data_3AG4
# 
_entry.id   3AG4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3AG4         
RCSB  RCSB029210   
WWPDB D_1000029210 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1occ . unspecified 
PDB 1ocz . unspecified 
PDB 1oco . unspecified 
PDB 1ocr . unspecified 
PDB 2occ . unspecified 
PDB 1v54 . unspecified 
PDB 1v55 . unspecified 
PDB 2dyr . unspecified 
PDB 2dys . unspecified 
PDB 2eij . unspecified 
PDB 2eik . unspecified 
PDB 2eil . unspecified 
PDB 2eim . unspecified 
PDB 2ein . unspecified 
PDB 2zxw . unspecified 
PDB 3abk . unspecified 
PDB 3abl . unspecified 
PDB 3abm . unspecified 
PDB 3AG1 . unspecified 
PDB 3AG2 . unspecified 
PDB 3AG3 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3AG4 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-19 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Muramoto, K.'      1 
'Ohta, K.'          2 
'Shinzawa-Itoh, K.' 3 
'Kanda, K.'         4 
'Taniguchi, M.'     5 
'Nabekura, H.'      6 
'Yamashita, E.'     7 
'Tsukihara, T.'     8 
'Yoshikawa, S.'     9 
# 
_citation.id                        primary 
_citation.title                     
'Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            107 
_citation.page_first                7740 
_citation.page_last                 7745 
_citation.year                      2010 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20385840 
_citation.pdbx_database_id_DOI      10.1073/pnas.0910410107 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Muramoto, K.'      1 
primary 'Ohta, K.'          2 
primary 'Shinzawa-Itoh, K.' 3 
primary 'Kanda, K.'         4 
primary 'Taniguchi, M.'     5 
primary 'Nabekura, H.'      6 
primary 'Yamashita, E.'     7 
primary 'Tsukihara, T.'     8 
primary 'Yoshikawa, S.'     9 
# 
_cell.entry_id           3AG4 
_cell.length_a           183.364 
_cell.length_b           206.648 
_cell.length_c           178.137 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3AG4 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Cytochrome c oxidase subunit 1' 57093.852 2    1.9.3.1 ? ? ? 
2  polymer     nat 'Cytochrome c oxidase subunit 2' 26068.404 2    1.9.3.1 ? ? ? 
3  polymer     nat 'Cytochrome c oxidase subunit 3' 29957.627 2    1.9.3.1 ? ? ? 
4  polymer     nat 'Cytochrome c oxidase subunit 4 isoform 1' 17179.646 2    1.9.3.1 ? ? ? 
5  polymer     nat 'Cytochrome c oxidase subunit 5A' 12453.081 2    1.9.3.1 ? ? ? 
6  polymer     nat 'Cytochrome c oxidase subunit 5B' 10684.038 2    1.9.3.1 ? ? ? 
7  polymer     nat 'Cytochrome c oxidase subunit 6A2' 9629.782  2    1.9.3.1 ? ? ? 
8  polymer     nat 'Cytochrome c oxidase subunit 6B1' 10039.244 2    1.9.3.1 ? ? ? 
9  polymer     nat 'Cytochrome c oxidase subunit 6C' 8537.019  2    1.9.3.1 ? ? ? 
10 polymer     nat 'Cytochrome c oxidase polypeptide 7A1' 6682.726  2    1.9.3.1 ? ? ? 
11 polymer     nat 'Cytochrome c oxidase subunit 7B' 6365.217  2    1.9.3.1 ? ? ? 
12 polymer     nat 'Cytochrome c oxidase subunit 7C' 5449.396  2    1.9.3.1 ? ? ? 
13 polymer     nat 'Cytochrome c oxidase subunit 8B' 4967.756  2    1.9.3.1 ? ? ? 
14 non-polymer syn HEME-A 852.837   4    ?       ? ? ? 
15 non-polymer syn 'CYANIDE ION' 26.017    2    ?       ? ? ? 
16 non-polymer syn 'COPPER (II) ION' 63.546    2    ?       ? ? ? 
17 non-polymer syn 'MAGNESIUM ION' 24.305    2    ?       ? ? ? 
18 non-polymer syn 'SODIUM ION' 22.990    2    ?       ? ? ? 
19 non-polymer syn TRISTEAROYLGLYCEROL 891.480   6    ?       ? ? ? 
20 non-polymer syn 
'(1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE' 749.007   
8    ?       ? ? ? 
21 non-polymer syn 'DINUCLEAR COPPER ION' 127.092   2    ?       ? ? ? 
22 non-polymer syn 'CHOLIC ACID' 408.571   8    ?       ? ? ? 
23 non-polymer syn 'UNKNOWN ATOM OR ION' ?         2    ?       ? ? ? 
24 non-polymer syn 
'(1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE' 
768.055   6    ?       ? ? ? 
25 non-polymer syn CARDIOLIPIN 1464.043  4    ?       ? ? ? 
26 non-polymer syn 
'(7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE' 
759.068   2    ?       ? ? ? 
27 non-polymer syn 'ZINC ION' 65.409    2    ?       ? ? ? 
28 non-polymer man DECYL-BETA-D-MALTOPYRANOSIDE 482.562   4    ?       ? ? ? 
29 water       nat water 18.015    1588 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'Cytochrome c oxidase polypeptide I'                                                                                            
2  'Cytochrome c oxidase polypeptide II'                                                                                           
3  'Cytochrome c oxidase polypeptide III'                                                                                          
4  'Cytochrome c oxidase subunit IV isoform 1, COX IV-1, Cytochrome c oxidase polypeptide IV'                                      
5  'Cytochrome c oxidase polypeptide Va'                                                                                           
6  'Cytochrome c oxidase polypeptide Vb, Cytochrome c oxidase polypeptide VIa'                                                     
7  'Cytochrome c oxidase polypeptide VIa-heart, COXVIAH, Cytochrome c oxidase polypeptide VIb'                                     
8  'Cytochrome c oxidase subunit VIb isoform 1, COX VIb-1, Cytochrome c oxidase polypeptide VII, Cytochrome c oxidase subunit AED' 
9  'Cytochrome c oxidase polypeptide VIc, Cytochrome c oxidase subunit STA'                                                        
10 'Cytochrome c oxidase polypeptide VIIa-heart, Cytochrome c oxidase subunit VIIa-H, COX VIIa-M, VIIIC'                           
11 'Cytochrome c oxidase polypeptide VIIb, IHQ'                                                                                    
12 'Cytochrome c oxidase polypeptide VIIc, Cytochrome c oxidase polypeptide VIIIA'                                                 
13 'Cytochrome c oxidase subunit 8H, Cytochrome c oxidase polypeptide VIII-heart, Cytochrome c oxidase subunit 8-1, VIIIb, IX'     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no yes 
;(FME)FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIG
GFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVS
SILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFW
FFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPT
GVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHW
FPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAF
ASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
;
;MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGN
WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG
AINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV
FSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF
SGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
;
A,N ? 
2  'polypeptide(L)' no yes 
;(FME)AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILI
ALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSS
EDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
;
;MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPS
LRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVL
HSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
;
B,O ? 
3  'polypeptide(L)' no no  
;MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLR
YGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHML
QALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
;
;MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLR
YGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHML
QALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
;
C,P ? 
4  'polypeptide(L)' no no  
;AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKT
VVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
;
;AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKT
VVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
;
D,Q ? 
5  'polypeptide(L)' no no  
;SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKE
IYPYVIQELRPTLNELGISTPEELGLDKV
;
;SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKE
IYPYVIQELRPTLNELGISTPEELGLDKV
;
E,R ? 
6  'polypeptide(L)' no no  
;ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQ
RCPSCGTHYKLVPHQLAH
;
;ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQ
RCPSCGTHYKLVPHQLAH
;
F,S ? 
7  'polypeptide(L)' no yes 
;ASAAKGDHGG(TPO)GARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVN
PLPTGYEKP
;
;ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPT
GYEKP
;
G,T ? 
8  'polypeptide(L)' no no  
;AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGT
FPGKI
;
;AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGT
FPGKI
;
H,U ? 
9  'polypeptide(L)' no yes '(SAC)TALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK' 
STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK I,V ? 
10 'polypeptide(L)' no no  FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK 
FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK J,W ? 
11 'polypeptide(L)' no no  IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ 
IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ K,X ? 
12 'polypeptide(L)' no no  SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK L,Y ? 
13 'polypeptide(L)' no no  ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA M,Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   FME n 
1  2   PHE n 
1  3   ILE n 
1  4   ASN n 
1  5   ARG n 
1  6   TRP n 
1  7   LEU n 
1  8   PHE n 
1  9   SER n 
1  10  THR n 
1  11  ASN n 
1  12  HIS n 
1  13  LYS n 
1  14  ASP n 
1  15  ILE n 
1  16  GLY n 
1  17  THR n 
1  18  LEU n 
1  19  TYR n 
1  20  LEU n 
1  21  LEU n 
1  22  PHE n 
1  23  GLY n 
1  24  ALA n 
1  25  TRP n 
1  26  ALA n 
1  27  GLY n 
1  28  MET n 
1  29  VAL n 
1  30  GLY n 
1  31  THR n 
1  32  ALA n 
1  33  LEU n 
1  34  SER n 
1  35  LEU n 
1  36  LEU n 
1  37  ILE n 
1  38  ARG n 
1  39  ALA n 
1  40  GLU n 
1  41  LEU n 
1  42  GLY n 
1  43  GLN n 
1  44  PRO n 
1  45  GLY n 
1  46  THR n 
1  47  LEU n 
1  48  LEU n 
1  49  GLY n 
1  50  ASP n 
1  51  ASP n 
1  52  GLN n 
1  53  ILE n 
1  54  TYR n 
1  55  ASN n 
1  56  VAL n 
1  57  VAL n 
1  58  VAL n 
1  59  THR n 
1  60  ALA n 
1  61  HIS n 
1  62  ALA n 
1  63  PHE n 
1  64  VAL n 
1  65  MET n 
1  66  ILE n 
1  67  PHE n 
1  68  PHE n 
1  69  MET n 
1  70  VAL n 
1  71  MET n 
1  72  PRO n 
1  73  ILE n 
1  74  MET n 
1  75  ILE n 
1  76  GLY n 
1  77  GLY n 
1  78  PHE n 
1  79  GLY n 
1  80  ASN n 
1  81  TRP n 
1  82  LEU n 
1  83  VAL n 
1  84  PRO n 
1  85  LEU n 
1  86  MET n 
1  87  ILE n 
1  88  GLY n 
1  89  ALA n 
1  90  PRO n 
1  91  ASP n 
1  92  MET n 
1  93  ALA n 
1  94  PHE n 
1  95  PRO n 
1  96  ARG n 
1  97  MET n 
1  98  ASN n 
1  99  ASN n 
1  100 MET n 
1  101 SER n 
1  102 PHE n 
1  103 TRP n 
1  104 LEU n 
1  105 LEU n 
1  106 PRO n 
1  107 PRO n 
1  108 SER n 
1  109 PHE n 
1  110 LEU n 
1  111 LEU n 
1  112 LEU n 
1  113 LEU n 
1  114 ALA n 
1  115 SER n 
1  116 SER n 
1  117 MET n 
1  118 VAL n 
1  119 GLU n 
1  120 ALA n 
1  121 GLY n 
1  122 ALA n 
1  123 GLY n 
1  124 THR n 
1  125 GLY n 
1  126 TRP n 
1  127 THR n 
1  128 VAL n 
1  129 TYR n 
1  130 PRO n 
1  131 PRO n 
1  132 LEU n 
1  133 ALA n 
1  134 GLY n 
1  135 ASN n 
1  136 LEU n 
1  137 ALA n 
1  138 HIS n 
1  139 ALA n 
1  140 GLY n 
1  141 ALA n 
1  142 SER n 
1  143 VAL n 
1  144 ASP n 
1  145 LEU n 
1  146 THR n 
1  147 ILE n 
1  148 PHE n 
1  149 SER n 
1  150 LEU n 
1  151 HIS n 
1  152 LEU n 
1  153 ALA n 
1  154 GLY n 
1  155 VAL n 
1  156 SER n 
1  157 SER n 
1  158 ILE n 
1  159 LEU n 
1  160 GLY n 
1  161 ALA n 
1  162 ILE n 
1  163 ASN n 
1  164 PHE n 
1  165 ILE n 
1  166 THR n 
1  167 THR n 
1  168 ILE n 
1  169 ILE n 
1  170 ASN n 
1  171 MET n 
1  172 LYS n 
1  173 PRO n 
1  174 PRO n 
1  175 ALA n 
1  176 MET n 
1  177 SER n 
1  178 GLN n 
1  179 TYR n 
1  180 GLN n 
1  181 THR n 
1  182 PRO n 
1  183 LEU n 
1  184 PHE n 
1  185 VAL n 
1  186 TRP n 
1  187 SER n 
1  188 VAL n 
1  189 MET n 
1  190 ILE n 
1  191 THR n 
1  192 ALA n 
1  193 VAL n 
1  194 LEU n 
1  195 LEU n 
1  196 LEU n 
1  197 LEU n 
1  198 SER n 
1  199 LEU n 
1  200 PRO n 
1  201 VAL n 
1  202 LEU n 
1  203 ALA n 
1  204 ALA n 
1  205 GLY n 
1  206 ILE n 
1  207 THR n 
1  208 MET n 
1  209 LEU n 
1  210 LEU n 
1  211 THR n 
1  212 ASP n 
1  213 ARG n 
1  214 ASN n 
1  215 LEU n 
1  216 ASN n 
1  217 THR n 
1  218 THR n 
1  219 PHE n 
1  220 PHE n 
1  221 ASP n 
1  222 PRO n 
1  223 ALA n 
1  224 GLY n 
1  225 GLY n 
1  226 GLY n 
1  227 ASP n 
1  228 PRO n 
1  229 ILE n 
1  230 LEU n 
1  231 TYR n 
1  232 GLN n 
1  233 HIS n 
1  234 LEU n 
1  235 PHE n 
1  236 TRP n 
1  237 PHE n 
1  238 PHE n 
1  239 GLY n 
1  240 HIS n 
1  241 PRO n 
1  242 GLU n 
1  243 VAL n 
1  244 TYR n 
1  245 ILE n 
1  246 LEU n 
1  247 ILE n 
1  248 LEU n 
1  249 PRO n 
1  250 GLY n 
1  251 PHE n 
1  252 GLY n 
1  253 MET n 
1  254 ILE n 
1  255 SER n 
1  256 HIS n 
1  257 ILE n 
1  258 VAL n 
1  259 THR n 
1  260 TYR n 
1  261 TYR n 
1  262 SER n 
1  263 GLY n 
1  264 LYS n 
1  265 LYS n 
1  266 GLU n 
1  267 PRO n 
1  268 PHE n 
1  269 GLY n 
1  270 TYR n 
1  271 MET n 
1  272 GLY n 
1  273 MET n 
1  274 VAL n 
1  275 TRP n 
1  276 ALA n 
1  277 MET n 
1  278 MET n 
1  279 SER n 
1  280 ILE n 
1  281 GLY n 
1  282 PHE n 
1  283 LEU n 
1  284 GLY n 
1  285 PHE n 
1  286 ILE n 
1  287 VAL n 
1  288 TRP n 
1  289 ALA n 
1  290 HIS n 
1  291 HIS n 
1  292 MET n 
1  293 PHE n 
1  294 THR n 
1  295 VAL n 
1  296 GLY n 
1  297 MET n 
1  298 ASP n 
1  299 VAL n 
1  300 ASP n 
1  301 THR n 
1  302 ARG n 
1  303 ALA n 
1  304 TYR n 
1  305 PHE n 
1  306 THR n 
1  307 SER n 
1  308 ALA n 
1  309 THR n 
1  310 MET n 
1  311 ILE n 
1  312 ILE n 
1  313 ALA n 
1  314 ILE n 
1  315 PRO n 
1  316 THR n 
1  317 GLY n 
1  318 VAL n 
1  319 LYS n 
1  320 VAL n 
1  321 PHE n 
1  322 SER n 
1  323 TRP n 
1  324 LEU n 
1  325 ALA n 
1  326 THR n 
1  327 LEU n 
1  328 HIS n 
1  329 GLY n 
1  330 GLY n 
1  331 ASN n 
1  332 ILE n 
1  333 LYS n 
1  334 TRP n 
1  335 SER n 
1  336 PRO n 
1  337 ALA n 
1  338 MET n 
1  339 MET n 
1  340 TRP n 
1  341 ALA n 
1  342 LEU n 
1  343 GLY n 
1  344 PHE n 
1  345 ILE n 
1  346 PHE n 
1  347 LEU n 
1  348 PHE n 
1  349 THR n 
1  350 VAL n 
1  351 GLY n 
1  352 GLY n 
1  353 LEU n 
1  354 THR n 
1  355 GLY n 
1  356 ILE n 
1  357 VAL n 
1  358 LEU n 
1  359 ALA n 
1  360 ASN n 
1  361 SER n 
1  362 SER n 
1  363 LEU n 
1  364 ASP n 
1  365 ILE n 
1  366 VAL n 
1  367 LEU n 
1  368 HIS n 
1  369 ASP n 
1  370 THR n 
1  371 TYR n 
1  372 TYR n 
1  373 VAL n 
1  374 VAL n 
1  375 ALA n 
1  376 HIS n 
1  377 PHE n 
1  378 HIS n 
1  379 TYR n 
1  380 VAL n 
1  381 LEU n 
1  382 SER n 
1  383 MET n 
1  384 GLY n 
1  385 ALA n 
1  386 VAL n 
1  387 PHE n 
1  388 ALA n 
1  389 ILE n 
1  390 MET n 
1  391 GLY n 
1  392 GLY n 
1  393 PHE n 
1  394 VAL n 
1  395 HIS n 
1  396 TRP n 
1  397 PHE n 
1  398 PRO n 
1  399 LEU n 
1  400 PHE n 
1  401 SER n 
1  402 GLY n 
1  403 TYR n 
1  404 THR n 
1  405 LEU n 
1  406 ASN n 
1  407 ASP n 
1  408 THR n 
1  409 TRP n 
1  410 ALA n 
1  411 LYS n 
1  412 ILE n 
1  413 HIS n 
1  414 PHE n 
1  415 ALA n 
1  416 ILE n 
1  417 MET n 
1  418 PHE n 
1  419 VAL n 
1  420 GLY n 
1  421 VAL n 
1  422 ASN n 
1  423 MET n 
1  424 THR n 
1  425 PHE n 
1  426 PHE n 
1  427 PRO n 
1  428 GLN n 
1  429 HIS n 
1  430 PHE n 
1  431 LEU n 
1  432 GLY n 
1  433 LEU n 
1  434 SER n 
1  435 GLY n 
1  436 MET n 
1  437 PRO n 
1  438 ARG n 
1  439 ARG n 
1  440 TYR n 
1  441 SER n 
1  442 ASP n 
1  443 TYR n 
1  444 PRO n 
1  445 ASP n 
1  446 ALA n 
1  447 TYR n 
1  448 THR n 
1  449 MET n 
1  450 TRP n 
1  451 ASN n 
1  452 THR n 
1  453 ILE n 
1  454 SER n 
1  455 SER n 
1  456 MET n 
1  457 GLY n 
1  458 SER n 
1  459 PHE n 
1  460 ILE n 
1  461 SER n 
1  462 LEU n 
1  463 THR n 
1  464 ALA n 
1  465 VAL n 
1  466 MET n 
1  467 LEU n 
1  468 MET n 
1  469 VAL n 
1  470 PHE n 
1  471 ILE n 
1  472 ILE n 
1  473 TRP n 
1  474 GLU n 
1  475 ALA n 
1  476 PHE n 
1  477 ALA n 
1  478 SER n 
1  479 LYS n 
1  480 ARG n 
1  481 GLU n 
1  482 VAL n 
1  483 LEU n 
1  484 THR n 
1  485 VAL n 
1  486 ASP n 
1  487 LEU n 
1  488 THR n 
1  489 THR n 
1  490 THR n 
1  491 ASN n 
1  492 LEU n 
1  493 GLU n 
1  494 TRP n 
1  495 LEU n 
1  496 ASN n 
1  497 GLY n 
1  498 CYS n 
1  499 PRO n 
1  500 PRO n 
1  501 PRO n 
1  502 TYR n 
1  503 HIS n 
1  504 THR n 
1  505 PHE n 
1  506 GLU n 
1  507 GLU n 
1  508 PRO n 
1  509 THR n 
1  510 TYR n 
1  511 VAL n 
1  512 ASN n 
1  513 LEU n 
1  514 LYS n 
2  1   FME n 
2  2   ALA n 
2  3   TYR n 
2  4   PRO n 
2  5   MET n 
2  6   GLN n 
2  7   LEU n 
2  8   GLY n 
2  9   PHE n 
2  10  GLN n 
2  11  ASP n 
2  12  ALA n 
2  13  THR n 
2  14  SER n 
2  15  PRO n 
2  16  ILE n 
2  17  MET n 
2  18  GLU n 
2  19  GLU n 
2  20  LEU n 
2  21  LEU n 
2  22  HIS n 
2  23  PHE n 
2  24  HIS n 
2  25  ASP n 
2  26  HIS n 
2  27  THR n 
2  28  LEU n 
2  29  MET n 
2  30  ILE n 
2  31  VAL n 
2  32  PHE n 
2  33  LEU n 
2  34  ILE n 
2  35  SER n 
2  36  SER n 
2  37  LEU n 
2  38  VAL n 
2  39  LEU n 
2  40  TYR n 
2  41  ILE n 
2  42  ILE n 
2  43  SER n 
2  44  LEU n 
2  45  MET n 
2  46  LEU n 
2  47  THR n 
2  48  THR n 
2  49  LYS n 
2  50  LEU n 
2  51  THR n 
2  52  HIS n 
2  53  THR n 
2  54  SER n 
2  55  THR n 
2  56  MET n 
2  57  ASP n 
2  58  ALA n 
2  59  GLN n 
2  60  GLU n 
2  61  VAL n 
2  62  GLU n 
2  63  THR n 
2  64  ILE n 
2  65  TRP n 
2  66  THR n 
2  67  ILE n 
2  68  LEU n 
2  69  PRO n 
2  70  ALA n 
2  71  ILE n 
2  72  ILE n 
2  73  LEU n 
2  74  ILE n 
2  75  LEU n 
2  76  ILE n 
2  77  ALA n 
2  78  LEU n 
2  79  PRO n 
2  80  SER n 
2  81  LEU n 
2  82  ARG n 
2  83  ILE n 
2  84  LEU n 
2  85  TYR n 
2  86  MET n 
2  87  MET n 
2  88  ASP n 
2  89  GLU n 
2  90  ILE n 
2  91  ASN n 
2  92  ASN n 
2  93  PRO n 
2  94  SER n 
2  95  LEU n 
2  96  THR n 
2  97  VAL n 
2  98  LYS n 
2  99  THR n 
2  100 MET n 
2  101 GLY n 
2  102 HIS n 
2  103 GLN n 
2  104 TRP n 
2  105 TYR n 
2  106 TRP n 
2  107 SER n 
2  108 TYR n 
2  109 GLU n 
2  110 TYR n 
2  111 THR n 
2  112 ASP n 
2  113 TYR n 
2  114 GLU n 
2  115 ASP n 
2  116 LEU n 
2  117 SER n 
2  118 PHE n 
2  119 ASP n 
2  120 SER n 
2  121 TYR n 
2  122 MET n 
2  123 ILE n 
2  124 PRO n 
2  125 THR n 
2  126 SER n 
2  127 GLU n 
2  128 LEU n 
2  129 LYS n 
2  130 PRO n 
2  131 GLY n 
2  132 GLU n 
2  133 LEU n 
2  134 ARG n 
2  135 LEU n 
2  136 LEU n 
2  137 GLU n 
2  138 VAL n 
2  139 ASP n 
2  140 ASN n 
2  141 ARG n 
2  142 VAL n 
2  143 VAL n 
2  144 LEU n 
2  145 PRO n 
2  146 MET n 
2  147 GLU n 
2  148 MET n 
2  149 THR n 
2  150 ILE n 
2  151 ARG n 
2  152 MET n 
2  153 LEU n 
2  154 VAL n 
2  155 SER n 
2  156 SER n 
2  157 GLU n 
2  158 ASP n 
2  159 VAL n 
2  160 LEU n 
2  161 HIS n 
2  162 SER n 
2  163 TRP n 
2  164 ALA n 
2  165 VAL n 
2  166 PRO n 
2  167 SER n 
2  168 LEU n 
2  169 GLY n 
2  170 LEU n 
2  171 LYS n 
2  172 THR n 
2  173 ASP n 
2  174 ALA n 
2  175 ILE n 
2  176 PRO n 
2  177 GLY n 
2  178 ARG n 
2  179 LEU n 
2  180 ASN n 
2  181 GLN n 
2  182 THR n 
2  183 THR n 
2  184 LEU n 
2  185 MET n 
2  186 SER n 
2  187 SER n 
2  188 ARG n 
2  189 PRO n 
2  190 GLY n 
2  191 LEU n 
2  192 TYR n 
2  193 TYR n 
2  194 GLY n 
2  195 GLN n 
2  196 CYS n 
2  197 SER n 
2  198 GLU n 
2  199 ILE n 
2  200 CYS n 
2  201 GLY n 
2  202 SER n 
2  203 ASN n 
2  204 HIS n 
2  205 SER n 
2  206 PHE n 
2  207 MET n 
2  208 PRO n 
2  209 ILE n 
2  210 VAL n 
2  211 LEU n 
2  212 GLU n 
2  213 LEU n 
2  214 VAL n 
2  215 PRO n 
2  216 LEU n 
2  217 LYS n 
2  218 TYR n 
2  219 PHE n 
2  220 GLU n 
2  221 LYS n 
2  222 TRP n 
2  223 SER n 
2  224 ALA n 
2  225 SER n 
2  226 MET n 
2  227 LEU n 
3  1   MET n 
3  2   THR n 
3  3   HIS n 
3  4   GLN n 
3  5   THR n 
3  6   HIS n 
3  7   ALA n 
3  8   TYR n 
3  9   HIS n 
3  10  MET n 
3  11  VAL n 
3  12  ASN n 
3  13  PRO n 
3  14  SER n 
3  15  PRO n 
3  16  TRP n 
3  17  PRO n 
3  18  LEU n 
3  19  THR n 
3  20  GLY n 
3  21  ALA n 
3  22  LEU n 
3  23  SER n 
3  24  ALA n 
3  25  LEU n 
3  26  LEU n 
3  27  MET n 
3  28  THR n 
3  29  SER n 
3  30  GLY n 
3  31  LEU n 
3  32  THR n 
3  33  MET n 
3  34  TRP n 
3  35  PHE n 
3  36  HIS n 
3  37  PHE n 
3  38  ASN n 
3  39  SER n 
3  40  MET n 
3  41  THR n 
3  42  LEU n 
3  43  LEU n 
3  44  MET n 
3  45  ILE n 
3  46  GLY n 
3  47  LEU n 
3  48  THR n 
3  49  THR n 
3  50  ASN n 
3  51  MET n 
3  52  LEU n 
3  53  THR n 
3  54  MET n 
3  55  TYR n 
3  56  GLN n 
3  57  TRP n 
3  58  TRP n 
3  59  ARG n 
3  60  ASP n 
3  61  VAL n 
3  62  ILE n 
3  63  ARG n 
3  64  GLU n 
3  65  SER n 
3  66  THR n 
3  67  PHE n 
3  68  GLN n 
3  69  GLY n 
3  70  HIS n 
3  71  HIS n 
3  72  THR n 
3  73  PRO n 
3  74  ALA n 
3  75  VAL n 
3  76  GLN n 
3  77  LYS n 
3  78  GLY n 
3  79  LEU n 
3  80  ARG n 
3  81  TYR n 
3  82  GLY n 
3  83  MET n 
3  84  ILE n 
3  85  LEU n 
3  86  PHE n 
3  87  ILE n 
3  88  ILE n 
3  89  SER n 
3  90  GLU n 
3  91  VAL n 
3  92  LEU n 
3  93  PHE n 
3  94  PHE n 
3  95  THR n 
3  96  GLY n 
3  97  PHE n 
3  98  PHE n 
3  99  TRP n 
3  100 ALA n 
3  101 PHE n 
3  102 TYR n 
3  103 HIS n 
3  104 SER n 
3  105 SER n 
3  106 LEU n 
3  107 ALA n 
3  108 PRO n 
3  109 THR n 
3  110 PRO n 
3  111 GLU n 
3  112 LEU n 
3  113 GLY n 
3  114 GLY n 
3  115 CYS n 
3  116 TRP n 
3  117 PRO n 
3  118 PRO n 
3  119 THR n 
3  120 GLY n 
3  121 ILE n 
3  122 HIS n 
3  123 PRO n 
3  124 LEU n 
3  125 ASN n 
3  126 PRO n 
3  127 LEU n 
3  128 GLU n 
3  129 VAL n 
3  130 PRO n 
3  131 LEU n 
3  132 LEU n 
3  133 ASN n 
3  134 THR n 
3  135 SER n 
3  136 VAL n 
3  137 LEU n 
3  138 LEU n 
3  139 ALA n 
3  140 SER n 
3  141 GLY n 
3  142 VAL n 
3  143 SER n 
3  144 ILE n 
3  145 THR n 
3  146 TRP n 
3  147 ALA n 
3  148 HIS n 
3  149 HIS n 
3  150 SER n 
3  151 LEU n 
3  152 MET n 
3  153 GLU n 
3  154 GLY n 
3  155 ASP n 
3  156 ARG n 
3  157 LYS n 
3  158 HIS n 
3  159 MET n 
3  160 LEU n 
3  161 GLN n 
3  162 ALA n 
3  163 LEU n 
3  164 PHE n 
3  165 ILE n 
3  166 THR n 
3  167 ILE n 
3  168 THR n 
3  169 LEU n 
3  170 GLY n 
3  171 VAL n 
3  172 TYR n 
3  173 PHE n 
3  174 THR n 
3  175 LEU n 
3  176 LEU n 
3  177 GLN n 
3  178 ALA n 
3  179 SER n 
3  180 GLU n 
3  181 TYR n 
3  182 TYR n 
3  183 GLU n 
3  184 ALA n 
3  185 PRO n 
3  186 PHE n 
3  187 THR n 
3  188 ILE n 
3  189 SER n 
3  190 ASP n 
3  191 GLY n 
3  192 VAL n 
3  193 TYR n 
3  194 GLY n 
3  195 SER n 
3  196 THR n 
3  197 PHE n 
3  198 PHE n 
3  199 VAL n 
3  200 ALA n 
3  201 THR n 
3  202 GLY n 
3  203 PHE n 
3  204 HIS n 
3  205 GLY n 
3  206 LEU n 
3  207 HIS n 
3  208 VAL n 
3  209 ILE n 
3  210 ILE n 
3  211 GLY n 
3  212 SER n 
3  213 THR n 
3  214 PHE n 
3  215 LEU n 
3  216 ILE n 
3  217 VAL n 
3  218 CYS n 
3  219 PHE n 
3  220 PHE n 
3  221 ARG n 
3  222 GLN n 
3  223 LEU n 
3  224 LYS n 
3  225 PHE n 
3  226 HIS n 
3  227 PHE n 
3  228 THR n 
3  229 SER n 
3  230 ASN n 
3  231 HIS n 
3  232 HIS n 
3  233 PHE n 
3  234 GLY n 
3  235 PHE n 
3  236 GLU n 
3  237 ALA n 
3  238 ALA n 
3  239 ALA n 
3  240 TRP n 
3  241 TYR n 
3  242 TRP n 
3  243 HIS n 
3  244 PHE n 
3  245 VAL n 
3  246 ASP n 
3  247 VAL n 
3  248 VAL n 
3  249 TRP n 
3  250 LEU n 
3  251 PHE n 
3  252 LEU n 
3  253 TYR n 
3  254 VAL n 
3  255 SER n 
3  256 ILE n 
3  257 TYR n 
3  258 TRP n 
3  259 TRP n 
3  260 GLY n 
3  261 SER n 
4  1   ALA n 
4  2   HIS n 
4  3   GLY n 
4  4   SER n 
4  5   VAL n 
4  6   VAL n 
4  7   LYS n 
4  8   SER n 
4  9   GLU n 
4  10  ASP n 
4  11  TYR n 
4  12  ALA n 
4  13  LEU n 
4  14  PRO n 
4  15  SER n 
4  16  TYR n 
4  17  VAL n 
4  18  ASP n 
4  19  ARG n 
4  20  ARG n 
4  21  ASP n 
4  22  TYR n 
4  23  PRO n 
4  24  LEU n 
4  25  PRO n 
4  26  ASP n 
4  27  VAL n 
4  28  ALA n 
4  29  HIS n 
4  30  VAL n 
4  31  LYS n 
4  32  ASN n 
4  33  LEU n 
4  34  SER n 
4  35  ALA n 
4  36  SER n 
4  37  GLN n 
4  38  LYS n 
4  39  ALA n 
4  40  LEU n 
4  41  LYS n 
4  42  GLU n 
4  43  LYS n 
4  44  GLU n 
4  45  LYS n 
4  46  ALA n 
4  47  SER n 
4  48  TRP n 
4  49  SER n 
4  50  SER n 
4  51  LEU n 
4  52  SER n 
4  53  ILE n 
4  54  ASP n 
4  55  GLU n 
4  56  LYS n 
4  57  VAL n 
4  58  GLU n 
4  59  LEU n 
4  60  TYR n 
4  61  ARG n 
4  62  LEU n 
4  63  LYS n 
4  64  PHE n 
4  65  LYS n 
4  66  GLU n 
4  67  SER n 
4  68  PHE n 
4  69  ALA n 
4  70  GLU n 
4  71  MET n 
4  72  ASN n 
4  73  ARG n 
4  74  SER n 
4  75  THR n 
4  76  ASN n 
4  77  GLU n 
4  78  TRP n 
4  79  LYS n 
4  80  THR n 
4  81  VAL n 
4  82  VAL n 
4  83  GLY n 
4  84  ALA n 
4  85  ALA n 
4  86  MET n 
4  87  PHE n 
4  88  PHE n 
4  89  ILE n 
4  90  GLY n 
4  91  PHE n 
4  92  THR n 
4  93  ALA n 
4  94  LEU n 
4  95  LEU n 
4  96  LEU n 
4  97  ILE n 
4  98  TRP n 
4  99  GLU n 
4  100 LYS n 
4  101 HIS n 
4  102 TYR n 
4  103 VAL n 
4  104 TYR n 
4  105 GLY n 
4  106 PRO n 
4  107 ILE n 
4  108 PRO n 
4  109 HIS n 
4  110 THR n 
4  111 PHE n 
4  112 GLU n 
4  113 GLU n 
4  114 GLU n 
4  115 TRP n 
4  116 VAL n 
4  117 ALA n 
4  118 LYS n 
4  119 GLN n 
4  120 THR n 
4  121 LYS n 
4  122 ARG n 
4  123 MET n 
4  124 LEU n 
4  125 ASP n 
4  126 MET n 
4  127 LYS n 
4  128 VAL n 
4  129 ALA n 
4  130 PRO n 
4  131 ILE n 
4  132 GLN n 
4  133 GLY n 
4  134 PHE n 
4  135 SER n 
4  136 ALA n 
4  137 LYS n 
4  138 TRP n 
4  139 ASP n 
4  140 TYR n 
4  141 ASP n 
4  142 LYS n 
4  143 ASN n 
4  144 GLU n 
4  145 TRP n 
4  146 LYS n 
4  147 LYS n 
5  1   SER n 
5  2   HIS n 
5  3   GLY n 
5  4   SER n 
5  5   HIS n 
5  6   GLU n 
5  7   THR n 
5  8   ASP n 
5  9   GLU n 
5  10  GLU n 
5  11  PHE n 
5  12  ASP n 
5  13  ALA n 
5  14  ARG n 
5  15  TRP n 
5  16  VAL n 
5  17  THR n 
5  18  TYR n 
5  19  PHE n 
5  20  ASN n 
5  21  LYS n 
5  22  PRO n 
5  23  ASP n 
5  24  ILE n 
5  25  ASP n 
5  26  ALA n 
5  27  TRP n 
5  28  GLU n 
5  29  LEU n 
5  30  ARG n 
5  31  LYS n 
5  32  GLY n 
5  33  MET n 
5  34  ASN n 
5  35  THR n 
5  36  LEU n 
5  37  VAL n 
5  38  GLY n 
5  39  TYR n 
5  40  ASP n 
5  41  LEU n 
5  42  VAL n 
5  43  PRO n 
5  44  GLU n 
5  45  PRO n 
5  46  LYS n 
5  47  ILE n 
5  48  ILE n 
5  49  ASP n 
5  50  ALA n 
5  51  ALA n 
5  52  LEU n 
5  53  ARG n 
5  54  ALA n 
5  55  CYS n 
5  56  ARG n 
5  57  ARG n 
5  58  LEU n 
5  59  ASN n 
5  60  ASP n 
5  61  PHE n 
5  62  ALA n 
5  63  SER n 
5  64  ALA n 
5  65  VAL n 
5  66  ARG n 
5  67  ILE n 
5  68  LEU n 
5  69  GLU n 
5  70  VAL n 
5  71  VAL n 
5  72  LYS n 
5  73  ASP n 
5  74  LYS n 
5  75  ALA n 
5  76  GLY n 
5  77  PRO n 
5  78  HIS n 
5  79  LYS n 
5  80  GLU n 
5  81  ILE n 
5  82  TYR n 
5  83  PRO n 
5  84  TYR n 
5  85  VAL n 
5  86  ILE n 
5  87  GLN n 
5  88  GLU n 
5  89  LEU n 
5  90  ARG n 
5  91  PRO n 
5  92  THR n 
5  93  LEU n 
5  94  ASN n 
5  95  GLU n 
5  96  LEU n 
5  97  GLY n 
5  98  ILE n 
5  99  SER n 
5  100 THR n 
5  101 PRO n 
5  102 GLU n 
5  103 GLU n 
5  104 LEU n 
5  105 GLY n 
5  106 LEU n 
5  107 ASP n 
5  108 LYS n 
5  109 VAL n 
6  1   ALA n 
6  2   SER n 
6  3   GLY n 
6  4   GLY n 
6  5   GLY n 
6  6   VAL n 
6  7   PRO n 
6  8   THR n 
6  9   ASP n 
6  10  GLU n 
6  11  GLU n 
6  12  GLN n 
6  13  ALA n 
6  14  THR n 
6  15  GLY n 
6  16  LEU n 
6  17  GLU n 
6  18  ARG n 
6  19  GLU n 
6  20  VAL n 
6  21  MET n 
6  22  LEU n 
6  23  ALA n 
6  24  ALA n 
6  25  ARG n 
6  26  LYS n 
6  27  GLY n 
6  28  GLN n 
6  29  ASP n 
6  30  PRO n 
6  31  TYR n 
6  32  ASN n 
6  33  ILE n 
6  34  LEU n 
6  35  ALA n 
6  36  PRO n 
6  37  LYS n 
6  38  ALA n 
6  39  THR n 
6  40  SER n 
6  41  GLY n 
6  42  THR n 
6  43  LYS n 
6  44  GLU n 
6  45  ASP n 
6  46  PRO n 
6  47  ASN n 
6  48  LEU n 
6  49  VAL n 
6  50  PRO n 
6  51  SER n 
6  52  ILE n 
6  53  THR n 
6  54  ASN n 
6  55  LYS n 
6  56  ARG n 
6  57  ILE n 
6  58  VAL n 
6  59  GLY n 
6  60  CYS n 
6  61  ILE n 
6  62  CYS n 
6  63  GLU n 
6  64  GLU n 
6  65  ASP n 
6  66  ASN n 
6  67  SER n 
6  68  THR n 
6  69  VAL n 
6  70  ILE n 
6  71  TRP n 
6  72  PHE n 
6  73  TRP n 
6  74  LEU n 
6  75  HIS n 
6  76  LYS n 
6  77  GLY n 
6  78  GLU n 
6  79  ALA n 
6  80  GLN n 
6  81  ARG n 
6  82  CYS n 
6  83  PRO n 
6  84  SER n 
6  85  CYS n 
6  86  GLY n 
6  87  THR n 
6  88  HIS n 
6  89  TYR n 
6  90  LYS n 
6  91  LEU n 
6  92  VAL n 
6  93  PRO n 
6  94  HIS n 
6  95  GLN n 
6  96  LEU n 
6  97  ALA n 
6  98  HIS n 
7  1   ALA n 
7  2   SER n 
7  3   ALA n 
7  4   ALA n 
7  5   LYS n 
7  6   GLY n 
7  7   ASP n 
7  8   HIS n 
7  9   GLY n 
7  10  GLY n 
7  11  TPO n 
7  12  GLY n 
7  13  ALA n 
7  14  ARG n 
7  15  THR n 
7  16  TRP n 
7  17  ARG n 
7  18  PHE n 
7  19  LEU n 
7  20  THR n 
7  21  PHE n 
7  22  GLY n 
7  23  LEU n 
7  24  ALA n 
7  25  LEU n 
7  26  PRO n 
7  27  SER n 
7  28  VAL n 
7  29  ALA n 
7  30  LEU n 
7  31  CYS n 
7  32  THR n 
7  33  LEU n 
7  34  ASN n 
7  35  SER n 
7  36  TRP n 
7  37  LEU n 
7  38  HIS n 
7  39  SER n 
7  40  GLY n 
7  41  HIS n 
7  42  ARG n 
7  43  GLU n 
7  44  ARG n 
7  45  PRO n 
7  46  ALA n 
7  47  PHE n 
7  48  ILE n 
7  49  PRO n 
7  50  TYR n 
7  51  HIS n 
7  52  HIS n 
7  53  LEU n 
7  54  ARG n 
7  55  ILE n 
7  56  ARG n 
7  57  THR n 
7  58  LYS n 
7  59  PRO n 
7  60  PHE n 
7  61  SER n 
7  62  TRP n 
7  63  GLY n 
7  64  ASP n 
7  65  GLY n 
7  66  ASN n 
7  67  HIS n 
7  68  THR n 
7  69  PHE n 
7  70  PHE n 
7  71  HIS n 
7  72  ASN n 
7  73  PRO n 
7  74  ARG n 
7  75  VAL n 
7  76  ASN n 
7  77  PRO n 
7  78  LEU n 
7  79  PRO n 
7  80  THR n 
7  81  GLY n 
7  82  TYR n 
7  83  GLU n 
7  84  LYS n 
7  85  PRO n 
8  1   ALA n 
8  2   GLU n 
8  3   ASP n 
8  4   ILE n 
8  5   GLN n 
8  6   ALA n 
8  7   LYS n 
8  8   ILE n 
8  9   LYS n 
8  10  ASN n 
8  11  TYR n 
8  12  GLN n 
8  13  THR n 
8  14  ALA n 
8  15  PRO n 
8  16  PHE n 
8  17  ASP n 
8  18  SER n 
8  19  ARG n 
8  20  PHE n 
8  21  PRO n 
8  22  ASN n 
8  23  GLN n 
8  24  ASN n 
8  25  GLN n 
8  26  THR n 
8  27  ARG n 
8  28  ASN n 
8  29  CYS n 
8  30  TRP n 
8  31  GLN n 
8  32  ASN n 
8  33  TYR n 
8  34  LEU n 
8  35  ASP n 
8  36  PHE n 
8  37  HIS n 
8  38  ARG n 
8  39  CYS n 
8  40  GLU n 
8  41  LYS n 
8  42  ALA n 
8  43  MET n 
8  44  THR n 
8  45  ALA n 
8  46  LYS n 
8  47  GLY n 
8  48  GLY n 
8  49  ASP n 
8  50  VAL n 
8  51  SER n 
8  52  VAL n 
8  53  CYS n 
8  54  GLU n 
8  55  TRP n 
8  56  TYR n 
8  57  ARG n 
8  58  ARG n 
8  59  VAL n 
8  60  TYR n 
8  61  LYS n 
8  62  SER n 
8  63  LEU n 
8  64  CYS n 
8  65  PRO n 
8  66  ILE n 
8  67  SER n 
8  68  TRP n 
8  69  VAL n 
8  70  SER n 
8  71  THR n 
8  72  TRP n 
8  73  ASP n 
8  74  ASP n 
8  75  ARG n 
8  76  ARG n 
8  77  ALA n 
8  78  GLU n 
8  79  GLY n 
8  80  THR n 
8  81  PHE n 
8  82  PRO n 
8  83  GLY n 
8  84  LYS n 
8  85  ILE n 
9  1   SAC n 
9  2   THR n 
9  3   ALA n 
9  4   LEU n 
9  5   ALA n 
9  6   LYS n 
9  7   PRO n 
9  8   GLN n 
9  9   MET n 
9  10  ARG n 
9  11  GLY n 
9  12  LEU n 
9  13  LEU n 
9  14  ALA n 
9  15  ARG n 
9  16  ARG n 
9  17  LEU n 
9  18  ARG n 
9  19  PHE n 
9  20  HIS n 
9  21  ILE n 
9  22  VAL n 
9  23  GLY n 
9  24  ALA n 
9  25  PHE n 
9  26  MET n 
9  27  VAL n 
9  28  SER n 
9  29  LEU n 
9  30  GLY n 
9  31  PHE n 
9  32  ALA n 
9  33  THR n 
9  34  PHE n 
9  35  TYR n 
9  36  LYS n 
9  37  PHE n 
9  38  ALA n 
9  39  VAL n 
9  40  ALA n 
9  41  GLU n 
9  42  LYS n 
9  43  ARG n 
9  44  LYS n 
9  45  LYS n 
9  46  ALA n 
9  47  TYR n 
9  48  ALA n 
9  49  ASP n 
9  50  PHE n 
9  51  TYR n 
9  52  ARG n 
9  53  ASN n 
9  54  TYR n 
9  55  ASP n 
9  56  SER n 
9  57  MET n 
9  58  LYS n 
9  59  ASP n 
9  60  PHE n 
9  61  GLU n 
9  62  GLU n 
9  63  MET n 
9  64  ARG n 
9  65  LYS n 
9  66  ALA n 
9  67  GLY n 
9  68  ILE n 
9  69  PHE n 
9  70  GLN n 
9  71  SER n 
9  72  ALA n 
9  73  LYS n 
10 1   PHE n 
10 2   GLU n 
10 3   ASN n 
10 4   ARG n 
10 5   VAL n 
10 6   ALA n 
10 7   GLU n 
10 8   LYS n 
10 9   GLN n 
10 10  LYS n 
10 11  LEU n 
10 12  PHE n 
10 13  GLN n 
10 14  GLU n 
10 15  ASP n 
10 16  ASN n 
10 17  GLY n 
10 18  LEU n 
10 19  PRO n 
10 20  VAL n 
10 21  HIS n 
10 22  LEU n 
10 23  LYS n 
10 24  GLY n 
10 25  GLY n 
10 26  ALA n 
10 27  THR n 
10 28  ASP n 
10 29  ASN n 
10 30  ILE n 
10 31  LEU n 
10 32  TYR n 
10 33  ARG n 
10 34  VAL n 
10 35  THR n 
10 36  MET n 
10 37  THR n 
10 38  LEU n 
10 39  CYS n 
10 40  LEU n 
10 41  GLY n 
10 42  GLY n 
10 43  THR n 
10 44  LEU n 
10 45  TYR n 
10 46  SER n 
10 47  LEU n 
10 48  TYR n 
10 49  CYS n 
10 50  LEU n 
10 51  GLY n 
10 52  TRP n 
10 53  ALA n 
10 54  SER n 
10 55  PHE n 
10 56  PRO n 
10 57  HIS n 
10 58  LYS n 
10 59  LYS n 
11 1   ILE n 
11 2   HIS n 
11 3   GLN n 
11 4   LYS n 
11 5   ARG n 
11 6   ALA n 
11 7   PRO n 
11 8   ASP n 
11 9   PHE n 
11 10  HIS n 
11 11  ASP n 
11 12  LYS n 
11 13  TYR n 
11 14  GLY n 
11 15  ASN n 
11 16  ALA n 
11 17  VAL n 
11 18  LEU n 
11 19  ALA n 
11 20  SER n 
11 21  GLY n 
11 22  ALA n 
11 23  THR n 
11 24  PHE n 
11 25  CYS n 
11 26  VAL n 
11 27  ALA n 
11 28  VAL n 
11 29  TRP n 
11 30  VAL n 
11 31  TYR n 
11 32  MET n 
11 33  ALA n 
11 34  THR n 
11 35  GLN n 
11 36  ILE n 
11 37  GLY n 
11 38  ILE n 
11 39  GLU n 
11 40  TRP n 
11 41  ASN n 
11 42  PRO n 
11 43  SER n 
11 44  PRO n 
11 45  VAL n 
11 46  GLY n 
11 47  ARG n 
11 48  VAL n 
11 49  THR n 
11 50  PRO n 
11 51  LYS n 
11 52  GLU n 
11 53  TRP n 
11 54  ARG n 
11 55  GLU n 
11 56  GLN n 
12 1   SER n 
12 2   HIS n 
12 3   TYR n 
12 4   GLU n 
12 5   GLU n 
12 6   GLY n 
12 7   PRO n 
12 8   GLY n 
12 9   LYS n 
12 10  ASN n 
12 11  ILE n 
12 12  PRO n 
12 13  PHE n 
12 14  SER n 
12 15  VAL n 
12 16  GLU n 
12 17  ASN n 
12 18  LYS n 
12 19  TRP n 
12 20  ARG n 
12 21  LEU n 
12 22  LEU n 
12 23  ALA n 
12 24  MET n 
12 25  MET n 
12 26  THR n 
12 27  LEU n 
12 28  PHE n 
12 29  PHE n 
12 30  GLY n 
12 31  SER n 
12 32  GLY n 
12 33  PHE n 
12 34  ALA n 
12 35  ALA n 
12 36  PRO n 
12 37  PHE n 
12 38  PHE n 
12 39  ILE n 
12 40  VAL n 
12 41  ARG n 
12 42  HIS n 
12 43  GLN n 
12 44  LEU n 
12 45  LEU n 
12 46  LYS n 
12 47  LYS n 
13 1   ILE n 
13 2   THR n 
13 3   ALA n 
13 4   LYS n 
13 5   PRO n 
13 6   ALA n 
13 7   LYS n 
13 8   THR n 
13 9   PRO n 
13 10  THR n 
13 11  SER n 
13 12  PRO n 
13 13  LYS n 
13 14  GLU n 
13 15  GLN n 
13 16  ALA n 
13 17  ILE n 
13 18  GLY n 
13 19  LEU n 
13 20  SER n 
13 21  VAL n 
13 22  THR n 
13 23  PHE n 
13 24  LEU n 
13 25  SER n 
13 26  PHE n 
13 27  LEU n 
13 28  LEU n 
13 29  PRO n 
13 30  ALA n 
13 31  GLY n 
13 32  TRP n 
13 33  VAL n 
13 34  LEU n 
13 35  TYR n 
13 36  HIS n 
13 37  LEU n 
13 38  ASP n 
13 39  ASN n 
13 40  TYR n 
13 41  LYS n 
13 42  LYS n 
13 43  SER n 
13 44  SER n 
13 45  ALA n 
13 46  ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? bovine 'Bos taurus' 9913 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP COX1_BOVIN  P00396 1  
;MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGN
WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILG
AINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKV
FSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF
SGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
;
1  ? 
2  UNP COX2_BOVIN  P68530 2  
;MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPS
LRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVL
HSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
;
1  ? 
3  UNP COX3_BOVIN  P00415 3  
;MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLR
YGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHML
QALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
;
1  ? 
4  UNP COX41_BOVIN P00423 4  
;AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKT
VVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
;
23 ? 
5  UNP COX5A_BOVIN P00426 5  
;SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKE
IYPYVIQELRPTLNELGISTPEELGLDKV
;
44 ? 
6  UNP COX5B_BOVIN P00428 6  
;ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQ
RCPSCGTHYKLVPHQLAH
;
32 ? 
7  UNP CX6A2_BOVIN P07471 7  
;ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPT
GYEKP
;
13 ? 
8  UNP CX6B1_BOVIN P00429 8  
;AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGT
FPGKI
;
2  ? 
9  UNP COX6C_BOVIN P04038 9  STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK 2  ? 
10 UNP CX7A1_BOVIN P07470 10 FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK 22 ? 
11 UNP COX7B_BOVIN P13183 11 IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ 25 ? 
12 UNP COX7C_BOVIN P00430 12 SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK 17 ? 
13 UNP COX8B_BOVIN P10175 13 ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA 25 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3AG4 A 1 ? 514 ? P00396 1  ? 514 ? 1 514 
2  2  3AG4 B 1 ? 227 ? P68530 1  ? 227 ? 1 227 
3  3  3AG4 C 1 ? 261 ? P00415 1  ? 261 ? 1 261 
4  4  3AG4 D 1 ? 147 ? P00423 23 ? 169 ? 1 147 
5  5  3AG4 E 1 ? 109 ? P00426 44 ? 152 ? 1 109 
6  6  3AG4 F 1 ? 98  ? P00428 32 ? 129 ? 1 98  
7  7  3AG4 G 1 ? 85  ? P07471 13 ? 97  ? 1 85  
8  8  3AG4 H 1 ? 85  ? P00429 2  ? 86  ? 1 85  
9  9  3AG4 I 1 ? 73  ? P04038 2  ? 74  ? 1 73  
10 10 3AG4 J 1 ? 59  ? P07470 22 ? 80  ? 1 59  
11 11 3AG4 K 1 ? 56  ? P13183 25 ? 80  ? 1 56  
12 12 3AG4 L 1 ? 47  ? P00430 17 ? 63  ? 1 47  
13 13 3AG4 M 1 ? 46  ? P10175 25 ? 70  ? 1 46  
14 1  3AG4 N 1 ? 514 ? P00396 1  ? 514 ? 1 514 
15 2  3AG4 O 1 ? 227 ? P68530 1  ? 227 ? 1 227 
16 3  3AG4 P 1 ? 261 ? P00415 1  ? 261 ? 1 261 
17 4  3AG4 Q 1 ? 147 ? P00423 23 ? 169 ? 1 147 
18 5  3AG4 R 1 ? 109 ? P00426 44 ? 152 ? 1 109 
19 6  3AG4 S 1 ? 98  ? P00428 32 ? 129 ? 1 98  
20 7  3AG4 T 1 ? 85  ? P07471 13 ? 97  ? 1 85  
21 8  3AG4 U 1 ? 85  ? P00429 2  ? 86  ? 1 85  
22 9  3AG4 V 1 ? 73  ? P04038 2  ? 74  ? 1 73  
23 10 3AG4 W 1 ? 59  ? P07470 22 ? 80  ? 1 59  
24 11 3AG4 X 1 ? 56  ? P13183 25 ? 80  ? 1 56  
25 12 3AG4 Y 1 ? 47  ? P00430 17 ? 63  ? 1 47  
26 13 3AG4 Z 1 ? 46  ? P10175 25 ? 70  ? 1 46  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                                                                                       
'C3 H7 N O2'         89.093   
ARG 'L-peptide linking' y ARGININE ?                                                                                       
'C6 H15 N4 O2 1'     175.209  
ASN 'L-peptide linking' y ASPARAGINE ?                                                                                       
'C4 H8 N2 O3'        132.118  
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                                                                       
'C4 H7 N O4'         133.103  
CDL non-polymer         . CARDIOLIPIN 
;DIPHOSPHATIDYL GLYCEROL; BIS-(1,2-DIACYL-SN-GLYCERO-3-PHOSPHO)-1',3'-SN-GLYCEROL
;
'C81 H156 O17 P2 -2' 1464.043 
CHD non-polymer         . 'CHOLIC ACID' ?                                                                                       
'C24 H40 O5'         408.571  
CU  non-polymer         . 'COPPER (II) ION' ? 'Cu 2'               63.546   
CUA non-polymer         . 'DINUCLEAR COPPER ION' ? Cu2                  127.092  
CYN non-polymer         . 'CYANIDE ION' ?                                                                                       
'C N -1'             26.017   
CYS 'L-peptide linking' y CYSTEINE ?                                                                                       
'C3 H7 N O2 S'       121.158  
DMU D-saccharide        . DECYL-BETA-D-MALTOPYRANOSIDE DECYLMALTOSIDE 'C22 H42 O11'        482.562  
FME 'L-peptide linking' n N-FORMYLMETHIONINE ? 'C6 H11 N O3 S'      177.221  
GLN 'L-peptide linking' y GLUTAMINE ?                                                                                       
'C5 H10 N2 O3'       146.144  
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                                                                       
'C5 H9 N O4'         147.129  
GLY 'peptide linking'   y GLYCINE ?                                                                                       
'C2 H5 N O2'         75.067   
HEA non-polymer         . HEME-A ?                                                                                       
'C49 H56 Fe N4 O6'   852.837  
HIS 'L-peptide linking' y HISTIDINE ?                                                                                       
'C6 H10 N3 O2 1'     156.162  
HOH non-polymer         . WATER ?                                                                                       'H2 O' 
18.015   
ILE 'L-peptide linking' y ISOLEUCINE ?                                                                                       
'C6 H13 N O2'        131.173  
LEU 'L-peptide linking' y LEUCINE ?                                                                                       
'C6 H13 N O2'        131.173  
LYS 'L-peptide linking' y LYSINE ?                                                                                       
'C6 H15 N2 O2 1'     147.195  
MET 'L-peptide linking' y METHIONINE ?                                                                                       
'C5 H11 N O2 S'      149.211  
MG  non-polymer         . 'MAGNESIUM ION' ?                                                                                       
'Mg 2'               24.305   
NA  non-polymer         . 'SODIUM ION' ?                                                                                       
'Na 1'               22.990   
PEK non-polymer         . 
'(1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE' 
'PHOSPHATIDYLETHANOLAMINE, 2-ARACHIDONOYL-1-STEAROYL-SN-GLYCEROL-3-PHOSPHOETHANOLAMINE' 'C43 H78 N O8 P'     768.055  
PGV non-polymer         . 
'(1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE' 
'PHOSPHATIDYLGLYCEROL, 2-VACCENOYL-1-PALMITOYL-SN-GLYCEROL-3-PHOSPHOGLYCEROL'           'C40 H77 O10 P'      749.007  
PHE 'L-peptide linking' y PHENYLALANINE ?                                                                                       
'C9 H11 N O2'        165.189  
PRO 'L-peptide linking' y PROLINE ?                                                                                       
'C5 H9 N O2'         115.130  
PSC non-polymer         . 
'(7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE' 
'PHOSPHATIDYLCHOLINE, 2-LINOLEOYL-1-PALMITOYL-SN-GYCEROL-3-PHOSPHOCHOLINE'              'C42 H81 N O8 P 1'   759.068  
SAC 'L-peptide linking' n N-ACETYL-SERINE ?                                                                                       
'C5 H9 N O4'         147.129  
SER 'L-peptide linking' y SERINE ?                                                                                       
'C3 H7 N O3'         105.093  
TGL non-polymer         . TRISTEAROYLGLYCEROL TRIACYLGLYCEROL 'C57 H110 O6'        891.480  
THR 'L-peptide linking' y THREONINE ?                                                                                       
'C4 H9 N O3'         119.119  
TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE                                                                      
'C4 H10 N O6 P'      199.099  
TRP 'L-peptide linking' y TRYPTOPHAN ?                                                                                       
'C11 H12 N2 O2'      204.225  
TYR 'L-peptide linking' y TYROSINE ?                                                                                       
'C9 H11 N O3'        181.189  
UNX non-polymer         . 'UNKNOWN ATOM OR ION' ? ?                    ?        
VAL 'L-peptide linking' y VALINE ?                                                                                       
'C5 H11 N O2'        117.146  
ZN  non-polymer         . 'ZINC ION' ?                                                                                       
'Zn 2'               65.409   
# 
_exptl.entry_id          3AG4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   5 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.11 
_exptl_crystal.density_percent_sol   70.10 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2002-07-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL44XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
# 
_reflns.entry_id                     3AG4 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             52.6 
_reflns.d_resolution_high            2.05 
_reflns.number_obs                   430029 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3AG4 
_refine.ls_number_reflns_obs                     398409 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.186 
_refine.ls_R_factor_R_free                       0.219 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2EIJ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28506 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2230 
_refine_hist.number_atoms_solvent             1588 
_refine_hist.number_atoms_total               32324 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        40 
# 
_struct.entry_id                  3AG4 
_struct.title                     'Bovine Heart Cytochrome c Oxidase in the Cyanide Ion-bound Fully Reduced State at 100 K' 
_struct.pdbx_descriptor           
;Cytochrome c oxidase subunit 1 (E.C.1.9.3.1), Cytochrome c oxidase subunit 2 (E.C.1.9.3.1), Cytochrome c oxidase subunit 3 (E.C.1.9.3.1), Cytochrome c oxidase subunit 4 isoform 1 (E.C.1.9.3.1), Cytochrome c oxidase subunit 5A (E.C.1.9.3.1), Cytochrome c oxidase subunit 5B (E.C.1.9.3.1), Cytochrome c oxidase subunit 6A2 (E.C.1.9.3.1), Cytochrome c oxidase subunit 6B1 (E.C.1.9.3.1), Cytochrome c oxidase subunit 6C (E.C.1.9.3.1), Cytochrome c oxidase polypeptide 7A1 (E.C.1.9.3.1), Cytochrome c oxidase subunit 7B (E.C.1.9.3.1), Cytochrome c oxidase subunit 7C (E.C.1.9.3.1), Cytochrome c oxidase subunit 8B (E.C.1.9.3.1)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3AG4 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;OXIDOREDUCTASE, Copper, Electron transport, Formylation, Heme, Iron, Membrane, Mitochondrion, Mitochondrion inner membrane, Respiratory chain, Transmembrane, Transport, Acetylation, Transit peptide, Zinc, Isopeptide bond, Ubl conjugation
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 1  ? 
O  N N 2  ? 
P  N N 3  ? 
Q  N N 4  ? 
R  N N 5  ? 
S  N N 6  ? 
T  N N 7  ? 
U  N N 8  ? 
V  N N 9  ? 
W  N N 10 ? 
X  N N 11 ? 
Y  N N 12 ? 
Z  N N 13 ? 
AA N N 14 ? 
BA N N 14 ? 
CA N N 15 ? 
DA N N 16 ? 
EA N N 17 ? 
FA N N 18 ? 
GA N N 19 ? 
HA N N 20 ? 
IA N N 20 ? 
JA N N 21 ? 
KA N N 22 ? 
LA N N 23 ? 
MA N N 22 ? 
NA N N 24 ? 
OA N N 20 ? 
PA N N 20 ? 
QA N N 25 ? 
RA N N 22 ? 
SA N N 19 ? 
TA N N 26 ? 
UA N N 27 ? 
VA N N 24 ? 
WA N N 25 ? 
XA N N 28 ? 
YA N N 24 ? 
ZA N N 22 ? 
AB N N 19 ? 
BB N N 28 ? 
CB N N 14 ? 
DB N N 14 ? 
EB N N 15 ? 
FB N N 16 ? 
GB N N 17 ? 
HB N N 18 ? 
IB N N 19 ? 
JB N N 19 ? 
KB N N 20 ? 
LB N N 20 ? 
MB N N 21 ? 
NB N N 22 ? 
OB N N 23 ? 
PB N N 22 ? 
QB N N 20 ? 
RB N N 20 ? 
SB N N 25 ? 
TB N N 22 ? 
UB N N 28 ? 
VB N N 19 ? 
WB N N 26 ? 
XB N N 27 ? 
YB N N 24 ? 
ZB N N 24 ? 
AC N N 24 ? 
BC N N 25 ? 
CC N N 22 ? 
DC N N 28 ? 
EC N N 29 ? 
FC N N 29 ? 
GC N N 29 ? 
HC N N 29 ? 
IC N N 29 ? 
JC N N 29 ? 
KC N N 29 ? 
LC N N 29 ? 
MC N N 29 ? 
NC N N 29 ? 
OC N N 29 ? 
PC N N 29 ? 
QC N N 29 ? 
RC N N 29 ? 
SC N N 29 ? 
TC N N 29 ? 
UC N N 29 ? 
VC N N 29 ? 
WC N N 29 ? 
XC N N 29 ? 
YC N N 29 ? 
ZC N N 29 ? 
AD N N 29 ? 
BD N N 29 ? 
CD N N 29 ? 
DD N N 29 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   FME A 1   ? LEU A 7   ? FME A 1   LEU A 7   1 ? 7  
HELX_P HELX_P2   2   ASN A 11  ? LEU A 41  ? ASN A 11  LEU A 41  1 ? 31 
HELX_P HELX_P3   3   ASP A 50  ? PHE A 68  ? ASP A 50  PHE A 68  1 ? 19 
HELX_P HELX_P4   4   MET A 69  ? ILE A 75  ? MET A 69  ILE A 75  1 ? 7  
HELX_P HELX_P5   5   GLY A 77  ? ILE A 87  ? GLY A 77  ILE A 87  1 ? 11 
HELX_P HELX_P6   6   ARG A 96  ? LEU A 104 ? ARG A 96  LEU A 104 1 ? 9  
HELX_P HELX_P7   7   LEU A 104 ? VAL A 118 ? LEU A 104 VAL A 118 1 ? 15 
HELX_P HELX_P8   8   ALA A 141 ? MET A 171 ? ALA A 141 MET A 171 1 ? 31 
HELX_P HELX_P9   9   SER A 177 ? THR A 181 ? SER A 177 THR A 181 5 ? 5  
HELX_P HELX_P10  10  PRO A 182 ? LEU A 215 ? PRO A 182 LEU A 215 1 ? 34 
HELX_P HELX_P11  11  ASP A 221 ? GLY A 225 ? ASP A 221 GLY A 225 5 ? 5  
HELX_P HELX_P12  12  ASP A 227 ? SER A 262 ? ASP A 227 SER A 262 1 ? 36 
HELX_P HELX_P13  13  GLY A 269 ? GLY A 284 ? GLY A 269 GLY A 284 1 ? 16 
HELX_P HELX_P14  14  PHE A 285 ? ILE A 286 ? PHE A 285 ILE A 286 5 ? 2  
HELX_P HELX_P15  15  VAL A 287 ? MET A 292 ? VAL A 287 MET A 292 5 ? 6  
HELX_P HELX_P16  16  ASP A 298 ? HIS A 328 ? ASP A 298 HIS A 328 1 ? 31 
HELX_P HELX_P17  17  SER A 335 ? ASN A 360 ? SER A 335 ASN A 360 1 ? 26 
HELX_P HELX_P18  18  ASN A 360 ? HIS A 368 ? ASN A 360 HIS A 368 1 ? 9  
HELX_P HELX_P19  19  THR A 370 ? LEU A 381 ? THR A 370 LEU A 381 1 ? 12 
HELX_P HELX_P20  20  LEU A 381 ? GLY A 402 ? LEU A 381 GLY A 402 1 ? 22 
HELX_P HELX_P21  21  ASN A 406 ? SER A 434 ? ASN A 406 SER A 434 1 ? 29 
HELX_P HELX_P22  22  PRO A 444 ? ALA A 446 ? PRO A 444 ALA A 446 5 ? 3  
HELX_P HELX_P23  23  TYR A 447 ? LYS A 479 ? TYR A 447 LYS A 479 1 ? 33 
HELX_P HELX_P24  24  LEU A 487 ? LEU A 495 ? LEU A 487 LEU A 495 5 ? 9  
HELX_P HELX_P25  25  SER B 14  ? LEU B 46  ? SER B 14  LEU B 46  1 ? 33 
HELX_P HELX_P26  26  GLU B 60  ? GLU B 89  ? GLU B 60  GLU B 89  1 ? 30 
HELX_P HELX_P27  27  PRO B 124 ? LEU B 128 ? PRO B 124 LEU B 128 5 ? 5  
HELX_P HELX_P28  28  PRO B 166 ? GLY B 169 ? PRO B 166 GLY B 169 5 ? 4  
HELX_P HELX_P29  29  ASN B 203 ? PHE B 206 ? ASN B 203 PHE B 206 5 ? 4  
HELX_P HELX_P30  30  PRO B 215 ? MET B 226 ? PRO B 215 MET B 226 1 ? 12 
HELX_P HELX_P31  31  PRO C 15  ? PHE C 37  ? PRO C 15  PHE C 37  1 ? 23 
HELX_P HELX_P32  32  MET C 40  ? THR C 66  ? MET C 40  THR C 66  1 ? 27 
HELX_P HELX_P33  33  THR C 72  ? ALA C 107 ? THR C 72  ALA C 107 1 ? 36 
HELX_P HELX_P34  34  THR C 109 ? GLY C 113 ? THR C 109 GLY C 113 5 ? 5  
HELX_P HELX_P35  35  GLU C 128 ? GLU C 153 ? GLU C 128 GLU C 153 1 ? 26 
HELX_P HELX_P36  36  ASP C 155 ? ALA C 184 ? ASP C 155 ALA C 184 1 ? 30 
HELX_P HELX_P37  37  ASP C 190 ? LYS C 224 ? ASP C 190 LYS C 224 1 ? 35 
HELX_P HELX_P38  38  HIS C 232 ? ILE C 256 ? HIS C 232 ILE C 256 1 ? 25 
HELX_P HELX_P39  39  LYS D 7   ? TYR D 11  ? LYS D 7   TYR D 11  5 ? 5  
HELX_P HELX_P40  40  SER D 34  ? LYS D 45  ? SER D 34  LYS D 45  1 ? 12 
HELX_P HELX_P41  41  ALA D 46  ? LEU D 51  ? ALA D 46  LEU D 51  5 ? 6  
HELX_P HELX_P42  42  SER D 52  ? PHE D 64  ? SER D 52  PHE D 64  1 ? 13 
HELX_P HELX_P43  43  SER D 67  ? ASN D 72  ? SER D 67  ASN D 72  1 ? 6  
HELX_P HELX_P44  44  ASN D 76  ? VAL D 103 ? ASN D 76  VAL D 103 1 ? 28 
HELX_P HELX_P45  45  PRO D 108 ? PHE D 111 ? PRO D 108 PHE D 111 5 ? 4  
HELX_P HELX_P46  46  GLU D 112 ? MET D 126 ? GLU D 112 MET D 126 1 ? 15 
HELX_P HELX_P47  47  PHE D 134 ? ALA D 136 ? PHE D 134 ALA D 136 5 ? 3  
HELX_P HELX_P48  48  THR E 7   ? LYS E 21  ? THR E 7   LYS E 21  1 ? 15 
HELX_P HELX_P49  49  ASP E 25  ? VAL E 37  ? ASP E 25  VAL E 37  1 ? 13 
HELX_P HELX_P50  50  GLU E 44  ? LEU E 58  ? GLU E 44  LEU E 58  1 ? 15 
HELX_P HELX_P51  51  ASP E 60  ? ALA E 75  ? ASP E 60  ALA E 75  1 ? 16 
HELX_P HELX_P52  52  GLU E 80  ? GLY E 97  ? GLU E 80  GLY E 97  1 ? 18 
HELX_P HELX_P53  53  THR F 8   ? ALA F 13  ? THR F 8   ALA F 13  1 ? 6  
HELX_P HELX_P54  54  THR F 14  ? LYS F 26  ? THR F 14  LYS F 26  1 ? 13 
HELX_P HELX_P55  55  GLY G 12  ? LEU G 23  ? GLY G 12  LEU G 23  1 ? 12 
HELX_P HELX_P56  56  LEU G 23  ? SER G 39  ? LEU G 23  SER G 39  1 ? 17 
HELX_P HELX_P57  57  GLN H 25  ? GLY H 47  ? GLN H 25  GLY H 47  1 ? 23 
HELX_P HELX_P58  58  ASP H 49  ? VAL H 52  ? ASP H 49  VAL H 52  5 ? 4  
HELX_P HELX_P59  59  CYS H 53  ? CYS H 64  ? CYS H 53  CYS H 64  1 ? 12 
HELX_P HELX_P60  60  PRO H 65  ? GLY H 79  ? PRO H 65  GLY H 79  1 ? 15 
HELX_P HELX_P61  61  GLY I 11  ? VAL I 39  ? GLY I 11  VAL I 39  1 ? 29 
HELX_P HELX_P62  62  VAL I 39  ? ASN I 53  ? VAL I 39  ASN I 53  1 ? 15 
HELX_P HELX_P63  63  ASP I 55  ? GLY I 67  ? ASP I 55  GLY I 67  1 ? 13 
HELX_P HELX_P64  64  ARG J 4   ? GLU J 14  ? ARG J 4   GLU J 14  1 ? 11 
HELX_P HELX_P65  65  PRO J 19  ? LYS J 23  ? PRO J 19  LYS J 23  5 ? 5  
HELX_P HELX_P66  66  GLY J 25  ? SER J 54  ? GLY J 25  SER J 54  1 ? 30 
HELX_P HELX_P67  67  ASP K 8   ? GLN K 35  ? ASP K 8   GLN K 35  1 ? 28 
HELX_P HELX_P68  68  ASN L 17  ? LYS L 47  ? ASN L 17  LYS L 47  1 ? 31 
HELX_P HELX_P69  69  SER M 11  ? HIS M 36  ? SER M 11  HIS M 36  1 ? 26 
HELX_P HELX_P70  70  HIS M 36  ? LYS M 42  ? HIS M 36  LYS M 42  1 ? 7  
HELX_P HELX_P71  71  FME N 1   ? LEU N 7   ? FME N 1   LEU N 7   1 ? 7  
HELX_P HELX_P72  72  ASN N 11  ? GLY N 42  ? ASN N 11  GLY N 42  1 ? 32 
HELX_P HELX_P73  73  ASP N 50  ? PHE N 68  ? ASP N 50  PHE N 68  1 ? 19 
HELX_P HELX_P74  74  MET N 69  ? ILE N 75  ? MET N 69  ILE N 75  1 ? 7  
HELX_P HELX_P75  75  GLY N 77  ? ILE N 87  ? GLY N 77  ILE N 87  1 ? 11 
HELX_P HELX_P76  76  ARG N 96  ? LEU N 104 ? ARG N 96  LEU N 104 1 ? 9  
HELX_P HELX_P77  77  LEU N 104 ? VAL N 118 ? LEU N 104 VAL N 118 1 ? 15 
HELX_P HELX_P78  78  ALA N 141 ? MET N 171 ? ALA N 141 MET N 171 1 ? 31 
HELX_P HELX_P79  79  SER N 177 ? THR N 181 ? SER N 177 THR N 181 5 ? 5  
HELX_P HELX_P80  80  PRO N 182 ? LEU N 215 ? PRO N 182 LEU N 215 1 ? 34 
HELX_P HELX_P81  81  ASP N 221 ? GLY N 225 ? ASP N 221 GLY N 225 5 ? 5  
HELX_P HELX_P82  82  ASP N 227 ? SER N 262 ? ASP N 227 SER N 262 1 ? 36 
HELX_P HELX_P83  83  GLY N 269 ? GLY N 284 ? GLY N 269 GLY N 284 1 ? 16 
HELX_P HELX_P84  84  PHE N 285 ? ILE N 286 ? PHE N 285 ILE N 286 5 ? 2  
HELX_P HELX_P85  85  VAL N 287 ? MET N 292 ? VAL N 287 MET N 292 5 ? 6  
HELX_P HELX_P86  86  ASP N 298 ? ILE N 312 ? ASP N 298 ILE N 312 1 ? 15 
HELX_P HELX_P87  87  ILE N 312 ? HIS N 328 ? ILE N 312 HIS N 328 1 ? 17 
HELX_P HELX_P88  88  SER N 335 ? ASN N 360 ? SER N 335 ASN N 360 1 ? 26 
HELX_P HELX_P89  89  ASN N 360 ? HIS N 368 ? ASN N 360 HIS N 368 1 ? 9  
HELX_P HELX_P90  90  THR N 370 ? LEU N 381 ? THR N 370 LEU N 381 1 ? 12 
HELX_P HELX_P91  91  LEU N 381 ? GLY N 402 ? LEU N 381 GLY N 402 1 ? 22 
HELX_P HELX_P92  92  ASN N 406 ? PHE N 426 ? ASN N 406 PHE N 426 1 ? 21 
HELX_P HELX_P93  93  PRO N 427 ? SER N 434 ? PRO N 427 SER N 434 1 ? 8  
HELX_P HELX_P94  94  PRO N 444 ? ALA N 446 ? PRO N 444 ALA N 446 5 ? 3  
HELX_P HELX_P95  95  TYR N 447 ? LYS N 479 ? TYR N 447 LYS N 479 1 ? 33 
HELX_P HELX_P96  96  LEU N 487 ? LEU N 495 ? LEU N 487 LEU N 495 5 ? 9  
HELX_P HELX_P97  97  SER O 14  ? THR O 47  ? SER O 14  THR O 47  1 ? 34 
HELX_P HELX_P98  98  GLU O 60  ? GLU O 89  ? GLU O 60  GLU O 89  1 ? 30 
HELX_P HELX_P99  99  PRO O 124 ? LEU O 128 ? PRO O 124 LEU O 128 5 ? 5  
HELX_P HELX_P100 100 PRO O 166 ? GLY O 169 ? PRO O 166 GLY O 169 5 ? 4  
HELX_P HELX_P101 101 ASN O 203 ? MET O 207 ? ASN O 203 MET O 207 5 ? 5  
HELX_P HELX_P102 102 PRO O 215 ? MET O 226 ? PRO O 215 MET O 226 1 ? 12 
HELX_P HELX_P103 103 PRO P 15  ? PHE P 37  ? PRO P 15  PHE P 37  1 ? 23 
HELX_P HELX_P104 104 MET P 40  ? THR P 66  ? MET P 40  THR P 66  1 ? 27 
HELX_P HELX_P105 105 THR P 72  ? ALA P 107 ? THR P 72  ALA P 107 1 ? 36 
HELX_P HELX_P106 106 THR P 109 ? GLY P 113 ? THR P 109 GLY P 113 5 ? 5  
HELX_P HELX_P107 107 GLU P 128 ? GLU P 153 ? GLU P 128 GLU P 153 1 ? 26 
HELX_P HELX_P108 108 ASP P 155 ? ALA P 184 ? ASP P 155 ALA P 184 1 ? 30 
HELX_P HELX_P109 109 ASP P 190 ? LYS P 224 ? ASP P 190 LYS P 224 1 ? 35 
HELX_P HELX_P110 110 HIS P 232 ? ILE P 256 ? HIS P 232 ILE P 256 1 ? 25 
HELX_P HELX_P111 111 LYS Q 7   ? TYR Q 11  ? LYS Q 7   TYR Q 11  5 ? 5  
HELX_P HELX_P112 112 SER Q 34  ? GLU Q 44  ? SER Q 34  GLU Q 44  1 ? 11 
HELX_P HELX_P113 113 LYS Q 45  ? ALA Q 46  ? LYS Q 45  ALA Q 46  5 ? 2  
HELX_P HELX_P114 114 SER Q 47  ? LEU Q 51  ? SER Q 47  LEU Q 51  5 ? 5  
HELX_P HELX_P115 115 SER Q 52  ? PHE Q 64  ? SER Q 52  PHE Q 64  1 ? 13 
HELX_P HELX_P116 116 SER Q 67  ? ASN Q 72  ? SER Q 67  ASN Q 72  1 ? 6  
HELX_P HELX_P117 117 ASN Q 76  ? VAL Q 103 ? ASN Q 76  VAL Q 103 1 ? 28 
HELX_P HELX_P118 118 PRO Q 108 ? PHE Q 111 ? PRO Q 108 PHE Q 111 5 ? 4  
HELX_P HELX_P119 119 GLU Q 112 ? MET Q 126 ? GLU Q 112 MET Q 126 1 ? 15 
HELX_P HELX_P120 120 PHE Q 134 ? ALA Q 136 ? PHE Q 134 ALA Q 136 5 ? 3  
HELX_P HELX_P121 121 THR R 7   ? LYS R 21  ? THR R 7   LYS R 21  1 ? 15 
HELX_P HELX_P122 122 ASP R 25  ? VAL R 37  ? ASP R 25  VAL R 37  1 ? 13 
HELX_P HELX_P123 123 GLU R 44  ? LEU R 58  ? GLU R 44  LEU R 58  1 ? 15 
HELX_P HELX_P124 124 ASP R 60  ? ALA R 75  ? ASP R 60  ALA R 75  1 ? 16 
HELX_P HELX_P125 125 GLU R 80  ? GLY R 97  ? GLU R 80  GLY R 97  1 ? 18 
HELX_P HELX_P126 126 THR S 8   ? ALA S 13  ? THR S 8   ALA S 13  1 ? 6  
HELX_P HELX_P127 127 THR S 14  ? LYS S 26  ? THR S 14  LYS S 26  1 ? 13 
HELX_P HELX_P128 128 GLY T 12  ? LEU T 23  ? GLY T 12  LEU T 23  1 ? 12 
HELX_P HELX_P129 129 LEU T 23  ? TRP T 36  ? LEU T 23  TRP T 36  1 ? 14 
HELX_P HELX_P130 130 GLN U 25  ? GLY U 47  ? GLN U 25  GLY U 47  1 ? 23 
HELX_P HELX_P131 131 ASP U 49  ? VAL U 52  ? ASP U 49  VAL U 52  5 ? 4  
HELX_P HELX_P132 132 CYS U 53  ? CYS U 64  ? CYS U 53  CYS U 64  1 ? 12 
HELX_P HELX_P133 133 PRO U 65  ? GLY U 79  ? PRO U 65  GLY U 79  1 ? 15 
HELX_P HELX_P134 134 GLY V 11  ? VAL V 39  ? GLY V 11  VAL V 39  1 ? 29 
HELX_P HELX_P135 135 VAL V 39  ? ASN V 53  ? VAL V 39  ASN V 53  1 ? 15 
HELX_P HELX_P136 136 ASP V 55  ? ALA V 66  ? ASP V 55  ALA V 66  1 ? 12 
HELX_P HELX_P137 137 ARG W 4   ? GLU W 14  ? ARG W 4   GLU W 14  1 ? 11 
HELX_P HELX_P138 138 PRO W 19  ? LYS W 23  ? PRO W 19  LYS W 23  5 ? 5  
HELX_P HELX_P139 139 GLY W 25  ? SER W 54  ? GLY W 25  SER W 54  1 ? 30 
HELX_P HELX_P140 140 ASP X 8   ? ILE X 36  ? ASP X 8   ILE X 36  1 ? 29 
HELX_P HELX_P141 141 ASN Y 17  ? LYS Y 47  ? ASN Y 17  LYS Y 47  1 ? 31 
HELX_P HELX_P142 142 SER Z 11  ? HIS Z 36  ? SER Z 11  HIS Z 36  1 ? 26 
HELX_P HELX_P143 143 HIS Z 36  ? LYS Z 42  ? HIS Z 36  LYS Z 42  1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? H  CYS 29  SG  ? ? ? 1_555 H  CYS 64  SG  ? ? H CYS 29  H CYS 64   1_555 ? ? ? ? ? ? ? 2.120 ? 
disulf2  disulf ? ? H  CYS 39  SG  ? ? ? 1_555 H  CYS 53  SG  ? ? H CYS 39  H CYS 53   1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf3  disulf ? ? U  CYS 29  SG  ? ? ? 1_555 U  CYS 64  SG  ? ? U CYS 29  U CYS 64   1_555 ? ? ? ? ? ? ? 2.126 ? 
disulf4  disulf ? ? U  CYS 39  SG  ? ? ? 1_555 U  CYS 53  SG  ? ? U CYS 39  U CYS 53   1_555 ? ? ? ? ? ? ? 2.046 ? 
covale1  covale ? ? A  HIS 240 NE2 ? ? ? 1_555 A  TYR 244 CE2 ? ? A HIS 240 A TYR 244  1_555 ? ? ? ? ? ? ? 1.367 ? 
covale2  covale ? ? N  HIS 240 NE2 ? ? ? 1_555 N  TYR 244 CE2 ? ? N HIS 240 N TYR 244  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale3  covale ? ? A  FME 1   C   ? ? ? 1_555 A  PHE 2   N   ? ? A FME 1   A PHE 2    1_555 ? ? ? ? ? ? ? 1.327 ? 
covale4  covale ? ? B  FME 1   C   ? ? ? 1_555 B  ALA 2   N   ? ? B FME 1   B ALA 2    1_555 ? ? ? ? ? ? ? 1.324 ? 
covale5  covale ? ? G  GLY 10  C   ? ? ? 1_555 G  TPO 11  N   ? ? G GLY 10  G TPO 11   1_555 ? ? ? ? ? ? ? 1.339 ? 
covale6  covale ? ? G  TPO 11  C   ? ? ? 1_555 G  GLY 12  N   ? ? G TPO 11  G GLY 12   1_555 ? ? ? ? ? ? ? 1.367 ? 
covale7  covale ? ? I  SAC 1   C   ? ? ? 1_555 I  THR 2   N   ? ? I SAC 1   I THR 2    1_555 ? ? ? ? ? ? ? 1.320 ? 
covale8  covale ? ? N  FME 1   C   ? ? ? 1_555 N  PHE 2   N   ? ? N FME 1   N PHE 2    1_555 ? ? ? ? ? ? ? 1.330 ? 
covale9  covale ? ? O  FME 1   C   ? ? ? 1_555 O  ALA 2   N   ? ? O FME 1   O ALA 2    1_555 ? ? ? ? ? ? ? 1.319 ? 
covale10 covale ? ? T  GLY 10  C   ? ? ? 1_555 T  TPO 11  N   ? ? T GLY 10  T TPO 11   1_555 ? ? ? ? ? ? ? 1.345 ? 
covale11 covale ? ? T  TPO 11  C   ? ? ? 1_555 T  GLY 12  N   ? ? T TPO 11  T GLY 12   1_555 ? ? ? ? ? ? ? 1.371 ? 
covale12 covale ? ? V  SAC 1   C   ? ? ? 1_555 V  THR 2   N   ? ? V SAC 1   V THR 2    1_555 ? ? ? ? ? ? ? 1.342 ? 
metalc1  metalc ? ? A  HIS 378 NE2 ? ? ? 1_555 AA HEA .   FE  ? ? A HIS 378 A HEA 515  1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc2  metalc ? ? A  HIS 240 ND1 ? ? ? 1_555 DA CU  .   CU  ? ? A HIS 240 A CU  517  1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc3  metalc ? ? N  HIS 240 ND1 ? ? ? 1_555 FB CU  .   CU  ? ? N HIS 240 N CU  517  1_555 ? ? ? ? ? ? ? 1.977 ? 
metalc4  metalc ? ? A  HIS 61  NE2 ? ? ? 1_555 AA HEA .   FE  ? ? A HIS 61  A HEA 515  1_555 ? ? ? ? ? ? ? 1.980 ? 
metalc5  metalc ? ? N  HIS 291 NE2 ? ? ? 1_555 FB CU  .   CU  ? ? N HIS 291 N CU  517  1_555 ? ? ? ? ? ? ? 1.989 ? 
metalc6  metalc ? ? B  HIS 161 ND1 ? ? ? 1_555 JA CUA .   CU1 ? ? B HIS 161 B CUA 228  1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc7  metalc ? ? O  HIS 161 ND1 ? ? ? 1_555 MB CUA .   CU1 ? ? O HIS 161 O CUA 228  1_555 ? ? ? ? ? ? ? 1.994 ? 
metalc8  metalc ? ? B  HIS 204 ND1 ? ? ? 1_555 JA CUA .   CU2 ? ? B HIS 204 B CUA 228  1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc9  metalc ? ? O  HIS 204 ND1 ? ? ? 1_555 MB CUA .   CU2 ? ? O HIS 204 O CUA 228  1_555 ? ? ? ? ? ? ? 2.022 ? 
metalc10 metalc ? ? N  HIS 378 NE2 ? ? ? 1_555 CB HEA .   FE  ? ? N HIS 378 N HEA 515  1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc11 metalc ? ? A  HIS 291 NE2 ? ? ? 1_555 DA CU  .   CU  ? ? A HIS 291 A CU  517  1_555 ? ? ? ? ? ? ? 2.034 ? 
metalc12 metalc ? ? N  HIS 61  NE2 ? ? ? 1_555 CB HEA .   FE  ? ? N HIS 61  N HEA 515  1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc13 metalc ? ? A  HIS 376 NE2 ? ? ? 1_555 BA HEA .   FE  ? ? A HIS 376 A HEA 516  1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc14 metalc ? ? B  GLU 198 OE1 ? ? ? 1_555 EA MG  .   MG  ? ? B GLU 198 A MG  518  1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc15 metalc ? ? A  ASP 369 OD1 ? ? ? 1_555 EA MG  .   MG  ? ? A ASP 369 A MG  518  1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc16 metalc ? ? N  ASP 369 OD1 ? ? ? 1_555 GB MG  .   MG  ? ? N ASP 369 N MG  518  1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc17 metalc ? ? N  HIS 376 NE2 ? ? ? 1_555 DB HEA .   FE  ? ? N HIS 376 N HEA 516  1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc18 metalc ? ? O  GLU 198 OE1 ? ? ? 1_555 GB MG  .   MG  ? ? O GLU 198 N MG  518  1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc19 metalc ? ? HB NA  .   NA  ? ? ? 1_555 RC HOH .   O   ? ? N NA  519 N HOH 3258 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc20 metalc ? ? FA NA  .   NA  ? ? ? 1_555 EC HOH .   O   ? ? A NA  519 A HOH 2258 1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc21 metalc ? ? O  GLU 198 O   ? ? ? 1_555 MB CUA .   CU2 ? ? O GLU 198 O CUA 228  1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc22 metalc ? ? N  GLY 45  O   ? ? ? 1_555 HB NA  .   NA  ? ? N GLY 45  N NA  519  1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc23 metalc ? ? N  GLU 40  OE1 ? ? ? 1_555 HB NA  .   NA  ? ? N GLU 40  N NA  519  1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc24 metalc ? ? EA MG  .   MG  ? ? ? 1_555 FC HOH .   O   ? ? A MG  518 B HOH 2267 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc25 metalc ? ? CA CYN .   N   ? ? ? 1_555 DA CU  .   CU  ? ? A CYN 520 A CU  517  1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc26 metalc ? ? N  GLU 40  O   ? ? ? 1_555 HB NA  .   NA  ? ? N GLU 40  N NA  519  1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc27 metalc ? ? EA MG  .   MG  ? ? ? 1_555 FC HOH .   O   ? ? A MG  518 B HOH 2266 1_555 ? ? ? ? ? ? ? 2.271 ? 
metalc28 metalc ? ? F  CYS 60  SG  ? ? ? 1_555 UA ZN  .   ZN  ? ? F CYS 60  F ZN  99   1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc29 metalc ? ? B  CYS 196 SG  ? ? ? 1_555 JA CUA .   CU2 ? ? B CYS 196 B CUA 228  1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc30 metalc ? ? EA MG  .   MG  ? ? ? 1_555 FC HOH .   O   ? ? A MG  518 B HOH 2268 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc31 metalc ? ? O  CYS 196 SG  ? ? ? 1_555 MB CUA .   CU2 ? ? O CYS 196 O CUA 228  1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc32 metalc ? ? O  CYS 200 SG  ? ? ? 1_555 MB CUA .   CU2 ? ? O CYS 200 O CUA 228  1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc33 metalc ? ? A  SER 441 O   ? ? ? 1_555 FA NA  .   NA  ? ? A SER 441 A NA  519  1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc34 metalc ? ? GB MG  .   MG  ? ? ? 1_555 SC HOH .   O   ? ? N MG  518 O HOH 3266 1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc35 metalc ? ? A  GLU 40  O   ? ? ? 1_555 FA NA  .   NA  ? ? A GLU 40  A NA  519  1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc36 metalc ? ? A  GLU 40  OE1 ? ? ? 1_555 FA NA  .   NA  ? ? A GLU 40  A NA  519  1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc37 metalc ? ? A  GLY 45  O   ? ? ? 1_555 FA NA  .   NA  ? ? A GLY 45  A NA  519  1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc38 metalc ? ? N  SER 441 O   ? ? ? 1_555 HB NA  .   NA  ? ? N SER 441 N NA  519  1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc39 metalc ? ? B  CYS 200 SG  ? ? ? 1_555 JA CUA .   CU2 ? ? B CYS 200 B CUA 228  1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc40 metalc ? ? O  CYS 196 SG  ? ? ? 1_555 MB CUA .   CU1 ? ? O CYS 196 O CUA 228  1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc41 metalc ? ? GB MG  .   MG  ? ? ? 1_555 SC HOH .   O   ? ? N MG  518 O HOH 3267 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc42 metalc ? ? GB MG  .   MG  ? ? ? 1_555 SC HOH .   O   ? ? N MG  518 O HOH 3268 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc43 metalc ? ? F  CYS 82  SG  ? ? ? 1_555 UA ZN  .   ZN  ? ? F CYS 82  F ZN  99   1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc44 metalc ? ? B  GLU 198 O   ? ? ? 1_555 JA CUA .   CU2 ? ? B GLU 198 B CUA 228  1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc45 metalc ? ? B  MET 207 SD  ? ? ? 1_555 JA CUA .   CU1 ? ? B MET 207 B CUA 228  1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc46 metalc ? ? F  CYS 62  SG  ? ? ? 1_555 UA ZN  .   ZN  ? ? F CYS 62  F ZN  99   1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc47 metalc ? ? S  CYS 62  SG  ? ? ? 1_555 XB ZN  .   ZN  ? ? S CYS 62  S ZN  99   1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc48 metalc ? ? S  CYS 82  SG  ? ? ? 1_555 XB ZN  .   ZN  ? ? S CYS 82  S ZN  99   1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc49 metalc ? ? B  CYS 200 SG  ? ? ? 1_555 JA CUA .   CU1 ? ? B CYS 200 B CUA 228  1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc50 metalc ? ? S  CYS 85  SG  ? ? ? 1_555 XB ZN  .   ZN  ? ? S CYS 85  S ZN  99   1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc51 metalc ? ? B  CYS 196 SG  ? ? ? 1_555 JA CUA .   CU1 ? ? B CYS 196 B CUA 228  1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc52 metalc ? ? O  CYS 200 SG  ? ? ? 1_555 MB CUA .   CU1 ? ? O CYS 200 O CUA 228  1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc53 metalc ? ? O  MET 207 SD  ? ? ? 1_555 MB CUA .   CU1 ? ? O MET 207 O CUA 228  1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc54 metalc ? ? F  CYS 85  SG  ? ? ? 1_555 UA ZN  .   ZN  ? ? F CYS 85  F ZN  99   1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc55 metalc ? ? S  CYS 60  SG  ? ? ? 1_555 XB ZN  .   ZN  ? ? S CYS 60  S ZN  99   1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc56 metalc ? ? EB CYN .   N   ? ? ? 1_555 FB CU  .   CU  ? ? N CYN 520 N CU  517  1_555 ? ? ? ? ? ? ? 2.437 ? 
metalc57 metalc ? ? DB HEA .   FE  ? ? ? 1_555 EB CYN .   N   ? ? N HEA 516 N CYN 520  1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc58 metalc ? ? N  HIS 290 NE2 ? ? ? 1_555 FB CU  .   CU  ? ? N HIS 290 N CU  517  1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc59 metalc ? ? BA HEA .   FE  ? ? ? 1_555 CA CYN .   N   ? ? A HEA 516 A CYN 520  1_555 ? ? ? ? ? ? ? 2.778 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 130 A . ? PRO 130 A PRO 131 A ? PRO 131 A 1 -0.28  
2 CYS 498 A . ? CYS 498 A PRO 499 A ? PRO 499 A 1 -8.01  
3 GLN 103 B . ? GLN 103 B TRP 104 B ? TRP 104 B 1 -12.70 
4 TRP 116 C . ? TRP 116 C PRO 117 C ? PRO 117 C 1 -6.08  
5 PRO 130 N . ? PRO 130 N PRO 131 N ? PRO 131 N 1 -0.08  
6 CYS 498 N . ? CYS 498 N PRO 499 N ? PRO 499 N 1 -8.81  
7 GLN 103 O . ? GLN 103 O TRP 104 O ? TRP 104 O 1 -12.09 
8 TRP 116 P . ? TRP 116 P PRO 117 P ? PRO 117 P 1 -9.69  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
D ? 2 ? 
