.95  ? 75   ALA E CA  1 
ATOM   9791  C  C   . ALA E  5  75  ? 48.191  275.752 222.283 1.00 47.15  ? 75   ALA E C   1 
ATOM   9792  O  O   . ALA E  5  75  ? 48.127  274.941 221.333 1.00 40.05  ? 75   ALA E O   1 
ATOM   9793  C  CB  . ALA E  5  75  ? 48.045  274.289 224.227 1.00 36.43  ? 75   ALA E CB  1 
ATOM   9794  N  N   . GLY E  5  76  ? 47.582  276.946 222.271 1.00 43.69  ? 76   GLY E N   1 
ATOM   9795  C  CA  . GLY E  5  76  ? 46.921  277.437 221.075 1.00 37.07  ? 76   GLY E CA  1 
ATOM   9796  C  C   . GLY E  5  76  ? 45.797  276.492 220.687 1.00 49.79  ? 76   GLY E C   1 
ATOM   9797  O  O   . GLY E  5  76  ? 44.974  276.141 221.535 1.00 40.89  ? 76   GLY E O   1 
ATOM   9798  N  N   . PRO E  5  77  ? 45.767  276.020 219.425 1.00 41.54  ? 77   PRO E N   1 
ATOM   9799  C  CA  . PRO E  5  77  ? 44.659  275.166 218.971 1.00 42.30  ? 77   PRO E CA  1 
ATOM   9800  C  C   . PRO E  5  77  ? 44.858  273.707 219.338 1.00 48.73  ? 77   PRO E C   1 
ATOM   9801  O  O   . PRO E  5  77  ? 44.020  272.874 218.982 1.00 46.77  ? 77   PRO E O   1 
ATOM   9802  C  CB  . PRO E  5  77  ? 44.680  275.363 217.422 1.00 34.10  ? 77   PRO E CB  1 
ATOM   9803  C  CG  . PRO E  5  77  ? 46.168  275.416 217.139 1.00 39.39  ? 77   PRO E CG  1 
ATOM   9804  C  CD  . PRO E  5  77  ? 46.770  276.200 218.350 1.00 49.95  ? 77   PRO E CD  1 
ATOM   9805  N  N   . HIS E  5  78  ? 45.950  273.374 220.034 1.00 39.49  ? 78   HIS E N   1 
ATOM   9806  C  CA  . HIS E  5  78  ? 46.227  271.980 220.400 1.00 38.66  ? 78   HIS E CA  1 
ATOM   9807  C  C   . HIS E  5  78  ? 45.466  271.668 221.681 1.00 41.24  ? 78   HIS E C   1 
ATOM   9808  O  O   . HIS E  5  78  ? 46.010  271.725 222.786 1.00 42.15  ? 78   HIS E O   1 
ATOM   9809  C  CB  . HIS E  5  78  ? 47.727  271.766 220.526 1.00 42.68  ? 78   HIS E CB  1 
ATOM   9810  C  CG  . HIS E  5  78  ? 48.438  271.878 219.213 1.00 62.52  ? 78   HIS E CG  1 
ATOM   9811  N  ND1 . HIS E  5  78  ? 48.251  270.966 218.197 1.00 53.89  ? 78   HIS E ND1 1 
ATOM   9812  C  CD2 . HIS E  5  78  ? 49.305  272.801 218.736 1.00 172.61 ? 78   HIS E CD2 1 
ATOM   9813  C  CE1 . HIS E  5  78  ? 48.980  271.318 217.152 1.00 49.22  ? 78   HIS E CE1 1 
ATOM   9814  N  NE2 . HIS E  5  78  ? 49.628  272.428 217.455 1.00 47.35  ? 78   HIS E NE2 1 
ATOM   9815  N  N   . LYS E  5  79  ? 44.173  271.338 221.506 1.00 39.98  ? 79   LYS E N   1 
ATOM   9816  C  CA  . LYS E  5  79  ? 43.167  271.226 222.567 1.00 45.92  ? 79   LYS E CA  1 
ATOM   9817  C  C   . LYS E  5  79  ? 43.425  270.054 223.518 1.00 48.05  ? 79   LYS E C   1 
ATOM   9818  O  O   . LYS E  5  79  ? 42.872  270.030 224.622 1.00 43.48  ? 79   LYS E O   1 
ATOM   9819  C  CB  . LYS E  5  79  ? 41.770  271.063 221.940 1.00 57.26  ? 79   LYS E CB  1 