E ? 2 ? 
F ? 3 ? 
G ? 2 ? 
H ? 5 ? 
I ? 3 ? 
J ? 2 ? 
K ? 2 ? 
L ? 3 ? 
M ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 482 ? THR A 484 ? VAL A 482 THR A 484 
A 2 THR M 2   ? ALA M 3   ? THR M 2   ALA M 3   
B 1 LEU B 116 ? SER B 120 ? LEU B 116 SER B 120 
B 2 TYR B 105 ? TYR B 110 ? TYR B 105 TYR B 110 
B 3 LEU B 95  ? HIS B 102 ? LEU B 95  HIS B 102 
B 4 ILE B 150 ? SER B 156 ? ILE B 150 SER B 156 
B 5 ASN B 180 ? LEU B 184 ? ASN B 180 LEU B 184 
C 1 VAL B 142 ? PRO B 145 ? VAL B 142 PRO B 145 
C 2 PRO B 208 ? VAL B 214 ? PRO B 208 VAL B 214 
C 3 GLY B 190 ? GLN B 195 ? GLY B 190 GLN B 195 
D 1 HIS B 161 ? VAL B 165 ? HIS B 161 VAL B 165 
D 2 LEU B 170 ? ALA B 174 ? LEU B 170 ALA B 174 
E 1 TRP D 138 ? ASP D 139 ? TRP D 138 ASP D 139 
E 2 GLU D 144 ? TRP D 145 ? GLU D 144 TRP D 145 
F 1 ASN F 47  ? SER F 51  ? ASN F 47  SER F 51  
F 2 HIS F 88  ? PRO F 93  ? HIS F 88  PRO F 93  
F 3 GLN F 80  ? ARG F 81  ? GLN F 80  ARG F 81  
G 1 LYS F 55  ? CYS F 60  ? LYS F 55  CYS F 60  
G 2 ILE F 70  ? HIS F 75  ? ILE F 70  HIS F 75  
H 1 LEU O 116 ? SER O 120 ? LEU O 116 SER O 120 
H 2 TYR O 105 ? TYR O 110 ? TYR O 105 TYR O 110 
H 3 LEU O 95  ? HIS O 102 ? LEU O 95  HIS O 102 
H 4 ILE O 150 ? SER O 156 ? ILE O 150 SER O 156 
H 5 ASN O 180 ? LEU O 184 ? ASN O 180 LEU O 184 
I 1 VAL O 142 ? PRO O 145 ? VAL O 142 PRO O 145 
I 2 ILE O 209 ? VAL O 214 ? ILE O 209 VAL O 214 
I 3 GLY O 190 ? GLY O 194 ? GLY O 190 GLY O 194 
J 1 HIS O 161 ? VAL O 165 ? HIS O 161 VAL O 165 
J 2 LEU O 170 ? ALA O 174 ? LEU O 170 ALA O 174 
K 1 TRP Q 138 ? ASP Q 139 ? TRP Q 138 ASP Q 139 
K 2 GLU Q 144 ? TRP Q 145 ? GLU Q 144 TRP Q 145 
L 1 ASN S 47  ? SER S 51  ? ASN S 47  SER S 51  
L 2 HIS S 88  ? PRO S 93  ? HIS S 88  PRO S 93  
L 3 GLN S 80  ? ARG S 81  ? GLN S 80  ARG S 81  
M 1 LYS S 55  ? CYS S 60  ? LYS S 55  CYS S 60  
M 2 ILE S 70  ? HIS S 75  ? ILE S 70  HIS S 75  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 483 ? N LEU A 483 O THR M 2   ? O THR M 2   
B 1 2 O LEU B 116 ? O LEU B 116 N TYR B 110 ? N TYR B 110 
B 2 3 O SER B 107 ? O SER B 107 N MET B 100 ? N MET B 100 
B 3 4 N LEU B 95  ? N LEU B 95  O ARG B 151 ? O ARG B 151 
B 4 5 N VAL B 154 ? N VAL B 154 O ASN B 180 ? O ASN B 180 
C 1 2 N VAL B 142 ? N VAL B 142 O GLU B 212 ? O GLU B 212 
C 2 3 O LEU B 211 ? O LEU B 211 N TYR B 192 ? N TYR B 192 
D 1 2 N HIS B 161 ? N HIS B 161 O ALA B 174 ? O ALA B 174 
E 1 2 N ASP D 139 ? N ASP D 139 O GLU D 144 ? O GLU D 144 
F 1 2 N ASN F 47  ? N ASN F 47  O LYS F 90  ? O LYS F 90  
F 2 3 O TYR F 89  ? O TYR F 89  N GLN F 80  ? N GLN F 80  
G 1 2 N CYS F 60  ? N CYS F 60  O ILE F 70  ? O ILE F 70  
H 1 2 O LEU O 116 ? O LEU O 116 N TYR O 110 ? N TYR O 110 
H 2 3 O SER O 107 ? O SER O 107 N MET O 100 ? N MET O 100 
H 3 4 N LEU O 95  ? N LEU O 95  O ARG O 151 ? O ARG O 151 
H 4 5 N VAL O 154 ? N VAL O 154 O ASN O 180 ? O ASN O 180 
I 1 2 N VAL O 142 ? N VAL O 142 O GLU O 212 ? O GLU O 212 
I 2 3 O LEU O 211 ? O LEU O 211 N TYR O 192 ? N TYR O 192 
J 1 2 N HIS O 161 ? N HIS O 161 O ALA O 174 ? O ALA O 174 
K 1 2 N ASP Q 139 ? N ASP Q 139 O GLU Q 144 ? O GLU Q 144 
L 1 2 N ASN S 47  ? N ASN S 47  O LYS S 90  ? O LYS S 90  
L 2 3 O TYR S 89  ? O TYR S 89  N GLN S 80  ? N GLN S 80  
M 1 2 N ARG S 56  ? N ARG S 56  O LEU S 74  ? O LEU S 74  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE HEA A 515'  
AC2 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE HEA A 516'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CYN A 520'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CU A 517'   
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 518'   
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 519'   
AC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE TGL A 521'  
AC8 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE PGV A 524'  
AC9 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE PGV A 522'  
BC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CUA B 228'  
BC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CHD B 1085' 
BC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CHD C 525'  
BC4 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE PEK C 264'  
BC5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE PGV C 267'  
BC6 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PGV C 268'  
BC7 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CDL C 270'  
BC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CHD C 271'  
BC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE TGL D 523'  
CC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE PSC E 229'  
CC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN F 99'    
CC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PEK G 265'  
CC4 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE CDL G 269'  
CC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE DMU G 272'  
CC6 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PEK G 1263' 
CC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CHD J 60'   
CC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE TGL L 522'  
CC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE DMU M 526'  
DC1 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE HEA N 515'  
DC2 Software ? ? ? ? 30 'BINDING SITE FOR RESIDUE HEA N 516'  
DC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CYN N 520'  
DC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CU N 517'   
DC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG N 518'   
DC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA N 519'   
DC7 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE TGL N 1521' 
DC8 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE TGL N 1522' 
DC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PGV N 1524' 
EC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE PGV N 1266' 
EC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CUA O 228'  
EC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CHD O 229'  
EC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CHD P 1525' 
EC5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE PGV P 1267' 
EC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PGV P 1268' 
EC7 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CDL P 1270' 
EC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CHD P 1271' 
EC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE DMU P 1272' 
FC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE TGL Q 1523' 
FC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PSC R 1229' 
FC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN S 99'    
FC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PEK S 1265' 
FC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PEK T 263'  
FC6 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE PEK T 1264' 
FC7 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE CDL T 1269' 
FC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CHD W 1059' 
FC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE DMU Z 1526' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 29 MET A  28  ? MET A 28   . ? 1_555 ? 