ATOM   9820  C  CG  . LYS E  5  79  ? 40.964  272.361 221.702 1.00 66.28  ? 79   LYS E CG  1 
ATOM   9821  C  CD  . LYS E  5  79  ? 41.303  273.077 220.402 1.00 141.31 ? 79   LYS E CD  1 
ATOM   9822  C  CE  . LYS E  5  79  ? 40.456  274.334 220.219 1.00 155.83 ? 79   LYS E CE  1 
ATOM   9823  N  NZ  . LYS E  5  79  ? 40.766  275.045 218.940 1.00 106.29 ? 79   LYS E NZ  1 
ATOM   9824  N  N   . GLU E  5  80  ? 44.253  269.092 223.120 1.00 41.74  ? 80   GLU E N   1 
ATOM   9825  C  CA  . GLU E  5  80  ? 44.588  267.937 223.944 1.00 48.23  ? 80   GLU E CA  1 
ATOM   9826  C  C   . GLU E  5  80  ? 45.687  268.231 224.973 1.00 40.75  ? 80   GLU E C   1 
ATOM   9827  O  O   . GLU E  5  80  ? 45.899  267.425 225.871 1.00 48.31  ? 80   GLU E O   1 
ATOM   9828  C  CB  . GLU E  5  80  ? 45.024  266.778 223.024 1.00 48.74  ? 80   GLU E CB  1 
ATOM   9829  C  CG  . GLU E  5  80  ? 46.453  266.884 222.487 1.00 46.35  ? 80   GLU E CG  1 
ATOM   9830  C  CD  . GLU E  5  80  ? 46.636  267.839 221.285 1.00 85.53  ? 80   GLU E CD  1 
ATOM   9831  O  OE1 . GLU E  5  80  ? 47.696  267.792 220.644 1.00 62.68  ? 80   GLU E OE1 1 
ATOM   9832  O  OE2 . GLU E  5  80  ? 45.744  268.637 220.946 1.00 48.26  ? 80   GLU E OE2 1 
ATOM   9833  N  N   . ILE E  5  81  ? 46.421  269.336 224.854 1.00 37.39  ? 81   ILE E N   1 
ATOM   9834  C  CA  . ILE E  5  81  ? 47.574  269.522 225.735 1.00 37.42  ? 81   ILE E CA  1 
ATOM   9835  C  C   . ILE E  5  81  ? 47.118  269.897 227.144 1.00 50.82  ? 81   ILE E C   1 
ATOM   9836  O  O   . ILE E  5  81  ? 47.557  269.313 228.137 1.00 43.39  ? 81   ILE E O   1 
ATOM   9837  C  CB  . ILE E  5  81  ? 48.549  270.563 225.160 1.00 40.77  ? 81   ILE E CB  1 
ATOM   9838  C  CG1 . ILE E  5  81  ? 49.178  270.033 223.854 1.00 39.97  ? 81   ILE E CG1 1 
ATOM   9839  C  CG2 . ILE E  5  81  ? 49.659  270.900 226.202 1.00 35.22  ? 81   ILE E CG2 1 
ATOM   9840  C  CD1 . ILE E  5  81  ? 50.197  270.993 223.249 1.00 44.29  ? 81   ILE E CD1 1 
ATOM   9841  N  N   . TYR E  5  82  ? 46.210  270.851 227.243 1.00 38.22  ? 82   TYR E N   1 
ATOM   9842  C  CA  . TYR E  5  82  ? 45.806  271.315 228.576 1.00 43.64  ? 82   TYR E CA  1 
ATOM   9843  C  C   . TYR E  5  82  ? 45.173  270.204 229.397 1.00 63.15  ? 82   TYR E C   1 
ATOM   9844  O  O   . TYR E  5  82  ? 45.604  270.003 230.541 1.00 46.12  ? 82   TYR E O   1 
ATOM   9845  C  CB  . TYR E  5  82  ? 44.870  272.512 228.444 1.00 42.34  ? 82   TYR E CB  1 
ATOM   9846  C  CG  . TYR E  5  82  ? 44.413  273.060 229.785 1.00 44.61  ? 82   TYR E CG  1 
ATOM   9847  C  CD1 . TYR E  5  82  ? 45.308  273.703 230.629 1.00 40.96  ? 82   TYR E CD1 1 
ATOM   9848  C  CD2 . TYR E  5  82  ? 43.067  272.987 230.164 1.00 39.85  ? 82   TYR E CD2 1 
ATOM   9849  C  CE1 . TYR E  5  82  ? 44.877  274.250 231.838 1.00 39.66  ? 82   TYR E CE1 1 
ATOM   9850  C  CE2 . TYR E  5  82  ? 42.629  273.527 231.369 1.00 44.13  ? 82   TYR E CE2 1 
ATOM   9851  C  CZ  . TYR E  5  82  ? 43.531  274.148 232.199 1.00 37.43  ? 82   TYR E CZ  1 
ATOM   9852  O  OH  . TYR E  5  82  ? 43.075  274.695 233.407 1.00 46.57  ? 82   TYR E OH  1 
ATOM   9853  N  N   . PRO E  5  83  ? 44.201  269.443 228.893 1.00 40.47  ? 83   PRO E N   1 
ATOM   9854  C  CA  . PRO E  5  83  ? 43.664  268.329 229.697 1.00 44.96  ? 83   PRO E CA  1 
ATOM   9855  C  C   . PRO E  5  83  ? 44.726  267.339 230.116 1.00 202.21 ? 83   PRO E C   1 
ATOM   9856  O  O   . PRO E  5  83  ? 44.620  266.803 231.203 1.00 48.04  ? 83   PRO E O   1 
ATOM   9857  C  CB  . PRO E  5  83  ? 42.607  267.698 228.774 1.00 42.69  ? 83   PRO E CB  1 
ATOM   9858  C  CG  . PRO E  5  83  ? 42.339  268.799 227.700 1.00 37.27  ? 83   PRO E CG  1 
ATOM   9859  C  CD  . PRO E  5  83  ? 43.602  269.502 227.538 1.00 38.18  ? 83   PRO E CD  1 
ATOM   9860  N  N   . TYR E  5  84  ? 45.772  267.106 229.333 1.00 44.98  ? 84   TYR E N   1 
ATOM   9861  C  CA  . TYR E  5  84  ? 46.847  266.230 229.786 1.00 47.28  ? 84   TYR E CA  1 
ATOM   9862  C  C   . TYR E  5  84  ? 47.629  266.865 230.932 1.00 51.24  ? 84   TYR E C   1 
ATOM   9863  O  O   . TYR E  5  84  ? 47.936  266.204 231.924 1.00 46.09  ? 84   TYR E O   1 
ATOM   9864  C  CB  . TYR E  5  84  ? 47.771  265.868 228.605 1.00 42.39  ? 84   TYR E CB  1 
ATOM   9865  C  CG  . TYR E  5  84  ? 49.048  265.216 229.077 1.00 42.42  ? 84   TYR E CG  1 
ATOM   9866  C  CD1 . TYR E  5  84  ? 49.093  263.843 229.406 1.00 46.11  ? 84   TYR E CD1 1 
ATOM   9867  C  CD2 . TYR E  5  84  ? 50.206  265.971 229.252 1.00 42.21  ? 84   TYR E CD2 1 
ATOM   9868  C  CE1 . TYR E  5  84  ? 50.281  263.257 229.882 1.00 49.94  ? 84   TYR E CE1 1 
ATOM   9869  C  CE2 . TYR E  5  84  ? 51.371  265.392 229.716 1.00 40.41  ? 84   TYR E CE2 1 
ATOM   9870  C  CZ  . TYR E  5  84  ? 51.402  264.035 230.025 1.00 88.78  ? 84   TYR E CZ  1 
ATOM   9871  O  OH  . TYR E  5  84  ? 52.555  263.475 230.484 1.00 58.82  ? 84   TYR E OH  1 
ATOM   9872  N  N   . VAL E  5  85  ? 47.950  268.143 230.820 1.00 39.71  ? 85   VAL E N   1 
ATOM   9873  C  CA  . VAL E  5  85  ? 48.749  268.789 231.857 1.00 50.63  ? 85   VAL E CA  1 
ATOM   9874  C  C   . VAL E  5  85  ? 47.983  268.828 233.175 1.00 140.49 ? 85   VAL E C   1 
ATOM   9875  O  O   . VAL E  5  85  ? 48.554  268.601 234.239 1.00 46.35  ? 85   VAL E O   1 
ATOM   9876  C  CB  . VAL E  5  85  ? 49.189  270.204 231.400 1.00 41.01  ? 85   VAL E CB  1 