2   AC1 29 THR A  31  ? THR A 31   . ? 1_555 ? 
3   AC1 29 SER A  34  ? SER A 34   . ? 1_555 ? 
4   AC1 29 ILE A  37  ? ILE A 37   . ? 1_555 ? 
5   AC1 29 ARG A  38  ? ARG A 38   . ? 1_555 ? 
6   AC1 29 TYR A  54  ? TYR A 54   . ? 1_555 ? 
7   AC1 29 VAL A  58  ? VAL A 58   . ? 1_555 ? 
8   AC1 29 HIS A  61  ? HIS A 61   . ? 1_555 ? 
9   AC1 29 ALA A  62  ? ALA A 62   . ? 1_555 ? 
10  AC1 29 MET A  65  ? MET A 65   . ? 1_555 ? 
11  AC1 29 VAL A  70  ? VAL A 70   . ? 1_555 ? 
12  AC1 29 ILE A  73  ? ILE A 73   . ? 1_555 ? 
13  AC1 29 GLY A  125 ? GLY A 125  . ? 1_555 ? 
14  AC1 29 TRP A  126 ? TRP A 126  . ? 1_555 ? 
15  AC1 29 TYR A  371 ? TYR A 371  . ? 1_555 ? 
16  AC1 29 PHE A  377 ? PHE A 377  . ? 1_555 ? 
17  AC1 29 HIS A  378 ? HIS A 378  . ? 1_555 ? 
18  AC1 29 SER A  382 ? SER A 382  . ? 1_555 ? 
19  AC1 29 VAL A  386 ? VAL A 386  . ? 1_555 ? 
20  AC1 29 MET A  417 ? MET A 417  . ? 1_555 ? 
21  AC1 29 PHE A  425 ? PHE A 425  . ? 1_555 ? 
22  AC1 29 GLN A  428 ? GLN A 428  . ? 1_555 ? 
23  AC1 29 ARG A  438 ? ARG A 438  . ? 1_555 ? 
24  AC1 29 ARG A  439 ? ARG A 439  . ? 1_555 ? 
25  AC1 29 TYR A  440 ? TYR A 440  . ? 1_555 ? 
26  AC1 29 VAL A  465 ? VAL A 465  . ? 1_555 ? 
27  AC1 29 HOH EC .   ? HOH A 2045 . ? 1_555 ? 
28  AC1 29 HOH EC .   ? HOH A 2283 . ? 1_555 ? 
29  AC1 29 HOH EC .   ? HOH A 2700 . ? 1_555 ? 
30  AC2 29 TRP A  126 ? TRP A 126  . ? 1_555 ? 
31  AC2 29 VAL A  243 ? VAL A 243  . ? 1_555 ? 
32  AC2 29 TYR A  244 ? TYR A 244  . ? 1_555 ? 
33  AC2 29 ILE A  247 ? ILE A 247  . ? 1_555 ? 
34  AC2 29 HIS A  290 ? HIS A 290  . ? 1_555 ? 
35  AC2 29 HIS A  291 ? HIS A 291  . ? 1_555 ? 
36  AC2 29 THR A  309 ? THR A 309  . ? 1_555 ? 
37  AC2 29 ILE A  312 ? ILE A 312  . ? 1_555 ? 
38  AC2 29 THR A  316 ? THR A 316  . ? 1_555 ? 
39  AC2 29 GLY A  317 ? GLY A 317  . ? 1_555 ? 
40  AC2 29 GLY A  352 ? GLY A 352  . ? 1_555 ? 
41  AC2 29 GLY A  355 ? GLY A 355  . ? 1_555 ? 
42  AC2 29 ILE A  356 ? ILE A 356  . ? 1_555 ? 
43  AC2 29 LEU A  358 ? LEU A 358  . ? 1_555 ? 
44  AC2 29 ALA A  359 ? ALA A 359  . ? 1_555 ? 
45  AC2 29 ASP A  364 ? ASP A 364  . ? 1_555 ? 
46  AC2 29 HIS A  368 ? HIS A 368  . ? 1_555 ? 
47  AC2 29 VAL A  373 ? VAL A 373  . ? 1_555 ? 
48  AC2 29 HIS A  376 ? HIS A 376  . ? 1_555 ? 
49  AC2 29 PHE A  377 ? PHE A 377  . ? 1_555 ? 
50  AC2 29 VAL A  380 ? VAL A 380  . ? 1_555 ? 
51  AC2 29 LEU A  381 ? LEU A 381  . ? 1_555 ? 
52  AC2 29 ARG A  438 ? ARG A 438  . ? 1_555 ? 
53  AC2 29 CYN CA .   ? CYN A 520  . ? 1_555 ? 
54  AC2 29 HOH EC .   ? HOH A 2081 . ? 1_555 ? 
55  AC2 29 HOH EC .   ? HOH A 2183 . ? 1_555 ? 
56  AC2 29 HOH EC .   ? HOH A 2272 . ? 1_555 ? 
57  AC2 29 HOH EC .   ? HOH A 2341 . ? 1_555 ? 
58  AC2 29 PRO B  69  ? PRO B 69   . ? 1_555 ? 
59  AC3 5  HIS A  240 ? HIS A 240  . ? 1_555 ? 
60  AC3 5  HIS A  290 ? HIS A 290  . ? 1_555 ? 
61  AC3 5  HIS A  291 ? HIS A 291  . ? 1_555 ? 
62  AC3 5  HEA BA .   ? HEA A 516  . ? 1_555 ? 
63  AC3 5  CU  DA .   ? CU  A 517  . ? 1_555 ? 
64  AC4 4  HIS A  240 ? HIS A 240  . ? 1_555 ? 
65  AC4 4  HIS A  290 ? HIS A 290  . ? 1_555 ? 
66  AC4 4  HIS A  291 ? HIS A 291  . ? 1_555 ? 
67  AC4 4  CYN CA .   ? CYN A 520  . ? 1_555 ? 
68  AC5 6  HIS A  368 ? HIS A 368  . ? 1_555 ? 
69  AC5 6  ASP A  369 ? ASP A 369  . ? 1_555 ? 
70  AC5 6  GLU B  198 ? GLU B 198  . ? 1_555 ? 
71  AC5 6  HOH FC .   ? HOH B 2266 . ? 1_555 ? 
72  AC5 6  HOH FC .   ? HOH B 2267 . ? 1_555 ? 
73  AC5 6  HOH FC .   ? HOH B 2268 . ? 1_555 ? 
74  AC6 4  GLU A  40  ? GLU A 40   . ? 1_555 ? 
75  AC6 4  GLY A  45  ? GLY A 45   . ? 1_555 ? 
76  AC6 4  SER A  441 ? SER A 441  . ? 1_555 ? 
77  AC6 4  HOH EC .   ? HOH A 2258 . ? 1_555 ? 
78  AC7 8  ASN A  422 ? ASN A 422  . ? 1_555 ? 
79  AC7 8  PHE A  426 ? PHE A 426  . ? 1_555 ? 
80  AC7 8  PHE A  430 ? PHE A 430  . ? 1_555 ? 
81  AC7 8  LEU A  433 ? LEU A 433  . ? 1_555 ? 
82  AC7 8  LEU B  7   ? LEU B 7    . ? 1_555 ? 
83  AC7 8  LEU B  28  ? LEU B 28   . ? 1_555 ? 
84  AC7 8  VAL B  31  ? VAL B 31   . ? 1_555 ? 
85  AC7 8  SER B  35  ? SER B 35   . ? 1_555 ? 
86  AC8 16 ASN A  406 ? ASN A 406  . ? 1_555 ? 
87  AC8 16 THR A  408 ? THR A 408  . ? 1_555 ? 
88  AC8 16 TRP A  409 ? TRP A 409  . ? 1_555 ? 
89  AC8 16 HOH EC .   ? HOH A 2668 . ? 1_555 ? 
90  AC8 16 HOH EC .   ? HOH A 4140 . ? 1_555 ? 
91  AC8 16 HOH EC .   ? HOH A 4452 . ? 1_555 ? 
92  AC8 16 HOH EC .   ? HOH A 4691 . ? 1_555 ? 
93  AC8 16 ALA D  84  ? ALA D 84   . ? 1_555 ? 
94  AC8 16 PHE D  87  ? PHE D 87   . ? 1_555 ? 
95  AC8 16 HIS K  10  ? HIS K 10   . ? 1_555 ? 
96  AC8 16 GLN M  15  ? GLN M 15   . ? 1_555 ? 
97  AC8 16 ALA M  16  ? ALA M 16   . ? 1_555 ? 
98  AC8 16 LEU M  19  ? LEU M 19   . ? 1_555 ? 
99  AC8 16 SER M  20  ? SER M 20   . ? 1_555 ? 
100 AC8 16 HOH QC .   ? HOH M 2126 . ? 1_555 ? 
101 AC8 16 HOH QC .   ? HOH M 4486 . ? 1_555 ? 
102 AC9 15 PHE A  94  ? PHE A 94   . ? 1_555 ? 
103 AC9 15 PRO A  95  ? PRO A 95   . ? 1_555 ? 
104 AC9 15 ARG A  96  ? ARG A 96   . ? 1_555 ? 
105 AC9 15 MET A  97  ? MET A 97   . ? 1_555 ? 
106 AC9 15 HOH EC .   ? HOH A 2085 . ? 1_555 ? 
107 AC9 15 HOH EC .   ? HOH A 2289 . ? 1_555 ? 
108 AC9 15 HOH EC .   ? HOH A 4723 . ? 1_555 ? 
109 AC9 15 HIS C  9   ? HIS C 9    . ? 1_555 ? 
110 AC9 15 ASN C  50  ? ASN C 50   . ? 1_555 ? 
111 AC9 15 TRP C  57  ? TRP C 57   . ? 1_555 ? 
112 AC9 15 TRP C  58  ? TRP C 58   . ? 1_555 ? 
113 AC9 15 GLU C  64  ? GLU C 64   . ? 1_555 ? 
114 AC9 15 HIS C  71  ? HIS C 71   . ? 1_555 ? 
115 AC9 15 GLY C  82  ? GLY C 82   . ? 1_555 ? 
116 AC9 15 PEK NA .   ? PEK C 264  . ? 1_555 ? 
117 BC1 6  HIS B  161 ? HIS B 161  . ? 1_555 ? 
118 BC1 6  CYS B  196 ? CYS B 196  . ? 1_555 ? 
119 BC1 6  GLU B  198 ? GLU B 198  . ? 1_555 ? 
120 BC1 6  CYS B  200 ? CYS B 200  . ? 1_555 ? 
121 BC1 6  HIS B  204 ? HIS B 204  . ? 1_555 ? 
122 BC1 6  MET B  207 ? MET B 207  . ? 1_555 ? 
123 BC2 12 MET A  271 ? MET A 271  . ? 1_555 ? 
124 BC2 12 GLN B  59  ? GLN B 59   . ? 1_555 ? 
125 BC2 12 GLU B  62  ? GLU B 62   . ? 1_555 ? 
126 BC2 12 THR B  63  ? THR B 63   . ? 1_555 ? 
127 BC2 12 THR B  66  ? THR B 66   . ? 1_555 ? 
128 BC2 12 HOH FC .   ? HOH B 2605 . ? 1_555 ? 
129 BC2 12 HOH FC .   ? HOH B 3446 . ? 1_555 ? 
130 BC2 12 PEK YB .   ? PEK S 1265 . ? 1_555 ? 
131 BC2 12 ARG T  14  ? ARG T 14   . ? 1_555 ? 
132 BC2 12 ARG T  17  ? ARG T 17   . ? 1_555 ? 
133 BC2 12 PHE T  18  ? PHE T 18   . ? 1_555 ? 
134 BC2 12 GLY T  22  ? GLY T 22   . ? 1_555 ? 
135 BC3 9  HIS A  233 ? HIS A 233  . ? 1_555 ? 
136 BC3 9  ASP A  300 ? ASP A 300  . ? 1_555 ? 
137 BC3 9  THR A  301 ? THR A 301  . ? 1_555 ? 
138 BC3 9  TYR A  304 ? TYR A 304  . ? 1_555 ? 
139 BC3 9  TRP C  99  ? TRP C 99   . ? 1_555 ? 
140 BC3 9  HIS C  103 ? HIS C 103  . ? 1_555 ? 
141 BC3 9  HOH GC .   ? HOH C 2155 . ? 1_555 ? 
142 BC3 9  HOH GC .   ? HOH C 4204 . ? 1_555 ? 
143 BC3 9  HOH GC .   ? HOH C 4556 . ? 1_555 ? 
144 BC4 18 HIS A  151 ? HIS A 151  . ? 1_555 ? 
145 BC4 18 PGV IA .   ? PGV A 522  . ? 1_555 ? 
146 BC4 18 HOH EC .   ? HOH A 4723 . ? 1_555 ? 
147 BC4 18 TRP C  34  ? TRP C 34   . ? 1_555 ? 
148 BC4 18 TYR C  181 ? TYR C 181  . ? 1_555 ? 
149 BC4 18 TYR C  182 ? TYR C 182  . ? 1_555 ? 
150 BC4 18 ALA C  184 ? ALA C 184  . ? 1_555 ? 
151 BC4 18 PHE C  186 ? PHE C 186  . ? 1_555 ? 
152 BC4 18 THR C  187 ? THR C 187  . ? 1_555 ? 
153 BC4 18 ILE C  188 ? ILE C 188  . ? 1_555 ? 
154 BC4 18 PHE C  198 ? PHE C 198  . ? 1_555 ? 
155 BC4 18 HOH GC .   ? HOH C 2350 . ? 1_555 ? 
156 BC4 18 TRP G  62  ? TRP G 62   . ? 1_555 ? 
157 BC4 18 THR G  68  ? THR G 68   . ? 1_555 ? 
158 BC4 18 PHE G  69  ? PHE G 69   . ? 1_555 ? 
159 BC4 18 PHE G  70  ? PHE G 70   . ? 1_555 ? 
160 BC4 18 HIS G  71  ? HIS G 71   . ? 1_555 ? 
161 BC4 18 ASN G  76  ? ASN G 76   . ? 1_555 ? 
162 BC5 20 MET C  54  ? MET C 54   . ? 1_555 ? 
163 BC5 20 TRP C  58  ? TRP C 58   . ? 1_555 ? 
164 BC5 20 VAL C  61  ? VAL C 61   . ? 1_555 ? 
165 BC5 20 SER C  65  ? SER C 65   . ? 1_555 ? 
166 BC5 20 THR C  66  ? THR C 66   . ? 1_555 ? 
167 BC5 20 HIS C  207 ? HIS C 207  . ? 1_555 ? 
168 BC5 20 ILE C  210 ? ILE C 210  . ? 1_555 ? 
169 BC5 20 PHE C  214 ? PHE C 214  . ? 1_555 ? 
170 BC5 20 ARG C  221 ? ARG C 221  . ? 1_555 ? 
171 BC5 20 HIS C  226 ? HIS C 226  . ? 1_555 ? 
172 BC5 20 PHE C  227 ? PHE C 227  . ? 1_555 ? 
173 BC5 20 HIS C  231 ? HIS C 231  . ? 1_555 ? 
174 BC5 20 HIS C  232 ? HIS C 232  . ? 1_555 ? 
175 BC5 20 PHE C  233 ? PHE C 233  . ? 1_555 ? 
176 BC5 20 GLY C  234 ? GLY C 234  . ? 1_555 ? 
177 BC5 20 CDL QA .   ? CDL C 270  . ? 1_555 ? 
178 BC5 20 HOH GC .   ? HOH C 2253 . ? 1_555 ? 
179 BC5 20 HOH GC .   ? HOH C 2559 . ? 1_555 ? 
180 BC5 20 HOH GC .   ? HOH C 4710 . ? 1_555 ? 
181 BC5 20 HOH JC .   ? HOH F 2065 . ? 1_555 ? 
182 BC6 11 THR C  95  ? THR C 95   . ? 1_555 ? 
183 BC6 11 TRP C  99  ? TRP C 99   . ? 1_555 ? 
184 BC6 11 TYR C  102 ? TYR C 102  . ? 1_555 ? 
185 BC6 11 HIS C  103 ? HIS C 103  . ? 1_555 ? 
186 BC6 11 LEU C  106 ? LEU C 106  . ? 1_555 ? 
187 BC6 11 ALA C  107 ? ALA C 107  . ? 1_555 ? 
188 BC6 11 HOH GC .   ? HOH C 4295 . ? 1_555 ? 
189 BC6 11 HOH GC .   ? HOH C 4316 . ? 1_555 ? 
190 BC6 11 HOH GC .   ? HOH C 4671 . ? 1_555 ? 
191 BC6 11 HOH GC .   ? HOH C 4773 . ? 1_555 ? 
192 BC6 11 HOH LC .   ? HOH H 4234 . ? 1_555 ? 
193 BC7 16 MET C  51  ? MET C 51   . ? 1_555 ? 
194 BC7 16 TYR C  55  ? TYR C 55   . ? 1_555 ? 
195 BC7 16 TRP C  58  ? TRP C 58   . ? 1_555 ? 
196 BC7 16 ARG C  59  ? ARG C 59   . ? 1_555 ? 
197 BC7 16 ILE C  62  ? ILE C 62   . ? 1_555 ? 
198 BC7 16 ARG C  63  ? ARG C 63   . ? 1_555 ? 
199 BC7 16 PHE C  67  ? PHE C 67   . ? 1_555 ? 
200 BC7 16 THR C  213 ? THR C 213  . ? 1_555 ? 
201 BC7 16 VAL C  217 ? VAL C 217  . ? 1_555 ? 
202 BC7 16 ARG C  221 ? ARG C 221  . ? 1_555 ? 
203 BC7 16 LYS C  224 ? LYS C 224  . ? 1_555 ? 
204 BC7 16 HIS C  226 ? HIS C 226  . ? 1_555 ? 
205 BC7 16 PGV OA .   ? PGV C 267  . ? 1_555 ? 
206 BC7 16 HOH GC .   ? HOH C 2144 . ? 1_555 ? 
207 BC7 16 HOH GC .   ? HOH C 4143 . ? 1_555 ? 
208 BC7 16 LYS J  8   ? LYS J 8    . ? 1_555 ? 
209 BC8 5  ARG C  156 ? ARG C 156  . ? 1_555 ? 
210 BC8 5  LEU C  160 ? LEU C 160  . ? 1_555 ? 
211 BC8 5  PHE C  164 ? PHE C 164  . ? 1_555 ? 
212 BC8 5  LEU C  223 ? LEU C 223  . ? 1_555 ? 
213 BC8 5  PHE J  1   ? PHE J 1    . ? 1_555 ? 
214 BC9 14 TRP A  334 ? TRP A 334  . ? 1_555 ? 
215 BC9 14 GLY A  343 ? GLY A 343  . ? 1_555 ? 
216 BC9 14 PHE A  414 ? PHE A 414  . ? 1_555 ? 
217 BC9 14 VAL A  419 ? VAL A 419  . ? 1_555 ? 
218 BC9 14 THR B  47  ? THR B 47   . ? 1_555 ? 
219 BC9 14 LYS B  49  ? LYS B 49   . ? 1_555 ? 
220 BC9 14 HOH FC .   ? HOH B 2562 . ? 1_555 ? 
221 BC9 14 ARG D  73  ? ARG D 73   . ? 1_555 ? 
222 BC9 14 THR D  75  ? THR D 75   . ? 1_555 ? 
223 BC9 14 GLU D  77  ? GLU D 77   . ? 1_555 ? 
224 BC9 14 TRP D  78  ? TRP D 78   . ? 1_555 ? 
225 BC9 14 VAL D  81  ? VAL D 81   . ? 1_555 ? 
226 BC9 14 HOH HC .   ? HOH D 4445 . ? 1_555 ? 
227 BC9 14 ARG I  16  ? ARG I 16   . ? 1_555 ? 
228 CC1 18 PHE A  321 ? PHE A 321  . ? 1_555 ? 
229 CC1 18 HIS A  328 ? HIS A 328  . ? 1_555 ? 
230 CC1 18 ILE B  41  ? ILE B 41   . ? 1_555 ? 
231 CC1 18 HIS B  52  ? HIS B 52   . ? 1_555 ? 
232 CC1 18 MET B  56  ? MET B 56   . ? 1_555 ? 
233 CC1 18 ASP B  57  ? ASP B 57   . ? 1_555 ? 
234 CC1 18 VAL B  61  ? VAL B 61   . ? 1_555 ? 
235 CC1 18 TRP B  65  ? TRP B 65   . ? 1_555 ? 
236 CC1 18 LEU B  68  ? LEU B 68   . ? 1_555 ? 
237 CC1 18 HOH FC .   ? HOH B 4201 . ? 1_555 ? 
238 CC1 18 HIS E  5   ? HIS E 5    . ? 1_555 ? 
239 CC1 18 ASP E  8   ? ASP E 8    . ? 1_555 ? 
240 CC1 18 PHE E  11  ? PHE E 11   . ? 1_555 ? 
241 CC1 18 LEU E  41  ? LEU E 41   . ? 1_555 ? 
242 CC1 18 HOH IC .   ? HOH E 2664 . ? 1_555 ? 
243 CC1 18 ARG I  10  ? ARG I 10   . ? 1_555 ? 
244 CC1 18 ALA I  14  ? ALA I 14   . ? 1_555 ? 
245 CC1 18 HOH MC .   ? HOH I 4186 . ? 1_555 ? 
246 CC2 4  CYS F  60  ? CYS F 60   . ? 1_555 ? 
247 CC2 4  CYS F  62  ? CYS F 62   . ? 1_555 ? 
248 CC2 4  CYS F  82  ? CYS F 82   . ? 1_555 ? 
249 CC2 4  CYS F  85  ? CYS F 85   . ? 1_555 ? 
250 CC3 11 LYS C  157 ? LYS C 157  . ? 1_555 ? 
251 CC3 11 HIS C  158 ? HIS C 158  . ? 1_555 ? 
252 CC3 11 GLN C  161 ? GLN C 161  . ? 1_555 ? 
253 CC3 11 TYR C  172 ? TYR C 172  . ? 1_555 ? 
254 CC3 11 HOH GC .   ? HOH C 4167 . ? 1_555 ? 
255 CC3 11 ALA F  1   ? ALA F 1    . ? 1_555 ? 
256 CC3 11 ARG G  17  ? ARG G 17   . ? 1_555 ? 
257 CC3 11 PHE G  21  ? PHE G 21   . ? 1_555 ? 
258 CC3 11 CDL WA .   ? CDL G 269  . ? 1_555 ? 
259 CC3 11 THR O  66  ? THR O 66   . ? 1_555 ? 
260 CC3 11 CHD NB .   ? CHD O 229  . ? 1_555 ? 
261 CC4 23 LEU C  127 ? LEU C 127  . ? 1_555 ? 
262 CC4 23 LEU C  131 ? LEU C 131  . ? 1_555 ? 
263 CC4 23 LEU C  138 ? LEU C 138  . ? 1_555 ? 
264 CC4 23 VAL C  254 ? VAL C 254  . ? 1_555 ? 
265 CC4 23 LEU G  23  ? LEU G 23   . ? 1_555 ? 
266 CC4 23 SER G  27  ? SER G 27   . ? 1_555 ? 
267 CC4 23 LEU G  30  ? LEU G 30   . ? 1_555 ? 
268 CC4 23 CYS G  31  ? CYS G 31   . ? 1_555 ? 
269 CC4 23 ASN G  34  ? ASN G 34   . ? 1_555 ? 
270 CC4 23 LEU G  37  ? LEU G 37   . ? 1_555 ? 
271 CC4 23 HIS G  38  ? HIS G 38   . ? 1_555 ? 
272 CC4 23 ARG G  42  ? ARG G 42   . ? 1_555 ? 
273 CC4 23 PEK VA .   ? PEK G 265  . ? 1_555 ? 
274 CC4 23 PHE N  282 ? PHE N 282  . ? 1_555 ? 
275 CC4 23 LEU N  283 ? LEU N 283  . ? 1_555 ? 
276 CC4 23 ILE N  286 ? ILE N 286  . ? 1_555 ? 
277 CC4 23 ASP N  300 ? ASP N 300  . ? 1_555 ? 
278 CC4 23 TYR N  304 ? TYR N 304  . ? 1_555 ? 
279 CC4 23 SER N  307 ? SER N 307  . ? 1_555 ? 
280 CC4 23 ILE N  311 ? ILE N 311  . ? 1_555 ? 
281 CC4 23 ALA O  77  ? ALA O 77   . ? 1_555 ? 
282 CC4 23 LEU O  78  ? LEU O 78   . ? 1_555 ? 
283 CC4 23 LEU O  81  ? LEU O 81   . ? 1_555 ? 
284 CC5 5  TRP C  34  ? TRP C 34   . ? 1_555 ? 
285 CC5 5  MET C  40  ? MET C 40   . ? 1_555 ? 
286 CC5 5  SER G  61  ? SER G 61   . ? 1_555 ? 
287 CC5 5  TRP G  62  ? TRP G 62   . ? 1_555 ? 
288 CC5 5  GLY G  63  ? GLY G 63   . ? 1_555 ? 
289 CC6 13 SER G  2   ? SER G 2    . ? 1_555 ? 
290 CC6 13 ALA G  3   ? ALA G 3    . ? 1_555 ? 
291 CC6 13 LYS G  5   ? LYS G 5    . ? 1_555 ? 
292 CC6 13 GLY G  6   ? GLY G 6    . ? 1_555 ? 
293 CC6 13 HIS G  8   ? HIS G 8    . ? 1_555 ? 
294 CC6 13 LYS P  77  ? LYS P 77   . ? 1_555 ? 
295 CC6 13 ARG P  80  ? ARG P 80   . ? 1_555 ? 
296 CC6 13 ILE P  84  ? ILE P 84   . ? 1_555 ? 
297 CC6 13 THR P  95  ? THR P 95   . ? 1_555 ? 
298 CC6 13 PHE P  98  ? PHE P 98   . ? 1_555 ? 
299 CC6 13 TRP P  240 ? TRP P 240  . ? 1_555 ? 
300 CC6 13 PHE P  244 ? PHE P 244  . ? 1_555 ? 
301 CC6 13 VAL P  247 ? VAL P 247  . ? 1_555 ? 
302 CC7 5  TYR J  32  ? TYR J 32   . ? 1_555 ? 
303 CC7 5  ARG J  33  ? ARG J 33   . ? 1_555 ? 
304 CC7 5  MET J  36  ? MET J 36   . ? 1_555 ? 
305 CC7 5  THR J  37  ? THR J 37   . ? 1_555 ? 
306 CC7 5  LEU J  40  ? LEU J 40   . ? 1_555 ? 
307 CC8 15 THR A  17  ? THR A 17   . ? 1_555 ? 
308 CC8 15 LEU A  18  ? LEU A 18   . ? 1_555 ? 
309 CC8 15 LEU A  20  ? LEU A 20   . ? 1_555 ? 
310 CC8 15 LEU A  21  ? LEU A 21   . ? 1_555 ? 
311 CC8 15 TRP A  25  ? TRP A 25   . ? 1_555 ? 
312 CC8 15 LEU A  113 ? LEU A 113  . ? 1_555 ? 
313 CC8 15 PHE A  400 ? PHE A 400  . ? 1_555 ? 
314 CC8 15 ILE L  11  ? ILE L 11   . ? 1_555 ? 
315 CC8 15 PRO L  12  ? PRO L 12   . ? 1_555 ? 
316 CC8 15 PHE L  13  ? PHE L 13   . ? 1_555 ? 
317 CC8 15 SER L  14  ? SER L 14   . ? 1_555 ? 
318 CC8 15 ARG L  20  ? ARG L 20   . ? 1_555 ? 
319 CC8 15 MET L  24  ? MET L 24   . ? 1_555 ? 
320 CC8 15 PHE L  29  ? PHE L 29   . ? 1_555 ? 
321 CC8 15 SER L  31  ? SER L 31   . ? 1_555 ? 
322 CC9 6  TRP D  98  ? TRP D 98   . ? 1_555 ? 
323 CC9 6  LEU M  28  ? LEU M 28   . ? 1_555 ? 
324 CC9 6  GLY M  31  ? GLY M 31   . ? 1_555 ? 
325 CC9 6  TRP M  32  ? TRP M 32   . ? 1_555 ? 
326 CC9 6  TYR M  35  ? TYR M 35   . ? 1_555 ? 
327 CC9 6  HIS M  36  ? HIS M 36   . ? 1_555 ? 
328 DC1 26 THR N  31  ? THR N 31   . ? 1_555 ? 
329 DC1 26 SER N  34  ? SER N 34   . ? 1_555 ? 
330 DC1 26 ILE N  37  ? ILE N 37   . ? 1_555 ? 
331 DC1 26 ARG N  38  ? ARG N 38   . ? 1_555 ? 
332 DC1 26 TYR N  54  ? TYR N 54   . ? 1_555 ? 
333 DC1 26 VAL N  58  ? VAL N 58   . ? 1_555 ? 
334 DC1 26 HIS N  61  ? HIS N 61   . ? 1_555 ? 
335 DC1 26 ALA N  62  ? ALA N 62   . ? 1_555 ? 
336 DC1 26 MET N  65  ? MET N 65   . ? 1_555 ? 
337 DC1 26 VAL N  70  ? VAL N 70   . ? 1_555 ? 
338 DC1 26 GLY N  125 ? GLY N 125  . ? 1_555 ? 
339 DC1 26 TRP N  126 ? TRP N 126  . ? 1_555 ? 
340 DC1 26 TYR N  371 ? TYR N 371  . ? 1_555 ? 
341 DC1 26 PHE N  377 ? PHE N 377  . ? 1_555 ? 
342 DC1 26 HIS N  378 ? HIS N 378  . ? 1_555 ? 
343 DC1 26 SER N  382 ? SER N 382  . ? 1_555 ? 
344 DC1 26 PHE N  393 ? PHE N 393  . ? 1_555 ? 
345 DC1 26 PHE N  425 ? PHE N 425  . ? 1_555 ? 
346 DC1 26 GLN N  428 ? GLN N 428  . ? 1_555 ? 
347 DC1 26 ARG N  438 ? ARG N 438  . ? 1_555 ? 
348 DC1 26 ARG N  439 ? ARG N 439  . ? 1_555 ? 
349 DC1 26 TYR N  440 ? TYR N 440  . ? 1_555 ? 
350 DC1 26 VAL N  465 ? VAL N 465  . ? 1_555 ? 
351 DC1 26 HOH RC .   ? HOH N 3045 . ? 1_555 ? 
352 DC1 26 HOH RC .   ? HOH N 3283 . ? 1_555 ? 
353 DC1 26 HOH RC .   ? HOH N 3700 . ? 1_555 ? 
354 DC2 30 TRP N  126 ? TRP N 126  . ? 1_555 ? 
355 DC2 30 VAL N  243 ? VAL N 243  . ? 1_555 ? 
356 DC2 30 TYR N  244 ? TYR N 244  . ? 1_555 ? 
357 DC2 30 ILE N  247 ? ILE N 247  . ? 1_555 ? 
358 DC2 30 HIS N  290 ? HIS N 290  . ? 1_555 ? 
359 DC2 30 HIS N  291 ? HIS N 291  . ? 1_555 ? 
360 DC2 30 ILE N  312 ? ILE N 312  . ? 1_555 ? 
361 DC2 30 THR N  316 ? THR N 316  . ? 1_555 ? 
362 DC2 30 GLY N  317 ? GLY N 317  . ? 1_555 ? 
363 DC2 30 VAL N  320 ? VAL N 320  . ? 1_555 ? 
364 DC2 30 PHE N  321 ? PHE N 321  . ? 1_555 ? 
365 DC2 30 GLY N  352 ? GLY N 352  . ? 1_555 ? 
366 DC2 30 GLY N  355 ? GLY N 355  . ? 1_555 ? 
367 DC2 30 ILE N  356 ? ILE N 356  . ? 1_555 ? 
368 DC2 30 LEU N  358 ? LEU N 358  . ? 1_555 ? 
369 DC2 30 ALA N  359 ? ALA N 359  . ? 1_555 ? 
370 DC2 30 ASP N  364 ? ASP N 364  . ? 1_555 ? 
371 DC2 30 HIS N  368 ? HIS N 368  . ? 1_555 ? 
372 DC2 30 VAL N  373 ? VAL N 373  . ? 1_555 ? 
373 DC2 30 HIS N  376 ? HIS N 376  . ? 1_555 ? 
374 DC2 30 PHE N  377 ? PHE N 377  . ? 1_555 ? 
375 DC2 30 VAL N  380 ? VAL N 380  . ? 1_555 ? 
376 DC2 30 LEU N  381 ? LEU N 381  . ? 1_555 ? 
377 DC2 30 ARG N  438 ? ARG N 438  . ? 1_555 ? 
378 DC2 30 CYN EB .   ? CYN N 520  . ? 1_555 ? 
379 DC2 30 HOH RC .   ? HOH N 3081 . ? 1_555 ? 
380 DC2 30 HOH RC .   ? HOH N 3183 . ? 1_555 ? 
381 DC2 30 HOH RC .   ? HOH N 3272 . ? 1_555 ? 
382 DC2 30 HOH RC .   ? HOH N 3341 . ? 1_555 ? 
383 DC2 30 PRO O  69  ? PRO O 69   . ? 1_555 ? 
384 DC3 6  HIS N  240 ? HIS N 240  . ? 1_555 ? 
385 DC3 6  HIS N  290 ? HIS N 290  . ? 1_555 ? 
386 DC3 6  HIS N  291 ? HIS N 291  . ? 1_555 ? 
387 DC3 6  HEA DB .   ? HEA N 516  . ? 1_555 ? 
388 DC3 6  CU  FB .   ? CU  N 517  . ? 1_555 ? 
389 DC3 6  HOH RC .   ? HOH N 4406 . ? 1_555 ? 
390 DC4 4  HIS N  240 ? HIS N 240  . ? 1_555 ? 
391 DC4 4  HIS N  290 ? HIS N 290  . ? 1_555 ? 
392 DC4 4  HIS N  291 ? HIS N 291  . ? 1_555 ? 
393 DC4 4  CYN EB .   ? CYN N 520  . ? 1_555 ? 
394 DC5 6  HIS N  368 ? HIS N 368  . ? 1_555 ? 
395 DC5 6  ASP N  369 ? ASP N 369  . ? 1_555 ? 
396 DC5 6  GLU O  198 ? GLU O 198  . ? 1_555 ? 
397 DC5 6  HOH SC .   ? HOH O 3266 . ? 1_555 ? 
398 DC5 6  HOH SC .   ? HOH O 3267 . ? 1_555 ? 
399 DC5 6  HOH SC .   ? HOH O 3268 . ? 1_555 ? 
400 DC6 4  GLU N  40  ? GLU N 40   . ? 1_555 ? 
401 DC6 4  GLY N  45  ? GLY N 45   . ? 1_555 ? 
402 DC6 4  SER N  441 ? SER N 441  . ? 1_555 ? 
403 DC6 4  HOH RC .   ? HOH N 3258 . ? 1_555 ? 
404 DC7 12 PHE N  346 ? PHE N 346  . ? 1_555 ? 
405 DC7 12 ASN N  422 ? ASN N 422  . ? 1_555 ? 
406 DC7 12 PHE N  426 ? PHE N 426  . ? 1_555 ? 
407 DC7 12 PHE N  430 ? PHE N 430  . ? 1_555 ? 
408 DC7 12 LEU N  433 ? LEU N 433  . ? 1_555 ? 
409 DC7 12 LEU O  7   ? LEU O 7    . ? 1_555 ? 
410 DC7 12 LEU O  28  ? LEU O 28   . ? 1_555 ? 
411 DC7 12 PHE O  32  ? PHE O 32   . ? 1_555 ? 
412 DC7 12 SER O  35  ? SER O 35   . ? 1_555 ? 
413 DC7 12 HOH UC .   ? HOH Q 3606 . ? 1_555 ? 
414 DC7 12 HOH UC .   ? HOH Q 4357 . ? 1_555 ? 
415 DC7 12 ARG V  43  ? ARG V 43   . ? 1_555 ? 
416 DC8 20 THR N  17  ? THR N 17   . ? 1_555 ? 
417 DC8 20 LEU N  18  ? LEU N 18   . ? 1_555 ? 
418 DC8 20 LEU N  20  ? LEU N 20   . ? 1_555 ? 
419 DC8 20 LEU N  21  ? LEU N 21   . ? 1_555 ? 
420 DC8 20 PHE N  22  ? PHE N 22   . ? 1_555 ? 
421 DC8 20 TRP N  25  ? TRP N 25   . ? 1_555 ? 
422 DC8 20 TRP N  81  ? TRP N 81   . ? 1_555 ? 
423 DC8 20 PRO N  106 ? PRO N 106  . ? 1_555 ? 
424 DC8 20 LEU N  113 ? LEU N 113  . ? 1_555 ? 
425 DC8 20 PHE N  400 ? PHE N 400  . ? 1_555 ? 
426 DC8 20 ILE Y  11  ? ILE Y 11   . ? 1_555 ? 
427 DC8 20 PRO Y  12  ? PRO Y 12   . ? 1_555 ? 
428 DC8 20 PHE Y  13  ? PHE Y 13   . ? 1_555 ? 
429 DC8 20 SER Y  14  ? SER Y 14   . ? 1_555 ? 
430 DC8 20 ARG Y  20  ? ARG Y 20   . ? 1_555 ? 
431 DC8 20 MET Y  24  ? MET Y 24   . ? 1_555 ? 
432 DC8 20 MET Y  25  ? MET Y 25   . ? 1_555 ? 
433 DC8 20 PHE Y  28  ? PHE Y 28   . ? 1_555 ? 
434 DC8 20 PHE Y  29  ? PHE Y 29   . ? 1_555 ? 
435 DC8 20 HOH CD .   ? HOH Y 4623 . ? 1_555 ? 
436 DC9 9  ASN N  406 ? ASN N 406  . ? 1_555 ? 
437 DC9 9  THR N  408 ? THR N 408  . ? 1_555 ? 
438 DC9 9  TRP N  409 ? TRP N 409  . ? 1_555 ? 
439 DC9 9  ILE N  412 ? ILE N 412  . ? 1_555 ? 
440 DC9 9  PHE Q  87  ? PHE Q 87   . ? 1_555 ? 
441 DC9 9  PRO Z  12  ? PRO Z 12   . ? 1_555 ? 
442 DC9 9  GLN Z  15  ? GLN Z 15   . ? 1_555 ? 
443 DC9 9  ALA Z  16  ? ALA Z 16   . ? 1_555 ? 
444 DC9 9  SER Z  20  ? SER Z 20   . ? 1_555 ? 
445 EC1 16 PHE N  94  ? PHE N 94   . ? 1_555 ? 
446 EC1 16 PRO N  95  ? PRO N 95   . ? 1_555 ? 
447 EC1 16 ARG N  96  ? ARG N 96   . ? 1_555 ? 
448 EC1 16 MET N  97  ? MET N 97   . ? 1_555 ? 
449 EC1 16 MET N  100 ? MET N 100  . ? 1_555 ? 
450 EC1 16 HOH RC .   ? HOH N 3085 . ? 1_555 ? 
451 EC1 16 HIS P  9   ? HIS P 9    . ? 1_555 ? 
452 EC1 16 ALA P  24  ? ALA P 24   . ? 1_555 ? 
453 EC1 16 ASN P  50  ? ASN P 50   . ? 1_555 ? 
454 EC1 16 TRP P  57  ? TRP P 57   . ? 1_555 ? 
455 EC1 16 TRP P  58  ? TRP P 58   . ? 1_555 ? 
456 EC1 16 GLU P  64  ? GLU P 64   . ? 1_555 ? 
457 EC1 16 HIS P  71  ? HIS P 71   . ? 1_555 ? 
458 EC1 16 LEU P  79  ? LEU P 79   . ? 1_555 ? 
459 EC1 16 GLY P  82  ? GLY P 82   . ? 1_555 ? 
460 EC1 16 GLU P  90  ? GLU P 90   . ? 1_555 ? 
461 EC2 6  HIS O  161 ? HIS O 161  . ? 1_555 ? 
462 EC2 6  CYS O  196 ? CYS O 196  . ? 1_555 ? 
463 EC2 6  GLU O  198 ? GLU O 198  . ? 1_555 ? 
464 EC2 6  CYS O  200 ? CYS O 200  . ? 1_555 ? 
465 EC2 6  HIS O  204 ? HIS O 204  . ? 1_555 ? 
466 EC2 6  MET O  207 ? MET O 207  . ? 1_555 ? 
467 EC3 10 ARG G  14  ? ARG G 14   . ? 1_555 ? 
468 EC3 10 ARG G  17  ? ARG G 17   . ? 1_555 ? 
469 EC3 10 PHE G  21  ? PHE G 21   . ? 1_555 ? 
470 EC3 10 PEK VA .   ? PEK G 265  . ? 1_555 ? 
471 EC3 10 MET N  271 ? MET N 271  . ? 1_555 ? 
472 EC3 10 GLU O  62  ? GLU O 62   . ? 1_555 ? 
473 EC3 10 THR O  63  ? THR O 63   . ? 1_555 ? 
474 EC3 10 THR O  66  ? THR O 66   . ? 1_555 ? 
475 EC3 10 HOH SC .   ? HOH O 2446 . ? 1_555 ? 
476 EC3 10 HOH SC .   ? HOH O 3605 . ? 1_555 ? 
477 EC4 8  HIS N  233 ? HIS N 233  . ? 1_555 ? 
478 EC4 8  ASP N  300 ? ASP N 300  . ? 1_555 ? 
479 EC4 8  THR N  301 ? THR N 301  . ? 1_555 ? 
480 EC4 8  TYR N  304 ? TYR N 304  . ? 1_555 ? 
481 EC4 8  TRP P  99  ? TRP P 99   . ? 1_555 ? 
482 EC4 8  HIS P  103 ? HIS P 103  . ? 1_555 ? 
483 EC4 8  PGV RB .   ? PGV P 1268 . ? 1_555 ? 
484 EC4 8  HOH TC .   ? HOH P 3155 . ? 1_555 ? 
485 EC5 20 MET P  54  ? MET P 54   . ? 1_555 ? 
486 EC5 20 TRP P  58  ? TRP P 58   . ? 1_555 ? 
487 EC5 20 VAL P  61  ? VAL P 61   . ? 1_555 ? 
488 EC5 20 SER P  65  ? SER P 65   . ? 1_555 ? 
489 EC5 20 THR P  66  ? THR P 66   . ? 1_555 ? 
490 EC5 20 HIS P  71  ? HIS P 71   . ? 1_555 ? 
491 EC5 20 HIS P  207 ? HIS P 207  . ? 1_555 ? 
492 EC5 20 ILE P  210 ? ILE P 210  . ? 1_555 ? 
493 EC5 20 PHE P  214 ? PHE P 214  . ? 1_555 ? 
494 EC5 20 ARG P  221 ? ARG P 221  . ? 1_555 ? 
495 EC5 20 HIS P  226 ? HIS P 226  . ? 1_555 ? 
496 EC5 20 PHE P  227 ? PHE P 227  . ? 1_555 ? 
497 EC5 20 HIS P  231 ? HIS P 231  . ? 1_555 ? 
498 EC5 20 HIS P  232 ? HIS P 232  . ? 1_555 ? 
499 EC5 20 PHE P  233 ? PHE P 233  . ? 1_555 ? 
500 EC5 20 GLY P  234 ? GLY P 234  . ? 1_555 ? 
501 EC5 20 CDL SB .   ? CDL P 1270 . ? 1_555 ? 
502 EC5 20 HOH TC .   ? HOH P 3253 . ? 1_555 ? 
503 EC5 20 HOH TC .   ? HOH P 3559 . ? 1_555 ? 
504 EC5 20 HOH WC .   ? HOH S 3065 . ? 1_555 ? 
505 EC6 12 ALA G  1   ? ALA G 1    . ? 1_555 ? 
506 EC6 12 ASP N  298 ? ASP N 298  . ? 1_555 ? 
507 EC6 12 THR P  95  ? THR P 95   . ? 1_555 ? 
508 EC6 12 TRP P  99  ? TRP P 99   . ? 1_555 ? 
509 EC6 12 TYR P  102 ? TYR P 102  . ? 1_555 ? 
510 EC6 12 HIS P  103 ? HIS P 103  . ? 1_555 ? 
511 EC6 12 ALA P  107 ? ALA P 107  . ? 1_555 ? 
512 EC6 12 CHD PB .   ? CHD P 1525 . ? 1_555 ? 
513 EC6 12 HOH TC .   ? HOH P 4315 . ? 1_555 ? 
514 EC6 12 HOH TC .   ? HOH P 4392 . ? 1_555 ? 
515 EC6 12 HOH TC .   ? HOH P 4561 . ? 1_555 ? 
516 EC6 12 ASN U  22  ? ASN U 22   . ? 1_555 ? 
517 EC7 15 MET P  51  ? MET P 51   . ? 1_555 ? 
518 EC7 15 LEU P  52  ? LEU P 52   . ? 1_555 ? 
519 EC7 15 TYR P  55  ? TYR P 55   . ? 1_555 ? 
520 EC7 15 TRP P  58  ? TRP P 58   . ? 1_555 ? 
521 EC7 15 ARG P  59  ? ARG P 59   . ? 1_555 ? 
522 EC7 15 ARG P  63  ? ARG P 63   . ? 1_555 ? 
523 EC7 15 PHE P  67  ? PHE P 67   . ? 1_555 ? 
524 EC7 15 VAL P  217 ? VAL P 217  . ? 1_555 ? 
525 EC7 15 PHE P  220 ? PHE P 220  . ? 1_555 ? 
526 EC7 15 ARG P  221 ? ARG P 221  . ? 1_555 ? 
527 EC7 15 LYS P  224 ? LYS P 224  . ? 1_555 ? 
528 EC7 15 HIS P  226 ? HIS P 226  . ? 1_555 ? 
529 EC7 15 PGV QB .   ? PGV P 1267 . ? 1_555 ? 
530 EC7 15 HOH TC .   ? HOH P 4810 . ? 1_555 ? 
531 EC7 15 LYS W  8   ? LYS W 8    . ? 1_555 ? 
532 EC8 8  ARG P  156 ? ARG P 156  . ? 1_555 ? 
533 EC8 8  LEU P  160 ? LEU P 160  . ? 1_555 ? 
534 EC8 8  PHE P  164 ? PHE P 164  . ? 1_555 ? 
535 EC8 8  PHE P  219 ? PHE P 219  . ? 1_555 ? 
536 EC8 8  LEU P  223 ? LEU P 223  . ? 1_555 ? 
537 EC8 8  HOH TC .   ? HOH P 4578 . ? 1_555 ? 
538 EC8 8  HOH TC .   ? HOH P 4657 . ? 1_555 ? 
539 EC8 8  PHE W  1   ? PHE W 1    . ? 1_555 ? 
540 EC9 6  TRP P  34  ? TRP P 34   . ? 1_555 ? 
541 EC9 6  MET P  40  ? MET P 40   . ? 1_555 ? 
542 EC9 6  HOH TC .   ? HOH P 4255 . ? 1_555 ? 
543 EC9 6  SER T  61  ? SER T 61   . ? 1_555 ? 
544 EC9 6  TRP T  62  ? TRP T 62   . ? 1_555 ? 
545 EC9 6  GLY T  63  ? GLY T 63   . ? 1_555 ? 
546 FC1 11 TRP N  334 ? TRP N 334  . ? 1_555 ? 
547 FC1 11 LEU O  39  ? LEU O 39   . ? 1_555 ? 
548 FC1 11 ILE O  42  ? ILE O 42   . ? 1_555 ? 
549 FC1 11 THR O  47  ? THR O 47   . ? 1_555 ? 
550 FC1 11 LYS O  49  ? LYS O 49   . ? 1_555 ? 
551 FC1 11 ARG Q  73  ? ARG Q 73   . ? 1_555 ? 
552 FC1 11 GLU Q  77  ? GLU Q 77   . ? 1_555 ? 
553 FC1 11 TRP Q  78  ? TRP Q 78   . ? 1_555 ? 
554 FC1 11 VAL Q  81  ? VAL Q 81   . ? 1_555 ? 
555 FC1 11 HOH UC .   ? HOH Q 4776 . ? 1_555 ? 
556 FC1 11 ARG V  16  ? ARG V 16   . ? 1_555 ? 
557 FC2 14 PHE N  321 ? PHE N 321  . ? 1_555 ? 
558 FC2 14 ILE O  41  ? ILE O 41   . ? 1_555 ? 
559 FC2 14 MET O  45  ? MET O 45   . ? 1_555 ? 
560 FC2 14 HIS O  52  ? HIS O 52   . ? 1_555 ? 
561 FC2 14 MET O  56  ? MET O 56   . ? 1_555 ? 
562 FC2 14 ASP O  57  ? ASP O 57   . ? 1_555 ? 
563 FC2 14 HIS R  5   ? HIS R 5    . ? 1_555 ? 
564 FC2 14 GLU R  6   ? GLU R 6    . ? 1_555 ? 
565 FC2 14 ASP R  8   ? ASP R 8    . ? 1_555 ? 
566 FC2 14 PHE R  11  ? PHE R 11   . ? 1_555 ? 
567 FC2 14 ASP R  40  ? ASP R 40   . ? 1_555 ? 
568 FC2 14 HOH VC .   ? HOH R 3664 . ? 1_555 ? 
569 FC2 14 ARG V  10  ? ARG V 10   . ? 1_555 ? 
570 FC2 14 ALA V  14  ? ALA V 14   . ? 1_555 ? 
571 FC3 4  CYS S  60  ? CYS S 60   . ? 1_555 ? 
572 FC3 4  CYS S  62  ? CYS S 62   . ? 1_555 ? 
573 FC3 4  CYS S  82  ? CYS S 82   . ? 1_555 ? 
574 FC3 4  CYS S  85  ? CYS S 85   . ? 1_555 ? 
575 FC4 10 GLN B  59  ? GLN B 59   . ? 1_555 ? 
576 FC4 10 CHD KA .   ? CHD B 1085 . ? 1_555 ? 
577 FC4 10 LYS P  157 ? LYS P 157  . ? 1_555 ? 
578 FC4 10 HIS P  158 ? HIS P 158  . ? 1_555 ? 
579 FC4 10 GLN P  161 ? GLN P 161  . ? 1_555 ? 
580 FC4 10 THR P  168 ? THR P 168  . ? 1_555 ? 
581 FC4 10 TYR P  172 ? TYR P 172  . ? 1_555 ? 
582 FC4 10 ALA S  1   ? ALA S 1    . ? 1_555 ? 
583 FC4 10 ARG T  17  ? ARG T 17   . ? 1_555 ? 
584 FC4 10 CDL BC .   ? CDL T 1269 . ? 1_555 ? 
585 FC5 11 LYS C  77  ? LYS C 77   . ? 1_555 ? 
586 FC5 11 ARG C  80  ? ARG C 80   . ? 1_555 ? 
587 FC5 11 TYR C  81  ? TYR C 81   . ? 1_555 ? 
588 FC5 11 ILE C  84  ? ILE C 84   . ? 1_555 ? 
589 FC5 11 PHE C  98  ? PHE C 98   . ? 1_555 ? 
590 FC5 11 TRP C  240 ? TRP C 240  . ? 1_555 ? 
591 FC5 11 SER T  2   ? SER T 2    . ? 1_555 ? 
592 FC5 11 ALA T  3   ? ALA T 3    . ? 1_555 ? 
593 FC5 11 LYS T  5   ? LYS T 5    . ? 1_555 ? 
594 FC5 11 GLY T  6   ? GLY T 6    . ? 1_555 ? 
595 FC5 11 HIS T  8   ? HIS T 8    . ? 1_555 ? 
596 FC6 17 HIS N  151 ? HIS N 151  . ? 1_555 ? 
597 FC6 17 TRP P  34  ? TRP P 34   . ? 1_555 ? 
598 FC6 17 TYR P  181 ? TYR P 181  . ? 1_555 ? 
599 FC6 17 TYR P  182 ? TYR P 182  . ? 1_555 ? 
600 FC6 17 ALA P  184 ? ALA P 184  . ? 1_555 ? 
601 FC6 17 PHE P  186 ? PHE P 186  . ? 1_555 ? 
602 FC6 17 THR P  187 ? THR P 187  . ? 1_555 ? 
603 FC6 17 ILE P  188 ? ILE P 188  . ? 1_555 ? 
604 FC6 17 PHE P  198 ? PHE P 198  . ? 1_555 ? 
605 FC6 17 GLY P  202 ? GLY P 202  . ? 1_555 ? 
606 FC6 17 TRP T  62  ? TRP T 62   . ? 1_555 ? 
607 FC6 17 THR T  68  ? THR T 68   . ? 1_555 ? 
608 FC6 17 PHE T  69  ? PHE T 69   . ? 1_555 ? 
609 FC6 17 PHE T  70  ? PHE T 70   . ? 1_555 ? 
610 FC6 17 HIS T  71  ? HIS T 71   . ? 1_555 ? 
611 FC6 17 ASN T  76  ? ASN T 76   . ? 1_555 ? 
612 FC6 17 HOH XC .   ? HOH T 3350 . ? 1_555 ? 
613 FC7 25 PHE A  282 ? PHE A 282  . ? 1_555 ? 
614 FC7 25 ASP A  300 ? ASP A 300  . ? 1_555 ? 
615 FC7 25 TYR A  304 ? TYR A 304  . ? 1_555 ? 
616 FC7 25 SER A  307 ? SER A 307  . ? 1_555 ? 
617 FC7 25 ILE A  311 ? ILE A 311  . ? 1_555 ? 
618 FC7 25 ILE B  74  ? ILE B 74   . ? 1_555 ? 
619 FC7 25 ALA B  77  ? ALA B 77   . ? 1_555 ? 
620 FC7 25 LEU B  78  ? LEU B 78   . ? 1_555 ? 
621 FC7 25 LEU B  81  ? LEU B 81   . ? 1_555 ? 
622 FC7 25 TYR B  85  ? TYR B 85   . ? 1_555 ? 
623 FC7 25 ASN P  125 ? ASN P 125  . ? 1_555 ? 
624 FC7 25 LEU P  127 ? LEU P 127  . ? 1_555 ? 
625 FC7 25 LEU P  131 ? LEU P 131  . ? 1_555 ? 
626 FC7 25 LEU P  138 ? LEU P 138  . ? 1_555 ? 
627 FC7 25 LEU P  250 ? LEU P 250  . ? 1_555 ? 
628 FC7 25 TYR P  253 ? TYR P 253  . ? 1_555 ? 
629 FC7 25 VAL P  254 ? VAL P 254  . ? 1_555 ? 
630 FC7 25 PEK YB .   ? PEK S 1265 . ? 1_555 ? 
631 FC7 25 SER T  27  ? SER T 27   . ? 1_555 ? 
632 FC7 25 LEU T  30  ? LEU T 30   . ? 1_555 ? 
633 FC7 25 CYS T  31  ? CYS T 31   . ? 1_555 ? 
634 FC7 25 ASN T  34  ? ASN T 34   . ? 1_555 ? 
635 FC7 25 LEU T  37  ? LEU T 37   . ? 1_555 ? 
636 FC7 25 HIS T  38  ? HIS T 38   . ? 1_555 ? 
637 FC7 25 HOH XC .   ? HOH T 4401 . ? 1_555 ? 
638 FC8 4  TYR W  32  ? TYR W 32   . ? 1_555 ? 
639 FC8 4  ARG W  33  ? ARG W 33   . ? 1_555 ? 
640 FC8 4  MET W  36  ? MET W 36   . ? 1_555 ? 
641 FC8 4  THR W  37  ? THR W 37   . ? 1_555 ? 
642 FC9 9  PHE N  459 ? PHE N 459  . ? 1_555 ? 
643 FC9 9  TRP Q  98  ? TRP Q 98   . ? 1_555 ? 
644 FC9 9  LEU Z  27  ? LEU Z 27   . ? 1_555 ? 
645 FC9 9  LEU Z  28  ? LEU Z 28   . ? 1_555 ? 
646 FC9 9  GLY Z  31  ? GLY Z 31   . ? 1_555 ? 
647 FC9 9  TRP Z  32  ? TRP Z 32   . ? 1_555 ? 
648 FC9 9  LEU Z  34  ? LEU Z 34   . ? 1_555 ? 
649 FC9 9  TYR Z  35  ? TYR Z 35   . ? 1_555 ? 
650 FC9 9  HIS Z  36  ? HIS Z 36   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3AG4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3AG4 
_atom_sites.fract_transf_matrix[1][1]   0.005454 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004839 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005614 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CU 
FE 
MG 
N  
NA 
O  
P  
S  
X  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1     N  N   . FME A  1  1   ? 53.497  334.663 224.114 1.00 51.23  ? 1    FME A N   1 
HETATM 2     C  CN  . FME A  1  1   ? 54.337  334.701 223.105 1.00 51.77  ? 1    FME A CN  1 
HETATM 3     O  O1  . FME A  1  1   ? 54.642  335.632 222.507 1.00 52.64  ? 1    FME A O1  1 
HETATM 4     C  CA  . FME A  1  1   ? 53.451  333.225 224.389 1.00 51.89  ? 1    FME A CA  1 
HETATM 5     C  CB  . FME A  1  1   ? 52.515  332.817 225.501 1.00 53.87  ? 1    FME A CB  1 
HETATM 6     C  CG  . FME A  1  1   ? 53.422  331.928 226.361 1.00 60.94  ? 1    FME A CG  1 
HETATM 7     S  SD  . FME A  1  1   ? 54.540  332.859 227.399 1.00 76.92  ? 1    FME A SD  1 
HETATM 8     C  CE  . FME A  1  1   ? 56.142  333.239 226.703 1.00 63.39  ? 1    FME A CE  1 
HETATM 9     C  C   . FME A  1  1   ? 53.213  332.411 223.098 1.00 48.32  ? 1    FME A C   1 
HETATM 10    O  O   . FME A  1  1   ? 54.011  331.544 222.796 1.00 46.46  ? 1    FME A O   1 
ATOM   11    N  N   . PHE A  1  2   ? 52.165  332.723 222.346 1.00 45.27  ? 2    PHE A N   1 
ATOM   12    C  CA  . PHE A  1  2   ? 51.858  331.965 221.157 1.00 44.38  ? 2    PHE A CA  1 
ATOM   13    C  C   . PHE A  1  2   ? 52.970  332.015 220.126 1.00 42.45  ? 2    PHE A C   1 
ATOM   14    O  O   . PHE A  1  2   ? 53.404  330.994 219.646 1.00 40.42  ? 2    PHE A O   1 
ATOM   15    C  CB  . PHE A  1  2   ? 50.575  332.429 220.478 1.00 44.61  ? 2    PHE A CB  1 
ATOM   16    C  CG  . PHE A  1  2   ? 50.155  331.525 219.331 1.00 45.01  ? 2    PHE A CG  1 
ATOM   17    C  CD1 . PHE A  1  2   ? 49.460  330.358 219.582 1.00 48.05  ? 2    PHE A CD1 1 
ATOM   18    C  CD2 . PHE A  1  2   ? 50.504  331.834 218.001 1.00 46.40  ? 2    PHE A CD2 1 
ATOM   19    C  CE1 . PHE A  1  2   ? 49.090  329.506 218.507 1.00 48.20  ? 2    PHE A CE1 1 
ATOM   20    C  CE2 . PHE A  1  2   ? 50.138  331.009 216.928 1.00 49.26  ? 2    PHE A CE2 1 
ATOM   21    C  CZ  . PHE A  1  2   ? 49.436  329.822 217.193 1.00 47.31  ? 2    PHE A CZ  1 
ATOM   22    N  N   . ILE A  1  3   ? 53.341  333.234 219.757 1.00 40.06  ? 3    ILE A N   1 
ATOM   23    C  CA  . ILE A  1  3   ? 54.412  333.529 218.851 1.00 39.85  ? 3    ILE A CA  1 
ATOM   24    C  C   . ILE A  1  3   ? 55.766  332.957 219.357 1.00 39.59  ? 3    ILE A C   1 
ATOM   25    O  O   . ILE A  1  3   ? 56.451  332.284 218.557 1.00 37.95  ? 3    ILE A O   1 
ATOM   26    C  CB  . ILE A  1  3   ? 54.544  335.048 218.606 1.00 40.67  ? 3    ILE A CB  1 
ATOM   27    C  CG1 . ILE A  1  3   ? 53.326  335.506 217.787 1.00 43.36  ? 3    ILE A CG1 1 
ATOM   28    C  CG2 . ILE A  1  3   ? 55.896  335.395 217.935 1.00 37.93  ? 3    ILE A CG2 1 
ATOM   29    C  CD1 . ILE A  1  3   ? 53.208  337.048 217.599 1.00 48.09  ? 3    ILE A CD1 1 
ATOM   30    N  N   . ASN A  1  4   ? 56.108  333.115 220.646 1.00 36.40  ? 4    ASN A N   1 
ATOM   31    C  CA  . ASN A  1  4   ? 57.335  332.561 221.129 1.00 36.83  ? 4    ASN A CA  1 
ATOM   32    C  C   . ASN A  1  4   ? 57.314  331.095 220.942 1.00 35.50  ? 4    ASN A C   1 
ATOM   33    O  O   . ASN A  1  4   ? 58.371  330.551 220.616 1.00 35.17  ? 4    ASN A O   1 
ATOM   34    C  CB  . ASN A  1  4   ? 57.593  332.773 222.630 1.00 39.26  ? 4    ASN A CB  1 
ATOM   35    C  CG  . ASN A  1  4   ? 58.081  334.160 222.937 1.00 45.17  ? 4    ASN A CG  1 
ATOM   36    O  OD1 . ASN A  1  4   ? 58.313  334.969 222.046 1.00 48.06  ? 4    ASN A OD1 1 
ATOM   37    N  ND2 . ASN A  1  4   ? 58.146  334.482 224.237 1.00 53.66  ? 4    ASN A ND2 1 
ATOM   38    N  N   . ARG A  1  5   ? 56.173  330.440 221.264 1.00 33.04  ? 5    ARG A N   1 
ATOM   39    C  CA  . ARG A  1  5   ? 56.121  328.959 221.298 1.00 31.30  ? 5    ARG A CA  1 
ATOM   40    C  C   . ARG A  1  5   ? 56.113  328.412 219.816 1.00 31.47  ? 5    ARG A C   1 
ATOM   41    O  O   . ARG A  1  5   ? 56.932  327.536 219.469 1.00 32.37  ? 5    ARG A O   1 
ATOM   42    C  CB  . ARG A  1  5   ? 54.979  328.367 222.111 1.00 28.93  ? 5    ARG A CB  1 
ATOM   43    C  CG  . ARG A  1  5   ? 55.041  326.813 222.132 1.00 32.11  ? 5    ARG A CG  1 
ATOM   44    C  CD  . ARG A  1  5   ? 54.046  326.160 223.034 1.00 32.80  ? 5    ARG A CD  1 
ATOM   45    N  NE  . ARG A  1  5   ? 54.228  324.725 223.068 1.00 35.13  ? 5    ARG A NE  1 
ATOM   46    C  CZ  . ARG A  1  5   ? 53.643  323.939 223.910 1.00 35.11  ? 5    ARG A CZ  1 
ATOM   47    N  NH1 . ARG A  1  5   ? 52.857  324.438 224.850 1.00 34.59  ? 5    ARG A NH1 1 
ATOM   48    N  NH2 . ARG A  1  5   ? 53.807  322.661 223.775 1.00 35.99  ? 5    ARG A NH2 1 
ATOM   49    N  N   . TRP A  1  6   ? 55.351  329.029 218.959 1.00 28.06  ? 6    TRP A N   1 
ATOM   50    C  CA  . TRP A  1  6   ? 55.042  328.430 217.685 1.00 29.11  ? 6    TRP A CA  1 
ATOM   51    C  C   . TRP A  1  6   ? 55.722  329.029 216.480 1.00 30.65  ? 6    TRP A C   1 
ATOM   52    O  O   . TRP A  1  6   ? 55.765  328.357 215.423 1.00 30.07  ? 6    TRP A O   1 
ATOM   53    C  CB  . TRP A  1  6   ? 53.490  328.380 217.471 1.00 28.92  ? 6    TRP A CB  1 
ATOM   54    C  CG  . TRP A  1  6   ? 52.854  327.419 218.531 1.00 30.84  ? 6    TRP A CG  1 
ATOM   55    C  CD1 . TRP A  1  6   ? 52.078  327.771 219.611 1.00 30.99  ? 6    TRP A CD1 1 
ATOM   56    C  CD2 . TRP A  1  6   ? 53.054  325.979 218.616 1.00 30.51  ? 6    TRP A CD2 1 
ATOM   57    N  NE1 . TRP A  1  6   ? 51.745  326.616 220.344 1.00 30.26  ? 6    TRP A NE1 1 
ATOM   58    C  CE2 . TRP A  1  6   ? 52.349  325.524 219.769 1.00 31.77  ? 6    TRP A CE2 1 
ATOM   59    C  CE3 . TRP A  1  6   ? 53.694  325.014 217.750 1.00 30.61  ? 6    TRP A CE3 1 
ATOM   60    C  CZ2 . TRP A  1  6   ? 52.325  324.198 220.152 1.00 30.34  ? 6    TRP A CZ2 1 
ATOM   61    C  CZ3 . TRP A  1  6   ? 53.703  323.741 218.136 1.00 31.39  ? 6    TRP A CZ3 1 
ATOM   62    C  CH2 . TRP A  1  6   ? 52.972  323.301 219.331 1.00 31.73  ? 6    TRP A CH2 1 
ATOM   63    N  N   . LEU A  1  7   ? 56.231  330.282 216.595 1.00 29.81  ? 7    LEU A N   1 
ATOM   64    C  CA  . LEU A  1  7   ? 56.974  330.884 215.492 1.00 32.22  ? 7    LEU A CA  1 
ATOM   65    C  C   . LEU A  1  7   ? 58.462  330.901 215.829 1.00 32.36  ? 7    LEU A C   1 
ATOM   66    O  O   . LEU A  1  7   ? 59.322  330.996 214.933 1.00 31.99  ? 7    LEU A O   1 
ATOM   67    C  CB  . LEU A  1  7   ? 56.500  332.319 215.190 1.00 31.16  ? 7    LEU A CB  1 
ATOM   68    C  CG  . LEU A  1  7   ? 55.359  332.388 214.146 1.00 38.97  ? 7    LEU A CG  1 
ATOM   69    C  CD1 . LEU A  1  7   ? 54.259  331.427 214.426 1.00 41.08  ? 7    LEU A CD1 1 
ATOM   70    C  CD2 . LEU A  1  7   ? 54.781  333.850 214.045 1.00 41.23  ? 7    LEU A CD2 1 
ATOM   71    N  N   . PHE A  1  8   ? 58.776  330.878 217.137 1.00 30.99  ? 8    PHE A N   1 
ATOM   72    C  CA  . PHE A  1  8   ? 60.180  331.086 217.521 1.00 30.62  ? 8    PHE A CA  1 
ATOM   73    C  C   . PHE A  1  8   ? 60.738  329.783 218.146 1.00 30.40  ? 8    PHE A C   1 
ATOM   74    O  O   . PHE A  1  8   ? 61.654  329.841 218.954 1.00 28.87  ? 8    PHE A O   1 
ATOM   75    C  CB  . PHE A  1  8   ? 60.332  332.233 218.542 1.00 28.89  ? 8    PHE A CB  1 
ATOM   76    C  CG  . PHE A  1  8   ? 60.017  333.625 218.007 1.00 33.42  ? 8    PHE A CG  1 
ATOM   77    C  CD1 . PHE A  1  8   ? 59.733  333.856 216.657 1.00 31.61  ? 8    PHE A CD1 1 
ATOM   78    C  CD2 . PHE A  1  8   ? 59.985  334.739 218.927 1.00 32.04  ? 8    PHE A CD2 1 
ATOM   79    C  CE1 . PHE A  1  8   ? 59.413  335.113 216.179 1.00 35.30  ? 8    PHE A CE1 1 
ATOM   80    C  CE2 . PHE A  1  8   ? 59.662  336.009 218.443 1.00 34.21  ? 8    PHE A CE2 1 
ATOM   81    C  CZ  . PHE A  1  8   ? 59.381  336.209 217.070 1.00 34.76  ? 8    PHE A CZ  1 
ATOM   82    N  N   . SER A  1  9   ? 60.067  328.627 217.884 1.00 29.33  ? 9    SER A N   1 
ATOM   83    C  CA  . SER A  1  9   ? 60.436  327.366 218.525 1.00 29.68  ? 9    SER A CA  1 
ATOM   84    C  C   . SER A  1  9   ? 61.902  326.977 218.418 1.00 30.71  ? 9    SER A C   1 
ATOM   85    O  O   . SER A  1  9   ? 62.571  327.236 217.396 1.00 29.50  ? 9    SER A O   1 
ATOM   86    C  CB  . SER A  1  9   ? 59.640  326.205 217.996 1.00 27.60  ? 9    SER A CB  1 
ATOM   87    O  OG  . SER A  1  9   ? 59.843  325.086 218.915 1.00 28.45  ? 9    SER A OG  1 
ATOM   88    N  N   . THR A  1  10  ? 62.372  326.348 219.506 1.00 31.37  ? 10   THR A N   1 
ATOM   89    C  CA  . THR A  1  10  ? 63.645  325.674 219.586 1.00 30.40  ? 10   THR A CA  1 
ATOM   90    C  C   . THR A  1  10  ? 63.406  324.309 220.229 1.00 29.98  ? 10   THR A C   1 
ATOM   91    O  O   . THR A  1  10  ? 64.349  323.693 220.752 1.00 30.02  ? 10   THR A O   1 
ATOM   92    C  CB  . THR A  1  10  ? 64.723  326.478 220.379 1.00 30.16  ? 10   THR A CB  1 
ATOM   93    O  OG1 . THR A  1  10  ? 64.226  326.851 221.701 1.00 32.24  ? 10   THR A OG1 1 
ATOM   94    C  CG2 . THR A  1  10  ? 65.012  327.794 219.640 1.00 27.46  ? 10   THR A CG2 1 
ATOM   95    N  N   . ASN A  1  11  ? 62.164  323.814 220.177 1.00 28.26  ? 11   ASN A N   1 
ATOM   96    C  CA  . ASN A  1  11  ? 61.827  322.526 220.723 1.00 28.04  ? 11   ASN A CA  1 
ATOM   97    C  C   . ASN A  1  11  ? 61.515  321.441 219.696 1.00 27.50  ? 11   ASN A C   1 
ATOM   98    O  O   . ASN A  1  11  ? 60.697  321.639 218.825 1.00 28.91  ? 11   ASN A O   1 
ATOM   99    C  CB  . ASN A  1  11  ? 60.550  322.748 221.543 1.00 29.08  ? 11   ASN A CB  1 
ATOM   100   C  CG  . ASN A  1  11  ? 60.110  321.506 222.284 1.00 30.00  ? 11   ASN A CG  1 
ATOM   101   O  OD1 . ASN A  1  11  ? 59.169  320.810 221.874 1.00 32.12  ? 11   ASN A OD1 1 
ATOM   102   N  ND2 . ASN A  1  11  ? 60.740  321.262 223.456 1.00 28.22  ? 11   ASN A ND2 1 
ATOM   103   N  N   . HIS A  1  12  ? 62.085  320.250 219.817 1.00 28.60  ? 12   HIS A N   1 
ATOM   104   C  CA  . HIS A  1  12  ? 61.942  319.290 218.761 1.00 28.06  ? 12   HIS A CA  1 
ATOM   105   C  C   . HIS A  1  12  ? 60.519  318.773 218.622 1.00 28.99  ? 12   HIS A C   1 
ATOM   106   O  O   . HIS A  1  12  ? 60.142  318.284 217.563 1.00 27.25  ? 12   HIS A O   1 
ATOM   107   C  CB  . HIS A  1  12  ? 62.915  318.131 218.968 1.00 26.80  ? 12   HIS A CB  1 
ATOM   108   C  CG  . HIS A  1  12  ? 62.604  317.208 220.116 1.00 28.14  ? 12   HIS A CG  1 
ATOM   109   N  ND1 . HIS A  1  12  ? 62.043  315.944 219.927 1.00 23.58  ? 12   HIS A ND1 1 
ATOM   110   C  CD2 . HIS A  1  12  ? 62.744  317.367 221.492 1.00 24.44  ? 12   HIS A CD2 1 
ATOM   111   C  CE1 . HIS A  1  12  ? 61.895  315.354 221.126 1.00 24.94  ? 12   HIS A CE1 1 
ATOM   112   N  NE2 . HIS A  1  12  ? 62.283  316.203 222.078 1.00 26.03  ? 12   HIS A NE2 1 
ATOM   113   N  N   . LYS A  1  13  ? 59.764  318.766 219.703 1.00 28.43  ? 13   LYS A N   1 
ATOM   114   C  CA  . LYS A  1  13  ? 58.454  318.134 219.640 1.00 26.77  ? 13   LYS A CA  1 
ATOM   115   C  C   . LYS A  1  13  ? 57.575  319.090 218.971 1.00 27.51  ? 13   LYS A C   1 
ATOM   116   O  O   . LYS A  1  13  ? 56.895  318.717 218.084 1.00 29.11  ? 13   LYS A O   1 
ATOM   117   C  CB  . LYS A  1  13  ? 57.894  317.925 221.067 1.00 26.24  ? 13   LYS A CB  1 
ATOM   118   C  CG  . LYS A  1  13  ? 58.658  316.891 221.885 1.00 33.71  ? 13   LYS A CG  1 
ATOM   119   C  CD  . LYS A  1  13  ? 58.222  316.969 223.445 1.00 33.59  ? 13   LYS A CD  1 
ATOM   120   C  CE  . LYS A  1  13  ? 59.229  316.155 224.334 1.00 36.56  ? 13   LYS A CE  1 
ATOM   121   N  NZ  . LYS A  1  13  ? 60.347  317.012 224.689 1.00 37.83  ? 13   LYS A NZ  1 
ATOM   122   N  N   . ASP A  1  14  ? 57.545  320.349 219.411 1.00 25.35  ? 14   ASP A N   1 
ATOM   123   C  CA  . ASP A  1  14  ? 56.674  321.329 218.769 1.00 27.58  ? 14   ASP A CA  1 
ATOM   124   C  C   . ASP A  1  14  ? 57.044  321.527 217.253 1.00 26.61  ? 14   ASP A C   1 
ATOM   125   O  O   . ASP A  1  14  ? 56.196  321.769 216.457 1.00 25.29  ? 14   ASP A O   1 
ATOM   126   C  CB  . ASP A  1  14  ? 56.876  322.685 219.463 1.00 25.73  ? 14   ASP A CB  1 
ATOM   127   C  CG  . ASP A  1  14  ? 56.212  322.732 220.862 1.00 28.61  ? 14   ASP A CG  1 
ATOM   128   O  OD1 . ASP A  1  14  ? 56.252  323.845 221.464 1.00 31.27  ? 14   ASP A OD1 1 
ATOM   129   O  OD2 . ASP A  1  14  ? 55.562  321.730 221.276 1.00 25.96  ? 14   ASP A OD2 1 
ATOM   130   N  N   . ILE A  1  15  ? 58.333  321.539 216.915 1.00 25.34  ? 15   ILE A N   1 
ATOM   131   C  CA  . ILE A  1  15  ? 58.697  321.726 215.514 1.00 24.96  ? 15   ILE A CA  1 
ATOM   132   C  C   . ILE A  1  15  ? 58.231  320.389 214.769 1.00 27.10  ? 15   ILE A C   1 
ATOM   133   O  O   . ILE A  1  15  ? 57.787  320.470 213.667 1.00 31.28  ? 15   ILE A O   1 
ATOM   134   C  CB  . ILE A  1  15  ? 60.234  321.919 215.432 1.00 26.62  ? 15   ILE A CB  1 
ATOM   135   C  CG1 . ILE A  1  15  ? 60.604  323.372 215.840 1.00 24.22  ? 15   ILE A CG1 1 
ATOM   136   C  CG2 . ILE A  1  15  ? 60.692  321.655 213.924 1.00 25.50  ? 15   ILE A CG2 1 
ATOM   137   C  CD1 . ILE A  1  15  ? 62.243  323.541 216.130 1.00 24.07  ? 15   ILE A CD1 1 
ATOM   138   N  N   . GLY A  1  16  ? 58.347  319.191 215.367 1.00 26.24  ? 16   GLY A N   1 
ATOM   139   C  CA  . GLY A  1  16  ? 57.848  317.980 214.756 1.00 25.04  ? 16   GLY A CA  1 
ATOM   140   C  C   . GLY A  1  16  ? 56.307  318.158 214.523 1.00 28.03  ? 16   GLY A C   1 
ATOM   141   O  O   . GLY A  1  16  ? 55.717  317.724 213.506 1.00 26.39  ? 16   GLY A O   1 
ATOM   142   N  N   . THR A  1  17  ? 55.595  318.738 215.493 1.00 26.62  ? 17   THR A N   1 
ATOM   143   C  CA  . THR A  1  17  ? 54.129  318.891 215.369 1.00 25.43  ? 17   THR A CA  1 
ATOM   144   C  C   . THR A  1  17  ? 53.878  319.852 214.214 1.00 27.92  ? 17   THR A C   1 
ATOM   145   O  O   . THR A  1  17  ? 52.877  319.723 213.487 1.00 30.58  ? 17   THR A O   1 
ATOM   146   C  CB  . THR A  1  17  ? 53.607  319.484 216.733 1.00 27.72  ? 17   THR A CB  1 
ATOM   147   O  OG1 . THR A  1  17  ? 53.646  318.410 217.714 1.00 26.62  ? 17   THR A OG1 1 
ATOM   148   C  CG2 . THR A  1  17  ? 52.178  320.054 216.591 1.00 25.29  ? 17   THR A CG2 1 
ATOM   149   N  N   . LEU A  1  18  ? 54.647  320.927 214.087 1.00 25.72  ? 18   LEU A N   1 
ATOM   150   C  CA  . LEU A  1  18  ? 54.359  321.854 212.984 1.00 26.53  ? 18   LEU A CA  1 
ATOM   151   C  C   . LEU A  1  18  ? 54.530  321.121 211.636 1.00 26.34  ? 18   LEU A C   1 
ATOM   152   O  O   . LEU A  1  18  ? 53.807  321.392 210.719 1.00 28.31  ? 18   LEU A O   1 
ATOM   153   C  CB  . LEU A  1  18  ? 55.422  323.013 213.004 1.00 23.14  ? 18   LEU A CB  1 
ATOM   154   C  CG  . LEU A  1  18  ? 55.209  324.077 214.193 1.00 26.15  ? 18   LEU A CG  1 
ATOM   155   C  CD1 . LEU A  1  18  ? 56.389  325.057 214.227 1.00 25.15  ? 18   LEU A CD1 1 
ATOM   156   C  CD2 . LEU A  1  18  ? 53.957  324.968 213.865 1.00 25.46  ? 18   LEU A CD2 1 
ATOM   157   N  N   . TYR A  1  19  ? 55.641  320.373 211.465 1.00 26.57  ? 19   TYR A N   1 
ATOM   158   C  CA  . TYR A  1  19  ? 55.842  319.547 210.225 1.00 26.38  ? 19   TYR A CA  1 
ATOM   159   C  C   . TYR A  1  19  ? 54.708  318.613 209.897 1.00 26.77  ? 19   TYR A C   1 
ATOM   160   O  O   . TYR A  1  19  ? 54.319  318.451 208.727 1.00 29.28  ? 19   TYR A O   1 
ATOM   161   C  CB  . TYR A  1  19  ? 57.030  318.692 210.486 1.00 26.02  ? 19   TYR A CB  1 
ATOM   162   C  CG  . TYR A  1  19  ? 58.343  319.388 210.060 1.00 23.55  ? 19   TYR A CG  1 
ATOM   163   C  CD1 . TYR A  1  19  ? 58.640  319.565 208.698 1.00 24.49  ? 19   TYR A CD1 1 
ATOM   164   C  CD2 . TYR A  1  19  ? 59.235  319.805 211.001 1.00 22.76  ? 19   TYR A CD2 1 
ATOM   165   C  CE1 . TYR A  1  19  ? 59.848  320.083 208.278 1.00 27.83  ? 19   TYR A CE1 1 
ATOM   166   C  CE2 . TYR A  1  19  ? 60.526  320.316 210.600 1.00 27.63  ? 19   TYR A CE2 1 
ATOM   167   C  CZ  . TYR A  1  19  ? 60.779  320.432 209.226 1.00 31.80  ? 19   TYR A CZ  1 
ATOM   168   O  OH  . TYR A  1  19  ? 61.988  320.909 208.784 1.00 27.23  ? 19   TYR A OH  1 
ATOM   169   N  N   . LEU A  1  20  ? 54.129  318.010 210.914 1.00 25.32  ? 20   LEU A N   1 
ATOM   170   C  CA  . LEU A  1  20  ? 52.944  317.138 210.698 1.00 25.02  ? 20   LEU A CA  1 
ATOM   171   C  C   . LEU A  1  20  ? 51.686  317.862 210.253 1.00 25.49  ? 20   LEU A C   1 
ATOM   172   O  O   . LEU A  1  20  ? 50.977  317.409 209.351 1.00 26.60  ? 20   LEU A O   1 
ATOM   173   C  CB  . LEU A  1  20  ? 52.637  316.295 211.931 1.00 23.10  ? 20   LEU A CB  1 
ATOM   174   C  CG  . LEU A  1  20  ? 53.659  315.300 212.470 1.00 24.96  ? 20   LEU A CG  1 
ATOM   175   C  CD1 . LEU A  1  20  ? 53.317  314.730 213.856 1.00 26.44  ? 20   LEU A CD1 1 
ATOM   176   C  CD2 . LEU A  1  20  ? 53.690  314.037 211.479 1.00 28.64  ? 20   LEU A CD2 1 
ATOM   177   N  N   . LEU A  1  21  ? 51.423  318.993 210.859 1.00 27.29  ? 21   LEU A N   1 
ATOM   178   C  CA  . LEU A  1  21  ? 50.334  319.850 210.381 1.00 27.47  ? 21   LEU A CA  1 
ATOM   179   C  C   . LEU A  1  21  ? 50.593  320.310 208.935 1.00 25.93  ? 21   LEU A C   1 
ATOM   180   O  O   . LEU A  1  21  ? 49.672  320.325 208.129 1.00 25.37  ? 21   LEU A O   1 
ATOM   181   C  CB  . LEU A  1  21  ? 50.270  321.125 211.277 1.00 28.85  ? 21   LEU A CB  1 
ATOM   182   C  CG  . LEU A  1  21  ? 49.694  320.772 212.698 1.00 31.03  ? 21   LEU A CG  1 
ATOM   183   C  CD1 . LEU A  1  21  ? 49.959  321.978 213.653 1.00 33.96  ? 21   LEU A CD1 1 
ATOM   184   C  CD2 . LEU A  1  21  ? 48.179  320.511 212.517 1.00 39.56  ? 21   LEU A CD2 1 
ATOM   185   N  N   . PHE A  1  22  ? 51.798  320.837 208.667 1.00 27.10  ? 22   PHE A N   1 
ATOM   186   C  CA  . PHE A  1  22  ? 52.189  321.289 207.343 1.00 27.88  ? 22   PHE A CA  1 
ATOM   187   C  C   . PHE A  1  22  ? 51.996  320.125 206.296 1.00 27.22  ? 22   PHE A C   1 
ATOM   188   O  O   . PHE A  1  22  ? 51.425  320.350 205.237 1.00 27.89  ? 22   PHE A O   1 
ATOM   189   C  CB  . PHE A  1  22  ? 53.647  321.803 207.373 1.00 28.23  ? 22   PHE A CB  1 
ATOM   190   C  CG  . PHE A  1  22  ? 54.173  322.200 206.010 1.00 31.99  ? 22   PHE A CG  1 
ATOM   191   C  CD1 . PHE A  1  22  ? 54.110  323.552 205.559 1.00 30.08  ? 22   PHE A CD1 1 
ATOM   192   C  CD2 . PHE A  1  22  ? 54.648  321.224 205.130 1.00 26.77  ? 22   PHE A CD2 1 
ATOM   193   C  CE1 . PHE A  1  22  ? 54.498  323.899 204.256 1.00 29.31  ? 22   PHE A CE1 1 
ATOM   194   C  CE2 . PHE A  1  22  ? 55.051  321.605 203.814 1.00 25.71  ? 22   PHE A CE2 1 
ATOM   195   C  CZ  . PHE A  1  22  ? 54.996  322.936 203.409 1.00 27.68  ? 22   PHE A CZ  1 
ATOM   196   N  N   . GLY A  1  23  ? 52.537  318.905 206.605 1.00 28.81  ? 23   GLY A N   1 
ATOM   197   C  CA  . GLY A  1  23  ? 52.467  317.755 205.719 1.00 27.46  ? 23   GLY A CA  1 
ATOM   198   C  C   . GLY A  1  23  ? 51.049  317.276 205.550 1.00 30.18  ? 23   GLY A C   1 
ATOM   199   O  O   . GLY A  1  23  ? 50.698  316.797 204.453 1.00 27.58  ? 23   GLY A O   1 
ATOM   200   N  N   . ALA A  1  24  ? 50.225  317.337 206.616 1.00 29.49  ? 24   ALA A N   1 
ATOM   201   C  CA  . ALA A  1  24  ? 48.789  316.943 206.414 1.00 27.73  ? 24   ALA A CA  1 
ATOM   202   C  C   . ALA A  1  24  ? 48.060  317.871 205.461 1.00 29.25  ? 24   ALA A C   1 
ATOM   203   O  O   . ALA A  1  24  ? 47.272  317.429 204.579 1.00 30.08  ? 24   ALA A O   1 
ATOM   204   C  CB  . ALA A  1  24  ? 48.058  316.906 207.776 1.00 27.99  ? 24   ALA A CB  1 
ATOM   205   N  N   . TRP A  1  25  ? 48.306  319.165 205.623 1.00 29.83  ? 25   TRP A N   1 
ATOM   206   C  CA  . TRP A  1  25  ? 47.769  320.187 204.707 1.00 30.41  ? 25   TRP A CA  1 
ATOM   207   C  C   . TRP A  1  25  ? 48.280  320.017 203.236 1.00 31.04  ? 25   TRP A C   1 
ATOM   208   O  O   . TRP A  1  25  ? 47.442  320.015 202.343 1.00 31.46  ? 25   TRP A O   1 
ATOM   209   C  CB  . TRP A  1  25  ? 48.065  321.553 205.264 1.00 31.07  ? 25   TRP A CB  1 
ATOM   210   C  CG  . TRP A  1  25  ? 47.210  322.664 204.631 1.00 31.05  ? 25   TRP A CG  1 
ATOM   211   C  CD1 . TRP A  1  25  ? 45.910  323.047 205.016 1.00 31.09  ? 25   TRP A CD1 1 
ATOM   212   C  CD2 . TRP A  1  25  ? 47.554  323.471 203.491 1.00 31.42  ? 25   TRP A CD2 1 
ATOM   213   N  NE1 . TRP A  1  25  ? 45.481  324.042 204.181 1.00 27.81  ? 25   TRP A NE1 1 
ATOM   214   C  CE2 . TRP A  1  25  ? 46.441  324.313 203.228 1.00 33.64  ? 25   TRP A CE2 1 
ATOM   215   C  CE3 . TRP A  1  25  ? 48.706  323.563 202.638 1.00 30.01  ? 25   TRP A CE3 1 
ATOM   216   C  CZ2 . TRP A  1  25  ? 46.443  325.255 202.174 1.00 33.73  ? 25   TRP A CZ2 1 
ATOM   217   C  CZ3 . TRP A  1  25  ? 48.711  324.505 201.580 1.00 34.14  ? 25   TRP A CZ3 1 
ATOM   218   C  CH2 . TRP A  1  25  ? 47.588  325.335 201.344 1.00 31.24  ? 25   TRP A CH2 1 
ATOM   219   N  N   . ALA A  1  26  ? 49.609  319.817 203.021 1.00 30.11  ? 26   ALA A N   1 
ATOM   220   C  CA  . ALA A  1  26  ? 50.166  319.545 201.691 1.00 29.38  ? 26   ALA A CA  1 
ATOM   221   C  C   . ALA A  1  26  ? 49.433  318.306 201.123 1.00 27.73  ? 26   ALA A C   1 
ATOM   222   O  O   . ALA A  1  26  ? 49.149  318.191 199.923 1.00 27.01  ? 26   ALA A O   1 
ATOM   223   C  CB  . ALA A  1  26  ? 51.730  319.281 201.823 1.00 27.23  ? 26   ALA A CB  1 
ATOM   224   N  N   . GLY A  1  27  ? 49.244  317.292 201.963 1.00 28.12  ? 27   GLY A N   1 
ATOM   225   C  CA  . GLY A  1  27  ? 48.624  316.102 201.529 1.00 28.53  ? 27   GLY A CA  1 
ATOM   226   C  C   . GLY A  1  27  ? 47.248  316.331 200.954 1.00 30.55  ? 27   GLY A C   1 
ATOM   227   O  O   . GLY A  1  27  ? 46.830  315.593 200.012 1.00 29.54  ? 27   GLY A O   1 
ATOM   228   N  N   . MET A  1  28  ? 46.494  317.261 201.523 1.00 28.49  ? 28   MET A N   1 
ATOM   229   C  CA  . MET A  1  28  ? 45.076  317.498 201.031 1.00 27.52  ? 28   MET A CA  1 
ATOM   230   C  C   . MET A  1  28  ? 45.297  318.189 199.621 1.00 29.23  ? 28   MET A C   1 
ATOM   231   O  O   . MET A  1  28  ? 44.521  317.967 198.658 1.00 24.42  ? 28   MET A O   1 
ATOM   232   C  CB  . MET A  1  28  ? 44.372  318.516 201.961 1.00 28.76  ? 28   MET A CB  1 
ATOM   233   C  CG  . MET A  1  28  ? 44.088  317.975 203.369 1.00 30.17  ? 28   MET A CG  1 
ATOM   234   S  SD  . MET A  1  28  ? 43.342  316.343 203.256 1.00 35.23  ? 28   MET A SD  1 
ATOM   235   C  CE  . MET A  1  28  ? 44.250  315.348 204.263 1.00 43.85  ? 28   MET A CE  1 
ATOM   236   N  N   . VAL A  1  29  ? 46.388  318.995 199.486 1.00 25.77  ? 29   VAL A N   1 
ATOM   237   C  CA  . VAL A  1  29  ? 46.565  319.650 198.176 1.00 26.91  ? 29   VAL A CA  1 
ATOM   238   C  C   . VAL A  1  29  ? 46.928  318.606 197.163 1.00 28.52  ? 29   VAL A C   1 
ATOM   239   O  O   . VAL A  1  29  ? 46.437  318.649 196.018 1.00 29.61  ? 29   VAL A O   1 
ATOM   240   C  CB  . VAL A  1  29  ? 47.688  320.759 198.239 1.00 27.05  ? 29   VAL A CB  1 
ATOM   241   C  CG1 . VAL A  1  29  ? 48.093  321.447 196.825 1.00 25.38  ? 29   VAL A CG1 1 
ATOM   242   C  CG2 . VAL A  1  29  ? 47.340  321.941 199.275 1.00 27.21  ? 29   VAL A CG2 1 
ATOM   243   N  N   . GLY A  1  30  ? 47.877  317.706 197.516 1.00 27.12  ? 30   GLY A N   1 
ATOM   244   C  CA  . GLY A  1  30  ? 48.405  316.817 196.487 1.00 29.85  ? 30   GLY A CA  1 
ATOM   245   C  C   . GLY A  1  30  ? 47.284  315.843 196.145 1.00 29.78  ? 30   GLY A C   1 
ATOM   246   O  O   . GLY A  1  30  ? 47.280  315.288 195.039 1.00 28.84  ? 30   GLY A O   1 
ATOM   247   N  N   . THR A  1  31  ? 46.408  315.572 197.113 1.00 28.03  ? 31   THR A N   1 
ATOM   248   C  CA  . THR A  1  31  ? 45.264  314.635 196.888 1.00 28.00  ? 31   THR A CA  1 
ATOM   249   C  C   . THR A  1  31  ? 44.249  315.242 195.881 1.00 28.01  ? 31   THR A C   1 
ATOM   250   O  O   . THR A  1  31  ? 43.826  314.579 194.954 1.00 28.99  ? 31   THR A O   1 
ATOM   251   C  CB  . THR A  1  31  ? 44.556  314.307 198.211 1.00 29.35  ? 31   THR A CB  1 
ATOM   252   O  OG1 . THR A  1  31  ? 45.461  313.538 199.037 1.00 27.67  ? 31   THR A OG1 1 
ATOM   253   C  CG2 . THR A  1  31  ? 43.322  313.475 197.977 1.00 28.13  ? 31   THR A CG2 1 
ATOM   254   N  N   . ALA A  1  32  ? 43.845  316.488 196.102 1.00 26.96  ? 32   ALA A N   1 
ATOM   255   C  CA  . ALA A  1  32  ? 42.995  317.247 195.128 1.00 27.97  ? 32   ALA A CA  1 
ATOM   256   C  C   . ALA A  1  32  ? 43.638  317.235 193.761 1.00 28.21  ? 32   ALA A C   1 
ATOM   257   O  O   . ALA A  1  32  ? 42.955  317.047 192.766 1.00 28.11  ? 32   ALA A O   1 
ATOM   258   C  CB  . ALA A  1  32  ? 42.843  318.719 195.672 1.00 25.79  ? 32   ALA A CB  1 
ATOM   259   N  N   . LEU A  1  33  ? 44.987  317.477 193.655 1.00 28.71  ? 33   LEU A N   1 
ATOM   260   C  CA  . LEU A  1  33  ? 45.618  317.476 192.386 1.00 25.98  ? 33   LEU A CA  1 
ATOM   261   C  C   . LEU A  1  33  ? 45.479  316.075 191.727 1.00 27.42  ? 33   LEU A C   1 
ATOM   262   O  O   . LEU A  1  33  ? 45.141  315.949 190.550 1.00 26.88  ? 33   LEU A O   1 
ATOM   263   C  CB  . LEU A  1  33  ? 47.117  317.930 192.505 1.00 24.76  ? 33   LEU A CB  1 
ATOM   264   C  CG  . LEU A  1  33  ? 47.320  319.435 192.739 1.00 23.06  ? 33   LEU A CG  1 
ATOM   265   C  CD1 . LEU A  1  33  ? 48.767  319.529 193.360 1.00 25.98  ? 33   LEU A CD1 1 
ATOM   266   C  CD2 . LEU A  1  33  ? 47.223  320.252 191.376 1.00 20.30  ? 33   LEU A CD2 1 
ATOM   267   N  N   . SER A  1  34  ? 45.703  314.997 192.491 1.00 26.34  ? 34   SER A N   1 
ATOM   268   C  CA  . SER A  1  34  ? 45.618  313.623 191.931 1.00 26.42  ? 34   SER A CA  1 
ATOM   269   C  C   . SER A  1  34  ? 44.157  313.335 191.513 1.00 27.18  ? 34   SER A C   1 
ATOM   270   O  O   . SER A  1  34  ? 43.878  312.585 190.530 1.00 29.29  ? 34   SER A O   1 
ATOM   271   C  CB  . SER A  1  34  ? 46.058  312.681 193.061 1.00 26.14  ? 34   SER A CB  1 
ATOM   272   O  OG  . SER A  1  34  ? 45.001  312.381 193.959 1.00 25.74  ? 34   SER A OG  1 
ATOM   273   N  N   . LEU A  1  35  ? 43.192  313.953 192.160 1.00 26.40  ? 35   LEU A N   1 
ATOM   274   C  CA  . LEU A  1  35  ? 41.807  313.612 191.799 1.00 26.48  ? 35   LEU A CA  1 
ATOM   275   C  C   . LEU A  1  35  ? 41.512  314.424 190.507 1.00 30.33  ? 35   LEU A C   1 
ATOM   276   O  O   . LEU A  1  35  ? 40.748  313.962 189.700 1.00 31.63  ? 35   LEU A O   1 
ATOM   277   C  CB  . LEU A  1  35  ? 40.810  314.033 192.828 1.00 25.82  ? 35   LEU A CB  1 
ATOM   278   C  CG  . LEU A  1  35  ? 40.925  313.088 194.043 1.00 30.27  ? 35   LEU A CG  1 
ATOM   279   C  CD1 . LEU A  1  35  ? 40.305  313.811 195.219 1.00 29.24  ? 35   LEU A CD1 1 
ATOM   280   C  CD2 . LEU A  1  35  ? 40.151  311.804 193.773 1.00 27.35  ? 35   LEU A CD2 1 
ATOM   281   N  N   . LEU A  1  36  ? 42.178  315.592 190.315 1.00 28.37  ? 36   LEU A N   1 
ATOM   282   C  CA  . LEU A  1  36  ? 41.984  316.311 189.031 1.00 31.36  ? 36   LEU A CA  1 
ATOM   283   C  C   . LEU A  1  36  ? 42.568  315.521 187.867 1.00 30.27  ? 36   LEU A C   1 
ATOM   284   O  O   . LEU A  1  36  ? 42.053  315.496 186.738 1.00 30.01  ? 36   LEU A O   1 
ATOM   285   C  CB  . LEU A  1  36  ? 42.579  317.750 189.127 1.00 31.35  ? 36   LEU A CB  1 
ATOM   286   C  CG  . LEU A  1  36  ? 41.653  318.654 189.997 1.00 27.96  ? 36   LEU A CG  1 
ATOM   287   C  CD1 . LEU A  1  36  ? 42.568  319.851 190.519 1.00 27.04  ? 36   LEU A CD1 1 
ATOM   288   C  CD2 . LEU A  1  36  ? 40.606  319.233 189.003 1.00 26.34  ? 36   LEU A CD2 1 
ATOM   289   N  N   . ILE A  1  37  ? 43.687  314.880 188.134 1.00 30.91  ? 37   ILE A N   1 
ATOM   290   C  CA  . ILE A  1  37  ? 44.304  314.032 187.148 1.00 27.71  ? 37   ILE A CA  1 
ATOM   291   C  C   . ILE A  1  37  ? 43.324  312.945 186.732 1.00 29.87  ? 37   ILE A C   1 
ATOM   292   O  O   . ILE A  1  37  ? 43.067  312.722 185.524 1.00 29.84  ? 37   ILE A O   1 
ATOM   293   C  CB  . ILE A  1  37  ? 45.582  313.285 187.772 1.00 27.71  ? 37   ILE A CB  1 
ATOM   294   C  CG1 . ILE A  1  37  ? 46.754  314.292 187.913 1.00 23.54  ? 37   ILE A CG1 1 
ATOM   295   C  CG2 . ILE A  1  37  ? 45.951  312.134 186.737 1.00 22.74  ? 37   ILE A CG2 1 
ATOM   296   C  CD1 . ILE A  1  37  ? 48.195  313.765 188.652 1.00 20.04  ? 37   ILE A CD1 1 
ATOM   297   N  N   . ARG A  1  38  ? 42.824  312.189 187.722 1.00 28.16  ? 38   ARG A N   1 
ATOM   298   C  CA  . ARG A  1  38  ? 41.966  311.043 187.482 1.00 28.02  ? 38   ARG A CA  1 
ATOM   299   C  C   . ARG A  1  38  ? 40.544  311.416 186.903 1.00 29.12  ? 38   ARG A C   1 
ATOM   300   O  O   . ARG A  1  38  ? 39.904  310.651 186.182 1.00 28.23  ? 38   ARG A O   1 
ATOM   301   C  CB  . ARG A  1  38  ? 41.975  310.133 188.757 1.00 26.18  ? 38   ARG A CB  1 
ATOM   302   C  CG  . ARG A  1  38  ? 43.329  309.358 188.913 1.00 24.83  ? 38   ARG A CG  1 
ATOM   303   C  CD  . ARG A  1  38  ? 43.248  307.965 188.453 1.00 24.19  ? 38   ARG A CD  1 
ATOM   304   N  NE  . ARG A  1  38  ? 42.641  307.708 187.055 1.00 27.76  ? 38   ARG A NE  1 
ATOM   305   C  CZ  . ARG A  1  38  ? 43.313  307.341 185.996 1.00 25.79  ? 38   ARG A CZ  1 
ATOM   306   N  NH1 . ARG A  1  38  ? 44.691  307.299 186.007 1.00 23.31  ? 38   ARG A NH1 1 
ATOM   307   N  NH2 . ARG A  1  38  ? 42.608  306.941 184.903 1.00 24.97  ? 38   ARG A NH2 1 
ATOM   308   N  N   . ALA A  1  39  ? 40.088  312.603 187.182 1.00 30.10  ? 39   ALA A N   1 
ATOM   309   C  CA  . ALA A  1  39  ? 38.845  313.125 186.586 1.00 29.18  ? 39   ALA A CA  1 
ATOM   310   C  C   . ALA A  1  39  ? 39.025  313.438 185.066 1.00 29.89  ? 39   ALA A C   1 
ATOM   311   O  O   . ALA A  1  39  ? 38.169  313.050 184.290 1.00 27.70  ? 39   ALA A O   1 
ATOM   312   C  CB  . ALA A  1  39  ? 38.399  314.460 187.337 1.00 25.48  ? 39   ALA A CB  1 
ATOM   313   N  N   . GLU A  1  40  ? 40.175  313.968 184.688 1.00 28.83  ? 40   GLU A N   1 
ATOM   314   C  CA  . GLU A  1  40  ? 40.501  314.234 183.283 1.00 29.78  ? 40   GLU A CA  1 
ATOM   315   C  C   . GLU A  1  40  ? 40.483  312.919 182.507 1.00 29.35  ? 40   GLU A C   1 
ATOM   316   O  O   . GLU A  1  40  ? 40.063  312.866 181.318 1.00 29.79  ? 40   GLU A O   1 
ATOM   317   C  CB  . GLU A  1  40  ? 41.877  314.902 183.183 1.00 28.64  ? 40   GLU A CB  1 
ATOM   318   C  CG  . GLU A  1  40  ? 42.377  315.121 181.653 1.00 27.15  ? 40   GLU A CG  1 
ATOM   319   C  CD  . GLU A  1  40  ? 41.407  315.979 180.784 1.00 33.63  ? 40   GLU A CD  1 
ATOM   320   O  OE1 . GLU A  1  40  ? 40.869  315.510 179.742 1.00 34.40  ? 40   GLU A OE1 1 
ATOM   321   O  OE2 . GLU A  1  40  ? 41.047  317.032 181.224 1.00 34.18  ? 40   GLU A OE2 1 
ATOM   322   N  N   . LEU A  1  41  ? 41.038  311.880 183.157 1.00 27.80  ? 41   LEU A N   1 
ATOM   323   C  CA  . LEU A  1  41  ? 41.228  310.557 182.524 1.00 27.14  ? 41   LEU A CA  1 
ATOM   324   C  C   . LEU A  1  41  ? 40.019  309.645 182.734 1.00 27.35  ? 41   LEU A C   1 
ATOM   325   O  O   . LEU A  1  41  ? 40.020  308.492 182.268 1.00 28.92  ? 41   LEU A O   1 
ATOM   326   C  CB  . LEU A  1  41  ? 42.497  309.903 183.051 1.00 26.19  ? 41   LEU A CB  1 
ATOM   327   C  CG  . LEU A  1  41  ? 43.816  310.681 182.758 1.00 22.08  ? 41   LEU A CG  1 
ATOM   328   C  CD1 . LEU A  1  41  ? 44.929  309.961 183.414 1.00 22.51  ? 41   LEU A CD1 1 
ATOM   329   C  CD2 . LEU A  1  41  ? 44.155  310.710 181.216 1.00 22.94  ? 41   LEU A CD2 1 
ATOM   330   N  N   . GLY A  1  42  ? 39.009  310.071 183.503 1.00 28.32  ? 42   GLY A N   1 
ATOM   331   C  CA  . GLY A  1  42  ? 37.934  309.134 183.945 1.00 28.03  ? 42   GLY A CA  1 
ATOM   332   C  C   . GLY A  1  42  ? 36.978  308.822 182.836 1.00 32.29  ? 42   GLY A C   1 
ATOM   333   O  O   . GLY A  1  42  ? 36.133  307.928 182.974 1.00 33.46  ? 42   GLY A O   1 
ATOM   334   N  N   . GLN A  1  43  ? 36.998  309.632 181.777 1.00 32.66  ? 43   GLN A N   1 
ATOM   335   C  CA  . GLN A  1  43  ? 36.307  309.201 180.573 1.00 33.40  ? 43   GLN A CA  1 
ATOM   336   C  C   . GLN A  1  43  ? 37.082  309.739 179.388 1.00 31.50  ? 43   GLN A C   1 
ATOM   337   O  O   . GLN A  1  43  ? 37.838  310.700 179.531 1.00 29.47  ? 43   GLN A O   1 
ATOM   338   C  CB  . GLN A  1  43  ? 34.779  309.554 180.564 1.00 33.34  ? 43   GLN A CB  1 
ATOM   339   C  CG  . GLN A  1  43  ? 34.526  310.996 180.342 1.00 34.37  ? 43   GLN A CG  1 
ATOM   340   C  CD  . GLN A  1  43  ? 33.028  311.397 180.059 1.00 34.21  ? 43   GLN A CD  1 
ATOM   341   O  OE1 . GLN A  1  43  ? 32.032  310.733 180.511 1.00 37.28  ? 43   GLN A OE1 1 
ATOM   342   N  NE2 . GLN A  1  43  ? 32.891  312.543 179.407 1.00 31.87  ? 43   GLN A NE2 1 
ATOM   343   N  N   . PRO A  1  44  ? 36.869  309.111 178.190 1.00 31.63  ? 44   PRO A N   1 
ATOM   344   C  CA  . PRO A  1  44  ? 37.558  309.468 176.934 1.00 32.26  ? 44   PRO A CA  1 
ATOM   345   C  C   . PRO A  1  44  ? 37.123  310.882 176.603 1.00 31.17  ? 44   PRO A C   1 
ATOM   346   O  O   . PRO A  1  44  ? 35.956  311.216 176.871 1.00 29.47  ? 44   PRO A O   1 
ATOM   347   C  CB  . PRO A  1  44  ? 36.919  308.521 175.920 1.00 31.64  ? 44   PRO A CB  1 
ATOM   348   C  CG  . PRO A  1  44  ? 36.226  307.468 176.662 1.00 35.30  ? 44   PRO A CG  1 
ATOM   349   C  CD  . PRO A  1  44  ? 35.947  307.937 178.039 1.00 31.33  ? 44   PRO A CD  1 
ATOM   350   N  N   . GLY A  1  45  ? 38.042  311.690 176.101 1.00 30.56  ? 45   GLY A N   1 
ATOM   351   C  CA  . GLY A  1  45  ? 37.773  313.042 175.680 1.00 33.12  ? 45   GLY A CA  1 
ATOM   352   C  C   . GLY A  1  45  ? 38.501  314.005 176.611 1.00 34.90  ? 45   GLY A C   1 
ATOM   353   O  O   . GLY A  1  45  ? 39.526  313.677 177.263 1.00 33.85  ? 45   GLY A O   1 
ATOM   354   N  N   . THR A  1  46  ? 38.038  315.219 176.625 1.00 36.42  ? 46   THR A N   1 
ATOM   355   C  CA  . THR A  1  46  ? 38.732  316.248 177.395 1.00 39.51  ? 46   THR A CA  1 
ATOM   356   C  C   . THR A  1  46  ? 37.777  316.776 178.438 1.00 40.57  ? 46   THR A C   1 
ATOM   357   O  O   . THR A  1  46  ? 36.534  316.893 178.218 1.00 42.03  ? 46   THR A O   1 
ATOM   358   C  CB  . THR A  1  46  ? 39.267  317.401 176.591 1.00 40.58  ? 46   THR A CB  1 
ATOM   359   O  OG1 . THR A  1  46  ? 40.054  318.229 177.496 1.00 46.02  ? 46   THR A OG1 1 
ATOM   360   C  CG2 . THR A  1  46  ? 38.076  318.301 176.002 1.00 40.07  ? 46   THR A CG2 1 
ATOM   361   N  N   . LEU A  1  47  ? 38.318  316.958 179.630 1.00 39.51  ? 47   LEU A N   1 
ATOM   362   C  CA  . LEU A  1  47  ? 37.552  317.517 180.720 1.00 38.20  ? 47   LEU A CA  1 
ATOM   363   C  C   . LEU A  1  47  ? 37.930  319.022 180.902 1.00 39.37  ? 47   LEU A C   1 
ATOM   364   O  O   . LEU A  1  47  ? 37.060  319.966 180.896 1.00 39.21  ? 47   LEU A O   1 
ATOM   365   C  CB  . LEU A  1  47  ? 37.823  316.698 182.023 1.00 36.88  ? 47   LEU A CB  1 
ATOM   366   C  CG  . LEU A  1  47  ? 37.222  317.414 183.216 1.00 36.53  ? 47   LEU A CG  1 
ATOM   367   C  CD1 . LEU A  1  47  ? 35.682  317.376 183.018 1.00 33.89  ? 47   LEU A CD1 1 