ATOM   9877  C  CG1 . VAL E  5  85  ? 49.891  270.952 232.582 1.00 40.33  ? 85   VAL E CG1 1 
ATOM   9878  C  CG2 . VAL E  5  85  ? 50.193  270.134 230.261 1.00 38.47  ? 85   VAL E CG2 1 
ATOM   9879  N  N   . ILE E  5  86  ? 46.678  269.093 233.131 1.00 37.19  ? 86   ILE E N   1 
ATOM   9880  C  CA  . ILE E  5  86  ? 45.891  269.104 234.369 1.00 49.87  ? 86   ILE E CA  1 
ATOM   9881  C  C   . ILE E  5  86  ? 45.873  267.714 234.992 1.00 70.61  ? 86   ILE E C   1 
ATOM   9882  O  O   . ILE E  5  86  ? 46.083  267.564 236.197 1.00 47.11  ? 86   ILE E O   1 
ATOM   9883  C  CB  . ILE E  5  86  ? 44.466  269.650 234.132 1.00 57.73  ? 86   ILE E CB  1 
ATOM   9884  C  CG1 . ILE E  5  86  ? 44.520  271.145 233.737 1.00 40.97  ? 86   ILE E CG1 1 
ATOM   9885  C  CG2 . ILE E  5  86  ? 43.534  269.398 235.423 1.00 41.63  ? 86   ILE E CG2 1 
ATOM   9886  C  CD1 . ILE E  5  86  ? 45.096  272.115 234.867 1.00 43.74  ? 86   ILE E CD1 1 
ATOM   9887  N  N   . GLN E  5  87  ? 45.636  266.680 234.176 1.00 45.64  ? 87   GLN E N   1 
ATOM   9888  C  CA  . GLN E  5  87  ? 45.780  265.287 234.585 1.00 54.25  ? 87   GLN E CA  1 
ATOM   9889  C  C   . GLN E  5  87  ? 47.070  265.067 235.348 1.00 48.79  ? 87   GLN E C   1 
ATOM   9890  O  O   . GLN E  5  87  ? 47.063  264.577 236.479 1.00 51.83  ? 87   GLN E O   1 
ATOM   9891  C  CB  . GLN E  5  87  ? 45.757  264.362 233.359 1.00 43.03  ? 87   GLN E CB  1 
ATOM   9892  C  CG  . GLN E  5  87  ? 46.159  262.912 233.681 1.00 51.73  ? 87   GLN E CG  1 
ATOM   9893  C  CD  . GLN E  5  87  ? 46.207  262.066 232.395 1.00 41.02  ? 87   GLN E CD  1 
ATOM   9894  O  OE1 . GLN E  5  87  ? 45.171  261.676 231.878 1.00 54.55  ? 87   GLN E OE1 1 
ATOM   9895  N  NE2 . GLN E  5  87  ? 47.398  261.831 231.872 1.00 43.31  ? 87   GLN E NE2 1 
ATOM   9896  N  N   . GLU E  5  88  ? 48.197  265.462 234.759 1.00 42.40  ? 88   GLU E N   1 
ATOM   9897  C  CA  . GLU E  5  88  ? 49.453  265.202 235.442 1.00 36.21  ? 88   GLU E CA  1 
ATOM   9898  C  C   . GLU E  5  88  ? 49.582  266.005 236.726 1.00 62.18  ? 88   GLU E C   1 
ATOM   9899  O  O   . GLU E  5  88  ? 50.356  265.620 237.597 1.00 50.29  ? 88   GLU E O   1 
ATOM   9900  C  CB  . GLU E  5  88  ? 50.634  265.481 234.525 1.00 50.54  ? 88   GLU E CB  1 
ATOM   9901  C  CG  . GLU E  5  88  ? 50.594  264.642 233.230 1.00 44.87  ? 88   GLU E CG  1 
ATOM   9902  C  CD  . GLU E  5  88  ? 50.621  263.171 233.543 1.00 90.43  ? 88   GLU E CD  1 
ATOM   9903  O  OE1 . GLU E  5  88  ? 49.635  262.444 233.313 1.00 47.71  ? 88   GLU E OE1 1 
ATOM   9904  O  OE2 . GLU E  5  88  ? 51.636  262.744 234.084 1.00 48.84  ? 88   GLU E OE2 1 
ATOM   9905  N  N   . LEU E  5  89  ? 48.857  267.106 236.866 1.00 43.91  ? 89   LEU E N   1 