ATOM   368   C  CD2 . LEU A  1  47  ? 37.605  316.727 184.615 1.00 38.43  ? 47   LEU A CD2 1 
ATOM   369   N  N   . LEU A  1  48  ? 39.230  319.252 181.090 1.00 39.97  ? 48   LEU A N   1 
ATOM   370   C  CA  . LEU A  1  48  ? 39.618  320.581 181.319 1.00 42.52  ? 48   LEU A CA  1 
ATOM   371   C  C   . LEU A  1  48  ? 39.646  321.366 180.006 1.00 42.86  ? 48   LEU A C   1 
ATOM   372   O  O   . LEU A  1  48  ? 39.702  322.595 180.023 1.00 45.04  ? 48   LEU A O   1 
ATOM   373   C  CB  . LEU A  1  48  ? 41.003  320.636 182.008 1.00 42.02  ? 48   LEU A CB  1 
ATOM   374   C  CG  . LEU A  1  48  ? 41.062  319.909 183.396 1.00 39.99  ? 48   LEU A CG  1 
ATOM   375   C  CD1 . LEU A  1  48  ? 42.426  320.047 184.039 1.00 37.20  ? 48   LEU A CD1 1 
ATOM   376   C  CD2 . LEU A  1  48  ? 40.030  320.299 184.443 1.00 38.19  ? 48   LEU A CD2 1 
ATOM   377   N  N   . GLY A  1  49  ? 39.782  320.684 178.884 1.00 43.34  ? 49   GLY A N   1 
ATOM   378   C  CA  . GLY A  1  49  ? 39.916  321.401 177.622 1.00 44.36  ? 49   GLY A CA  1 
ATOM   379   C  C   . GLY A  1  49  ? 41.204  322.195 177.569 1.00 45.83  ? 49   GLY A C   1 
ATOM   380   O  O   . GLY A  1  49  ? 41.331  323.096 176.737 1.00 47.73  ? 49   GLY A O   1 
ATOM   381   N  N   . ASP A  1  50  ? 42.191  321.880 178.391 1.00 43.37  ? 50   ASP A N   1 
ATOM   382   C  CA  . ASP A  1  50  ? 43.402  322.700 178.415 1.00 42.37  ? 50   ASP A CA  1 
ATOM   383   C  C   . ASP A  1  50  ? 44.551  321.860 178.909 1.00 42.04  ? 50   ASP A C   1 
ATOM   384   O  O   . ASP A  1  50  ? 44.655  321.558 180.100 1.00 41.29  ? 50   ASP A O   1 
ATOM   385   C  CB  . ASP A  1  50  ? 43.231  323.920 179.332 1.00 41.22  ? 50   ASP A CB  1 
ATOM   386   C  CG  . ASP A  1  50  ? 44.358  324.941 179.118 1.00 43.61  ? 50   ASP A CG  1 
ATOM   387   O  OD1 . ASP A  1  50  ? 45.442  324.498 178.822 1.00 46.31  ? 50   ASP A OD1 1 
ATOM   388   O  OD2 . ASP A  1  50  ? 44.191  326.169 179.211 1.00 48.65  ? 50   ASP A OD2 1 
ATOM   389   N  N   . ASP A  1  51  ? 45.339  321.347 177.983 1.00 40.47  ? 51   ASP A N   1 
ATOM   390   C  CA  . ASP A  1  51  ? 46.297  320.297 178.359 1.00 41.61  ? 51   ASP A CA  1 
ATOM   391   C  C   . ASP A  1  51  ? 47.574  320.864 178.945 1.00 39.44  ? 51   ASP A C   1 
ATOM   392   O  O   . ASP A  1  51  ? 48.372  320.112 179.603 1.00 37.92  ? 51   ASP A O   1 
ATOM   393   C  CB  . ASP A  1  51  ? 46.601  319.368 177.146 1.00 42.38  ? 51   ASP A CB  1 
ATOM   394   C  CG  . ASP A  1  51  ? 45.371  318.565 176.709 1.00 45.85  ? 51   ASP A CG  1 
ATOM   395   O  OD1 . ASP A  1  51  ? 45.150  318.459 175.483 1.00 54.70  ? 51   ASP A OD1 1 
ATOM   396   O  OD2 . ASP A  1  51  ? 44.532  318.140 177.548 1.00 46.86  ? 51   ASP A OD2 1 
ATOM   397   N  N   . GLN A  1  52  ? 47.800  322.167 178.714 1.00 36.08  ? 52   GLN A N   1 
ATOM   398   C  CA  . GLN A  1  52  ? 48.845  322.786 179.462 1.00 34.48  ? 52   GLN A CA  1 
ATOM   399   C  C   . GLN A  1  52  ? 48.369  322.730 180.997 1.00 33.82  ? 52   GLN A C   1 
ATOM   400   O  O   . GLN A  1  52  ? 49.152  322.460 181.866 1.00 32.24  ? 52   GLN A O   1 
ATOM   401   C  CB  . GLN A  1  52  ? 49.005  324.211 179.021 1.00 34.21  ? 52   GLN A CB  1 
ATOM   402   C  CG  . GLN A  1  52  ? 50.023  325.026 179.949 1.00 31.63  ? 52   GLN A CG  1 
ATOM   403   C  CD  . GLN A  1  52  ? 51.520  324.622 179.902 1.00 33.38  ? 52   GLN A CD  1 
ATOM   404   O  OE1 . GLN A  1  52  ? 51.946  323.880 179.047 1.00 32.86  ? 52   GLN A OE1 1 
ATOM   405   N  NE2 . GLN A  1  52  ? 52.331  325.233 180.796 1.00 30.06  ? 52   GLN A NE2 1 
ATOM   406   N  N   . ILE A  1  53  ? 47.094  322.948 181.271 1.00 32.25  ? 53   ILE A N   1 
ATOM   407   C  CA  . ILE A  1  53  ? 46.629  322.973 182.657 1.00 33.34  ? 53   ILE A CA  1 
ATOM   408   C  C   . ILE A  1  53  ? 46.757  321.514 183.208 1.00 32.58  ? 53   ILE A C   1 
ATOM   409   O  O   . ILE A  1  53  ? 47.227  321.338 184.355 1.00 33.01  ? 53   ILE A O   1 
ATOM   410   C  CB  . ILE A  1  53  ? 45.150  323.502 182.841 1.00 32.30  ? 53   ILE A CB  1 
ATOM   411   C  CG1 . ILE A  1  53  ? 44.937  324.947 182.404 1.00 38.35  ? 53   ILE A CG1 1 
ATOM   412   C  CG2 . ILE A  1  53  ? 44.746  323.403 184.327 1.00 36.70  ? 53   ILE A CG2 1 
ATOM   413   C  CD1 . ILE A  1  53  ? 43.314  325.445 182.595 1.00 43.26  ? 53   ILE A CD1 1 
ATOM   414   N  N   . TYR A  1  54  ? 46.361  320.488 182.411 1.00 32.35  ? 54   TYR A N   1 
ATOM   415   C  CA  . TYR A  1  54  ? 46.538  319.103 182.822 1.00 30.75  ? 54   TYR A CA  1 
ATOM   416   C  C   . TYR A  1  54  ? 48.069  318.860 183.252 1.00 30.78  ? 54   TYR A C   1 
ATOM   417   O  O   . TYR A  1  54  ? 48.355  318.362 184.336 1.00 29.72  ? 54   TYR A O   1 
ATOM   418   C  CB  . TYR A  1  54  ? 46.135  318.153 181.686 1.00 29.54  ? 54   TYR A CB  1 
ATOM   419   C  CG  . TYR A  1  54  ? 46.348  316.688 182.122 1.00 29.58  ? 54   TYR A CG  1 
ATOM   420   C  CD1 . TYR A  1  54  ? 47.510  316.016 181.775 1.00 28.04  ? 54   TYR A CD1 1 
ATOM   421   C  CD2 . TYR A  1  54  ? 45.460  316.061 182.988 1.00 31.94  ? 54   TYR A CD2 1 
ATOM   422   C  CE1 . TYR A  1  54  ? 47.759  314.794 182.230 1.00 28.25  ? 54   TYR A CE1 1 
ATOM   423   C  CE2 . TYR A  1  54  ? 45.677  314.760 183.447 1.00 25.48  ? 54   TYR A CE2 1 
ATOM   424   C  CZ  . TYR A  1  54  ? 46.803  314.133 183.013 1.00 26.02  ? 54   TYR A CZ  1 
ATOM   425   O  OH  . TYR A  1  54  ? 47.084  312.860 183.508 1.00 26.40  ? 54   TYR A OH  1 
ATOM   426   N  N   . ASN A  1  55  ? 48.996  319.299 182.422 1.00 26.13  ? 55   ASN A N   1 
ATOM   427   C  CA  . ASN A  1  55  ? 50.440  319.038 182.664 1.00 28.69  ? 55   ASN A CA  1 
ATOM   428   C  C   . ASN A  1  55  ? 50.918  319.807 183.890 1.00 27.04  ? 55   ASN A C   1 
ATOM   429   O  O   . ASN A  1  55  ? 51.747  319.302 184.636 1.00 26.70  ? 55   ASN A O   1 
ATOM   430   C  CB  . ASN A  1  55  ? 51.311  319.418 181.481 1.00 26.99  ? 55   ASN A CB  1 
ATOM   431   C  CG  . ASN A  1  55  ? 50.982  318.613 180.249 1.00 30.17  ? 55   ASN A CG  1 
ATOM   432   O  OD1 . ASN A  1  55  ? 50.347  317.549 180.330 1.00 29.88  ? 55   ASN A OD1 1 
ATOM   433   N  ND2 . ASN A  1  55  ? 51.498  319.054 179.090 1.00 28.99  ? 55   ASN A ND2 1 
ATOM   434   N  N   . VAL A  1  56  ? 50.305  320.955 184.144 1.00 27.66  ? 56   VAL A N   1 
ATOM   435   C  CA  . VAL A  1  56  ? 50.670  321.726 185.359 1.00 28.58  ? 56   VAL A CA  1 
ATOM   436   C  C   . VAL A  1  56  ? 50.146  320.968 186.642 1.00 27.31  ? 56   VAL A C   1 
ATOM   437   O  O   . VAL A  1  56  ? 50.828  320.958 187.697 1.00 28.53  ? 56   VAL A O   1 
ATOM   438   C  CB  . VAL A  1  56  ? 50.037  323.095 185.274 1.00 31.00  ? 56   VAL A CB  1 
ATOM   439   C  CG1 . VAL A  1  56  ? 50.161  323.879 186.621 1.00 28.27  ? 56   VAL A CG1 1 
ATOM   440   C  CG2 . VAL A  1  56  ? 50.720  323.909 184.099 1.00 28.27  ? 56   VAL A CG2 1 
ATOM   441   N  N   . VAL A  1  57  ? 48.951  320.399 186.534 1.00 26.03  ? 57   VAL A N   1 
ATOM   442   C  CA  . VAL A  1  57  ? 48.352  319.633 187.601 1.00 26.09  ? 57   VAL A CA  1 
ATOM   443   C  C   . VAL A  1  57  ? 49.207  318.371 187.952 1.00 27.17  ? 57   VAL A C   1 
ATOM   444   O  O   . VAL A  1  57  ? 49.478  318.086 189.133 1.00 28.46  ? 57   VAL A O   1 
ATOM   445   C  CB  . VAL A  1  57  ? 46.859  319.181 187.212 1.00 26.13  ? 57   VAL A CB  1 
ATOM   446   C  CG1 . VAL A  1  57  ? 46.371  318.105 188.256 1.00 19.49  ? 57   VAL A CG1 1 
ATOM   447   C  CG2 . VAL A  1  57  ? 45.958  320.448 187.294 1.00 22.16  ? 57   VAL A CG2 1 
ATOM   448   N  N   . VAL A  1  58  ? 49.601  317.625 186.907 1.00 25.29  ? 58   VAL A N   1 
ATOM   449   C  CA  . VAL A  1  58  ? 50.480  316.472 187.064 1.00 25.85  ? 58   VAL A CA  1 
ATOM   450   C  C   . VAL A  1  58  ? 51.789  316.866 187.751 1.00 27.17  ? 58   VAL A C   1 
ATOM   451   O  O   . VAL A  1  58  ? 52.179  316.223 188.765 1.00 27.17  ? 58   VAL A O   1 
ATOM   452   C  CB  . VAL A  1  58  ? 50.801  315.767 185.658 1.00 25.75  ? 58   VAL A CB  1 
ATOM   453   C  CG1 . VAL A  1  58  ? 52.018  314.764 185.884 1.00 25.07  ? 58   VAL A CG1 1 
ATOM   454   C  CG2 . VAL A  1  58  ? 49.469  315.100 185.173 1.00 23.29  ? 58   VAL A CG2 1 
ATOM   455   N  N   . THR A  1  59  ? 52.505  317.827 187.156 1.00 26.72  ? 59   THR A N   1 
ATOM   456   C  CA  . THR A  1  59  ? 53.691  318.382 187.806 1.00 27.23  ? 59   THR A CA  1 
ATOM   457   C  C   . THR A  1  59  ? 53.533  318.780 189.334 1.00 26.50  ? 59   THR A C   1 
ATOM   458   O  O   . THR A  1  59  ? 54.345  318.395 190.194 1.00 24.51  ? 59   THR A O   1 
ATOM   459   C  CB  . THR A  1  59  ? 54.179  319.603 186.949 1.00 27.14  ? 59   THR A CB  1 
ATOM   460   O  OG1 . THR A  1  59  ? 54.265  319.181 185.563 1.00 27.81  ? 59   THR A OG1 1 
ATOM   461   C  CG2 . THR A  1  59  ? 55.611  320.109 187.489 1.00 24.84  ? 59   THR A CG2 1 
ATOM   462   N  N   . ALA A  1  60  ? 52.484  319.549 189.686 1.00 27.67  ? 60   ALA A N   1 
ATOM   463   C  CA  . ALA A  1  60  ? 52.305  320.097 191.016 1.00 26.32  ? 60   ALA A CA  1 
ATOM   464   C  C   . ALA A  1  60  ? 51.984  318.899 191.954 1.00 28.65  ? 60   ALA A C   1 
ATOM   465   O  O   . ALA A  1  60  ? 52.407  318.874 193.072 1.00 31.06  ? 60   ALA A O   1 
ATOM   466   C  CB  . ALA A  1  60  ? 51.094  321.064 190.948 1.00 29.93  ? 60   ALA A CB  1 
ATOM   467   N  N   . HIS A  1  61  ? 51.239  317.928 191.447 1.00 27.10  ? 61   HIS A N   1 
ATOM   468   C  CA  . HIS A  1  61  ? 50.729  316.748 192.213 1.00 28.29  ? 61   HIS A CA  1 
ATOM   469   C  C   . HIS A  1  61  ? 52.069  316.104 192.741 1.00 29.85  ? 61   HIS A C   1 
ATOM   470   O  O   . HIS A  1  61  ? 52.225  315.858 193.948 1.00 28.62  ? 61   HIS A O   1 
ATOM   471   C  CB  . HIS A  1  61  ? 50.031  315.767 191.285 1.00 24.63  ? 61   HIS A CB  1 
ATOM   472   C  CG  . HIS A  1  61  ? 49.937  314.333 191.850 1.00 25.73  ? 61   HIS A CG  1 
ATOM   473   N  ND1 . HIS A  1  61  ? 49.320  314.052 193.058 1.00 25.82  ? 61   HIS A ND1 1 
ATOM   474   C  CD2 . HIS A  1  61  ? 50.443  313.147 191.410 1.00 28.56  ? 61   HIS A CD2 1 
ATOM   475   C  CE1 . HIS A  1  61  ? 49.360  312.742 193.287 1.00 27.87  ? 61   HIS A CE1 1 
ATOM   476   N  NE2 . HIS A  1  61  ? 50.141  312.182 192.374 1.00 26.76  ? 61   HIS A NE2 1 
ATOM   477   N  N   . ALA A  1  62  ? 52.963  315.772 191.788 1.00 26.67  ? 62   ALA A N   1 
ATOM   478   C  CA  . ALA A  1  62  ? 54.225  315.099 192.199 1.00 26.58  ? 62   ALA A CA  1 
ATOM   479   C  C   . ALA A  1  62  ? 55.044  315.974 193.189 1.00 26.29  ? 62   ALA A C   1 
ATOM   480   O  O   . ALA A  1  62  ? 55.489  315.481 194.218 1.00 26.14  ? 62   ALA A O   1 
ATOM   481   C  CB  . ALA A  1  62  ? 55.029  314.829 190.982 1.00 26.14  ? 62   ALA A CB  1 
ATOM   482   N  N   . PHE A  1  63  ? 55.281  317.277 192.904 1.00 26.74  ? 63   PHE A N   1 
ATOM   483   C  CA  . PHE A  1  63  ? 56.143  318.095 193.806 1.00 25.65  ? 63   PHE A CA  1 
ATOM   484   C  C   . PHE A  1  63  ? 55.494  318.238 195.182 1.00 27.23  ? 63   PHE A C   1 
ATOM   485   O  O   . PHE A  1  63  ? 56.151  318.186 196.236 1.00 24.22  ? 63   PHE A O   1 
ATOM   486   C  CB  . PHE A  1  63  ? 56.270  319.530 193.209 1.00 25.08  ? 63   PHE A CB  1 
ATOM   487   C  CG  . PHE A  1  63  ? 57.302  319.650 192.099 1.00 27.04  ? 63   PHE A CG  1 
ATOM   488   C  CD1 . PHE A  1  63  ? 58.571  318.996 192.226 1.00 30.52  ? 63   PHE A CD1 1 
ATOM   489   C  CD2 . PHE A  1  63  ? 57.039  320.377 190.952 1.00 27.02  ? 63   PHE A CD2 1 
ATOM   490   C  CE1 . PHE A  1  63  ? 59.456  319.042 191.201 1.00 29.37  ? 63   PHE A CE1 1 
ATOM   491   C  CE2 . PHE A  1  63  ? 57.944  320.503 189.954 1.00 26.97  ? 63   PHE A CE2 1 
ATOM   492   C  CZ  . PHE A  1  63  ? 59.179  319.895 190.087 1.00 26.24  ? 63   PHE A CZ  1 
ATOM   493   N  N   . VAL A  1  64  ? 54.139  318.385 195.206 1.00 27.18  ? 64   VAL A N   1 
ATOM   494   C  CA  . VAL A  1  64  ? 53.507  318.520 196.507 1.00 24.72  ? 64   VAL A CA  1 
ATOM   495   C  C   . VAL A  1  64  ? 53.600  317.201 197.336 1.00 27.57  ? 64   VAL A C   1 
ATOM   496   O  O   . VAL A  1  64  ? 53.958  317.226 198.552 1.00 27.07  ? 64   VAL A O   1 
ATOM   497   C  CB  . VAL A  1  64  ? 52.031  318.874 196.280 1.00 26.89  ? 64   VAL A CB  1 
ATOM   498   C  CG1 . VAL A  1  64  ? 51.243  318.797 197.697 1.00 26.01  ? 64   VAL A CG1 1 
ATOM   499   C  CG2 . VAL A  1  64  ? 51.977  320.350 195.746 1.00 20.39  ? 64   VAL A CG2 1 
ATOM   500   N  N   . MET A  1  65  ? 53.247  316.030 196.724 1.00 26.02  ? 65   MET A N   1 
ATOM   501   C  CA  . MET A  1  65  ? 53.266  314.769 197.444 1.00 25.85  ? 65   MET A CA  1 
ATOM   502   C  C   . MET A  1  65  ? 54.672  314.528 197.903 1.00 26.51  ? 65   MET A C   1 
ATOM   503   O  O   . MET A  1  65  ? 54.835  314.012 199.007 1.00 28.00  ? 65   MET A O   1 
ATOM   504   C  CB  . MET A  1  65  ? 52.763  313.550 196.606 1.00 23.51  ? 65   MET A CB  1 
ATOM   505   C  CG  . MET A  1  65  ? 51.240  313.689 196.203 1.00 23.08  ? 65   MET A CG  1 
ATOM   506   S  SD  . MET A  1  65  ? 50.373  313.803 197.864 1.00 28.39  ? 65   MET A SD  1 
ATOM   507   C  CE  . MET A  1  65  ? 48.840  312.922 197.357 1.00 21.89  ? 65   MET A CE  1 
ATOM   508   N  N   . ILE A  1  66  ? 55.671  314.757 197.071 1.00 23.84  ? 66   ILE A N   1 
ATOM   509   C  CA  . ILE A  1  66  ? 57.057  314.402 197.447 1.00 24.48  ? 66   ILE A CA  1 
ATOM   510   C  C   . ILE A  1  66  ? 57.727  315.354 198.453 1.00 26.34  ? 66   ILE A C   1 
ATOM   511   O  O   . ILE A  1  66  ? 58.146  314.973 199.619 1.00 25.44  ? 66   ILE A O   1 
ATOM   512   C  CB  . ILE A  1  66  ? 57.949  314.321 196.181 1.00 23.73  ? 66   ILE A CB  1 
ATOM   513   C  CG1 . ILE A  1  66  ? 57.512  313.057 195.373 1.00 25.10  ? 66   ILE A CG1 1 
ATOM   514   C  CG2 . ILE A  1  66  ? 59.519  314.371 196.620 1.00 22.86  ? 66   ILE A CG2 1 
ATOM   515   C  CD1 . ILE A  1  66  ? 58.297  312.946 194.004 1.00 29.98  ? 66   ILE A CD1 1 
ATOM   516   N  N   . PHE A  1  67  ? 57.740  316.644 198.091 1.00 26.59  ? 67   PHE A N   1 
ATOM   517   C  CA  . PHE A  1  67  ? 58.482  317.624 198.893 1.00 24.44  ? 67   PHE A CA  1 
ATOM   518   C  C   . PHE A  1  67  ? 57.726  318.242 200.044 1.00 26.36  ? 67   PHE A C   1 
ATOM   519   O  O   . PHE A  1  67  ? 58.327  318.756 200.987 1.00 24.17  ? 67   PHE A O   1 
ATOM   520   C  CB  . PHE A  1  67  ? 58.905  318.740 197.947 1.00 23.67  ? 67   PHE A CB  1 
ATOM   521   C  CG  . PHE A  1  67  ? 59.975  318.294 197.001 1.00 27.51  ? 67   PHE A CG  1 
ATOM   522   C  CD1 . PHE A  1  67  ? 61.292  318.218 197.431 1.00 31.78  ? 67   PHE A CD1 1 
ATOM   523   C  CD2 . PHE A  1  67  ? 59.642  317.874 195.716 1.00 28.13  ? 67   PHE A CD2 1 
ATOM   524   C  CE1 . PHE A  1  67  ? 62.361  317.732 196.567 1.00 29.76  ? 67   PHE A CE1 1 
ATOM   525   C  CE2 . PHE A  1  67  ? 60.675  317.337 194.787 1.00 26.54  ? 67   PHE A CE2 1 
ATOM   526   C  CZ  . PHE A  1  67  ? 62.080  317.351 195.230 1.00 24.64  ? 67   PHE A CZ  1 
ATOM   527   N  N   . PHE A  1  68  ? 56.378  318.273 199.918 1.00 26.34  ? 68   PHE A N   1 
ATOM   528   C  CA  . PHE A  1  68  ? 55.603  318.938 200.949 1.00 25.98  ? 68   PHE A CA  1 
ATOM   529   C  C   . PHE A  1  68  ? 54.783  317.957 201.780 1.00 27.16  ? 68   PHE A C   1 
ATOM   530   O  O   . PHE A  1  68  ? 54.439  318.312 202.951 1.00 26.46  ? 68   PHE A O   1 
ATOM   531   C  CB  . PHE A  1  68  ? 54.718  320.107 200.420 1.00 26.30  ? 68   PHE A CB  1 
ATOM   532   C  CG  . PHE A  1  68  ? 55.512  321.121 199.686 1.00 25.56  ? 68   PHE A CG  1 
ATOM   533   C  CD1 . PHE A  1  68  ? 56.703  321.594 200.224 1.00 27.56  ? 68   PHE A CD1 1 
ATOM   534   C  CD2 . PHE A  1  68  ? 55.186  321.501 198.403 1.00 29.92  ? 68   PHE A CD2 1 
ATOM   535   C  CE1 . PHE A  1  68  ? 57.562  322.421 199.551 1.00 26.23  ? 68   PHE A CE1 1 
ATOM   536   C  CE2 . PHE A  1  68  ? 56.115  322.475 197.651 1.00 32.69  ? 68   PHE A CE2 1 
ATOM   537   C  CZ  . PHE A  1  68  ? 57.317  322.848 198.267 1.00 29.62  ? 68   PHE A CZ  1 
ATOM   538   N  N   . MET A  1  69  ? 54.504  316.729 201.271 1.00 23.20  ? 69   MET A N   1 
ATOM   539   C  CA  . MET A  1  69  ? 53.795  315.847 202.140 1.00 24.60  ? 69   MET A CA  1 
ATOM   540   C  C   . MET A  1  69  ? 54.737  314.781 202.722 1.00 25.33  ? 69   MET A C   1 
ATOM   541   O  O   . MET A  1  69  ? 54.977  314.683 203.969 1.00 26.41  ? 69   MET A O   1 
ATOM   542   C  CB  . MET A  1  69  ? 52.504  315.300 201.430 1.00 24.19  ? 69   MET A CB  1 
ATOM   543   C  CG  . MET A  1  69  ? 51.634  314.347 202.346 1.00 23.82  ? 69   MET A CG  1 
ATOM   544   S  SD  . MET A  1  69  ? 52.185  312.571 202.488 1.00 30.31  ? 69   MET A SD  1 
ATOM   545   C  CE  . MET A  1  69  ? 51.918  311.847 200.799 1.00 26.58  ? 69   MET A CE  1 
ATOM   546   N  N   . VAL A  1  70  ? 55.355  314.003 201.858 1.00 25.61  ? 70   VAL A N   1 
ATOM   547   C  CA  . VAL A  1  70  ? 56.118  312.871 202.367 1.00 24.10  ? 70   VAL A CA  1 
ATOM   548   C  C   . VAL A  1  70  ? 57.370  313.294 203.146 1.00 27.72  ? 70   VAL A C   1 
ATOM   549   O  O   . VAL A  1  70  ? 57.597  312.801 204.340 1.00 28.12  ? 70   VAL A O   1 
ATOM   550   C  CB  . VAL A  1  70  ? 56.550  311.851 201.207 1.00 23.01  ? 70   VAL A CB  1 
ATOM   551   C  CG1 . VAL A  1  70  ? 57.401  310.724 201.934 1.00 22.22  ? 70   VAL A CG1 1 
ATOM   552   C  CG2 . VAL A  1  70  ? 55.300  311.130 200.723 1.00 24.32  ? 70   VAL A CG2 1 
ATOM   553   N  N   . MET A  1  71  ? 58.238  314.110 202.532 1.00 27.21  ? 71   MET A N   1 
ATOM   554   C  CA  . MET A  1  71  ? 59.496  314.388 203.254 1.00 28.07  ? 71   MET A CA  1 
ATOM   555   C  C   . MET A  1  71  ? 59.235  315.112 204.584 1.00 27.18  ? 71   MET A C   1 
ATOM   556   O  O   . MET A  1  71  ? 59.813  314.761 205.619 1.00 29.01  ? 71   MET A O   1 
ATOM   557   C  CB  . MET A  1  71  ? 60.417  315.184 202.385 1.00 25.40  ? 71   MET A CB  1 
ATOM   558   C  CG  . MET A  1  71  ? 60.955  314.333 201.162 1.00 30.87  ? 71   MET A CG  1 
ATOM   559   S  SD  . MET A  1  71  ? 61.964  315.356 200.095 1.00 39.42  ? 71   MET A SD  1 
ATOM   560   C  CE  . MET A  1  71  ? 63.500  315.161 200.904 1.00 34.48  ? 71   MET A CE  1 
ATOM   561   N  N   . PRO A  1  72  ? 58.376  316.142 204.567 1.00 27.39  ? 72   PRO A N   1 
ATOM   562   C  CA  . PRO A  1  72  ? 58.113  316.791 205.898 1.00 27.78  ? 72   PRO A CA  1 
ATOM   563   C  C   . PRO A  1  72  ? 57.516  315.868 206.930 1.00 27.68  ? 72   PRO A C   1 
ATOM   564   O  O   . PRO A  1  72  ? 57.835  315.990 208.137 1.00 28.82  ? 72   PRO A O   1 
ATOM   565   C  CB  . PRO A  1  72  ? 57.087  317.907 205.552 1.00 25.00  ? 72   PRO A CB  1 
ATOM   566   C  CG  . PRO A  1  72  ? 57.432  318.244 204.075 1.00 26.83  ? 72   PRO A CG  1 
ATOM   567   C  CD  . PRO A  1  72  ? 57.729  316.887 203.447 1.00 26.01  ? 72   PRO A CD  1 
ATOM   568   N  N   . ILE A  1  73  ? 56.579  315.027 206.535 1.00 29.32  ? 73   ILE A N   1 
ATOM   569   C  CA  . ILE A  1  73  ? 55.990  314.214 207.547 1.00 27.54  ? 73   ILE A CA  1 
ATOM   570   C  C   . ILE A  1  73  ? 57.050  313.209 208.119 1.00 30.58  ? 73   ILE A C   1 
ATOM   571   O  O   . ILE A  1  73  ? 57.220  313.025 209.345 1.00 29.12  ? 73   ILE A O   1 
ATOM   572   C  CB  . ILE A  1  73  ? 54.769  313.505 206.983 1.00 28.79  ? 73   ILE A CB  1 
ATOM   573   C  CG1 . ILE A  1  73  ? 53.570  314.485 206.858 1.00 25.61  ? 73   ILE A CG1 1 
ATOM   574   C  CG2 . ILE A  1  73  ? 54.362  312.391 207.916 1.00 25.83  ? 73   ILE A CG2 1 
ATOM   575   C  CD1 . ILE A  1  73  ? 52.224  313.806 206.127 1.00 26.80  ? 73   ILE A CD1 1 
ATOM   576   N  N   . MET A  1  74  ? 57.677  312.452 207.249 1.00 30.79  ? 74   MET A N   1 
ATOM   577   C  CA  . MET A  1  74  ? 58.584  311.383 207.656 1.00 29.78  ? 74   MET A CA  1 
ATOM   578   C  C   . MET A  1  74  ? 59.791  311.947 208.416 1.00 30.15  ? 74   MET A C   1 
ATOM   579   O  O   . MET A  1  74  ? 60.076  311.499 209.532 1.00 28.17  ? 74   MET A O   1 
ATOM   580   C  CB  . MET A  1  74  ? 58.930  310.508 206.426 1.00 31.91  ? 74   MET A CB  1 
ATOM   581   C  CG  . MET A  1  74  ? 57.758  309.247 206.258 1.00 30.43  ? 74   MET A CG  1 
ATOM   582   S  SD  . MET A  1  74  ? 58.552  308.499 204.967 1.00 47.79  ? 74   MET A SD  1 
ATOM   583   C  CE  . MET A  1  74  ? 57.292  307.230 204.471 1.00 40.06  ? 74   MET A CE  1 
ATOM   584   N  N   . ILE A  1  75  ? 60.480  312.913 207.858 1.00 27.07  ? 75   ILE A N   1 
ATOM   585   C  CA  . ILE A  1  75  ? 61.737  313.309 208.461 1.00 27.47  ? 75   ILE A CA  1 
ATOM   586   C  C   . ILE A  1  75  ? 61.485  314.484 209.410 1.00 29.68  ? 75   ILE A C   1 
ATOM   587   O  O   . ILE A  1  75  ? 61.933  314.419 210.569 1.00 28.36  ? 75   ILE A O   1 
ATOM   588   C  CB  . ILE A  1  75  ? 62.729  313.703 207.328 1.00 29.65  ? 75   ILE A CB  1 
ATOM   589   C  CG1 . ILE A  1  75  ? 62.875  312.539 206.267 1.00 30.67  ? 75   ILE A CG1 1 
ATOM   590   C  CG2 . ILE A  1  75  ? 64.029  314.250 207.882 1.00 29.45  ? 75   ILE A CG2 1 
ATOM   591   C  CD1 . ILE A  1  75  ? 62.894  313.091 204.634 1.00 34.80  ? 75   ILE A CD1 1 
ATOM   592   N  N   . GLY A  1  76  ? 60.830  315.570 208.919 1.00 26.95  ? 76   GLY A N   1 
ATOM   593   C  CA  . GLY A  1  76  ? 60.564  316.636 209.882 1.00 28.01  ? 76   GLY A CA  1 
ATOM   594   C  C   . GLY A  1  76  ? 59.583  316.269 211.041 1.00 29.50  ? 76   GLY A C   1 
ATOM   595   O  O   . GLY A  1  76  ? 59.738  316.818 212.139 1.00 32.72  ? 76   GLY A O   1 
ATOM   596   N  N   . GLY A  1  77  ? 58.580  315.419 210.773 1.00 27.16  ? 77   GLY A N   1 
ATOM   597   C  CA  . GLY A  1  77  ? 57.443  315.160 211.588 1.00 27.88  ? 77   GLY A CA  1 
ATOM   598   C  C   . GLY A  1  77  ? 57.869  314.047 212.555 1.00 29.04  ? 77   GLY A C   1 
ATOM   599   O  O   . GLY A  1  77  ? 58.249  314.303 213.718 1.00 26.80  ? 77   GLY A O   1 
ATOM   600   N  N   . PHE A  1  78  ? 57.863  312.801 212.076 1.00 25.69  ? 78   PHE A N   1 
ATOM   601   C  CA  . PHE A  1  78  ? 58.301  311.663 212.905 1.00 25.04  ? 78   PHE A CA  1 
ATOM   602   C  C   . PHE A  1  78  ? 59.786  311.761 213.294 1.00 28.30  ? 78   PHE A C   1 
ATOM   603   O  O   . PHE A  1  78  ? 60.125  311.390 214.442 1.00 26.65  ? 78   PHE A O   1 
ATOM   604   C  CB  . PHE A  1  78  ? 58.020  310.342 212.091 1.00 24.69  ? 78   PHE A CB  1 
ATOM   605   C  CG  . PHE A  1  78  ? 56.515  310.095 211.939 1.00 27.66  ? 78   PHE A CG  1 
ATOM   606   C  CD1 . PHE A  1  78  ? 55.896  310.251 210.743 1.00 28.82  ? 78   PHE A CD1 1 
ATOM   607   C  CD2 . PHE A  1  78  ? 55.767  309.648 213.071 1.00 26.42  ? 78   PHE A CD2 1 
ATOM   608   C  CE1 . PHE A  1  78  ? 54.454  309.921 210.596 1.00 21.69  ? 78   PHE A CE1 1 
ATOM   609   C  CE2 . PHE A  1  78  ? 54.375  309.427 212.977 1.00 27.69  ? 78   PHE A CE2 1 
ATOM   610   C  CZ  . PHE A  1  78  ? 53.754  309.553 211.747 1.00 30.16  ? 78   PHE A CZ  1 
ATOM   611   N  N   . GLY A  1  79  ? 60.672  312.286 212.415 1.00 25.98  ? 79   GLY A N   1 
ATOM   612   C  CA  . GLY A  1  79  ? 62.151  312.281 212.768 1.00 24.08  ? 79   GLY A CA  1 
ATOM   613   C  C   . GLY A  1  79  ? 62.291  313.278 213.968 1.00 26.96  ? 79   GLY A C   1 
ATOM   614   O  O   . GLY A  1  79  ? 62.825  312.929 214.967 1.00 26.42  ? 79   GLY A O   1 
ATOM   615   N  N   . ASN A  1  80  ? 61.700  314.469 213.909 1.00 29.17  ? 80   ASN A N   1 
ATOM   616   C  CA  . ASN A  1  80  ? 61.830  315.423 215.100 1.00 27.51  ? 80   ASN A CA  1 
ATOM   617   C  C   . ASN A  1  80  ? 61.190  314.935 216.373 1.00 29.24  ? 80   ASN A C   1 
ATOM   618   O  O   . ASN A  1  80  ? 61.775  315.062 217.410 1.00 28.00  ? 80   ASN A O   1 
ATOM   619   C  CB  . ASN A  1  80  ? 61.312  316.825 214.790 1.00 27.94  ? 80   ASN A CB  1 
ATOM   620   C  CG  . ASN A  1  80  ? 62.369  317.660 214.174 1.00 30.83  ? 80   ASN A CG  1 
ATOM   621   O  OD1 . ASN A  1  80  ? 63.391  317.862 214.795 1.00 39.68  ? 80   ASN A OD1 1 
ATOM   622   N  ND2 . ASN A  1  80  ? 62.145  318.180 212.944 1.00 26.80  ? 80   ASN A ND2 1 
ATOM   623   N  N   . TRP A  1  81  ? 59.987  314.349 216.301 1.00 29.89  ? 81   TRP A N   1 
ATOM   624   C  CA  . TRP A  1  81  ? 59.321  313.919 217.508 1.00 29.15  ? 81   TRP A CA  1 
ATOM   625   C  C   . TRP A  1  81  ? 60.094  312.750 218.077 1.00 28.72  ? 81   TRP A C   1 
ATOM   626   O  O   . TRP A  1  81  ? 60.274  312.648 219.289 1.00 29.85  ? 81   TRP A O   1 
ATOM   627   C  CB  . TRP A  1  81  ? 57.906  313.400 217.098 1.00 27.36  ? 81   TRP A CB  1 
ATOM   628   C  CG  . TRP A  1  81  ? 56.841  314.335 217.508 1.00 26.73  ? 81   TRP A CG  1 
ATOM   629   C  CD1 . TRP A  1  81  ? 56.139  315.228 216.761 1.00 25.57  ? 81   TRP A CD1 1 
ATOM   630   C  CD2 . TRP A  1  81  ? 56.396  314.477 218.872 1.00 26.79  ? 81   TRP A CD2 1 
ATOM   631   N  NE1 . TRP A  1  81  ? 55.188  315.890 217.600 1.00 29.47  ? 81   TRP A NE1 1 
ATOM   632   C  CE2 . TRP A  1  81  ? 55.368  315.446 218.902 1.00 29.15  ? 81   TRP A CE2 1 
ATOM   633   C  CE3 . TRP A  1  81  ? 56.781  313.863 220.060 1.00 28.52  ? 81   TRP A CE3 1 
ATOM   634   C  CZ2 . TRP A  1  81  ? 54.664  315.812 220.150 1.00 28.27  ? 81   TRP A CZ2 1 
ATOM   635   C  CZ3 . TRP A  1  81  ? 56.002  314.160 221.335 1.00 28.59  ? 81   TRP A CZ3 1 
ATOM   636   C  CH2 . TRP A  1  81  ? 55.017  315.146 221.341 1.00 27.29  ? 81   TRP A CH2 1 
ATOM   637   N  N   . LEU A  1  82  ? 60.450  311.779 217.237 1.00 27.72  ? 82   LEU A N   1 
ATOM   638   C  CA  . LEU A  1  82  ? 60.882  310.497 217.771 1.00 27.85  ? 82   LEU A CA  1 
ATOM   639   C  C   . LEU A  1  82  ? 62.375  310.326 217.927 1.00 29.30  ? 82   LEU A C   1 
ATOM   640   O  O   . LEU A  1  82  ? 62.782  309.600 218.849 1.00 28.62  ? 82   LEU A O   1 
ATOM   641   C  CB  . LEU A  1  82  ? 60.382  309.352 216.873 1.00 27.03  ? 82   LEU A CB  1 
ATOM   642   C  CG  . LEU A  1  82  ? 58.844  309.220 216.583 1.00 30.84  ? 82   LEU A CG  1 
ATOM   643   C  CD1 . LEU A  1  82  ? 58.671  308.015 215.575 1.00 21.50  ? 82   LEU A CD1 1 
ATOM   644   C  CD2 . LEU A  1  82  ? 58.126  309.005 217.900 1.00 30.28  ? 82   LEU A CD2 1 
ATOM   645   N  N   . VAL A  1  83  ? 63.199  310.892 217.009 1.00 27.92  ? 83   VAL A N   1 
ATOM   646   C  CA  . VAL A  1  83  ? 64.629  310.507 217.136 1.00 26.66  ? 83   VAL A CA  1 
ATOM   647   C  C   . VAL A  1  83  ? 65.262  310.954 218.537 1.00 28.42  ? 83   VAL A C   1 
ATOM   648   O  O   . VAL A  1  83  ? 65.922  310.169 219.161 1.00 29.71  ? 83   VAL A O   1 
ATOM   649   C  CB  . VAL A  1  83  ? 65.458  311.020 215.950 1.00 25.18  ? 83   VAL A CB  1 
ATOM   650   C  CG1 . VAL A  1  83  ? 66.964  311.113 216.248 1.00 27.02  ? 83   VAL A CG1 1 
ATOM   651   C  CG2 . VAL A  1  83  ? 65.153  310.139 214.657 1.00 18.99  ? 83   VAL A CG2 1 
ATOM   652   N  N   . PRO A  1  84  ? 65.080  312.204 218.973 1.00 26.66  ? 84   PRO A N   1 
ATOM   653   C  CA  . PRO A  1  84  ? 65.693  312.591 220.284 1.00 27.57  ? 84   PRO A CA  1 
ATOM   654   C  C   . PRO A  1  84  ? 65.137  311.745 221.399 1.00 27.44  ? 84   PRO A C   1 
ATOM   655   O  O   . PRO A  1  84  ? 65.870  311.286 222.232 1.00 27.79  ? 84   PRO A O   1 
ATOM   656   C  CB  . PRO A  1  84  ? 65.288  314.067 220.427 1.00 26.39  ? 84   PRO A CB  1 
ATOM   657   C  CG  . PRO A  1  84  ? 65.031  314.552 218.901 1.00 28.51  ? 84   PRO A CG  1 
ATOM   658   C  CD  . PRO A  1  84  ? 64.387  313.317 218.320 1.00 27.45  ? 84   PRO A CD  1 
ATOM   659   N  N   . LEU A  1  85  ? 63.819  311.484 221.396 1.00 28.47  ? 85   LEU A N   1 
ATOM   660   C  CA  . LEU A  1  85  ? 63.254  310.620 222.418 1.00 26.47  ? 85   LEU A CA  1 
ATOM   661   C  C   . LEU A  1  85  ? 63.833  309.232 222.416 1.00 28.85  ? 85   LEU A C   1 
ATOM   662   O  O   . LEU A  1  85  ? 64.129  308.690 223.476 1.00 31.03  ? 85   LEU A O   1 
ATOM   663   C  CB  . LEU A  1  85  ? 61.712  310.537 222.254 1.00 25.04  ? 85   LEU A CB  1 
ATOM   664   C  CG  . LEU A  1  85  ? 60.942  311.805 222.361 1.00 25.67  ? 85   LEU A CG  1 
ATOM   665   C  CD1 . LEU A  1  85  ? 59.355  311.436 222.198 1.00 20.66  ? 85   LEU A CD1 1 
ATOM   666   C  CD2 . LEU A  1  85  ? 61.244  312.515 223.785 1.00 26.78  ? 85   LEU A CD2 1 
ATOM   667   N  N   . MET A  1  86  ? 63.997  308.604 221.243 1.00 26.69  ? 86   MET A N   1 
ATOM   668   C  CA  . MET A  1  86  ? 64.489  307.263 221.135 1.00 25.10  ? 86   MET A CA  1 
ATOM   669   C  C   . MET A  1  86  ? 65.975  307.161 221.513 1.00 27.34  ? 86   MET A C   1 
ATOM   670   O  O   . MET A  1  86  ? 66.474  306.016 221.789 1.00 25.11  ? 86   MET A O   1 
ATOM   671   C  CB  . MET A  1  86  ? 64.413  306.777 219.638 1.00 26.75  ? 86   MET A CB  1 
ATOM   672   C  CG  . MET A  1  86  ? 62.988  306.381 219.358 1.00 23.06  ? 86   MET A CG  1 
ATOM   673   S  SD  . MET A  1  86  ? 62.756  305.807 217.621 1.00 28.47  ? 86   MET A SD  1 
ATOM   674   C  CE  . MET A  1  86  ? 60.924  305.430 217.667 1.00 23.45  ? 86   MET A CE  1 
ATOM   675   N  N   . ILE A  1  87  ? 66.653  308.298 221.593 1.00 25.71  ? 87   ILE A N   1 
ATOM   676   C  CA  . ILE A  1  87  ? 68.065  308.106 222.020 1.00 27.80  ? 87   ILE A CA  1 
ATOM   677   C  C   . ILE A  1  87  ? 68.225  308.807 223.384 1.00 29.42  ? 87   ILE A C   1 
ATOM   678   O  O   . ILE A  1  87  ? 69.376  308.958 223.832 1.00 30.25  ? 87   ILE A O   1 
ATOM   679   C  CB  . ILE A  1  87  ? 69.117  308.680 221.072 1.00 25.96  ? 87   ILE A CB  1 
ATOM   680   C  CG1 . ILE A  1  87  ? 68.971  310.198 220.786 1.00 23.45  ? 87   ILE A CG1 1 
ATOM   681   C  CG2 . ILE A  1  87  ? 69.220  307.799 219.720 1.00 25.31  ? 87   ILE A CG2 1 
ATOM   682   C  CD1 . ILE A  1  87  ? 70.146  310.669 219.768 1.00 25.57  ? 87   ILE A CD1 1 
ATOM   683   N  N   . GLY A  1  88  ? 67.101  309.269 223.976 1.00 28.03  ? 88   GLY A N   1 
ATOM   684   C  CA  . GLY A  1  88  ? 67.245  309.888 225.324 1.00 28.20  ? 88   GLY A CA  1 
ATOM   685   C  C   . GLY A  1  88  ? 67.951  311.216 225.266 1.00 29.05  ? 88   GLY A C   1 
ATOM   686   O  O   . GLY A  1  88  ? 68.523  311.637 226.252 1.00 31.35  ? 88   GLY A O   1 
ATOM   687   N  N   . ALA A  1  89  ? 67.791  311.970 224.145 1.00 28.55  ? 89   ALA A N   1 
ATOM   688   C  CA  . ALA A  1  89  ? 68.435  313.239 224.035 1.00 27.40  ? 89   ALA A CA  1 
ATOM   689   C  C   . ALA A  1  89  ? 67.486  314.341 224.392 1.00 25.23  ? 89   ALA A C   1 
ATOM   690   O  O   . ALA A  1  89  ? 66.241  314.160 224.257 1.00 29.18  ? 89   ALA A O   1 
ATOM   691   C  CB  . ALA A  1  89  ? 68.976  313.460 222.574 1.00 27.98  ? 89   ALA A CB  1 
ATOM   692   N  N   . PRO A  1  90  ? 68.032  315.460 224.892 1.00 26.32  ? 90   PRO A N   1 
ATOM   693   C  CA  . PRO A  1  90  ? 67.195  316.554 225.351 1.00 26.89  ? 90   PRO A CA  1 
ATOM   694   C  C   . PRO A  1  90  ? 66.628  317.402 224.246 1.00 31.33  ? 90   PRO A C   1 
ATOM   695   O  O   . PRO A  1  90  ? 65.644  318.126 224.494 1.00 31.11  ? 90   PRO A O   1 
ATOM   696   C  CB  . PRO A  1  90  ? 68.170  317.343 226.293 1.00 26.40  ? 90   PRO A CB  1 
ATOM   697   C  CG  . PRO A  1  90  ? 69.551  317.187 225.615 1.00 25.91  ? 90   PRO A CG  1 
ATOM   698   C  CD  . PRO A  1  90  ? 69.504  315.740 225.173 1.00 26.26  ? 90   PRO A CD  1 
ATOM   699   N  N   . ASP A  1  91  ? 67.223  317.350 223.019 1.00 30.45  ? 91   ASP A N   1 
ATOM   700   C  CA  . ASP A  1  91  ? 66.636  318.035 221.865 1.00 30.56  ? 91   ASP A CA  1 
ATOM   701   C  C   . ASP A  1  91  ? 67.488  317.629 220.654 1.00 30.00  ? 91   ASP A C   1 
ATOM   702   O  O   . ASP A  1  91  ? 68.354  316.769 220.804 1.00 30.83  ? 91   ASP A O   1 
ATOM   703   C  CB  . ASP A  1  91  ? 66.584  319.603 221.983 1.00 27.61  ? 91   ASP A CB  1 
ATOM   704   C  CG  . ASP A  1  91  ? 65.439  320.160 221.127 1.00 33.65  ? 91   ASP A CG  1 
ATOM   705   O  OD1 . ASP A  1  91  ? 65.642  320.269 219.847 1.00 33.69  ? 91   ASP A OD1 1 
ATOM   706   O  OD2 . ASP A  1  91  ? 64.309  320.261 221.659 1.00 28.50  ? 91   ASP A OD2 1 
ATOM   707   N  N   . MET A  1  92  ? 67.326  318.331 219.505 1.00 29.77  ? 92   MET A N   1 
ATOM   708   C  CA  . MET A  1  92  ? 68.226  318.193 218.347 1.00 30.55  ? 92   MET A CA  1 
ATOM   709   C  C   . MET A  1  92  ? 69.553  318.914 218.636 1.00 29.28  ? 92   MET A C   1 
ATOM   710   O  O   . MET A  1  92  ? 69.627  319.766 219.552 1.00 28.86  ? 92   MET A O   1 
ATOM   711   C  CB  . MET A  1  92  ? 67.567  318.789 217.099 1.00 29.51  ? 92   MET A CB  1 
ATOM   712   C  CG  . MET A  1  92  ? 66.279  317.932 216.749 1.00 27.14  ? 92   MET A CG  1 
ATOM   713   S  SD  . MET A  1  92  ? 66.686  316.316 215.949 1.00 30.72  ? 92   MET A SD  1 
ATOM   714   C  CE  . MET A  1  92  ? 67.288  316.987 214.341 1.00 24.50  ? 92   MET A CE  1 
ATOM   715   N  N   . ALA A  1  93  ? 70.612  318.581 217.896 1.00 27.50  ? 93   ALA A N   1 
ATOM   716   C  CA  . ALA A  1  93  ? 71.879  319.235 218.139 1.00 28.42  ? 93   ALA A CA  1 
ATOM   717   C  C   . ALA A  1  93  ? 71.794  320.742 217.885 1.00 29.94  ? 93   ALA A C   1 
ATOM   718   O  O   . ALA A  1  93  ? 72.485  321.561 218.604 1.00 29.60  ? 93   ALA A O   1 
ATOM   719   C  CB  . ALA A  1  93  ? 73.055  318.570 217.282 1.00 27.96  ? 93   ALA A CB  1 
ATOM   720   N  N   . PHE A  1  94  ? 71.028  321.164 216.828 1.00 27.48  ? 94   PHE A N   1 
ATOM   721   C  CA  . PHE A  1  94  ? 71.013  322.551 216.457 1.00 26.87  ? 94   PHE A CA  1 
ATOM   722   C  C   . PHE A  1  94  ? 69.536  323.009 216.543 1.00 27.06  ? 94   PHE A C   1 
ATOM   723   O  O   . PHE A  1  94  ? 68.807  323.059 215.520 1.00 27.74  ? 94   PHE A O   1 
ATOM   724   C  CB  . PHE A  1  94  ? 71.677  322.809 215.048 1.00 23.20  ? 94   PHE A CB  1 
ATOM   725   C  CG  . PHE A  1  94  ? 73.055  322.193 214.913 1.00 29.27  ? 94   PHE A CG  1 
ATOM   726   C  CD1 . PHE A  1  94  ? 74.051  322.451 215.856 1.00 20.92  ? 94   PHE A CD1 1 
ATOM   727   C  CD2 . PHE A  1  94  ? 73.318  321.229 213.929 1.00 26.25  ? 94   PHE A CD2 1 
ATOM   728   C  CE1 . PHE A  1  94  ? 75.359  321.882 215.716 1.00 25.54  ? 94   PHE A CE1 1 
ATOM   729   C  CE2 . PHE A  1  94  ? 74.554  320.721 213.828 1.00 29.44  ? 94   PHE A CE2 1 
ATOM   730   C  CZ  . PHE A  1  94  ? 75.595  321.060 214.717 1.00 27.90  ? 94   PHE A CZ  1 
ATOM   731   N  N   . PRO A  1  95  ? 69.002  323.221 217.787 1.00 29.78  ? 95   PRO A N   1 
ATOM   732   C  CA  . PRO A  1  95  ? 67.467  323.255 217.877 1.00 28.75  ? 95   PRO A CA  1 
ATOM   733   C  C   . PRO A  1  95  ? 66.832  324.457 217.199 1.00 28.99  ? 95   PRO A C   1 
ATOM   734   O  O   . PRO A  1  95  ? 65.581  324.527 217.021 1.00 33.60  ? 95   PRO A O   1 
ATOM   735   C  CB  . PRO A  1  95  ? 67.220  323.397 219.416 1.00 28.18  ? 95   PRO A CB  1 
ATOM   736   C  CG  . PRO A  1  95  ? 68.525  322.981 220.098 1.00 31.79  ? 95   PRO A CG  1 
ATOM   737   C  CD  . PRO A  1  95  ? 69.662  323.200 219.112 1.00 29.06  ? 95   PRO A CD  1 
ATOM   738   N  N   . ARG A  1  96  ? 67.650  325.503 217.027 1.00 29.82  ? 96   ARG A N   1 
ATOM   739   C  CA  . ARG A  1  96  ? 67.237  326.764 216.443 1.00 29.80  ? 96   ARG A CA  1 
ATOM   740   C  C   . ARG A  1  96  ? 67.372  326.636 214.883 1.00 30.35  ? 96   ARG A C   1 
ATOM   741   O  O   . ARG A  1  96  ? 66.421  326.911 214.143 1.00 29.01  ? 96   ARG A O   1 
ATOM   742   C  CB  . ARG A  1  96  ? 68.041  327.987 217.035 1.00 30.74  ? 96   ARG A CB  1 
ATOM   743   C  CG  . ARG A  1  96  ? 67.929  329.291 216.279 1.00 32.27  ? 96   ARG A CG  1 
ATOM   744   C  CD  . ARG A  1  96  ? 68.682  330.445 216.915 1.00 27.12  ? 96   ARG A CD  1 
ATOM   745   N  NE  . ARG A  1  96  ? 70.060  330.044 217.234 1.00 29.45  ? 96   ARG A NE  1 
ATOM   746   C  CZ  . ARG A  1  96  ? 70.780  330.408 218.284 1.00 32.92  ? 96   ARG A CZ  1 
ATOM   747   N  NH1 . ARG A  1  96  ? 70.390  331.387 219.159 1.00 29.10  ? 96   ARG A NH1 1 
ATOM   748   N  NH2 . ARG A  1  96  ? 71.963  329.816 218.419 1.00 28.17  ? 96   ARG A NH2 1 
ATOM   749   N  N   . MET A  1  97  ? 68.507  326.135 214.394 1.00 29.87  ? 97   MET A N   1 
ATOM   750   C  CA  . MET A  1  97  ? 68.538  325.862 212.932 1.00 28.25  ? 97   MET A CA  1 
ATOM   751   C  C   . MET A  1  97  ? 67.386  324.947 212.528 1.00 28.52  ? 97   MET A C   1 
ATOM   752   O  O   . MET A  1  97  ? 66.891  325.028 211.418 1.00 28.58  ? 97   MET A O   1 
ATOM   753   C  CB  . MET A  1  97  ? 69.856  325.239 212.511 1.00 29.57  ? 97   MET A CB  1 
ATOM   754   C  CG  . MET A  1  97  ? 70.004  325.160 210.937 1.00 30.20  ? 97   MET A CG  1 
ATOM   755   S  SD  . MET A  1  97  ? 71.747  324.629 210.558 1.00 30.02  ? 97   MET A SD  1 
ATOM   756   C  CE  . MET A  1  97  ? 71.607  322.810 210.957 1.00 22.29  ? 97   MET A CE  1 
ATOM   757   N  N   . ASN A  1  98  ? 67.072  323.985 213.369 1.00 27.22  ? 98   ASN A N   1 
ATOM   758   C  CA  . ASN A  1  98  ? 65.921  323.047 213.079 1.00 28.00  ? 98   ASN A CA  1 
ATOM   759   C  C   . ASN A  1  98  ? 64.650  323.850 212.747 1.00 27.98  ? 98   ASN A C   1 
ATOM   760   O  O   . ASN A  1  98  ? 63.841  323.488 211.887 1.00 29.17  ? 98   ASN A O   1 
ATOM   761   C  CB  . ASN A  1  98  ? 65.717  322.184 214.347 1.00 29.14  ? 98   ASN A CB  1 
ATOM   762   C  CG  . ASN A  1  98  ? 64.843  320.958 214.122 1.00 33.55  ? 98   ASN A CG  1 
ATOM   763   O  OD1 . ASN A  1  98  ? 64.776  320.467 213.037 1.00 33.96  ? 98   ASN A OD1 1 
ATOM   764   N  ND2 . ASN A  1  98  ? 64.160  320.494 215.184 1.00 29.46  ? 98   ASN A ND2 1 
ATOM   765   N  N   . ASN A  1  99  ? 64.450  324.981 213.431 1.00 27.27  ? 99   ASN A N   1 
ATOM   766   C  CA  . ASN A  1  99  ? 63.196  325.725 213.266 1.00 26.76  ? 99   ASN A CA  1 
ATOM   767   C  C   . ASN A  1  99  ? 63.251  326.435 211.877 1.00 25.19  ? 99   ASN A C   1 
ATOM   768   O  O   . ASN A  1  99  ? 62.240  326.720 211.291 1.00 25.98  ? 99   ASN A O   1 
ATOM   769   C  CB  . ASN A  1  99  ? 63.071  326.825 214.346 1.00 24.90  ? 99   ASN A CB  1 
ATOM   770   C  CG  . ASN A  1  99  ? 61.650  327.375 214.429 1.00 28.61  ? 99   ASN A CG  1 
ATOM   771   O  OD1 . ASN A  1  99  ? 60.700  326.632 214.335 1.00 28.63  ? 99   ASN A OD1 1 
ATOM   772   N  ND2 . ASN A  1  99  ? 61.521  328.668 214.610 1.00 26.78  ? 99   ASN A ND2 1 
ATOM   773   N  N   . MET A  1  100 ? 64.446  326.753 211.387 1.00 25.06  ? 100  MET A N   1 
ATOM   774   C  CA  . MET A  1  100 ? 64.518  327.398 210.062 1.00 24.90  ? 100  MET A CA  1 
ATOM   775   C  C   . MET A  1  100 ? 64.256  326.337 208.944 1.00 28.85  ? 100  MET A C   1 
ATOM   776   O  O   . MET A  1  100 ? 63.545  326.651 207.913 1.00 30.03  ? 100  MET A O   1 
ATOM   777   C  CB  . MET A  1  100 ? 65.895  328.054 209.851 1.00 24.84  ? 100  MET A CB  1 
ATOM   778   C  CG  . MET A  1  100 ? 65.794  328.992 208.508 1.00 26.84  ? 100  MET A CG  1 
ATOM   779   S  SD  . MET A  1  100 ? 67.247  329.901 208.237 1.00 30.19  ? 100  MET A SD  1 
ATOM   780   C  CE  . MET A  1  100 ? 68.622  328.759 208.108 1.00 26.22  ? 100  MET A CE  1 
ATOM   781   N  N   . SER A  1  101 ? 64.749  325.089 209.158 1.00 28.34  ? 101  SER A N   1 
ATOM   782   C  CA  . SER A  1  101 ? 64.294  323.990 208.206 1.00 29.75  ? 101  SER A CA  1 
ATOM   783   C  C   . SER A  1  101 ? 62.775  323.989 208.110 1.00 30.27  ? 101  SER A C   1 
ATOM   784   O  O   . SER A  1  101 ? 62.170  323.745 207.023 1.00 30.29  ? 101  SER A O   1 
ATOM   785   C  CB  . SER A  1  101 ? 64.777  322.638 208.759 1.00 27.78  ? 101  SER A CB  1 
ATOM   786   O  OG  . SER A  1  101 ? 66.184  322.580 208.426 1.00 30.15  ? 101  SER A OG  1 
ATOM   787   N  N   . PHE A  1  102 ? 62.086  324.121 209.249 1.00 28.77  ? 102  PHE A N   1 
ATOM   788   C  CA  . PHE A  1  102 ? 60.644  324.116 209.131 1.00 26.99  ? 102  PHE A CA  1 
ATOM   789   C  C   . PHE A  1  102 ? 60.154  325.290 208.369 1.00 26.90  ? 102  PHE A C   1 
ATOM   790   O  O   . PHE A  1  102 ? 59.401  325.137 207.376 1.00 28.22  ? 102  PHE A O   1 
ATOM   791   C  CB  . PHE A  1  102 ? 59.885  324.092 210.494 1.00 27.36  ? 102  PHE A CB  1 
ATOM   792   C  CG  . PHE A  1  102 ? 58.390  324.268 210.276 1.00 26.17  ? 102  PHE A CG  1 
ATOM   793   C  CD1 . PHE A  1  102 ? 57.689  323.276 209.691 1.00 25.36  ? 102  PHE A CD1 1 
ATOM   794   C  CD2 . PHE A  1  102 ? 57.770  325.446 210.501 1.00 27.51  ? 102  PHE A CD2 1 
ATOM   795   C  CE1 . PHE A  1  102 ? 56.325  323.407 209.413 1.00 21.65  ? 102  PHE A CE1 1 
ATOM   796   C  CE2 . PHE A  1  102 ? 56.437  325.640 210.171 1.00 23.67  ? 102  PHE A CE2 1 
ATOM   797   C  CZ  . PHE A  1  102 ? 55.701  324.627 209.574 1.00 27.72  ? 102  PHE A CZ  1 
ATOM   798   N  N   . TRP A  1  103 ? 60.570  326.486 208.776 1.00 25.78  ? 103  TRP A N   1 
ATOM   799   C  CA  . TRP A  1  103 ? 59.912  327.698 208.256 1.00 26.63  ? 103  TRP A CA  1 
ATOM   800   C  C   . TRP A  1  103 ? 60.251  327.972 206.818 1.00 27.60  ? 103  TRP A C   1 
ATOM   801   O  O   . TRP A  1  103 ? 59.605  328.807 206.181 1.00 27.47  ? 103  TRP A O   1 
ATOM   802   C  CB  . TRP A  1  103 ? 60.225  328.962 209.128 1.00 25.80  ? 103  TRP A CB  1 
ATOM   803   C  CG  . TRP A  1  103 ? 59.335  328.948 210.368 1.00 26.75  ? 103  TRP A CG  1 
ATOM   804   C  CD1 . TRP A  1  103 ? 59.695  328.642 211.660 1.00 24.03  ? 103  TRP A CD1 1 
ATOM   805   C  CD2 . TRP A  1  103 ? 57.909  329.133 210.355 1.00 28.82  ? 103  TRP A CD2 1 
ATOM   806   N  NE1 . TRP A  1  103 ? 58.549  328.652 212.456 1.00 29.24  ? 103  TRP A NE1 1 
ATOM   807   C  CE2 . TRP A  1  103 ? 57.446  328.946 211.679 1.00 27.35  ? 103  TRP A CE2 1 
ATOM   808   C  CE3 . TRP A  1  103 ? 56.984  329.366 209.332 1.00 30.06  ? 103  TRP A CE3 1 
ATOM   809   C  CZ2 . TRP A  1  103 ? 56.066  329.001 212.030 1.00 28.95  ? 103  TRP A CZ2 1 
ATOM   810   C  CZ3 . TRP A  1  103 ? 55.583  329.411 209.679 1.00 30.19  ? 103  TRP A CZ3 1 
ATOM   811   C  CH2 . TRP A  1  103 ? 55.158  329.304 211.028 1.00 30.27  ? 103  TRP A CH2 1 
ATOM   812   N  N   . LEU A  1  104 ? 61.352  327.397 206.333 1.00 28.44  ? 104  LEU A N   1 
ATOM   813   C  CA  . LEU A  1  104 ? 61.640  327.431 204.866 1.00 28.66  ? 104  LEU A CA  1 
ATOM   814   C  C   . LEU A  1  104 ? 60.569  326.760 204.028 1.00 27.72  ? 104  LEU A C   1 
ATOM   815   O  O   . LEU A  1  104 ? 60.434  327.036 202.854 1.00 28.79  ? 104  LEU A O   1 
ATOM   816   C  CB  . LEU A  1  104 ? 63.003  326.808 204.504 1.00 28.20  ? 104  LEU A CB  1 
ATOM   817   C  CG  . LEU A  1  104 ? 64.180  327.686 204.806 1.00 28.68  ? 104  LEU A CG  1 
ATOM   818   C  CD1 . LEU A  1  104 ? 65.472  326.791 204.825 1.00 24.98  ? 104  LEU A CD1 1 
ATOM   819   C  CD2 . LEU A  1  104 ? 64.257  328.867 203.765 1.00 27.91  ? 104  LEU A CD2 1 
ATOM   820   N  N   . LEU A  1  105 ? 59.744  325.909 204.604 1.00 27.11  ? 105  LEU A N   1 
ATOM   821   C  CA  . LEU A  1  105 ? 58.806  325.120 203.773 1.00 29.16  ? 105  LEU A CA  1 
ATOM   822   C  C   . LEU A  1  105 ? 57.539  325.923 203.355 1.00 27.20  ? 105  LEU A C   1 
ATOM   823   O  O   . LEU A  1  105 ? 57.072  325.831 202.229 1.00 25.73  ? 105  LEU A O   1 
ATOM   824   C  CB  . LEU A  1  105 ? 58.470  323.755 204.454 1.00 26.48  ? 105  LEU A CB  1 
ATOM   825   C  CG  . LEU A  1  105 ? 59.595  322.718 204.421 1.00 30.02  ? 105  LEU A CG  1 
ATOM   826   C  CD1 . LEU A  1  105 ? 59.137  321.412 205.075 1.00 28.90  ? 105  LEU A CD1 1 
ATOM   827   C  CD2 . LEU A  1  105 ? 60.145  322.524 202.993 1.00 29.11  ? 105  LEU A CD2 1 
ATOM   828   N  N   . PRO A  1  106 ? 56.968  326.687 204.286 1.00 29.15  ? 106  PRO A N   1 
ATOM   829   C  CA  . PRO A  1  106 ? 55.872  327.517 203.754 1.00 28.22  ? 106  PRO A CA  1 
ATOM   830   C  C   . PRO A  1  106 ? 56.228  328.480 202.603 1.00 28.97  ? 106  PRO A C   1 
ATOM   831   O  O   . PRO A  1  106 ? 55.480  328.560 201.658 1.00 31.50  ? 106  PRO A O   1 
ATOM   832   C  CB  . PRO A  1  106 ? 55.312  328.270 205.049 1.00 28.41  ? 106  PRO A CB  1 
ATOM   833   C  CG  . PRO A  1  106 ? 55.598  327.168 206.181 1.00 30.49  ? 106  PRO A CG  1 
ATOM   834   C  CD  . PRO A  1  106 ? 57.055  326.779 205.799 1.00 28.94  ? 106  PRO A CD  1 
ATOM   835   N  N   . PRO A  1  107 ? 57.347  329.241 202.699 1.00 29.03  ? 107  PRO A N   1 
ATOM   836   C  CA  . PRO A  1  107 ? 57.785  329.987 201.538 1.00 29.22  ? 107  PRO A CA  1 
ATOM   837   C  C   . PRO A  1  107 ? 58.014  329.087 200.274 1.00 30.17  ? 107  PRO A C   1 
ATOM   838   O  O   . PRO A  1  107 ? 57.693  329.493 199.190 1.00 29.72  ? 107  PRO A O   1 
ATOM   839   C  CB  . PRO A  1  107 ? 59.185  330.520 201.962 1.00 31.44  ? 107  PRO A CB  1 
ATOM   840   C  CG  . PRO A  1  107 ? 59.334  330.384 203.426 1.00 28.67  ? 107  PRO A CG  1 
ATOM   841   C  CD  . PRO A  1  107 ? 58.164  329.499 203.897 1.00 27.51  ? 107  PRO A CD  1 
ATOM   842   N  N   . SER A  1  108 ? 58.635  327.912 200.422 1.00 30.56  ? 108  SER A N   1 
ATOM   843   C  CA  . SER A  1  108 ? 58.922  327.049 199.259 1.00 27.74  ? 108  SER A CA  1 
ATOM   844   C  C   . SER A  1  108 ? 57.532  326.653 198.651 1.00 27.18  ? 108  SER A C   1 
ATOM   845   O  O   . SER A  1  108 ? 57.358  326.672 197.459 1.00 26.93  ? 108  SER A O   1 
ATOM   846   C  CB  . SER A  1  108 ? 59.594  325.802 199.735 1.00 26.02  ? 108  SER A CB  1 
ATOM   847   O  OG  . SER A  1  108 ? 59.618  324.863 198.688 1.00 31.81  ? 108  SER A OG  1 
ATOM   848   N  N   . PHE A  1  109 ? 56.557  326.357 199.472 1.00 27.45  ? 109  PHE A N   1 
ATOM   849   C  CA  . PHE A  1  109 ? 55.197  325.981 198.930 1.00 24.81  ? 109  PHE A CA  1 
ATOM   850   C  C   . PHE A  1  109 ? 54.451  327.117 198.247 1.00 28.69  ? 109  PHE A C   1 
ATOM   851   O  O   . PHE A  1  109 ? 53.768  326.961 197.183 1.00 28.79  ? 109  PHE A O   1 
ATOM   852   C  CB  . PHE A  1  109 ? 54.425  325.441 200.086 1.00 24.46  ? 109  PHE A CB  1 
ATOM   853   C  CG  . PHE A  1  109 ? 53.303  324.485 199.733 1.00 27.71  ? 109  PHE A CG  1 
ATOM   854   C  CD1 . PHE A  1  109 ? 52.689  323.776 200.725 1.00 32.43  ? 109  PHE A CD1 1 
ATOM   855   C  CD2 . PHE A  1  109 ? 52.804  324.342 198.420 1.00 29.97  ? 109  PHE A CD2 1 
ATOM   856   C  CE1 . PHE A  1  109 ? 51.629  322.912 200.487 1.00 28.19  ? 109  PHE A CE1 1 
ATOM   857   C  CE2 . PHE A  1  109 ? 51.703  323.430 198.164 1.00 32.35  ? 109  PHE A CE2 1 
ATOM   858   C  CZ  . PHE A  1  109 ? 51.215  322.654 199.211 1.00 30.71  ? 109  PHE A CZ  1 
ATOM   859   N  N   . LEU A  1  110 ? 54.618  328.308 198.850 1.00 28.59  ? 110  LEU A N   1 
ATOM   860   C  CA  . LEU A  1  110 ? 54.063  329.505 198.276 1.00 29.07  ? 110  LEU A CA  1 
ATOM   861   C  C   . LEU A  1  110 ? 54.714  329.722 196.845 1.00 30.99  ? 110  LEU A C   1 
ATOM   862   O  O   . LEU A  1  110 ? 54.023  330.138 195.962 1.00 28.29  ? 110  LEU A O   1 
ATOM   863   C  CB  . LEU A  1  110 ? 54.397  330.650 199.189 1.00 28.66  ? 110  LEU A CB  1 
ATOM   864   C  CG  . LEU A  1  110 ? 54.030  332.054 198.628 1.00 33.64  ? 110  LEU A CG  1 
ATOM   865   C  CD1 . LEU A  1  110 ? 52.509  332.148 198.281 1.00 29.61  ? 110  LEU A CD1 1 
ATOM   866   C  CD2 . LEU A  1  110 ? 54.463  333.103 199.596 1.00 34.67  ? 110  LEU A CD2 1 
ATOM   867   N  N   . LEU A  1  111 ? 56.071  329.573 196.688 1.00 27.29  ? 111  LEU A N   1 
ATOM   868   C  CA  . LEU A  1  111 ? 56.658  329.752 195.401 1.00 28.21  ? 111  LEU A CA  1 
ATOM   869   C  C   . LEU A  1  111 ? 56.039  328.768 194.415 1.00 28.32  ? 111  LEU A C   1 
ATOM   870   O  O   . LEU A  1  111 ? 55.881  329.052 193.219 1.00 28.78  ? 111  LEU A O   1 
ATOM   871   C  CB  . LEU A  1  111 ? 58.179  329.535 195.468 1.00 26.45  ? 111  LEU A CB  1 
ATOM   872   C  CG  . LEU A  1  111 ? 58.907  330.647 196.260 1.00 26.42  ? 111  LEU A CG  1 
ATOM   873   C  CD1 . LEU A  1  111 ? 60.346  330.303 196.602 1.00 26.46  ? 111  LEU A CD1 1 
ATOM   874   C  CD2 . LEU A  1  111 ? 58.924  331.958 195.447 1.00 31.17  ? 111  LEU A CD2 1 
ATOM   875   N  N   . LEU A  1  112 ? 55.836  327.556 194.853 1.00 28.80  ? 112  LEU A N   1 
ATOM   876   C  CA  . LEU A  1  112 ? 55.209  326.563 193.993 1.00 31.11  ? 112  LEU A CA  1 
ATOM   877   C  C   . LEU A  1  112 ? 53.798  327.020 193.635 1.00 33.37  ? 112  LEU A C   1 
ATOM   878   O  O   . LEU A  1  112 ? 53.381  326.934 192.474 1.00 33.20  ? 112  LEU A O   1 
ATOM   879   C  CB  . LEU A  1  112 ? 55.131  325.148 194.653 1.00 32.81  ? 112  LEU A CB  1 
ATOM   880   C  CG  . LEU A  1  112 ? 54.588  324.105 193.599 1.00 33.86  ? 112  LEU A CG  1 
ATOM   881   C  CD1 . LEU A  1  112 ? 55.894  323.871 192.484 1.00 40.95  ? 112  LEU A CD1 1 
ATOM   882   C  CD2 . LEU A  1  112 ? 54.034  322.786 194.077 1.00 35.84  ? 112  LEU A CD2 1 
ATOM   883   N  N   . LEU A  1  113 ? 53.018  327.468 194.597 1.00 32.91  ? 113  LEU A N   1 
ATOM   884   C  CA  . LEU A  1  113 ? 51.656  327.883 194.220 1.00 35.17  ? 113  LEU A CA  1 
ATOM   885   C  C   . LEU A  1  113 ? 51.762  329.146 193.255 1.00 35.89  ? 113  LEU A C   1 
ATOM   886   O  O   . LEU A  1  113 ? 50.994  329.243 192.292 1.00 34.94  ? 113  LEU A O   1 
ATOM   887   C  CB  . LEU A  1  113 ? 50.754  328.028 195.509 1.00 38.24  ? 113  LEU A CB  1 
ATOM   888   C  CG  . LEU A  1  113 ? 50.438  326.583 196.318 1.00 42.18  ? 113  LEU A CG  1 
ATOM   889   C  CD1 . LEU A  1  113 ? 49.662  326.614 197.860 1.00 44.93  ? 113  LEU A CD1 1 
ATOM   890   C  CD2 . LEU A  1  113 ? 49.767  325.301 195.577 1.00 38.30  ? 113  LEU A CD2 1 
ATOM   891   N  N   . ALA A  1  114 ? 52.739  330.011 193.456 1.00 30.61  ? 114  ALA A N   1 
ATOM   892   C  CA  . ALA A  1  114 ? 52.960  331.146 192.557 1.00 32.87  ? 114  ALA A CA  1 
ATOM   893   C  C   . ALA A  1  114 ? 53.241  330.701 191.112 1.00 34.89  ? 114  ALA A C   1 
ATOM   894   O  O   . ALA A  1  114 ? 52.731  331.298 190.121 1.00 32.83  ? 114  ALA A O   1 
ATOM   895   C  CB  . ALA A  1  114 ? 54.071  332.011 193.041 1.00 29.93  ? 114  ALA A CB  1 
ATOM   896   N  N   . SER A  1  115 ? 54.064  329.669 190.947 1.00 33.89  ? 115  SER A N   1 
ATOM   897   C  CA  . SER A  1  115 ? 54.344  329.250 189.603 1.00 35.44  ? 115  SER A CA  1 
ATOM   898   C  C   . SER A  1  115 ? 53.086  328.749 188.883 1.00 33.85  ? 115  SER A C   1 
ATOM   899   O  O   . SER A  1  115 ? 52.977  328.951 187.686 1.00 35.65  ? 115  SER A O   1 
ATOM   900   C  CB  . SER A  1  115 ? 55.464  328.180 189.574 1.00 35.21  ? 115  SER A CB  1 
ATOM   901   O  OG  . SER A  1  115 ? 54.904  326.997 189.905 1.00 40.30  ? 115  SER A OG  1 
ATOM   902   N  N   . SER A  1  116 ? 52.136  328.115 189.573 1.00 33.81  ? 116  SER A N   1 
ATOM   903   C  CA  . SER A  1  116 ? 50.865  327.649 188.969 1.00 32.59  ? 116  SER A CA  1 
ATOM   904   C  C   . SER A  1  116 ? 49.864  328.805 188.707 1.00 33.90  ? 116  SER A C   1 
ATOM   905   O  O   . SER A  1  116 ? 49.007  328.679 187.824 1.00 33.09  ? 116  SER A O   1 
ATOM   906   C  CB  . SER A  1  116 ? 50.204  326.559 189.826 1.00 34.00  ? 116  SER A CB  1 
ATOM   907   O  OG  . SER A  1  116 ? 49.658  327.230 190.941 1.00 36.21  ? 116  SER A OG  1 
ATOM   908   N  N   . MET A  1  117 ? 50.064  329.951 189.344 1.00 33.55  ? 117  MET A N   1 
ATOM   909   C  CA  . MET A  1  117 ? 49.134  331.107 189.240 1.00 34.44  ? 117  MET A CA  1 
ATOM   910   C  C   . MET A  1  117 ? 49.553  332.123 188.171 1.00 32.91  ? 117  MET A C   1 
ATOM   911   O  O   . MET A  1  117 ? 48.688  332.800 187.569 1.00 32.44  ? 117  MET A O   1 
ATOM   912   C  CB  . MET A  1  117 ? 49.080  331.871 190.601 1.00 33.51  ? 117  MET A CB  1 
ATOM   913   C  CG  . MET A  1  117 ? 48.425  331.172 191.902 1.00 39.87  ? 117  MET A CG  1 
ATOM   914   S  SD  . MET A  1  117 ? 46.722  330.883 191.315 1.00 50.52  ? 117  MET A SD  1 
ATOM   915   C  CE  . MET A  1  117 ? 46.107  332.573 191.560 1.00 50.52  ? 117  MET A CE  1 
ATOM   916   N  N   . VAL A  1  118 ? 50.867  332.283 187.988 1.00 32.30  ? 118  VAL A N   1 
ATOM   917   C  CA  . VAL A  1  118 ? 51.361  333.136 186.961 1.00 32.16  ? 118  VAL A CA  1 
ATOM   918   C  C   . VAL A  1  118 ? 51.466  332.456 185.614 1.00 32.59  ? 118  VAL A C   1 
ATOM   919   O  O   . VAL A  1  118 ? 51.639  331.204 185.528 1.00 33.68  ? 118  VAL A O   1 
ATOM   920   C  CB  . VAL A  1  118 ? 52.743  333.793 187.330 1.00 32.63  ? 118  VAL A CB  1 
ATOM   921   C  CG1 . VAL A  1  118 ? 52.695  334.477 188.726 1.00 32.47  ? 118  VAL A CG1 1 
ATOM   922   C  CG2 . VAL A  1  118 ? 53.907  332.767 187.218 1.00 31.48  ? 118  VAL A CG2 1 
ATOM   923   N  N   . GLU A  1  119 ? 51.400  333.271 184.538 1.00 31.14  ? 119  GLU A N   1 
ATOM   924   C  CA  . GLU A  1  119 ? 51.424  332.743 183.155 1.00 31.28  ? 119  GLU A CA  1 
ATOM   925   C  C   . GLU A  1  119 ? 50.523  331.559 182.975 1.00 30.21  ? 119  GLU A C   1 
ATOM   926   O  O   . GLU A  1  119 ? 49.354  331.616 183.376 1.00 32.29  ? 119  GLU A O   1 
ATOM   927   C  CB  . GLU A  1  119 ? 52.894  332.364 182.744 1.00 32.81  ? 119  GLU A CB  1 
ATOM   928   C  CG  . GLU A  1  119 ? 53.797  333.586 183.010 1.00 34.64  ? 119  GLU A CG  1 
ATOM   929   C  CD  . GLU A  1  119 ? 53.608  334.736 181.950 1.00 43.11  ? 119  GLU A CD  1 
ATOM   930   O  OE1 . GLU A  1  119 ? 54.186  335.829 182.136 1.00 49.16  ? 119  GLU A OE1 1 
ATOM   931   O  OE2 . GLU A  1  119 ? 52.952  334.533 180.927 1.00 41.22  ? 119  GLU A OE2 1 
ATOM   932   N  N   . ALA A  1  120 ? 51.064  330.492 182.391 1.00 30.34  ? 120  ALA A N   1 
ATOM   933   C  CA  . ALA A  1  120 ? 50.340  329.228 182.170 1.00 30.41  ? 120  ALA A CA  1 
ATOM   934   C  C   . ALA A  1  120 ? 50.864  328.103 183.044 1.00 29.42  ? 120  ALA A C   1 
ATOM   935   O  O   . ALA A  1  120 ? 50.644  326.919 182.743 1.00 29.36  ? 120  ALA A O   1 
ATOM   936   C  CB  . ALA A  1  120 ? 50.419  328.831 180.611 1.00 31.31  ? 120  ALA A CB  1 
ATOM   937   N  N   . GLY A  1  121 ? 51.537  328.413 184.166 1.00 29.93  ? 121  GLY A N   1 
ATOM   938   C  CA  . GLY A  1  121 ? 52.008  327.269 185.020 1.00 29.51  ? 121  GLY A CA  1 
ATOM   939   C  C   . GLY A  1  121 ? 53.311  326.620 184.456 1.00 28.86  ? 121  GLY A C   1 
ATOM   940   O  O   . GLY A  1  121 ? 53.723  326.869 183.315 1.00 27.08  ? 121  GLY A O   1 
ATOM   941   N  N   . ALA A  1  122 ? 53.936  325.761 185.249 1.00 28.38  ? 122  ALA A N   1 
ATOM   942   C  CA  . ALA A  1  122 ? 55.008  324.923 184.728 1.00 27.71  ? 122  ALA A CA  1 
ATOM   943   C  C   . ALA A  1  122 ? 54.451  323.526 184.402 1.00 28.91  ? 122  ALA A C   1 
ATOM   944   O  O   . ALA A  1  122 ? 54.279  322.724 185.319 1.00 25.94  ? 122  ALA A O   1 
ATOM   945   C  CB  . ALA A  1  122 ? 56.230  324.866 185.815 1.00 28.12  ? 122  ALA A CB  1 
ATOM   946   N  N   . GLY A  1  123 ? 54.181  323.226 183.119 1.00 27.56  ? 123  GLY A N   1 
ATOM   947   C  CA  . GLY A  1  123 ? 53.652  321.985 182.733 1.00 27.90  ? 123  GLY A CA  1 
ATOM   948   C  C   . GLY A  1  123 ? 54.755  321.090 182.246 1.00 29.40  ? 123  GLY A C   1 
ATOM   949   O  O   . GLY A  1  123 ? 54.780  320.768 181.069 1.00 27.08  ? 123  GLY A O   1 
ATOM   950   N  N   . THR A  1  124 ? 55.733  320.802 183.108 1.00 30.76  ? 124  THR A N   1 
ATOM   951   C  CA  . THR A  1  124 ? 57.026  320.208 182.674 1.00 29.02  ? 124  THR A CA  1 
ATOM   952   C  C   . THR A  1  124 ? 57.221  318.698 183.031 1.00 29.15  ? 124  THR A C   1 
ATOM   953   O  O   . THR A  1  124 ? 58.147  318.076 182.556 1.00 27.10  ? 124  THR A O   1 
ATOM   954   C  CB  . THR A  1  124 ? 58.176  320.978 183.353 1.00 29.32  ? 124  THR A CB  1 
ATOM   955   O  OG1 . THR A  1  124 ? 57.947  321.024 184.779 1.00 25.27  ? 124  THR A OG1 1 
ATOM   956   C  CG2 . THR A  1  124 ? 58.211  322.405 182.828 1.00 22.78  ? 124  THR A CG2 1 
ATOM   957   N  N   . GLY A  1  125 ? 56.376  318.137 183.914 1.00 28.97  ? 125  GLY A N   1 
ATOM   958   C  CA  . GLY A  1  125 ? 56.763  316.911 184.628 1.00 26.45  ? 125  GLY A CA  1 
ATOM   959   C  C   . GLY A  1  125 ? 57.628  317.346 185.812 1.00 25.91  ? 125  GLY A C   1 
ATOM   960   O  O   . GLY A  1  125 ? 58.283  318.399 185.742 1.00 26.21  ? 125  GLY A O   1 
ATOM   961   N  N   . TRP A  1  126 ? 57.588  316.567 186.875 1.00 23.95  ? 126  TRP A N   1 
ATOM   962   C  CA  . TRP A  1  126 ? 58.362  316.863 188.129 1.00 24.39  ? 126  TRP A CA  1 
ATOM   963   C  C   . TRP A  1  126 ? 59.870  316.710 187.820 1.00 24.69  ? 126  TRP A C   1 
ATOM   964   O  O   . TRP A  1  126 ? 60.735  317.127 188.605 1.00 25.95  ? 126  TRP A O   1 
ATOM   965   C  CB  . TRP A  1  126 ? 57.918  315.942 189.318 1.00 21.47  ? 126  TRP A CB  1 
ATOM   966   C  CG  . TRP A  1  126 ? 58.562  314.537 189.413 1.00 26.49  ? 126  TRP A CG  1 
ATOM   967   C  CD1 . TRP A  1  126 ? 58.274  313.433 188.650 1.00 24.32  ? 126  TRP A CD1 1 
ATOM   968   C  CD2 . TRP A  1  126 ? 59.651  314.141 190.300 1.00 29.43  ? 126  TRP A CD2 1 
ATOM   969   N  NE1 . TRP A  1  126 ? 59.084  312.387 189.005 1.00 25.43  ? 126  TRP A NE1 1 
ATOM   970   C  CE2 . TRP A  1  126 ? 59.940  312.783 190.016 1.00 30.95  ? 126  TRP A CE2 1 
ATOM   971   C  CE3 . TRP A  1  126 ? 60.325  314.794 191.389 1.00 29.73  ? 126  TRP A CE3 1 
ATOM   972   C  CZ2 . TRP A  1  126 ? 60.935  312.052 190.731 1.00 26.38  ? 126  TRP A CZ2 1 
ATOM   973   C  CZ3 . TRP A  1  126 ? 61.304  314.073 192.116 1.00 28.49  ? 126  TRP A CZ3 1 
ATOM   974   C  CH2 . TRP A  1  126 ? 61.596  312.714 191.786 1.00 28.59  ? 126  TRP A CH2 1 
ATOM   975   N  N   . THR A  1  127 ? 60.192  316.220 186.634 1.00 23.95  ? 127  THR A N   1 
ATOM   976   C  CA  . THR A  1  127 ? 61.620  316.013 186.197 1.00 27.00  ? 127  THR A CA  1 
ATOM   977   C  C   . THR A  1  127 ? 62.172  317.297 185.548 1.00 25.93  ? 127  THR A C   1 
ATOM   978   O  O   . THR A  1  127 ? 63.379  317.585 185.594 1.00 26.85  ? 127  THR A O   1 
ATOM   979   C  CB  . THR A  1  127 ? 61.737  314.881 185.153 1.00 28.66  ? 127  THR A CB  1 
ATOM   980   O  OG1 . THR A  1  127 ? 60.633  314.943 184.248 1.00 27.23  ? 127  THR A OG1 1 
ATOM   981   C  CG2 . THR A  1  127 ? 61.684  313.488 185.805 1.00 29.92  ? 127  THR A CG2 1 
ATOM   982   N  N   . VAL A  1  128 ? 61.250  318.168 185.181 1.00 24.54  ? 128  VAL A N   1 
ATOM   983   C  CA  . VAL A  1  128 ? 61.575  319.506 184.653 1.00 25.94  ? 128  VAL A CA  1 
ATOM   984   C  C   . VAL A  1  128 ? 62.692  319.487 183.589 1.00 26.67  ? 128  VAL A C   1 
ATOM   985   O  O   . VAL A  1  128 ? 63.581  320.366 183.631 1.00 25.61  ? 128  VAL A O   1 
ATOM   986   C  CB  . VAL A  1  128 ? 62.000  320.539 185.821 1.00 28.95  ? 128  VAL A CB  1 
ATOM   987   C  CG1 . VAL A  1  128 ? 61.922  321.987 185.337 1.00 24.27  ? 128  VAL A CG1 1 
ATOM   988   C  CG2 . VAL A  1  128 ? 61.120  320.322 187.153 1.00 25.05  ? 128  VAL A CG2 1 
ATOM   989   N  N   . TYR A  1  129 ? 62.591  318.588 182.594 1.00 24.92  ? 129  TYR A N   1 
ATOM   990   C  CA  . TYR A  1  129 ? 63.602  318.419 181.561 1.00 26.61  ? 129  TYR A CA  1 
ATOM   991   C  C   . TYR A  1  129 ? 63.601  319.613 180.608 1.00 27.01  ? 129  TYR A C   1 
ATOM   992   O  O   . TYR A  1  129 ? 62.549  320.021 180.142 1.00 25.71  ? 129  TYR A O   1 
ATOM   993   C  CB  . TYR A  1  129 ? 63.324  317.150 180.682 1.00 24.18  ? 129  TYR A CB  1 
ATOM   994   C  CG  . TYR A  1  129 ? 63.713  315.879 181.294 1.00 21.67  ? 129  TYR A CG  1 
ATOM   995   C  CD1 . TYR A  1  129 ? 63.524  314.691 180.591 1.00 28.56  ? 129  TYR A CD1 1 
ATOM   996   C  CD2 . TYR A  1  129 ? 64.216  315.791 182.590 1.00 20.66  ? 129  TYR A CD2 1 
ATOM   997   C  CE1 . TYR A  1  129 ? 63.802  313.457 181.117 1.00 30.16  ? 129  TYR A CE1 1 
ATOM   998   C  CE2 . TYR A  1  129 ? 64.589  314.468 183.135 1.00 24.65  ? 129  TYR A CE2 1 
ATOM   999   C  CZ  . TYR A  1  129 ? 64.387  313.348 182.351 1.00 29.75  ? 129  TYR A CZ  1 
ATOM   1000  O  OH  . TYR A  1  129 ? 64.676  312.044 182.781 1.00 25.81  ? 129  TYR A OH  1 
ATOM   1001  N  N   . PRO A  1  130 ? 64.796  320.143 180.284 1.00 26.56  ? 130  PRO A N   1 
ATOM   1002  C  CA  . PRO A  1  130 ? 64.887  321.060 179.183 1.00 26.29  ? 130  PRO A CA  1 
ATOM   1003  C  C   . PRO A  1  130 ? 64.987  320.233 177.861 1.00 26.49  ? 130  PRO A C   1 
ATOM   1004  O  O   . PRO A  1  130 ? 65.441  319.072 177.894 1.00 27.26  ? 130  PRO A O   1 
ATOM   1005  C  CB  . PRO A  1  130 ? 66.255  321.813 179.454 1.00 25.16  ? 130  PRO A CB  1 
ATOM   1006  C  CG  . PRO A  1  130 ? 67.113  320.764 180.182 1.00 27.61  ? 130  PRO A CG  1 
ATOM   1007  C  CD  . PRO A  1  130 ? 66.080  319.890 180.962 1.00 27.47  ? 130  PRO A CD  1 
ATOM   1008  N  N   . PRO A  1  131 ? 64.713  320.830 176.677 1.00 25.90  ? 131  PRO A N   1 
ATOM   1009  C  CA  . PRO A  1  131 ? 64.309  322.230 176.492 1.00 24.63  ? 131  PRO A CA  1 
ATOM   1010  C  C   . PRO A  1  131 ? 62.840  322.531 176.855 1.00 24.94  ? 131  PRO A C   1 
ATOM   1011  O  O   . PRO A  1  131 ? 62.454  323.678 176.789 1.00 27.24  ? 131  PRO A O   1 
ATOM   1012  C  CB  . PRO A  1  131 ? 64.531  322.429 174.934 1.00 23.17  ? 131  PRO A CB  1 
ATOM   1013  C  CG  . PRO A  1  131 ? 65.435  321.270 174.459 1.00 26.56  ? 131  PRO A CG  1 
ATOM   1014  C  CD  . PRO A  1  131 ? 64.975  320.152 175.399 1.00 22.42  ? 131  PRO A CD  1 
ATOM   1015  N  N   . LEU A  1  132 ? 61.991  321.555 177.103 1.00 25.51  ? 132  LEU A N   1 
ATOM   1016  C  CA  . LEU A  1  132 ? 60.582  321.932 177.338 1.00 26.53  ? 132  LEU A CA  1 
ATOM   1017  C  C   . LEU A  1  132 ? 60.515  322.979 178.533 1.00 28.15  ? 132  LEU A C   1 
ATOM   1018  O  O   . LEU A  1  132 ? 59.612  323.838 178.602 1.00 28.35  ? 132  LEU A O   1 
ATOM   1019  C  CB  . LEU A  1  132 ? 59.809  320.663 177.823 1.00 25.35  ? 132  LEU A CB  1 
ATOM   1020  C  CG  . LEU A  1  132 ? 58.318  320.956 178.191 1.00 27.42  ? 132  LEU A CG  1 
ATOM   1021  C  CD1 . LEU A  1  132 ? 57.544  321.724 177.041 1.00 28.92  ? 132  LEU A CD1 1 
ATOM   1022  C  CD2 . LEU A  1  132 ? 57.566  319.767 178.553 1.00 26.47  ? 132  LEU A CD2 1 
ATOM   1023  N  N   . ALA A  1  133 ? 61.344  322.742 179.561 1.00 24.47  ? 133  ALA A N   1 
ATOM   1024  C  CA  . ALA A  1  133 ? 61.418  323.677 180.696 1.00 28.25  ? 133  ALA A CA  1 
ATOM   1025  C  C   . ALA A  1  133 ? 62.316  324.915 180.428 1.00 29.45  ? 133  ALA A C   1 
ATOM   1026  O  O   . ALA A  1  133 ? 62.413  325.750 181.346 1.00 29.90  ? 133  ALA A O   1 
ATOM   1027  C  CB  . ALA A  1  133 ? 61.977  322.961 181.899 1.00 25.63  ? 133  ALA A CB  1 
ATOM   1028  N  N   . GLY A  1  134 ? 62.926  325.044 179.235 1.00 29.55  ? 134  GLY A N   1 
ATOM   1029  C  CA  . GLY A  1  134 ? 63.765  326.244 178.924 1.00 28.50  ? 134  GLY A CA  1 
ATOM   1030  C  C   . GLY A  1  134 ? 62.954  327.475 178.600 1.00 30.37  ? 134  GLY A C   1 
ATOM   1031  O  O   . GLY A  1  134 ? 61.673  327.437 178.606 1.00 26.13  ? 134  GLY A O   1 
ATOM   1032  N  N   . ASN A  1  135 ? 63.670  328.592 178.328 1.00 29.25  ? 135  ASN A N   1 
ATOM   1033  C  CA  . ASN A  1  135 ? 62.954  329.920 178.257 1.00 30.71  ? 135  ASN A CA  1 
ATOM   1034  C  C   . ASN A  1  135 ? 62.236  330.180 176.916 1.00 31.31  ? 135  ASN A C   1 
ATOM   1035  O  O   . ASN A  1  135 ? 61.630  331.224 176.763 1.00 35.30  ? 135  ASN A O   1 
ATOM   1036  C  CB  . ASN A  1  135 ? 63.918  331.148 178.532 1.00 28.50  ? 135  ASN A CB  1 
ATOM   1037  C  CG  . ASN A  1  135 ? 65.103  331.196 177.532 1.00 29.42  ? 135  ASN A CG  1 
ATOM   1038  O  OD1 . ASN A  1  135 ? 65.026  330.503 176.502 1.00 29.23  ? 135  ASN A OD1 1 
ATOM   1039  N  ND2 . ASN A  1  135 ? 66.270  331.901 177.882 1.00 28.59  ? 135  ASN A ND2 1 
ATOM   1040  N  N   . LEU A  1  136 ? 62.220  329.216 176.021 1.00 31.33  ? 136  LEU A N   1 
ATOM   1041  C  CA  . LEU A  1  136 ? 61.449  329.262 174.757 1.00 33.12  ? 136  LEU A CA  1 
ATOM   1042  C  C   . LEU A  1  136 ? 60.132  328.458 174.806 1.00 31.72  ? 136  LEU A C   1 
ATOM   1043  O  O   . LEU A  1  136 ? 59.075  329.003 174.518 1.00 30.95  ? 136  LEU A O   1 
ATOM   1044  C  CB  . LEU A  1  136 ? 62.412  328.794 173.651 1.00 32.70  ? 136  LEU A CB  1 
ATOM   1045  C  CG  . LEU A  1  136 ? 62.199  328.724 172.119 1.00 45.19  ? 136  LEU A CG  1 
ATOM   1046  C  CD1 . LEU A  1  136 ? 61.230  329.774 171.594 1.00 48.83  ? 136  LEU A CD1 1 
ATOM   1047  C  CD2 . LEU A  1  136 ? 63.611  328.919 171.471 1.00 51.29  ? 136  LEU A CD2 1 
ATOM   1048  N  N   . ALA A  1  137 ? 60.190  327.205 175.272 1.00 30.24  ? 137  ALA A N   1 
ATOM   1049  C  CA  . ALA A  1  137 ? 59.026  326.355 175.370 1.00 29.51  ? 137  ALA A CA  1 
ATOM   1050  C  C   . ALA A  1  137 ? 58.359  326.678 176.713 1.00 31.65  ? 137  ALA A C   1 
ATOM   1051  O  O   . ALA A  1  137 ? 57.194  326.372 176.874 1.00 28.25  ? 137  ALA A O   1 
ATOM   1052  C  CB  . ALA A  1  137 ? 59.412  324.892 175.312 1.00 29.59  ? 137  ALA A CB  1 
ATOM   1053  N  N   . HIS A  1  138 ? 59.060  327.295 177.707 1.00 31.05  ? 138  HIS A N   1 
ATOM   1054  C  CA  . HIS A  1  138 ? 58.239  327.658 178.932 1.00 29.51  ? 138  HIS A CA  1 
ATOM   1055  C  C   . HIS A  1  138 ? 58.724  329.084 179.338 1.00 30.25  ? 138  HIS A C   1 
ATOM   1056  O  O   . HIS A  1  138 ? 59.410  329.281 180.346 1.00 30.53  ? 138  HIS A O   1 
ATOM   1057  C  CB  . HIS A  1  138 ? 58.486  326.580 180.068 1.00 31.35  ? 138  HIS A CB  1 
ATOM   1058  C  CG  . HIS A  1  138 ? 57.286  325.694 180.326 1.00 24.33  ? 138  HIS A CG  1 
ATOM   1059  N  ND1 . HIS A  1  138 ? 57.101  324.474 179.690 1.00 29.24  ? 138  HIS A ND1 1 
ATOM   1060  C  CD2 . HIS A  1  138 ? 56.153  325.930 181.014 1.00 26.32  ? 138  HIS A CD2 1 
ATOM   1061  C  CE1 . HIS A  1  138 ? 55.931  323.955 180.037 1.00 23.87  ? 138  HIS A CE1 1 
ATOM   1062  N  NE2 . HIS A  1  138 ? 55.318  324.822 180.846 1.00 27.47  ? 138  HIS A NE2 1 
ATOM   1063  N  N   . ALA A  1  139 ? 58.482  330.032 178.452 1.00 29.22  ? 139  ALA A N   1 
ATOM   1064  C  CA  . ALA A  1  139 ? 58.877  331.441 178.627 1.00 28.32  ? 139  ALA A CA  1 
ATOM   1065  C  C   . ALA A  1  139 ? 58.105  332.055 179.819 1.00 28.24  ? 139  ALA A C   1 
ATOM   1066  O  O   . ALA A  1  139 ? 56.858  331.731 180.105 1.00 28.60  ? 139  ALA A O   1 
ATOM   1067  C  CB  . ALA A  1  139 ? 58.582  332.176 177.246 1.00 30.64  ? 139  ALA A CB  1 
ATOM   1068  N  N   . GLY A  1  140 ? 58.773  332.887 180.588 1.00 27.92  ? 140  GLY A N   1 
ATOM   1069  C  CA  . GLY A  1  140 ? 58.028  333.613 181.639 1.00 28.26  ? 140  GLY A CA  1 
ATOM   1070  C  C   . GLY A  1  140 ? 58.382  332.963 183.027 1.00 30.43  ? 140  GLY A C   1 
ATOM   1071  O  O   . GLY A  1  140 ? 59.309  332.103 183.091 1.00 29.59  ? 140  GLY A O   1 
ATOM   1072  N  N   . ALA A  1  141 ? 57.687  333.364 184.087 1.00 29.40  ? 141  ALA A N   1 
ATOM   1073  C  CA  . ALA A  1  141 ? 58.189  333.130 185.443 1.00 30.76  ? 141  ALA A CA  1 
ATOM   1074  C  C   . ALA A  1  141 ? 57.926  331.754 186.090 1.00 31.28  ? 141  ALA A C   1 
ATOM   1075  O  O   . ALA A  1  141 ? 58.661  331.412 186.991 1.00 33.88  ? 141  ALA A O   1 
ATOM   1076  C  CB  . ALA A  1  141 ? 57.770  334.259 186.361 1.00 28.27  ? 141  ALA A CB  1 
ATOM   1077  N  N   . SER A  1  142 ? 56.994  330.948 185.540 1.00 30.11  ? 142  SER A N   1 
ATOM   1078  C  CA  . SER A  1  142 ? 56.471  329.754 186.208 1.00 29.27  ? 142  SER A CA  1 
ATOM   1079  C  C   . SER A  1  142 ? 57.615  328.775 186.490 1.00 28.61  ? 142  SER A C   1 
ATOM   1080  O  O   . SER A  1  142 ? 57.760  328.319 187.618 1.00 30.04  ? 142  SER A O   1 
ATOM   1081  C  CB  . SER A  1  142 ? 55.411  329.081 185.417 1.00 28.48  ? 142  SER A CB  1 
ATOM   1082  O  OG  . SER A  1  142 ? 54.268  329.967 185.329 1.00 26.71  ? 142  SER A OG  1 
ATOM   1083  N  N   . VAL A  1  143 ? 58.453  328.501 185.507 1.00 28.42  ? 143  VAL A N   1 
ATOM   1084  C  CA  . VAL A  1  143 ? 59.500  327.494 185.769 1.00 28.73  ? 143  VAL A CA  1 
ATOM   1085  C  C   . VAL A  1  143 ? 60.555  328.061 186.703 1.00 29.91  ? 143  VAL A C   1 
ATOM   1086  O  O   . VAL A  1  143 ? 61.100  327.323 187.525 1.00 30.16  ? 143  VAL A O   1 
ATOM   1087  C  CB  . VAL A  1  143 ? 60.206  326.960 184.488 1.00 30.04  ? 143  VAL A CB  1 
ATOM   1088  C  CG1 . VAL A  1  143 ? 61.588  326.267 184.837 1.00 21.88  ? 143  VAL A CG1 1 
ATOM   1089  C  CG2 . VAL A  1  143 ? 59.299  325.997 183.711 1.00 27.16  ? 143  VAL A CG2 1 
ATOM   1090  N  N   . ASP A  1  144 ? 60.857  329.354 186.623 1.00 30.34  ? 144  ASP A N   1 
ATOM   1091  C  CA  . ASP A  1  144 ? 61.779  329.916 187.642 1.00 32.38  ? 144  ASP A CA  1 
ATOM   1092  C  C   . ASP A  1  144 ? 61.277  329.888 189.085 1.00 31.06  ? 144  ASP A C   1 
ATOM   1093  O  O   . ASP A  1  144 ? 62.062  329.679 190.026 1.00 32.01  ? 144  ASP A O   1 
ATOM   1094  C  CB  . ASP A  1  144 ? 62.189  331.337 187.239 1.00 31.68  ? 144  ASP A CB  1 
ATOM   1095  C  CG  . ASP A  1  144 ? 62.902  331.311 185.910 1.00 35.22  ? 144  ASP A CG  1 
ATOM   1096  O  OD1 . ASP A  1  144 ? 62.556  332.134 185.063 1.00 33.64  ? 144  ASP A OD1 1 
ATOM   1097  O  OD2 . ASP A  1  144 ? 63.772  330.394 185.728 1.00 31.44  ? 144  ASP A OD2 1 
ATOM   1098  N  N   . LEU A  1  145 ? 59.990  330.156 189.248 1.00 31.09  ? 145  LEU A N   1 
ATOM   1099  C  CA  . LEU A  1  145 ? 59.352  330.013 190.536 1.00 30.38  ? 145  LEU A CA  1 
ATOM   1100  C  C   . LEU A  1  145 ? 59.449  328.582 191.055 1.00 28.74  ? 145  LEU A C   1 
ATOM   1101  O  O   . LEU A  1  145 ? 59.647  328.393 192.256 1.00 28.14  ? 145  LEU A O   1 
ATOM   1102  C  CB  . LEU A  1  145 ? 57.884  330.421 190.467 1.00 29.42  ? 145  LEU A CB  1 
ATOM   1103  C  CG  . LEU A  1  145 ? 57.776  331.945 190.419 1.00 29.73  ? 145  LEU A CG  1 
ATOM   1104  C  CD1 . LEU A  1  145 ? 56.360  332.394 189.933 1.00 27.05  ? 145  LEU A CD1 1 
ATOM   1105  C  CD2 . LEU A  1  145 ? 58.178  332.716 191.795 1.00 30.04  ? 145  LEU A CD2 1 
ATOM   1106  N  N   . THR A  1  146 ? 59.184  327.582 190.190 1.00 28.61  ? 146  THR A N   1 
ATOM   1107  C  CA  . THR A  1  146 ? 59.418  326.168 190.545 1.00 29.08  ? 146  THR A CA  1 
ATOM   1108  C  C   . THR A  1  146 ? 60.855  325.873 190.954 1.00 28.57  ? 146  THR A C   1 
ATOM   1109  O  O   . THR A  1  146 ? 61.122  325.158 191.938 1.00 27.36  ? 146  THR A O   1 
ATOM   1110  C  CB  . THR A  1  146 ? 59.049  325.189 189.340 1.00 29.84  ? 146  THR A CB  1 
ATOM   1111  O  OG1 . THR A  1  146 ? 57.696  325.398 189.030 1.00 32.39  ? 146  THR A OG1 1 
ATOM   1112  C  CG2 . THR A  1  146 ? 59.245  323.622 189.688 1.00 26.19  ? 146  THR A CG2 1 
ATOM   1113  N  N   . ILE A  1  147 ? 61.795  326.362 190.183 1.00 27.64  ? 147  ILE A N   1 
ATOM   1114  C  CA  . ILE A  1  147 ? 63.148  326.096 190.531 1.00 25.67  ? 147  ILE A CA  1 
ATOM   1115  C  C   . ILE A  1  147 ? 63.429  326.693 191.913 1.00 27.47  ? 147  ILE A C   1 
ATOM   1116  O  O   . ILE A  1  147 ? 64.073  326.082 192.740 1.00 27.23  ? 147  ILE A O   1 
ATOM   1117  C  CB  . ILE A  1  147 ? 64.105  326.763 189.503 1.00 24.54  ? 147  ILE A CB  1 
ATOM   1118  C  CG1 . ILE A  1  147 ? 64.123  326.008 188.104 1.00 24.18  ? 147  ILE A CG1 1 
ATOM   1119  C  CG2 . ILE A  1  147 ? 65.614  326.802 190.081 1.00 24.24  ? 147  ILE A CG2 1 
ATOM   1120  C  CD1 . ILE A  1  147 ? 64.878  326.704 186.897 1.00 24.97  ? 147  ILE A CD1 1 
ATOM   1121  N  N   . PHE A  1  148 ? 63.057  327.962 192.148 1.00 27.12  ? 148  PHE A N   1 
ATOM   1122  C  CA  . PHE A  1  148 ? 63.280  328.559 193.491 1.00 26.67  ? 148  PHE A CA  1 
ATOM   1123  C  C   . PHE A  1  148 ? 62.599  327.827 194.607 1.00 26.16  ? 148  PHE A C   1 
ATOM   1124  O  O   . PHE A  1  148 ? 63.114  327.788 195.730 1.00 25.80  ? 148  PHE A O   1 
ATOM   1125  C  CB  . PHE A  1  148 ? 62.879  330.075 193.494 1.00 27.19  ? 148  PHE A CB  1 
ATOM   1126  C  CG  . PHE A  1  148 ? 63.818  330.906 192.662 1.00 30.94  ? 148  PHE A CG  1 
ATOM   1127  C  CD1 . PHE A  1  148 ? 65.249  330.762 192.826 1.00 29.01  ? 148  PHE A CD1 1 
ATOM   1128  C  CD2 . PHE A  1  148 ? 63.302  331.805 191.737 1.00 28.90  ? 148  PHE A CD2 1 
ATOM   1129  C  CE1 . PHE A  1  148 ? 66.134  331.518 192.037 1.00 25.51  ? 148  PHE A CE1 1 
ATOM   1130  C  CE2 . PHE A  1  148 ? 64.129  332.562 190.969 1.00 27.64  ? 148  PHE A CE2 1 
ATOM   1131  C  CZ  . PHE A  1  148 ? 65.544  332.469 191.096 1.00 23.42  ? 148  PHE A CZ  1 
ATOM   1132  N  N   . SER A  1  149 ? 61.419  327.258 194.341 1.00 26.34  ? 149  SER A N   1 
ATOM   1133  C  CA  . SER A  1  149 ? 60.734  326.478 195.349 1.00 25.81  ? 149  SER A CA  1 
ATOM   1134  C  C   . SER A  1  149 ? 61.641  325.286 195.779 1.00 26.68  ? 149  SER A C   1 
ATOM   1135  O  O   . SER A  1  149 ? 61.778  324.963 196.960 1.00 29.40  ? 149  SER A O   1 
ATOM   1136  C  CB  . SER A  1  149 ? 59.358  325.940 194.711 1.00 23.24  ? 149  SER A CB  1 
ATOM   1137  O  OG  . SER A  1  149 ? 58.818  325.076 195.611 1.00 26.42  ? 149  SER A OG  1 
ATOM   1138  N  N   . LEU A  1  150 ? 62.147  324.540 194.781 1.00 27.88  ? 150  LEU A N   1 
ATOM   1139  C  CA  . LEU A  1  150 ? 63.088  323.444 194.990 1.00 28.31  ? 150  LEU A CA  1 
ATOM   1140  C  C   . LEU A  1  150 ? 64.336  323.869 195.719 1.00 29.18  ? 150  LEU A C   1 
ATOM   1141  O  O   . LEU A  1  150 ? 64.768  323.145 196.586 1.00 29.67  ? 150  LEU A O   1 
ATOM   1142  C  CB  . LEU A  1  150 ? 63.490  322.752 193.627 1.00 25.31  ? 150  LEU A CB  1 
ATOM   1143  C  CG  . LEU A  1  150 ? 62.270  322.058 192.996 1.00 31.27  ? 150  LEU A CG  1 
ATOM   1144  C  CD1 . LEU A  1  150 ? 62.823  321.528 191.667 1.00 33.55  ? 150  LEU A CD1 1 
ATOM   1145  C  CD2 . LEU A  1  150 ? 61.912  320.890 194.006 1.00 27.50  ? 150  LEU A CD2 1 
ATOM   1146  N  N   . HIS A  1  151 ? 64.890  325.047 195.399 1.00 29.10  ? 151  HIS A N   1 
ATOM   1147  C  CA  . HIS A  1  151 ? 66.076  325.591 196.103 1.00 28.65  ? 151  HIS A CA  1 
ATOM   1148  C  C   . HIS A  1  151 ? 65.757  325.686 197.630 1.00 29.79  ? 151  HIS A C   1 
ATOM   1149  O  O   . HIS A  1  151 ? 66.547  325.274 198.472 1.00 30.35  ? 151  HIS A O   1 
ATOM   1150  C  CB  . HIS A  1  151 ? 66.437  326.989 195.558 1.00 29.18  ? 151  HIS A CB  1 
ATOM   1151  C  CG  . HIS A  1  151 ? 67.421  326.930 194.428 1.00 34.37  ? 151  HIS A CG  1 
ATOM   1152  N  ND1 . HIS A  1  151 ? 67.353  327.769 193.331 1.00 36.08  ? 151  HIS A ND1 1 
ATOM   1153  C  CD2 . HIS A  1  151 ? 68.493  326.130 194.216 1.00 33.32  ? 151  HIS A CD2 1 
ATOM   1154  C  CE1 . HIS A  1  151 ? 68.338  327.488 192.491 1.00 34.13  ? 151  HIS A CE1 1 
ATOM   1155  N  NE2 . HIS A  1  151 ? 69.037  326.502 193.000 1.00 33.65  ? 151  HIS A NE2 1 
ATOM   1156  N  N   . LEU A  1  152 ? 64.593  326.223 197.972 1.00 27.19  ? 152  LEU A N   1 
ATOM   1157  C  CA  . LEU A  1  152 ? 64.282  326.416 199.407 1.00 30.04  ? 152  LEU A CA  1 
ATOM   1158  C  C   . LEU A  1  152 ? 64.032  325.125 200.110 1.00 27.98  ? 152  LEU A C   1 
ATOM   1159  O  O   . LEU A  1  152 ? 64.522  324.932 201.214 1.00 26.94  ? 152  LEU A O   1 
ATOM   1160  C  CB  . LEU A  1  152 ? 63.149  327.405 199.673 1.00 27.84  ? 152  LEU A CB  1 
ATOM   1161  C  CG  . LEU A  1  152 ? 63.175  328.924 199.229 1.00 34.87  ? 152  LEU A CG  1 
ATOM   1162  C  CD1 . LEU A  1  152 ? 62.140  329.818 200.024 1.00 29.03  ? 152  LEU A CD1 1 
ATOM   1163  C  CD2 . LEU A  1  152 ? 64.518  329.412 199.050 1.00 36.00  ? 152  LEU A CD2 1 
ATOM   1164  N  N   . ALA A  1  153 ? 63.294  324.219 199.445 1.00 28.55  ? 153  ALA A N   1 
ATOM   1165  C  CA  . ALA A  1  153 ? 63.023  322.920 200.038 1.00 26.56  ? 153  ALA A CA  1 
ATOM   1166  C  C   . ALA A  1  153 ? 64.396  322.188 200.120 1.00 28.66  ? 153  ALA A C   1 
ATOM   1167  O  O   . ALA A  1  153 ? 64.638  321.396 201.032 1.00 25.69  ? 153  ALA A O   1 
ATOM   1168  C  CB  . ALA A  1  153 ? 62.104  322.089 199.070 1.00 28.60  ? 153  ALA A CB  1 
ATOM   1169  N  N   . GLY A  1  154 ? 65.258  322.389 199.145 1.00 27.98  ? 154  GLY A N   1 
ATOM   1170  C  CA  . GLY A  1  154 ? 66.614  321.753 199.154 1.00 28.81  ? 154  GLY A CA  1 
ATOM   1171  C  C   . GLY A  1  154 ? 67.429  322.246 200.406 1.00 29.41  ? 154  GLY A C   1 
ATOM   1172  O  O   . GLY A  1  154 ? 67.978  321.451 201.121 1.00 27.28  ? 154  GLY A O   1 
ATOM   1173  N  N   . VAL A  1  155 ? 67.499  323.573 200.606 1.00 27.96  ? 155  VAL A N   1 
ATOM   1174  C  CA  . VAL A  1  155 ? 68.197  324.165 201.761 1.00 28.40  ? 155  VAL A CA  1 
ATOM   1175  C  C   . VAL A  1  155 ? 67.571  323.616 203.080 1.00 26.75  ? 155  VAL A C   1 
ATOM   1176  O  O   . VAL A  1  155 ? 68.265  323.121 203.915 1.00 26.35  ? 155  VAL A O   1 
ATOM   1177  C  CB  . VAL A  1  155 ? 68.126  325.695 201.770 1.00 29.24  ? 155  VAL A CB  1 
ATOM   1178  C  CG1 . VAL A  1  155 ? 68.748  326.249 203.104 1.00 28.99  ? 155  VAL A CG1 1 
ATOM   1179  C  CG2 . VAL A  1  155 ? 68.899  326.329 200.539 1.00 29.77  ? 155  VAL A CG2 1 
ATOM   1180  N  N   . SER A  1  156 ? 66.248  323.614 203.199 1.00 27.27  ? 156  SER A N   1 
ATOM   1181  C  CA  . SER A  1  156 ? 65.593  323.140 204.398 1.00 26.69  ? 156  SER A CA  1 
ATOM   1182  C  C   . SER A  1  156 ? 66.036  321.689 204.720 1.00 28.18  ? 156  SER A C   1 
ATOM   1183  O  O   . SER A  1  156 ? 66.365  321.385 205.869 1.00 28.69  ? 156  SER A O   1 
ATOM   1184  C  CB  . SER A  1  156 ? 64.055  323.107 204.148 1.00 26.84  ? 156  SER A CB  1 
ATOM   1185  O  OG  . SER A  1  156 ? 63.467  322.413 205.204 1.00 24.62  ? 156  SER A OG  1 
ATOM   1186  N  N   . SER A  1  157 ? 66.053  320.754 203.722 1.00 28.11  ? 157  SER A N   1 
ATOM   1187  C  CA  . SER A  1  157 ? 66.372  319.321 203.960 1.00 25.85  ? 157  SER A CA  1 
ATOM   1188  C  C   . SER A  1  157 ? 67.888  319.147 204.127 1.00 27.14  ? 157  SER A C   1 
ATOM   1189  O  O   . SER A  1  157 ? 68.335  318.250 204.828 1.00 26.64  ? 157  SER A O   1 
ATOM   1190  C  CB  . SER A  1  157 ? 65.919  318.491 202.737 1.00 26.71  ? 157  SER A CB  1 
ATOM   1191  O  OG  . SER A  1  157 ? 64.504  318.202 202.882 1.00 29.68  ? 157  SER A OG  1 
ATOM   1192  N  N   . ILE A  1  158 ? 68.717  319.952 203.456 1.00 24.72  ? 158  ILE A N   1 
ATOM   1193  C  CA  . ILE A  1  158 ? 70.148  319.794 203.657 1.00 26.40  ? 158  ILE A CA  1 
ATOM   1194  C  C   . ILE A  1  158 ? 70.521  320.225 205.083 1.00 28.13  ? 158  ILE A C   1 
ATOM   1195  O  O   . ILE A  1  158 ? 71.308  319.549 205.725 1.00 30.45  ? 158  ILE A O   1 
ATOM   1196  C  CB  . ILE A  1  158 ? 70.944  320.623 202.657 1.00 28.46  ? 158  ILE A CB  1 
ATOM   1197  C  CG1 . ILE A  1  158 ? 70.977  319.828 201.337 1.00 30.91  ? 158  ILE A CG1 1 
ATOM   1198  C  CG2 . ILE A  1  158 ? 72.402  320.843 203.179 1.00 27.35  ? 158  ILE A CG2 1 
ATOM   1199  C  CD1 . ILE A  1  158 ? 71.351  320.819 200.168 1.00 26.95  ? 158  ILE A CD1 1 
ATOM   1200  N  N   . LEU A  1  159 ? 69.916  321.284 205.606 1.00 26.06  ? 159  LEU A N   1 
ATOM   1201  C  CA  . LEU A  1  159 ? 70.280  321.719 207.005 1.00 25.26  ? 159  LEU A CA  1 
ATOM   1202  C  C   . LEU A  1  159 ? 69.617  320.724 207.977 1.00 27.01  ? 159  LEU A C   1 
ATOM   1203  O  O   . LEU A  1  159 ? 70.203  320.360 208.982 1.00 30.61  ? 159  LEU A O   1 
ATOM   1204  C  CB  . LEU A  1  159 ? 69.721  323.099 207.272 1.00 23.92  ? 159  LEU A CB  1 
ATOM   1205  C  CG  . LEU A  1  159 ? 70.341  324.200 206.372 1.00 26.01  ? 159  LEU A CG  1 
ATOM   1206  C  CD1 . LEU A  1  159 ? 69.726  325.455 206.772 1.00 29.56  ? 159  LEU A CD1 1 
ATOM   1207  C  CD2 . LEU A  1  159 ? 71.987  324.212 206.481 1.00 23.44  ? 159  LEU A CD2 1 
ATOM   1208  N  N   . GLY A  1  160 ? 68.442  320.195 207.639 1.00 27.46  ? 160  GLY A N   1 
ATOM   1209  C  CA  . GLY A  1  160 ? 67.866  319.067 208.389 1.00 25.58  ? 160  GLY A CA  1 
ATOM   1210  C  C   . GLY A  1  160 ? 68.742  317.848 208.498 1.00 27.32  ? 160  GLY A C   1 
ATOM   1211  O  O   . GLY A  1  160 ? 68.868  317.243 209.546 1.00 27.45  ? 160  GLY A O   1 
ATOM   1212  N  N   . ALA A  1  161 ? 69.326  317.455 207.385 1.00 26.57  ? 161  ALA A N   1 
ATOM   1213  C  CA  . ALA A  1  161 ? 70.198  316.303 207.320 1.00 26.55  ? 161  ALA A CA  1 
ATOM   1214  C  C   . ALA A  1  161 ? 71.467  316.542 208.175 1.00 25.96  ? 161  ALA A C   1 
ATOM   1215  O  O   . ALA A  1  161 ? 71.884  315.659 208.936 1.00 28.00  ? 161  ALA A O   1 
ATOM   1216  C  CB  . ALA A  1  161 ? 70.622  316.105 205.849 1.00 24.60  ? 161  ALA A CB  1 
ATOM   1217  N  N   . ILE A  1  162 ? 72.049  317.724 208.101 1.00 26.72  ? 162  ILE A N   1 
ATOM   1218  C  CA  . ILE A  1  162 ? 73.182  318.026 208.990 1.00 26.59  ? 162  ILE A CA  1 
ATOM   1219  C  C   . ILE A  1  162 ? 72.766  317.897 210.482 1.00 26.78  ? 162  ILE A C   1 
ATOM   1220  O  O   . ILE A  1  162 ? 73.566  317.391 211.310 1.00 24.82  ? 162  ILE A O   1 
ATOM   1221  C  CB  . ILE A  1  162 ? 73.750  319.440 208.710 1.00 27.89  ? 162  ILE A CB  1 
ATOM   1222  C  CG1 . ILE A  1  162 ? 74.389  319.527 207.303 1.00 25.31  ? 162  ILE A CG1 1 
ATOM   1223  C  CG2 . ILE A  1  162 ? 74.761  319.958 209.796 1.00 26.53  ? 162  ILE A CG2 1 
ATOM   1224  C  CD1 . ILE A  1  162 ? 74.675  320.970 206.808 1.00 28.12  ? 162  ILE A CD1 1 
ATOM   1225  N  N   . ASN A  1  163 ? 71.532  318.317 210.826 1.00 25.90  ? 163  ASN A N   1 
ATOM   1226  C  CA  . ASN A  1  163 ? 71.062  318.340 212.170 1.00 25.24  ? 163  ASN A CA  1 
ATOM   1227  C  C   . ASN A  1  163 ? 70.857  316.875 212.657 1.00 26.92  ? 163  ASN A C   1 
ATOM   1228  O  O   . ASN A  1  163 ? 71.298  316.453 213.776 1.00 26.89  ? 163  ASN A O   1 
ATOM   1229  C  CB  . ASN A  1  163 ? 69.723  319.103 212.203 1.00 25.93  ? 163  ASN A CB  1 
ATOM   1230  C  CG  . ASN A  1  163 ? 69.533  319.913 213.532 1.00 29.24  ? 163  ASN A CG  1 
ATOM   1231  O  OD1 . ASN A  1  163 ? 70.026  319.489 214.584 1.00 24.19  ? 163  ASN A OD1 1 
ATOM   1232  N  ND2 . ASN A  1  163 ? 68.882  321.094 213.451 1.00 27.99  ? 163  ASN A ND2 1 
ATOM   1233  N  N   . PHE A  1  164 ? 70.192  316.072 211.831 1.00 24.82  ? 164  PHE A N   1 
ATOM   1234  C  CA  . PHE A  1  164 ? 69.989  314.672 212.226 1.00 26.69  ? 164  PHE A CA  1 
ATOM   1235  C  C   . PHE A  1  164 ? 71.241  313.869 212.316 1.00 27.30  ? 164  PHE A C   1 
ATOM   1236  O  O   . PHE A  1  164 ? 71.480  313.088 213.228 1.00 26.41  ? 164  PHE A O   1 
ATOM   1237  C  CB  . PHE A  1  164 ? 69.056  314.007 211.250 1.00 26.81  ? 164  PHE A CB  1 
ATOM   1238  C  CG  . PHE A  1  164 ? 67.569  314.274 211.593 1.00 24.40  ? 164  PHE A CG  1 
ATOM   1239  C  CD1 . PHE A  1  164 ? 66.793  315.077 210.814 1.00 28.60  ? 164  PHE A CD1 1 
ATOM   1240  C  CD2 . PHE A  1  164 ? 67.024  313.715 212.707 1.00 24.55  ? 164  PHE A CD2 1 
ATOM   1241  C  CE1 . PHE A  1  164 ? 65.472  315.331 211.154 1.00 28.25  ? 164  PHE A CE1 1 
ATOM   1242  C  CE2 . PHE A  1  164 ? 65.635  313.998 213.102 1.00 27.84  ? 164  PHE A CE2 1 
ATOM   1243  C  CZ  . PHE A  1  164 ? 64.930  314.798 212.315 1.00 27.57  ? 164  PHE A CZ  1 
ATOM   1244  N  N   . ILE A  1  165 ? 72.058  313.976 211.311 1.00 25.96  ? 165  ILE A N   1 
ATOM   1245  C  CA  . ILE A  1  165 ? 73.349  313.237 211.436 1.00 25.61  ? 165  ILE A CA  1 
ATOM   1246  C  C   . ILE A  1  165 ? 74.094  313.570 212.743 1.00 24.69  ? 165  ILE A C   1 
ATOM   1247  O  O   . ILE A  1  165 ? 74.557  312.717 213.511 1.00 24.96  ? 165  ILE A O   1 
ATOM   1248  C  CB  . ILE A  1  165 ? 74.276  313.471 210.149 1.00 25.14  ? 165  ILE A CB  1 
ATOM   1249  C  CG1 . ILE A  1  165 ? 73.570  312.965 208.877 1.00 26.21  ? 165  ILE A CG1 1 
ATOM   1250  C  CG2 . ILE A  1  165 ? 75.721  312.730 210.349 1.00 24.61  ? 165  ILE A CG2 1 
ATOM   1251  C  CD1 . ILE A  1  165 ? 74.305  313.538 207.578 1.00 23.67  ? 165  ILE A CD1 1 
ATOM   1252  N  N   . THR A  1  166 ? 74.314  314.862 212.967 1.00 27.44  ? 166  THR A N   1 
ATOM   1253  C  CA  . THR A  1  166 ? 75.097  315.297 214.112 1.00 28.44  ? 166  THR A CA  1 
ATOM   1254  C  C   . THR A  1  166 ? 74.375  314.803 215.386 1.00 27.43  ? 166  THR A C   1 
ATOM   1255  O  O   . THR A  1  166 ? 75.022  314.334 216.342 1.00 27.40  ? 166  THR A O   1 
ATOM   1256  C  CB  . THR A  1  166 ? 75.121  316.809 214.146 1.00 28.25  ? 166  THR A CB  1 
ATOM   1257  O  OG1 . THR A  1  166 ? 75.764  317.310 212.962 1.00 27.81  ? 166  THR A OG1 1 
ATOM   1258  C  CG2 . THR A  1  166 ? 75.924  317.337 215.438 1.00 26.73  ? 166  THR A CG2 1 
ATOM   1259  N  N   . THR A  1  167 ? 73.039  315.030 215.457 1.00 28.23  ? 167  THR A N   1 
ATOM   1260  C  CA  . THR A  1  167 ? 72.291  314.665 216.656 1.00 26.67  ? 167  THR A CA  1 
ATOM   1261  C  C   . THR A  1  167 ? 72.508  313.147 216.927 1.00 29.96  ? 167  THR A C   1 
ATOM   1262  O  O   . THR A  1  167 ? 72.782  312.710 218.075 1.00 29.41  ? 167  THR A O   1 
ATOM   1263  C  CB  . THR A  1  167 ? 70.771  314.924 216.407 1.00 25.56  ? 167  THR A CB  1 
ATOM   1264  O  OG1 . THR A  1  167 ? 70.604  316.363 216.306 1.00 26.64  ? 167  THR A OG1 1 
ATOM   1265  C  CG2 . THR A  1  167 ? 69.934  314.414 217.625 1.00 24.47  ? 167  THR A CG2 1 
ATOM   1266  N  N   . ILE A  1  168 ? 72.293  312.305 215.892 1.00 29.34  ? 168  ILE A N   1 
ATOM   1267  C  CA  . ILE A  1  168 ? 72.374  310.840 216.048 1.00 27.92  ? 168  ILE A CA  1 
ATOM   1268  C  C   . ILE A  1  168 ? 73.832  310.381 216.342 1.00 29.66  ? 168  ILE A C   1 
ATOM   1269  O  O   . ILE A  1  168 ? 74.078  309.445 217.061 1.00 29.76  ? 168  ILE A O   1 
ATOM   1270  C  CB  . ILE A  1  168 ? 71.822  310.162 214.753 1.00 27.86  ? 168  ILE A CB  1 
ATOM   1271  C  CG1 . ILE A  1  168 ? 70.232  310.356 214.745 1.00 25.10  ? 168  ILE A CG1 1 
ATOM   1272  C  CG2 . ILE A  1  168 ? 72.042  308.643 214.746 1.00 26.00  ? 168  ILE A CG2 1 
ATOM   1273  C  CD1 . ILE A  1  168 ? 69.575  310.137 213.288 1.00 23.66  ? 168  ILE A CD1 1 
ATOM   1274  N  N   . ILE A  1  169 ? 74.815  311.008 215.738 1.00 29.55  ? 169  ILE A N   1 
ATOM   1275  C  CA  . ILE A  1  169 ? 76.202  310.574 216.041 1.00 33.89  ? 169  ILE A CA  1 
ATOM   1276  C  C   . ILE A  1  169 ? 76.666  311.061 217.411 1.00 32.07  ? 169  ILE A C   1 
ATOM   1277  O  O   . ILE A  1  169 ? 77.439  310.370 218.103 1.00 34.15  ? 169  ILE A O   1 
ATOM   1278  C  CB  . ILE A  1  169 ? 77.235  311.297 215.069 1.00 32.94  ? 169  ILE A CB  1 
ATOM   1279  C  CG1 . ILE A  1  169 ? 77.135  310.791 213.630 1.00 41.04  ? 169  ILE A CG1 1 
ATOM   1280  C  CG2 . ILE A  1  169 ? 78.629  311.065 215.484 1.00 38.64  ? 169  ILE A CG2 1 
ATOM   1281  C  CD1 . ILE A  1  169 ? 77.021  309.395 213.557 1.00 43.59  ? 169  ILE A CD1 1 
ATOM   1282  N  N   . ASN A  1  170 ? 76.248  312.297 217.789 1.00 30.67  ? 170  ASN A N   1 
ATOM   1283  C  CA  . ASN A  1  170 ? 76.901  312.972 218.916 1.00 28.68  ? 170  ASN A CA  1 
ATOM   1284  C  C   . ASN A  1  170 ? 76.041  312.933 220.174 1.00 30.51  ? 170  ASN A C   1 
ATOM   1285  O  O   . ASN A  1  170 ? 76.571  313.281 221.210 1.00 28.24  ? 170  ASN A O   1 
ATOM   1286  C  CB  . ASN A  1  170 ? 77.083  314.492 218.598 1.00 29.07  ? 170  ASN A CB  1 
ATOM   1287  C  CG  . ASN A  1  170 ? 77.979  315.176 219.611 1.00 30.64  ? 170  ASN A CG  1 
ATOM   1288  O  OD1 . ASN A  1  170 ? 79.066  314.670 219.900 1.00 28.78  ? 170  ASN A OD1 1 
ATOM   1289  N  ND2 . ASN A  1  170 ? 77.546  316.303 220.168 1.00 29.91  ? 170  ASN A ND2 1 
ATOM   1290  N  N   . MET A  1  171 ? 74.719  312.583 220.122 1.00 26.17  ? 171  MET A N   1 
ATOM   1291  C  CA  . MET A  1  171 ? 73.937  312.876 221.342 1.00 24.26  ? 171  MET A CA  1 
ATOM   1292  C  C   . MET A  1  171 ? 73.311  311.658 221.936 1.00 29.27  ? 171  MET A C   1 
ATOM   1293  O  O   . MET A  1  171 ? 72.298  311.795 222.569 1.00 30.52  ? 171  MET A O   1 
ATOM   1294  C  CB  . MET A  1  171 ? 72.824  313.905 220.977 1.00 25.59  ? 171  MET A CB  1 
ATOM   1295  C  CG  . MET A  1  171 ? 73.481  315.323 220.710 1.00 25.90  ? 171  MET A CG  1 
ATOM   1296  S  SD  . MET A  1  171 ? 72.382  316.584 220.240 1.00 29.16  ? 171  MET A SD  1 
ATOM   1297  C  CE  . MET A  1  171 ? 71.562  316.864 221.836 1.00 30.47  ? 171  MET A CE  1 
ATOM   1298  N  N   . LYS A  1  172 ? 73.862  310.450 221.752 1.00 28.76  ? 172  LYS A N   1 
ATOM   1299  C  CA  . LYS A  1  172 ? 73.309  309.268 222.371 1.00 30.36  ? 172  LYS A CA  1 
ATOM   1300  C  C   . LYS A  1  172 ? 73.912  309.168 223.842 1.00 31.23  ? 172  LYS A C   1 
ATOM   1301  O  O   . LYS A  1  172 ? 74.903  309.826 224.141 1.00 30.79  ? 172  LYS A O   1 
ATOM   1302  C  CB  . LYS A  1  172 ? 73.751  308.018 221.569 1.00 27.83  ? 172  LYS A CB  1 
ATOM   1303  C  CG  . LYS A  1  172 ? 73.286  308.051 220.096 1.00 33.80  ? 172  LYS A CG  1 
ATOM   1304  C  CD  . LYS A  1  172 ? 73.855  306.906 219.218 1.00 34.13  ? 172  LYS A CD  1 
ATOM   1305  C  CE  . LYS A  1  172 ? 75.340  306.607 219.395 1.00 35.68  ? 172  LYS A CE  1 
ATOM   1306  N  NZ  . LYS A  1  172 ? 76.178  307.620 218.684 1.00 43.36  ? 172  LYS A NZ  1 
ATOM   1307  N  N   . PRO A  1  173 ? 73.328  308.300 224.719 1.00 30.20  ? 173  PRO A N   1 
ATOM   1308  C  CA  . PRO A  1  173 ? 73.992  308.064 226.062 1.00 29.11  ? 173  PRO A CA  1 
ATOM   1309  C  C   . PRO A  1  173 ? 75.394  307.574 225.735 1.00 31.61  ? 173  PRO A C   1 
ATOM   1310  O  O   . PRO A  1  173 ? 75.605  306.926 224.753 1.00 34.22  ? 173  PRO A O   1 
ATOM   1311  C  CB  . PRO A  1  173 ? 73.136  306.949 226.641 1.00 27.81  ? 173  PRO A CB  1 
ATOM   1312  C  CG  . PRO A  1  173 ? 71.645  307.227 226.023 1.00 25.74  ? 173  PRO A CG  1 
ATOM   1313  C  CD  . PRO A  1  173 ? 72.072  307.530 224.559 1.00 28.96  ? 173  PRO A CD  1 
ATOM   1314  N  N   . PRO A  1  174 ? 76.406  307.939 226.534 1.00 35.63  ? 174  PRO A N   1 
ATOM   1315  C  CA  . PRO A  1  174 ? 77.850  307.594 226.363 1.00 33.78  ? 174  PRO A CA  1 
ATOM   1316  C  C   . PRO A  1  174 ? 78.081  306.121 226.184 1.00 34.62  ? 174  PRO A C   1 
ATOM   1317  O  O   . PRO A  1  174 ? 78.922  305.719 225.411 1.00 32.99  ? 174  PRO A O   1 
ATOM   1318  C  CB  . PRO A  1  174 ? 78.481  308.059 227.692 1.00 36.98  ? 174  PRO A CB  1 
ATOM   1319  C  CG  . PRO A  1  174 ? 77.612  309.112 228.229 1.00 36.21  ? 174  PRO A CG  1 
ATOM   1320  C  CD  . PRO A  1  174 ? 76.164  308.859 227.681 1.00 32.26  ? 174  PRO A CD  1 
ATOM   1321  N  N   . ALA A  1  175 ? 77.262  305.285 226.796 1.00 33.00  ? 175  ALA A N   1 
ATOM   1322  C  CA  . ALA A  1  175 ? 77.351  303.839 226.675 1.00 33.91  ? 175  ALA A CA  1 
ATOM   1323  C  C   . ALA A  1  175 ? 76.671  303.211 225.458 1.00 34.86  ? 175  ALA A C   1 
ATOM   1324  O  O   . ALA A  1  175 ? 76.978  302.089 225.116 1.00 36.17  ? 175  ALA A O   1 
ATOM   1325  C  CB  . ALA A  1  175 ? 76.772  303.213 227.965 1.00 35.18  ? 175  ALA A CB  1 
ATOM   1326  N  N   . MET A  1  176 ? 75.783  303.957 224.772 1.00 33.37  ? 176  MET A N   1 
ATOM   1327  C  CA  . MET A  1  176 ? 75.029  303.394 223.690 1.00 32.09  ? 176  MET A CA  1 
ATOM   1328  C  C   . MET A  1  176 ? 75.914  303.578 222.425 1.00 32.53  ? 176  MET A C   1 
ATOM   1329  O  O   . MET A  1  176 ? 76.221  304.706 221.996 1.00 29.83  ? 176  MET A O   1 
ATOM   1330  C  CB  . MET A  1  176 ? 73.772  304.209 223.517 1.00 31.80  ? 176  MET A CB  1 
ATOM   1331  C  CG  . MET A  1  176 ? 72.881  303.719 222.298 1.00 35.30  ? 176  MET A CG  1 
ATOM   1332  S  SD  . MET A  1  176 ? 71.528  304.829 221.915 1.00 37.45  ? 176  MET A SD  1 
ATOM   1333  C  CE  . MET A  1  176 ? 70.228  304.524 223.164 1.00 31.55  ? 176  MET A CE  1 
ATOM   1334  N  N   . SER A  1  177 ? 76.365  302.489 221.870 1.00 31.55  ? 177  SER A N   1 
ATOM   1335  C  CA  . SER A  1  177 ? 76.917  302.552 220.516 1.00 32.48  ? 177  SER A CA  1 
ATOM   1336  C  C   . SER A  1  177 ? 75.822  302.688 219.411 1.00 30.85  ? 177  SER A C   1 
ATOM   1337  O  O   . SER A  1  177 ? 74.608  302.482 219.599 1.00 29.12  ? 177  SER A O   1 
ATOM   1338  C  CB  . SER A  1  177 ? 77.852  301.364 220.190 1.00 32.53  ? 177  SER A CB  1 
ATOM   1339  O  OG  . SER A  1  177 ? 77.064  300.192 219.741 1.00 34.20  ? 177  SER A OG  1 
ATOM   1340  N  N   . GLN A  1  178 ? 76.316  302.853 218.201 1.00 31.77  ? 178  GLN A N   1 
ATOM   1341  C  CA  . GLN A  1  178 ? 75.432  302.921 217.067 1.00 32.05  ? 178  GLN A CA  1 
ATOM   1342  C  C   . GLN A  1  178 ? 74.657  301.637 216.894 1.00 32.83  ? 178  GLN A C   1 
ATOM   1343  O  O   . GLN A  1  178 ? 73.576  301.621 216.353 1.00 34.73  ? 178  GLN A O   1 
ATOM   1344  C  CB  . GLN A  1  178 ? 76.208  303.283 215.800 1.00 34.01  ? 178  GLN A CB  1 
ATOM   1345  C  CG  . GLN A  1  178 ? 75.327  304.336 214.944 1.00 42.82  ? 178  GLN A CG  1 
ATOM   1346  C  CD  . GLN A  1  178 ? 75.087  305.742 215.614 1.00 47.66  ? 178  GLN A CD  1 
ATOM   1347  O  OE1 . GLN A  1  178 ? 73.959  306.066 215.820 1.00 40.48  ? 178  GLN A OE1 1 
ATOM   1348  N  NE2 . GLN A  1  178 ? 76.168  306.514 215.969 1.00 46.42  ? 178  GLN A NE2 1 
ATOM   1349  N  N   . TYR A  1  179 ? 75.215  300.533 217.310 1.00 34.15  ? 179  TYR A N   1 
ATOM   1350  C  CA  . TYR A  1  179 ? 74.543  299.261 217.170 1.00 33.06  ? 179  TYR A CA  1 
ATOM   1351  C  C   . TYR A  1  179 ? 73.620  299.016 218.368 1.00 34.22  ? 179  TYR A C   1 
ATOM   1352  O  O   . TYR A  1  179 ? 73.184  297.882 218.547 1.00 29.50  ? 179  TYR A O   1 
ATOM   1353  C  CB  . TYR A  1  179 ? 75.557  298.100 217.009 1.00 33.65  ? 179  TYR A CB  1 
ATOM   1354  C  CG  . TYR A  1  179 ? 76.528  298.398 215.873 1.00 35.14  ? 179  TYR A CG  1 
ATOM   1355  C  CD1 . TYR A  1  179 ? 76.042  298.651 214.581 1.00 34.86  ? 179  TYR A CD1 1 
ATOM   1356  C  CD2 . TYR A  1  179 ? 77.917  298.628 216.173 1.00 36.23  ? 179  TYR A CD2 1 
ATOM   1357  C  CE1 . TYR A  1  179 ? 76.909  298.995 213.543 1.00 38.09  ? 179  TYR A CE1 1 
ATOM   1358  C  CE2 . TYR A  1  179 ? 78.802  298.927 215.150 1.00 37.08  ? 179  TYR A CE2 1 
ATOM   1359  C  CZ  . TYR A  1  179 ? 78.311  299.109 213.854 1.00 39.51  ? 179  TYR A CZ  1 
ATOM   1360  O  OH  . TYR A  1  179 ? 79.201  299.482 212.892 1.00 40.49  ? 179  TYR A OH  1 
ATOM   1361  N  N   . GLN A  1  180 ? 73.288  300.085 219.131 1.00 31.63  ? 180  GLN A N   1 
ATOM   1362  C  CA  . GLN A  1  180 ? 72.285  299.961 220.120 1.00 32.16  ? 180  GLN A CA  1 
ATOM   1363  C  C   . GLN A  1  180 ? 71.178  301.010 219.916 1.00 32.41  ? 180  GLN A C   1 
ATOM   1364  O  O   . GLN A  1  180 ? 70.493  301.298 220.893 1.00 30.67  ? 180  GLN A O   1 
ATOM   1365  C  CB  . GLN A  1  180 ? 72.885  300.227 221.561 1.00 32.14  ? 180  GLN A CB  1 
ATOM   1366  C  CG  . GLN A  1  180 ? 73.313  298.913 222.221 1.00 36.56  ? 180  GLN A CG  1 
ATOM   1367  C  CD  . GLN A  1  180 ? 74.831  298.692 222.414 1.00 43.36  ? 180  GLN A CD  1 
ATOM   1368  O  OE1 . GLN A  1  180 ? 75.296  297.532 222.583 1.00 49.48  ? 180  GLN A OE1 1 
ATOM   1369  N  NE2 . GLN A  1  180 ? 75.570  299.765 222.537 1.00 36.81  ? 180  GLN A NE2 1 
ATOM   1370  N  N   . THR A  1  181 ? 71.036  301.594 218.720 1.00 30.46  ? 181  THR A N   1 
ATOM   1371  C  CA  . THR A  1  181 ? 69.956  302.594 218.518 1.00 31.85  ? 181  THR A CA  1 
ATOM   1372  C  C   . THR A  1  181 ? 68.906  301.893 217.730 1.00 29.27  ? 181  THR A C   1 
ATOM   1373  O  O   . THR A  1  181 ? 69.226  300.893 217.039 1.00 32.00  ? 181  THR A O   1 
ATOM   1374  C  CB  . THR A  1  181 ? 70.470  303.829 217.626 1.00 32.93  ? 181  THR A CB  1 
ATOM   1375  O  OG1 . THR A  1  181 ? 70.856  303.272 216.433 1.00 38.39  ? 181  THR A OG1 1 
ATOM   1376  C  CG2 . THR A  1  181 ? 71.748  304.494 218.211 1.00 34.48  ? 181  THR A CG2 1 
ATOM   1377  N  N   . PRO A  1  182 ? 67.654  302.291 217.938 1.00 27.04  ? 182  PRO A N   1 
ATOM   1378  C  CA  . PRO A  1  182 ? 66.603  301.595 217.285 1.00 27.97  ? 182  PRO A CA  1 
ATOM   1379  C  C   . PRO A  1  182 ? 66.725  301.746 215.722 1.00 28.82  ? 182  PRO A C   1 
ATOM   1380  O  O   . PRO A  1  182 ? 67.306  302.695 215.229 1.00 27.65  ? 182  PRO A O   1 
ATOM   1381  C  CB  . PRO A  1  182 ? 65.337  302.349 217.743 1.00 27.63  ? 182  PRO A CB  1 
ATOM   1382  C  CG  . PRO A  1  182 ? 65.664  302.897 219.127 1.00 28.22  ? 182  PRO A CG  1 
ATOM   1383  C  CD  . PRO A  1  182 ? 67.169  303.389 218.841 1.00 26.00  ? 182  PRO A CD  1 
ATOM   1384  N  N   . LEU A  1  183 ? 66.080  300.861 215.003 1.00 28.39  ? 183  LEU A N   1 
ATOM   1385  C  CA  . LEU A  1  183 ? 66.101  300.874 213.518 1.00 28.64  ? 183  LEU A CA  1 
ATOM   1386  C  C   . LEU A  1  183 ? 65.487  302.152 212.910 1.00 28.34  ? 183  LEU A C   1 
ATOM   1387  O  O   . LEU A  1  183 ? 65.953  302.657 211.873 1.00 29.20  ? 183  LEU A O   1 
ATOM   1388  C  CB  . LEU A  1  183 ? 65.380  299.588 213.013 1.00 28.45  ? 183  LEU A CB  1 
ATOM   1389  C  CG  . LEU A  1  183 ? 66.205  298.303 213.265 1.00 26.97  ? 183  LEU A CG  1 
ATOM   1390  C  CD1 . LEU A  1  183 ? 65.388  297.148 212.702 1.00 26.19  ? 183  LEU A CD1 1 
ATOM   1391  C  CD2 . LEU A  1  183 ? 67.678  298.368 212.650 1.00 28.34  ? 183  LEU A CD2 1 
ATOM   1392  N  N   . PHE A  1  184 ? 64.505  302.749 213.569 1.00 30.02  ? 184  PHE A N   1 
ATOM   1393  C  CA  . PHE A  1  184 ? 63.982  304.014 213.039 1.00 26.92  ? 184  PHE A CA  1 
ATOM   1394  C  C   . PHE A  1  184 ? 65.122  305.110 213.002 1.00 28.60  ? 184  PHE A C   1 
ATOM   1395  O  O   . PHE A  1  184 ? 65.221  305.868 212.030 1.00 28.08  ? 184  PHE A O   1 
ATOM   1396  C  CB  . PHE A  1  184 ? 62.748  304.590 213.796 1.00 27.11  ? 184  PHE A CB  1 
ATOM   1397  C  CG  . PHE A  1  184 ? 62.263  305.903 213.192 1.00 26.47  ? 184  PHE A CG  1 
ATOM   1398  C  CD1 . PHE A  1  184 ? 61.698  305.895 211.895 1.00 21.92  ? 184  PHE A CD1 1 
ATOM   1399  C  CD2 . PHE A  1  184 ? 62.357  307.072 213.907 1.00 27.65  ? 184  PHE A CD2 1 
ATOM   1400  C  CE1 . PHE A  1  184 ? 61.266  307.077 211.252 1.00 28.65  ? 184  PHE A CE1 1 
ATOM   1401  C  CE2 . PHE A  1  184 ? 61.860  308.281 213.346 1.00 26.42  ? 184  PHE A CE2 1 
ATOM   1402  C  CZ  . PHE A  1  184 ? 61.346  308.300 211.989 1.00 21.69  ? 184  PHE A CZ  1 
ATOM   1403  N  N   . VAL A  1  185 ? 65.933  305.181 214.035 1.00 28.08  ? 185  VAL A N   1 
ATOM   1404  C  CA  . VAL A  1  185 ? 67.005  306.157 214.103 1.00 27.01  ? 185  VAL A CA  1 
ATOM   1405  C  C   . VAL A  1  185 ? 68.047  305.857 213.023 1.00 27.53  ? 185  VAL A C   1 
ATOM   1406  O  O   . VAL A  1  185 ? 68.518  306.751 212.337 1.00 29.90  ? 185  VAL A O   1 
ATOM   1407  C  CB  . VAL A  1  185 ? 67.619  306.097 215.489 1.00 28.14  ? 185  VAL A CB  1 
ATOM   1408  C  CG1 . VAL A  1  185 ? 68.839  306.944 215.597 1.00 27.78  ? 185  VAL A CG1 1 
ATOM   1409  C  CG2 . VAL A  1  185 ? 66.546  306.462 216.612 1.00 24.84  ? 185  VAL A CG2 1 
ATOM   1410  N  N   . TRP A  1  186 ? 68.388  304.590 212.822 1.00 25.92  ? 186  TRP A N   1 
ATOM   1411  C  CA  . TRP A  1  186 ? 69.157  304.202 211.659 1.00 26.56  ? 186  TRP A CA  1 
ATOM   1412  C  C   . TRP A  1  186 ? 68.541  304.658 210.319 1.00 25.92  ? 186  TRP A C   1 
ATOM   1413  O  O   . TRP A  1  186 ? 69.289  305.204 209.521 1.00 25.24  ? 186  TRP A O   1 
ATOM   1414  C  CB  . TRP A  1  186 ? 69.374  302.657 211.576 1.00 26.49  ? 186  TRP A CB  1 
ATOM   1415  C  CG  . TRP A  1  186 ? 70.546  302.188 212.381 1.00 27.15  ? 186  TRP A CG  1 
ATOM   1416  C  CD1 . TRP A  1  186 ? 70.466  301.454 213.558 1.00 28.68  ? 186  TRP A CD1 1 
ATOM   1417  C  CD2 . TRP A  1  186 ? 71.959  302.242 212.045 1.00 27.92  ? 186  TRP A CD2 1 
ATOM   1418  N  NE1 . TRP A  1  186 ? 71.758  301.183 214.021 1.00 24.96  ? 186  TRP A NE1 1 
ATOM   1419  C  CE2 . TRP A  1  186 ? 72.674  301.638 213.119 1.00 26.90  ? 186  TRP A CE2 1 
ATOM   1420  C  CE3 . TRP A  1  186 ? 72.684  302.788 210.989 1.00 32.59  ? 186  TRP A CE3 1 
ATOM   1421  C  CZ2 . TRP A  1  186 ? 74.120  301.535 213.131 1.00 30.96  ? 186  TRP A CZ2 1 
ATOM   1422  C  CZ3 . TRP A  1  186 ? 74.065  302.690 210.972 1.00 30.93  ? 186  TRP A CZ3 1 
ATOM   1423  C  CH2 . TRP A  1  186 ? 74.785  302.042 212.041 1.00 31.53  ? 186  TRP A CH2 1 
ATOM   1424  N  N   . SER A  1  187 ? 67.200  304.518 210.129 1.00 24.65  ? 187  SER A N   1 
ATOM   1425  C  CA  . SER A  1  187 ? 66.581  304.818 208.878 1.00 23.36  ? 187  SER A CA  1 
ATOM   1426  C  C   . SER A  1  187 ? 66.696  306.334 208.647 1.00 26.58  ? 187  SER A C   1 
ATOM   1427  O  O   . SER A  1  187 ? 66.881  306.768 207.491 1.00 28.86  ? 187  SER A O   1 
ATOM   1428  C  CB  . SER A  1  187 ? 65.124  304.252 208.884 1.00 24.28  ? 187  SER A CB  1 
ATOM   1429  O  OG  . SER A  1  187 ? 64.302  305.101 209.648 1.00 24.11  ? 187  SER A OG  1 
ATOM   1430  N  N   . VAL A  1  188 ? 66.629  307.183 209.735 1.00 26.91  ? 188  VAL A N   1 
ATOM   1431  C  CA  . VAL A  1  188 ? 66.717  308.671 209.602 1.00 24.12  ? 188  VAL A CA  1 
ATOM   1432  C  C   . VAL A  1  188 ? 68.161  309.036 209.311 1.00 26.43  ? 188  VAL A C   1 
ATOM   1433  O  O   . VAL A  1  188 ? 68.478  309.918 208.474 1.00 26.35  ? 188  VAL A O   1 
ATOM   1434  C  CB  . VAL A  1  188 ? 66.119  309.332 210.861 1.00 23.39  ? 188  VAL A CB  1 
ATOM   1435  C  CG1 . VAL A  1  188 ? 66.311  310.857 210.860 1.00 25.73  ? 188  VAL A CG1 1 
ATOM   1436  C  CG2 . VAL A  1  188 ? 64.570  309.013 210.896 1.00 24.63  ? 188  VAL A CG2 1 
ATOM   1437  N  N   . MET A  1  189 ? 69.091  308.397 210.027 1.00 24.96  ? 189  MET A N   1 
ATOM   1438  C  CA  . MET A  1  189 ? 70.483  308.732 209.729 1.00 26.64  ? 189  MET A CA  1 
ATOM   1439  C  C   . MET A  1  189 ? 70.895  308.477 208.279 1.00 25.45  ? 189  MET A C   1 
ATOM   1440  O  O   . MET A  1  189 ? 71.652  309.239 207.694 1.00 25.59  ? 189  MET A O   1 
ATOM   1441  C  CB  . MET A  1  189 ? 71.344  307.971 210.645 1.00 25.55  ? 189  MET A CB  1 
ATOM   1442  C  CG  . MET A  1  189 ? 72.719  307.811 210.100 1.00 37.13  ? 189  MET A CG  1 
ATOM   1443  S  SD  . MET A  1  189 ? 73.797  309.024 210.767 1.00 49.88  ? 189  MET A SD  1 
ATOM   1444  C  CE  . MET A  1  189 ? 74.297  307.878 211.833 1.00 27.61  ? 189  MET A CE  1 
ATOM   1445  N  N   . ILE A  1  190 ? 70.521  307.314 207.742 1.00 25.91  ? 190  ILE A N   1 
ATOM   1446  C  CA  . ILE A  1  190 ? 70.842  306.944 206.379 1.00 24.54  ? 190  ILE A CA  1 
ATOM   1447  C  C   . ILE A  1  190 ? 70.148  307.866 205.360 1.00 25.56  ? 190  ILE A C   1 
ATOM   1448  O  O   . ILE A  1  190 ? 70.833  308.384 204.445 1.00 27.32  ? 190  ILE A O   1 
ATOM   1449  C  CB  . ILE A  1  190 ? 70.547  305.416 206.162 1.00 24.95  ? 190  ILE A CB  1 
ATOM   1450  C  CG1 . ILE A  1  190 ? 71.619  304.631 206.982 1.00 25.89  ? 190  ILE A CG1 1 
ATOM   1451  C  CG2 . ILE A  1  190 ? 70.886  305.015 204.635 1.00 27.43  ? 190  ILE A CG2 1 
ATOM   1452  C  CD1 . ILE A  1  190 ? 71.122  303.252 207.263 1.00 27.98  ? 190  ILE A CD1 1 
ATOM   1453  N  N   . THR A  1  191 ? 68.842  308.121 205.585 1.00 21.75  ? 191  THR A N   1 
ATOM   1454  C  CA  . THR A  1  191 ? 68.133  309.073 204.787 1.00 23.44  ? 191  THR A CA  1 
ATOM   1455  C  C   . THR A  1  191 ? 68.870  310.412 204.753 1.00 23.16  ? 191  THR A C   1 
ATOM   1456  O  O   . THR A  1  191 ? 69.005  311.039 203.741 1.00 25.02  ? 191  THR A O   1 
ATOM   1457  C  CB  . THR A  1  191 ? 66.733  309.283 205.411 1.00 22.25  ? 191  THR A CB  1 
ATOM   1458  O  OG1 . THR A  1  191 ? 66.057  308.039 205.292 1.00 25.07  ? 191  THR A OG1 1 
ATOM   1459  C  CG2 . THR A  1  191 ? 65.961  310.388 204.663 1.00 17.90  ? 191  THR A CG2 1 
ATOM   1460  N  N   . ALA A  1  192 ? 69.296  310.878 205.917 1.00 22.86  ? 192  ALA A N   1 
ATOM   1461  C  CA  . ALA A  1  192 ? 70.028  312.157 205.981 1.00 24.93  ? 192  ALA A CA  1 
ATOM   1462  C  C   . ALA A  1  192 ? 71.360  312.134 205.258 1.00 25.81  ? 192  ALA A C   1 
ATOM   1463  O  O   . ALA A  1  192 ? 71.765  313.155 204.673 1.00 25.06  ? 192  ALA A O   1 
ATOM   1464  C  CB  . ALA A  1  192 ? 70.249  312.554 207.538 1.00 23.69  ? 192  ALA A CB  1 
ATOM   1465  N  N   . VAL A  1  193 ? 72.117  311.069 205.376 1.00 25.27  ? 193  VAL A N   1 
ATOM   1466  C  CA  . VAL A  1  193 ? 73.371  311.043 204.592 1.00 27.73  ? 193  VAL A CA  1 
ATOM   1467  C  C   . VAL A  1  193 ? 73.009  311.161 203.073 1.00 28.60  ? 193  VAL A C   1 
ATOM   1468  O  O   . VAL A  1  193 ? 73.703  311.838 202.300 1.00 28.58  ? 193  VAL A O   1 
ATOM   1469  C  CB  . VAL A  1  193 ? 74.123  309.778 204.807 1.00 27.27  ? 193  VAL A CB  1 
ATOM   1470  C  CG1 . VAL A  1  193 ? 75.337  309.581 203.802 1.00 28.77  ? 193  VAL A CG1 1 
ATOM   1471  C  CG2 . VAL A  1  193 ? 74.606  309.766 206.391 1.00 25.75  ? 193  VAL A CG2 1 
ATOM   1472  N  N   . LEU A  1  194 ? 71.953  310.504 202.640 1.00 26.97  ? 194  LEU A N   1 
ATOM   1473  C  CA  . LEU A  1  194 ? 71.603  310.620 201.220 1.00 25.72  ? 194  LEU A CA  1 
ATOM   1474  C  C   . LEU A  1  194 ? 71.142  311.989 200.844 1.00 26.42  ? 194  LEU A C   1 
ATOM   1475  O  O   . LEU A  1  194 ? 71.342  312.338 199.640 1.00 27.63  ? 194  LEU A O   1 
ATOM   1476  C  CB  . LEU A  1  194 ? 70.404  309.695 200.869 1.00 27.58  ? 194  LEU A CB  1 
ATOM   1477  C  CG  . LEU A  1  194 ? 70.619  308.126 200.771 1.00 30.85  ? 194  LEU A CG  1 
ATOM   1478  C  CD1 . LEU A  1  194 ? 69.611  307.263 200.024 1.00 24.59  ? 194  LEU A CD1 1 
ATOM   1479  C  CD2 . LEU A  1  194 ? 72.029  307.392 201.086 1.00 30.03  ? 194  LEU A CD2 1 
ATOM   1480  N  N   . LEU A  1  195 ? 70.346  312.692 201.736 1.00 23.36  ? 195  LEU A N   1 
ATOM   1481  C  CA  . LEU A  1  195 ? 69.878  314.060 201.448 1.00 24.46  ? 195  LEU A CA  1 
ATOM   1482  C  C   . LEU A  1  195 ? 71.144  314.894 201.222 1.00 25.35  ? 195  LEU A C   1 
ATOM   1483  O  O   . LEU A  1  195 ? 71.214  315.800 200.362 1.00 24.24  ? 195  LEU A O   1 
ATOM   1484  C  CB  . LEU A  1  195 ? 69.146  314.701 202.608 1.00 23.09  ? 195  LEU A CB  1 
ATOM   1485  C  CG  . LEU A  1  195 ? 67.723  313.943 202.570 1.00 21.83  ? 195  LEU A CG  1 
ATOM   1486  C  CD1 . LEU A  1  195 ? 66.945  314.191 204.006 1.00 24.53  ? 195  LEU A CD1 1 
ATOM   1487  C  CD2 . LEU A  1  195 ? 66.942  314.693 201.517 1.00 22.59  ? 195  LEU A CD2 1 
ATOM   1488  N  N   . LEU A  1  196 ? 72.061  314.706 202.143 1.00 24.33  ? 196  LEU A N   1 
ATOM   1489  C  CA  . LEU A  1  196 ? 73.272  315.622 202.233 1.00 24.86  ? 196  LEU A CA  1 
ATOM   1490  C  C   . LEU A  1  196 ? 74.093  315.596 200.926 1.00 24.43  ? 196  LEU A C   1 
ATOM   1491  O  O   . LEU A  1  196 ? 74.743  316.623 200.469 1.00 26.68  ? 196  LEU A O   1 
ATOM   1492  C  CB  . LEU A  1  196 ? 74.152  315.068 203.411 1.00 24.81  ? 196  LEU A CB  1 
ATOM   1493  C  CG  . LEU A  1  196 ? 75.352  316.039 203.705 1.00 31.18  ? 196  LEU A CG  1 
ATOM   1494  C  CD1 . LEU A  1  196 ? 74.937  317.341 204.507 1.00 28.88  ? 196  LEU A CD1 1 
ATOM   1495  C  CD2 . LEU A  1  196 ? 76.560  315.288 204.389 1.00 27.10  ? 196  LEU A CD2 1 
ATOM   1496  N  N   . LEU A  1  197 ? 74.302  314.385 200.436 1.00 24.15  ? 197  LEU A N   1 
ATOM   1497  C  CA  . LEU A  1  197 ? 75.016  314.132 199.177 1.00 24.59  ? 197  LEU A CA  1 
ATOM   1498  C  C   . LEU A  1  197 ? 74.209  314.380 197.889 1.00 28.22  ? 197  LEU A C   1 
ATOM   1499  O  O   . LEU A  1  197 ? 74.796  314.858 196.892 1.00 31.08  ? 197  LEU A O   1 
ATOM   1500  C  CB  . LEU A  1  197 ? 75.664  312.716 199.154 1.00 25.63  ? 197  LEU A CB  1 
ATOM   1501  C  CG  . LEU A  1  197 ? 76.462  312.391 200.462 1.00 25.90  ? 197  LEU A CG  1 
ATOM   1502  C  CD1 . LEU A  1  197 ? 76.719  310.835 200.333 1.00 24.20  ? 197  LEU A CD1 1 
ATOM   1503  C  CD2 . LEU A  1  197 ? 77.804  313.253 200.400 1.00 31.59  ? 197  LEU A CD2 1 
ATOM   1504  N  N   . SER A  1  198 ? 72.896  314.105 197.877 1.00 27.86  ? 198  SER A N   1 
ATOM   1505  C  CA  . SER A  1  198 ? 72.181  314.196 196.605 1.00 26.76  ? 198  SER A CA  1 
ATOM   1506  C  C   . SER A  1  198 ? 71.607  315.543 196.318 1.00 28.02  ? 198  SER A C   1 
ATOM   1507  O  O   . SER A  1  198 ? 71.570  315.998 195.195 1.00 27.46  ? 198  SER A O   1 
ATOM   1508  C  CB  . SER A  1  198 ? 71.134  313.087 196.598 1.00 27.04  ? 198  SER A CB  1 
ATOM   1509  O  OG  . SER A  1  198 ? 70.136  313.330 197.548 1.00 28.11  ? 198  SER A OG  1 
ATOM   1510  N  N   . LEU A  1  199 ? 71.054  316.208 197.324 1.00 27.94  ? 199  LEU A N   1 
ATOM   1511  C  CA  . LEU A  1  199 ? 70.418  317.531 197.044 1.00 26.89  ? 199  LEU A CA  1 
ATOM   1512  C  C   . LEU A  1  199 ? 71.362  318.586 196.472 1.00 27.83  ? 199  LEU A C   1 
ATOM   1513  O  O   . LEU A  1  199 ? 70.924  319.409 195.712 1.00 27.57  ? 199  LEU A O   1 
ATOM   1514  C  CB  . LEU A  1  199 ? 69.730  318.068 198.300 1.00 26.18  ? 199  LEU A CB  1 
ATOM   1515  C  CG  . LEU A  1  199 ? 68.354  317.386 198.552 1.00 29.67  ? 199  LEU A CG  1 
ATOM   1516  C  CD1 . LEU A  1  199 ? 68.003  317.784 200.001 1.00 24.97  ? 199  LEU A CD1 1 
ATOM   1517  C  CD2 . LEU A  1  199 ? 67.377  317.988 197.554 1.00 27.13  ? 199  LEU A CD2 1 
ATOM   1518  N  N   . PRO A  1  200 ? 72.649  318.596 196.862 1.00 27.22  ? 200  PRO A N   1 
ATOM   1519  C  CA  . PRO A  1  200 ? 73.510  319.621 196.232 1.00 24.71  ? 200  PRO A CA  1 
ATOM   1520  C  C   . PRO A  1  200 ? 73.726  319.400 194.754 1.00 24.98  ? 200  PRO A C   1 
ATOM   1521  O  O   . PRO A  1  200 ? 73.944  320.385 194.029 1.00 26.66  ? 200  PRO A O   1 
ATOM   1522  C  CB  . PRO A  1  200 ? 74.833  319.460 196.964 1.00 25.72  ? 200  PRO A CB  1 
ATOM   1523  C  CG  . PRO A  1  200 ? 74.401  318.880 198.364 1.00 27.38  ? 200  PRO A CG  1 
ATOM   1524  C  CD  . PRO A  1  200 ? 73.324  317.896 197.979 1.00 25.09  ? 200  PRO A CD  1 
ATOM   1525  N  N   . VAL A  1  201 ? 73.613  318.164 194.290 1.00 27.64  ? 201  VAL A N   1 
ATOM   1526  C  CA  . VAL A  1  201 ? 73.694  317.866 192.850 1.00 25.19  ? 201  VAL A CA  1 
ATOM   1527  C  C   . VAL A  1  201 ? 72.418  318.353 192.178 1.00 27.17  ? 201  VAL A C   1 
ATOM   1528  O  O   . VAL A  1  201 ? 72.525  318.984 191.094 1.00 26.69  ? 201  VAL A O   1 
ATOM   1529  C  CB  . VAL A  1  201 ? 73.986  316.362 192.624 1.00 28.63  ? 201  VAL A CB  1 
ATOM   1530  C  CG1 . VAL A  1  201 ? 74.201  316.112 191.137 1.00 29.63  ? 201  VAL A CG1 1 
ATOM   1531  C  CG2 . VAL A  1  201 ? 75.318  315.945 193.331 1.00 26.48  ? 201  VAL A CG2 1 
ATOM   1532  N  N   . LEU A  1  202 ? 71.206  318.013 192.691 1.00 25.49  ? 202  LEU A N   1 
ATOM   1533  C  CA  . LEU A  1  202 ? 70.049  318.694 192.116 1.00 26.15  ? 202  LEU A CA  1 
ATOM   1534  C  C   . LEU A  1  202 ? 70.241  320.222 192.136 1.00 27.43  ? 202  LEU A C   1 
ATOM   1535  O  O   . LEU A  1  202 ? 69.906  320.866 191.157 1.00 28.63  ? 202  LEU A O   1 
ATOM   1536  C  CB  . LEU A  1  202 ? 68.862  318.377 192.955 1.00 23.91  ? 202  LEU A CB  1 
ATOM   1537  C  CG  . LEU A  1  202 ? 67.508  319.000 192.576 1.00 23.59  ? 202  LEU A CG  1 
ATOM   1538  C  CD1 . LEU A  1  202 ? 67.037  318.379 191.298 1.00 24.17  ? 202  LEU A CD1 1 
ATOM   1539  C  CD2 . LEU A  1  202 ? 66.387  318.864 193.772 1.00 27.23  ? 202  LEU A CD2 1 
ATOM   1540  N  N   . ALA A  1  203 ? 70.670  320.830 193.273 1.00 25.80  ? 203  ALA A N   1 
ATOM   1541  C  CA  . ALA A  1  203 ? 70.790  322.263 193.317 1.00 26.41  ? 203  ALA A CA  1 
ATOM   1542  C  C   . ALA A  1  203 ? 71.732  322.762 192.164 1.00 28.32  ? 203  ALA A C   1 
ATOM   1543  O  O   . ALA A  1  203 ? 71.451  323.797 191.521 1.00 26.80  ? 203  ALA A O   1 
ATOM   1544  C  CB  . ALA A  1  203 ? 71.277  322.752 194.737 1.00 26.44  ? 203  ALA A CB  1 
ATOM   1545  N  N   . ALA A  1  204 ? 72.781  322.021 191.861 1.00 27.00  ? 204  ALA A N   1 
ATOM   1546  C  CA  . ALA A  1  204 ? 73.726  322.479 190.829 1.00 28.65  ? 204  ALA A CA  1 
ATOM   1547  C  C   . ALA A  1  204 ? 72.992  322.346 189.500 1.00 28.29  ? 204  ALA A C   1 
ATOM   1548  O  O   . ALA A  1  204 ? 72.997  323.307 188.681 1.00 28.34  ? 204  ALA A O   1 
ATOM   1549  C  CB  . ALA A  1  204 ? 74.989  321.620 190.763 1.00 28.75  ? 204  ALA A CB  1 
ATOM   1550  N  N   . GLY A  1  205 ? 72.256  321.258 189.319 1.00 25.15  ? 205  GLY A N   1 
ATOM   1551  C  CA  . GLY A  1  205 ? 71.599  321.107 187.979 1.00 25.92  ? 205  GLY A CA  1 
ATOM   1552  C  C   . GLY A  1  205 ? 70.437  322.075 187.752 1.00 28.93  ? 205  GLY A C   1 
ATOM   1553  O  O   . GLY A  1  205 ? 70.293  322.591 186.648 1.00 28.33  ? 205  GLY A O   1 
ATOM   1554  N  N   . ILE A  1  206 ? 69.626  322.365 188.774 1.00 25.78  ? 206  ILE A N   1 
ATOM   1555  C  CA  . ILE A  1  206 ? 68.530  323.353 188.548 1.00 25.59  ? 206  ILE A CA  1 
ATOM   1556  C  C   . ILE A  1  206 ? 69.019  324.804 188.500 1.00 28.52  ? 206  ILE A C   1 
ATOM   1557  O  O   . ILE A  1  206 ? 68.370  325.656 187.888 1.00 27.06  ? 206  ILE A O   1 
ATOM   1558  C  CB  . ILE A  1  206 ? 67.401  323.262 189.594 1.00 26.74  ? 206  ILE A CB  1 
ATOM   1559  C  CG1 . ILE A  1  206 ? 67.854  323.689 191.046 1.00 26.35  ? 206  ILE A CG1 1 
ATOM   1560  C  CG2 . ILE A  1  206 ? 66.687  321.846 189.470 1.00 25.07  ? 206  ILE A CG2 1 
ATOM   1561  C  CD1 . ILE A  1  206 ? 66.765  323.261 192.127 1.00 25.41  ? 206  ILE A CD1 1 
ATOM   1562  N  N   . THR A  1  207 ? 70.198  325.039 189.083 1.00 26.40  ? 207  THR A N   1 
ATOM   1563  C  CA  . THR A  1  207 ? 70.881  326.333 188.964 1.00 27.48  ? 207  THR A CA  1 
ATOM   1564  C  C   . THR A  1  207 ? 71.326  326.534 187.499 1.00 28.29  ? 207  THR A C   1 
ATOM   1565  O  O   . THR A  1  207 ? 71.223  327.635 186.952 1.00 27.16  ? 207  THR A O   1 
ATOM   1566  C  CB  . THR A  1  207 ? 72.054  326.430 190.021 1.00 26.38  ? 207  THR A CB  1 
ATOM   1567  O  OG1 . THR A  1  207 ? 71.487  326.261 191.345 1.00 28.23  ? 207  THR A OG1 1 
ATOM   1568  C  CG2 . THR A  1  207 ? 72.772  327.808 189.943 1.00 27.51  ? 207  THR A CG2 1 
ATOM   1569  N  N   . MET A  1  208 ? 71.943  325.518 186.909 1.00 27.46  ? 208  MET A N   1 
ATOM   1570  C  CA  . MET A  1  208 ? 72.291  325.539 185.502 1.00 27.59  ? 208  MET A CA  1 
ATOM   1571  C  C   . MET A  1  208 ? 71.053  325.795 184.672 1.00 27.86  ? 208  MET A C   1 
ATOM   1572  O  O   . MET A  1  208 ? 71.153  326.483 183.701 1.00 29.92  ? 208  MET A O   1 
ATOM   1573  C  CB  . MET A  1  208 ? 73.058  324.220 185.196 1.00 25.32  ? 208  MET A CB  1 
ATOM   1574  C  CG  . MET A  1  208 ? 74.509  324.282 185.773 1.00 31.08  ? 208  MET A CG  1 
ATOM   1575  S  SD  . MET A  1  208 ? 75.092  322.606 185.474 1.00 44.00  ? 208  MET A SD  1 
ATOM   1576  C  CE  . MET A  1  208 ? 75.805  321.942 186.986 1.00 36.90  ? 208  MET A CE  1 
ATOM   1577  N  N   . LEU A  1  209 ? 69.903  325.187 185.015 1.00 27.06  ? 209  LEU A N   1 
ATOM   1578  C  CA  . LEU A  1  209 ? 68.671  325.438 184.280 1.00 26.77  ? 209  LEU A CA  1 
ATOM   1579  C  C   . LEU A  1  209 ? 68.241  326.902 184.417 1.00 26.78  ? 209  LEU A C   1 
ATOM   1580  O  O   . LEU A  1  209 ? 67.909  327.570 183.404 1.00 27.41  ? 209  LEU A O   1 
ATOM   1581  C  CB  . LEU A  1  209 ? 67.536  324.499 184.688 1.00 28.77  ? 209  LEU A CB  1 
ATOM   1582  C  CG  . LEU A  1  209 ? 66.180  324.603 183.910 1.00 25.90  ? 209  LEU A CG  1 
ATOM   1583  C  CD1 . LEU A  1  209 ? 66.390  324.376 182.306 1.00 25.69  ? 209  LEU A CD1 1 
ATOM   1584  C  CD2 . LEU A  1  209 ? 65.168  323.584 184.573 1.00 24.93  ? 209  LEU A CD2 1 
ATOM   1585  N  N   . LEU A  1  210 ? 68.314  327.421 185.654 1.00 28.34  ? 210  LEU A N   1 
ATOM   1586  C  CA  . LEU A  1  210 ? 68.026  328.844 185.892 1.00 27.73  ? 210  LEU A CA  1 
ATOM   1587  C  C   . LEU A  1  210 ? 68.945  329.775 185.065 1.00 26.59  ? 210  LEU A C   1 
ATOM   1588  O  O   . LEU A  1  210 ? 68.478  330.816 184.505 1.00 27.86  ? 210  LEU A O   1 
ATOM   1589  C  CB  . LEU A  1  210 ? 68.246  329.127 187.402 1.00 25.56  ? 210  LEU A CB  1 
ATOM   1590  C  CG  . LEU A  1  210 ? 67.826  330.495 187.853 1.00 27.78  ? 210  LEU A CG  1 
ATOM   1591  C  CD1 . LEU A  1  210 ? 66.219  330.595 187.953 1.00 26.31  ? 210  LEU A CD1 1 
ATOM   1592  C  CD2 . LEU A  1  210 ? 68.515  330.847 189.193 1.00 26.10  ? 210  LEU A CD2 1 
ATOM   1593  N  N   . THR A  1  211 ? 70.260  329.480 185.003 1.00 26.45  ? 211  THR A N   1 
ATOM   1594  C  CA  . THR A  1  211 ? 71.122  330.370 184.231 1.00 26.75  ? 211  THR A CA  1 
ATOM   1595  C  C   . THR A  1  211 ? 70.886  330.178 182.696 1.00 29.73  ? 211  THR A C   1 
ATOM   1596  O  O   . THR A  1  211 ? 70.958  331.167 181.913 1.00 31.42  ? 211  THR A O   1 
ATOM   1597  C  CB  . THR A  1  211 ? 72.603  330.208 184.653 1.00 27.85  ? 211  THR A CB  1 
ATOM   1598  O  OG1 . THR A  1  211 ? 73.060  328.895 184.349 1.00 28.37  ? 211  THR A OG1 1 
ATOM   1599  C  CG2 . THR A  1  211 ? 72.791  330.489 186.187 1.00 28.38  ? 211  THR A CG2 1 
ATOM   1600  N  N   . ASP A  1  212 ? 70.560  328.934 182.266 1.00 28.79  ? 212  ASP A N   1 
ATOM   1601  C  CA  . ASP A  1  212 ? 70.225  328.759 180.865 1.00 28.26  ? 212  ASP A CA  1 
ATOM   1602  C  C   . ASP A  1  212 ? 68.983  329.622 180.572 1.00 29.86  ? 212  ASP A C   1 
ATOM   1603  O  O   . ASP A  1  212 ? 68.890  330.249 179.450 1.00 29.91  ? 212  ASP A O   1 
ATOM   1604  C  CB  . ASP A  1  212 ? 69.972  327.273 180.447 1.00 25.91  ? 212  ASP A CB  1 
ATOM   1605  C  CG  . ASP A  1  212 ? 71.238  326.540 180.101 1.00 28.11  ? 212  ASP A CG  1 
ATOM   1606  O  OD1 . ASP A  1  212 ? 71.109  325.545 179.409 1.00 26.68  ? 212  ASP A OD1 1 
ATOM   1607  O  OD2 . ASP A  1  212 ? 72.386  326.948 180.474 1.00 25.88  ? 212  ASP A OD2 1 
ATOM   1608  N  N   . ARG A  1  213 ? 68.035  329.691 181.515 1.00 28.52  ? 213  ARG A N   1 
ATOM   1609  C  CA  . ARG A  1  213 ? 66.825  330.481 181.256 1.00 28.83  ? 213  ARG A CA  1 
ATOM   1610  C  C   . ARG A  1  213 ? 66.971  331.971 181.376 1.00 31.47  ? 213  ARG A C   1 
ATOM   1611  O  O   . ARG A  1  213 ? 66.123  332.677 180.844 1.00 31.17  ? 213  ARG A O   1 
ATOM   1612  C  CB  . ARG A  1  213 ? 65.661  330.074 182.228 1.00 26.94  ? 213  ARG A CB  1 
ATOM   1613  C  CG  . ARG A  1  213 ? 65.129  328.708 181.972 1.00 28.82  ? 213  ARG A CG  1 
ATOM   1614  C  CD  . ARG A  1  213 ? 64.214  328.215 183.145 1.00 28.84  ? 213  ARG A CD  1 
ATOM   1615  N  NE  . ARG A  1  213 ? 63.172  329.168 183.366 1.00 29.34  ? 213  ARG A NE  1 
ATOM   1616  C  CZ  . ARG A  1  213 ? 62.082  329.354 182.607 1.00 29.65  ? 213  ARG A CZ  1 
ATOM   1617  N  NH1 . ARG A  1  213 ? 61.746  328.541 181.566 1.00 26.56  ? 213  ARG A NH1 1 
ATOM   1618  N  NH2 . ARG A  1  213 ? 61.267  330.313 182.960 1.00 30.83  ? 213  ARG A NH2 1 
ATOM   1619  N  N   . ASN A  1  214 ? 67.939  332.479 182.179 1.00 31.96  ? 214  ASN A N   1 
ATOM   1620  C  CA  . ASN A  1  214 ? 67.980  333.903 182.456 1.00 31.35  ? 214  ASN A CA  1 
ATOM   1621  C  C   . ASN A  1  214 ? 69.354  334.562 182.262 1.00 31.95  ? 214  ASN A C   1 
ATOM   1622  O  O   . ASN A  1  214 ? 69.429  335.796 182.237 1.00 32.00  ? 214  ASN A O   1 
ATOM   1623  C  CB  . ASN A  1  214 ? 67.532  334.140 183.891 1.00 32.65  ? 214  ASN A CB  1 
ATOM   1624  C  CG  . ASN A  1  214 ? 66.091  333.712 184.089 1.00 31.81  ? 214  ASN A CG  1 
ATOM   1625  O  OD1 . ASN A  1  214 ? 65.166  334.384 183.618 1.00 34.77  ? 214  ASN A OD1 1 
ATOM   1626  N  ND2 . ASN A  1  214 ? 65.890  332.581 184.730 1.00 29.50  ? 214  ASN A ND2 1 
ATOM   1627  N  N   . LEU A  1  215 ? 70.437  333.794 182.120 1.00 28.41  ? 215  LEU A N   1 
ATOM   1628  C  CA  . LEU A  1  215 ? 71.780  334.485 181.955 1.00 27.47  ? 215  LEU A CA  1 
ATOM   1629  C  C   . LEU A  1  215 ? 72.490  334.090 180.661 1.00 28.48  ? 215  LEU A C   1 
ATOM   1630  O  O   . LEU A  1  215 ? 73.772  334.261 180.559 1.00 29.56  ? 215  LEU A O   1 
ATOM   1631  C  CB  . LEU A  1  215 ? 72.695  334.145 183.190 1.00 28.71  ? 215  LEU A CB  1 
ATOM   1632  C  CG  . LEU A  1  215 ? 72.175  334.686 184.553 1.00 32.64  ? 215  LEU A CG  1 
ATOM   1633  C  CD1 . LEU A  1  215 ? 73.179  334.246 185.715 1.00 32.29  ? 215  LEU A CD1 1 
ATOM   1634  C  CD2 . LEU A  1  215 ? 72.022  336.240 184.505 1.00 33.83  ? 215  LEU A CD2 1 
ATOM   1635  N  N   . ASN A  1  216 ? 71.725  333.512 179.677 1.00 28.97  ? 216  ASN A N   1 
ATOM   1636  C  CA  . ASN A  1  216 ? 72.343  333.079 178.394 1.00 30.09  ? 216  ASN A CA  1 
ATOM   1637  C  C   . ASN A  1  216 ? 73.463  332.066 178.513 1.00 31.84  ? 216  ASN A C   1 
ATOM   1638  O  O   . ASN A  1  216 ? 74.359  331.937 177.598 1.00 29.50  ? 216  ASN A O   1 
ATOM   1639  C  CB  . ASN A  1  216 ? 72.716  334.330 177.518 1.00 31.22  ? 216  ASN A CB  1 
ATOM   1640  C  CG  . ASN A  1  216 ? 71.460  335.143 177.246 1.00 31.62  ? 216  ASN A CG  1 
ATOM   1641  O  OD1 . ASN A  1  216 ? 70.447  334.551 176.838 1.00 29.14  ? 216  ASN A OD1 1 
ATOM   1642  N  ND2 . ASN A  1  216 ? 71.448  336.386 177.635 1.00 31.04  ? 216  ASN A ND2 1 
ATOM   1643  N  N   . THR A  1  217 ? 73.425  331.260 179.614 1.00 29.38  ? 217  THR A N   1 
ATOM   1644  C  CA  . THR A  1  217 ? 74.297  330.072 179.598 1.00 27.57  ? 217  THR A CA  1 
ATOM   1645  C  C   . THR A  1  217 ? 73.746  329.002 178.679 1.00 28.40  ? 217  THR A C   1 
ATOM   1646  O  O   . THR A  1  217 ? 72.563  328.996 178.313 1.00 27.79  ? 217  THR A O   1 
ATOM   1647  C  CB  . THR A  1  217 ? 74.528  329.463 181.045 1.00 25.84  ? 217  THR A CB  1 
ATOM   1648  O  OG1 . THR A  1  217 ? 73.254  329.177 181.599 1.00 30.59  ? 217  THR A OG1 1 
ATOM   1649  C  CG2 . THR A  1  217 ? 75.184  330.530 181.962 1.00 25.83  ? 217  THR A CG2 1 
ATOM   1650  N  N   . THR A  1  218 ? 74.553  327.990 178.341 1.00 28.17  ? 218  THR A N   1 
ATOM   1651  C  CA  . THR A  1  218 ? 73.967  327.001 177.426 1.00 26.06  ? 218  THR A CA  1 
ATOM   1652  C  C   . THR A  1  218 ? 74.387  325.563 177.886 1.00 27.75  ? 218  THR A C   1 
ATOM   1653  O  O   . THR A  1  218 ? 74.699  324.701 177.081 1.00 26.61  ? 218  THR A O   1 
ATOM   1654  C  CB  . THR A  1  218 ? 74.420  327.259 175.966 1.00 26.73  ? 218  THR A CB  1 
ATOM   1655  O  OG1 . THR A  1  218 ? 75.810  327.639 176.020 1.00 29.65  ? 218  THR A OG1 1 
ATOM   1656  C  CG2 . THR A  1  218 ? 73.577  328.408 175.366 1.00 23.88  ? 218  THR A CG2 1 
ATOM   1657  N  N   . PHE A  1  219 ? 74.279  325.303 179.203 1.00 25.39  ? 219  PHE A N   1 
ATOM   1658  C  CA  . PHE A  1  219 ? 74.650  324.000 179.696 1.00 27.29  ? 219  PHE A CA  1 
ATOM   1659  C  C   . PHE A  1  219 ? 73.837  322.916 179.000 1.00 28.30  ? 219  PHE A C   1 
ATOM   1660  O  O   . PHE A  1  219 ? 74.359  321.816 178.766 1.00 28.00  ? 219  PHE A O   1 
ATOM   1661  C  CB  . PHE A  1  219 ? 74.265  323.986 181.162 1.00 27.97  ? 219  PHE A CB  1 
ATOM   1662  C  CG  . PHE A  1  219 ? 75.193  324.804 182.019 1.00 28.65  ? 219  PHE A CG  1 
ATOM   1663  C  CD1 . PHE A  1  219 ? 74.699  325.974 182.623 1.00 20.95  ? 219  PHE A CD1 1 
ATOM   1664  C  CD2 . PHE A  1  219 ? 76.532  324.396 182.233 1.00 27.79  ? 219  PHE A CD2 1 
ATOM   1665  C  CE1 . PHE A  1  219 ? 75.492  326.799 183.447 1.00 25.62  ? 219  PHE A CE1 1 
ATOM   1666  C  CE2 . PHE A  1  219 ? 77.368  325.199 183.101 1.00 28.68  ? 219  PHE A CE2 1 
ATOM   1667  C  CZ  . PHE A  1  219 ? 76.865  326.437 183.627 1.00 26.04  ? 219  PHE A CZ  1 
ATOM   1668  N  N   . PHE A  1  220 ? 72.516  323.179 178.751 1.00 24.32  ? 220  PHE A N   1 
ATOM   1669  C  CA  . PHE A  1  220 ? 71.709  322.140 178.203 1.00 24.64  ? 220  PHE A CA  1 
ATOM   1670  C  C   . PHE A  1  220 ? 71.251  322.449 176.756 1.00 29.01  ? 220  PHE A C   1 
ATOM   1671  O  O   . PHE A  1  220 ? 70.283  321.838 176.283 1.00 31.89  ? 220  PHE A O   1 
ATOM   1672  C  CB  . PHE A  1  220 ? 70.459  321.996 179.110 1.00 24.57  ? 220  PHE A CB  1 
ATOM   1673  C  CG  . PHE A  1  220 ? 70.844  321.843 180.558 1.00 24.48  ? 220  PHE A CG  1 
ATOM   1674  C  CD1 . PHE A  1  220 ? 71.838  320.943 180.909 1.00 26.22  ? 220  PHE A CD1 1 
ATOM   1675  C  CD2 . PHE A  1  220 ? 70.271  322.634 181.556 1.00 25.02  ? 220  PHE A CD2 1 
ATOM   1676  C  CE1 . PHE A  1  220 ? 72.288  320.826 182.250 1.00 26.58  ? 220  PHE A CE1 1 
ATOM   1677  C  CE2 . PHE A  1  220 ? 70.632  322.478 182.864 1.00 24.97  ? 220  PHE A CE2 1 
ATOM   1678  C  CZ  . PHE A  1  220 ? 71.670  321.574 183.257 1.00 25.23  ? 220  PHE A CZ  1 
ATOM   1679  N  N   . ASP A  1  221 ? 71.832  323.484 176.154 1.00 28.74  ? 221  ASP A N   1 
ATOM   1680  C  CA  . ASP A  1  221 ? 71.376  323.986 174.810 1.00 29.93  ? 221  ASP A CA  1 
ATOM   1681  C  C   . ASP A  1  221 ? 72.405  323.663 173.767 1.00 29.44  ? 221  ASP A C   1 
ATOM   1682  O  O   . ASP A  1  221 ? 73.500  324.154 173.821 1.00 29.51  ? 221  ASP A O   1 
ATOM   1683  C  CB  . ASP A  1  221 ? 71.060  325.465 174.925 1.00 29.62  ? 221  ASP A CB  1 
ATOM   1684  C  CG  . ASP A  1  221 ? 70.679  326.082 173.583 1.00 32.55  ? 221  ASP A CG  1 
ATOM   1685  O  OD1 . ASP A  1  221 ? 70.669  325.377 172.544 1.00 31.13  ? 221  ASP A OD1 1 
ATOM   1686  O  OD2 . ASP A  1  221 ? 70.384  327.284 173.610 1.00 32.52  ? 221  ASP A OD2 1 
ATOM   1687  N  N   . PRO A  1  222 ? 72.123  322.678 172.897 1.00 30.29  ? 222  PRO A N   1 
ATOM   1688  C  CA  . PRO A  1  222 ? 73.094  322.253 171.877 1.00 28.42  ? 222  PRO A CA  1 
ATOM   1689  C  C   . PRO A  1  222 ? 73.609  323.406 171.012 1.00 28.54  ? 222  PRO A C   1 
ATOM   1690  O  O   . PRO A  1  222 ? 74.776  323.341 170.619 1.00 29.42  ? 222  PRO A O   1 
ATOM   1691  C  CB  . PRO A  1  222 ? 72.346  321.245 171.001 1.00 28.06  ? 222  PRO A CB  1 
ATOM   1692  C  CG  . PRO A  1  222 ? 70.946  321.136 171.554 1.00 34.51  ? 222  PRO A CG  1 
ATOM   1693  C  CD  . PRO A  1  222 ? 70.785  322.025 172.804 1.00 31.56  ? 222  PRO A CD  1 
ATOM   1694  N  N   . ALA A  1  223 ? 72.861  324.509 170.859 1.00 29.03  ? 223  ALA A N   1 
ATOM   1695  C  CA  . ALA A  1  223 ? 73.353  325.652 170.043 1.00 29.72  ? 223  ALA A CA  1 
ATOM   1696  C  C   . ALA A  1  223 ? 74.641  326.238 170.705 1.00 31.03  ? 223  ALA A C   1 
ATOM   1697  O  O   . ALA A  1  223 ? 75.485  326.810 170.018 1.00 28.60  ? 223  ALA A O   1 
ATOM   1698  C  CB  . ALA A  1  223 ? 72.276  326.776 169.915 1.00 30.53  ? 223  ALA A CB  1 
ATOM   1699  N  N   . GLY A  1  224 ? 74.823  326.113 172.054 1.00 31.69  ? 224  GLY A N   1 
ATOM   1700  C  CA  . GLY A  1  224 ? 76.093  326.560 172.606 1.00 27.11  ? 224  GLY A CA  1 
ATOM   1701  C  C   . GLY A  1  224 ? 77.020  325.422 172.912 1.00 28.62  ? 224  GLY A C   1 
ATOM   1702  O  O   . GLY A  1  224 ? 78.014  325.671 173.524 1.00 28.81  ? 224  GLY A O   1 
ATOM   1703  N  N   . GLY A  1  225 ? 76.746  324.171 172.450 1.00 27.88  ? 225  GLY A N   1 
ATOM   1704  C  CA  . GLY A  1  225 ? 77.643  323.033 172.725 1.00 28.81  ? 225  GLY A CA  1 
ATOM   1705  C  C   . GLY A  1  225 ? 77.106  322.295 174.001 1.00 29.57  ? 225  GLY A C   1 
ATOM   1706  O  O   . GLY A  1  225 ? 77.812  321.393 174.513 1.00 28.24  ? 225  GLY A O   1 
ATOM   1707  N  N   . GLY A  1  226 ? 75.906  322.693 174.506 1.00 29.43  ? 226  GLY A N   1 
ATOM   1708  C  CA  . GLY A  1  226 ? 75.315  322.034 175.756 1.00 27.62  ? 226  GLY A CA  1 
ATOM   1709  C  C   . GLY A  1  226 ? 74.575  320.777 175.329 1.00 30.04  ? 226  GLY A C   1 
ATOM   1710  O  O   . GLY A  1  226 ? 74.516  320.442 174.101 1.00 30.36  ? 226  GLY A O   1 
ATOM   1711  N  N   . ASP A  1  227 ? 73.905  320.113 176.284 1.00 29.08  ? 227  ASP A N   1 
ATOM   1712  C  CA  . ASP A  1  227 ? 73.264  318.845 176.054 1.00 29.42  ? 227  ASP A CA  1 
ATOM   1713  C  C   . ASP A  1  227 ? 72.135  318.631 177.085 1.00 30.60  ? 227  ASP A C   1 
ATOM   1714  O  O   . ASP A  1  227 ? 72.366  318.625 178.315 1.00 29.37  ? 227  ASP A O   1 
ATOM   1715  C  CB  . ASP A  1  227 ? 74.366  317.736 176.352 1.00 29.81  ? 227  ASP A CB  1 
ATOM   1716  C  CG  . ASP A  1  227 ? 73.928  316.338 176.030 1.00 27.87  ? 227  ASP A CG  1 
ATOM   1717  O  OD1 . ASP A  1  227 ? 74.751  315.470 176.267 1.00 30.73  ? 227  ASP A OD1 1 
ATOM   1718  O  OD2 . ASP A  1  227 ? 72.789  315.995 175.714 1.00 29.08  ? 227  ASP A OD2 1 
ATOM   1719  N  N   . PRO A  1  228 ? 70.921  318.442 176.576 1.00 27.99  ? 228  PRO A N   1 
ATOM   1720  C  CA  . PRO A  1  228 ? 69.828  318.182 177.412 1.00 28.40  ? 228  PRO A CA  1 
ATOM   1721  C  C   . PRO A  1  228 ? 70.056  316.949 178.279 1.00 28.43  ? 228  PRO A C   1 
ATOM   1722  O  O   . PRO A  1  228 ? 69.493  316.902 179.376 1.00 28.35  ? 228  PRO A O   1 
ATOM   1723  C  CB  . PRO A  1  228 ? 68.683  317.852 176.404 1.00 25.94  ? 228  PRO A CB  1 
ATOM   1724  C  CG  . PRO A  1  228 ? 69.055  318.692 175.170 1.00 26.00  ? 228  PRO A CG  1 
ATOM   1725  C  CD  . PRO A  1  228 ? 70.561  318.578 175.125 1.00 26.22  ? 228  PRO A CD  1 
ATOM   1726  N  N   . ILE A  1  229 ? 70.742  315.935 177.741 1.00 28.20  ? 229  ILE A N   1 
ATOM   1727  C  CA  . ILE A  1  229 ? 70.951  314.696 178.496 1.00 29.17  ? 229  ILE A CA  1 
ATOM   1728  C  C   . ILE A  1  229 ? 71.777  314.945 179.795 1.00 31.34  ? 229  ILE A C   1 
ATOM   1729  O  O   . ILE A  1  229 ? 71.664  314.198 180.768 1.00 30.17  ? 229  ILE A O   1 
ATOM   1730  C  CB  . ILE A  1  229 ? 71.646  313.613 177.649 1.00 28.55  ? 229  ILE A CB  1 
ATOM   1731  C  CG1 . ILE A  1  229 ? 70.792  313.224 176.355 1.00 28.98  ? 229  ILE A CG1 1 
ATOM   1732  C  CG2 . ILE A  1  229 ? 71.921  312.338 178.473 1.00 28.41  ? 229  ILE A CG2 1 
ATOM   1733  C  CD1 . ILE A  1  229 ? 69.318  313.245 176.692 1.00 26.89  ? 229  ILE A CD1 1 
ATOM   1734  N  N   . LEU A  1  230 ? 72.702  315.902 179.749 1.00 28.15  ? 230  LEU A N   1 
ATOM   1735  C  CA  . LEU A  1  230 ? 73.446  316.220 180.958 1.00 27.25  ? 230  LEU A CA  1 
ATOM   1736  C  C   . LEU A  1  230 ? 72.485  316.616 182.109 1.00 27.88  ? 230  LEU A C   1 
ATOM   1737  O  O   . LEU A  1  230 ? 72.718  316.262 183.270 1.00 26.38  ? 230  LEU A O   1 
ATOM   1738  C  CB  . LEU A  1  230 ? 74.398  317.404 180.714 1.00 26.35  ? 230  LEU A CB  1 
ATOM   1739  C  CG  . LEU A  1  230 ? 75.006  317.976 182.047 1.00 28.33  ? 230  LEU A CG  1 
ATOM   1740  C  CD1 . LEU A  1  230 ? 76.010  316.970 182.731 1.00 23.63  ? 230  LEU A CD1 1 
ATOM   1741  C  CD2 . LEU A  1  230 ? 75.732  319.329 181.643 1.00 26.89  ? 230  LEU A CD2 1 
ATOM   1742  N  N   . TYR A  1  231 ? 71.429  317.369 181.805 1.00 24.95  ? 231  TYR A N   1 
ATOM   1743  C  CA  . TYR A  1  231 ? 70.526  317.736 182.893 1.00 28.63  ? 231  TYR A CA  1 
ATOM   1744  C  C   . TYR A  1  231 ? 69.913  316.494 183.484 1.00 27.58  ? 231  TYR A C   1 
ATOM   1745  O  O   . TYR A  1  231 ? 69.682  316.448 184.683 1.00 26.94  ? 231  TYR A O   1 
ATOM   1746  C  CB  . TYR A  1  231 ? 69.333  318.624 182.384 1.00 26.66  ? 231  TYR A CB  1 
ATOM   1747  C  CG  . TYR A  1  231 ? 68.269  318.835 183.456 1.00 30.26  ? 231  TYR A CG  1 
ATOM   1748  C  CD1 . TYR A  1  231 ? 67.187  317.964 183.572 1.00 25.58  ? 231  TYR A CD1 1 
ATOM   1749  C  CD2 . TYR A  1  231 ? 68.324  319.954 184.322 1.00 27.65  ? 231  TYR A CD2 1 
ATOM   1750  C  CE1 . TYR A  1  231 ? 66.232  318.130 184.584 1.00 28.23  ? 231  TYR A CE1 1 
ATOM   1751  C  CE2 . TYR A  1  231 ? 67.395  320.155 185.308 1.00 28.83  ? 231  TYR A CE2 1 
ATOM   1752  C  CZ  . TYR A  1  231 ? 66.343  319.213 185.432 1.00 29.58  ? 231  TYR A CZ  1 
ATOM   1753  O  OH  . TYR A  1  231 ? 65.431  319.461 186.417 1.00 32.01  ? 231  TYR A OH  1 
ATOM   1754  N  N   . GLN A  1  232 ? 69.527  315.537 182.632 1.00 26.82  ? 232  GLN A N   1 
ATOM   1755  C  CA  . GLN A  1  232 ? 68.906  314.293 183.113 1.00 25.11  ? 232  GLN A CA  1 
ATOM   1756  C  C   . GLN A  1  232 ? 69.803  313.511 184.048 1.00 25.64  ? 232  GLN A C   1 
ATOM   1757  O  O   . GLN A  1  232 ? 69.321  312.900 184.938 1.00 25.16  ? 232  GLN A O   1 
ATOM   1758  C  CB  . GLN A  1  232 ? 68.526  313.393 181.929 1.00 26.76  ? 232  GLN A CB  1 
ATOM   1759  C  CG  . GLN A  1  232 ? 67.585  314.109 180.975 1.00 26.77  ? 232  GLN A CG  1 
ATOM   1760  C  CD  . GLN A  1  232 ? 66.987  313.200 179.895 1.00 30.68  ? 232  GLN A CD  1 
ATOM   1761  O  OE1 . GLN A  1  232 ? 66.978  311.960 179.981 1.00 29.12  ? 232  GLN A OE1 1 
ATOM   1762  N  NE2 . GLN A  1  232 ? 66.491  313.867 178.848 1.00 30.40  ? 232  GLN A NE2 1 
ATOM   1763  N  N   . HIS A  1  233 ? 71.136  313.436 183.774 1.00 25.75  ? 233  HIS A N   1 
ATOM   1764  C  CA  . HIS A  1  233 ? 72.042  312.737 184.661 1.00 24.67  ? 233  HIS A CA  1 
ATOM   1765  C  C   . HIS A  1  233 ? 72.072  313.431 185.988 1.00 26.83  ? 233  HIS A C   1 
ATOM   1766  O  O   . HIS A  1  233 ? 72.160  312.745 187.014 1.00 27.59  ? 233  HIS A O   1 
ATOM   1767  C  CB  . HIS A  1  233 ? 73.511  312.860 184.030 1.00 26.17  ? 233  HIS A CB  1 
ATOM   1768  C  CG  . HIS A  1  233 ? 73.729  311.810 182.977 1.00 30.40  ? 233  HIS A CG  1 
ATOM   1769  N  ND1 . HIS A  1  233 ? 73.447  310.471 183.210 1.00 28.59  ? 233  HIS A ND1 1 
ATOM   1770  C  CD2 . HIS A  1  233 ? 74.069  311.908 181.656 1.00 30.09  ? 233  HIS A CD2 1 
ATOM   1771  C  CE1 . HIS A  1  233 ? 73.676  309.770 182.106 1.00 33.22  ? 233  HIS A CE1 1 