ATOM   9906  C  CA  . LEU E  5  89  ? 49.006  267.968 238.037 1.00 47.08  ? 89   LEU E CA  1 
ATOM   9907  C  C   . LEU E  5  89  ? 48.000  267.664 239.144 1.00 38.11  ? 89   LEU E C   1 
ATOM   9908  O  O   . LEU E  5  89  ? 48.118  268.225 240.245 1.00 48.40  ? 89   LEU E O   1 
ATOM   9909  C  CB  . LEU E  5  89  ? 48.879  269.446 237.614 1.00 44.27  ? 89   LEU E CB  1 
ATOM   9910  C  CG  . LEU E  5  89  ? 50.030  270.066 236.829 1.00 47.97  ? 89   LEU E CG  1 
ATOM   9911  C  CD1 . LEU E  5  89  ? 49.572  271.402 236.242 1.00 39.38  ? 89   LEU E CD1 1 
ATOM   9912  C  CD2 . LEU E  5  89  ? 51.278  270.242 237.671 1.00 47.13  ? 89   LEU E CD2 1 
ATOM   9913  N  N   . ARG E  5  90  ? 47.007  266.813 238.873 1.00 41.38  ? 90   ARG E N   1 
ATOM   9914  C  CA  . ARG E  5  90  ? 45.922  266.529 239.802 1.00 53.46  ? 90   ARG E CA  1 
ATOM   9915  C  C   . ARG E  5  90  ? 46.410  266.255 241.222 1.00 69.21  ? 90   ARG E C   1 
ATOM   9916  O  O   . ARG E  5  90  ? 45.855  266.840 242.166 1.00 48.44  ? 90   ARG E O   1 
ATOM   9917  C  CB  . ARG E  5  90  ? 45.110  265.363 239.217 1.00 61.05  ? 90   ARG E CB  1 
ATOM   9918  C  CG  . ARG E  5  90  ? 43.640  265.490 239.288 1.00 102.20 ? 90   ARG E CG  1 
ATOM   9919  C  CD  . ARG E  5  90  ? 43.135  266.378 238.198 1.00 73.30  ? 90   ARG E CD  1 
ATOM   9920  N  NE  . ARG E  5  90  ? 42.519  267.507 238.854 1.00 79.48  ? 90   ARG E NE  1 
ATOM   9921  C  CZ  . ARG E  5  90  ? 41.542  268.224 238.345 1.00 183.32 ? 90   ARG E CZ  1 
ATOM   9922  N  NH1 . ARG E  5  90  ? 41.055  267.938 237.160 1.00 52.12  ? 90   ARG E NH1 1 
ATOM   9923  N  NH2 . ARG E  5  90  ? 41.049  269.219 239.041 1.00 46.96  ? 90   ARG E NH2 1 
ATOM   9924  N  N   . PRO E  5  91  ? 47.446  265.450 241.458 1.00 51.16  ? 91   PRO E N   1 
ATOM   9925  C  CA  . PRO E  5  91  ? 47.866  265.253 242.862 1.00 65.32  ? 91   PRO E CA  1 
ATOM   9926  C  C   . PRO E  5  91  ? 48.380  266.521 243.491 1.00 80.08  ? 91   PRO E C   1 
ATOM   9927  O  O   . PRO E  5  91  ? 48.174  266.755 244.686 1.00 55.81  ? 91   PRO E O   1 
ATOM   9928  C  CB  . PRO E  5  91  ? 48.981  264.205 242.760 1.00 46.76  ? 91   PRO E CB  1 
ATOM   9929  C  CG  . PRO E  5  91  ? 48.729  263.520 241.469 1.00 59.69  ? 91   PRO E CG  1 
ATOM   9930  C  CD  . PRO E  5  91  ? 48.266  264.619 240.558 1.00 42.81  ? 91   PRO E CD  1 
ATOM   9931  N  N   . THR E  5  92  ? 49.065  267.355 242.713 1.00 44.91  ? 92   THR E N   1 
ATOM   9932  C  CA  . THR E  5  92  ? 49.563  268.605 243.282 1.00 43.45  ? 92   THR E CA  1 
ATOM   9933  C  C   . THR E  5  92  ? 48.428  269.585 243.541 1.00 58.31  ? 92   THR E C   1 
ATOM   9934  O  O   . THR E  5  92  ? 48.409  270.262 244.583 1.00 45.44  ? 92   THR E O   1 