ATOM   1772  N  NE2 . HIS A  1  233 ? 74.006  310.631 181.134 1.00 29.91  ? 233  HIS A NE2 1 
ATOM   1773  N  N   . LEU A  1  234 ? 72.119  314.782 185.977 1.00 24.03  ? 234  LEU A N   1 
ATOM   1774  C  CA  . LEU A  1  234 ? 72.214  315.581 187.262 1.00 26.75  ? 234  LEU A CA  1 
ATOM   1775  C  C   . LEU A  1  234 ? 70.978  315.426 188.060 1.00 26.05  ? 234  LEU A C   1 
ATOM   1776  O  O   . LEU A  1  234 ? 71.040  315.112 189.307 1.00 28.33  ? 234  LEU A O   1 
ATOM   1777  C  CB  . LEU A  1  234 ? 72.542  317.058 186.998 1.00 27.02  ? 234  LEU A CB  1 
ATOM   1778  C  CG  . LEU A  1  234 ? 73.888  317.277 186.264 1.00 31.86  ? 234  LEU A CG  1 
ATOM   1779  C  CD1 . LEU A  1  234 ? 74.059  318.776 185.902 1.00 25.40  ? 234  LEU A CD1 1 
ATOM   1780  C  CD2 . LEU A  1  234 ? 75.058  316.976 187.197 1.00 29.88  ? 234  LEU A CD2 1 
ATOM   1781  N  N   . PHE A  1  235 ? 69.832  315.534 187.390 1.00 26.21  ? 235  PHE A N   1 
ATOM   1782  C  CA  . PHE A  1  235 ? 68.577  315.295 188.022 1.00 23.33  ? 235  PHE A CA  1 
ATOM   1783  C  C   . PHE A  1  235 ? 68.439  313.881 188.630 1.00 24.88  ? 235  PHE A C   1 
ATOM   1784  O  O   . PHE A  1  235 ? 68.130  313.701 189.840 1.00 25.53  ? 235  PHE A O   1 
ATOM   1785  C  CB  . PHE A  1  235 ? 67.403  315.541 187.081 1.00 22.96  ? 235  PHE A CB  1 
ATOM   1786  C  CG  . PHE A  1  235 ? 66.095  315.307 187.747 1.00 26.84  ? 235  PHE A CG  1 
ATOM   1787  C  CD1 . PHE A  1  235 ? 65.432  316.373 188.378 1.00 25.36  ? 235  PHE A CD1 1 
ATOM   1788  C  CD2 . PHE A  1  235 ? 65.506  314.045 187.749 1.00 25.75  ? 235  PHE A CD2 1 
ATOM   1789  C  CE1 . PHE A  1  235 ? 64.181  316.124 189.092 1.00 23.35  ? 235  PHE A CE1 1 
ATOM   1790  C  CE2 . PHE A  1  235 ? 64.312  313.780 188.560 1.00 24.18  ? 235  PHE A CE2 1 
ATOM   1791  C  CZ  . PHE A  1  235 ? 63.628  314.871 189.184 1.00 26.13  ? 235  PHE A CZ  1 
ATOM   1792  N  N   . TRP A  1  236 ? 68.625  312.843 187.840 1.00 24.27  ? 236  TRP A N   1 
ATOM   1793  C  CA  . TRP A  1  236 ? 68.501  311.451 188.389 1.00 23.33  ? 236  TRP A CA  1 
ATOM   1794  C  C   . TRP A  1  236 ? 69.590  311.078 189.308 1.00 26.03  ? 236  TRP A C   1 
ATOM   1795  O  O   . TRP A  1  236 ? 69.410  310.122 190.140 1.00 24.82  ? 236  TRP A O   1 
ATOM   1796  C  CB  . TRP A  1  236 ? 68.435  310.410 187.190 1.00 21.95  ? 236  TRP A CB  1 
ATOM   1797  C  CG  . TRP A  1  236 ? 66.965  310.575 186.558 1.00 23.79  ? 236  TRP A CG  1 
ATOM   1798  C  CD1 . TRP A  1  236 ? 66.580  311.015 185.269 1.00 26.23  ? 236  TRP A CD1 1 
ATOM   1799  C  CD2 . TRP A  1  236 ? 65.753  310.325 187.290 1.00 26.98  ? 236  TRP A CD2 1 
ATOM   1800  N  NE1 . TRP A  1  236 ? 65.132  311.088 185.220 1.00 24.16  ? 236  TRP A NE1 1 
ATOM   1801  C  CE2 . TRP A  1  236 ? 64.636  310.615 186.425 1.00 26.48  ? 236  TRP A CE2 1 
ATOM   1802  C  CE3 . TRP A  1  236 ? 65.505  309.889 188.612 1.00 24.75  ? 236  TRP A CE3 1 
ATOM   1803  C  CZ2 . TRP A  1  236 ? 63.307  310.490 186.851 1.00 25.30  ? 236  TRP A CZ2 1 
ATOM   1804  C  CZ3 . TRP A  1  236 ? 64.131  309.731 189.015 1.00 29.29  ? 236  TRP A CZ3 1 
ATOM   1805  C  CH2 . TRP A  1  236 ? 63.081  310.047 188.156 1.00 28.24  ? 236  TRP A CH2 1 
ATOM   1806  N  N   . PHE A  1  237 ? 70.759  311.742 189.191 1.00 24.80  ? 237  PHE A N   1 
ATOM   1807  C  CA  . PHE A  1  237 ? 71.804  311.364 190.127 1.00 25.85  ? 237  PHE A CA  1 
ATOM   1808  C  C   . PHE A  1  237 ? 71.224  311.720 191.576 1.00 27.64  ? 237  PHE A C   1 
ATOM   1809  O  O   . PHE A  1  237 ? 71.525  311.049 192.603 1.00 28.70  ? 237  PHE A O   1 
ATOM   1810  C  CB  . PHE A  1  237 ? 73.094  312.125 189.834 1.00 24.12  ? 237  PHE A CB  1 
ATOM   1811  C  CG  . PHE A  1  237 ? 74.248  311.695 190.745 1.00 27.96  ? 237  PHE A CG  1 
ATOM   1812  C  CD1 . PHE A  1  237 ? 74.453  312.338 191.989 1.00 30.04  ? 237  PHE A CD1 1 
ATOM   1813  C  CD2 . PHE A  1  237 ? 75.006  310.553 190.446 1.00 27.45  ? 237  PHE A CD2 1 
ATOM   1814  C  CE1 . PHE A  1  237 ? 75.486  311.913 192.892 1.00 33.11  ? 237  PHE A CE1 1 
ATOM   1815  C  CE2 . PHE A  1  237 ? 76.036  310.069 191.381 1.00 31.30  ? 237  PHE A CE2 1 
ATOM   1816  C  CZ  . PHE A  1  237 ? 76.236  310.737 192.590 1.00 26.02  ? 237  PHE A CZ  1 
ATOM   1817  N  N   . PHE A  1  238 ? 70.436  312.791 191.666 1.00 24.32  ? 238  PHE A N   1 
ATOM   1818  C  CA  . PHE A  1  238 ? 69.731  313.108 192.910 1.00 25.78  ? 238  PHE A CA  1 
ATOM   1819  C  C   . PHE A  1  238 ? 68.465  312.265 193.027 1.00 25.21  ? 238  PHE A C   1 
ATOM   1820  O  O   . PHE A  1  238 ? 68.060  311.740 194.118 1.00 24.28  ? 238  PHE A O   1 
ATOM   1821  C  CB  . PHE A  1  238 ? 69.290  314.613 192.904 1.00 24.52  ? 238  PHE A CB  1 
ATOM   1822  C  CG  . PHE A  1  238 ? 67.924  314.821 193.608 1.00 24.42  ? 238  PHE A CG  1 
ATOM   1823  C  CD1 . PHE A  1  238 ? 67.867  314.944 195.016 1.00 23.41  ? 238  PHE A CD1 1 
ATOM   1824  C  CD2 . PHE A  1  238 ? 66.746  314.935 192.861 1.00 24.31  ? 238  PHE A CD2 1 
ATOM   1825  C  CE1 . PHE A  1  238 ? 66.700  315.147 195.678 1.00 28.66  ? 238  PHE A CE1 1 
ATOM   1826  C  CE2 . PHE A  1  238 ? 65.526  315.126 193.504 1.00 21.79  ? 238  PHE A CE2 1 
ATOM   1827  C  CZ  . PHE A  1  238 ? 65.529  315.273 194.992 1.00 21.27  ? 238  PHE A CZ  1 
ATOM   1828  N  N   . GLY A  1  239 ? 67.802  312.121 191.878 1.00 25.90  ? 239  GLY A N   1 
ATOM   1829  C  CA  . GLY A  1  239 ? 66.409  311.567 191.864 1.00 22.69  ? 239  GLY A CA  1 
ATOM   1830  C  C   . GLY A  1  239 ? 66.380  310.091 192.350 1.00 27.28  ? 239  GLY A C   1 
ATOM   1831  O  O   . GLY A  1  239 ? 65.338  309.627 192.967 1.00 27.40  ? 239  GLY A O   1 
ATOM   1832  N  N   . HIS A  1  240 ? 67.405  309.268 192.024 1.00 24.27  ? 240  HIS A N   1 
ATOM   1833  C  CA  . HIS A  1  240 ? 67.348  307.965 192.571 1.00 23.57  ? 240  HIS A CA  1 
ATOM   1834  C  C   . HIS A  1  240 ? 67.523  307.909 194.092 1.00 25.60  ? 240  HIS A C   1 
ATOM   1835  O  O   . HIS A  1  240 ? 66.672  307.362 194.808 1.00 26.96  ? 240  HIS A O   1 
ATOM   1836  C  CB  . HIS A  1  240 ? 68.260  306.848 191.943 1.00 25.37  ? 240  HIS A CB  1 
ATOM   1837  C  CG  . HIS A  1  240 ? 67.850  305.578 192.546 1.00 27.85  ? 240  HIS A CG  1 
ATOM   1838  N  ND1 . HIS A  1  240 ? 66.724  304.918 192.121 1.00 33.68  ? 240  HIS A ND1 1 
ATOM   1839  C  CD2 . HIS A  1  240 ? 68.208  305.008 193.721 1.00 27.30  ? 240  HIS A CD2 1 
ATOM   1840  C  CE1 . HIS A  1  240 ? 66.450  303.942 192.979 1.00 25.00  ? 240  HIS A CE1 1 
ATOM   1841  N  NE2 . HIS A  1  240 ? 67.314  303.980 193.960 1.00 27.05  ? 240  HIS A NE2 1 
ATOM   1842  N  N   . PRO A  1  241 ? 68.635  308.459 194.621 1.00 27.45  ? 241  PRO A N   1 
ATOM   1843  C  CA  . PRO A  1  241 ? 68.651  308.593 196.083 1.00 27.50  ? 241  PRO A CA  1 
ATOM   1844  C  C   . PRO A  1  241 ? 67.381  309.187 196.640 1.00 26.99  ? 241  PRO A C   1 
ATOM   1845  O  O   . PRO A  1  241 ? 66.991  308.723 197.661 1.00 27.26  ? 241  PRO A O   1 
ATOM   1846  C  CB  . PRO A  1  241 ? 69.821  309.592 196.382 1.00 26.40  ? 241  PRO A CB  1 
ATOM   1847  C  CG  . PRO A  1  241 ? 70.830  309.272 195.193 1.00 25.45  ? 241  PRO A CG  1 
ATOM   1848  C  CD  . PRO A  1  241 ? 69.840  309.048 193.970 1.00 26.84  ? 241  PRO A CD  1 
ATOM   1849  N  N   . GLU A  1  242 ? 66.793  310.236 196.069 1.00 25.51  ? 242  GLU A N   1 
ATOM   1850  C  CA  . GLU A  1  242 ? 65.487  310.729 196.502 1.00 25.04  ? 242  GLU A CA  1 
ATOM   1851  C  C   . GLU A  1  242 ? 64.441  309.654 196.723 1.00 26.65  ? 242  GLU A C   1 
ATOM   1852  O  O   . GLU A  1  242 ? 63.676  309.724 197.727 1.00 28.31  ? 242  GLU A O   1 
ATOM   1853  C  CB  . GLU A  1  242 ? 64.902  311.714 195.531 1.00 22.38  ? 242  GLU A CB  1 
ATOM   1854  C  CG  . GLU A  1  242 ? 63.549  312.251 195.986 1.00 23.47  ? 242  GLU A CG  1 
ATOM   1855  C  CD  . GLU A  1  242 ? 63.574  313.081 197.338 1.00 25.57  ? 242  GLU A CD  1 
ATOM   1856  O  OE1 . GLU A  1  242 ? 62.438  313.455 197.742 1.00 31.87  ? 242  GLU A OE1 1 
ATOM   1857  O  OE2 . GLU A  1  242 ? 64.675  313.453 197.922 1.00 28.19  ? 242  GLU A OE2 1 
ATOM   1858  N  N   . VAL A  1  243 ? 64.340  308.677 195.811 1.00 26.70  ? 243  VAL A N   1 
ATOM   1859  C  CA  . VAL A  1  243 ? 63.254  307.664 196.063 1.00 26.31  ? 243  VAL A CA  1 
ATOM   1860  C  C   . VAL A  1  243 ? 63.491  306.836 197.316 1.00 26.28  ? 243  VAL A C   1 
ATOM   1861  O  O   . VAL A  1  243 ? 62.493  306.433 197.994 1.00 24.14  ? 243  VAL A O   1 
ATOM   1862  C  CB  . VAL A  1  243 ? 62.861  306.794 194.849 1.00 29.78  ? 243  VAL A CB  1 
ATOM   1863  C  CG1 . VAL A  1  243 ? 62.525  307.693 193.610 1.00 30.49  ? 243  VAL A CG1 1 
ATOM   1864  C  CG2 . VAL A  1  243 ? 63.954  305.842 194.460 1.00 27.03  ? 243  VAL A CG2 1 
ATOM   1865  N  N   . TYR A  1  244 ? 64.780  306.529 197.610 1.00 24.97  ? 244  TYR A N   1 
ATOM   1866  C  CA  . TYR A  1  244 ? 65.147  305.748 198.843 1.00 24.71  ? 244  TYR A CA  1 
ATOM   1867  C  C   . TYR A  1  244 ? 64.979  306.710 200.047 1.00 25.26  ? 244  TYR A C   1 
ATOM   1868  O  O   . TYR A  1  244 ? 64.566  306.307 201.119 1.00 27.11  ? 244  TYR A O   1 
ATOM   1869  C  CB  . TYR A  1  244 ? 66.602  305.202 198.735 1.00 23.93  ? 244  TYR A CB  1 
ATOM   1870  C  CG  . TYR A  1  244 ? 66.584  304.200 197.641 1.00 22.17  ? 244  TYR A CG  1 
ATOM   1871  C  CD1 . TYR A  1  244 ? 66.035  302.945 197.896 1.00 25.04  ? 244  TYR A CD1 1 
ATOM   1872  C  CD2 . TYR A  1  244 ? 67.053  304.530 196.334 1.00 24.23  ? 244  TYR A CD2 1 
ATOM   1873  C  CE1 . TYR A  1  244 ? 65.882  301.928 196.835 1.00 26.89  ? 244  TYR A CE1 1 
ATOM   1874  C  CE2 . TYR A  1  244 ? 66.973  303.551 195.212 1.00 25.73  ? 244  TYR A CE2 1 
ATOM   1875  C  CZ  . TYR A  1  244 ? 66.336  302.288 195.494 1.00 27.93  ? 244  TYR A CZ  1 
ATOM   1876  O  OH  . TYR A  1  244 ? 66.238  301.338 194.528 1.00 30.63  ? 244  TYR A OH  1 
ATOM   1877  N  N   . ILE A  1  245 ? 65.337  307.977 199.858 1.00 24.00  ? 245  ILE A N   1 
ATOM   1878  C  CA  . ILE A  1  245 ? 65.054  308.999 200.896 1.00 25.01  ? 245  ILE A CA  1 
ATOM   1879  C  C   . ILE A  1  245 ? 63.514  308.985 201.294 1.00 26.06  ? 245  ILE A C   1 
ATOM   1880  O  O   . ILE A  1  245 ? 63.107  309.082 202.509 1.00 26.91  ? 245  ILE A O   1 
ATOM   1881  C  CB  . ILE A  1  245 ? 65.516  310.385 200.410 1.00 25.20  ? 245  ILE A CB  1 
ATOM   1882  C  CG1 . ILE A  1  245 ? 67.000  310.533 200.569 1.00 23.63  ? 245  ILE A CG1 1 
ATOM   1883  C  CG2 . ILE A  1  245 ? 64.723  311.519 201.095 1.00 22.37  ? 245  ILE A CG2 1 
ATOM   1884  C  CD1 . ILE A  1  245 ? 67.608  311.603 199.596 1.00 22.62  ? 245  ILE A CD1 1 
ATOM   1885  N  N   . LEU A  1  246 ? 62.646  308.878 200.319 1.00 27.92  ? 246  LEU A N   1 
ATOM   1886  C  CA  . LEU A  1  246 ? 61.228  308.947 200.643 1.00 25.91  ? 246  LEU A CA  1 
ATOM   1887  C  C   . LEU A  1  246 ? 60.806  307.683 201.370 1.00 29.02  ? 246  LEU A C   1 
ATOM   1888  O  O   . LEU A  1  246 ? 59.808  307.667 202.085 1.00 32.63  ? 246  LEU A O   1 
ATOM   1889  C  CB  . LEU A  1  246 ? 60.437  308.977 199.350 1.00 24.50  ? 246  LEU A CB  1 
ATOM   1890  C  CG  . LEU A  1  246 ? 60.617  310.323 198.555 1.00 23.54  ? 246  LEU A CG  1 
ATOM   1891  C  CD1 . LEU A  1  246 ? 60.098  310.274 197.133 1.00 19.50  ? 246  LEU A CD1 1 
ATOM   1892  C  CD2 . LEU A  1  246 ? 59.934  311.471 199.307 1.00 23.79  ? 246  LEU A CD2 1 
ATOM   1893  N  N   . ILE A  1  247 ? 61.460  306.550 201.120 1.00 27.97  ? 247  ILE A N   1 
ATOM   1894  C  CA  . ILE A  1  247 ? 60.881  305.285 201.746 1.00 25.83  ? 247  ILE A CA  1 
ATOM   1895  C  C   . ILE A  1  247 ? 61.660  304.827 202.985 1.00 26.56  ? 247  ILE A C   1 
ATOM   1896  O  O   . ILE A  1  247 ? 61.115  304.084 203.771 1.00 24.37  ? 247  ILE A O   1 
ATOM   1897  C  CB  . ILE A  1  247 ? 60.835  304.091 200.678 1.00 23.29  ? 247  ILE A CB  1 
ATOM   1898  C  CG1 . ILE A  1  247 ? 59.730  303.054 201.025 1.00 27.38  ? 247  ILE A CG1 1 
ATOM   1899  C  CG2 . ILE A  1  247 ? 62.294  303.406 200.503 1.00 23.31  ? 247  ILE A CG2 1 
ATOM   1900  C  CD1 . ILE A  1  247 ? 58.278  303.728 200.944 1.00 23.40  ? 247  ILE A CD1 1 
ATOM   1901  N  N   . LEU A  1  248 ? 62.989  305.138 203.075 1.00 24.11  ? 248  LEU A N   1 
ATOM   1902  C  CA  . LEU A  1  248 ? 63.764  304.580 204.213 1.00 23.83  ? 248  LEU A CA  1 
ATOM   1903  C  C   . LEU A  1  248 ? 63.099  304.924 205.646 1.00 23.10  ? 248  LEU A C   1 
ATOM   1904  O  O   . LEU A  1  248 ? 63.087  304.037 206.472 1.00 25.08  ? 248  LEU A O   1 
ATOM   1905  C  CB  . LEU A  1  248 ? 65.199  305.212 204.192 1.00 24.15  ? 248  LEU A CB  1 
ATOM   1906  C  CG  . LEU A  1  248 ? 66.100  304.372 203.235 1.00 24.17  ? 248  LEU A CG  1 
ATOM   1907  C  CD1 . LEU A  1  248 ? 67.458  305.079 202.869 1.00 28.54  ? 248  LEU A CD1 1 
ATOM   1908  C  CD2 . LEU A  1  248 ? 66.471  303.021 203.874 1.00 26.75  ? 248  LEU A CD2 1 
ATOM   1909  N  N   . PRO A  1  249 ? 62.705  306.188 205.940 1.00 24.38  ? 249  PRO A N   1 
ATOM   1910  C  CA  . PRO A  1  249 ? 62.049  306.346 207.273 1.00 24.81  ? 249  PRO A CA  1 
ATOM   1911  C  C   . PRO A  1  249 ? 60.762  305.550 207.378 1.00 27.10  ? 249  PRO A C   1 
ATOM   1912  O  O   . PRO A  1  249 ? 60.358  305.116 208.492 1.00 27.43  ? 249  PRO A O   1 
ATOM   1913  C  CB  . PRO A  1  249 ? 61.687  307.896 207.363 1.00 24.67  ? 249  PRO A CB  1 
ATOM   1914  C  CG  . PRO A  1  249 ? 62.641  308.629 206.280 1.00 24.86  ? 249  PRO A CG  1 
ATOM   1915  C  CD  . PRO A  1  249 ? 62.630  307.457 205.159 1.00 24.31  ? 249  PRO A CD  1 
ATOM   1916  N  N   . GLY A  1  250 ? 60.134  305.269 206.253 1.00 26.08  ? 250  GLY A N   1 
ATOM   1917  C  CA  . GLY A  1  250 ? 58.980  304.353 206.289 1.00 27.95  ? 250  GLY A CA  1 
ATOM   1918  C  C   . GLY A  1  250 ? 59.386  302.914 206.689 1.00 28.83  ? 250  GLY A C   1 
ATOM   1919  O  O   . GLY A  1  250 ? 58.659  302.223 207.490 1.00 28.27  ? 250  GLY A O   1 
ATOM   1920  N  N   . PHE A  1  251 ? 60.482  302.438 206.156 1.00 26.37  ? 251  PHE A N   1 
ATOM   1921  C  CA  . PHE A  1  251 ? 60.936  301.071 206.500 1.00 27.32  ? 251  PHE A CA  1 
ATOM   1922  C  C   . PHE A  1  251 ? 61.268  301.109 208.085 1.00 27.61  ? 251  PHE A C   1 
ATOM   1923  O  O   . PHE A  1  251 ? 61.138  300.095 208.758 1.00 29.43  ? 251  PHE A O   1 
ATOM   1924  C  CB  . PHE A  1  251 ? 62.324  300.877 205.880 1.00 28.25  ? 251  PHE A CB  1 
ATOM   1925  C  CG  . PHE A  1  251 ? 62.325  300.564 204.346 1.00 27.24  ? 251  PHE A CG  1 
ATOM   1926  C  CD1 . PHE A  1  251 ? 63.547  300.461 203.699 1.00 27.75  ? 251  PHE A CD1 1 
ATOM   1927  C  CD2 . PHE A  1  251 ? 61.119  300.259 203.658 1.00 27.66  ? 251  PHE A CD2 1 
ATOM   1928  C  CE1 . PHE A  1  251 ? 63.594  300.064 202.308 1.00 27.35  ? 251  PHE A CE1 1 
ATOM   1929  C  CE2 . PHE A  1  251 ? 61.115  299.891 202.316 1.00 28.63  ? 251  PHE A CE2 1 
ATOM   1930  C  CZ  . PHE A  1  251 ? 62.404  299.811 201.646 1.00 29.94  ? 251  PHE A CZ  1 
ATOM   1931  N  N   . GLY A  1  252 ? 61.934  302.200 208.539 1.00 27.39  ? 252  GLY A N   1 
ATOM   1932  C  CA  . GLY A  1  252 ? 62.299  302.380 210.019 1.00 25.35  ? 252  GLY A CA  1 
ATOM   1933  C  C   . GLY A  1  252 ? 60.953  302.198 210.768 1.00 26.06  ? 252  GLY A C   1 
ATOM   1934  O  O   . GLY A  1  252 ? 60.878  301.448 211.723 1.00 26.19  ? 252  GLY A O   1 
ATOM   1935  N  N   . MET A  1  253 ? 59.919  303.000 210.450 1.00 25.09  ? 253  MET A N   1 
ATOM   1936  C  CA  . MET A  1  253 ? 58.636  302.887 211.216 1.00 26.98  ? 253  MET A CA  1 
ATOM   1937  C  C   . MET A  1  253 ? 58.027  301.574 211.100 1.00 27.29  ? 253  MET A C   1 
ATOM   1938  O  O   . MET A  1  253 ? 57.465  301.002 212.081 1.00 30.26  ? 253  MET A O   1 
ATOM   1939  C  CB  . MET A  1  253 ? 57.638  304.003 210.757 1.00 23.36  ? 253  MET A CB  1 
ATOM   1940  C  CG  . MET A  1  253 ? 58.164  305.447 211.077 1.00 28.10  ? 253  MET A CG  1 
ATOM   1941  S  SD  . MET A  1  253 ? 56.893  306.661 210.773 1.00 31.00  ? 253  MET A SD  1 
ATOM   1942  C  CE  . MET A  1  253 ? 56.786  306.692 208.951 1.00 23.41  ? 253  MET A CE  1 
ATOM   1943  N  N   . ILE A  1  254 ? 58.073  300.992 209.886 1.00 27.59  ? 254  ILE A N   1 
ATOM   1944  C  CA  . ILE A  1  254 ? 57.517  299.644 209.738 1.00 26.00  ? 254  ILE A CA  1 
ATOM   1945  C  C   . ILE A  1  254 ? 58.139  298.631 210.679 1.00 26.69  ? 254  ILE A C   1 
ATOM   1946  O  O   . ILE A  1  254 ? 57.415  297.807 211.318 1.00 27.16  ? 254  ILE A O   1 
ATOM   1947  C  CB  . ILE A  1  254 ? 57.545  299.149 208.218 1.00 27.65  ? 254  ILE A CB  1 
ATOM   1948  C  CG1 . ILE A  1  254 ? 56.643  300.016 207.343 1.00 24.47  ? 254  ILE A CG1 1 
ATOM   1949  C  CG2 . ILE A  1  254 ? 57.222  297.561 208.108 1.00 26.27  ? 254  ILE A CG2 1 
ATOM   1950  C  CD1 . ILE A  1  254 ? 55.040  299.893 207.671 1.00 24.61  ? 254  ILE A CD1 1 
ATOM   1951  N  N   . SER A  1  255 ? 59.476  298.597 210.743 1.00 26.10  ? 255  SER A N   1 
ATOM   1952  C  CA  . SER A  1  255 ? 60.117  297.724 211.629 1.00 25.95  ? 255  SER A CA  1 
ATOM   1953  C  C   . SER A  1  255 ? 59.617  297.957 213.076 1.00 26.18  ? 255  SER A C   1 
ATOM   1954  O  O   . SER A  1  255 ? 59.432  297.001 213.779 1.00 28.87  ? 255  SER A O   1 
ATOM   1955  C  CB  . SER A  1  255 ? 61.633  298.061 211.696 1.00 25.58  ? 255  SER A CB  1 
ATOM   1956  O  OG  . SER A  1  255 ? 62.220  297.622 210.449 1.00 29.70  ? 255  SER A OG  1 
ATOM   1957  N  N   . HIS A  1  256 ? 59.475  299.196 213.537 1.00 24.98  ? 256  HIS A N   1 
ATOM   1958  C  CA  . HIS A  1  256 ? 58.964  299.436 214.922 1.00 26.02  ? 256  HIS A CA  1 
ATOM   1959  C  C   . HIS A  1  256 ? 57.528  298.998 215.107 1.00 28.44  ? 256  HIS A C   1 
ATOM   1960  O  O   . HIS A  1  256 ? 57.197  298.390 216.144 1.00 27.61  ? 256  HIS A O   1 
ATOM   1961  C  CB  . HIS A  1  256 ? 59.009  300.939 215.271 1.00 26.34  ? 256  HIS A CB  1 
ATOM   1962  C  CG  . HIS A  1  256 ? 60.378  301.417 215.590 1.00 24.41  ? 256  HIS A CG  1 
ATOM   1963  N  ND1 . HIS A  1  256 ? 60.740  301.876 216.845 1.00 27.44  ? 256  HIS A ND1 1 
ATOM   1964  C  CD2 . HIS A  1  256 ? 61.509  301.353 214.863 1.00 28.11  ? 256  HIS A CD2 1 
ATOM   1965  C  CE1 . HIS A  1  256 ? 62.056  302.101 216.846 1.00 28.01  ? 256  HIS A CE1 1 
ATOM   1966  N  NE2 . HIS A  1  256 ? 62.523  301.841 215.632 1.00 31.32  ? 256  HIS A NE2 1 
ATOM   1967  N  N   . ILE A  1  257 ? 56.698  299.226 214.088 1.00 27.45  ? 257  ILE A N   1 
ATOM   1968  C  CA  . ILE A  1  257 ? 55.259  298.851 214.202 1.00 27.15  ? 257  ILE A CA  1 
ATOM   1969  C  C   . ILE A  1  257 ? 55.058  297.322 214.205 1.00 28.46  ? 257  ILE A C   1 
ATOM   1970  O  O   . ILE A  1  257 ? 54.206  296.789 214.979 1.00 30.84  ? 257  ILE A O   1 
ATOM   1971  C  CB  . ILE A  1  257 ? 54.480  299.484 213.065 1.00 28.48  ? 257  ILE A CB  1 
ATOM   1972  C  CG1 . ILE A  1  257 ? 54.418  301.003 213.290 1.00 26.85  ? 257  ILE A CG1 1 
ATOM   1973  C  CG2 . ILE A  1  257 ? 52.958  298.941 212.975 1.00 29.22  ? 257  ILE A CG2 1 
ATOM   1974  C  CD1 . ILE A  1  257 ? 54.072  301.762 211.888 1.00 19.38  ? 257  ILE A CD1 1 
ATOM   1975  N  N   . VAL A  1  258 ? 55.747  296.603 213.306 1.00 27.20  ? 258  VAL A N   1 
ATOM   1976  C  CA  . VAL A  1  258 ? 55.653  295.103 213.220 1.00 26.93  ? 258  VAL A CA  1 
ATOM   1977  C  C   . VAL A  1  258 ? 56.163  294.538 214.530 1.00 29.26  ? 258  VAL A C   1 
ATOM   1978  O  O   . VAL A  1  258 ? 55.572  293.604 215.052 1.00 29.90  ? 258  VAL A O   1 
ATOM   1979  C  CB  . VAL A  1  258 ? 56.431  294.596 211.992 1.00 29.18  ? 258  VAL A CB  1 
ATOM   1980  C  CG1 . VAL A  1  258 ? 56.457  293.154 211.915 1.00 30.69  ? 258  VAL A CG1 1 
ATOM   1981  C  CG2 . VAL A  1  258 ? 55.657  295.208 210.686 1.00 26.32  ? 258  VAL A CG2 1 
ATOM   1982  N  N   . THR A  1  259 ? 57.329  295.019 214.994 1.00 26.07  ? 259  THR A N   1 
ATOM   1983  C  CA  . THR A  1  259 ? 57.848  294.513 216.269 1.00 27.02  ? 259  THR A CA  1 
ATOM   1984  C  C   . THR A  1  259 ? 56.860  294.717 217.404 1.00 29.02  ? 259  THR A C   1 
ATOM   1985  O  O   . THR A  1  259 ? 56.579  293.777 218.199 1.00 29.33  ? 259  THR A O   1 
ATOM   1986  C  CB  . THR A  1  259 ? 59.109  295.262 216.633 1.00 28.44  ? 259  THR A CB  1 
ATOM   1987  O  OG1 . THR A  1  259 ? 60.029  295.024 215.570 1.00 25.50  ? 259  THR A OG1 1 
ATOM   1988  C  CG2 . THR A  1  259 ? 59.697  294.687 217.895 1.00 27.13  ? 259  THR A CG2 1 
ATOM   1989  N  N   . TYR A  1  260 ? 56.356  295.931 217.509 1.00 29.39  ? 260  TYR A N   1 
ATOM   1990  C  CA  . TYR A  1  260 ? 55.434  296.315 218.581 1.00 30.02  ? 260  TYR A CA  1 
ATOM   1991  C  C   . TYR A  1  260 ? 54.145  295.473 218.536 1.00 32.67  ? 260  TYR A C   1 
ATOM   1992  O  O   . TYR A  1  260 ? 53.769  294.859 219.562 1.00 32.08  ? 260  TYR A O   1 
ATOM   1993  C  CB  . TYR A  1  260 ? 55.145  297.861 218.509 1.00 29.91  ? 260  TYR A CB  1 
ATOM   1994  C  CG  . TYR A  1  260 ? 54.405  298.345 219.719 1.00 29.24  ? 260  TYR A CG  1 
ATOM   1995  C  CD1 . TYR A  1  260 ? 55.081  298.951 220.773 1.00 28.55  ? 260  TYR A CD1 1 
ATOM   1996  C  CD2 . TYR A  1  260 ? 53.028  298.210 219.800 1.00 27.08  ? 260  TYR A CD2 1 
ATOM   1997  C  CE1 . TYR A  1  260 ? 54.384  299.451 221.965 1.00 29.22  ? 260  TYR A CE1 1 
ATOM   1998  C  CE2 . TYR A  1  260 ? 52.317  298.612 221.014 1.00 27.85  ? 260  TYR A CE2 1 
ATOM   1999  C  CZ  . TYR A  1  260 ? 53.033  299.243 222.046 1.00 32.68  ? 260  TYR A CZ  1 
ATOM   2000  O  OH  . TYR A  1  260 ? 52.424  299.594 223.243 1.00 33.57  ? 260  TYR A OH  1 
ATOM   2001  N  N   . TYR A  1  261 ? 53.433  295.391 217.412 1.00 30.46  ? 261  TYR A N   1 
ATOM   2002  C  CA  . TYR A  1  261 ? 52.190  294.617 217.417 1.00 30.08  ? 261  TYR A CA  1 
ATOM   2003  C  C   . TYR A  1  261 ? 52.348  293.092 217.281 1.00 30.93  ? 261  TYR A C   1 
ATOM   2004  O  O   . TYR A  1  261 ? 51.363  292.394 217.278 1.00 30.50  ? 261  TYR A O   1 
ATOM   2005  C  CB  . TYR A  1  261 ? 51.174  295.152 216.407 1.00 28.57  ? 261  TYR A CB  1 
ATOM   2006  C  CG  . TYR A  1  261 ? 50.815  296.569 216.738 1.00 29.47  ? 261  TYR A CG  1 
ATOM   2007  C  CD1 . TYR A  1  261 ? 49.879  296.815 217.780 1.00 31.67  ? 261  TYR A CD1 1 
ATOM   2008  C  CD2 . TYR A  1  261 ? 51.449  297.666 216.076 1.00 28.17  ? 261  TYR A CD2 1 
ATOM   2009  C  CE1 . TYR A  1  261 ? 49.506  298.165 218.199 1.00 29.24  ? 261  TYR A CE1 1 
ATOM   2010  C  CE2 . TYR A  1  261 ? 51.136  299.008 216.476 1.00 30.72  ? 261  TYR A CE2 1 
ATOM   2011  C  CZ  . TYR A  1  261 ? 50.136  299.257 217.523 1.00 26.37  ? 261  TYR A CZ  1 
ATOM   2012  O  OH  . TYR A  1  261 ? 49.837  300.658 217.883 1.00 26.69  ? 261  TYR A OH  1 
ATOM   2013  N  N   . SER A  1  262 ? 53.564  292.597 217.137 1.00 29.50  ? 262  SER A N   1 
ATOM   2014  C  CA  . SER A  1  262 ? 53.840  291.202 217.304 1.00 28.97  ? 262  SER A CA  1 
ATOM   2015  C  C   . SER A  1  262 ? 54.141  290.908 218.773 1.00 28.51  ? 262  SER A C   1 
ATOM   2016  O  O   . SER A  1  262 ? 54.499  289.797 219.042 1.00 30.22  ? 262  SER A O   1 
ATOM   2017  C  CB  . SER A  1  262 ? 55.046  290.764 216.482 1.00 29.94  ? 262  SER A CB  1 
ATOM   2018  O  OG  . SER A  1  262 ? 54.838  291.077 215.113 1.00 32.45  ? 262  SER A OG  1 
ATOM   2019  N  N   . GLY A  1  263 ? 54.091  291.878 219.672 1.00 29.10  ? 263  GLY A N   1 
ATOM   2020  C  CA  . GLY A  1  263 ? 54.365  291.596 221.096 1.00 30.98  ? 263  GLY A CA  1 
ATOM   2021  C  C   . GLY A  1  263 ? 55.802  291.310 221.272 1.00 34.38  ? 263  GLY A C   1 
ATOM   2022  O  O   . GLY A  1  263 ? 56.200  290.597 222.221 1.00 32.56  ? 263  GLY A O   1 
ATOM   2023  N  N   . LYS A  1  264 ? 56.667  291.849 220.375 1.00 32.96  ? 264  LYS A N   1 
ATOM   2024  C  CA  . LYS A  1  264 ? 58.076  291.427 220.470 1.00 32.21  ? 264  LYS A CA  1 
ATOM   2025  C  C   . LYS A  1  264 ? 58.931  292.486 221.083 1.00 33.25  ? 264  LYS A C   1 
ATOM   2026  O  O   . LYS A  1  264 ? 58.623  293.666 221.012 1.00 29.12  ? 264  LYS A O   1 
ATOM   2027  C  CB  . LYS A  1  264 ? 58.586  290.962 219.092 1.00 34.10  ? 264  LYS A CB  1 
ATOM   2028  C  CG  . LYS A  1  264 ? 58.658  289.382 218.998 1.00 38.05  ? 264  LYS A CG  1 
ATOM   2029  C  CD  . LYS A  1  264 ? 57.679  288.803 218.297 1.00 45.35  ? 264  LYS A CD  1 
ATOM   2030  C  CE  . LYS A  1  264 ? 58.008  287.382 217.928 1.00 37.94  ? 264  LYS A CE  1 
ATOM   2031  N  NZ  . LYS A  1  264 ? 58.831  287.082 216.732 1.00 32.81  ? 264  LYS A NZ  1 
ATOM   2032  N  N   . LYS A  1  265 ? 60.044  292.087 221.709 1.00 31.50  ? 265  LYS A N   1 
ATOM   2033  C  CA  . LYS A  1  265 ? 60.887  293.118 222.286 1.00 32.38  ? 265  LYS A CA  1 
ATOM   2034  C  C   . LYS A  1  265 ? 61.885  293.669 221.239 1.00 32.07  ? 265  LYS A C   1 
ATOM   2035  O  O   . LYS A  1  265 ? 62.550  294.691 221.509 1.00 28.15  ? 265  LYS A O   1 
ATOM   2036  C  CB  . LYS A  1  265 ? 61.634  292.577 223.486 1.00 33.16  ? 265  LYS A CB  1 
ATOM   2037  C  CG  . LYS A  1  265 ? 62.730  291.619 223.098 1.00 39.52  ? 265  LYS A CG  1 
ATOM   2038  C  CD  . LYS A  1  265 ? 63.190  290.934 224.428 1.00 43.30  ? 265  LYS A CD  1 
ATOM   2039  C  CE  . LYS A  1  265 ? 64.396  290.027 224.194 1.00 49.39  ? 265  LYS A CE  1 
ATOM   2040  N  NZ  . LYS A  1  265 ? 63.876  288.747 223.675 1.00 50.88  ? 265  LYS A NZ  1 
ATOM   2041  N  N   . GLU A  1  266 ? 62.022  292.986 220.095 1.00 27.69  ? 266  GLU A N   1 
ATOM   2042  C  CA  . GLU A  1  266 ? 63.034  293.449 219.144 1.00 32.09  ? 266  GLU A CA  1 
ATOM   2043  C  C   . GLU A  1  266 ? 62.664  292.898 217.782 1.00 31.14  ? 266  GLU A C   1 
ATOM   2044  O  O   . GLU A  1  266 ? 62.026  291.895 217.692 1.00 32.19  ? 266  GLU A O   1 
ATOM   2045  C  CB  . GLU A  1  266 ? 64.454  292.981 219.569 1.00 30.67  ? 266  GLU A CB  1 
ATOM   2046  C  CG  . GLU A  1  266 ? 64.463  291.425 219.598 1.00 35.01  ? 266  GLU A CG  1 
ATOM   2047  C  CD  . GLU A  1  266 ? 65.566  290.832 220.473 1.00 38.76  ? 266  GLU A CD  1 
ATOM   2048  O  OE1 . GLU A  1  266 ? 66.193  291.603 221.269 1.00 36.07  ? 266  GLU A OE1 1 
ATOM   2049  O  OE2 . GLU A  1  266 ? 65.902  289.634 220.245 1.00 42.47  ? 266  GLU A OE2 1 
ATOM   2050  N  N   . PRO A  1  267 ? 63.073  293.611 216.688 1.00 33.05  ? 267  PRO A N   1 
ATOM   2051  C  CA  . PRO A  1  267 ? 62.868  293.086 215.339 1.00 31.46  ? 267  PRO A CA  1 
ATOM   2052  C  C   . PRO A  1  267 ? 63.782  291.860 215.116 1.00 32.48  ? 267  PRO A C   1 
ATOM   2053  O  O   . PRO A  1  267 ? 64.843  291.749 215.699 1.00 32.70  ? 267  PRO A O   1 
ATOM   2054  C  CB  . PRO A  1  267 ? 63.434  294.229 214.382 1.00 29.80  ? 267  PRO A CB  1 
ATOM   2055  C  CG  . PRO A  1  267 ? 64.502  294.988 215.358 1.00 30.79  ? 267  PRO A CG  1 
ATOM   2056  C  CD  . PRO A  1  267 ? 63.854  294.886 216.724 1.00 32.65  ? 267  PRO A CD  1 
ATOM   2057  N  N   . PHE A  1  268 ? 63.386  290.966 214.214 1.00 30.88  ? 268  PHE A N   1 
ATOM   2058  C  CA  . PHE A  1  268 ? 64.313  289.904 213.862 1.00 29.99  ? 268  PHE A CA  1 
ATOM   2059  C  C   . PHE A  1  268 ? 65.524  290.445 213.132 1.00 31.34  ? 268  PHE A C   1 
ATOM   2060  O  O   . PHE A  1  268 ? 65.359  291.284 212.186 1.00 32.42  ? 268  PHE A O   1 
ATOM   2061  C  CB  . PHE A  1  268 ? 63.550  288.985 212.887 1.00 31.34  ? 268  PHE A CB  1 
ATOM   2062  C  CG  . PHE A  1  268 ? 64.296  287.781 212.491 1.00 31.90  ? 268  PHE A CG  1 
ATOM   2063  C  CD1 . PHE A  1  268 ? 64.216  286.621 213.315 1.00 33.41  ? 268  PHE A CD1 1 
ATOM   2064  C  CD2 . PHE A  1  268 ? 65.108  287.797 211.365 1.00 32.53  ? 268  PHE A CD2 1 
ATOM   2065  C  CE1 . PHE A  1  268 ? 64.867  285.517 212.974 1.00 37.68  ? 268  PHE A CE1 1 
ATOM   2066  C  CE2 . PHE A  1  268 ? 65.842  286.678 211.020 1.00 39.27  ? 268  PHE A CE2 1 
ATOM   2067  C  CZ  . PHE A  1  268 ? 65.689  285.511 211.829 1.00 36.40  ? 268  PHE A CZ  1 
ATOM   2068  N  N   . GLY A  1  269 ? 66.732  289.932 213.436 1.00 30.05  ? 269  GLY A N   1 
ATOM   2069  C  CA  . GLY A  1  269 ? 67.931  290.210 212.571 1.00 29.33  ? 269  GLY A CA  1 
ATOM   2070  C  C   . GLY A  1  269 ? 68.254  291.726 212.526 1.00 31.53  ? 269  GLY A C   1 
ATOM   2071  O  O   . GLY A  1  269 ? 68.488  292.340 211.478 1.00 31.55  ? 269  GLY A O   1 
ATOM   2072  N  N   . TYR A  1  270 ? 68.358  292.329 213.678 1.00 26.55  ? 270  TYR A N   1 
ATOM   2073  C  CA  . TYR A  1  270 ? 68.690  293.732 213.737 1.00 27.81  ? 270  TYR A CA  1 
ATOM   2074  C  C   . TYR A  1  270 ? 69.930  294.138 212.876 1.00 28.59  ? 270  TYR A C   1 
ATOM   2075  O  O   . TYR A  1  270 ? 69.861  295.046 212.081 1.00 27.93  ? 270  TYR A O   1 
ATOM   2076  C  CB  . TYR A  1  270 ? 68.970  294.064 215.228 1.00 24.31  ? 270  TYR A CB  1 
ATOM   2077  C  CG  . TYR A  1  270 ? 69.486  295.478 215.445 1.00 26.24  ? 270  TYR A CG  1 
ATOM   2078  C  CD1 . TYR A  1  270 ? 68.584  296.549 215.700 1.00 25.18  ? 270  TYR A CD1 1 
ATOM   2079  C  CD2 . TYR A  1  270 ? 70.868  295.736 215.417 1.00 27.93  ? 270  TYR A CD2 1 
ATOM   2080  C  CE1 . TYR A  1  270 ? 69.088  297.864 216.000 1.00 26.01  ? 270  TYR A CE1 1 
ATOM   2081  C  CE2 . TYR A  1  270 ? 71.368  296.997 215.670 1.00 21.70  ? 270  TYR A CE2 1 
ATOM   2082  C  CZ  . TYR A  1  270 ? 70.493  298.034 215.961 1.00 23.70  ? 270  TYR A CZ  1 
ATOM   2083  O  OH  . TYR A  1  270 ? 71.082  299.276 216.160 1.00 28.47  ? 270  TYR A OH  1 
ATOM   2084  N  N   . MET A  1  271 ? 71.068  293.463 213.030 1.00 27.96  ? 271  MET A N   1 
ATOM   2085  C  CA  . MET A  1  271 ? 72.258  293.878 212.282 1.00 29.84  ? 271  MET A CA  1 
ATOM   2086  C  C   . MET A  1  271 ? 72.002  293.597 210.754 1.00 29.82  ? 271  MET A C   1 
ATOM   2087  O  O   . MET A  1  271 ? 72.524  294.293 209.910 1.00 27.79  ? 271  MET A O   1 
ATOM   2088  C  CB  . MET A  1  271 ? 73.511  293.086 212.764 1.00 29.22  ? 271  MET A CB  1 
ATOM   2089  C  CG  . MET A  1  271 ? 73.883  293.426 214.200 1.00 33.36  ? 271  MET A CG  1 
ATOM   2090  S  SD  . MET A  1  271 ? 74.395  295.152 214.319 1.00 34.45  ? 271  MET A SD  1 
ATOM   2091  C  CE  . MET A  1  271 ? 76.109  295.095 213.713 1.00 32.42  ? 271  MET A CE  1 
ATOM   2092  N  N   . GLY A  1  272 ? 71.238  292.584 210.403 1.00 28.32  ? 272  GLY A N   1 
ATOM   2093  C  CA  . GLY A  1  272 ? 70.856  292.427 208.975 1.00 27.78  ? 272  GLY A CA  1 
ATOM   2094  C  C   . GLY A  1  272 ? 70.047  293.590 208.429 1.00 30.31  ? 272  GLY A C   1 
ATOM   2095  O  O   . GLY A  1  272 ? 70.190  293.948 207.214 1.00 27.63  ? 272  GLY A O   1 
ATOM   2096  N  N   . MET A  1  273 ? 69.181  294.168 209.288 1.00 30.80  ? 273  MET A N   1 
ATOM   2097  C  CA  . MET A  1  273 ? 68.300  295.321 208.896 1.00 30.18  ? 273  MET A CA  1 
ATOM   2098  C  C   . MET A  1  273 ? 69.158  296.574 208.740 1.00 28.32  ? 273  MET A C   1 
ATOM   2099  O  O   . MET A  1  273 ? 69.018  297.328 207.779 1.00 27.93  ? 273  MET A O   1 
ATOM   2100  C  CB  . MET A  1  273 ? 67.279  295.590 210.002 1.00 27.28  ? 273  MET A CB  1 
ATOM   2101  C  CG  . MET A  1  273 ? 66.176  294.426 210.087 1.00 29.29  ? 273  MET A CG  1 
ATOM   2102  S  SD  . MET A  1  273 ? 65.315  294.260 208.485 1.00 36.66  ? 273  MET A SD  1 
ATOM   2103  C  CE  . MET A  1  273 ? 63.656  294.652 209.066 1.00 32.25  ? 273  MET A CE  1 
ATOM   2104  N  N   . VAL A  1  274 ? 70.114  296.783 209.662 1.00 26.40  ? 274  VAL A N   1 
ATOM   2105  C  CA  . VAL A  1  274 ? 71.094  297.816 209.503 1.00 26.62  ? 274  VAL A CA  1 
ATOM   2106  C  C   . VAL A  1  274 ? 71.917  297.660 208.221 1.00 27.43  ? 274  VAL A C   1 
ATOM   2107  O  O   . VAL A  1  274 ? 72.114  298.592 207.478 1.00 29.42  ? 274  VAL A O   1 
ATOM   2108  C  CB  . VAL A  1  274 ? 72.076  297.892 210.761 1.00 26.87  ? 274  VAL A CB  1 
ATOM   2109  C  CG1 . VAL A  1  274 ? 73.218  298.928 210.515 1.00 25.39  ? 274  VAL A CG1 1 
ATOM   2110  C  CG2 . VAL A  1  274 ? 71.269  298.249 212.033 1.00 26.17  ? 274  VAL A CG2 1 
ATOM   2111  N  N   . TRP A  1  275 ? 72.464  296.484 208.026 1.00 28.54  ? 275  TRP A N   1 
ATOM   2112  C  CA  . TRP A  1  275 ? 73.244  296.191 206.871 1.00 29.97  ? 275  TRP A CA  1 
ATOM   2113  C  C   . TRP A  1  275 ? 72.358  296.486 205.608 1.00 28.87  ? 275  TRP A C   1 
ATOM   2114  O  O   . TRP A  1  275 ? 72.883  297.026 204.627 1.00 28.56  ? 275  TRP A O   1 
ATOM   2115  C  CB  . TRP A  1  275 ? 73.690  294.701 206.873 1.00 28.03  ? 275  TRP A CB  1 
ATOM   2116  C  CG  . TRP A  1  275 ? 74.252  294.245 205.526 1.00 29.10  ? 275  TRP A CG  1 
ATOM   2117  C  CD1 . TRP A  1  275 ? 75.538  294.398 205.084 1.00 30.05  ? 275  TRP A CD1 1 
ATOM   2118  C  CD2 . TRP A  1  275 ? 73.527  293.547 204.450 1.00 30.82  ? 275  TRP A CD2 1 
ATOM   2119  N  NE1 . TRP A  1  275 ? 75.670  293.910 203.764 1.00 29.25  ? 275  TRP A NE1 1 
ATOM   2120  C  CE2 . TRP A  1  275 ? 74.442  293.405 203.362 1.00 29.66  ? 275  TRP A CE2 1 
ATOM   2121  C  CE3 . TRP A  1  275 ? 72.156  293.149 204.271 1.00 28.31  ? 275  TRP A CE3 1 
ATOM   2122  C  CZ2 . TRP A  1  275 ? 74.086  292.776 202.142 1.00 31.34  ? 275  TRP A CZ2 1 
ATOM   2123  C  CZ3 . TRP A  1  275 ? 71.774  292.612 203.104 1.00 30.63  ? 275  TRP A CZ3 1 
ATOM   2124  C  CH2 . TRP A  1  275 ? 72.722  292.393 202.021 1.00 31.97  ? 275  TRP A CH2 1 
ATOM   2125  N  N   . ALA A  1  276 ? 71.066  296.125 205.650 1.00 27.93  ? 276  ALA A N   1 
ATOM   2126  C  CA  . ALA A  1  276 ? 70.255  296.243 204.430 1.00 26.91  ? 276  ALA A CA  1 
ATOM   2127  C  C   . ALA A  1  276 ? 70.046  297.722 204.089 1.00 26.81  ? 276  ALA A C   1 
ATOM   2128  O  O   . ALA A  1  276 ? 70.088  298.136 202.945 1.00 26.96  ? 276  ALA A O   1 
ATOM   2129  C  CB  . ALA A  1  276 ? 68.824  295.522 204.551 1.00 28.63  ? 276  ALA A CB  1 
ATOM   2130  N  N   . MET A  1  277 ? 69.775  298.534 205.094 1.00 26.91  ? 277  MET A N   1 
ATOM   2131  C  CA  . MET A  1  277 ? 69.519  300.007 204.877 1.00 26.74  ? 277  MET A CA  1 
ATOM   2132  C  C   . MET A  1  277 ? 70.824  300.667 204.431 1.00 27.28  ? 277  MET A C   1 
ATOM   2133  O  O   . MET A  1  277 ? 70.818  301.524 203.450 1.00 26.87  ? 277  MET A O   1 
ATOM   2134  C  CB  . MET A  1  277 ? 68.909  300.599 206.171 1.00 26.13  ? 277  MET A CB  1 
ATOM   2135  C  CG  . MET A  1  277 ? 67.455  300.144 206.319 1.00 29.53  ? 277  MET A CG  1 
ATOM   2136  S  SD  . MET A  1  277 ? 66.692  301.137 207.613 1.00 28.37  ? 277  MET A SD  1 
ATOM   2137  C  CE  . MET A  1  277 ? 67.445  300.542 209.172 1.00 25.69  ? 277  MET A CE  1 
ATOM   2138  N  N   . MET A  1  278 ? 71.960  300.308 205.062 1.00 25.88  ? 278  MET A N   1 
ATOM   2139  C  CA  . MET A  1  278 ? 73.288  300.834 204.576 1.00 28.97  ? 278  MET A CA  1 
ATOM   2140  C  C   . MET A  1  278 ? 73.637  300.482 203.084 1.00 28.48  ? 278  MET A C   1 
ATOM   2141  O  O   . MET A  1  278 ? 74.015  301.313 202.329 1.00 29.33  ? 278  MET A O   1 
ATOM   2142  C  CB  . MET A  1  278 ? 74.408  300.305 205.453 1.00 28.17  ? 278  MET A CB  1 
ATOM   2143  C  CG  . MET A  1  278 ? 74.003  300.730 206.780 1.00 41.37  ? 278  MET A CG  1 
ATOM   2144  S  SD  . MET A  1  278 ? 75.042  302.146 207.124 1.00 54.74  ? 278  MET A SD  1 
ATOM   2145  C  CE  . MET A  1  278 ? 75.976  300.765 207.945 1.00 41.53  ? 278  MET A CE  1 
ATOM   2146  N  N   . SER A  1  279 ? 73.417  299.228 202.714 1.00 29.90  ? 279  SER A N   1 
ATOM   2147  C  CA  . SER A  1  279 ? 73.678  298.725 201.338 1.00 30.59  ? 279  SER A CA  1 
ATOM   2148  C  C   . SER A  1  279 ? 72.735  299.407 200.364 1.00 29.70  ? 279  SER A C   1 
ATOM   2149  O  O   . SER A  1  279 ? 73.122  299.709 199.303 1.00 31.60  ? 279  SER A O   1 
ATOM   2150  C  CB  . SER A  1  279 ? 73.445  297.198 201.299 1.00 27.66  ? 279  SER A CB  1 
ATOM   2151  O  OG  . SER A  1  279 ? 74.314  296.567 202.220 1.00 32.58  ? 279  SER A OG  1 
ATOM   2152  N  N   . ILE A  1  280 ? 71.457  299.561 200.707 1.00 30.29  ? 280  ILE A N   1 
ATOM   2153  C  CA  . ILE A  1  280 ? 70.521  300.247 199.864 1.00 31.05  ? 280  ILE A CA  1 
ATOM   2154  C  C   . ILE A  1  280 ? 70.972  301.728 199.733 1.00 34.95  ? 280  ILE A C   1 
ATOM   2155  O  O   . ILE A  1  280 ? 70.997  302.326 198.610 1.00 34.71  ? 280  ILE A O   1 
ATOM   2156  C  CB  . ILE A  1  280 ? 69.095  300.161 200.529 1.00 31.40  ? 280  ILE A CB  1 
ATOM   2157  C  CG1 . ILE A  1  280 ? 68.471  298.746 200.296 1.00 23.27  ? 280  ILE A CG1 1 
ATOM   2158  C  CG2 . ILE A  1  280 ? 68.237  301.326 199.933 1.00 29.82  ? 280  ILE A CG2 1 
ATOM   2159  C  CD1 . ILE A  1  280 ? 67.200  298.479 201.253 1.00 33.08  ? 280  ILE A CD1 1 
ATOM   2160  N  N   . GLY A  1  281 ? 71.375  302.333 200.839 1.00 33.93  ? 281  GLY A N   1 
ATOM   2161  C  CA  . GLY A  1  281 ? 71.873  303.685 200.740 1.00 33.70  ? 281  GLY A CA  1 
ATOM   2162  C  C   . GLY A  1  281 ? 73.081  303.836 199.843 1.00 36.10  ? 281  GLY A C   1 
ATOM   2163  O  O   . GLY A  1  281 ? 73.081  304.743 198.982 1.00 34.06  ? 281  GLY A O   1 
ATOM   2164  N  N   . PHE A  1  282 ? 74.086  302.956 199.991 1.00 32.40  ? 282  PHE A N   1 
ATOM   2165  C  CA  . PHE A  1  282 ? 75.236  302.979 199.174 1.00 34.22  ? 282  PHE A CA  1 
ATOM   2166  C  C   . PHE A  1  282 ? 74.927  302.735 197.631 1.00 34.11  ? 282  PHE A C   1 
ATOM   2167  O  O   . PHE A  1  282 ? 75.340  303.497 196.764 1.00 32.50  ? 282  PHE A O   1 
ATOM   2168  C  CB  . PHE A  1  282 ? 76.212  301.922 199.702 1.00 34.47  ? 282  PHE A CB  1 
ATOM   2169  C  CG  . PHE A  1  282 ? 77.401  301.773 198.883 1.00 43.94  ? 282  PHE A CG  1 
ATOM   2170  C  CD1 . PHE A  1  282 ? 78.489  302.633 199.067 1.00 52.93  ? 282  PHE A CD1 1 
ATOM   2171  C  CD2 . PHE A  1  282 ? 77.488  300.736 197.900 1.00 50.11  ? 282  PHE A CD2 1 
ATOM   2172  C  CE1 . PHE A  1  282 ? 79.681  302.491 198.217 1.00 58.95  ? 282  PHE A CE1 1 
ATOM   2173  C  CE2 . PHE A  1  282 ? 78.641  300.581 197.049 1.00 56.23  ? 282  PHE A CE2 1 
ATOM   2174  C  CZ  . PHE A  1  282 ? 79.735  301.458 197.208 1.00 60.97  ? 282  PHE A CZ  1 
ATOM   2175  N  N   . LEU A  1  283 ? 74.216  301.652 197.336 1.00 32.51  ? 283  LEU A N   1 
ATOM   2176  C  CA  . LEU A  1  283 ? 73.920  301.258 195.996 1.00 31.66  ? 283  LEU A CA  1 
ATOM   2177  C  C   . LEU A  1  283 ? 72.912  302.247 195.373 1.00 30.87  ? 283  LEU A C   1 
ATOM   2178  O  O   . LEU A  1  283 ? 72.833  302.336 194.131 1.00 28.56  ? 283  LEU A O   1 
ATOM   2179  C  CB  . LEU A  1  283 ? 73.239  299.843 196.021 1.00 31.15  ? 283  LEU A CB  1 
ATOM   2180  C  CG  . LEU A  1  283 ? 74.092  298.645 196.523 1.00 34.31  ? 283  LEU A CG  1 
ATOM   2181  C  CD1 . LEU A  1  283 ? 73.203  297.413 196.671 1.00 32.62  ? 283  LEU A CD1 1 
ATOM   2182  C  CD2 . LEU A  1  283 ? 75.173  298.436 195.498 1.00 35.88  ? 283  LEU A CD2 1 
ATOM   2183  N  N   . GLY A  1  284 ? 72.257  303.086 196.193 1.00 29.02  ? 284  GLY A N   1 
ATOM   2184  C  CA  . GLY A  1  284 ? 71.248  304.006 195.660 1.00 25.82  ? 284  GLY A CA  1 
ATOM   2185  C  C   . GLY A  1  284 ? 71.929  305.117 194.873 1.00 24.81  ? 284  GLY A C   1 
ATOM   2186  O  O   . GLY A  1  284 ? 71.264  305.881 194.214 1.00 27.07  ? 284  GLY A O   1 
ATOM   2187  N  N   . PHE A  1  285 ? 73.270  305.262 194.970 1.00 24.28  ? 285  PHE A N   1 
ATOM   2188  C  CA  . PHE A  1  285 ? 74.002  306.208 194.177 1.00 25.94  ? 285  PHE A CA  1 
ATOM   2189  C  C   . PHE A  1  285 ? 74.609  305.688 192.847 1.00 27.56  ? 285  PHE A C   1 
ATOM   2190  O  O   . PHE A  1  285 ? 75.218  306.478 192.079 1.00 28.70  ? 285  PHE A O   1 
ATOM   2191  C  CB  . PHE A  1  285 ? 75.205  306.768 194.987 1.00 25.08  ? 285  PHE A CB  1 
ATOM   2192  C  CG  . PHE A  1  285 ? 74.774  307.777 196.030 1.00 26.27  ? 285  PHE A CG  1 
ATOM   2193  C  CD1 . PHE A  1  285 ? 74.503  309.101 195.640 1.00 24.08  ? 285  PHE A CD1 1 
ATOM   2194  C  CD2 . PHE A  1  285 ? 74.549  307.380 197.292 1.00 25.99  ? 285  PHE A CD2 1 
ATOM   2195  C  CE1 . PHE A  1  285 ? 74.059  310.062 196.613 1.00 24.50  ? 285  PHE A CE1 1 
ATOM   2196  C  CE2 . PHE A  1  285 ? 74.090  308.331 198.326 1.00 28.02  ? 285  PHE A CE2 1 
ATOM   2197  C  CZ  . PHE A  1  285 ? 73.861  309.671 197.931 1.00 27.17  ? 285  PHE A CZ  1 
ATOM   2198  N  N   . ILE A  1  286 ? 74.394  304.437 192.524 1.00 26.33  ? 286  ILE A N   1 
ATOM   2199  C  CA  . ILE A  1  286 ? 74.996  303.911 191.276 1.00 27.85  ? 286  ILE A CA  1 
ATOM   2200  C  C   . ILE A  1  286 ? 74.086  303.262 190.290 1.00 28.36  ? 286  ILE A C   1 
ATOM   2201  O  O   . ILE A  1  286 ? 74.539  302.460 189.431 1.00 28.69  ? 286  ILE A O   1 
ATOM   2202  C  CB  . ILE A  1  286 ? 76.178  303.000 191.633 1.00 27.84  ? 286  ILE A CB  1 
ATOM   2203  C  CG1 . ILE A  1  286 ? 75.720  301.696 192.316 1.00 29.81  ? 286  ILE A CG1 1 
ATOM   2204  C  CG2 . ILE A  1  286 ? 77.243  303.846 192.531 1.00 31.66  ? 286  ILE A CG2 1 
ATOM   2205  C  CD1 . ILE A  1  286 ? 76.909  300.671 192.609 1.00 34.34  ? 286  ILE A CD1 1 
ATOM   2206  N  N   . VAL A  1  287 ? 72.791  303.589 190.392 1.00 28.75  ? 287  VAL A N   1 
ATOM   2207  C  CA  . VAL A  1  287 ? 71.809  302.950 189.529 1.00 26.61  ? 287  VAL A CA  1 
ATOM   2208  C  C   . VAL A  1  287 ? 70.988  304.018 188.742 1.00 27.05  ? 287  VAL A C   1 
ATOM   2209  O  O   . VAL A  1  287 ? 70.110  303.649 188.004 1.00 27.64  ? 287  VAL A O   1 
ATOM   2210  C  CB  . VAL A  1  287 ? 70.820  302.168 190.351 1.00 27.24  ? 287  VAL A CB  1 
ATOM   2211  C  CG1 . VAL A  1  287 ? 71.501  300.982 191.056 1.00 26.87  ? 287  VAL A CG1 1 
ATOM   2212  C  CG2 . VAL A  1  287 ? 70.146  303.028 191.442 1.00 27.18  ? 287  VAL A CG2 1 
ATOM   2213  N  N   . TRP A  1  288 ? 71.298  305.329 188.879 1.00 27.68  ? 288  TRP A N   1 
ATOM   2214  C  CA  . TRP A  1  288 ? 70.353  306.363 188.418 1.00 26.30  ? 288  TRP A CA  1 
ATOM   2215  C  C   . TRP A  1  288 ? 69.953  306.283 186.921 1.00 27.51  ? 288  TRP A C   1 
ATOM   2216  O  O   . TRP A  1  288 ? 68.833  306.694 186.522 1.00 26.87  ? 288  TRP A O   1 
ATOM   2217  C  CB  . TRP A  1  288 ? 70.940  307.812 188.664 1.00 23.79  ? 288  TRP A CB  1 
ATOM   2218  C  CG  . TRP A  1  288 ? 72.049  308.206 187.699 1.00 26.11  ? 288  TRP A CG  1 
ATOM   2219  C  CD1 . TRP A  1  288 ? 71.897  308.898 186.551 1.00 26.79  ? 288  TRP A CD1 1 
ATOM   2220  C  CD2 . TRP A  1  288 ? 73.426  307.949 187.849 1.00 25.70  ? 288  TRP A CD2 1 
ATOM   2221  N  NE1 . TRP A  1  288 ? 73.114  309.027 185.916 1.00 21.41  ? 288  TRP A NE1 1 
ATOM   2222  C  CE2 . TRP A  1  288 ? 74.071  308.446 186.700 1.00 24.11  ? 288  TRP A CE2 1 
ATOM   2223  C  CE3 . TRP A  1  288 ? 74.174  307.218 188.799 1.00 23.91  ? 288  TRP A CE3 1 
ATOM   2224  C  CZ2 . TRP A  1  288 ? 75.509  308.352 186.477 1.00 26.60  ? 288  TRP A CZ2 1 
ATOM   2225  C  CZ3 . TRP A  1  288 ? 75.680  307.158 188.608 1.00 25.14  ? 288  TRP A CZ3 1 
ATOM   2226  C  CH2 . TRP A  1  288 ? 76.281  307.655 187.457 1.00 25.09  ? 288  TRP A CH2 1 
ATOM   2227  N  N   . ALA A  1  289 ? 70.857  305.778 186.072 1.00 27.58  ? 289  ALA A N   1 
ATOM   2228  C  CA  . ALA A  1  289 ? 70.567  305.864 184.638 1.00 23.78  ? 289  ALA A CA  1 
ATOM   2229  C  C   . ALA A  1  289 ? 69.634  304.841 184.195 1.00 27.83  ? 289  ALA A C   1 
ATOM   2230  O  O   . ALA A  1  289 ? 69.328  304.878 183.016 1.00 27.69  ? 289  ALA A O   1 
ATOM   2231  C  CB  . ALA A  1  289 ? 71.931  305.806 183.766 1.00 26.63  ? 289  ALA A CB  1 
ATOM   2232  N  N   . HIS A  1  290 ? 69.145  303.931 185.075 1.00 26.30  ? 290  HIS A N   1 
ATOM   2233  C  CA  . HIS A  1  290 ? 67.960  303.162 184.669 1.00 28.40  ? 290  HIS A CA  1 
ATOM   2234  C  C   . HIS A  1  290 ? 66.738  304.047 184.434 1.00 26.50  ? 290  HIS A C   1 
ATOM   2235  O  O   . HIS A  1  290 ? 65.673  303.530 183.945 1.00 28.76  ? 290  HIS A O   1 
ATOM   2236  C  CB  . HIS A  1  290 ? 67.590  301.916 185.544 1.00 29.01  ? 290  HIS A CB  1 
ATOM   2237  C  CG  . HIS A  1  290 ? 67.142  302.272 186.925 1.00 32.66  ? 290  HIS A CG  1 
ATOM   2238  N  ND1 . HIS A  1  290 ? 67.383  301.472 188.035 1.00 35.46  ? 290  HIS A ND1 1 
ATOM   2239  C  CD2 . HIS A  1  290 ? 66.474  303.344 187.385 1.00 36.82  ? 290  HIS A CD2 1 
ATOM   2240  C  CE1 . HIS A  1  290 ? 66.850  302.011 189.114 1.00 31.69  ? 290  HIS A CE1 1 
ATOM   2241  N  NE2 . HIS A  1  290 ? 66.286  303.149 188.746 1.00 36.19  ? 290  HIS A NE2 1 
ATOM   2242  N  N   . HIS A  1  291 ? 66.839  305.368 184.774 1.00 26.65  ? 291  HIS A N   1 
ATOM   2243  C  CA  . HIS A  1  291 ? 65.814  306.356 184.407 1.00 25.98  ? 291  HIS A CA  1 
ATOM   2244  C  C   . HIS A  1  291 ? 66.011  306.953 183.005 1.00 25.17  ? 291  HIS A C   1 
ATOM   2245  O  O   . HIS A  1  291 ? 65.195  307.796 182.557 1.00 26.98  ? 291  HIS A O   1 
ATOM   2246  C  CB  . HIS A  1  291 ? 65.806  307.480 185.407 1.00 25.66  ? 291  HIS A CB  1 
ATOM   2247  C  CG  . HIS A  1  291 ? 65.348  306.956 186.730 1.00 30.41  ? 291  HIS A CG  1 
ATOM   2248  N  ND1 . HIS A  1  291 ? 64.008  306.731 187.014 1.00 28.29  ? 291  HIS A ND1 1 
ATOM   2249  C  CD2 . HIS A  1  291 ? 66.057  306.518 187.791 1.00 28.41  ? 291  HIS A CD2 1 
ATOM   2250  C  CE1 . HIS A  1  291 ? 63.902  306.219 188.244 1.00 27.46  ? 291  HIS A CE1 1 
ATOM   2251  N  NE2 . HIS A  1  291 ? 65.134  306.110 188.748 1.00 33.98  ? 291  HIS A NE2 1 
ATOM   2252  N  N   . MET A  1  292 ? 67.001  306.402 182.277 1.00 25.92  ? 292  MET A N   1 
ATOM   2253  C  CA  . MET A  1  292 ? 67.440  307.023 181.006 1.00 23.99  ? 292  MET A CA  1 
ATOM   2254  C  C   . MET A  1  292 ? 67.695  305.917 179.945 1.00 26.08  ? 292  MET A C   1 
ATOM   2255  O  O   . MET A  1  292 ? 68.500  306.115 179.069 1.00 26.16  ? 292  MET A O   1 
ATOM   2256  C  CB  . MET A  1  292 ? 68.737  307.909 181.265 1.00 24.01  ? 292  MET A CB  1 
ATOM   2257  C  CG  . MET A  1  292 ? 68.481  309.019 182.305 1.00 22.25  ? 292  MET A CG  1 
ATOM   2258  S  SD  . MET A  1  292 ? 69.940  309.816 182.820 1.00 28.39  ? 292  MET A SD  1 
ATOM   2259  C  CE  . MET A  1  292 ? 70.541  310.404 181.158 1.00 26.56  ? 292  MET A CE  1 
ATOM   2260  N  N   . PHE A  1  293 ? 67.082  304.753 180.026 1.00 26.44  ? 293  PHE A N   1 
ATOM   2261  C  CA  . PHE A  1  293 ? 67.445  303.675 179.113 1.00 26.64  ? 293  PHE A CA  1 
ATOM   2262  C  C   . PHE A  1  293 ? 66.981  303.947 177.655 1.00 28.62  ? 293  PHE A C   1 
ATOM   2263  O  O   . PHE A  1  293 ? 67.533  303.291 176.741 1.00 27.83  ? 293  PHE A O   1 
ATOM   2264  C  CB  . PHE A  1  293 ? 66.788  302.330 179.507 1.00 25.55  ? 293  PHE A CB  1 
ATOM   2265  C  CG  . PHE A  1  293 ? 67.410  301.624 180.725 1.00 27.58  ? 293  PHE A CG  1 
ATOM   2266  C  CD1 . PHE A  1  293 ? 68.858  301.510 180.906 1.00 27.23  ? 293  PHE A CD1 1 
ATOM   2267  C  CD2 . PHE A  1  293 ? 66.588  300.930 181.586 1.00 27.38  ? 293  PHE A CD2 1 
ATOM   2268  C  CE1 . PHE A  1  293 ? 69.405  300.764 181.975 1.00 28.54  ? 293  PHE A CE1 1 
ATOM   2269  C  CE2 . PHE A  1  293 ? 67.121  300.135 182.629 1.00 24.91  ? 293  PHE A CE2 1 
ATOM   2270  C  CZ  . PHE A  1  293 ? 68.547  300.072 182.811 1.00 27.52  ? 293  PHE A CZ  1 
ATOM   2271  N  N   . THR A  1  294 ? 66.113  304.960 177.411 1.00 27.68  ? 294  THR A N   1 
ATOM   2272  C  CA  . THR A  1  294 ? 65.679  305.222 176.009 1.00 27.80  ? 294  THR A CA  1 
ATOM   2273  C  C   . THR A  1  294 ? 66.375  306.445 175.452 1.00 28.84  ? 294  THR A C   1 
ATOM   2274  O  O   . THR A  1  294 ? 66.031  306.915 174.344 1.00 30.56  ? 294  THR A O   1 
ATOM   2275  C  CB  . THR A  1  294 ? 64.112  305.411 175.876 1.00 25.61  ? 294  THR A CB  1 
ATOM   2276  O  OG1 . THR A  1  294 ? 63.753  306.565 176.664 1.00 26.70  ? 294  THR A OG1 1 
ATOM   2277  C  CG2 . THR A  1  294 ? 63.378  304.216 176.445 1.00 23.07  ? 294  THR A CG2 1 
ATOM   2278  N  N   . VAL A  1  295 ? 67.314  306.994 176.206 1.00 30.85  ? 295  VAL A N   1 
ATOM   2279  C  CA  . VAL A  1  295 ? 67.946  308.232 175.762 1.00 29.17  ? 295  VAL A CA  1 
ATOM   2280  C  C   . VAL A  1  295 ? 68.934  308.014 174.609 1.00 30.24  ? 295  VAL A C   1 
ATOM   2281  O  O   . VAL A  1  295 ? 69.454  309.002 174.087 1.00 28.46  ? 295  VAL A O   1 
ATOM   2282  C  CB  . VAL A  1  295 ? 68.520  309.189 176.846 1.00 29.68  ? 295  VAL A CB  1 
ATOM   2283  C  CG1 . VAL A  1  295 ? 67.427  309.489 178.004 1.00 24.22  ? 295  VAL A CG1 1 
ATOM   2284  C  CG2 . VAL A  1  295 ? 69.921  308.814 177.363 1.00 28.08  ? 295  VAL A CG2 1 
ATOM   2285  N  N   . GLY A  1  296 ? 69.264  306.754 174.298 1.00 30.62  ? 296  GLY A N   1 
ATOM   2286  C  CA  . GLY A  1  296 ? 70.326  306.579 173.334 1.00 33.81  ? 296  GLY A CA  1 
ATOM   2287  C  C   . GLY A  1  296 ? 71.581  306.209 174.032 1.00 35.22  ? 296  GLY A C   1 
ATOM   2288  O  O   . GLY A  1  296 ? 72.566  306.808 173.787 1.00 35.60  ? 296  GLY A O   1 
ATOM   2289  N  N   . MET A  1  297 ? 71.527  305.122 174.808 1.00 38.14  ? 297  MET A N   1 
ATOM   2290  C  CA  . MET A  1  297 ? 72.580  304.757 175.714 1.00 40.08  ? 297  MET A CA  1 
ATOM   2291  C  C   . MET A  1  297 ? 73.348  303.596 175.177 1.00 36.48  ? 297  MET A C   1 
ATOM   2292  O  O   . MET A  1  297 ? 72.716  302.640 174.747 1.00 38.21  ? 297  MET A O   1 
ATOM   2293  C  CB  . MET A  1  297 ? 71.973  304.430 177.185 1.00 41.04  ? 297  MET A CB  1 
ATOM   2294  C  CG  . MET A  1  297 ? 72.433  305.460 178.360 1.00 51.64  ? 297  MET A CG  1 
ATOM   2295  S  SD  . MET A  1  297 ? 71.608  305.044 180.068 1.00 54.80  ? 297  MET A SD  1 
ATOM   2296  C  CE  . MET A  1  297 ? 71.788  303.382 179.612 1.00 13.88  ? 297  MET A CE  1 
ATOM   2297  N  N   . ASP A  1  298 ? 74.709  303.600 175.283 1.00 39.00  ? 298  ASP A N   1 
ATOM   2298  C  CA  . ASP A  1  298 ? 75.545  302.471 174.750 1.00 40.14  ? 298  ASP A CA  1 
ATOM   2299  C  C   . ASP A  1  298 ? 75.053  301.208 175.417 1.00 40.12  ? 298  ASP A C   1 
ATOM   2300  O  O   . ASP A  1  298 ? 74.558  301.263 176.565 1.00 35.07  ? 298  ASP A O   1 
ATOM   2301  C  CB  . ASP A  1  298 ? 77.079  302.642 175.062 1.00 44.75  ? 298  ASP A CB  1 
ATOM   2302  C  CG  . ASP A  1  298 ? 77.696  303.914 174.399 1.00 55.84  ? 298  ASP A CG  1 
ATOM   2303  O  OD1 . ASP A  1  298 ? 76.988  304.440 173.481 1.00 67.81  ? 298  ASP A OD1 1 
ATOM   2304  O  OD2 . ASP A  1  298 ? 78.849  304.433 174.745 1.00 59.94  ? 298  ASP A OD2 1 
ATOM   2305  N  N   . VAL A  1  299 ? 75.271  300.040 174.809 1.00 37.05  ? 299  VAL A N   1 
ATOM   2306  C  CA  . VAL A  1  299 ? 74.757  298.804 175.363 1.00 37.73  ? 299  VAL A CA  1 
ATOM   2307  C  C   . VAL A  1  299 ? 75.433  298.334 176.685 1.00 37.38  ? 299  VAL A C   1 
ATOM   2308  O  O   . VAL A  1  299 ? 74.789  297.725 177.527 1.00 38.56  ? 299  VAL A O   1 
ATOM   2309  C  CB  . VAL A  1  299 ? 74.842  297.620 174.241 1.00 39.20  ? 299  VAL A CB  1 
ATOM   2310  C  CG1 . VAL A  1  299 ? 76.271  297.195 173.976 1.00 42.36  ? 299  VAL A CG1 1 
ATOM   2311  C  CG2 . VAL A  1  299 ? 74.060  296.492 174.590 1.00 38.77  ? 299  VAL A CG2 1 
ATOM   2312  N  N   . ASP A  1  300 ? 76.749  298.501 176.795 1.00 36.12  ? 300  ASP A N   1 
ATOM   2313  C  CA  . ASP A  1  300 ? 77.486  298.031 177.963 1.00 35.62  ? 300  ASP A CA  1 
ATOM   2314  C  C   . ASP A  1  300 ? 77.013  298.905 179.156 1.00 35.41  ? 300  ASP A C   1 
ATOM   2315  O  O   . ASP A  1  300 ? 76.885  298.412 180.207 1.00 37.91  ? 300  ASP A O   1 
ATOM   2316  C  CB  . ASP A  1  300 ? 78.988  298.291 177.752 1.00 36.25  ? 300  ASP A CB  1 
ATOM   2317  C  CG  . ASP A  1  300 ? 79.605  297.279 176.752 1.00 39.91  ? 300  ASP A CG  1 
ATOM   2318  O  OD1 . ASP A  1  300 ? 78.976  296.231 176.506 1.00 39.81  ? 300  ASP A OD1 1 
ATOM   2319  O  OD2 . ASP A  1  300 ? 80.694  297.548 176.310 1.00 47.86  ? 300  ASP A OD2 1 
ATOM   2320  N  N   . THR A  1  301 ? 76.771  300.194 178.964 1.00 35.27  ? 301  THR A N   1 
ATOM   2321  C  CA  . THR A  1  301 ? 76.221  301.102 180.047 1.00 33.95  ? 301  THR A CA  1 
ATOM   2322  C  C   . THR A  1  301 ? 74.804  300.572 180.479 1.00 36.13  ? 301  THR A C   1 
ATOM   2323  O  O   . THR A  1  301 ? 74.520  300.452 181.686 1.00 34.90  ? 301  THR A O   1 
ATOM   2324  C  CB  . THR A  1  301 ? 76.210  302.513 179.554 1.00 33.61  ? 301  THR A CB  1 
ATOM   2325  O  OG1 . THR A  1  301 ? 77.579  302.953 179.542 1.00 30.91  ? 301  THR A OG1 1 
ATOM   2326  C  CG2 . THR A  1  301 ? 75.422  303.423 180.535 1.00 30.45  ? 301  THR A CG2 1 
ATOM   2327  N  N   . ARG A  1  302 ? 73.970  300.182 179.494 1.00 31.96  ? 302  ARG A N   1 
ATOM   2328  C  CA  . ARG A  1  302 ? 72.702  299.561 179.796 1.00 34.46  ? 302  ARG A CA  1 
ATOM   2329  C  C   . ARG A  1  302 ? 72.803  298.245 180.592 1.00 33.14  ? 302  ARG A C   1 
ATOM   2330  O  O   . ARG A  1  302 ? 72.028  297.991 181.570 1.00 31.77  ? 302  ARG A O   1 
ATOM   2331  C  CB  . ARG A  1  302 ? 71.960  299.304 178.465 1.00 33.33  ? 302  ARG A CB  1 
ATOM   2332  C  CG  . ARG A  1  302 ? 71.158  300.469 178.073 1.00 37.62  ? 302  ARG A CG  1 
ATOM   2333  C  CD  . ARG A  1  302 ? 70.229  300.077 176.896 1.00 48.49  ? 302  ARG A CD  1 
ATOM   2334  N  NE  . ARG A  1  302 ? 70.986  300.458 175.717 1.00 60.28  ? 302  ARG A NE  1 
ATOM   2335  C  CZ  . ARG A  1  302 ? 70.688  300.049 174.477 1.00 65.60  ? 302  ARG A CZ  1 
ATOM   2336  N  NH1 . ARG A  1  302 ? 69.592  299.244 174.294 1.00 62.34  ? 302  ARG A NH1 1 
ATOM   2337  N  NH2 . ARG A  1  302 ? 71.483  300.458 173.453 1.00 57.44  ? 302  ARG A NH2 1 
ATOM   2338  N  N   . ALA A  1  303 ? 73.793  297.389 180.215 1.00 34.38  ? 303  ALA A N   1 
ATOM   2339  C  CA  . ALA A  1  303 ? 73.943  296.119 180.889 1.00 31.93  ? 303  ALA A CA  1 
ATOM   2340  C  C   . ALA A  1  303 ? 74.377  296.404 182.349 1.00 32.87  ? 303  ALA A C   1 
ATOM   2341  O  O   . ALA A  1  303 ? 73.928  295.760 183.267 1.00 30.64  ? 303  ALA A O   1 
ATOM   2342  C  CB  . ALA A  1  303 ? 75.011  295.246 180.177 1.00 34.59  ? 303  ALA A CB  1 
ATOM   2343  N  N   . TYR A  1  304 ? 75.281  297.340 182.528 1.00 31.00  ? 304  TYR A N   1 
ATOM   2344  C  CA  . TYR A  1  304 ? 75.751  297.658 183.869 1.00 32.74  ? 304  TYR A CA  1 
ATOM   2345  C  C   . TYR A  1  304 ? 74.612  298.271 184.720 1.00 31.93  ? 304  TYR A C   1 
ATOM   2346  O  O   . TYR A  1  304 ? 74.455  297.915 185.868 1.00 32.48  ? 304  TYR A O   1 
ATOM   2347  C  CB  . TYR A  1  304 ? 76.942  298.664 183.834 1.00 31.08  ? 304  TYR A CB  1 
ATOM   2348  C  CG  . TYR A  1  304 ? 77.022  299.313 185.202 1.00 36.48  ? 304  TYR A CG  1 
ATOM   2349  C  CD1 . TYR A  1  304 ? 77.710  298.701 186.260 1.00 36.48  ? 304  TYR A CD1 1 
ATOM   2350  C  CD2 . TYR A  1  304 ? 76.367  300.516 185.460 1.00 40.14  ? 304  TYR A CD2 1 
ATOM   2351  C  CE1 . TYR A  1  304 ? 77.670  299.287 187.614 1.00 40.35  ? 304  TYR A CE1 1 
ATOM   2352  C  CE2 . TYR A  1  304 ? 76.378  301.116 186.766 1.00 37.78  ? 304  TYR A CE2 1 
ATOM   2353  C  CZ  . TYR A  1  304 ? 76.986  300.450 187.828 1.00 35.09  ? 304  TYR A CZ  1 
ATOM   2354  O  OH  . TYR A  1  304 ? 76.977  301.077 189.076 1.00 37.75  ? 304  TYR A OH  1 
ATOM   2355  N  N   . PHE A  1  305 ? 73.834  299.201 184.192 1.00 32.20  ? 305  PHE A N   1 
ATOM   2356  C  CA  . PHE A  1  305 ? 72.808  299.805 185.064 1.00 30.59  ? 305  PHE A CA  1 
ATOM   2357  C  C   . PHE A  1  305 ? 71.719  298.761 185.375 1.00 31.97  ? 305  PHE A C   1 
ATOM   2358  O  O   . PHE A  1  305 ? 71.127  298.784 186.441 1.00 33.03  ? 305  PHE A O   1 
ATOM   2359  C  CB  . PHE A  1  305 ? 72.246  301.059 184.451 1.00 31.74  ? 305  PHE A CB  1 
ATOM   2360  C  CG  . PHE A  1  305 ? 73.078  302.253 184.815 1.00 30.58  ? 305  PHE A CG  1 
ATOM   2361  C  CD1 . PHE A  1  305 ? 72.969  302.801 186.088 1.00 27.60  ? 305  PHE A CD1 1 
ATOM   2362  C  CD2 . PHE A  1  305 ? 74.054  302.709 183.980 1.00 31.87  ? 305  PHE A CD2 1 
ATOM   2363  C  CE1 . PHE A  1  305 ? 73.782  303.949 186.507 1.00 25.32  ? 305  PHE A CE1 1 
ATOM   2364  C  CE2 . PHE A  1  305 ? 74.891  303.776 184.383 1.00 29.56  ? 305  PHE A CE2 1 
ATOM   2365  C  CZ  . PHE A  1  305 ? 74.727  304.417 185.617 1.00 30.40  ? 305  PHE A CZ  1 
ATOM   2366  N  N   . THR A  1  306 ? 71.449  297.837 184.457 1.00 29.54  ? 306  THR A N   1 
ATOM   2367  C  CA  . THR A  1  306 ? 70.417  296.764 184.726 1.00 30.33  ? 306  THR A CA  1 
ATOM   2368  C  C   . THR A  1  306 ? 70.865  295.906 185.931 1.00 30.81  ? 306  THR A C   1 
ATOM   2369  O  O   . THR A  1  306 ? 70.068  295.567 186.760 1.00 31.78  ? 306  THR A O   1 
ATOM   2370  C  CB  . THR A  1  306 ? 70.413  295.842 183.462 1.00 31.04  ? 306  THR A CB  1 
ATOM   2371  O  OG1 . THR A  1  306 ? 69.649  296.533 182.496 1.00 33.80  ? 306  THR A OG1 1 
ATOM   2372  C  CG2 . THR A  1  306 ? 69.758  294.529 183.811 1.00 32.29  ? 306  THR A CG2 1 
ATOM   2373  N  N   . SER A  1  307 ? 72.134  295.529 185.939 1.00 31.62  ? 307  SER A N   1 
ATOM   2374  C  CA  . SER A  1  307 ? 72.707  294.614 186.920 1.00 33.20  ? 307  SER A CA  1 
ATOM   2375  C  C   . SER A  1  307 ? 72.860  295.268 188.259 1.00 33.95  ? 307  SER A C   1 
ATOM   2376  O  O   . SER A  1  307 ? 72.574  294.633 189.268 1.00 33.68  ? 307  SER A O   1 
ATOM   2377  C  CB  . SER A  1  307 ? 74.183  294.287 186.510 1.00 34.77  ? 307  SER A CB  1 
ATOM   2378  O  OG  . SER A  1  307 ? 74.020  293.650 185.242 1.00 44.61  ? 307  SER A OG  1 
ATOM   2379  N  N   . ALA A  1  308 ? 73.400  296.483 188.267 1.00 30.50  ? 308  ALA A N   1 
ATOM   2380  C  CA  . ALA A  1  308 ? 73.492  297.276 189.567 1.00 31.91  ? 308  ALA A CA  1 
ATOM   2381  C  C   . ALA A  1  308 ? 72.096  297.513 190.145 1.00 29.56  ? 308  ALA A C   1 
ATOM   2382  O  O   . ALA A  1  308 ? 71.856  297.429 191.371 1.00 32.29  ? 308  ALA A O   1 
ATOM   2383  C  CB  . ALA A  1  308 ? 74.188  298.584 189.333 1.00 24.96  ? 308  ALA A CB  1 
ATOM   2384  N  N   . THR A  1  309 ? 71.158  297.840 189.299 1.00 28.73  ? 309  THR A N   1 
ATOM   2385  C  CA  . THR A  1  309 ? 69.744  297.931 189.766 1.00 29.38  ? 309  THR A CA  1 
ATOM   2386  C  C   . THR A  1  309 ? 69.173  296.649 190.406 1.00 32.79  ? 309  THR A C   1 
ATOM   2387  O  O   . THR A  1  309 ? 68.521  296.688 191.452 1.00 33.12  ? 309  THR A O   1 
ATOM   2388  C  CB  . THR A  1  309 ? 68.813  298.284 188.607 1.00 30.53  ? 309  THR A CB  1 
ATOM   2389  O  OG1 . THR A  1  309 ? 69.226  299.577 188.180 1.00 27.45  ? 309  THR A OG1 1 
ATOM   2390  C  CG2 . THR A  1  309 ? 67.238  298.436 189.135 1.00 27.86  ? 309  THR A CG2 1 
ATOM   2391  N  N   . MET A  1  310 ? 69.378  295.497 189.769 1.00 33.17  ? 310  MET A N   1 
ATOM   2392  C  CA  . MET A  1  310 ? 69.003  294.243 190.414 1.00 36.04  ? 310  MET A CA  1 
ATOM   2393  C  C   . MET A  1  310 ? 69.629  293.889 191.768 1.00 36.58  ? 310  MET A C   1 
ATOM   2394  O  O   . MET A  1  310 ? 68.955  293.284 192.567 1.00 38.87  ? 310  MET A O   1 
ATOM   2395  C  CB  . MET A  1  310 ? 69.353  293.078 189.453 1.00 35.47  ? 310  MET A CB  1 
ATOM   2396  C  CG  . MET A  1  310 ? 68.393  293.161 188.242 1.00 40.46  ? 310  MET A CG  1 
ATOM   2397  S  SD  . MET A  1  310 ? 68.578  291.797 187.053 1.00 55.38  ? 310  MET A SD  1 
ATOM   2398  C  CE  . MET A  1  310 ? 66.829  291.826 187.382 1.00 45.47  ? 310  MET A CE  1 
ATOM   2399  N  N   . ILE A  1  311 ? 70.922  294.071 191.884 1.00 35.69  ? 311  ILE A N   1 
ATOM   2400  C  CA  . ILE A  1  311 ? 71.630  293.869 193.133 1.00 38.60  ? 311  ILE A CA  1 
ATOM   2401  C  C   . ILE A  1  311 ? 70.906  294.530 194.357 1.00 39.59  ? 311  ILE A C   1 
ATOM   2402  O  O   . ILE A  1  311 ? 70.888  293.919 195.439 1.00 38.02  ? 311  ILE A O   1 
ATOM   2403  C  CB  . ILE A  1  311 ? 73.047  294.418 192.958 1.00 37.89  ? 311  ILE A CB  1 
ATOM   2404  C  CG1 . ILE A  1  311 ? 73.705  293.545 191.895 1.00 43.09  ? 311  ILE A CG1 1 
ATOM   2405  C  CG2 . ILE A  1  311 ? 73.950  294.278 194.237 1.00 41.20  ? 311  ILE A CG2 1 
ATOM   2406  C  CD1 . ILE A  1  311 ? 75.224  293.943 191.592 1.00 42.93  ? 311  ILE A CD1 1 
ATOM   2407  N  N   . ILE A  1  312 ? 70.241  295.691 194.178 1.00 42.15  ? 312  ILE A N   1 
ATOM   2408  C  CA  . ILE A  1  312 ? 69.463  296.425 195.248 1.00 41.79  ? 312  ILE A CA  1 
ATOM   2409  C  C   . ILE A  1  312 ? 68.322  295.637 195.759 1.00 42.73  ? 312  ILE A C   1 
ATOM   2410  O  O   . ILE A  1  312 ? 67.967  295.767 196.954 1.00 41.47  ? 312  ILE A O   1 
ATOM   2411  C  CB  . ILE A  1  312 ? 68.865  297.742 194.720 1.00 46.25  ? 312  ILE A CB  1 
ATOM   2412  C  CG1 . ILE A  1  312 ? 69.936  298.835 194.585 1.00 44.65  ? 312  ILE A CG1 1 
ATOM   2413  C  CG2 . ILE A  1  312 ? 67.775  298.256 195.729 1.00 46.41  ? 312  ILE A CG2 1 
ATOM   2414  C  CD1 . ILE A  1  312 ? 69.809  299.926 195.980 1.00 38.59  ? 312  ILE A CD1 1 
ATOM   2415  N  N   . ALA A  1  313 ? 67.696  294.773 194.928 1.00 40.00  ? 313  ALA A N   1 
ATOM   2416  C  CA  . ALA A  1  313 ? 66.676  293.862 195.489 1.00 39.55  ? 313  ALA A CA  1 
ATOM   2417  C  C   . ALA A  1  313 ? 67.192  292.942 196.523 1.00 38.81  ? 313  ALA A C   1 
ATOM   2418  O  O   . ALA A  1  313 ? 66.475  292.352 197.398 1.00 39.88  ? 313  ALA A O   1 
ATOM   2419  C  CB  . ALA A  1  313 ? 66.127  292.952 194.249 1.00 42.88  ? 313  ALA A CB  1 
ATOM   2420  N  N   . ILE A  1  314 ? 68.506  292.701 196.495 1.00 36.95  ? 314  ILE A N   1 
ATOM   2421  C  CA  . ILE A  1  314 ? 68.935  291.712 197.478 1.00 34.35  ? 314  ILE A CA  1 
ATOM   2422  C  C   . ILE A  1  314 ? 68.768  292.319 198.923 1.00 35.02  ? 314  ILE A C   1 
ATOM   2423  O  O   . ILE A  1  314 ? 68.017  291.750 199.780 1.00 36.82  ? 314  ILE A O   1 
ATOM   2424  C  CB  . ILE A  1  314 ? 70.362  291.206 197.199 1.00 31.58  ? 314  ILE A CB  1 
ATOM   2425  C  CG1 . ILE A  1  314 ? 70.382  290.543 195.773 1.00 37.07  ? 314  ILE A CG1 1 
ATOM   2426  C  CG2 . ILE A  1  314 ? 70.827  290.208 198.301 1.00 33.53  ? 314  ILE A CG2 1 
ATOM   2427  C  CD1 . ILE A  1  314 ? 71.790  290.024 195.401 1.00 40.44  ? 314  ILE A CD1 1 
ATOM   2428  N  N   . PRO A  1  315 ? 69.506  293.441 199.227 1.00 31.32  ? 315  PRO A N   1 
ATOM   2429  C  CA  . PRO A  1  315 ? 69.206  294.015 200.601 1.00 31.39  ? 315  PRO A CA  1 
ATOM   2430  C  C   . PRO A  1  315 ? 67.724  294.368 200.863 1.00 33.21  ? 315  PRO A C   1 
ATOM   2431  O  O   . PRO A  1  315 ? 67.205  294.177 201.968 1.00 33.74  ? 315  PRO A O   1 
ATOM   2432  C  CB  . PRO A  1  315 ? 70.184  295.195 200.723 1.00 29.62  ? 315  PRO A CB  1 
ATOM   2433  C  CG  . PRO A  1  315 ? 70.487  295.573 199.236 1.00 28.02  ? 315  PRO A CG  1 
ATOM   2434  C  CD  . PRO A  1  315 ? 70.536  294.218 198.492 1.00 28.69  ? 315  PRO A CD  1 
ATOM   2435  N  N   . THR A  1  316 ? 67.027  294.804 199.851 1.00 38.37  ? 316  THR A N   1 
ATOM   2436  C  CA  . THR A  1  316 ? 65.584  295.087 200.064 1.00 39.86  ? 316  THR A CA  1 
ATOM   2437  C  C   . THR A  1  316 ? 64.785  293.871 200.493 1.00 42.34  ? 316  THR A C   1 
ATOM   2438  O  O   . THR A  1  316 ? 63.994  294.051 201.402 1.00 43.87  ? 316  THR A O   1 
ATOM   2439  C  CB  . THR A  1  316 ? 64.990  295.636 198.915 1.00 41.32  ? 316  THR A CB  1 
ATOM   2440  O  OG1 . THR A  1  316 ? 65.843  296.685 198.437 1.00 34.25  ? 316  THR A OG1 1 
ATOM   2441  C  CG2 . THR A  1  316 ? 63.583  296.125 199.293 1.00 39.18  ? 316  THR A CG2 1 
ATOM   2442  N  N   . GLY A  1  317 ? 65.068  292.631 199.965 1.00 41.19  ? 317  GLY A N   1 
ATOM   2443  C  CA  . GLY A  1  317 ? 64.381  291.438 200.393 1.00 37.30  ? 317  GLY A CA  1 
ATOM   2444  C  C   . GLY A  1  317 ? 64.731  290.894 201.778 1.00 40.43  ? 317  GLY A C   1 
ATOM   2445  O  O   . GLY A  1  317 ? 63.825  290.422 202.535 1.00 38.77  ? 317  GLY A O   1 
ATOM   2446  N  N   . VAL A  1  318 ? 66.003  290.889 202.182 1.00 36.52  ? 318  VAL A N   1 
ATOM   2447  C  CA  . VAL A  1  318 ? 66.288  290.766 203.603 1.00 38.25  ? 318  VAL A CA  1 
ATOM   2448  C  C   . VAL A  1  318 ? 65.328  291.477 204.600 1.00 39.78  ? 318  VAL A C   1 
ATOM   2449  O  O   . VAL A  1  318 ? 65.086  290.993 205.755 1.00 42.02  ? 318  VAL A O   1 
ATOM   2450  C  CB  . VAL A  1  318 ? 67.833  291.153 203.914 1.00 38.78  ? 318  VAL A CB  1 
ATOM   2451  C  CG1 . VAL A  1  318 ? 68.177  291.070 205.443 1.00 33.46  ? 318  VAL A CG1 1 
ATOM   2452  C  CG2 . VAL A  1  318 ? 68.691  290.204 203.114 1.00 38.83  ? 318  VAL A CG2 1 
ATOM   2453  N  N   . LYS A  1  319 ? 64.887  292.678 204.208 1.00 40.03  ? 319  LYS A N   1 
ATOM   2454  C  CA  . LYS A  1  319 ? 64.092  293.558 205.062 1.00 36.06  ? 319  LYS A CA  1 
ATOM   2455  C  C   . LYS A  1  319 ? 62.659  292.943 205.005 1.00 34.94  ? 319  LYS A C   1 
ATOM   2456  O  O   . LYS A  1  319 ? 62.071  292.707 206.008 1.00 34.19  ? 319  LYS A O   1 
ATOM   2457  C  CB  . LYS A  1  319 ? 64.084  294.958 204.493 1.00 37.10  ? 319  LYS A CB  1 
ATOM   2458  C  CG  . LYS A  1  319 ? 65.463  295.678 204.777 1.00 39.89  ? 319  LYS A CG  1 
ATOM   2459  C  CD  . LYS A  1  319 ? 65.354  297.189 204.682 1.00 32.21  ? 319  LYS A CD  1 
ATOM   2460  C  CE  . LYS A  1  319 ? 64.853  297.941 206.007 1.00 28.89  ? 319  LYS A CE  1 
ATOM   2461  N  NZ  . LYS A  1  319 ? 65.308  297.481 207.316 1.00 35.55  ? 319  LYS A NZ  1 
ATOM   2462  N  N   . VAL A  1  320 ? 62.157  292.622 203.833 1.00 34.59  ? 320  VAL A N   1 
ATOM   2463  C  CA  . VAL A  1  320 ? 60.810  291.974 203.743 1.00 36.10  ? 320  VAL A CA  1 
ATOM   2464  C  C   . VAL A  1  320 ? 60.775  290.668 204.542 1.00 36.39  ? 320  VAL A C   1 
ATOM   2465  O  O   . VAL A  1  320 ? 59.851  290.457 205.361 1.00 36.87  ? 320  VAL A O   1 
ATOM   2466  C  CB  . VAL A  1  320 ? 60.356  291.774 202.329 1.00 35.65  ? 320  VAL A CB  1 
ATOM   2467  C  CG1 . VAL A  1  320 ? 59.023  290.880 202.211 1.00 35.01  ? 320  VAL A CG1 1 
ATOM   2468  C  CG2 . VAL A  1  320 ? 60.069  293.172 201.693 1.00 36.95  ? 320  VAL A CG2 1 
ATOM   2469  N  N   . PHE A  1  321 ? 61.720  289.779 204.287 1.00 34.48  ? 321  PHE A N   1 
ATOM   2470  C  CA  . PHE A  1  321 ? 61.726  288.535 205.057 1.00 36.07  ? 321  PHE A CA  1 
ATOM   2471  C  C   . PHE A  1  321 ? 61.957  288.779 206.572 1.00 33.61  ? 321  PHE A C   1 
ATOM   2472  O  O   . PHE A  1  321 ? 61.435  288.053 207.380 1.00 35.89  ? 321  PHE A O   1 
ATOM   2473  C  CB  . PHE A  1  321 ? 62.709  287.534 204.430 1.00 35.78  ? 321  PHE A CB  1 
ATOM   2474  C  CG  . PHE A  1  321 ? 62.360  287.169 203.015 1.00 42.89  ? 321  PHE A CG  1 
ATOM   2475  C  CD1 . PHE A  1  321 ? 63.271  287.274 201.986 1.00 47.97  ? 321  PHE A CD1 1 
ATOM   2476  C  CD2 . PHE A  1  321 ? 61.067  286.675 202.707 1.00 49.50  ? 321  PHE A CD2 1 
ATOM   2477  C  CE1 . PHE A  1  321 ? 62.893  286.961 200.692 1.00 47.76  ? 321  PHE A CE1 1 
ATOM   2478  C  CE2 . PHE A  1  321 ? 60.722  286.372 201.394 1.00 48.03  ? 321  PHE A CE2 1 
ATOM   2479  C  CZ  . PHE A  1  321 ? 61.620  286.513 200.430 1.00 48.30  ? 321  PHE A CZ  1 
ATOM   2480  N  N   . SER A  1  322 ? 62.656  289.847 206.944 1.00 31.97  ? 322  SER A N   1 
ATOM   2481  C  CA  . SER A  1  322 ? 62.906  290.065 208.353 1.00 34.10  ? 322  SER A CA  1 
ATOM   2482  C  C   . SER A  1  322 ? 61.727  290.589 208.999 1.00 31.21  ? 322  SER A C   1 
ATOM   2483  O  O   . SER A  1  322 ? 61.565  290.345 210.154 1.00 34.53  ? 322  SER A O   1 
ATOM   2484  C  CB  . SER A  1  322 ? 64.103  290.971 208.671 1.00 32.71  ? 322  SER A CB  1 
ATOM   2485  O  OG  . SER A  1  322 ? 65.276  290.411 208.130 1.00 34.16  ? 322  SER A OG  1 
ATOM   2486  N  N   . TRP A  1  323 ? 60.874  291.279 208.266 1.00 31.45  ? 323  TRP A N   1 
ATOM   2487  C  CA  . TRP A  1  323 ? 59.547  291.680 208.830 1.00 30.77  ? 323  TRP A CA  1 
ATOM   2488  C  C   . TRP A  1  323 ? 58.673  290.466 208.980 1.00 30.70  ? 323  TRP A C   1 
ATOM   2489  O  O   . TRP A  1  323 ? 57.944  290.366 209.961 1.00 30.97  ? 323  TRP A O   1 
ATOM   2490  C  CB  . TRP A  1  323 ? 58.825  292.713 207.991 1.00 31.65  ? 323  TRP A CB  1 
ATOM   2491  C  CG  . TRP A  1  323 ? 59.508  294.042 208.000 1.00 31.16  ? 323  TRP A CG  1 
ATOM   2492  C  CD1 . TRP A  1  323 ? 60.078  294.666 209.098 1.00 30.94  ? 323  TRP A CD1 1 
ATOM   2493  C  CD2 . TRP A  1  323 ? 59.689  294.911 206.891 1.00 34.36  ? 323  TRP A CD2 1 
ATOM   2494  N  NE1 . TRP A  1  323 ? 60.604  295.851 208.710 1.00 33.94  ? 323  TRP A NE1 1 
ATOM   2495  C  CE2 . TRP A  1  323 ? 60.382  296.046 207.368 1.00 35.35  ? 323  TRP A CE2 1 
ATOM   2496  C  CE3 . TRP A  1  323 ? 59.293  294.857 205.527 1.00 36.28  ? 323  TRP A CE3 1 
ATOM   2497  C  CZ2 . TRP A  1  323 ? 60.731  297.156 206.526 1.00 33.81  ? 323  TRP A CZ2 1 
ATOM   2498  C  CZ3 . TRP A  1  323 ? 59.688  295.932 204.643 1.00 34.53  ? 323  TRP A CZ3 1 
ATOM   2499  C  CH2 . TRP A  1  323 ? 60.387  297.089 205.193 1.00 32.96  ? 323  TRP A CH2 1 
ATOM   2500  N  N   . LEU A  1  324 ? 58.677  289.576 207.990 1.00 30.35  ? 324  LEU A N   1 
ATOM   2501  C  CA  . LEU A  1  324 ? 57.887  288.335 208.184 1.00 32.15  ? 324  LEU A CA  1 
ATOM   2502  C  C   . LEU A  1  324 ? 58.377  287.505 209.421 1.00 31.66  ? 324  LEU A C   1 
ATOM   2503  O  O   . LEU A  1  324 ? 57.585  286.948 210.204 1.00 34.11  ? 324  LEU A O   1 
ATOM   2504  C  CB  . LEU A  1  324 ? 57.987  287.491 206.911 1.00 30.17  ? 324  LEU A CB  1 
ATOM   2505  C  CG  . LEU A  1  324 ? 57.490  288.127 205.585 1.00 37.30  ? 324  LEU A CG  1 
ATOM   2506  C  CD1 . LEU A  1  324 ? 57.507  287.098 204.446 1.00 30.24  ? 324  LEU A CD1 1 
ATOM   2507  C  CD2 . LEU A  1  324 ? 56.201  288.791 205.682 1.00 34.10  ? 324  LEU A CD2 1 
ATOM   2508  N  N   . ALA A  1  325 ? 59.710  287.403 209.543 1.00 31.74  ? 325  ALA A N   1 
ATOM   2509  C  CA  . ALA A  1  325 ? 60.336  286.719 210.633 1.00 29.50  ? 325  ALA A CA  1 
ATOM   2510  C  C   . ALA A  1  325 ? 60.091  287.401 211.926 1.00 28.83  ? 325  ALA A C   1 
ATOM   2511  O  O   . ALA A  1  325 ? 60.077  286.732 212.973 1.00 30.70  ? 325  ALA A O   1 
ATOM   2512  C  CB  . ALA A  1  325 ? 61.884  286.605 210.340 1.00 30.50  ? 325  ALA A CB  1 
ATOM   2513  N  N   . THR A  1  326 ? 59.822  288.703 211.946 1.00 30.67  ? 326  THR A N   1 
ATOM   2514  C  CA  . THR A  1  326 ? 59.500  289.408 213.194 1.00 28.63  ? 326  THR A CA  1 
ATOM   2515  C  C   . THR A  1  326 ? 58.078  288.952 213.576 1.00 32.54  ? 326  THR A C   1 
ATOM   2516  O  O   . THR A  1  326 ? 57.800  288.669 214.781 1.00 32.31  ? 326  THR A O   1 
ATOM   2517  C  CB  . THR A  1  326 ? 59.598  290.946 213.041 1.00 29.38  ? 326  THR A CB  1 
ATOM   2518  O  OG1 . THR A  1  326 ? 60.982  291.168 212.716 1.00 28.63  ? 326  THR A OG1 1 
ATOM   2519  C  CG2 . THR A  1  326 ? 59.281  291.611 214.302 1.00 26.98  ? 326  THR A CG2 1 
ATOM   2520  N  N   . LEU A  1  327 ? 57.220  288.821 212.577 1.00 33.59  ? 327  LEU A N   1 
ATOM   2521  C  CA  . LEU A  1  327 ? 55.767  288.441 212.899 1.00 34.92  ? 327  LEU A CA  1 
ATOM   2522  C  C   . LEU A  1  327 ? 55.684  287.011 213.454 1.00 34.63  ? 327  LEU A C   1 
ATOM   2523  O  O   . LEU A  1  327 ? 54.810  286.710 214.280 1.00 32.98  ? 327  LEU A O   1 
ATOM   2524  C  CB  . LEU A  1  327 ? 54.869  288.417 211.642 1.00 34.63  ? 327  LEU A CB  1 
ATOM   2525  C  CG  . LEU A  1  327 ? 54.612  289.754 210.931 1.00 34.65  ? 327  LEU A CG  1 
ATOM   2526  C  CD1 . LEU A  1  327 ? 54.041  289.511 209.524 1.00 27.23  ? 327  LEU A CD1 1 
ATOM   2527  C  CD2 . LEU A  1  327 ? 53.676  290.707 211.820 1.00 25.57  ? 327  LEU A CD2 1 
ATOM   2528  N  N   . HIS A  1  328 ? 56.596  286.162 212.971 1.00 33.74  ? 328  HIS A N   1 
ATOM   2529  C  CA  . HIS A  1  328 ? 56.653  284.745 213.268 1.00 34.24  ? 328  HIS A CA  1 
ATOM   2530  C  C   . HIS A  1  328 ? 56.725  284.471 214.789 1.00 34.37  ? 328  HIS A C   1 
ATOM   2531  O  O   . HIS A  1  328 ? 57.685  284.923 215.448 1.00 34.08  ? 328  HIS A O   1 
ATOM   2532  C  CB  . HIS A  1  328 ? 57.858  284.114 212.602 1.00 34.10  ? 328  HIS A CB  1 
ATOM   2533  C  CG  . HIS A  1  328 ? 58.041  282.657 212.919 1.00 36.14  ? 328  HIS A CG  1 
ATOM   2534  N  ND1 . HIS A  1  328 ? 57.098  281.690 212.578 1.00 36.99  ? 328  HIS A ND1 1 
ATOM   2535  C  CD2 . HIS A  1  328 ? 59.074  281.993 213.509 1.00 32.46  ? 328  HIS A CD2 1 
ATOM   2536  C  CE1 . HIS A  1  328 ? 57.543  280.497 212.950 1.00 38.07  ? 328  HIS A CE1 1 
ATOM   2537  N  NE2 . HIS A  1  328 ? 58.752  280.656 213.491 1.00 36.99  ? 328  HIS A NE2 1 
ATOM   2538  N  N   . GLY A  1  329 ? 55.647  283.848 215.350 1.00 31.04  ? 329  GLY A N   1 
ATOM   2539  C  CA  . GLY A  1  329 ? 55.666  283.491 216.805 1.00 30.86  ? 329  GLY A CA  1 
ATOM   2540  C  C   . GLY A  1  329 ? 55.148  284.674 217.594 1.00 32.55  ? 329  GLY A C   1 
ATOM   2541  O  O   . GLY A  1  329 ? 55.156  284.678 218.825 1.00 30.84  ? 329  GLY A O   1 
ATOM   2542  N  N   . GLY A  1  330 ? 54.763  285.747 216.905 1.00 31.12  ? 330  GLY A N   1 
ATOM   2543  C  CA  . GLY A  1  330 ? 54.277  286.922 217.689 1.00 31.15  ? 330  GLY A CA  1 
ATOM   2544  C  C   . GLY A  1  330 ? 52.908  286.642 218.282 1.00 32.92  ? 330  GLY A C   1 
ATOM   2545  O  O   . GLY A  1  330 ? 52.089  285.785 217.790 1.00 34.57  ? 330  GLY A O   1 
ATOM   2546  N  N   . ASN A  1  331 ? 52.645  287.370 219.347 1.00 33.55  ? 331  ASN A N   1 
ATOM   2547  C  CA  . ASN A  1  331 ? 51.324  287.460 219.910 1.00 34.97  ? 331  ASN A CA  1 
ATOM   2548  C  C   . ASN A  1  331 ? 50.646  288.624 219.149 1.00 34.41  ? 331  ASN A C   1 
ATOM   2549  O  O   . ASN A  1  331 ? 50.739  289.790 219.547 1.00 38.24  ? 331  ASN A O   1 
ATOM   2550  C  CB  . ASN A  1  331 ? 51.393  287.771 221.447 1.00 30.59  ? 331  ASN A CB  1 
ATOM   2551  C  CG  . ASN A  1  331 ? 49.964  287.993 222.034 1.00 38.97  ? 331  ASN A CG  1 
ATOM   2552  O  OD1 . ASN A  1  331 ? 48.990  287.671 221.362 1.00 37.52  ? 331  ASN A OD1 1 
ATOM   2553  N  ND2 . ASN A  1  331 ? 49.850  288.641 223.194 1.00 38.77  ? 331  ASN A ND2 1 
ATOM   2554  N  N   . ILE A  1  332 ? 49.952  288.318 218.075 1.00 34.93  ? 332  ILE A N   1 
ATOM   2555  C  CA  . ILE A  1  332 ? 49.696  289.345 217.036 1.00 35.31  ? 332  ILE A CA  1 
ATOM   2556  C  C   . ILE A  1  332 ? 48.561  290.159 217.535 1.00 36.05  ? 332  ILE A C   1 
ATOM   2557  O  O   . ILE A  1  332 ? 47.522  289.587 217.878 1.00 35.92  ? 332  ILE A O   1 
ATOM   2558  C  CB  . ILE A  1  332 ? 49.263  288.756 215.624 1.00 34.94  ? 332  ILE A CB  1 
ATOM   2559  C  CG1 . ILE A  1  332 ? 50.307  287.853 214.988 1.00 31.25  ? 332  ILE A CG1 1 
ATOM   2560  C  CG2 . ILE A  1  332 ? 48.717  289.943 214.695 1.00 35.26  ? 332  ILE A CG2 1 
ATOM   2561  C  CD1 . ILE A  1  332 ? 51.844  288.424 214.949 1.00 33.11  ? 332  ILE A CD1 1 
ATOM   2562  N  N   . LYS A  1  333 ? 48.752  291.495 217.612 1.00 36.49  ? 333  LYS A N   1 
ATOM   2563  C  CA  . LYS A  1  333 ? 47.712  292.380 217.991 1.00 36.66  ? 333  LYS A CA  1 
ATOM   2564  C  C   . LYS A  1  333 ? 47.166  293.107 216.699 1.00 37.38  ? 333  LYS A C   1 
ATOM   2565  O  O   . LYS A  1  333 ? 47.915  293.809 216.002 1.00 33.24  ? 333  LYS A O   1 
ATOM   2566  C  CB  . LYS A  1  333 ? 48.262  293.328 219.020 1.00 37.47  ? 333  LYS A CB  1 
ATOM   2567  C  CG  . LYS A  1  333 ? 47.381  294.512 219.267 1.00 40.77  ? 333  LYS A CG  1 
ATOM   2568  C  CD  . LYS A  1  333 ? 46.389  294.382 220.325 1.00 51.57  ? 333  LYS A CD  1 
ATOM   2569  C  CE  . LYS A  1  333 ? 46.365  295.768 221.041 1.00 55.10  ? 333  LYS A CE  1 
ATOM   2570  N  NZ  . LYS A  1  333 ? 46.515  295.710 222.582 1.00 55.19  ? 333  LYS A NZ  1 
ATOM   2571  N  N   . TRP A  1  334 ? 45.876  292.925 216.398 1.00 33.69  ? 334  TRP A N   1 
ATOM   2572  C  CA  . TRP A  1  334 ? 45.281  293.412 215.117 1.00 34.70  ? 334  TRP A CA  1 
ATOM   2573  C  C   . TRP A  1  334 ? 44.790  294.802 215.242 1.00 34.64  ? 334  TRP A C   1 
ATOM   2574  O  O   . TRP A  1  334 ? 43.584  295.045 215.039 1.00 34.70  ? 334  TRP A O   1 
ATOM   2575  C  CB  . TRP A  1  334 ? 44.115  292.506 214.632 1.00 35.21  ? 334  TRP A CB  1 
ATOM   2576  C  CG  . TRP A  1  334 ? 44.586  291.172 214.210 1.00 37.81  ? 334  TRP A CG  1 
ATOM   2577  C  CD1 . TRP A  1  334 ? 44.672  290.055 214.982 1.00 42.86  ? 334  TRP A CD1 1 
ATOM   2578  C  CD2 . TRP A  1  334 ? 45.090  290.808 212.937 1.00 38.31  ? 334  TRP A CD2 1 
ATOM   2579  N  NE1 . TRP A  1  334 ? 45.218  289.030 214.274 1.00 43.15  ? 334  TRP A NE1 1 
ATOM   2580  C  CE2 . TRP A  1  334 ? 45.461  289.457 213.006 1.00 40.23  ? 334  TRP A CE2 1 
ATOM   2581  C  CE3 . TRP A  1  334 ? 45.278  291.517 211.714 1.00 40.31  ? 334  TRP A CE3 1 
ATOM   2582  C  CZ2 . TRP A  1  334 ? 46.007  288.768 211.903 1.00 41.73  ? 334  TRP A CZ2 1 
ATOM   2583  C  CZ3 . TRP A  1  334 ? 45.821  290.833 210.632 1.00 43.31  ? 334  TRP A CZ3 1 
ATOM   2584  C  CH2 . TRP A  1  334 ? 46.169  289.479 210.734 1.00 44.00  ? 334  TRP A CH2 1 
ATOM   2585  N  N   . SER A  1  335 ? 45.689  295.720 215.648 1.00 33.77  ? 335  SER A N   1 
ATOM   2586  C  CA  . SER A  1  335 ? 45.389  297.147 215.753 1.00 32.19  ? 335  SER A CA  1 
ATOM   2587  C  C   . SER A  1  335 ? 45.418  297.731 214.311 1.00 32.38  ? 335  SER A C   1 
ATOM   2588  O  O   . SER A  1  335 ? 45.875  297.107 213.362 1.00 33.72  ? 335  SER A O   1 
ATOM   2589  C  CB  . SER A  1  335 ? 46.509  297.875 216.549 1.00 33.10  ? 335  SER A CB  1 
ATOM   2590  O  OG  . SER A  1  335 ? 47.782  297.613 215.845 1.00 36.76  ? 335  SER A OG  1 
ATOM   2591  N  N   . PRO A  1  336 ? 44.804  298.863 214.150 1.00 31.21  ? 336  PRO A N   1 
ATOM   2592  C  CA  . PRO A  1  336 ? 44.794  299.602 212.912 1.00 30.50  ? 336  PRO A CA  1 
ATOM   2593  C  C   . PRO A  1  336 ? 46.283  299.861 212.472 1.00 31.01  ? 336  PRO A C   1 
ATOM   2594  O  O   . PRO A  1  336 ? 46.557  299.627 211.321 1.00 30.93  ? 336  PRO A O   1 
ATOM   2595  C  CB  . PRO A  1  336 ? 44.123  300.922 213.315 1.00 28.81  ? 336  PRO A CB  1 
ATOM   2596  C  CG  . PRO A  1  336 ? 43.700  300.846 214.780 1.00 28.13  ? 336  PRO A CG  1 
ATOM   2597  C  CD  . PRO A  1  336 ? 44.142  299.556 215.308 1.00 28.09  ? 336  PRO A CD  1 
ATOM   2598  N  N   . ALA A  1  337 ? 47.234  300.241 213.340 1.00 27.44  ? 337  ALA A N   1 
ATOM   2599  C  CA  . ALA A  1  337 ? 48.596  300.394 212.882 1.00 27.81  ? 337  ALA A CA  1 
ATOM   2600  C  C   . ALA A  1  337 ? 49.185  299.093 212.294 1.00 29.88  ? 337  ALA A C   1 
ATOM   2601  O  O   . ALA A  1  337 ? 49.889  299.169 211.270 1.00 28.73  ? 337  ALA A O   1 
ATOM   2602  C  CB  . ALA A  1  337 ? 49.552  301.029 213.955 1.00 26.63  ? 337  ALA A CB  1 
ATOM   2603  N  N   . MET A  1  338 ? 48.907  297.941 212.915 1.00 26.74  ? 338  MET A N   1 
ATOM   2604  C  CA  . MET A  1  338 ? 49.358  296.692 212.349 1.00 27.79  ? 338  MET A CA  1 
ATOM   2605  C  C   . MET A  1  338 ? 48.754  296.438 210.960 1.00 28.05  ? 338  MET A C   1 
ATOM   2606  O  O   . MET A  1  338 ? 49.455  295.973 210.093 1.00 29.17  ? 338  MET A O   1 
ATOM   2607  C  CB  . MET A  1  338 ? 49.090  295.484 213.312 1.00 29.87  ? 338  MET A CB  1 
ATOM   2608  C  CG  . MET A  1  338 ? 49.566  294.058 212.770 1.00 26.63  ? 338  MET A CG  1 
ATOM   2609  S  SD  . MET A  1  338 ? 51.385  294.147 212.635 1.00 30.35  ? 338  MET A SD  1 
ATOM   2610  C  CE  . MET A  1  338 ? 51.666  292.651 213.567 1.00 31.86  ? 338  MET A CE  1 
ATOM   2611  N  N   . MET A  1  339 ? 47.471  296.722 210.744 1.00 24.58  ? 339  MET A N   1 
ATOM   2612  C  CA  . MET A  1  339 ? 46.933  296.516 209.447 1.00 27.23  ? 339  MET A CA  1 
ATOM   2613  C  C   . MET A  1  339 ? 47.678  297.410 208.466 1.00 27.71  ? 339  MET A C   1 
ATOM   2614  O  O   . MET A  1  339 ? 48.013  296.940 207.397 1.00 28.83  ? 339  MET A O   1 
ATOM   2615  C  CB  . MET A  1  339 ? 45.447  296.893 209.503 1.00 23.94  ? 339  MET A CB  1 
ATOM   2616  C  CG  . MET A  1  339 ? 44.737  295.903 210.455 1.00 28.28  ? 339  MET A CG  1 
ATOM   2617  S  SD  . MET A  1  339 ? 42.896  296.311 210.393 1.00 33.37  ? 339  MET A SD  1 
ATOM   2618  C  CE  . MET A  1  339 ? 42.433  295.059 211.682 1.00 31.78  ? 339  MET A CE  1 
ATOM   2619  N  N   . TRP A  1  340 ? 47.991  298.653 208.809 1.00 28.41  ? 340  TRP A N   1 
ATOM   2620  C  CA  . TRP A  1  340 ? 48.636  299.588 207.829 1.00 26.85  ? 340  TRP A CA  1 
ATOM   2621  C  C   . TRP A  1  340 ? 50.001  298.995 207.451 1.00 29.38  ? 340  TRP A C   1 
ATOM   2622  O  O   . TRP A  1  340 ? 50.464  299.095 206.292 1.00 27.41  ? 340  TRP A O   1 
ATOM   2623  C  CB  . TRP A  1  340 ? 48.893  300.981 208.489 1.00 28.68  ? 340  TRP A CB  1 
ATOM   2624  C  CG  . TRP A  1  340 ? 47.670  301.825 208.484 1.00 26.42  ? 340  TRP A CG  1 
ATOM   2625  C  CD1 . TRP A  1  340 ? 46.838  302.112 209.570 1.00 28.24  ? 340  TRP A CD1 1 
ATOM   2626  C  CD2 . TRP A  1  340 ? 47.025  302.400 207.324 1.00 29.42  ? 340  TRP A CD2 1 
ATOM   2627  N  NE1 . TRP A  1  340 ? 45.810  302.885 209.159 1.00 26.44  ? 340  TRP A NE1 1 
ATOM   2628  C  CE2 . TRP A  1  340 ? 45.833  303.006 207.776 1.00 30.34  ? 340  TRP A CE2 1 
ATOM   2629  C  CE3 . TRP A  1  340 ? 47.308  302.391 205.926 1.00 30.53  ? 340  TRP A CE3 1 
ATOM   2630  C  CZ2 . TRP A  1  340 ? 44.965  303.729 206.901 1.00 28.71  ? 340  TRP A CZ2 1 
ATOM   2631  C  CZ3 . TRP A  1  340 ? 46.455  303.130 205.058 1.00 29.26  ? 340  TRP A CZ3 1 
ATOM   2632  C  CH2 . TRP A  1  340 ? 45.275  303.766 205.536 1.00 31.08  ? 340  TRP A CH2 1 
ATOM   2633  N  N   . ALA A  1  341 ? 50.666  298.407 208.446 1.00 26.22  ? 341  ALA A N   1 
ATOM   2634  C  CA  . ALA A  1  341 ? 52.041  297.882 208.231 1.00 28.08  ? 341  ALA A CA  1 
ATOM   2635  C  C   . ALA A  1  341 ? 52.004  296.630 207.396 1.00 28.58  ? 341  ALA A C   1 
ATOM   2636  O  O   . ALA A  1  341 ? 52.906  296.396 206.543 1.00 27.62  ? 341  ALA A O   1 
ATOM   2637  C  CB  . ALA A  1  341 ? 52.750  297.547 209.642 1.00 27.68  ? 341  ALA A CB  1 
ATOM   2638  N  N   . LEU A  1  342 ? 50.956  295.822 207.605 1.00 27.29  ? 342  LEU A N   1 
ATOM   2639  C  CA  . LEU A  1  342 ? 50.813  294.627 206.737 1.00 29.41  ? 342  LEU A CA  1 
ATOM   2640  C  C   . LEU A  1  342 ? 50.458  294.970 205.305 1.00 28.83  ? 342  LEU A C   1 
ATOM   2641  O  O   . LEU A  1  342 ? 50.863  294.258 204.373 1.00 32.11  ? 342  LEU A O   1 
ATOM   2642  C  CB  . LEU A  1  342 ? 49.770  293.672 207.289 1.00 27.42  ? 342  LEU A CB  1 
ATOM   2643  C  CG  . LEU A  1  342 ? 50.107  293.103 208.732 1.00 31.41  ? 342  LEU A CG  1 
ATOM   2644  C  CD1 . LEU A  1  342 ? 48.916  292.377 209.346 1.00 30.35  ? 342  LEU A CD1 1 
ATOM   2645  C  CD2 . LEU A  1  342 ? 51.179  292.154 208.681 1.00 31.24  ? 342  LEU A CD2 1 
ATOM   2646  N  N   . GLY A  1  343 ? 49.545  295.923 205.138 1.00 30.50  ? 343  GLY A N   1 
ATOM   2647  C  CA  . GLY A  1  343 ? 49.212  296.451 203.806 1.00 30.25  ? 343  GLY A CA  1 
ATOM   2648  C  C   . GLY A  1  343 ? 50.440  297.037 203.144 1.00 30.34  ? 343  GLY A C   1 
ATOM   2649  O  O   . GLY A  1  343 ? 50.597  296.882 201.911 1.00 31.10  ? 343  GLY A O   1 
ATOM   2650  N  N   . PHE A  1  344 ? 51.282  297.789 203.903 1.00 28.89  ? 344  PHE A N   1 
ATOM   2651  C  CA  . PHE A  1  344 ? 52.574  298.229 203.444 1.00 27.31  ? 344  PHE A CA  1 
ATOM   2652  C  C   . PHE A  1  344 ? 53.421  297.045 202.887 1.00 28.64  ? 344  PHE A C   1 
ATOM   2653  O  O   . PHE A  1  344 ? 53.967  297.157 201.780 1.00 28.29  ? 344  PHE A O   1 
ATOM   2654  C  CB  . PHE A  1  344 ? 53.399  298.896 204.550 1.00 26.60  ? 344  PHE A CB  1 
ATOM   2655  C  CG  . PHE A  1  344 ? 54.765  299.246 204.103 1.00 26.59  ? 344  PHE A CG  1 
ATOM   2656  C  CD1 . PHE A  1  344 ? 55.778  298.284 204.146 1.00 27.33  ? 344  PHE A CD1 1 
ATOM   2657  C  CD2 . PHE A  1  344 ? 55.094  300.553 203.688 1.00 28.16  ? 344  PHE A CD2 1 
ATOM   2658  C  CE1 . PHE A  1  344 ? 57.142  298.605 203.731 1.00 32.86  ? 344  PHE A CE1 1 
ATOM   2659  C  CE2 . PHE A  1  344 ? 56.427  300.862 203.226 1.00 24.10  ? 344  PHE A CE2 1 
ATOM   2660  C  CZ  . PHE A  1  344 ? 57.419  299.859 203.229 1.00 25.34  ? 344  PHE A CZ  1 
ATOM   2661  N  N   . ILE A  1  345 ? 53.586  295.965 203.667 1.00 28.83  ? 345  ILE A N   1 
ATOM   2662  C  CA  . ILE A  1  345 ? 54.483  294.880 203.275 1.00 30.01  ? 345  ILE A CA  1 
ATOM   2663  C  C   . ILE A  1  345 ? 53.995  294.296 201.929 1.00 32.48  ? 345  ILE A C   1 
ATOM   2664  O  O   . ILE A  1  345 ? 54.772  294.083 200.971 1.00 32.24  ? 345  ILE A O   1 
ATOM   2665  C  CB  . ILE A  1  345 ? 54.523  293.784 204.325 1.00 30.46  ? 345  ILE A CB  1 
ATOM   2666  C  CG1 . ILE A  1  345 ? 55.308  294.269 205.553 1.00 33.96  ? 345  ILE A CG1 1 
ATOM   2667  C  CG2 . ILE A  1  345 ? 55.254  292.553 203.722 1.00 33.49  ? 345  ILE A CG2 1 
ATOM   2668  C  CD1 . ILE A  1  345 ? 55.276  293.333 206.767 1.00 27.80  ? 345  ILE A CD1 1 
ATOM   2669  N  N   . PHE A  1  346 ? 52.695  294.139 201.811 1.00 29.99  ? 346  PHE A N   1 
ATOM   2670  C  CA  . PHE A  1  346 ? 52.140  293.617 200.565 1.00 33.20  ? 346  PHE A CA  1 
ATOM   2671  C  C   . PHE A  1  346 ? 52.232  294.592 199.349 1.00 31.82  ? 346  PHE A C   1 
ATOM   2672  O  O   . PHE A  1  346 ? 52.703  294.210 198.257 1.00 32.18  ? 346  PHE A O   1 
ATOM   2673  C  CB  . PHE A  1  346 ? 50.666  293.301 200.802 1.00 36.64  ? 346  PHE A CB  1 
ATOM   2674  C  CG  . PHE A  1  346 ? 50.019  292.569 199.557 1.00 45.81  ? 346  PHE A CG  1 
ATOM   2675  C  CD1 . PHE A  1  346 ? 50.651  291.415 199.023 1.00 55.42  ? 346  PHE A CD1 1 
ATOM   2676  C  CD2 . PHE A  1  346 ? 48.959  293.121 198.892 1.00 47.63  ? 346  PHE A CD2 1 
ATOM   2677  C  CE1 . PHE A  1  346 ? 50.113  290.772 197.800 1.00 56.98  ? 346  PHE A CE1 1 
ATOM   2678  C  CE2 . PHE A  1  346 ? 48.377  292.492 197.712 1.00 50.34  ? 346  PHE A CE2 1 
ATOM   2679  C  CZ  . PHE A  1  346 ? 48.960  291.355 197.205 1.00 54.71  ? 346  PHE A CZ  1 
ATOM   2680  N  N   . LEU A  1  347 ? 51.827  295.839 199.495 1.00 29.82  ? 347  LEU A N   1 
ATOM   2681  C  CA  . LEU A  1  347 ? 51.916  296.775 198.433 1.00 30.66  ? 347  LEU A CA  1 
ATOM   2682  C  C   . LEU A  1  347 ? 53.400  297.002 198.049 1.00 31.53  ? 347  LEU A C   1 
ATOM   2683  O  O   . LEU A  1  347 ? 53.761  297.196 196.877 1.00 27.98  ? 347  LEU A O   1 
ATOM   2684  C  CB  . LEU A  1  347 ? 51.429  298.103 198.903 1.00 34.03  ? 347  LEU A CB  1 
ATOM   2685  C  CG  . LEU A  1  347 ? 49.962  298.092 199.338 1.00 42.53  ? 347  LEU A CG  1 
ATOM   2686  C  CD1 . LEU A  1  347 ? 49.655  299.594 199.775 1.00 45.09  ? 347  LEU A CD1 1 
ATOM   2687  C  CD2 . LEU A  1  347 ? 49.035  297.562 198.316 1.00 49.60  ? 347  LEU A CD2 1 
ATOM   2688  N  N   . PHE A  1  348 ? 54.266  297.016 199.034 1.00 26.67  ? 348  PHE A N   1 
ATOM   2689  C  CA  . PHE A  1  348 ? 55.672  297.358 198.691 1.00 27.45  ? 348  PHE A CA  1 
ATOM   2690  C  C   . PHE A  1  348 ? 56.242  296.233 197.917 1.00 28.27  ? 348  PHE A C   1 
ATOM   2691  O  O   . PHE A  1  348 ? 56.948  296.438 196.956 1.00 29.87  ? 348  PHE A O   1 
ATOM   2692  C  CB  . PHE A  1  348 ? 56.515  297.559 200.028 1.00 25.95  ? 348  PHE A CB  1 
ATOM   2693  C  CG  . PHE A  1  348 ? 57.947  297.851 199.732 1.00 26.76  ? 348  PHE A CG  1 
ATOM   2694  C  CD1 . PHE A  1  348 ? 58.900  296.827 199.835 1.00 29.98  ? 348  PHE A CD1 1 
ATOM   2695  C  CD2 . PHE A  1  348 ? 58.328  299.145 199.351 1.00 27.16  ? 348  PHE A CD2 1 
ATOM   2696  C  CE1 . PHE A  1  348 ? 60.319  297.110 199.560 1.00 30.99  ? 348  PHE A CE1 1 
ATOM   2697  C  CE2 . PHE A  1  348 ? 59.705  299.397 199.018 1.00 31.64  ? 348  PHE A CE2 1 
ATOM   2698  C  CZ  . PHE A  1  348 ? 60.660  298.352 199.120 1.00 32.34  ? 348  PHE A CZ  1 
ATOM   2699  N  N   . THR A  1  349 ? 55.898  294.970 198.265 1.00 28.67  ? 349  THR A N   1 
ATOM   2700  C  CA  . THR A  1  349 ? 56.355  293.840 197.533 1.00 32.59  ? 349  THR A CA  1 
ATOM   2701  C  C   . THR A  1  349 ? 55.864  293.862 196.061 1.00 32.67  ? 349  THR A C   1 
ATOM   2702  O  O   . THR A  1  349 ? 56.616  293.574 195.166 1.00 34.66  ? 349  THR A O   1 
ATOM   2703  C  CB  . THR A  1  349 ? 55.899  292.505 198.251 1.00 35.44  ? 349  THR A CB  1 
ATOM   2704  O  OG1 . THR A  1  349 ? 56.535  292.479 199.523 1.00 36.15  ? 349  THR A OG1 1 
ATOM   2705  C  CG2 . THR A  1  349 ? 56.242  291.262 197.427 1.00 36.16  ? 349  THR A CG2 1 
ATOM   2706  N  N   . VAL A  1  350 ? 54.612  294.111 195.843 1.00 30.06  ? 350  VAL A N   1 
ATOM   2707  C  CA  . VAL A  1  350 ? 54.046  294.196 194.516 1.00 32.61  ? 350  VAL A CA  1 
ATOM   2708  C  C   . VAL A  1  350 ? 54.873  295.222 193.682 1.00 31.84  ? 350  VAL A C   1 
ATOM   2709  O  O   . VAL A  1  350 ? 55.387  294.855 192.579 1.00 30.00  ? 350  VAL A O   1 
ATOM   2710  C  CB  . VAL A  1  350 ? 52.574  294.619 194.549 1.00 30.22  ? 350  VAL A CB  1 
ATOM   2711  C  CG1 . VAL A  1  350 ? 52.127  294.832 193.117 1.00 30.00  ? 350  VAL A CG1 1 
ATOM   2712  C  CG2 . VAL A  1  350 ? 51.683  293.494 195.128 1.00 33.14  ? 350  VAL A CG2 1 
ATOM   2713  N  N   . GLY A  1  351 ? 55.034  296.444 194.240 1.00 28.80  ? 351  GLY A N   1 
ATOM   2714  C  CA  . GLY A  1  351 ? 55.680  297.528 193.519 1.00 28.75  ? 351  GLY A CA  1 
ATOM   2715  C  C   . GLY A  1  351 ? 57.131  297.206 193.331 1.00 32.45  ? 351  GLY A C   1 
ATOM   2716  O  O   . GLY A  1  351 ? 57.704  297.505 192.278 1.00 28.30  ? 351  GLY A O   1 
ATOM   2717  N  N   . GLY A  1  352 ? 57.790  296.590 194.330 1.00 31.08  ? 352  GLY A N   1 
ATOM   2718  C  CA  . GLY A  1  352 ? 59.281  296.235 194.098 1.00 31.64  ? 352  GLY A CA  1 
ATOM   2719  C  C   . GLY A  1  352 ? 59.372  295.152 193.017 1.00 33.76  ? 352  GLY A C   1 
ATOM   2720  O  O   . GLY A  1  352 ? 60.343  295.124 192.189 1.00 33.64  ? 352  GLY A O   1 
ATOM   2721  N  N   . LEU A  1  353 ? 58.362  294.289 192.910 1.00 31.47  ? 353  LEU A N   1 
ATOM   2722  C  CA  . LEU A  1  353 ? 58.520  293.237 191.930 1.00 32.02  ? 353  LEU A CA  1 
ATOM   2723  C  C   . LEU A  1  353 ? 58.300  293.793 190.437 1.00 35.05  ? 353  LEU A C   1 
ATOM   2724  O  O   . LEU A  1  353 ? 58.978  293.319 189.504 1.00 35.80  ? 353  LEU A O   1 
ATOM   2725  C  CB  . LEU A  1  353 ? 57.591  292.071 192.166 1.00 35.03  ? 353  LEU A CB  1 
ATOM   2726  C  CG  . LEU A  1  353 ? 58.125  291.175 193.364 1.00 37.09  ? 353  LEU A CG  1 
ATOM   2727  C  CD1 . LEU A  1  353 ? 57.000  290.277 193.659 1.00 30.65  ? 353  LEU A CD1 1 
ATOM   2728  C  CD2 . LEU A  1  353 ? 59.470  290.450 193.066 1.00 33.60  ? 353  LEU A CD2 1 
ATOM   2729  N  N   . THR A  1  354 ? 57.375  294.762 190.248 1.00 29.61  ? 354  THR A N   1 
ATOM   2730  C  CA  . THR A  1  354 ? 57.250  295.465 188.911 1.00 30.25  ? 354  THR A CA  1 
ATOM   2731  C  C   . THR A  1  354 ? 58.510  296.286 188.696 1.00 30.90  ? 354  THR A C   1 
ATOM   2732  O  O   . THR A  1  354 ? 58.940  296.452 187.574 1.00 33.78  ? 354  THR A O   1 
ATOM   2733  C  CB  . THR A  1  354 ? 55.950  296.279 188.804 1.00 26.30  ? 354  THR A CB  1 
ATOM   2734  O  OG1 . THR A  1  354 ? 55.988  297.234 189.895 1.00 27.13  ? 354  THR A OG1 1 
ATOM   2735  C  CG2 . THR A  1  354 ? 54.761  295.303 189.029 1.00 26.20  ? 354  THR A CG2 1 
ATOM   2736  N  N   . GLY A  1  355 ? 59.127  296.822 189.732 1.00 29.54  ? 355  GLY A N   1 
ATOM   2737  C  CA  . GLY A  1  355 ? 60.484  297.436 189.580 1.00 29.86  ? 355  GLY A CA  1 
ATOM   2738  C  C   . GLY A  1  355 ? 61.432  296.419 188.925 1.00 35.16  ? 355  GLY A C   1 
ATOM   2739  O  O   . GLY A  1  355 ? 62.259  296.740 187.988 1.00 35.82  ? 355  GLY A O   1 
ATOM   2740  N  N   . ILE A  1  356 ? 61.393  295.186 189.390 1.00 37.42  ? 356  ILE A N   1 
ATOM   2741  C  CA  . ILE A  1  356 ? 62.299  294.175 188.836 1.00 38.28  ? 356  ILE A CA  1 
ATOM   2742  C  C   . ILE A  1  356 ? 62.019  293.914 187.328 1.00 38.78  ? 356  ILE A C   1 
ATOM   2743  O  O   . ILE A  1  356 ? 62.991  293.719 186.556 1.00 38.15  ? 356  ILE A O   1 
ATOM   2744  C  CB  . ILE A  1  356 ? 62.367  292.893 189.725 1.00 40.64  ? 356  ILE A CB  1 
ATOM   2745  C  CG1 . ILE A  1  356 ? 63.047  293.239 191.115 1.00 41.35  ? 356  ILE A CG1 1 
ATOM   2746  C  CG2 . ILE A  1  356 ? 63.009  291.656 189.019 1.00 41.25  ? 356  ILE A CG2 1 
ATOM   2747  C  CD1 . ILE A  1  356 ? 64.638  293.813 191.109 1.00 51.75  ? 356  ILE A CD1 1 
ATOM   2748  N  N   . VAL A  1  357 ? 60.727  293.909 186.917 1.00 37.05  ? 357  VAL A N   1 
ATOM   2749  C  CA  . VAL A  1  357 ? 60.432  293.827 185.502 1.00 36.00  ? 357  VAL A CA  1 
ATOM   2750  C  C   . VAL A  1  357 ? 61.136  294.966 184.766 1.00 35.59  ? 357  VAL A C   1 
ATOM   2751  O  O   . VAL A  1  357 ? 61.825  294.712 183.798 1.00 37.09  ? 357  VAL A O   1 
ATOM   2752  C  CB  . VAL A  1  357 ? 58.959  293.846 185.270 1.00 36.41  ? 357  VAL A CB  1 
ATOM   2753  C  CG1 . VAL A  1  357 ? 58.689  293.732 183.813 1.00 34.16  ? 357  VAL A CG1 1 
ATOM   2754  C  CG2 . VAL A  1  357 ? 58.331  292.722 186.080 1.00 31.21  ? 357  VAL A CG2 1 
ATOM   2755  N  N   . LEU A  1  358 ? 61.069  296.171 185.310 1.00 31.58  ? 358  LEU A N   1 
ATOM   2756  C  CA  . LEU A  1  358 ? 61.578  297.357 184.692 1.00 33.24  ? 358  LEU A CA  1 
ATOM   2757  C  C   . LEU A  1  358 ? 63.142  297.402 184.602 1.00 37.32  ? 358  LEU A C   1 
ATOM   2758  O  O   . LEU A  1  358 ? 63.701  298.112 183.736 1.00 37.37  ? 358  LEU A O   1 
ATOM   2759  C  CB  . LEU A  1  358 ? 61.070  298.613 185.368 1.00 29.71  ? 358  LEU A CB  1 
ATOM   2760  C  CG  . LEU A  1  358 ? 59.532  298.878 185.132 1.00 26.56  ? 358  LEU A CG  1 
ATOM   2761  C  CD1 . LEU A  1  358 ? 59.085  299.798 186.224 1.00 21.58  ? 358  LEU A CD1 1 
ATOM   2762  C  CD2 . LEU A  1  358 ? 59.290  299.551 183.660 1.00 24.93  ? 358  LEU A CD2 1 
ATOM   2763  N  N   . ALA A  1  359 ? 63.802  296.641 185.459 1.00 36.34  ? 359  ALA A N   1 
ATOM   2764  C  CA  . ALA A  1  359 ? 65.262  296.756 185.627 1.00 37.47  ? 359  ALA A CA  1 
ATOM   2765  C  C   . ALA A  1  359 ? 65.869  296.269 184.324 1.00 35.52  ? 359  ALA A C   1 
ATOM   2766  O  O   . ALA A  1  359 ? 66.916  296.675 183.967 1.00 35.97  ? 359  ALA A O   1 
ATOM   2767  C  CB  . ALA A  1  359 ? 65.773  295.739 186.784 1.00 35.52  ? 359  ALA A CB  1 
ATOM   2768  N  N   . ASN A  1  360 ? 65.164  295.370 183.655 1.00 32.20  ? 360  ASN A N   1 
ATOM   2769  C  CA  . ASN A  1  360 ? 65.594  294.823 182.402 1.00 33.98  ? 360  ASN A CA  1 
ATOM   2770  C  C   . ASN A  1  360 ? 65.524  295.809 181.289 1.00 32.46  ? 360  ASN A C   1 
ATOM   2771  O  O   . ASN A  1  360 ? 64.368  296.076 180.858 1.00 31.71  ? 360  ASN A O   1 
ATOM   2772  C  CB  . ASN A  1  360 ? 64.684  293.632 182.160 1.00 34.36  ? 360  ASN A CB  1 
ATOM   2773  C  CG  . ASN A  1  360 ? 64.874  292.648 183.270 1.00 39.02  ? 360  ASN A CG  1 
ATOM   2774  O  OD1 . ASN A  1  360 ? 66.004  292.063 183.425 1.00 40.18  ? 360  ASN A OD1 1 
ATOM   2775  N  ND2 . ASN A  1  360 ? 63.822  292.472 184.100 1.00 40.36  ? 360  ASN A ND2 1 
ATOM   2776  N  N   . SER A  1  361 ? 66.674  296.411 180.921 1.00 30.95  ? 361  SER A N   1 
ATOM   2777  C  CA  . SER A  1  361 ? 66.571  297.573 179.996 1.00 34.63  ? 361  SER A CA  1 
ATOM   2778  C  C   . SER A  1  361 ? 65.840  297.196 178.702 1.00 33.14  ? 361  SER A C   1 
ATOM   2779  O  O   . SER A  1  361 ? 65.117  298.026 178.158 1.00 34.69  ? 361  SER A O   1 
ATOM   2780  C  CB  . SER A  1  361 ? 67.907  298.171 179.534 1.00 34.04  ? 361  SER A CB  1 
ATOM   2781  O  OG  . SER A  1  361 ? 68.661  297.222 178.848 1.00 40.83  ? 361  SER A OG  1 
ATOM   2782  N  N   . SER A  1  362 ? 66.009  295.968 178.215 1.00 32.08  ? 362  SER A N   1 
ATOM   2783  C  CA  . SER A  1  362 ? 65.290  295.550 177.004 1.00 33.45  ? 362  SER A CA  1 
ATOM   2784  C  C   . SER A  1  362 ? 63.789  295.606 177.166 1.00 33.30  ? 362  SER A C   1 
ATOM   2785  O  O   . SER A  1  362 ? 63.079  296.062 176.232 1.00 31.82  ? 362  SER A O   1 
ATOM   2786  C  CB  . SER A  1  362 ? 65.625  294.077 176.627 1.00 35.38  ? 362  SER A CB  1 
ATOM   2787  O  OG  . SER A  1  362 ? 67.028  293.964 176.431 1.00 40.83  ? 362  SER A OG  1 
ATOM   2788  N  N   . LEU A  1  363 ? 63.240  295.176 178.305 1.00 31.57  ? 363  LEU A N   1 
ATOM   2789  C  CA  . LEU A  1  363 ? 61.780  295.362 178.472 1.00 30.56  ? 363  LEU A CA  1 
ATOM   2790  C  C   . LEU A  1  363 ? 61.436  296.820 178.801 1.00 32.80  ? 363  LEU A C   1 
ATOM   2791  O  O   . LEU A  1  363 ? 60.314  297.298 178.493 1.00 33.95  ? 363  LEU A O   1 
ATOM   2792  C  CB  . LEU A  1  363 ? 61.238  294.550 179.669 1.00 32.96  ? 363  LEU A CB  1 
ATOM   2793  C  CG  . LEU A  1  363 ? 61.014  293.083 179.532 1.00 36.93  ? 363  LEU A CG  1 
ATOM   2794  C  CD1 . LEU A  1  363 ? 60.505  292.487 180.839 1.00 37.41  ? 363  LEU A CD1 1 
ATOM   2795  C  CD2 . LEU A  1  363 ? 60.015  292.818 178.376 1.00 36.27  ? 363  LEU A CD2 1 
ATOM   2796  N  N   . ASP A  1  364 ? 62.366  297.525 179.459 1.00 29.48  ? 364  ASP A N   1 
ATOM   2797  C  CA  . ASP A  1  364 ? 62.032  298.910 179.817 1.00 31.65  ? 364  ASP A CA  1 
ATOM   2798  C  C   . ASP A  1  364 ? 61.882  299.788 178.553 1.00 31.10  ? 364  ASP A C   1 
ATOM   2799  O  O   . ASP A  1  364 ? 61.179  300.882 178.557 1.00 30.81  ? 364  ASP A O   1 
ATOM   2800  C  CB  . ASP A  1  364 ? 63.171  299.504 180.643 1.00 29.23  ? 364  ASP A CB  1 
ATOM   2801  C  CG  . ASP A  1  364 ? 62.820  300.938 181.120 1.00 35.52  ? 364  ASP A CG  1 
ATOM   2802  O  OD1 . ASP A  1  364 ? 63.455  301.946 180.699 1.00 28.82  ? 364  ASP A OD1 1 
ATOM   2803  O  OD2 . ASP A  1  364 ? 61.856  301.053 181.888 1.00 29.40  ? 364  ASP A OD2 1 
ATOM   2804  N  N   . ILE A  1  365 ? 62.576  299.406 177.455 1.00 30.92  ? 365  ILE A N   1 
ATOM   2805  C  CA  . ILE A  1  365 ? 62.427  300.209 176.188 1.00 28.30  ? 365  ILE A CA  1 
ATOM   2806  C  C   . ILE A  1  365 ? 60.923  300.253 175.946 1.00 29.51  ? 365  ILE A C   1 
ATOM   2807  O  O   . ILE A  1  365 ? 60.305  301.316 175.653 1.00 28.80  ? 365  ILE A O   1 
ATOM   2808  C  CB  . ILE A  1  365 ? 63.148  299.533 174.982 1.00 30.72  ? 365  ILE A CB  1 
ATOM   2809  C  CG1 . ILE A  1  365 ? 64.702  299.422 175.161 1.00 33.37  ? 365  ILE A CG1 1 
ATOM   2810  C  CG2 . ILE A  1  365 ? 62.857  300.350 173.604 1.00 31.25  ? 365  ILE A CG2 1 
ATOM   2811  C  CD1 . ILE A  1  365 ? 65.268  300.654 175.661 1.00 32.85  ? 365  ILE A CD1 1 
ATOM   2812  N  N   . VAL A  1  366 ? 60.243  299.110 176.113 1.00 26.17  ? 366  VAL A N   1 
ATOM   2813  C  CA  . VAL A  1  366 ? 58.811  299.200 175.782 1.00 28.74  ? 366  VAL A CA  1 
ATOM   2814  C  C   . VAL A  1  366 ? 57.944  299.729 176.922 1.00 30.04  ? 366  VAL A C   1 
ATOM   2815  O  O   . VAL A  1  366 ? 56.821  300.202 176.691 1.00 30.86  ? 366  VAL A O   1 
ATOM   2816  C  CB  . VAL A  1  366 ? 58.262  297.726 175.408 1.00 30.94  ? 366  VAL A CB  1 
ATOM   2817  C  CG1 . VAL A  1  366 ? 56.773  297.796 174.918 1.00 31.88  ? 366  VAL A CG1 1 
ATOM   2818  C  CG2 . VAL A  1  366 ? 59.145  297.230 174.297 1.00 35.60  ? 366  VAL A CG2 1 
ATOM   2819  N  N   . LEU A  1  367 ? 58.439  299.664 178.186 1.00 28.23  ? 367  LEU A N   1 
ATOM   2820  C  CA  . LEU A  1  367 ? 57.559  300.070 179.329 1.00 28.59  ? 367  LEU A CA  1 
ATOM   2821  C  C   . LEU A  1  367 ? 57.822  301.478 179.759 1.00 27.80  ? 367  LEU A C   1 
ATOM   2822  O  O   . LEU A  1  367 ? 57.052  302.056 180.473 1.00 30.24  ? 367  LEU A O   1 
ATOM   2823  C  CB  . LEU A  1  367 ? 57.747  299.103 180.525 1.00 21.84  ? 367  LEU A CB  1 
ATOM   2824  C  CG  . LEU A  1  367 ? 57.291  297.725 180.094 1.00 27.29  ? 367  LEU A CG  1 
ATOM   2825  C  CD1 . LEU A  1  367 ? 57.610  296.671 181.269 1.00 29.16  ? 367  LEU A CD1 1 
ATOM   2826  C  CD2 . LEU A  1  367 ? 55.776  297.640 179.866 1.00 22.05  ? 367  LEU A CD2 1 
ATOM   2827  N  N   . HIS A  1  368 ? 58.920  302.036 179.304 1.00 26.08  ? 368  HIS A N   1 
ATOM   2828  C  CA  . HIS A  1  368 ? 59.340  303.335 179.759 1.00 27.46  ? 368  HIS A CA  1 
ATOM   2829  C  C   . HIS A  1  368 ? 58.337  304.391 179.330 1.00 27.69  ? 368  HIS A C   1 
ATOM   2830  O  O   . HIS A  1  368 ? 57.876  304.351 178.164 1.00 26.75  ? 368  HIS A O   1 
ATOM   2831  C  CB  . HIS A  1  368 ? 60.755  303.790 179.130 1.00 24.56  ? 368  HIS A CB  1 
ATOM   2832  C  CG  . HIS A  1  368 ? 61.083  305.227 179.451 1.00 27.02  ? 368  HIS A CG  1 
ATOM   2833  N  ND1 . HIS A  1  368 ? 61.458  305.605 180.714 1.00 24.64  ? 368  HIS A ND1 1 
ATOM   2834  C  CD2 . HIS A  1  368 ? 61.142  306.373 178.676 1.00 26.26  ? 368  HIS A CD2 1 
ATOM   2835  C  CE1 . HIS A  1  368 ? 61.717  306.926 180.719 1.00 27.98  ? 368  HIS A CE1 1 
ATOM   2836  N  NE2 . HIS A  1  368 ? 61.488  307.428 179.507 1.00 25.30  ? 368  HIS A NE2 1 
ATOM   2837  N  N   . ASP A  1  369 ? 58.094  305.398 180.174 1.00 27.50  ? 369  ASP A N   1 
ATOM   2838  C  CA  . ASP A  1  369 ? 57.132  306.400 179.751 1.00 28.11  ? 369  ASP A CA  1 
ATOM   2839  C  C   . ASP A  1  369 ? 55.751  305.874 179.445 1.00 27.19  ? 369  ASP A C   1 
ATOM   2840  O  O   . ASP A  1  369 ? 54.993  306.468 178.645 1.00 27.89  ? 369  ASP A O   1 
ATOM   2841  C  CB  . ASP A  1  369 ? 57.707  307.360 178.627 1.00 27.24  ? 369  ASP A CB  1 
ATOM   2842  C  CG  . ASP A  1  369 ? 57.882  308.832 179.170 1.00 28.27  ? 369  ASP A CG  1 
ATOM   2843  O  OD1 . ASP A  1  369 ? 58.988  309.308 179.298 1.00 25.62  ? 369  ASP A OD1 1 
ATOM   2844  O  OD2 . ASP A  1  369 ? 56.901  309.587 179.474 1.00 29.83  ? 369  ASP A OD2 1 
ATOM   2845  N  N   . THR A  1  370 ? 55.390  304.822 180.144 1.00 27.65  ? 370  THR A N   1 
ATOM   2846  C  CA  . THR A  1  370 ? 53.993  304.274 180.053 1.00 26.57  ? 370  THR A CA  1 
ATOM   2847  C  C   . THR A  1  370 ? 53.445  304.123 181.480 1.00 27.61  ? 370  THR A C   1 
ATOM   2848  O  O   . THR A  1  370 ? 54.159  304.286 182.436 1.00 25.75  ? 370  THR A O   1 
ATOM   2849  C  CB  . THR A  1  370 ? 53.877  302.824 179.452 1.00 27.48  ? 370  THR A CB  1 
ATOM   2850  O  OG1 . THR A  1  370 ? 54.347  301.841 180.440 1.00 25.17  ? 370  THR A OG1 1 
ATOM   2851  C  CG2 . THR A  1  370 ? 54.629  302.665 178.102 1.00 22.53  ? 370  THR A CG2 1 
ATOM   2852  N  N   . TYR A  1  371 ? 52.138  303.829 181.594 1.00 27.08  ? 371  TYR A N   1 
ATOM   2853  C  CA  . TYR A  1  371 ? 51.531  303.686 182.855 1.00 27.26  ? 371  TYR A CA  1 
ATOM   2854  C  C   . TYR A  1  371 ? 52.126  302.493 183.661 1.00 30.06  ? 371  TYR A C   1 
ATOM   2855  O  O   . TYR A  1  371 ? 51.829  302.353 184.888 1.00 31.25  ? 371  TYR A O   1 
ATOM   2856  C  CB  . TYR A  1  371 ? 49.999  303.520 182.667 1.00 25.79  ? 371  TYR A CB  1 
ATOM   2857  C  CG  . TYR A  1  371 ? 49.409  304.804 182.988 1.00 25.99  ? 371  TYR A CG  1 
ATOM   2858  C  CD1 . TYR A  1  371 ? 49.080  305.153 184.325 1.00 23.21  ? 371  TYR A CD1 1 
ATOM   2859  C  CD2 . TYR A  1  371 ? 49.377  305.792 182.031 1.00 27.15  ? 371  TYR A CD2 1 
ATOM   2860  C  CE1 . TYR A  1  371 ? 48.595  306.511 184.675 1.00 24.45  ? 371  TYR A CE1 1 
ATOM   2861  C  CE2 . TYR A  1  371 ? 48.856  307.120 182.352 1.00 32.46  ? 371  TYR A CE2 1 
ATOM   2862  C  CZ  . TYR A  1  371 ? 48.416  307.430 183.634 1.00 27.84  ? 371  TYR A CZ  1 
ATOM   2863  O  OH  . TYR A  1  371 ? 47.942  308.752 183.842 1.00 27.27  ? 371  TYR A OH  1 
ATOM   2864  N  N   . TYR A  1  372 ? 52.933  301.604 183.046 1.00 29.12  ? 372  TYR A N   1 
ATOM   2865  C  CA  . TYR A  1  372 ? 53.484  300.484 183.848 1.00 28.54  ? 372  TYR A CA  1 
ATOM   2866  C  C   . TYR A  1  372 ? 54.415  301.121 184.934 1.00 29.19  ? 372  TYR A C   1 
ATOM   2867  O  O   . TYR A  1  372 ? 54.521  300.576 186.016 1.00 27.46  ? 372  TYR A O   1 
ATOM   2868  C  CB  . TYR A  1  372 ? 54.306  299.482 183.053 1.00 26.34  ? 372  TYR A CB  1 
ATOM   2869  C  CG  . TYR A  1  372 ? 54.606  298.175 183.745 1.00 26.46  ? 372  TYR A CG  1 
ATOM   2870  C  CD1 . TYR A  1  372 ? 55.805  297.969 184.448 1.00 30.47  ? 372  TYR A CD1 1 
ATOM   2871  C  CD2 . TYR A  1  372 ? 53.724  297.109 183.624 1.00 25.49  ? 372  TYR A CD2 1 
ATOM   2872  C  CE1 . TYR A  1  372 ? 56.109  296.702 185.061 1.00 24.73  ? 372  TYR A CE1 1 
ATOM   2873  C  CE2 . TYR A  1  372 ? 53.970  295.857 184.277 1.00 28.70  ? 372  TYR A CE2 1 
ATOM   2874  C  CZ  . TYR A  1  372 ? 55.183  295.664 184.942 1.00 31.51  ? 372  TYR A CZ  1 
ATOM   2875  O  OH  . TYR A  1  372 ? 55.420  294.466 185.542 1.00 28.00  ? 372  TYR A OH  1 
ATOM   2876  N  N   . VAL A  1  373 ? 55.127  302.164 184.567 1.00 27.41  ? 373  VAL A N   1 
ATOM   2877  C  CA  . VAL A  1  373 ? 56.037  302.895 185.516 1.00 28.28  ? 373  VAL A CA  1 
ATOM   2878  C  C   . VAL A  1  373 ? 55.219  303.645 186.578 1.00 28.65  ? 373  VAL A C   1 
ATOM   2879  O  O   . VAL A  1  373 ? 55.584  303.627 187.684 1.00 27.41  ? 373  VAL A O   1 
ATOM   2880  C  CB  . VAL A  1  373 ? 56.956  303.912 184.778 1.00 29.21  ? 373  VAL A CB  1 
ATOM   2881  C  CG1 . VAL A  1  373 ? 57.944  304.657 185.740 1.00 28.21  ? 373  VAL A CG1 1 
ATOM   2882  C  CG2 . VAL A  1  373 ? 57.757  303.068 183.641 1.00 25.36  ? 373  VAL A CG2 1 
ATOM   2883  N  N   . VAL A  1  374 ? 54.082  304.258 186.205 1.00 28.48  ? 374  VAL A N   1 
ATOM   2884  C  CA  . VAL A  1  374 ? 53.267  304.951 187.141 1.00 27.73  ? 374  VAL A CA  1 
ATOM   2885  C  C   . VAL A  1  374 ? 52.738  303.925 188.132 1.00 28.57  ? 374  VAL A C   1 
ATOM   2886  O  O   . VAL A  1  374 ? 52.724  304.233 189.353 1.00 29.21  ? 374  VAL A O   1 
ATOM   2887  C  CB  . VAL A  1  374 ? 52.131  305.656 186.442 1.00 28.59  ? 374  VAL A CB  1 
ATOM   2888  C  CG1 . VAL A  1  374 ? 51.257  306.368 187.415 1.00 26.51  ? 374  VAL A CG1 1 
ATOM   2889  C  CG2 . VAL A  1  374 ? 52.727  306.633 185.365 1.00 22.84  ? 374  VAL A CG2 1 
ATOM   2890  N  N   . ALA A  1  375 ? 52.424  302.686 187.671 1.00 26.98  ? 375  ALA A N   1 
ATOM   2891  C  CA  . ALA A  1  375 ? 51.893  301.628 188.526 1.00 28.50  ? 375  ALA A CA  1 
ATOM   2892  C  C   . ALA A  1  375 ? 53.032  301.159 189.474 1.00 28.15  ? 375  ALA A C   1 
ATOM   2893  O  O   . ALA A  1  375 ? 52.808  301.073 190.635 1.00 28.97  ? 375  ALA A O   1 
ATOM   2894  C  CB  . ALA A  1  375 ? 51.280  300.469 187.755 1.00 28.23  ? 375  ALA A CB  1 
ATOM   2895  N  N   . HIS A  1  376 ? 54.195  300.823 188.972 1.00 26.81  ? 376  HIS A N   1 
ATOM   2896  C  CA  . HIS A  1  376 ? 55.363  300.554 189.825 1.00 25.72  ? 376  HIS A CA  1 
ATOM   2897  C  C   . HIS A  1  376 ? 55.464  301.509 190.952 1.00 27.72  ? 376  HIS A C   1 
ATOM   2898  O  O   . HIS A  1  376 ? 55.481  301.062 192.177 1.00 26.16  ? 376  HIS A O   1 
ATOM   2899  C  CB  . HIS A  1  376 ? 56.658  300.667 189.012 1.00 26.28  ? 376  HIS A CB  1 
ATOM   2900  C  CG  . HIS A  1  376 ? 57.923  300.751 189.817 1.00 30.37  ? 376  HIS A CG  1 
ATOM   2901  N  ND1 . HIS A  1  376 ? 58.351  299.746 190.696 1.00 31.54  ? 376  HIS A ND1 1 
ATOM   2902  C  CD2 . HIS A  1  376 ? 58.885  301.721 189.847 1.00 31.05  ? 376  HIS A CD2 1 
ATOM   2903  C  CE1 . HIS A  1  376 ? 59.509  300.125 191.232 1.00 36.85  ? 376  HIS A CE1 1 
ATOM   2904  N  NE2 . HIS A  1  376 ? 59.822  301.336 190.777 1.00 32.18  ? 376  HIS A NE2 1 
ATOM   2905  N  N   . PHE A  1  377 ? 55.580  302.813 190.625 1.00 25.54  ? 377  PHE A N   1 
ATOM   2906  C  CA  . PHE A  1  377 ? 55.899  303.692 191.756 1.00 26.44  ? 377  PHE A CA  1 
ATOM   2907  C  C   . PHE A  1  377 ? 54.765  304.100 192.618 1.00 26.20  ? 377  PHE A C   1 
ATOM   2908  O  O   . PHE A  1  377 ? 55.023  304.470 193.794 1.00 26.23  ? 377  PHE A O   1 
ATOM   2909  C  CB  . PHE A  1  377 ? 56.815  304.892 191.433 1.00 26.97  ? 377  PHE A CB  1 
ATOM   2910  C  CG  . PHE A  1  377 ? 56.204  305.959 190.549 1.00 29.10  ? 377  PHE A CG  1 
ATOM   2911  C  CD1 . PHE A  1  377 ? 56.510  305.985 189.137 1.00 23.76  ? 377  PHE A CD1 1 
ATOM   2912  C  CD2 . PHE A  1  377 ? 55.366  306.995 191.107 1.00 26.92  ? 377  PHE A CD2 1 
ATOM   2913  C  CE1 . PHE A  1  377 ? 55.997  307.047 188.399 1.00 24.87  ? 377  PHE A CE1 1 
ATOM   2914  C  CE2 . PHE A  1  377 ? 54.793  307.925 190.364 1.00 32.18  ? 377  PHE A CE2 1 
ATOM   2915  C  CZ  . PHE A  1  377 ? 55.122  307.999 188.955 1.00 31.39  ? 377  PHE A CZ  1 
ATOM   2916  N  N   . HIS A  1  378 ? 53.495  304.086 192.151 1.00 25.98  ? 378  HIS A N   1 
ATOM   2917  C  CA  . HIS A  1  378 ? 52.415  304.321 193.103 1.00 26.30  ? 378  HIS A CA  1 
ATOM   2918  C  C   . HIS A  1  378 ? 52.242  303.145 194.083 1.00 28.52  ? 378  HIS A C   1 
ATOM   2919  O  O   . HIS A  1  378 ? 51.706  303.337 195.196 1.00 27.95  ? 378  HIS A O   1 
ATOM   2920  C  CB  . HIS A  1  378 ? 51.107  304.756 192.432 1.00 23.15  ? 378  HIS A CB  1 
ATOM   2921  C  CG  . HIS A  1  378 ? 51.135  306.197 191.981 1.00 26.84  ? 378  HIS A CG  1 
ATOM   2922  N  ND1 . HIS A  1  378 ? 51.683  306.604 190.763 1.00 27.27  ? 378  HIS A ND1 1 
ATOM   2923  C  CD2 . HIS A  1  378 ? 50.749  307.332 192.617 1.00 25.68  ? 378  HIS A CD2 1 
ATOM   2924  C  CE1 . HIS A  1  378 ? 51.520  307.918 190.630 1.00 31.97  ? 378  HIS A CE1 1 
ATOM   2925  N  NE2 . HIS A  1  378 ? 50.988  308.396 191.759 1.00 26.27  ? 378  HIS A NE2 1 
ATOM   2926  N  N   . TYR A  1  379 ? 52.648  301.938 193.690 1.00 25.23  ? 379  TYR A N   1 
ATOM   2927  C  CA  . TYR A  1  379 ? 52.675  300.792 194.670 1.00 27.71  ? 379  TYR A CA  1 
ATOM   2928  C  C   . TYR A  1  379 ? 53.837  300.973 195.631 1.00 30.76  ? 379  TYR A C   1 
ATOM   2929  O  O   . TYR A  1  379 ? 53.615  301.023 196.838 1.00 30.16  ? 379  TYR A O   1 
ATOM   2930  C  CB  . TYR A  1  379 ? 52.794  299.382 194.021 1.00 25.55  ? 379  TYR A CB  1 
ATOM   2931  C  CG  . TYR A  1  379 ? 51.385  298.818 193.729 1.00 25.56  ? 379  TYR A CG  1 
ATOM   2932  C  CD1 . TYR A  1  379 ? 50.708  299.142 192.543 1.00 25.40  ? 379  TYR A CD1 1 
ATOM   2933  C  CD2 . TYR A  1  379 ? 50.717  298.073 194.683 1.00 28.90  ? 379  TYR A CD2 1 
ATOM   2934  C  CE1 . TYR A  1  379 ? 49.391  298.640 192.278 1.00 28.73  ? 379  TYR A CE1 1 
ATOM   2935  C  CE2 . TYR A  1  379 ? 49.391  297.600 194.449 1.00 35.09  ? 379  TYR A CE2 1 
ATOM   2936  C  CZ  . TYR A  1  379 ? 48.764  297.871 193.216 1.00 33.77  ? 379  TYR A CZ  1 
ATOM   2937  O  OH  . TYR A  1  379 ? 47.463  297.458 193.031 1.00 29.23  ? 379  TYR A OH  1 
ATOM   2938  N  N   . VAL A  1  380 ? 55.061  301.034 195.105 1.00 31.99  ? 380  VAL A N   1 
ATOM   2939  C  CA  . VAL A  1  380 ? 56.258  300.876 195.975 1.00 38.12  ? 380  VAL A CA  1 
ATOM   2940  C  C   . VAL A  1  380 ? 56.532  302.125 196.676 1.00 40.09  ? 380  VAL A C   1 
ATOM   2941  O  O   . VAL A  1  380 ? 57.001  302.127 197.803 1.00 44.14  ? 380  VAL A O   1 
ATOM   2942  C  CB  . VAL A  1  380 ? 57.664  300.668 195.328 1.00 39.50  ? 380  VAL A CB  1 
ATOM   2943  C  CG1 . VAL A  1  380 ? 58.357  299.441 195.649 1.00 43.09  ? 380  VAL A CG1 1 
ATOM   2944  C  CG2 . VAL A  1  380 ? 58.146  301.628 194.188 1.00 37.44  ? 380  VAL A CG2 1 
ATOM   2945  N  N   . LEU A  1  381 ? 56.281  303.224 196.027 1.00 41.69  ? 381  LEU A N   1 
ATOM   2946  C  CA  . LEU A  1  381 ? 56.573  304.490 196.613 1.00 40.73  ? 381  LEU A CA  1 
ATOM   2947  C  C   . LEU A  1  381 ? 55.407  305.194 197.207 1.00 40.60  ? 381  LEU A C   1 
ATOM   2948  O  O   . LEU A  1  381 ? 55.376  305.533 198.376 1.00 40.44  ? 381  LEU A O   1 
ATOM   2949  C  CB  . LEU A  1  381 ? 57.241  305.460 195.606 1.00 40.35  ? 381  LEU A CB  1 
ATOM   2950  C  CG  . LEU A  1  381 ? 57.364  306.920 196.115 1.00 43.53  ? 381  LEU A CG  1 
ATOM   2951  C  CD1 . LEU A  1  381 ? 58.353  306.929 197.388 1.00 47.03  ? 381  LEU A CD1 1 
ATOM   2952  C  CD2 . LEU A  1  381 ? 58.027  307.873 195.034 1.00 43.53  ? 381  LEU A CD2 1 
ATOM   2953  N  N   . SER A  1  382 ? 54.550  305.611 196.364 1.00 38.23  ? 382  SER A N   1 
ATOM   2954  C  CA  . SER A  1  382 ? 53.353  306.283 196.791 1.00 39.76  ? 382  SER A CA  1 
ATOM   2955  C  C   . SER A  1  382 ? 52.542  305.648 197.887 1.00 38.58  ? 382  SER A C   1 
ATOM   2956  O  O   . SER A  1  382 ? 52.552  306.275 198.932 1.00 34.69  ? 382  SER A O   1 
ATOM   2957  C  CB  . SER A  1  382 ? 52.447  306.643 195.576 1.00 39.90  ? 382  SER A CB  1 
ATOM   2958  O  OG  . SER A  1  382 ? 53.344  307.297 194.588 1.00 41.14  ? 382  SER A OG  1 
ATOM   2959  N  N   . MET A  1  383 ? 51.840  304.526 197.662 1.00 37.17  ? 383  MET A N   1 
ATOM   2960  C  CA  . MET A  1  383 ? 51.103  303.697 198.700 1.00 38.22  ? 383  MET A CA  1 
ATOM   2961  C  C   . MET A  1  383 ? 52.067  303.155 199.848 1.00 37.64  ? 383  MET A C   1 
ATOM   2962  O  O   . MET A  1  383 ? 51.690  303.106 201.037 1.00 37.87  ? 383  MET A O   1 
ATOM   2963  C  CB  . MET A  1  383 ? 50.597  302.325 198.214 1.00 41.74  ? 383  MET A CB  1 
ATOM   2964  C  CG  . MET A  1  383 ? 49.328  302.212 197.325 1.00 51.88  ? 383  MET A CG  1 
ATOM   2965  S  SD  . MET A  1  383 ? 48.979  300.431 196.652 1.00 63.93  ? 383  MET A SD  1 
ATOM   2966  C  CE  . MET A  1  383 ? 48.303  300.876 195.010 1.00 64.03  ? 383  MET A CE  1 
ATOM   2967  N  N   . GLY A  1  384 ? 53.258  302.675 199.490 1.00 34.23  ? 384  GLY A N   1 
ATOM   2968  C  CA  . GLY A  1  384 ? 54.271  302.311 200.494 1.00 30.60  ? 384  GLY A CA  1 
ATOM   2969  C  C   . GLY A  1  384 ? 54.485  303.456 201.478 1.00 31.91  ? 384  GLY A C   1 
ATOM   2970  O  O   . GLY A  1  384 ? 54.266  303.251 202.666 1.00 31.14  ? 384  GLY A O   1 
ATOM   2971  N  N   . ALA A  1  385 ? 54.843  304.648 201.020 1.00 28.86  ? 385  ALA A N   1 
ATOM   2972  C  CA  . ALA A  1  385 ? 55.021  305.844 201.900 1.00 31.21  ? 385  ALA A CA  1 
ATOM   2973  C  C   . ALA A  1  385 ? 53.751  306.286 202.658 1.00 28.63  ? 385  ALA A C   1 
ATOM   2974  O  O   . ALA A  1  385 ? 53.799  306.494 203.889 1.00 28.28  ? 385  ALA A O   1 
ATOM   2975  C  CB  . ALA A  1  385 ? 55.631  307.030 201.190 1.00 26.92  ? 385  ALA A CB  1 
ATOM   2976  N  N   . VAL A  1  386 ? 52.646  306.332 201.963 1.00 25.36  ? 386  VAL A N   1 
ATOM   2977  C  CA  . VAL A  1  386 ? 51.379  306.699 202.588 1.00 27.77  ? 386  VAL A CA  1 
ATOM   2978  C  C   . VAL A  1  386 ? 50.994  305.660 203.653 1.00 26.18  ? 386  VAL A C   1 
ATOM   2979  O  O   . VAL A  1  386 ? 50.586  306.078 204.695 1.00 27.59  ? 386  VAL A O   1 
ATOM   2980  C  CB  . VAL A  1  386 ? 50.256  306.837 201.564 1.00 26.15  ? 386  VAL A CB  1 
ATOM   2981  C  CG1 . VAL A  1  386 ? 48.944  306.823 202.252 1.00 26.79  ? 386  VAL A CG1 1 
ATOM   2982  C  CG2 . VAL A  1  386 ? 50.503  308.195 200.756 1.00 25.21  ? 386  VAL A CG2 1 
ATOM   2983  N  N   . PHE A  1  387 ? 51.097  304.356 203.398 1.00 25.30  ? 387  PHE A N   1 
ATOM   2984  C  CA  . PHE A  1  387 ? 50.733  303.319 204.358 1.00 25.09  ? 387  PHE A CA  1 
ATOM   2985  C  C   . PHE A  1  387 ? 51.655  303.362 205.562 1.00 27.97  ? 387  PHE A C   1 
ATOM   2986  O  O   . PHE A  1  387 ? 51.154  303.153 206.647 1.00 27.21  ? 387  PHE A O   1 
ATOM   2987  C  CB  . PHE A  1  387 ? 50.743  301.919 203.699 1.00 25.83  ? 387  PHE A CB  1 
ATOM   2988  C  CG  . PHE A  1  387 ? 49.368  301.617 202.960 1.00 27.16  ? 387  PHE A CG  1 
ATOM   2989  C  CD1 . PHE A  1  387 ? 48.573  300.574 203.367 1.00 30.75  ? 387  PHE A CD1 1 
ATOM   2990  C  CD2 . PHE A  1  387 ? 48.869  302.530 201.998 1.00 24.80  ? 387  PHE A CD2 1 
ATOM   2991  C  CE1 . PHE A  1  387 ? 47.315  300.290 202.728 1.00 26.19  ? 387  PHE A CE1 1 
ATOM   2992  C  CE2 . PHE A  1  387 ? 47.562  302.277 201.333 1.00 29.57  ? 387  PHE A CE2 1 
ATOM   2993  C  CZ  . PHE A  1  387 ? 46.816  301.166 201.727 1.00 31.68  ? 387  PHE A CZ  1 
ATOM   2994  N  N   . ALA A  1  388 ? 53.010  303.489 205.348 1.00 25.78  ? 388  ALA A N   1 
ATOM   2995  C  CA  . ALA A  1  388 ? 53.859  303.683 206.513 1.00 25.38  ? 388  ALA A CA  1 
ATOM   2996  C  C   . ALA A  1  388 ? 53.520  304.918 207.353 1.00 26.86  ? 388  ALA A C   1 
ATOM   2997  O  O   . ALA A  1  388 ? 53.567  304.888 208.617 1.00 28.72  ? 388  ALA A O   1 
ATOM   2998  C  CB  . ALA A  1  388 ? 55.487  303.728 206.009 1.00 23.93  ? 388  ALA A CB  1 
ATOM   2999  N  N   . ILE A  1  389 ? 53.291  306.076 206.684 1.00 26.42  ? 389  ILE A N   1 
ATOM   3000  C  CA  . ILE A  1  389 ? 52.894  307.292 207.344 1.00 27.36  ? 389  ILE A CA  1 
ATOM   3001  C  C   . ILE A  1  389 ? 51.561  307.071 208.096 1.00 30.30  ? 389  ILE A C   1 
ATOM   3002  O  O   . ILE A  1  389 ? 51.457  307.505 209.252 1.00 29.56  ? 389  ILE A O   1 
ATOM   3003  C  CB  . ILE A  1  389 ? 52.679  308.511 206.342 1.00 28.47  ? 389  ILE A CB  1 
ATOM   3004  C  CG1 . ILE A  1  389 ? 54.079  309.029 205.913 1.00 27.99  ? 389  ILE A CG1 1 
ATOM   3005  C  CG2 . ILE A  1  389 ? 51.794  309.571 206.924 1.00 23.39  ? 389  ILE A CG2 1 
ATOM   3006  C  CD1 . ILE A  1  389 ? 53.933  309.953 204.594 1.00 23.00  ? 389  ILE A CD1 1 
ATOM   3007  N  N   . MET A  1  390 ? 50.588  306.416 207.493 1.00 28.56  ? 390  MET A N   1 
ATOM   3008  C  CA  . MET A  1  390 ? 49.291  306.235 208.214 1.00 30.76  ? 390  MET A CA  1 
ATOM   3009  C  C   . MET A  1  390 ? 49.528  305.269 209.409 1.00 29.79  ? 390  MET A C   1 
ATOM   3010  O  O   . MET A  1  390 ? 49.034  305.528 210.494 1.00 29.55  ? 390  MET A O   1 
ATOM   3011  C  CB  . MET A  1  390 ? 48.197  305.692 207.339 1.00 28.53  ? 390  MET A CB  1 
ATOM   3012  C  CG  . MET A  1  390 ? 47.550  306.728 206.290 1.00 32.61  ? 390  MET A CG  1 
ATOM   3013  S  SD  . MET A  1  390 ? 47.291  308.398 207.009 1.00 41.57  ? 390  MET A SD  1 
ATOM   3014  C  CE  . MET A  1  390 ? 46.069  308.124 208.273 1.00 46.72  ? 390  MET A CE  1 
ATOM   3015  N  N   . GLY A  1  391 ? 50.358  304.237 209.192 1.00 30.62  ? 391  GLY A N   1 
ATOM   3016  C  CA  . GLY A  1  391 ? 50.704  303.313 210.277 1.00 29.38  ? 391  GLY A CA  1 
ATOM   3017  C  C   . GLY A  1  391 ? 51.335  304.092 211.426 1.00 30.03  ? 391  GLY A C   1 
ATOM   3018  O  O   . GLY A  1  391 ? 50.894  303.975 212.589 1.00 28.81  ? 391  GLY A O   1 
ATOM   3019  N  N   . GLY A  1  392 ? 52.405  304.812 211.126 1.00 28.35  ? 392  GLY A N   1 
ATOM   3020  C  CA  . GLY A  1  392 ? 53.156  305.600 212.127 1.00 27.66  ? 392  GLY A CA  1 
ATOM   3021  C  C   . GLY A  1  392 ? 52.126  306.568 212.822 1.00 29.27  ? 392  GLY A C   1 
ATOM   3022  O  O   . GLY A  1  392 ? 52.166  306.774 214.006 1.00 28.72  ? 392  GLY A O   1 
ATOM   3023  N  N   . PHE A  1  393 ? 51.235  307.168 212.061 1.00 26.29  ? 393  PHE A N   1 
ATOM   3024  C  CA  . PHE A  1  393 ? 50.435  308.257 212.562 1.00 28.46  ? 393  PHE A CA  1 
ATOM   3025  C  C   . PHE A  1  393 ? 49.418  307.635 213.578 1.00 30.24  ? 393  PHE A C   1 
ATOM   3026  O  O   . PHE A  1  393 ? 49.242  308.150 214.717 1.00 27.98  ? 393  PHE A O   1 
ATOM   3027  C  CB  . PHE A  1  393 ? 49.611  308.926 211.466 1.00 26.50  ? 393  PHE A CB  1 
ATOM   3028  C  CG  . PHE A  1  393 ? 48.725  310.035 212.011 1.00 29.47  ? 393  PHE A CG  1 
ATOM   3029  C  CD1 . PHE A  1  393 ? 49.297  311.267 212.286 1.00 31.04  ? 393  PHE A CD1 1 
ATOM   3030  C  CD2 . PHE A  1  393 ? 47.319  309.860 212.149 1.00 29.78  ? 393  PHE A CD2 1 
ATOM   3031  C  CE1 . PHE A  1  393 ? 48.573  312.323 212.803 1.00 30.55  ? 393  PHE A CE1 1 
ATOM   3032  C  CE2 . PHE A  1  393 ? 46.525  310.952 212.722 1.00 27.35  ? 393  PHE A CE2 1 
ATOM   3033  C  CZ  . PHE A  1  393 ? 47.149  312.184 212.957 1.00 31.18  ? 393  PHE A CZ  1 
ATOM   3034  N  N   . VAL A  1  394 ? 48.806  306.548 213.157 1.00 29.47  ? 394  VAL A N   1 
ATOM   3035  C  CA  . VAL A  1  394 ? 47.851  305.855 214.120 1.00 31.95  ? 394  VAL A CA  1 
ATOM   3036  C  C   . VAL A  1  394 ? 48.565  305.282 215.327 1.00 31.64  ? 394  VAL A C   1 
ATOM   3037  O  O   . VAL A  1  394 ? 48.095  305.458 216.453 1.00 27.40  ? 394  VAL A O   1 
ATOM   3038  C  CB  . VAL A  1  394 ? 46.954  304.776 213.436 1.00 34.39  ? 394  VAL A CB  1 
ATOM   3039  C  CG1 . VAL A  1  394 ? 46.241  305.482 212.243 1.00 30.59  ? 394  VAL A CG1 1 
ATOM   3040  C  CG2 . VAL A  1  394 ? 47.799  303.826 212.795 1.00 38.72  ? 394  VAL A CG2 1 
ATOM   3041  N  N   . HIS A  1  395 ? 49.745  304.702 215.112 1.00 28.73  ? 395  HIS A N   1 
ATOM   3042  C  CA  . HIS A  1  395 ? 50.478  304.202 216.238 1.00 28.82  ? 395  HIS A CA  1 
ATOM   3043  C  C   . HIS A  1  395 ? 50.902  305.272 217.204 1.00 29.58  ? 395  HIS A C   1 
ATOM   3044  O  O   . HIS A  1  395 ? 50.882  305.008 218.466 1.00 31.03  ? 395  HIS A O   1 
ATOM   3045  C  CB  . HIS A  1  395 ? 51.707  303.407 215.730 1.00 26.85  ? 395  HIS A CB  1 
ATOM   3046  C  CG  . HIS A  1  395 ? 52.534  302.827 216.841 1.00 28.94  ? 395  HIS A CG  1 
ATOM   3047  N  ND1 . HIS A  1  395 ? 52.048  301.914 217.763 1.00 29.05  ? 395  HIS A ND1 1 
ATOM   3048  C  CD2 . HIS A  1  395 ? 53.835  303.009 217.148 1.00 22.98  ? 395  HIS A CD2 1 
ATOM   3049  C  CE1 . HIS A  1  395 ? 53.036  301.514 218.544 1.00 26.70  ? 395  HIS A CE1 1 
ATOM   3050  N  NE2 . HIS A  1  395 ? 54.117  302.198 218.229 1.00 27.98  ? 395  HIS A NE2 1 
ATOM   3051  N  N   . TRP A  1  396 ? 51.402  306.440 216.730 1.00 26.87  ? 396  TRP A N   1 
ATOM   3052  C  CA  . TRP A  1  396 ? 52.004  307.357 217.654 1.00 27.10  ? 396  TRP A CA  1 
ATOM   3053  C  C   . TRP A  1  396 ? 51.135  308.563 217.917 1.00 26.31  ? 396  TRP A C   1 
ATOM   3054  O  O   . TRP A  1  396 ? 51.438  309.389 218.777 1.00 25.24  ? 396  TRP A O   1 
ATOM   3055  C  CB  . TRP A  1  396 ? 53.419  307.823 217.169 1.00 23.27  ? 396  TRP A CB  1 
ATOM   3056  C  CG  . TRP A  1  396 ? 54.533  306.866 217.461 1.00 27.67  ? 396  TRP A CG  1 
ATOM   3057  C  CD1 . TRP A  1  396 ? 55.103  306.573 218.676 1.00 26.08  ? 396  TRP A CD1 1 
ATOM   3058  C  CD2 . TRP A  1  396 ? 55.326  306.167 216.454 1.00 27.51  ? 396  TRP A CD2 1 
ATOM   3059  N  NE1 . TRP A  1  396 ? 56.179  305.629 218.494 1.00 23.98  ? 396  TRP A NE1 1 
ATOM   3060  C  CE2 . TRP A  1  396 ? 56.336  305.419 217.135 1.00 28.26  ? 396  TRP A CE2 1 
ATOM   3061  C  CE3 . TRP A  1  396 ? 55.237  306.087 215.029 1.00 27.75  ? 396  TRP A CE3 1 
ATOM   3062  C  CZ2 . TRP A  1  396 ? 57.280  304.585 216.434 1.00 24.68  ? 396  TRP A CZ2 1 
ATOM   3063  C  CZ3 . TRP A  1  396 ? 56.126  305.175 214.329 1.00 26.15  ? 396  TRP A CZ3 1 
ATOM   3064  C  CH2 . TRP A  1  396 ? 57.136  304.481 215.020 1.00 27.99  ? 396  TRP A CH2 1 
ATOM   3065  N  N   . PHE A  1  397 ? 49.954  308.594 217.338 1.00 26.17  ? 397  PHE A N   1 
ATOM   3066  C  CA  . PHE A  1  397 ? 49.001  309.683 217.698 1.00 27.80  ? 397  PHE A CA  1 
ATOM   3067  C  C   . PHE A  1  397 ? 48.803  309.789 219.214 1.00 27.13  ? 397  PHE A C   1 
ATOM   3068  O  O   . PHE A  1  397 ? 48.735  310.866 219.760 1.00 28.79  ? 397  PHE A O   1 
ATOM   3069  C  CB  . PHE A  1  397 ? 47.630  309.397 217.061 1.00 27.22  ? 397  PHE A CB  1 
ATOM   3070  C  CG  . PHE A  1  397 ? 46.646  310.517 217.312 1.00 32.70  ? 397  PHE A CG  1 
ATOM   3071  C  CD1 . PHE A  1  397 ? 45.676  310.385 218.361 1.00 29.71  ? 397  PHE A CD1 1 
ATOM   3072  C  CD2 . PHE A  1  397 ? 46.704  311.730 216.584 1.00 31.65  ? 397  PHE A CD2 1 
ATOM   3073  C  CE1 . PHE A  1  397 ? 44.766  311.445 218.627 1.00 25.35  ? 397  PHE A CE1 1 
ATOM   3074  C  CE2 . PHE A  1  397 ? 45.729  312.799 216.853 1.00 35.18  ? 397  PHE A CE2 1 
ATOM   3075  C  CZ  . PHE A  1  397 ? 44.814  312.654 217.878 1.00 33.71  ? 397  PHE A CZ  1 
ATOM   3076  N  N   . PRO A  1  398 ? 48.602  308.654 219.916 1.00 30.48  ? 398  PRO A N   1 
ATOM   3077  C  CA  . PRO A  1  398 ? 48.341  308.903 221.395 1.00 29.60  ? 398  PRO A CA  1 
ATOM   3078  C  C   . PRO A  1  398 ? 49.575  309.500 222.140 1.00 29.69  ? 398  PRO A C   1 
ATOM   3079  O  O   . PRO A  1  398 ? 49.408  310.279 223.097 1.00 30.50  ? 398  PRO A O   1 
ATOM   3080  C  CB  . PRO A  1  398 ? 48.020  307.490 221.948 1.00 28.78  ? 398  PRO A CB  1 
ATOM   3081  C  CG  . PRO A  1  398 ? 47.540  306.665 220.621 1.00 29.44  ? 398  PRO A CG  1 
ATOM   3082  C  CD  . PRO A  1  398 ? 48.506  307.223 219.547 1.00 28.84  ? 398  PRO A CD  1 
ATOM   3083  N  N   . LEU A  1  399 ? 50.789  309.198 221.663 1.00 30.54  ? 399  LEU A N   1 
ATOM   3084  C  CA  . LEU A  1  399 ? 52.026  309.718 222.216 1.00 26.35  ? 399  LEU A CA  1 
ATOM   3085  C  C   . LEU A  1  399 ? 52.136  311.163 222.000 1.00 28.75  ? 399  LEU A C   1 
ATOM   3086  O  O   . LEU A  1  399 ? 52.372  311.913 222.956 1.00 29.10  ? 399  LEU A O   1 
ATOM   3087  C  CB  . LEU A  1  399 ? 53.257  309.029 221.582 1.00 28.25  ? 399  LEU A CB  1 
ATOM   3088  C  CG  . LEU A  1  399 ? 54.608  309.610 222.032 1.00 26.96  ? 399  LEU A CG  1 
ATOM   3089  C  CD1 . LEU A  1  399 ? 54.711  309.589 223.661 1.00 24.67  ? 399  LEU A CD1 1 
ATOM   3090  C  CD2 . LEU A  1  399 ? 55.874  308.900 221.306 1.00 23.57  ? 399  LEU A CD2 1 
ATOM   3091  N  N   . PHE A  1  400 ? 51.873  311.624 220.758 1.00 28.73  ? 400  PHE A N   1 
ATOM   3092  C  CA  . PHE A  1  400 ? 51.938  313.050 220.457 1.00 29.32  ? 400  PHE A CA  1 
ATOM   3093  C  C   . PHE A  1  400 ? 50.800  313.841 221.107 1.00 28.64  ? 400  PHE A C   1 
ATOM   3094  O  O   . PHE A  1  400 ? 51.040  315.007 221.487 1.00 32.15  ? 400  PHE A O   1 
ATOM   3095  C  CB  . PHE A  1  400 ? 51.764  313.254 218.900 1.00 28.92  ? 400  PHE A CB  1 
ATOM   3096  C  CG  . PHE A  1  400 ? 52.877  312.494 218.056 1.00 30.02  ? 400  PHE A CG  1 
ATOM   3097  C  CD1 . PHE A  1  400 ? 54.054  312.117 218.644 1.00 28.78  ? 400  PHE A CD1 1 
ATOM   3098  C  CD2 . PHE A  1  400 ? 52.699  312.203 216.708 1.00 30.12  ? 400  PHE A CD2 1 
ATOM   3099  C  CE1 . PHE A  1  400 ? 55.093  311.403 217.959 1.00 31.07  ? 400  PHE A CE1 1 
ATOM   3100  C  CE2 . PHE A  1  400 ? 53.743  311.532 215.972 1.00 30.62  ? 400  PHE A CE2 1 
ATOM   3101  C  CZ  . PHE A  1  400 ? 54.904  311.140 216.565 1.00 30.36  ? 400  PHE A CZ  1 
ATOM   3102  N  N   . SER A  1  401 ? 49.566  313.264 221.171 1.00 29.25  ? 401  SER A N   1 
ATOM   3103  C  CA  . SER A  1  401 ? 48.450  314.104 221.601 1.00 29.23  ? 401  SER A CA  1 
ATOM   3104  C  C   . SER A  1  401 ? 48.015  313.864 223.093 1.00 29.13  ? 401  SER A C   1 
ATOM   3105  O  O   . SER A  1  401 ? 47.345  314.747 223.680 1.00 30.98  ? 401  SER A O   1 
ATOM   3106  C  CB  . SER A  1  401 ? 47.241  313.873 220.708 1.00 28.88  ? 401  SER A CB  1 
ATOM   3107  O  OG  . SER A  1  401 ? 46.710  312.564 220.923 1.00 28.30  ? 401  SER A OG  1 
ATOM   3108  N  N   . GLY A  1  402 ? 48.248  312.644 223.599 1.00 29.87  ? 402  GLY A N   1 
ATOM   3109  C  CA  . GLY A  1  402 ? 47.821  312.209 224.924 1.00 29.57  ? 402  GLY A CA  1 
ATOM   3110  C  C   . GLY A  1  402 ? 46.370  311.685 224.797 1.00 32.85  ? 402  GLY A C   1 
ATOM   3111  O  O   . GLY A  1  402 ? 45.751  311.339 225.801 1.00 30.46  ? 402  GLY A O   1 
ATOM   3112  N  N   . TYR A  1  403 ? 45.815  311.585 223.577 1.00 29.72  ? 403  TYR A N   1 
ATOM   3113  C  CA  . TYR A  1  403 ? 44.467  311.081 223.384 1.00 31.53  ? 403  TYR A CA  1 
ATOM   3114  C  C   . TYR A  1  403 ? 44.447  309.839 222.520 1.00 32.97  ? 403  TYR A C   1 
ATOM   3115  O  O   . TYR A  1  403 ? 45.387  309.559 221.743 1.00 33.05  ? 403  TYR A O   1 
ATOM   3116  C  CB  . TYR A  1  403 ? 43.586  312.078 222.719 1.00 29.21  ? 403  TYR A CB  1 
ATOM   3117  C  CG  . TYR A  1  403 ? 43.406  313.358 223.493 1.00 31.71  ? 403  TYR A CG  1 
ATOM   3118  C  CD1 . TYR A  1  403 ? 42.932  313.402 224.840 1.00 28.76  ? 403  TYR A CD1 1 
ATOM   3119  C  CD2 . TYR A  1  403 ? 43.700  314.524 222.905 1.00 28.85  ? 403  TYR A CD2 1 
ATOM   3120  C  CE1 . TYR A  1  403 ? 42.734  314.617 225.484 1.00 27.45  ? 403  TYR A CE1 1 
ATOM   3121  C  CE2 . TYR A  1  403 ? 43.493  315.739 223.532 1.00 28.49  ? 403  TYR A CE2 1 
ATOM   3122  C  CZ  . TYR A  1  403 ? 43.013  315.761 224.867 1.00 26.99  ? 403  TYR A CZ  1 
ATOM   3123  O  OH  . TYR A  1  403 ? 42.875  317.019 225.472 1.00 33.77  ? 403  TYR A OH  1 
ATOM   3124  N  N   . THR A  1  404 ? 43.369  309.070 222.635 1.00 30.24  ? 404  THR A N   1 
ATOM   3125  C  CA  . THR A  1  404 ? 43.248  307.875 221.772 1.00 29.32  ? 404  THR A CA  1 
ATOM   3126  C  C   . THR A  1  404 ? 42.286  308.110 220.607 1.00 29.90  ? 404  THR A C   1 
ATOM   3127  O  O   . THR A  1  404 ? 41.261  308.891 220.655 1.00 29.42  ? 404  THR A O   1 
ATOM   3128  C  CB  . THR A  1  404 ? 42.860  306.576 222.507 1.00 29.18  ? 404  THR A CB  1 
ATOM   3129  O  OG1 . THR A  1  404 ? 41.514  306.722 223.048 1.00 32.56  ? 404  THR A OG1 1 
ATOM   3130  C  CG2 . THR A  1  404 ? 43.922  306.218 223.579 1.00 31.98  ? 404  THR A CG2 1 
ATOM   3131  N  N   . LEU A  1  405 ? 42.583  307.368 219.550 1.00 30.42  ? 405  LEU A N   1 
ATOM   3132  C  CA  . LEU A  1  405 ? 41.689  307.285 218.383 1.00 30.67  ? 405  LEU A CA  1 
ATOM   3133  C  C   . LEU A  1  405 ? 40.593  306.241 218.649 1.00 32.16  ? 405  LEU A C   1 
ATOM   3134  O  O   . LEU A  1  405 ? 40.712  305.378 219.533 1.00 30.35  ? 405  LEU A O   1 
ATOM   3135  C  CB  . LEU A  1  405 ? 42.540  306.853 217.155 1.00 30.37  ? 405  LEU A CB  1 
ATOM   3136  C  CG  . LEU A  1  405 ? 43.696  307.765 216.769 1.00 32.31  ? 405  LEU A CG  1 
ATOM   3137  C  CD1 . LEU A  1  405 ? 44.544  307.161 215.584 1.00 30.73  ? 405  LEU A CD1 1 
ATOM   3138  C  CD2 . LEU A  1  405 ? 43.067  309.038 216.246 1.00 26.64  ? 405  LEU A CD2 1 
ATOM   3139  N  N   . ASN A  1  406 ? 39.552  306.239 217.828 1.00 31.71  ? 406  ASN A N   1 
ATOM   3140  C  CA  . ASN A  1  406 ? 38.607  305.153 217.946 1.00 32.63  ? 406  ASN A CA  1 
ATOM   3141  C  C   . ASN A  1  406 ? 39.147  304.045 217.030 1.00 32.34  ? 406  ASN A C   1 
ATOM   3142  O  O   . ASN A  1  406 ? 39.278  304.283 215.834 1.00 31.65  ? 406  ASN A O   1 
ATOM   3143  C  CB  . ASN A  1  406 ? 37.186  305.686 217.543 1.00 32.36  ? 406  ASN A CB  1 
ATOM   3144  C  CG  . ASN A  1  406 ? 36.173  304.617 217.485 1.00 34.52  ? 406  ASN A CG  1 
ATOM   3145  O  OD1 . ASN A  1  406 ? 36.406  303.535 216.942 1.00 33.89  ? 406  ASN A OD1 1 
ATOM   3146  N  ND2 . ASN A  1  406 ? 35.011  304.885 218.120 1.00 37.68  ? 406  ASN A ND2 1 
ATOM   3147  N  N   . ASP A  1  407 ? 39.496  302.881 217.581 1.00 29.55  ? 407  ASP A N   1 
ATOM   3148  C  CA  . ASP A  1  407 ? 40.106  301.835 216.799 1.00 30.78  ? 407  ASP A CA  1 
ATOM   3149  C  C   . ASP A  1  407 ? 39.196  301.310 215.751 1.00 31.88  ? 407  ASP A C   1 
ATOM   3150  O  O   . ASP A  1  407 ? 39.681  300.861 214.695 1.00 31.20  ? 407  ASP A O   1 
ATOM   3151  C  CB  . ASP A  1  407 ? 40.518  300.652 217.627 1.00 27.18  ? 407  ASP A CB  1 
ATOM   3152  C  CG  . ASP A  1  407 ? 41.961  300.815 218.227 1.00 36.93  ? 407  ASP A CG  1 
ATOM   3153  O  OD1 . ASP A  1  407 ? 42.394  299.857 218.866 1.00 39.20  ? 407  ASP A OD1 1 
ATOM   3154  O  OD2 . ASP A  1  407 ? 42.666  301.841 217.995 1.00 30.99  ? 407  ASP A OD2 1 
ATOM   3155  N  N   . THR A  1  408 ? 37.869  301.250 216.048 1.00 31.52  ? 408  THR A N   1 
ATOM   3156  C  CA  . THR A  1  408 ? 36.978  300.773 214.985 1.00 28.65  ? 408  THR A CA  1 
ATOM   3157  C  C   . THR A  1  408 ? 36.942  301.675 213.746 1.00 29.25  ? 408  THR A C   1 
ATOM   3158  O  O   . THR A  1  408 ? 37.100  301.192 212.612 1.00 29.90  ? 408  THR A O   1 
ATOM   3159  C  CB  . THR A  1  408 ? 35.517  300.527 215.579 1.00 32.00  ? 408  THR A CB  1 
ATOM   3160  O  OG1 . THR A  1  408 ? 35.624  299.546 216.652 1.00 29.41  ? 408  THR A OG1 1 
ATOM   3161  C  CG2 . THR A  1  408 ? 34.680  299.892 214.464 1.00 25.92  ? 408  THR A CG2 1 
ATOM   3162  N  N   . TRP A  1  409 ? 36.765  302.978 213.945 1.00 28.70  ? 409  TRP A N   1 
ATOM   3163  C  CA  . TRP A  1  409 ? 36.783  303.909 212.869 1.00 28.77  ? 409  TRP A CA  1 
ATOM   3164  C  C   . TRP A  1  409 ? 38.114  303.814 212.098 1.00 30.86  ? 409  TRP A C   1 
ATOM   3165  O  O   . TRP A  1  409 ? 38.161  303.940 210.810 1.00 29.67  ? 409  TRP A O   1 
ATOM   3166  C  CB  . TRP A  1  409 ? 36.652  305.364 213.360 1.00 29.35  ? 409  TRP A CB  1 
ATOM   3167  C  CG  . TRP A  1  409 ? 35.144  305.857 213.548 1.00 32.67  ? 409  TRP A CG  1 
ATOM   3168  C  CD1 . TRP A  1  409 ? 34.604  306.324 214.690 1.00 32.02  ? 409  TRP A CD1 1 
ATOM   3169  C  CD2 . TRP A  1  409 ? 34.132  305.948 212.553 1.00 35.73  ? 409  TRP A CD2 1 
ATOM   3170  N  NE1 . TRP A  1  409 ? 33.298  306.707 214.487 1.00 35.43  ? 409  TRP A NE1 1 
ATOM   3171  C  CE2 . TRP A  1  409 ? 32.978  306.465 213.178 1.00 33.36  ? 409  TRP A CE2 1 
ATOM   3172  C  CE3 . TRP A  1  409 ? 34.071  305.615 211.169 1.00 33.97  ? 409  TRP A CE3 1 
ATOM   3173  C  CZ2 . TRP A  1  409 ? 31.750  306.696 212.466 1.00 35.77  ? 409  TRP A CZ2 1 
ATOM   3174  C  CZ3 . TRP A  1  409 ? 32.869  305.849 210.486 1.00 31.91  ? 409  TRP A CZ3 1 
ATOM   3175  C  CH2 . TRP A  1  409 ? 31.744  306.383 211.126 1.00 33.96  ? 409  TRP A CH2 1 
ATOM   3176  N  N   . ALA A  1  410 ? 39.202  303.647 212.852 1.00 28.35  ? 410  ALA A N   1 