ATOM   9935  C  CB  . THR E  5  92  ? 50.604  269.208 242.363 1.00 57.39  ? 92   THR E CB  1 
ATOM   9936  O  OG1 . THR E  5  92  ? 51.728  268.321 242.322 1.00 51.91  ? 92   THR E OG1 1 
ATOM   9937  C  CG2 . THR E  5  92  ? 51.033  270.580 242.890 1.00 45.11  ? 92   THR E CG2 1 
ATOM   9938  N  N   . LEU E  5  93  ? 47.463  269.631 242.618 1.00 41.29  ? 93   LEU E N   1 
ATOM   9939  C  CA  . LEU E  5  93  ? 46.302  270.513 242.729 1.00 56.16  ? 93   LEU E CA  1 
ATOM   9940  C  C   . LEU E  5  93  ? 45.520  270.172 243.965 1.00 154.06 ? 93   LEU E C   1 
ATOM   9941  O  O   . LEU E  5  93  ? 45.132  271.044 244.743 1.00 46.14  ? 93   LEU E O   1 
ATOM   9942  C  CB  . LEU E  5  93  ? 45.395  270.373 241.500 1.00 42.44  ? 93   LEU E CB  1 
ATOM   9943  C  CG  . LEU E  5  93  ? 46.013  270.865 240.207 1.00 44.29  ? 93   LEU E CG  1 
ATOM   9944  C  CD1 . LEU E  5  93  ? 44.944  270.793 239.061 1.00 38.18  ? 93   LEU E CD1 1 
ATOM   9945  C  CD2 . LEU E  5  93  ? 46.576  272.279 240.372 1.00 36.31  ? 93   LEU E CD2 1 
ATOM   9946  N  N   . ASN E  5  94  ? 45.271  268.889 244.140 1.00 48.75  ? 94   ASN E N   1 
ATOM   9947  C  CA  . ASN E  5  94  ? 44.612  268.378 245.339 1.00 74.47  ? 94   ASN E CA  1 
ATOM   9948  C  C   . ASN E  5  94  ? 45.402  268.697 246.590 1.00 120.09 ? 94   ASN E C   1 
ATOM   9949  O  O   . ASN E  5  94  ? 44.860  269.219 247.569 1.00 54.63  ? 94   ASN E O   1 
ATOM   9950  C  CB  . ASN E  5  94  ? 44.444  266.878 245.207 1.00 48.81  ? 94   ASN E CB  1 
ATOM   9951  C  CG  . ASN E  5  94  ? 43.451  266.525 244.165 1.00 138.03 ? 94   ASN E CG  1 
ATOM   9952  O  OD1 . ASN E  5  94  ? 42.537  267.294 243.913 1.00 53.41  ? 94   ASN E OD1 1 
ATOM   9953  N  ND2 . ASN E  5  94  ? 43.606  265.359 243.554 1.00 51.30  ? 94   ASN E ND2 1 
ATOM   9954  N  N   . GLU E  5  95  ? 46.681  268.348 246.591 1.00 42.20  ? 95   GLU E N   1 
ATOM   9955  C  CA  . GLU E  5  95  ? 47.510  268.575 247.769 1.00 48.79  ? 95   GLU E CA  1 
ATOM   9956  C  C   . GLU E  5  95  ? 47.462  270.035 248.220 1.00 201.36 ? 95   GLU E C   1 
ATOM   9957  O  O   . GLU E  5  95  ? 47.200  270.325 249.391 1.00 46.73  ? 95   GLU E O   1 
ATOM   9958  C  CB  . GLU E  5  95  ? 48.938  268.140 247.479 1.00 54.58  ? 95   GLU E CB  1 
ATOM   9959  C  CG  . GLU E  5  95  ? 49.867  268.286 248.680 1.00 55.34  ? 95   GLU E CG  1 
ATOM   9960  C  CD  . GLU E  5  95  ? 51.327  268.129 248.299 1.00 72.23  ? 95   GLU E CD  1 
ATOM   9961  O  OE1 . GLU E  5  95  ? 52.192  268.846 248.819 1.00 52.41  ? 95   GLU E OE1 1 
ATOM   9962  O  OE2 . GLU E  5  95  ? 51.628  267.264 247.474 1.00 51.61  ? 95   GLU E OE2 1 
ATOM   9963  N  N   . LEU E  5  96  ? 47.692  270.967 247.29