ATOM   3177  C  CA  . ALA A  1  410 ? 40.541  303.607 212.164 1.00 28.27  ? 410  ALA A CA  1 
ATOM   3178  C  C   . ALA A  1  410 ? 40.676  302.292 211.307 1.00 30.89  ? 410  ALA A C   1 
ATOM   3179  O  O   . ALA A  1  410 ? 41.356  302.310 210.204 1.00 27.80  ? 410  ALA A O   1 
ATOM   3180  C  CB  . ALA A  1  410 ? 41.662  303.771 213.195 1.00 23.12  ? 410  ALA A CB  1 
ATOM   3181  N  N   . LYS A  1  411 ? 40.090  301.148 211.805 1.00 29.88  ? 411  LYS A N   1 
ATOM   3182  C  CA  . LYS A  1  411 ? 40.025  299.929 210.957 1.00 28.20  ? 411  LYS A CA  1 
ATOM   3183  C  C   . LYS A  1  411 ? 39.195  300.167 209.666 1.00 31.20  ? 411  LYS A C   1 
ATOM   3184  O  O   . LYS A  1  411 ? 39.583  299.745 208.587 1.00 30.86  ? 411  LYS A O   1 
ATOM   3185  C  CB  . LYS A  1  411 ? 39.516  298.670 211.738 1.00 29.28  ? 411  LYS A CB  1 
ATOM   3186  C  CG  . LYS A  1  411 ? 40.563  298.334 212.837 1.00 27.73  ? 411  LYS A CG  1 
ATOM   3187  C  CD  . LYS A  1  411 ? 39.935  297.272 213.779 1.00 29.82  ? 411  LYS A CD  1 
ATOM   3188  C  CE  . LYS A  1  411 ? 40.792  297.155 215.101 1.00 33.29  ? 411  LYS A CE  1 
ATOM   3189  N  NZ  . LYS A  1  411 ? 40.531  295.779 215.760 1.00 34.54  ? 411  LYS A NZ  1 
ATOM   3190  N  N   . ILE A  1  412 ? 38.036  300.817 209.813 1.00 31.31  ? 412  ILE A N   1 
ATOM   3191  C  CA  . ILE A  1  412 ? 37.213  301.187 208.712 1.00 30.99  ? 412  ILE A CA  1 
ATOM   3192  C  C   . ILE A  1  412 ? 38.009  302.035 207.693 1.00 30.66  ? 412  ILE A C   1 
ATOM   3193  O  O   . ILE A  1  412 ? 38.033  301.709 206.538 1.00 31.33  ? 412  ILE A O   1 
ATOM   3194  C  CB  . ILE A  1  412 ? 35.960  301.936 209.180 1.00 32.07  ? 412  ILE A CB  1 
ATOM   3195  C  CG1 . ILE A  1  412 ? 34.960  300.968 209.933 1.00 24.73  ? 412  ILE A CG1 1 
ATOM   3196  C  CG2 . ILE A  1  412 ? 35.272  302.593 207.939 1.00 30.63  ? 412  ILE A CG2 1 
ATOM   3197  C  CD1 . ILE A  1  412 ? 34.090  301.811 210.987 1.00 28.09  ? 412  ILE A CD1 1 
ATOM   3198  N  N   . HIS A  1  413 ? 38.658  303.100 208.133 1.00 29.01  ? 413  HIS A N   1 
ATOM   3199  C  CA  . HIS A  1  413 ? 39.462  303.882 207.278 1.00 30.64  ? 413  HIS A CA  1 
ATOM   3200  C  C   . HIS A  1  413 ? 40.512  303.023 206.525 1.00 31.23  ? 413  HIS A C   1 
ATOM   3201  O  O   . HIS A  1  413 ? 40.720  303.227 205.298 1.00 32.81  ? 413  HIS A O   1 
ATOM   3202  C  CB  . HIS A  1  413 ? 40.085  305.047 208.153 1.00 30.50  ? 413  HIS A CB  1 
ATOM   3203  C  CG  . HIS A  1  413 ? 41.146  305.803 207.449 1.00 33.96  ? 413  HIS A CG  1 
ATOM   3204  N  ND1 . HIS A  1  413 ? 42.454  305.761 207.863 1.00 37.63  ? 413  HIS A ND1 1 
ATOM   3205  C  CD2 . HIS A  1  413 ? 41.133  306.556 206.320 1.00 33.39  ? 413  HIS A CD2 1 
ATOM   3206  C  CE1 . HIS A  1  413 ? 43.221  306.400 206.990 1.00 35.53  ? 413  HIS A CE1 1 
ATOM   3207  N  NE2 . HIS A  1  413 ? 42.460  306.912 206.064 1.00 29.33  ? 413  HIS A NE2 1 
ATOM   3208  N  N   . PHE A  1  414 ? 41.261  302.152 207.213 1.00 28.37  ? 414  PHE A N   1 
ATOM   3209  C  CA  . PHE A  1  414 ? 42.309  301.343 206.532 1.00 29.94  ? 414  PHE A CA  1 
ATOM   3210  C  C   . PHE A  1  414 ? 41.591  300.581 205.393 1.00 29.62  ? 414  PHE A C   1 
ATOM   3211  O  O   . PHE A  1  414 ? 42.086  300.432 204.278 1.00 30.18  ? 414  PHE A O   1 
ATOM   3212  C  CB  . PHE A  1  414 ? 43.019  300.314 207.509 1.00 26.83  ? 414  PHE A CB  1 
ATOM   3213  C  CG  . PHE A  1  414 ? 43.772  299.219 206.785 1.00 31.14  ? 414  PHE A CG  1 
ATOM   3214  C  CD1 . PHE A  1  414 ? 45.053  299.453 206.292 1.00 28.51  ? 414  PHE A CD1 1 
ATOM   3215  C  CD2 . PHE A  1  414 ? 43.185  297.954 206.594 1.00 27.72  ? 414  PHE A CD2 1 
ATOM   3216  C  CE1 . PHE A  1  414 ? 45.668  298.455 205.544 1.00 26.73  ? 414  PHE A CE1 1 
ATOM   3217  C  CE2 . PHE A  1  414 ? 43.794  296.921 205.896 1.00 32.66  ? 414  PHE A CE2 1 
ATOM   3218  C  CZ  . PHE A  1  414 ? 45.089  297.151 205.382 1.00 30.62  ? 414  PHE A CZ  1 
ATOM   3219  N  N   . ALA A  1  415 ? 40.480  299.960 205.723 1.00 29.87  ? 415  ALA A N   1 
ATOM   3220  C  CA  . ALA A  1  415 ? 39.794  299.061 204.763 1.00 28.53  ? 415  ALA A CA  1 
ATOM   3221  C  C   . ALA A  1  415 ? 39.389  299.816 203.475 1.00 29.32  ? 415  ALA A C   1 
ATOM   3222  O  O   . ALA A  1  415 ? 39.674  299.356 202.321 1.00 31.76  ? 415  ALA A O   1 
ATOM   3223  C  CB  . ALA A  1  415 ? 38.531  298.431 205.393 1.00 28.58  ? 415  ALA A CB  1 
ATOM   3224  N  N   . ILE A  1  416 ? 38.753  300.966 203.620 1.00 26.54  ? 416  ILE A N   1 
ATOM   3225  C  CA  . ILE A  1  416 ? 38.365  301.770 202.454 1.00 28.41  ? 416  ILE A CA  1 
ATOM   3226  C  C   . ILE A  1  416 ? 39.648  302.147 201.627 1.00 30.42  ? 416  ILE A C   1 
ATOM   3227  O  O   . ILE A  1  416 ? 39.680  302.030 200.392 1.00 31.30  ? 416  ILE A O   1 
ATOM   3228  C  CB  . ILE A  1  416 ? 37.625  303.036 202.889 1.00 28.87  ? 416  ILE A CB  1 
ATOM   3229  C  CG1 . ILE A  1  416 ? 36.364  302.702 203.821 1.00 29.12  ? 416  ILE A CG1 1 
ATOM   3230  C  CG2 . ILE A  1  416 ? 37.128  304.010 201.626 1.00 24.66  ? 416  ILE A CG2 1 
ATOM   3231  C  CD1 . ILE A  1  416 ? 35.832  304.150 204.466 1.00 27.91  ? 416  ILE A CD1 1 
ATOM   3232  N  N   . MET A  1  417 ? 40.709  302.557 202.326 1.00 28.92  ? 417  MET A N   1 
ATOM   3233  C  CA  . MET A  1  417 ? 41.886  303.035 201.659 1.00 30.16  ? 417  MET A CA  1 
ATOM   3234  C  C   . MET A  1  417 ? 42.481  301.869 200.899 1.00 28.27  ? 417  MET A C   1 
ATOM   3235  O  O   . MET A  1  417 ? 42.806  302.050 199.765 1.00 27.46  ? 417  MET A O   1 
ATOM   3236  C  CB  . MET A  1  417 ? 42.915  303.526 202.694 1.00 27.23  ? 417  MET A CB  1 
ATOM   3237  C  CG  . MET A  1  417 ? 44.000  304.270 201.973 1.00 33.07  ? 417  MET A CG  1 
ATOM   3238  S  SD  . MET A  1  417 ? 43.499  305.879 201.250 1.00 36.29  ? 417  MET A SD  1 
ATOM   3239  C  CE  . MET A  1  417 ? 45.251  306.312 200.936 1.00 34.50  ? 417  MET A CE  1 
ATOM   3240  N  N   . PHE A  1  418 ? 42.541  300.668 201.487 1.00 25.84  ? 418  PHE A N   1 
ATOM   3241  C  CA  . PHE A  1  418 ? 43.185  299.545 200.842 1.00 27.81  ? 418  PHE A CA  1 
ATOM   3242  C  C   . PHE A  1  418 ? 42.441  299.156 199.513 1.00 29.94  ? 418  PHE A C   1 
ATOM   3243  O  O   . PHE A  1  418 ? 43.056  298.822 198.478 1.00 28.29  ? 418  PHE A O   1 
ATOM   3244  C  CB  . PHE A  1  418 ? 43.160  298.318 201.813 1.00 28.48  ? 418  PHE A CB  1 
ATOM   3245  C  CG  . PHE A  1  418 ? 43.942  297.140 201.282 1.00 29.33  ? 418  PHE A CG  1 
ATOM   3246  C  CD1 . PHE A  1  418 ? 45.380  297.161 201.347 1.00 28.91  ? 418  PHE A CD1 1 
ATOM   3247  C  CD2 . PHE A  1  418 ? 43.306  296.058 200.643 1.00 31.20  ? 418  PHE A CD2 1 
ATOM   3248  C  CE1 . PHE A  1  418 ? 46.143  296.103 200.850 1.00 30.84  ? 418  PHE A CE1 1 
ATOM   3249  C  CE2 . PHE A  1  418 ? 44.131  294.993 200.114 1.00 33.27  ? 418  PHE A CE2 1 
ATOM   3250  C  CZ  . PHE A  1  418 ? 45.514  295.022 200.222 1.00 33.70  ? 418  PHE A CZ  1 
ATOM   3251  N  N   . VAL A  1  419 ? 41.093  299.131 199.561 1.00 30.06  ? 419  VAL A N   1 
ATOM   3252  C  CA  . VAL A  1  419 ? 40.301  298.924 198.345 1.00 27.89  ? 419  VAL A CA  1 
ATOM   3253  C  C   . VAL A  1  419 ? 40.532  300.082 197.336 1.00 29.43  ? 419  VAL A C   1 
ATOM   3254  O  O   . VAL A  1  419 ? 40.754  299.875 196.149 1.00 30.01  ? 419  VAL A O   1 
ATOM   3255  C  CB  . VAL A  1  419 ? 38.695  298.808 198.722 1.00 30.38  ? 419  VAL A CB  1 
ATOM   3256  C  CG1 . VAL A  1  419 ? 37.845  298.838 197.317 1.00 26.82  ? 419  VAL A CG1 1 
ATOM   3257  C  CG2 . VAL A  1  419 ? 38.440  297.565 199.580 1.00 30.32  ? 419  VAL A CG2 1 
ATOM   3258  N  N   . GLY A  1  420 ? 40.508  301.313 197.787 1.00 29.14  ? 420  GLY A N   1 
ATOM   3259  C  CA  . GLY A  1  420 ? 40.602  302.443 196.850 1.00 31.21  ? 420  GLY A CA  1 
ATOM   3260  C  C   . GLY A  1  420 ? 41.934  302.374 196.120 1.00 31.99  ? 420  GLY A C   1 
ATOM   3261  O  O   . GLY A  1  420 ? 41.998  302.481 194.857 1.00 32.51  ? 420  GLY A O   1 
ATOM   3262  N  N   . VAL A  1  421 ? 43.006  302.271 196.885 1.00 29.61  ? 421  VAL A N   1 
ATOM   3263  C  CA  . VAL A  1  421 ? 44.324  302.401 196.196 1.00 27.51  ? 421  VAL A CA  1 
ATOM   3264  C  C   . VAL A  1  421 ? 44.554  301.225 195.242 1.00 28.26  ? 421  VAL A C   1 
ATOM   3265  O  O   . VAL A  1  421 ? 45.109  301.381 194.176 1.00 25.60  ? 421  VAL A O   1 
ATOM   3266  C  CB  . VAL A  1  421 ? 45.509  302.460 197.156 1.00 28.98  ? 421  VAL A CB  1 
ATOM   3267  C  CG1 . VAL A  1  421 ? 45.411  303.783 198.055 1.00 26.24  ? 421  VAL A CG1 1 
ATOM   3268  C  CG2 . VAL A  1  421 ? 45.654  301.232 198.061 1.00 25.41  ? 421  VAL A CG2 1 
ATOM   3269  N  N   . ASN A  1  422 ? 44.099  300.067 195.608 1.00 27.12  ? 422  ASN A N   1 
ATOM   3270  C  CA  . ASN A  1  422 ? 44.276  298.934 194.650 1.00 28.76  ? 422  ASN A CA  1 
ATOM   3271  C  C   . ASN A  1  422 ? 43.371  299.082 193.398 1.00 29.35  ? 422  ASN A C   1 
ATOM   3272  O  O   . ASN A  1  422 ? 43.783  298.733 192.297 1.00 29.73  ? 422  ASN A O   1 
ATOM   3273  C  CB  . ASN A  1  422 ? 44.017  297.586 195.366 1.00 28.65  ? 422  ASN A CB  1 
ATOM   3274  C  CG  . ASN A  1  422 ? 45.241  297.189 196.159 1.00 32.69  ? 422  ASN A CG  1 
ATOM   3275  O  OD1 . ASN A  1  422 ? 46.288  296.903 195.577 1.00 30.92  ? 422  ASN A OD1 1 
ATOM   3276  N  ND2 . ASN A  1  422 ? 45.183  297.379 197.465 1.00 32.45  ? 422  ASN A ND2 1 
ATOM   3277  N  N   . MET A  1  423 ? 42.127  299.517 193.606 1.00 31.26  ? 423  MET A N   1 
ATOM   3278  C  CA  . MET A  1  423 ? 41.231  299.764 192.454 1.00 29.28  ? 423  MET A CA  1 
ATOM   3279  C  C   . MET A  1  423 ? 41.815  300.886 191.553 1.00 32.53  ? 423  MET A C   1 
ATOM   3280  O  O   . MET A  1  423 ? 41.733  300.842 190.278 1.00 32.09  ? 423  MET A O   1 
ATOM   3281  C  CB  . MET A  1  423 ? 39.837  300.111 192.903 1.00 30.23  ? 423  MET A CB  1 
ATOM   3282  C  CG  . MET A  1  423 ? 38.946  300.358 191.607 1.00 30.14  ? 423  MET A CG  1 
ATOM   3283  S  SD  . MET A  1  423 ? 37.278  300.747 192.132 1.00 34.83  ? 423  MET A SD  1 
ATOM   3284  C  CE  . MET A  1  423 ? 36.907  299.396 193.102 1.00 38.95  ? 423  MET A CE  1 
ATOM   3285  N  N   . THR A  1  424 ? 42.573  301.813 192.142 1.00 30.91  ? 424  THR A N   1 
ATOM   3286  C  CA  . THR A  1  424 ? 43.147  302.900 191.378 1.00 29.31  ? 424  THR A CA  1 
ATOM   3287  C  C   . THR A  1  424 ? 44.321  302.414 190.601 1.00 29.96  ? 424  THR A C   1 
ATOM   3288  O  O   . THR A  1  424 ? 44.432  302.705 189.361 1.00 29.74  ? 424  THR A O   1 
ATOM   3289  C  CB  . THR A  1  424 ? 43.636  304.105 192.309 1.00 29.76  ? 424  THR A CB  1 
ATOM   3290  O  OG1 . THR A  1  424 ? 42.477  304.582 193.050 1.00 28.46  ? 424  THR A OG1 1 
ATOM   3291  C  CG2 . THR A  1  424 ? 44.223  305.215 191.466 1.00 31.36  ? 424  THR A CG2 1 
ATOM   3292  N  N   . PHE A  1  425 ? 45.273  301.741 191.273 1.00 27.20  ? 425  PHE A N   1 
ATOM   3293  C  CA  . PHE A  1  425 ? 46.543  301.566 190.532 1.00 28.17  ? 425  PHE A CA  1 
ATOM   3294  C  C   . PHE A  1  425 ? 46.706  300.177 189.887 1.00 28.70  ? 425  PHE A C   1 
ATOM   3295  O  O   . PHE A  1  425 ? 47.466  300.077 188.966 1.00 27.25  ? 425  PHE A O   1 
ATOM   3296  C  CB  . PHE A  1  425 ? 47.755  301.858 191.473 1.00 26.38  ? 425  PHE A CB  1 
ATOM   3297  C  CG  . PHE A  1  425 ? 47.751  303.316 191.951 1.00 27.40  ? 425  PHE A CG  1 
ATOM   3298  C  CD1 . PHE A  1  425 ? 47.377  303.645 193.274 1.00 28.33  ? 425  PHE A CD1 1 
ATOM   3299  C  CD2 . PHE A  1  425 ? 48.076  304.378 191.045 1.00 25.32  ? 425  PHE A CD2 1 
ATOM   3300  C  CE1 . PHE A  1  425 ? 47.359  305.019 193.718 1.00 29.44  ? 425  PHE A CE1 1 
ATOM   3301  C  CE2 . PHE A  1  425 ? 48.006  305.699 191.467 1.00 25.84  ? 425  PHE A CE2 1 
ATOM   3302  C  CZ  . PHE A  1  425 ? 47.655  306.019 192.782 1.00 27.44  ? 425  PHE A CZ  1 
ATOM   3303  N  N   . PHE A  1  426 ? 46.045  299.091 190.415 1.00 28.37  ? 426  PHE A N   1 
ATOM   3304  C  CA  . PHE A  1  426 ? 46.289  297.817 189.791 1.00 27.28  ? 426  PHE A CA  1 
ATOM   3305  C  C   . PHE A  1  426 ? 46.020  297.851 188.236 1.00 29.17  ? 426  PHE A C   1 
ATOM   3306  O  O   . PHE A  1  426 ? 46.860  297.293 187.428 1.00 31.29  ? 426  PHE A O   1 
ATOM   3307  C  CB  . PHE A  1  426 ? 45.503  296.644 190.425 1.00 27.43  ? 426  PHE A CB  1 
ATOM   3308  C  CG  . PHE A  1  426 ? 46.177  295.360 190.102 1.00 32.34  ? 426  PHE A CG  1 
ATOM   3309  C  CD1 . PHE A  1  426 ? 47.455  295.074 190.686 1.00 34.22  ? 426  PHE A CD1 1 
ATOM   3310  C  CD2 . PHE A  1  426 ? 45.716  294.562 189.080 1.00 34.32  ? 426  PHE A CD2 1 
ATOM   3311  C  CE1 . PHE A  1  426 ? 48.185  293.893 190.304 1.00 35.58  ? 426  PHE A CE1 1 
ATOM   3312  C  CE2 . PHE A  1  426 ? 46.440  293.421 188.693 1.00 36.45  ? 426  PHE A CE2 1 
ATOM   3313  C  CZ  . PHE A  1  426 ? 47.642  293.110 189.255 1.00 37.15  ? 426  PHE A CZ  1 
ATOM   3314  N  N   . PRO A  1  427 ? 44.881  298.431 187.807 1.00 29.20  ? 427  PRO A N   1 
ATOM   3315  C  CA  . PRO A  1  427 ? 44.574  298.434 186.323 1.00 28.81  ? 427  PRO A CA  1 
ATOM   3316  C  C   . PRO A  1  427 ? 45.643  299.156 185.480 1.00 29.24  ? 427  PRO A C   1 
ATOM   3317  O  O   . PRO A  1  427 ? 45.762  298.897 184.285 1.00 31.18  ? 427  PRO A O   1 
ATOM   3318  C  CB  . PRO A  1  427 ? 43.241  299.208 186.230 1.00 30.72  ? 427  PRO A CB  1 
ATOM   3319  C  CG  . PRO A  1  427 ? 42.556  299.005 187.655 1.00 29.37  ? 427  PRO A CG  1 
ATOM   3320  C  CD  . PRO A  1  427 ? 43.801  299.134 188.581 1.00 30.74  ? 427  PRO A CD  1 
ATOM   3321  N  N   . GLN A  1  428 ? 46.489  299.979 186.104 1.00 29.52  ? 428  GLN A N   1 
ATOM   3322  C  CA  . GLN A  1  428 ? 47.468  300.721 185.322 1.00 27.28  ? 428  GLN A CA  1 
ATOM   3323  C  C   . GLN A  1  428 ? 48.561  299.868 184.840 1.00 26.11  ? 428  GLN A C   1 
ATOM   3324  O  O   . GLN A  1  428 ? 49.220  300.253 183.894 1.00 28.44  ? 428  GLN A O   1 
ATOM   3325  C  CB  . GLN A  1  428 ? 47.978  301.971 186.081 1.00 26.28  ? 428  GLN A CB  1 
ATOM   3326  C  CG  . GLN A  1  428 ? 46.927  303.018 186.440 1.00 26.10  ? 428  GLN A CG  1 
ATOM   3327  C  CD  . GLN A  1  428 ? 47.441  304.159 187.312 1.00 28.62  ? 428  GLN A CD  1 
ATOM   3328  O  OE1 . GLN A  1  428 ? 48.613  304.178 187.692 1.00 28.52  ? 428  GLN A OE1 1 
ATOM   3329  N  NE2 . GLN A  1  428 ? 46.575  305.094 187.667 1.00 24.18  ? 428  GLN A NE2 1 
ATOM   3330  N  N   . HIS A  1  429 ? 48.811  298.720 185.466 1.00 25.84  ? 429  HIS A N   1 
ATOM   3331  C  CA  . HIS A  1  429 ? 49.747  297.738 184.865 1.00 28.42  ? 429  HIS A CA  1 
ATOM   3332  C  C   . HIS A  1  429 ? 49.283  297.315 183.439 1.00 29.32  ? 429  HIS A C   1 
ATOM   3333  O  O   . HIS A  1  429 ? 50.077  297.223 182.542 1.00 30.35  ? 429  HIS A O   1 
ATOM   3334  C  CB  . HIS A  1  429 ? 49.892  296.456 185.712 1.00 29.54  ? 429  HIS A CB  1 
ATOM   3335  C  CG  . HIS A  1  429 ? 50.422  296.689 187.111 1.00 30.01  ? 429  HIS A CG  1 
ATOM   3336  N  ND1 . HIS A  1  429 ? 49.578  296.778 188.211 1.00 28.20  ? 429  HIS A ND1 1 
ATOM   3337  C  CD2 . HIS A  1  429 ? 51.692  296.794 187.598 1.00 27.69  ? 429  HIS A CD2 1 
ATOM   3338  C  CE1 . HIS A  1  429 ? 50.303  296.939 189.317 1.00 29.23  ? 429  HIS A CE1 1 
ATOM   3339  N  NE2 . HIS A  1  429 ? 51.583  297.000 188.976 1.00 25.53  ? 429  HIS A NE2 1 
ATOM   3340  N  N   . PHE A  1  430 ? 47.986  297.068 183.272 1.00 30.44  ? 430  PHE A N   1 
ATOM   3341  C  CA  . PHE A  1  430 ? 47.406  296.632 182.015 1.00 30.50  ? 430  PHE A CA  1 
ATOM   3342  C  C   . PHE A  1  430 ? 47.543  297.733 180.951 1.00 31.56  ? 430  PHE A C   1 
ATOM   3343  O  O   . PHE A  1  430 ? 47.907  297.460 179.800 1.00 32.58  ? 430  PHE A O   1 
ATOM   3344  C  CB  . PHE A  1  430 ? 45.881  296.285 182.209 1.00 28.10  ? 430  PHE A CB  1 
ATOM   3345  C  CG  . PHE A  1  430 ? 45.649  295.256 183.272 1.00 31.49  ? 430  PHE A CG  1 
ATOM   3346  C  CD1 . PHE A  1  430 ? 46.470  294.127 183.376 1.00 33.92  ? 430  PHE A CD1 1 
ATOM   3347  C  CD2 . PHE A  1  430 ? 44.514  295.324 184.053 1.00 35.51  ? 430  PHE A CD2 1 
ATOM   3348  C  CE1 . PHE A  1  430 ? 46.219  293.147 184.394 1.00 35.49  ? 430  PHE A CE1 1 
ATOM   3349  C  CE2 . PHE A  1  430 ? 44.246  294.338 185.045 1.00 36.13  ? 430  PHE A CE2 1 
ATOM   3350  C  CZ  . PHE A  1  430 ? 45.106  293.283 185.204 1.00 39.88  ? 430  PHE A CZ  1 
ATOM   3351  N  N   . LEU A  1  431 ? 47.246  298.970 181.364 1.00 30.79  ? 431  LEU A N   1 
ATOM   3352  C  CA  . LEU A  1  431 ? 47.424  300.120 180.538 1.00 29.32  ? 431  LEU A CA  1 
ATOM   3353  C  C   . LEU A  1  431 ? 48.858  300.291 180.090 1.00 29.36  ? 431  LEU A C   1 
ATOM   3354  O  O   . LEU A  1  431 ? 49.122  300.624 178.897 1.00 28.39  ? 431  LEU A O   1 
ATOM   3355  C  CB  . LEU A  1  431 ? 46.972  301.366 181.281 1.00 28.34  ? 431  LEU A CB  1 
ATOM   3356  C  CG  . LEU A  1  431 ? 45.433  301.458 181.504 1.00 27.23  ? 431  LEU A CG  1 
ATOM   3357  C  CD1 . LEU A  1  431 ? 45.180  302.680 182.423 1.00 25.36  ? 431  LEU A CD1 1 
ATOM   3358  C  CD2 . LEU A  1  431 ? 44.638  301.620 180.201 1.00 27.35  ? 431  LEU A CD2 1 
ATOM   3359  N  N   . GLY A  1  432 ? 49.806  300.092 181.002 1.00 27.67  ? 432  GLY A N   1 
ATOM   3360  C  CA  . GLY A  1  432 ? 51.203  300.241 180.599 1.00 27.93  ? 432  GLY A CA  1 
ATOM   3361  C  C   . GLY A  1  432 ? 51.713  299.108 179.705 1.00 28.02  ? 432  GLY A C   1 
ATOM   3362  O  O   . GLY A  1  432 ? 52.344  299.368 178.638 1.00 28.25  ? 432  GLY A O   1 
ATOM   3363  N  N   . LEU A  1  433 ? 51.367  297.855 180.030 1.00 27.33  ? 433  LEU A N   1 
ATOM   3364  C  CA  . LEU A  1  433 ? 51.775  296.717 179.128 1.00 26.99  ? 433  LEU A CA  1 
ATOM   3365  C  C   . LEU A  1  433 ? 51.173  296.885 177.743 1.00 29.95  ? 433  LEU A C   1 
ATOM   3366  O  O   . LEU A  1  433 ? 51.858  296.661 176.720 1.00 28.73  ? 433  LEU A O   1 
ATOM   3367  C  CB  . LEU A  1  433 ? 51.338  295.360 179.732 1.00 29.17  ? 433  LEU A CB  1 
ATOM   3368  C  CG  . LEU A  1  433 ? 52.041  294.908 181.014 1.00 27.50  ? 433  LEU A CG  1 
ATOM   3369  C  CD1 . LEU A  1  433 ? 51.186  293.821 181.732 1.00 29.89  ? 433  LEU A CD1 1 
ATOM   3370  C  CD2 . LEU A  1  433 ? 53.567  294.495 180.740 1.00 27.70  ? 433  LEU A CD2 1 
ATOM   3371  N  N   . SER A  1  434 ? 49.899  297.322 177.671 1.00 30.56  ? 434  SER A N   1 
ATOM   3372  C  CA  . SER A  1  434 ? 49.310  297.562 176.377 1.00 30.44  ? 434  SER A CA  1 
ATOM   3373  C  C   . SER A  1  434 ? 49.708  298.844 175.692 1.00 31.43  ? 434  SER A C   1 
ATOM   3374  O  O   . SER A  1  434 ? 49.232  299.106 174.535 1.00 34.04  ? 434  SER A O   1 
ATOM   3375  C  CB  . SER A  1  434 ? 47.756  297.429 176.458 1.00 28.33  ? 434  SER A CB  1 
ATOM   3376  O  OG  . SER A  1  434 ? 47.187  298.363 177.382 1.00 28.94  ? 434  SER A OG  1 
ATOM   3377  N  N   . GLY A  1  435 ? 50.592  299.656 176.291 1.00 31.06  ? 435  GLY A N   1 
ATOM   3378  C  CA  . GLY A  1  435 ? 51.172  300.712 175.561 1.00 29.36  ? 435  GLY A CA  1 
ATOM   3379  C  C   . GLY A  1  435 ? 50.637  302.134 175.827 1.00 31.28  ? 435  GLY A C   1 
ATOM   3380  O  O   . GLY A  1  435 ? 50.985  303.053 175.072 1.00 30.85  ? 435  GLY A O   1 
ATOM   3381  N  N   . MET A  1  436 ? 49.791  302.361 176.836 1.00 30.86  ? 436  MET A N   1 
ATOM   3382  C  CA  . MET A  1  436 ? 49.296  303.762 177.102 1.00 29.98  ? 436  MET A CA  1 
ATOM   3383  C  C   . MET A  1  436 ? 50.431  304.625 177.655 1.00 29.76  ? 436  MET A C   1 
ATOM   3384  O  O   . MET A  1  436 ? 50.956  304.263 178.747 1.00 28.55  ? 436  MET A O   1 
ATOM   3385  C  CB  . MET A  1  436 ? 48.131  303.816 178.073 1.00 28.40  ? 436  MET A CB  1 
ATOM   3386  C  CG  . MET A  1  436 ? 47.652  305.257 178.357 1.00 30.58  ? 436  MET A CG  1 
ATOM   3387  S  SD  . MET A  1  436 ? 46.408  305.351 179.646 1.00 30.66  ? 436  MET A SD  1 
ATOM   3388  C  CE  . MET A  1  436 ? 46.455  307.212 179.814 1.00 22.07  ? 436  MET A CE  1 
ATOM   3389  N  N   . PRO A  1  437 ? 50.766  305.767 176.964 1.00 29.33  ? 437  PRO A N   1 
ATOM   3390  C  CA  . PRO A  1  437 ? 51.817  306.587 177.569 1.00 26.30  ? 437  PRO A CA  1 
ATOM   3391  C  C   . PRO A  1  437 ? 51.387  307.232 178.908 1.00 27.09  ? 437  PRO A C   1 
ATOM   3392  O  O   . PRO A  1  437 ? 50.190  307.452 179.137 1.00 27.65  ? 437  PRO A O   1 
ATOM   3393  C  CB  . PRO A  1  437 ? 52.028  307.698 176.521 1.00 24.39  ? 437  PRO A CB  1 
ATOM   3394  C  CG  . PRO A  1  437 ? 51.695  306.982 175.122 1.00 23.60  ? 437  PRO A CG  1 
ATOM   3395  C  CD  . PRO A  1  437 ? 50.369  306.363 175.640 1.00 26.22  ? 437  PRO A CD  1 
ATOM   3396  N  N   . ARG A  1  438 ? 52.375  307.609 179.729 1.00 27.49  ? 438  ARG A N   1 
ATOM   3397  C  CA  . ARG A  1  438 ? 52.096  308.445 180.891 1.00 29.90  ? 438  ARG A CA  1 
ATOM   3398  C  C   . ARG A  1  438 ? 52.097  309.886 180.397 1.00 30.95  ? 438  ARG A C   1 
ATOM   3399  O  O   . ARG A  1  438 ? 52.552  310.199 179.252 1.00 29.08  ? 438  ARG A O   1 
ATOM   3400  C  CB  . ARG A  1  438 ? 53.281  308.592 181.852 1.00 30.88  ? 438  ARG A CB  1 
ATOM   3401  C  CG  . ARG A  1  438 ? 54.037  307.652 182.244 1.00 38.11  ? 438  ARG A CG  1 
ATOM   3402  C  CD  . ARG A  1  438 ? 55.501  308.121 182.827 1.00 34.21  ? 438  ARG A CD  1 
ATOM   3403  N  NE  . ARG A  1  438 ? 55.517  309.042 184.053 1.00 26.20  ? 438  ARG A NE  1 
ATOM   3404  C  CZ  . ARG A  1  438 ? 56.478  309.036 184.938 1.00 31.78  ? 438  ARG A CZ  1 
ATOM   3405  N  NH1 . ARG A  1  438 ? 57.444  308.074 184.850 1.00 22.45  ? 438  ARG A NH1 1 
ATOM   3406  N  NH2 . ARG A  1  438 ? 56.459  309.935 185.907 1.00 27.14  ? 438  ARG A NH2 1 
ATOM   3407  N  N   . ARG A  1  439 ? 51.706  310.787 181.320 1.00 30.72  ? 439  ARG A N   1 
ATOM   3408  C  CA  . ARG A  1  439 ? 51.707  312.216 181.018 1.00 29.23  ? 439  ARG A CA  1 
ATOM   3409  C  C   . ARG A  1  439 ? 50.739  312.614 179.909 1.00 26.93  ? 439  ARG A C   1 
ATOM   3410  O  O   . ARG A  1  439 ? 50.885  313.704 179.312 1.00 31.02  ? 439  ARG A O   1 
ATOM   3411  C  CB  . ARG A  1  439 ? 53.129  312.738 180.744 1.00 26.65  ? 439  ARG A CB  1 
ATOM   3412  C  CG  . ARG A  1  439 ? 53.901  312.765 182.130 1.00 26.85  ? 439  ARG A CG  1 
ATOM   3413  C  CD  . ARG A  1  439 ? 55.395  312.673 181.933 1.00 26.49  ? 439  ARG A CD  1 
ATOM   3414  N  NE  . ARG A  1  439 ? 56.085  312.891 183.222 1.00 27.91  ? 439  ARG A NE  1 
ATOM   3415  C  CZ  . ARG A  1  439 ? 57.377  313.057 183.315 1.00 22.80  ? 439  ARG A CZ  1 
ATOM   3416  N  NH1 . ARG A  1  439 ? 58.088  312.910 182.219 1.00 18.38  ? 439  ARG A NH1 1 
ATOM   3417  N  NH2 . ARG A  1  439 ? 57.946  313.288 184.499 1.00 23.56  ? 439  ARG A NH2 1 
ATOM   3418  N  N   . TYR A  1  440 ? 49.706  311.832 179.729 1.00 28.47  ? 440  TYR A N   1 
ATOM   3419  C  CA  . TYR A  1  440 ? 48.643  312.078 178.742 1.00 25.84  ? 440  TYR A CA  1 
ATOM   3420  C  C   . TYR A  1  440 ? 47.298  312.523 179.314 1.00 28.02  ? 440  TYR A C   1 
ATOM   3421  O  O   . TYR A  1  440 ? 46.847  312.018 180.380 1.00 25.54  ? 440  TYR A O   1 
ATOM   3422  C  CB  . TYR A  1  440 ? 48.391  310.752 177.976 1.00 26.42  ? 440  TYR A CB  1 
ATOM   3423  C  CG  . TYR A  1  440 ? 49.195  310.580 176.681 1.00 27.32  ? 440  TYR A CG  1 
ATOM   3424  C  CD1 . TYR A  1  440 ? 48.666  309.876 175.567 1.00 24.21  ? 440  TYR A CD1 1 
ATOM   3425  C  CD2 . TYR A  1  440 ? 50.506  311.093 176.597 1.00 27.05  ? 440  TYR A CD2 1 
ATOM   3426  C  CE1 . TYR A  1  440 ? 49.454  309.705 174.396 1.00 31.73  ? 440  TYR A CE1 1 
ATOM   3427  C  CE2 . TYR A  1  440 ? 51.273  310.952 175.421 1.00 33.62  ? 440  TYR A CE2 1 
ATOM   3428  C  CZ  . TYR A  1  440 ? 50.757  310.225 174.355 1.00 32.58  ? 440  TYR A CZ  1 
ATOM   3429  O  OH  . TYR A  1  440 ? 51.588  310.129 173.258 1.00 28.93  ? 440  TYR A OH  1 
ATOM   3430  N  N   . SER A  1  441 ? 46.664  313.490 178.636 1.00 26.42  ? 441  SER A N   1 
ATOM   3431  C  CA  . SER A  1  441 ? 45.387  314.051 179.063 1.00 27.68  ? 441  SER A CA  1 
ATOM   3432  C  C   . SER A  1  441 ? 44.239  313.228 178.488 1.00 27.21  ? 441  SER A C   1 
ATOM   3433  O  O   . SER A  1  441 ? 42.990  313.387 178.868 1.00 28.57  ? 441  SER A O   1 
ATOM   3434  C  CB  . SER A  1  441 ? 45.278  315.516 178.604 1.00 27.24  ? 441  SER A CB  1 
ATOM   3435  O  OG  . SER A  1  441 ? 45.295  315.563 177.158 1.00 33.34  ? 441  SER A OG  1 
ATOM   3436  N  N   . ASP A  1  442 ? 44.591  312.341 177.547 1.00 28.52  ? 442  ASP A N   1 
ATOM   3437  C  CA  . ASP A  1  442 ? 43.495  311.533 176.899 1.00 28.21  ? 442  ASP A CA  1 
ATOM   3438  C  C   . ASP A  1  442 ? 44.206  310.438 176.183 1.00 28.24  ? 442  ASP A C   1 
ATOM   3439  O  O   . ASP A  1  442 ? 45.436  310.462 176.038 1.00 27.68  ? 442  ASP A O   1 
ATOM   3440  C  CB  . ASP A  1  442 ? 42.781  312.430 175.833 1.00 29.62  ? 442  ASP A CB  1 
ATOM   3441  C  CG  . ASP A  1  442 ? 41.419  311.884 175.402 1.00 32.87  ? 442  ASP A CG  1 
ATOM   3442  O  OD1 . ASP A  1  442 ? 40.854  312.516 174.507 1.00 32.18  ? 442  ASP A OD1 1 
ATOM   3443  O  OD2 . ASP A  1  442 ? 40.943  310.816 175.893 1.00 30.83  ? 442  ASP A OD2 1 
ATOM   3444  N  N   . TYR A  1  443 ? 43.455  309.443 175.774 1.00 25.90  ? 443  TYR A N   1 
ATOM   3445  C  CA  . TYR A  1  443 ? 43.988  308.151 175.333 1.00 27.11  ? 443  TYR A CA  1 
ATOM   3446  C  C   . TYR A  1  443 ? 43.133  307.577 174.173 1.00 27.66  ? 443  TYR A C   1 
ATOM   3447  O  O   . TYR A  1  443 ? 41.888  307.738 174.125 1.00 30.01  ? 443  TYR A O   1 
ATOM   3448  C  CB  . TYR A  1  443 ? 44.056  307.045 176.520 1.00 25.36  ? 443  TYR A CB  1 
ATOM   3449  C  CG  . TYR A  1  443 ? 42.796  307.105 177.375 1.00 26.58  ? 443  TYR A CG  1 
ATOM   3450  C  CD1 . TYR A  1  443 ? 41.605  306.493 176.940 1.00 24.86  ? 443  TYR A CD1 1 
ATOM   3451  C  CD2 . TYR A  1  443 ? 42.766  307.803 178.590 1.00 24.18  ? 443  TYR A CD2 1 
ATOM   3452  C  CE1 . TYR A  1  443 ? 40.434  306.624 177.706 1.00 23.96  ? 443  TYR A CE1 1 
ATOM   3453  C  CE2 . TYR A  1  443 ? 41.666  307.868 179.338 1.00 25.16  ? 443  TYR A CE2 1 
ATOM   3454  C  CZ  . TYR A  1  443 ? 40.462  307.336 178.876 1.00 25.51  ? 443  TYR A CZ  1 
ATOM   3455  O  OH  . TYR A  1  443 ? 39.322  307.457 179.674 1.00 27.73  ? 443  TYR A OH  1 
ATOM   3456  N  N   . PRO A  1  444 ? 43.767  306.782 173.320 1.00 29.11  ? 444  PRO A N   1 
ATOM   3457  C  CA  . PRO A  1  444 ? 43.026  306.015 172.243 1.00 29.15  ? 444  PRO A CA  1 
ATOM   3458  C  C   . PRO A  1  444 ? 41.918  305.184 172.939 1.00 30.58  ? 444  PRO A C   1 
ATOM   3459  O  O   . PRO A  1  444 ? 42.121  304.731 174.122 1.00 32.25  ? 444  PRO A O   1 
ATOM   3460  C  CB  . PRO A  1  444 ? 44.108  305.105 171.688 1.00 27.38  ? 444  PRO A CB  1 
ATOM   3461  C  CG  . PRO A  1  444 ? 45.416  305.930 171.797 1.00 27.33  ? 444  PRO A CG  1 
ATOM   3462  C  CD  . PRO A  1  444 ? 45.244  306.608 173.252 1.00 31.28  ? 444  PRO A CD  1 
ATOM   3463  N  N   . ASP A  1  445 ? 40.775  304.968 172.263 1.00 28.37  ? 445  ASP A N   1 
ATOM   3464  C  CA  . ASP A  1  445 ? 39.573  304.428 172.889 1.00 28.99  ? 445  ASP A CA  1 
ATOM   3465  C  C   . ASP A  1  445 ? 39.757  303.051 173.501 1.00 29.38  ? 445  ASP A C   1 
ATOM   3466  O  O   . ASP A  1  445 ? 39.039  302.718 174.442 1.00 30.36  ? 445  ASP A O   1 
ATOM   3467  C  CB  . ASP A  1  445 ? 38.401  304.308 171.832 1.00 28.14  ? 445  ASP A CB  1 
ATOM   3468  C  CG  . ASP A  1  445 ? 38.032  305.654 171.247 1.00 29.54  ? 445  ASP A CG  1 
ATOM   3469  O  OD1 . ASP A  1  445 ? 37.206  305.728 170.319 1.00 30.76  ? 445  ASP A OD1 1 
ATOM   3470  O  OD2 . ASP A  1  445 ? 38.488  306.718 171.774 1.00 33.54  ? 445  ASP A OD2 1 
ATOM   3471  N  N   . ALA A  1  446 ? 40.641  302.190 172.959 1.00 30.00  ? 446  ALA A N   1 
ATOM   3472  C  CA  . ALA A  1  446 ? 40.841  300.861 173.537 1.00 28.06  ? 446  ALA A CA  1 
ATOM   3473  C  C   . ALA A  1  446 ? 41.149  300.944 175.090 1.00 29.19  ? 446  ALA A C   1 
ATOM   3474  O  O   . ALA A  1  446 ? 40.833  299.998 175.822 1.00 29.75  ? 446  ALA A O   1 
ATOM   3475  C  CB  . ALA A  1  446 ? 42.006  300.179 172.854 1.00 26.09  ? 446  ALA A CB  1 
ATOM   3476  N  N   . TYR A  1  447 ? 41.830  302.019 175.559 1.00 30.46  ? 447  TYR A N   1 
ATOM   3477  C  CA  . TYR A  1  447 ? 42.225  302.127 176.981 1.00 27.38  ? 447  TYR A CA  1 
ATOM   3478  C  C   . TYR A  1  447 ? 41.115  302.582 177.918 1.00 30.19  ? 447  TYR A C   1 
ATOM   3479  O  O   . TYR A  1  447 ? 41.369  302.805 179.111 1.00 28.94  ? 447  TYR A O   1 
ATOM   3480  C  CB  . TYR A  1  447 ? 43.435  303.038 177.139 1.00 28.72  ? 447  TYR A CB  1 
ATOM   3481  C  CG  . TYR A  1  447 ? 44.582  302.653 176.251 1.00 28.52  ? 447  TYR A CG  1 
ATOM   3482  C  CD1 . TYR A  1  447 ? 45.343  301.528 176.531 1.00 27.37  ? 447  TYR A CD1 1 
ATOM   3483  C  CD2 . TYR A  1  447 ? 44.940  303.429 175.144 1.00 28.64  ? 447  TYR A CD2 1 
ATOM   3484  C  CE1 . TYR A  1  447 ? 46.462  301.197 175.798 1.00 30.86  ? 447  TYR A CE1 1 
ATOM   3485  C  CE2 . TYR A  1  447 ? 46.096  303.071 174.367 1.00 30.31  ? 447  TYR A CE2 1 
ATOM   3486  C  CZ  . TYR A  1  447 ? 46.815  301.943 174.676 1.00 32.18  ? 447  TYR A CZ  1 
ATOM   3487  O  OH  . TYR A  1  447 ? 47.955  301.568 173.923 1.00 31.46  ? 447  TYR A OH  1 
ATOM   3488  N  N   . THR A  1  448 ? 39.888  302.725 177.412 1.00 28.90  ? 448  THR A N   1 
ATOM   3489  C  CA  . THR A  1  448 ? 38.858  303.268 178.228 1.00 27.57  ? 448  THR A CA  1 
ATOM   3490  C  C   . THR A  1  448 ? 38.598  302.464 179.444 1.00 29.68  ? 448  THR A C   1 
ATOM   3491  O  O   . THR A  1  448 ? 38.413  303.075 180.546 1.00 29.75  ? 448  THR A O   1 
ATOM   3492  C  CB  . THR A  1  448 ? 37.585  303.483 177.402 1.00 29.39  ? 448  THR A CB  1 
ATOM   3493  O  OG1 . THR A  1  448 ? 37.839  304.490 176.400 1.00 30.32  ? 448  THR A OG1 1 
ATOM   3494  C  CG2 . THR A  1  448 ? 36.378  303.977 178.227 1.00 26.12  ? 448  THR A CG2 1 
ATOM   3495  N  N   . MET A  1  449 ? 38.399  301.146 179.290 1.00 29.15  ? 449  MET A N   1 
ATOM   3496  C  CA  . MET A  1  449 ? 37.968  300.352 180.441 1.00 32.26  ? 449  MET A CA  1 
ATOM   3497  C  C   . MET A  1  449 ? 38.876  300.587 181.720 1.00 30.76  ? 449  MET A C   1 
ATOM   3498  O  O   . MET A  1  449 ? 38.411  300.946 182.842 1.00 33.12  ? 449  MET A O   1 
ATOM   3499  C  CB  . MET A  1  449 ? 37.877  298.808 180.147 1.00 29.87  ? 449  MET A CB  1 
ATOM   3500  C  CG  . MET A  1  449 ? 37.065  298.332 181.379 1.00 40.34  ? 449  MET A CG  1 
ATOM   3501  S  SD  . MET A  1  449 ? 36.625  296.694 181.209 1.00 55.66  ? 449  MET A SD  1 
ATOM   3502  C  CE  . MET A  1  449 ? 35.013  296.824 180.456 1.00 45.97  ? 449  MET A CE  1 
ATOM   3503  N  N   . TRP A  1  450 ? 40.194  300.435 181.559 1.00 29.66  ? 450  TRP A N   1 
ATOM   3504  C  CA  . TRP A  1  450 ? 41.029  300.512 182.772 1.00 29.63  ? 450  TRP A CA  1 
ATOM   3505  C  C   . TRP A  1  450 ? 41.113  301.866 183.323 1.00 30.24  ? 450  TRP A C   1 
ATOM   3506  O  O   . TRP A  1  450 ? 41.207  302.001 184.504 1.00 27.87  ? 450  TRP A O   1 
ATOM   3507  C  CB  . TRP A  1  450 ? 42.441  299.999 182.469 1.00 29.87  ? 450  TRP A CB  1 
ATOM   3508  C  CG  . TRP A  1  450 ? 42.324  298.507 181.930 1.00 28.93  ? 450  TRP A CG  1 
ATOM   3509  C  CD1 . TRP A  1  450 ? 42.934  298.011 180.804 1.00 32.91  ? 450  TRP A CD1 1 
ATOM   3510  C  CD2 . TRP A  1  450 ? 41.584  297.428 182.476 1.00 31.81  ? 450  TRP A CD2 1 
ATOM   3511  N  NE1 . TRP A  1  450 ? 42.626  296.664 180.624 1.00 31.40  ? 450  TRP A NE1 1 
ATOM   3512  C  CE2 . TRP A  1  450 ? 41.782  296.284 181.608 1.00 31.81  ? 450  TRP A CE2 1 
ATOM   3513  C  CE3 . TRP A  1  450 ? 40.800  297.274 183.611 1.00 32.32  ? 450  TRP A CE3 1 
ATOM   3514  C  CZ2 . TRP A  1  450 ? 41.183  295.064 181.814 1.00 37.21  ? 450  TRP A CZ2 1 
ATOM   3515  C  CZ3 . TRP A  1  450 ? 40.183  296.028 183.818 1.00 40.36  ? 450  TRP A CZ3 1 
ATOM   3516  C  CH2 . TRP A  1  450 ? 40.404  294.936 182.939 1.00 43.20  ? 450  TRP A CH2 1 
ATOM   3517  N  N   . ASN A  1  451 ? 41.124  302.884 182.462 1.00 29.06  ? 451  ASN A N   1 
ATOM   3518  C  CA  . ASN A  1  451 ? 41.043  304.303 182.927 1.00 29.37  ? 451  ASN A CA  1 
ATOM   3519  C  C   . ASN A  1  451 ? 39.855  304.670 183.739 1.00 30.57  ? 451  ASN A C   1 
ATOM   3520  O  O   . ASN A  1  451 ? 39.985  305.429 184.730 1.00 26.56  ? 451  ASN A O   1 
ATOM   3521  C  CB  . ASN A  1  451 ? 41.234  305.288 181.724 1.00 26.67  ? 451  ASN A CB  1 
ATOM   3522  C  CG  . ASN A  1  451 ? 42.744  305.450 181.389 1.00 26.55  ? 451  ASN A CG  1 
ATOM   3523  O  OD1 . ASN A  1  451 ? 43.507  306.057 182.157 1.00 28.66  ? 451  ASN A OD1 1 
ATOM   3524  N  ND2 . ASN A  1  451 ? 43.167  304.898 180.271 1.00 27.54  ? 451  ASN A ND2 1 
ATOM   3525  N  N   . THR A  1  452 ? 38.695  304.151 183.290 1.00 27.73  ? 452  THR A N   1 
ATOM   3526  C  CA  . THR A  1  452 ? 37.494  304.359 184.019 1.00 29.32  ? 452  THR A CA  1 
ATOM   3527  C  C   . THR A  1  452 ? 37.538  303.693 185.432 1.00 28.55  ? 452  THR A C   1 
ATOM   3528  O  O   . THR A  1  452 ? 37.154  304.307 186.399 1.00 30.13  ? 452  THR A O   1 
ATOM   3529  C  CB  . THR A  1  452 ? 36.249  303.720 183.205 1.00 29.86  ? 452  THR A CB  1 
ATOM   3530  O  OG1 . THR A  1  452 ? 36.304  304.256 181.821 1.00 31.04  ? 452  THR A OG1 1 
ATOM   3531  C  CG2 . THR A  1  452 ? 34.994  304.109 183.857 1.00 26.17  ? 452  THR A CG2 1 
ATOM   3532  N  N   . ILE A  1  453 ? 37.909  302.418 185.511 1.00 29.43  ? 453  ILE A N   1 
ATOM   3533  C  CA  . ILE A  1  453 ? 38.019  301.755 186.798 1.00 29.23  ? 453  ILE A CA  1 
ATOM   3534  C  C   . ILE A  1  453 ? 39.027  302.569 187.693 1.00 29.23  ? 453  ILE A C   1 
ATOM   3535  O  O   . ILE A  1  453 ? 38.788  302.754 188.882 1.00 32.28  ? 453  ILE A O   1 
ATOM   3536  C  CB  . ILE A  1  453 ? 38.426  300.280 186.542 1.00 30.18  ? 453  ILE A CB  1 
ATOM   3537  C  CG1 . ILE A  1  453 ? 37.182  299.526 185.895 1.00 31.79  ? 453  ILE A CG1 1 
ATOM   3538  C  CG2 . ILE A  1  453 ? 38.883  299.622 187.874 1.00 30.45  ? 453  ILE A CG2 1 
ATOM   3539  C  CD1 . ILE A  1  453 ? 37.608  298.108 185.248 1.00 35.45  ? 453  ILE A CD1 1 
ATOM   3540  N  N   . SER A  1  454 ? 40.174  303.018 187.139 1.00 29.51  ? 454  SER A N   1 
ATOM   3541  C  CA  . SER A  1  454 ? 41.238  303.595 187.893 1.00 28.91  ? 454  SER A CA  1 
ATOM   3542  C  C   . SER A  1  454 ? 40.725  304.900 188.520 1.00 29.61  ? 454  SER A C   1 
ATOM   3543  O  O   . SER A  1  454 ? 40.885  305.152 189.699 1.00 27.27  ? 454  SER A O   1 
ATOM   3544  C  CB  . SER A  1  454 ? 42.473  303.814 187.000 1.00 28.80  ? 454  SER A CB  1 
ATOM   3545  O  OG  . SER A  1  454 ? 43.395  304.641 187.761 1.00 30.68  ? 454  SER A OG  1 
ATOM   3546  N  N   . SER A  1  455 ? 39.953  305.658 187.757 1.00 29.30  ? 455  SER A N   1 
ATOM   3547  C  CA  . SER A  1  455 ? 39.393  306.949 188.218 1.00 28.48  ? 455  SER A CA  1 
ATOM   3548  C  C   . SER A  1  455 ? 38.322  306.726 189.285 1.00 29.75  ? 455  SER A C   1 
ATOM   3549  O  O   . SER A  1  455 ? 38.121  307.551 190.282 1.00 26.49  ? 455  SER A O   1 
ATOM   3550  C  CB  . SER A  1  455 ? 38.866  307.746 187.004 1.00 25.15  ? 455  SER A CB  1 
ATOM   3551  O  OG  . SER A  1  455 ? 39.993  308.135 186.192 1.00 29.05  ? 455  SER A OG  1 
ATOM   3552  N  N   . MET A  1  456 ? 37.585  305.645 189.095 1.00 28.29  ? 456  MET A N   1 
ATOM   3553  C  CA  . MET A  1  456 ? 36.603  305.334 190.146 1.00 30.85  ? 456  MET A CA  1 
ATOM   3554  C  C   . MET A  1  456 ? 37.343  304.977 191.462 1.00 31.06  ? 456  MET A C   1 
ATOM   3555  O  O   . MET A  1  456 ? 36.931  305.419 192.539 1.00 30.80  ? 456  MET A O   1 
ATOM   3556  C  CB  . MET A  1  456 ? 35.692  304.143 189.736 1.00 27.59  ? 456  MET A CB  1 
ATOM   3557  C  CG  . MET A  1  456 ? 34.738  304.607 188.580 1.00 29.24  ? 456  MET A CG  1 
ATOM   3558  S  SD  . MET A  1  456 ? 33.884  303.132 187.954 1.00 34.84  ? 456  MET A SD  1 
ATOM   3559  C  CE  . MET A  1  456 ? 32.667  304.049 186.937 1.00 31.14  ? 456  MET A CE  1 
ATOM   3560  N  N   . GLY A  1  457 ? 38.380  304.135 191.380 1.00 30.35  ? 457  GLY A N   1 
ATOM   3561  C  CA  . GLY A  1  457 ? 39.216  303.837 192.641 1.00 30.03  ? 457  GLY A CA  1 
ATOM   3562  C  C   . GLY A  1  457 ? 39.682  305.067 193.348 1.00 27.63  ? 457  GLY A C   1 
ATOM   3563  O  O   . GLY A  1  457 ? 39.768  305.142 194.563 1.00 29.47  ? 457  GLY A O   1 
ATOM   3564  N  N   . SER A  1  458 ? 39.961  306.074 192.594 1.00 28.20  ? 458  SER A N   1 
ATOM   3565  C  CA  . SER A  1  458 ? 40.543  307.345 193.129 1.00 28.50  ? 458  SER A CA  1 
ATOM   3566  C  C   . SER A  1  458 ? 39.550  308.067 194.044 1.00 28.95  ? 458  SER A C   1 
ATOM   3567  O  O   . SER A  1  458 ? 39.998  308.743 194.969 1.00 29.00  ? 458  SER A O   1 
ATOM   3568  C  CB  . SER A  1  458 ? 41.054  308.259 191.970 1.00 29.38  ? 458  SER A CB  1 
ATOM   3569  O  OG  . SER A  1  458 ? 39.983  309.072 191.314 1.00 27.70  ? 458  SER A OG  1 
ATOM   3570  N  N   . PHE A  1  459 ? 38.247  308.053 193.697 1.00 29.94  ? 459  PHE A N   1 
ATOM   3571  C  CA  . PHE A  1  459 ? 37.185  308.553 194.556 1.00 28.41  ? 459  PHE A CA  1 
ATOM   3572  C  C   . PHE A  1  459 ? 37.031  307.708 195.827 1.00 29.92  ? 459  PHE A C   1 
ATOM   3573  O  O   . PHE A  1  459 ? 36.691  308.261 196.830 1.00 31.50  ? 459  PHE A O   1 
ATOM   3574  C  CB  . PHE A  1  459 ? 35.821  308.525 193.840 1.00 28.28  ? 459  PHE A CB  1 
ATOM   3575  C  CG  . PHE A  1  459 ? 35.512  309.811 193.077 1.00 30.75  ? 459  PHE A CG  1 
ATOM   3576  C  CD1 . PHE A  1  459 ? 34.245  310.375 193.090 1.00 30.10  ? 459  PHE A CD1 1 
ATOM   3577  C  CD2 . PHE A  1  459 ? 36.563  310.472 192.395 1.00 30.42  ? 459  PHE A CD2 1 
ATOM   3578  C  CE1 . PHE A  1  459 ? 34.030  311.580 192.337 1.00 26.80  ? 459  PHE A CE1 1 
ATOM   3579  C  CE2 . PHE A  1  459 ? 36.378  311.627 191.589 1.00 29.47  ? 459  PHE A CE2 1 
ATOM   3580  C  CZ  . PHE A  1  459 ? 35.083  312.192 191.573 1.00 31.49  ? 459  PHE A CZ  1 
ATOM   3581  N  N   . ILE A  1  460 ? 37.213  306.389 195.763 1.00 27.08  ? 460  ILE A N   1 
ATOM   3582  C  CA  . ILE A  1  460 ? 37.168  305.582 196.993 1.00 27.68  ? 460  ILE A CA  1 
ATOM   3583  C  C   . ILE A  1  460 ? 38.220  306.056 197.990 1.00 30.27  ? 460  ILE A C   1 
ATOM   3584  O  O   . ILE A  1  460 ? 37.936  306.247 199.218 1.00 27.47  ? 460  ILE A O   1 
ATOM   3585  C  CB  . ILE A  1  460 ? 37.381  304.055 196.735 1.00 28.25  ? 460  ILE A CB  1 
ATOM   3586  C  CG1 . ILE A  1  460 ? 36.145  303.505 195.931 1.00 29.90  ? 460  ILE A CG1 1 
ATOM   3587  C  CG2 . ILE A  1  460 ? 37.501  303.278 198.177 1.00 23.45  ? 460  ILE A CG2 1 
ATOM   3588  C  CD1 . ILE A  1  460 ? 36.209  302.013 195.449 1.00 29.86  ? 460  ILE A CD1 1 
ATOM   3589  N  N   . SER A  1  461 ? 39.478  306.190 197.520 1.00 30.37  ? 461  SER A N   1 
ATOM   3590  C  CA  . SER A  1  461 ? 40.481  306.852 198.399 1.00 29.76  ? 461  SER A CA  1 
ATOM   3591  C  C   . SER A  1  461 ? 40.148  308.270 198.855 1.00 32.17  ? 461  SER A C   1 
ATOM   3592  O  O   . SER A  1  461 ? 40.489  308.613 200.009 1.00 32.05  ? 461  SER A O   1 
ATOM   3593  C  CB  . SER A  1  461 ? 41.877  306.832 197.774 1.00 29.09  ? 461  SER A CB  1 
ATOM   3594  O  OG  . SER A  1  461 ? 42.131  305.514 197.443 1.00 30.54  ? 461  SER A OG  1 
ATOM   3595  N  N   . LEU A  1  462 ? 39.525  309.147 198.014 1.00 32.67  ? 462  LEU A N   1 
ATOM   3596  C  CA  . LEU A  1  462 ? 38.960  310.394 198.547 1.00 31.34  ? 462  LEU A CA  1 
ATOM   3597  C  C   . LEU A  1  462 ? 38.067  310.208 199.787 1.00 32.38  ? 462  LEU A C   1 
ATOM   3598  O  O   . LEU A  1  462 ? 38.211  310.951 200.799 1.00 30.01  ? 462  LEU A O   1 
ATOM   3599  C  CB  . LEU A  1  462 ? 38.118  311.187 197.511 1.00 30.78  ? 462  LEU A CB  1 
ATOM   3600  C  CG  . LEU A  1  462 ? 37.405  312.457 197.982 1.00 31.47  ? 462  LEU A CG  1 
ATOM   3601  C  CD1 . LEU A  1  462 ? 38.287  313.644 198.654 1.00 31.84  ? 462  LEU A CD1 1 
ATOM   3602  C  CD2 . LEU A  1  462 ? 36.528  312.928 196.810 1.00 31.26  ? 462  LEU A CD2 1 
ATOM   3603  N  N   . THR A  1  463 ? 37.150  309.230 199.711 1.00 29.88  ? 463  THR A N   1 
ATOM   3604  C  CA  . THR A  1  463 ? 36.255  309.029 200.820 1.00 32.05  ? 463  THR A CA  1 
ATOM   3605  C  C   . THR A  1  463 ? 37.038  308.660 202.118 1.00 31.94  ? 463  THR A C   1 
ATOM   3606  O  O   . THR A  1  463 ? 36.668  309.141 203.214 1.00 30.35  ? 463  THR A O   1 
ATOM   3607  C  CB  . THR A  1  463 ? 35.214  307.939 200.443 1.00 33.89  ? 463  THR A CB  1 
ATOM   3608  O  OG1 . THR A  1  463 ? 34.427  308.459 199.359 1.00 32.23  ? 463  THR A OG1 1 
ATOM   3609  C  CG2 . THR A  1  463 ? 34.297  307.504 201.651 1.00 28.55  ? 463  THR A CG2 1 
ATOM   3610  N  N   . ALA A  1  464 ? 38.089  307.830 201.971 1.00 31.76  ? 464  ALA A N   1 
ATOM   3611  C  CA  . ALA A  1  464 ? 38.962  307.454 203.064 1.00 32.17  ? 464  ALA A CA  1 
ATOM   3612  C  C   . ALA A  1  464 ? 39.669  308.680 203.625 1.00 32.61  ? 464  ALA A C   1 
ATOM   3613  O  O   . ALA A  1  464 ? 39.757  308.869 204.844 1.00 33.18  ? 464  ALA A O   1 
ATOM   3614  C  CB  . ALA A  1  464 ? 39.953  306.377 202.637 1.00 30.65  ? 464  ALA A CB  1 
ATOM   3615  N  N   . VAL A  1  465 ? 40.159  309.567 202.783 1.00 33.75  ? 465  VAL A N   1 
ATOM   3616  C  CA  . VAL A  1  465 ? 40.800  310.836 203.295 1.00 32.46  ? 465  VAL A CA  1 
ATOM   3617  C  C   . VAL A  1  465 ? 39.815  311.714 204.082 1.00 32.75  ? 465  VAL A C   1 
ATOM   3618  O  O   . VAL A  1  465 ? 40.127  312.163 205.148 1.00 32.29  ? 465  VAL A O   1 
ATOM   3619  C  CB  . VAL A  1  465 ? 41.425  311.657 202.081 1.00 34.15  ? 465  VAL A CB  1 
ATOM   3620  C  CG1 . VAL A  1  465 ? 41.948  313.004 202.595 1.00 36.46  ? 465  VAL A CG1 1 
ATOM   3621  C  CG2 . VAL A  1  465 ? 42.514  310.839 201.589 1.00 38.33  ? 465  VAL A CG2 1 
ATOM   3622  N  N   . MET A  1  466 ? 38.596  311.911 203.576 1.00 32.44  ? 466  MET A N   1 
ATOM   3623  C  CA  . MET A  1  466 ? 37.616  312.739 204.319 1.00 32.16  ? 466  MET A CA  1 
ATOM   3624  C  C   . MET A  1  466 ? 37.350  312.026 205.687 1.00 31.53  ? 466  MET A C   1 
ATOM   3625  O  O   . MET A  1  466 ? 37.273  312.656 206.737 1.00 31.97  ? 466  MET A O   1 
ATOM   3626  C  CB  . MET A  1  466 ? 36.354  312.910 203.470 1.00 30.38  ? 466  MET A CB  1 
ATOM   3627  C  CG  . MET A  1  466 ? 36.658  313.601 202.091 1.00 28.47  ? 466  MET A CG  1 
ATOM   3628  S  SD  . MET A  1  466 ? 35.064  313.949 201.369 1.00 33.31  ? 466  MET A SD  1 
ATOM   3629  C  CE  . MET A  1  466 ? 34.480  312.355 200.942 1.00 29.24  ? 466  MET A CE  1 
ATOM   3630  N  N   . LEU A  1  467 ? 37.296  310.716 205.675 1.00 30.89  ? 467  LEU A N   1 
ATOM   3631  C  CA  . LEU A  1  467 ? 37.061  310.001 206.927 1.00 31.30  ? 467  LEU A CA  1 
ATOM   3632  C  C   . LEU A  1  467 ? 38.220  310.152 207.892 1.00 33.42  ? 467  LEU A C   1 
ATOM   3633  O  O   . LEU A  1  467 ? 38.017  310.371 209.079 1.00 33.33  ? 467  LEU A O   1 
ATOM   3634  C  CB  . LEU A  1  467 ? 36.713  308.523 206.656 1.00 30.52  ? 467  LEU A CB  1 
ATOM   3635  C  CG  . LEU A  1  467 ? 36.134  307.719 207.862 1.00 37.48  ? 467  LEU A CG  1 
ATOM   3636  C  CD1 . LEU A  1  467 ? 34.660  308.198 208.212 1.00 36.92  ? 467  LEU A CD1 1 
ATOM   3637  C  CD2 . LEU A  1  467 ? 36.204  306.187 207.708 1.00 32.08  ? 467  LEU A CD2 1 
ATOM   3638  N  N   . MET A  1  468 ? 39.449  310.027 207.395 1.00 31.67  ? 468  MET A N   1 
ATOM   3639  C  CA  . MET A  1  468 ? 40.599  310.262 208.219 1.00 31.32  ? 468  MET A CA  1 
ATOM   3640  C  C   . MET A  1  468 ? 40.425  311.571 209.005 1.00 32.87  ? 468  MET A C   1 
ATOM   3641  O  O   . MET A  1  468 ? 40.726  311.631 210.207 1.00 33.40  ? 468  MET A O   1 
ATOM   3642  C  CB  . MET A  1  468 ? 41.821  310.393 207.324 1.00 31.49  ? 468  MET A CB  1 
ATOM   3643  C  CG  . MET A  1  468 ? 43.113  310.423 208.111 1.00 32.97  ? 468  MET A CG  1 
ATOM   3644  S  SD  . MET A  1  468 ? 44.633  310.925 207.225 1.00 39.97  ? 468  MET A SD  1 
ATOM   3645  C  CE  . MET A  1  468 ? 44.212  312.593 206.648 1.00 35.23  ? 468  MET A CE  1 
ATOM   3646  N  N   . VAL A  1  469 ? 40.022  312.641 208.330 1.00 31.51  ? 469  VAL A N   1 
ATOM   3647  C  CA  . VAL A  1  469 ? 39.869  314.015 208.975 1.00 29.72  ? 469  VAL A CA  1 
ATOM   3648  C  C   . VAL A  1  469 ? 38.854  313.932 210.114 1.00 31.41  ? 469  VAL A C   1 
ATOM   3649  O  O   . VAL A  1  469 ? 39.138  314.368 211.273 1.00 29.02  ? 469  VAL A O   1 
ATOM   3650  C  CB  . VAL A  1  469 ? 39.514  315.070 207.928 1.00 31.30  ? 469  VAL A CB  1 
ATOM   3651  C  CG1 . VAL A  1  469 ? 39.208  316.493 208.675 1.00 28.44  ? 469  VAL A CG1 1 
ATOM   3652  C  CG2 . VAL A  1  469 ? 40.874  315.339 206.968 1.00 25.30  ? 469  VAL A CG2 1 
ATOM   3653  N  N   . PHE A  1  470 ? 37.737  313.254 209.835 1.00 28.92  ? 470  PHE A N   1 
ATOM   3654  C  CA  . PHE A  1  470 ? 36.699  313.231 210.824 1.00 29.49  ? 470  PHE A CA  1 
ATOM   3655  C  C   . PHE A  1  470 ? 37.252  312.381 211.981 1.00 29.58  ? 470  PHE A C   1 
ATOM   3656  O  O   . PHE A  1  470 ? 37.037  312.656 213.122 1.00 29.96  ? 470  PHE A O   1 
ATOM   3657  C  CB  . PHE A  1  470 ? 35.523  312.457 210.246 1.00 26.45  ? 470  PHE A CB  1 
ATOM   3658  C  CG  . PHE A  1  470 ? 34.739  311.731 211.315 1.00 29.40  ? 470  PHE A CG  1 
ATOM   3659  C  CD1 . PHE A  1  470 ? 33.808  312.465 212.078 1.00 32.71  ? 470  PHE A CD1 1 
ATOM   3660  C  CD2 . PHE A  1  470 ? 34.870  310.307 211.478 1.00 31.56  ? 470  PHE A CD2 1 
ATOM   3661  C  CE1 . PHE A  1  470 ? 32.952  311.812 213.006 1.00 34.75  ? 470  PHE A CE1 1 
ATOM   3662  C  CE2 . PHE A  1  470 ? 34.106  309.643 212.436 1.00 33.85  ? 470  PHE A CE2 1 
ATOM   3663  C  CZ  . PHE A  1  470 ? 33.105  310.447 213.230 1.00 30.76  ? 470  PHE A CZ  1 
ATOM   3664  N  N   . ILE A  1  471 ? 37.952  311.287 211.690 1.00 29.11  ? 471  ILE A N   1 
ATOM   3665  C  CA  . ILE A  1  471 ? 38.547  310.458 212.778 1.00 29.87  ? 471  ILE A CA  1 
ATOM   3666  C  C   . ILE A  1  471 ? 39.485  311.222 213.731 1.00 29.34  ? 471  ILE A C   1 
ATOM   3667  O  O   . ILE A  1  471 ? 39.468  311.064 214.950 1.00 33.99  ? 471  ILE A O   1 
ATOM   3668  C  CB  . ILE A  1  471 ? 39.227  309.207 212.201 1.00 28.72  ? 471  ILE A CB  1 
ATOM   3669  C  CG1 . ILE A  1  471 ? 38.151  308.319 211.569 1.00 29.65  ? 471  ILE A CG1 1 
ATOM   3670  C  CG2 . ILE A  1  471 ? 39.945  308.473 213.294 1.00 29.89  ? 471  ILE A CG2 1 
ATOM   3671  C  CD1 . ILE A  1  471 ? 38.791  307.059 210.836 1.00 30.15  ? 471  ILE A CD1 1 
ATOM   3672  N  N   . ILE A  1  472 ? 40.241  312.119 213.184 1.00 28.87  ? 472  ILE A N   1 
ATOM   3673  C  CA  . ILE A  1  472 ? 41.171  312.888 213.990 1.00 29.70  ? 472  ILE A CA  1 
ATOM   3674  C  C   . ILE A  1  472 ? 40.298  313.883 214.743 1.00 31.61  ? 472  ILE A C   1 
ATOM   3675  O  O   . ILE A  1  472 ? 40.519  314.101 215.942 1.00 30.69  ? 472  ILE A O   1 
ATOM   3676  C  CB  . ILE A  1  472 ? 42.188  313.604 213.132 1.00 32.17  ? 472  ILE A CB  1 
ATOM   3677  C  CG1 . ILE A  1  472 ? 43.107  312.543 212.417 1.00 30.06  ? 472  ILE A CG1 1 
ATOM   3678  C  CG2 . ILE A  1  472 ? 43.067  314.604 213.999 1.00 28.47  ? 472  ILE A CG2 1 
ATOM   3679  C  CD1 . ILE A  1  472 ? 43.960  313.277 211.289 1.00 29.41  ? 472  ILE A CD1 1 
ATOM   3680  N  N   . TRP A  1  473 ? 39.306  314.469 214.080 1.00 27.87  ? 473  TRP A N   1 
ATOM   3681  C  CA  . TRP A  1  473 ? 38.388  315.320 214.861 1.00 30.40  ? 473  TRP A CA  1 
ATOM   3682  C  C   . TRP A  1  473 ? 37.749  314.606 216.059 1.00 31.00  ? 473  TRP A C   1 
ATOM   3683  O  O   . TRP A  1  473 ? 37.697  315.142 217.194 1.00 31.53  ? 473  TRP A O   1 
ATOM   3684  C  CB  . TRP A  1  473 ? 37.229  315.788 213.971 1.00 29.59  ? 473  TRP A CB  1 
ATOM   3685  C  CG  . TRP A  1  473 ? 36.217  316.607 214.777 1.00 30.56  ? 473  TRP A CG  1 
ATOM   3686  C  CD1 . TRP A  1  473 ? 36.385  317.885 215.322 1.00 30.59  ? 473  TRP A CD1 1 
ATOM   3687  C  CD2 . TRP A  1  473 ? 34.892  316.145 215.179 1.00 31.87  ? 473  TRP A CD2 1 
ATOM   3688  N  NE1 . TRP A  1  473 ? 35.218  318.211 216.059 1.00 31.06  ? 473  TRP A NE1 1 
ATOM   3689  C  CE2 . TRP A  1  473 ? 34.303  317.169 215.963 1.00 30.69  ? 473  TRP A CE2 1 
ATOM   3690  C  CE3 . TRP A  1  473 ? 34.197  314.930 215.011 1.00 29.24  ? 473  TRP A CE3 1 
ATOM   3691  C  CZ2 . TRP A  1  473 ? 32.998  317.032 216.513 1.00 28.28  ? 473  TRP A CZ2 1 
ATOM   3692  C  CZ3 . TRP A  1  473 ? 32.877  314.803 215.530 1.00 31.90  ? 473  TRP A CZ3 1 
ATOM   3693  C  CH2 . TRP A  1  473 ? 32.321  315.826 216.286 1.00 30.23  ? 473  TRP A CH2 1 
ATOM   3694  N  N   . GLU A  1  474 ? 37.263  313.407 215.801 1.00 32.52  ? 474  GLU A N   1 
ATOM   3695  C  CA  . GLU A  1  474 ? 36.594  312.633 216.835 1.00 32.48  ? 474  GLU A CA  1 
ATOM   3696  C  C   . GLU A  1  474 ? 37.534  312.411 218.016 1.00 32.81  ? 474  GLU A C   1 
ATOM   3697  O  O   . GLU A  1  474 ? 37.088  312.419 219.200 1.00 31.51  ? 474  GLU A O   1 
ATOM   3698  C  CB  . GLU A  1  474 ? 36.050  311.324 216.292 1.00 31.47  ? 474  GLU A CB  1 
ATOM   3699  C  CG  . GLU A  1  474 ? 34.974  310.617 217.250 1.00 37.31  ? 474  GLU A CG  1 
ATOM   3700  C  CD  . GLU A  1  474 ? 35.658  309.813 218.369 1.00 36.93  ? 474  GLU A CD  1 
ATOM   3701  O  OE1 . GLU A  1  474 ? 35.067  309.642 219.465 1.00 36.72  ? 474  GLU A OE1 1 
ATOM   3702  O  OE2 . GLU A  1  474 ? 36.815  309.342 218.193 1.00 36.20  ? 474  GLU A OE2 1 
ATOM   3703  N  N   . ALA A  1  475 ? 38.843  312.199 217.769 1.00 30.35  ? 475  ALA A N   1 
ATOM   3704  C  CA  . ALA A  1  475 ? 39.681  311.883 218.939 1.00 29.56  ? 475  ALA A CA  1 
ATOM   3705  C  C   . ALA A  1  475 ? 39.813  313.125 219.841 1.00 31.01  ? 475  ALA A C   1 
ATOM   3706  O  O   . ALA A  1  475 ? 39.789  313.063 221.108 1.00 31.73  ? 475  ALA A O   1 
ATOM   3707  C  CB  . ALA A  1  475 ? 41.043  311.430 218.400 1.00 28.55  ? 475  ALA A CB  1 
ATOM   3708  N  N   . PHE A  1  476 ? 40.105  314.267 219.194 1.00 29.12  ? 476  PHE A N   1 
ATOM   3709  C  CA  . PHE A  1  476 ? 40.282  315.505 219.913 1.00 29.33  ? 476  PHE A CA  1 
ATOM   3710  C  C   . PHE A  1  476 ? 38.968  315.963 220.502 1.00 29.04  ? 476  PHE A C   1 
ATOM   3711  O  O   . PHE A  1  476 ? 39.034  316.598 221.586 1.00 31.38  ? 476  PHE A O   1 
ATOM   3712  C  CB  . PHE A  1  476 ? 40.807  316.585 218.976 1.00 27.06  ? 476  PHE A CB  1 
ATOM   3713  C  CG  . PHE A  1  476 ? 42.304  316.536 218.756 1.00 30.21  ? 476  PHE A CG  1 
ATOM   3714  C  CD1 . PHE A  1  476 ? 42.838  316.340 217.460 1.00 33.16  ? 476  PHE A CD1 1 
ATOM   3715  C  CD2 . PHE A  1  476 ? 43.198  316.751 219.836 1.00 28.90  ? 476  PHE A CD2 1 
ATOM   3716  C  CE1 . PHE A  1  476 ? 44.246  316.295 217.274 1.00 30.91  ? 476  PHE A CE1 1 
ATOM   3717  C  CE2 . PHE A  1  476 ? 44.566  316.748 219.674 1.00 27.72  ? 476  PHE A CE2 1 
ATOM   3718  C  CZ  . PHE A  1  476 ? 45.118  316.533 218.344 1.00 31.37  ? 476  PHE A CZ  1 
ATOM   3719  N  N   . ALA A  1  477 ? 37.813  315.611 219.859 1.00 28.22  ? 477  ALA A N   1 
ATOM   3720  C  CA  . ALA A  1  477 ? 36.452  315.944 220.374 1.00 28.25  ? 477  ALA A CA  1 
ATOM   3721  C  C   . ALA A  1  477 ? 36.055  315.161 221.621 1.00 30.59  ? 477  ALA A C   1 
ATOM   3722  O  O   . ALA A  1  477 ? 35.386  315.747 222.490 1.00 30.99  ? 477  ALA A O   1 
ATOM   3723  C  CB  . ALA A  1  477 ? 35.379  315.834 219.348 1.00 23.91  ? 477  ALA A CB  1 
ATOM   3724  N  N   . SER A  1  478 ? 36.381  313.860 221.671 1.00 30.13  ? 478  SER A N   1 
ATOM   3725  C  CA  . SER A  1  478 ? 36.077  313.007 222.805 1.00 31.73  ? 478  SER A CA  1 
ATOM   3726  C  C   . SER A  1  478 ? 37.034  313.024 224.011 1.00 31.42  ? 478  SER A C   1 
ATOM   3727  O  O   . SER A  1  478 ? 36.582  312.941 225.106 1.00 33.92  ? 478  SER A O   1 
ATOM   3728  C  CB  . SER A  1  478 ? 35.821  311.583 222.352 1.00 28.15  ? 478  SER A CB  1 
ATOM   3729  O  OG  . SER A  1  478 ? 34.753  311.672 221.438 1.00 30.81  ? 478  SER A OG  1 
ATOM   3730  N  N   . LYS A  1  479 ? 38.327  313.296 223.796 1.00 33.99  ? 479  LYS A N   1 
ATOM   3731  C  CA  . LYS A  1  479 ? 39.387  313.405 224.777 1.00 31.32  ? 479  LYS A CA  1 
ATOM   3732  C  C   . LYS A  1  479 ? 39.425  312.206 225.720 1.00 32.35  ? 479  LYS A C   1 
ATOM   3733  O  O   . LYS A  1  479 ? 39.298  312.373 226.935 1.00 32.53  ? 479  LYS A O   1 
ATOM   3734  C  CB  . LYS A  1  479 ? 39.259  314.668 225.638 1.00 30.18  ? 479  LYS A CB  1 
ATOM   3735  C  CG  . LYS A  1  479 ? 39.201  316.004 224.884 1.00 31.26  ? 479  LYS A CG  1 
ATOM   3736  C  CD  . LYS A  1  479 ? 39.046  317.215 225.823 1.00 32.08  ? 479  LYS A CD  1 
ATOM   3737  C  CE  . LYS A  1  479 ? 39.786  318.399 225.270 1.00 30.31  ? 479  LYS A CE  1 
ATOM   3738  N  NZ  . LYS A  1  479 ? 39.520  319.809 225.944 1.00 30.89  ? 479  LYS A NZ  1 
ATOM   3739  N  N   . ARG A  1  480 ? 39.599  311.011 225.184 1.00 30.49  ? 480  ARG A N   1 
ATOM   3740  C  CA  . ARG A  1  480 ? 39.950  309.859 225.993 1.00 27.53  ? 480  ARG A CA  1 
ATOM   3741  C  C   . ARG A  1  480 ? 41.413  309.909 226.257 1.00 31.60  ? 480  ARG A C   1 
ATOM   3742  O  O   . ARG A  1  480 ? 42.249  309.673 225.338 1.00 30.42  ? 480  ARG A O   1 
ATOM   3743  C  CB  . ARG A  1  480 ? 39.670  308.624 225.160 1.00 26.99  ? 480  ARG A CB  1 
ATOM   3744  C  CG  . ARG A  1  480 ? 38.251  308.487 224.745 1.00 24.55  ? 480  ARG A CG  1 
ATOM   3745  C  CD  . ARG A  1  480 ? 38.112  307.265 223.835 1.00 29.25  ? 480  ARG A CD  1 
ATOM   3746  N  NE  . ARG A  1  480 ? 38.620  307.693 222.476 1.00 27.58  ? 480  ARG A NE  1 
ATOM   3747  C  CZ  . ARG A  1  480 ? 37.914  308.193 221.464 1.00 33.68  ? 480  ARG A CZ  1 
ATOM   3748  N  NH1 . ARG A  1  480 ? 36.565  308.308 221.514 1.00 26.89  ? 480  ARG A NH1 1 
ATOM   3749  N  NH2 . ARG A  1  480 ? 38.585  308.586 220.352 1.00 27.44  ? 480  ARG A NH2 1 
ATOM   3750  N  N   . GLU A  1  481 ? 41.804  310.061 227.508 1.00 30.24  ? 481  GLU A N   1 
ATOM   3751  C  CA  . GLU A  1  481 ? 43.222  310.359 227.772 1.00 31.25  ? 481  GLU A CA  1 
ATOM   3752  C  C   . GLU A  1  481 ? 43.931  309.043 228.067 1.00 32.11  ? 481  GLU A C   1 
ATOM   3753  O  O   . GLU A  1  481 ? 43.392  308.193 228.769 1.00 29.84  ? 481  GLU A O   1 
ATOM   3754  C  CB  . GLU A  1  481 ? 43.376  311.336 228.970 1.00 31.52  ? 481  GLU A CB  1 
ATOM   3755  C  CG  . GLU A  1  481 ? 43.076  312.780 228.593 1.00 30.64  ? 481  GLU A CG  1 
ATOM   3756  C  CD  . GLU A  1  481 ? 43.017  313.684 229.870 1.00 36.55  ? 481  GLU A CD  1 
ATOM   3757  O  OE1 . GLU A  1  481 ? 42.778  314.903 229.779 1.00 36.53  ? 481  GLU A OE1 1 
ATOM   3758  O  OE2 . GLU A  1  481 ? 43.151  313.168 230.956 1.00 38.54  ? 481  GLU A OE2 1 
ATOM   3759  N  N   . VAL A  1  482 ? 45.189  308.910 227.615 1.00 30.69  ? 482  VAL A N   1 
ATOM   3760  C  CA  . VAL A  1  482 ? 45.911  307.645 227.707 1.00 29.75  ? 482  VAL A CA  1 
ATOM   3761  C  C   . VAL A  1  482 ? 46.230  307.349 229.192 1.00 33.81  ? 482  VAL A C   1 
ATOM   3762  O  O   . VAL A  1  482 ? 46.537  308.282 229.955 1.00 35.24  ? 482  VAL A O   1 
ATOM   3763  C  CB  . VAL A  1  482 ? 47.303  307.758 226.880 1.00 31.88  ? 482  VAL A CB  1 
ATOM   3764  C  CG1 . VAL A  1  482 ? 48.227  306.600 227.226 1.00 29.38  ? 482  VAL A CG1 1 
ATOM   3765  C  CG2 . VAL A  1  482 ? 46.990  307.812 225.352 1.00 26.50  ? 482  VAL A CG2 1 
ATOM   3766  N  N   . LEU A  1  483 ? 46.197  306.071 229.594 1.00 31.38  ? 483  LEU A N   1 
ATOM   3767  C  CA  . LEU A  1  483 ? 46.544  305.703 230.997 1.00 32.84  ? 483  LEU A CA  1 
ATOM   3768  C  C   . LEU A  1  483 ? 47.811  304.863 230.941 1.00 33.89  ? 483  LEU A C   1 
ATOM   3769  O  O   . LEU A  1  483 ? 48.804  305.204 231.614 1.00 36.15  ? 483  LEU A O   1 
ATOM   3770  C  CB  . LEU A  1  483 ? 45.409  304.859 231.694 1.00 30.90  ? 483  LEU A CB  1 
ATOM   3771  C  CG  . LEU A  1  483 ? 44.206  305.676 232.073 1.00 34.62  ? 483  LEU A CG  1 
ATOM   3772  C  CD1 . LEU A  1  483 ? 42.946  304.802 232.554 1.00 30.73  ? 483  LEU A CD1 1 
ATOM   3773  C  CD2 . LEU A  1  483 ? 44.612  306.831 233.020 1.00 31.21  ? 483  LEU A CD2 1 
ATOM   3774  N  N   . THR A  1  484 ? 47.819  303.808 230.106 1.00 33.18  ? 484  THR A N   1 
ATOM   3775  C  CA  . THR A  1  484 ? 48.909  302.826 230.148 1.00 34.10  ? 484  THR A CA  1 
ATOM   3776  C  C   . THR A  1  484 ? 49.345  302.397 228.686 1.00 34.04  ? 484  THR A C   1 
ATOM   3777  O  O   . THR A  1  484 ? 48.486  302.267 227.833 1.00 31.74  ? 484  THR A O   1 
ATOM   3778  C  CB  . THR A  1  484 ? 48.320  301.618 230.837 1.00 35.64  ? 484  THR A CB  1 
ATOM   3779  O  OG1 . THR A  1  484 ? 48.300  301.820 232.323 1.00 44.04  ? 484  THR A OG1 1 
ATOM   3780  C  CG2 . THR A  1  484 ? 49.008  300.453 230.588 1.00 41.08  ? 484  THR A CG2 1 
ATOM   3781  N  N   . VAL A  1  485 ? 50.607  301.979 228.480 1.00 31.30  ? 485  VAL A N   1 
ATOM   3782  C  CA  . VAL A  1  485 ? 50.994  301.637 227.140 1.00 33.64  ? 485  VAL A CA  1 
ATOM   3783  C  C   . VAL A  1  485 ? 51.900  300.450 227.410 1.00 32.94  ? 485  VAL A C   1 
ATOM   3784  O  O   . VAL A  1  485 ? 52.763  300.570 228.227 1.00 30.76  ? 485  VAL A O   1 
ATOM   3785  C  CB  . VAL A  1  485 ? 51.847  302.841 226.494 1.00 34.36  ? 485  VAL A CB  1 
ATOM   3786  C  CG1 . VAL A  1  485 ? 52.621  302.381 225.264 1.00 34.12  ? 485  VAL A CG1 1 
ATOM   3787  C  CG2 . VAL A  1  485 ? 50.969  304.171 226.256 1.00 35.02  ? 485  VAL A CG2 1 
ATOM   3788  N  N   . ASP A  1  486 ? 51.798  299.367 226.678 1.00 31.88  ? 486  ASP A N   1 
ATOM   3789  C  CA  . ASP A  1  486 ? 52.686  298.250 226.871 1.00 33.98  ? 486  ASP A CA  1 
ATOM   3790  C  C   . ASP A  1  486 ? 54.036  298.389 226.194 1.00 33.58  ? 486  ASP A C   1 
ATOM   3791  O  O   . ASP A  1  486 ? 54.204  299.190 225.303 1.00 32.79  ? 486  ASP A O   1 
ATOM   3792  C  CB  . ASP A  1  486 ? 52.086  297.083 226.097 1.00 37.33  ? 486  ASP A CB  1 
ATOM   3793  C  CG  . ASP A  1  486 ? 50.962  296.471 226.836 1.00 48.26  ? 486  ASP A CG  1 
ATOM   3794  O  OD1 . ASP A  1  486 ? 51.250  295.825 227.871 1.00 66.37  ? 486  ASP A OD1 1 
ATOM   3795  O  OD2 . ASP A  1  486 ? 49.852  296.613 226.384 1.00 54.07  ? 486  ASP A OD2 1 
ATOM   3796  N  N   . LEU A  1  487 ? 54.949  297.523 226.562 1.00 30.51  ? 487  LEU A N   1 
ATOM   3797  C  CA  . LEU A  1  487 ? 56.270  297.380 225.917 1.00 31.26  ? 487  LEU A CA  1 
ATOM   3798  C  C   . LEU A  1  487 ? 57.044  298.627 226.006 1.00 29.89  ? 487  LEU A C   1 
ATOM   3799  O  O   . LEU A  1  487 ? 57.897  298.819 225.173 1.00 31.45  ? 487  LEU A O   1 
ATOM   3800  C  CB  . LEU A  1  487 ? 56.188  296.923 224.417 1.00 28.83  ? 487  LEU A CB  1 
ATOM   3801  C  CG  . LEU A  1  487 ? 55.185  295.739 224.127 1.00 28.57  ? 487  LEU A CG  1 
ATOM   3802  C  CD1 . LEU A  1  487 ? 55.038  295.451 222.615 1.00 30.28  ? 487  LEU A CD1 1 
ATOM   3803  C  CD2 . LEU A  1  487 ? 55.703  294.431 224.855 1.00 37.82  ? 487  LEU A CD2 1 
ATOM   3804  N  N   . THR A  1  488 ? 56.862  299.441 227.045 1.00 29.50  ? 488  THR A N   1 
ATOM   3805  C  CA  . THR A  1  488 ? 57.727  300.604 227.159 1.00 29.81  ? 488  THR A CA  1 
ATOM   3806  C  C   . THR A  1  488 ? 59.242  300.223 227.344 1.00 31.00  ? 488  THR A C   1 
ATOM   3807  O  O   . THR A  1  488 ? 60.167  301.097 227.111 1.00 29.62  ? 488  THR A O   1 
ATOM   3808  C  CB  . THR A  1  488 ? 57.317  301.598 228.297 1.00 33.67  ? 488  THR A CB  1 
ATOM   3809  O  OG1 . THR A  1  488 ? 57.366  300.921 229.574 1.00 33.68  ? 488  THR A OG1 1 
ATOM   3810  C  CG2 . THR A  1  488 ? 55.932  302.233 228.080 1.00 33.80  ? 488  THR A CG2 1 
ATOM   3811  N  N   . THR A  1  489 ? 59.517  298.988 227.778 1.00 29.16  ? 489  THR A N   1 
ATOM   3812  C  CA  . THR A  1  489 ? 60.879  298.657 228.131 1.00 30.89  ? 489  THR A CA  1 
ATOM   3813  C  C   . THR A  1  489 ? 61.725  298.608 226.820 1.00 30.00  ? 489  THR A C   1 
ATOM   3814  O  O   . THR A  1  489 ? 62.918  298.652 226.856 1.00 30.63  ? 489  THR A O   1 
ATOM   3815  C  CB  . THR A  1  489 ? 61.031  297.270 228.823 1.00 31.64  ? 489  THR A CB  1 
ATOM   3816  O  OG1 . THR A  1  489 ? 60.365  296.294 228.073 1.00 33.40  ? 489  THR A OG1 1 
ATOM   3817  C  CG2 . THR A  1  489 ? 60.505  297.235 230.304 1.00 31.84  ? 489  THR A CG2 1 
ATOM   3818  N  N   . THR A  1  490 ? 61.077  298.464 225.665 1.00 30.65  ? 490  THR A N   1 
ATOM   3819  C  CA  . THR A  1  490 ? 61.814  298.482 224.379 1.00 29.95  ? 490  THR A CA  1 
ATOM   3820  C  C   . THR A  1  490 ? 61.230  299.470 223.427 1.00 30.38  ? 490  THR A C   1 
ATOM   3821  O  O   . THR A  1  490 ? 61.442  299.364 222.208 1.00 30.51  ? 490  THR A O   1 
ATOM   3822  C  CB  . THR A  1  490 ? 61.783  297.088 223.713 1.00 31.47  ? 490  THR A CB  1 
ATOM   3823  O  OG1 . THR A  1  490 ? 60.400  296.612 223.684 1.00 33.33  ? 490  THR A OG1 1 
ATOM   3824  C  CG2 . THR A  1  490 ? 62.604  296.101 224.593 1.00 26.82  ? 490  THR A CG2 1 
ATOM   3825  N  N   . ASN A  1  491 ? 60.586  300.497 223.975 1.00 28.79  ? 491  ASN A N   1 
ATOM   3826  C  CA  . ASN A  1  491 ? 60.057  301.649 223.210 1.00 29.68  ? 491  ASN A CA  1 
ATOM   3827  C  C   . ASN A  1  491 ? 60.150  302.899 224.053 1.00 28.88  ? 491  ASN A C   1 
ATOM   3828  O  O   . ASN A  1  491 ? 59.115  303.445 224.548 1.00 29.91  ? 491  ASN A O   1 
ATOM   3829  C  CB  . ASN A  1  491 ? 58.605  301.395 222.743 1.00 28.59  ? 491  ASN A CB  1 
ATOM   3830  C  CG  . ASN A  1  491 ? 58.495  300.181 221.859 1.00 32.73  ? 491  ASN A CG  1 
ATOM   3831  O  OD1 . ASN A  1  491 ? 58.561  300.341 220.639 1.00 25.73  ? 491  ASN A OD1 1 
ATOM   3832  N  ND2 . ASN A  1  491 ? 58.241  298.969 222.422 1.00 26.79  ? 491  ASN A ND2 1 
ATOM   3833  N  N   . LEU A  1  492 ? 61.407  303.379 224.158 1.00 26.33  ? 492  LEU A N   1 
ATOM   3834  C  CA  . LEU A  1  492 ? 61.774  304.495 225.046 1.00 26.09  ? 492  LEU A CA  1 
ATOM   3835  C  C   . LEU A  1  492 ? 60.993  305.765 224.844 1.00 27.05  ? 492  LEU A C   1 
ATOM   3836  O  O   . LEU A  1  492 ? 60.711  306.519 225.813 1.00 29.97  ? 492  LEU A O   1 
ATOM   3837  C  CB  . LEU A  1  492 ? 63.301  304.860 224.853 1.00 23.73  ? 492  LEU A CB  1 
ATOM   3838  C  CG  . LEU A  1  492 ? 63.800  306.072 225.623 1.00 25.94  ? 492  LEU A CG  1 
ATOM   3839  C  CD1 . LEU A  1  492 ? 63.575  305.870 227.186 1.00 27.57  ? 492  LEU A CD1 1 
ATOM   3840  C  CD2 . LEU A  1  492 ? 65.375  306.268 225.315 1.00 27.30  ? 492  LEU A CD2 1 
ATOM   3841  N  N   . GLU A  1  493 ? 60.599  306.032 223.588 1.00 27.94  ? 493  GLU A N   1 
ATOM   3842  C  CA  . GLU A  1  493 ? 59.836  307.264 223.275 1.00 27.56  ? 493  GLU A CA  1 
ATOM   3843  C  C   . GLU A  1  493 ? 58.532  307.373 224.029 1.00 26.39  ? 493  GLU A C   1 
ATOM   3844  O  O   . GLU A  1  493 ? 58.051  308.542 224.198 1.00 25.31  ? 493  GLU A O   1 
ATOM   3845  C  CB  . GLU A  1  493 ? 59.552  307.363 221.717 1.00 24.85  ? 493  GLU A CB  1 
ATOM   3846  C  CG  . GLU A  1  493 ? 58.440  306.373 221.209 1.00 26.79  ? 493  GLU A CG  1 
ATOM   3847  C  CD  . GLU A  1  493 ? 58.882  305.017 220.757 1.00 24.51  ? 493  GLU A CD  1 
ATOM   3848  O  OE1 . GLU A  1  493 ? 60.012  304.589 221.155 1.00 28.93  ? 493  GLU A OE1 1 
ATOM   3849  O  OE2 . GLU A  1  493 ? 58.106  304.366 219.972 1.00 30.37  ? 493  GLU A OE2 1 
ATOM   3850  N  N   . TRP A  1  494 ? 57.994  306.263 224.522 1.00 26.88  ? 494  TRP A N   1 
ATOM   3851  C  CA  . TRP A  1  494 ? 56.647  306.267 225.230 1.00 30.96  ? 494  TRP A CA  1 
ATOM   3852  C  C   . TRP A  1  494 ? 56.866  306.502 226.792 1.00 31.42  ? 494  TRP A C   1 
ATOM   3853  O  O   . TRP A  1  494 ? 55.895  306.737 227.544 1.00 30.10  ? 494  TRP A O   1 
ATOM   3854  C  CB  . TRP A  1  494 ? 55.890  304.927 225.071 1.00 30.56  ? 494  TRP A CB  1 
ATOM   3855  C  CG  . TRP A  1  494 ? 55.385  304.694 223.648 1.00 30.69  ? 494  TRP A CG  1 
ATOM   3856  C  CD1 . TRP A  1  494 ? 55.998  304.025 222.688 1.00 31.75  ? 494  TRP A CD1 1 
ATOM   3857  C  CD2 . TRP A  1  494 ? 54.093  305.116 223.122 1.00 32.11  ? 494  TRP A CD2 1 
ATOM   3858  N  NE1 . TRP A  1  494 ? 55.191  304.031 221.530 1.00 29.66  ? 494  TRP A NE1 1 
ATOM   3859  C  CE2 . TRP A  1  494 ? 54.036  304.720 221.797 1.00 31.46  ? 494  TRP A CE2 1 
ATOM   3860  C  CE3 . TRP A  1  494 ? 52.985  305.828 223.675 1.00 28.63  ? 494  TRP A CE3 1 
ATOM   3861  C  CZ2 . TRP A  1  494 ? 52.911  304.930 221.019 1.00 31.66  ? 494  TRP A CZ2 1 
ATOM   3862  C  CZ3 . TRP A  1  494 ? 51.919  306.066 222.910 1.00 34.25  ? 494  TRP A CZ3 1 
ATOM   3863  C  CH2 . TRP A  1  494 ? 51.916  305.664 221.530 1.00 30.33  ? 494  TRP A CH2 1 
ATOM   3864  N  N   . LEU A  1  495 ? 58.151  306.426 227.218 1.00 33.71  ? 495  LEU A N   1 
ATOM   3865  C  CA  . LEU A  1  495 ? 58.393  306.241 228.658 1.00 34.09  ? 495  LEU A CA  1 
ATOM   3866  C  C   . LEU A  1  495 ? 58.255  307.583 229.411 1.00 33.89  ? 495  LEU A C   1 
ATOM   3867  O  O   . LEU A  1  495 ? 58.129  307.573 230.620 1.00 34.20  ? 495  LEU A O   1 
ATOM   3868  C  CB  . LEU A  1  495 ? 59.699  305.493 228.921 1.00 33.27  ? 495  LEU A CB  1 
ATOM   3869  C  CG  . LEU A  1  495 ? 60.047  304.897 230.302 1.00 37.02  ? 495  LEU A CG  1 
ATOM   3870  C  CD1 . LEU A  1  495 ? 59.034  303.914 230.815 1.00 36.40  ? 495  LEU A CD1 1 
ATOM   3871  C  CD2 . LEU A  1  495 ? 61.547  304.254 230.156 1.00 30.76  ? 495  LEU A CD2 1 
ATOM   3872  N  N   . ASN A  1  496 ? 58.301  308.735 228.738 1.00 31.56  ? 496  ASN A N   1 
ATOM   3873  C  CA  . ASN A  1  496 ? 57.961  309.986 229.463 1.00 29.66  ? 496  ASN A CA  1 
ATOM   3874  C  C   . ASN A  1  496 ? 56.494  310.372 229.520 1.00 29.05  ? 496  ASN A C   1 
ATOM   3875  O  O   . ASN A  1  496 ? 56.149  311.537 229.782 1.00 27.94  ? 496  ASN A O   1 
ATOM   3876  C  CB  . ASN A  1  496 ? 58.775  311.119 228.900 1.00 28.08  ? 496  ASN A CB  1 
ATOM   3877  C  CG  . ASN A  1  496 ? 60.188  311.011 229.343 1.00 32.69  ? 496  ASN A CG  1 
ATOM   3878  O  OD1 . ASN A  1  496 ? 60.488  311.330 230.489 1.00 31.76  ? 496  ASN A OD1 1 
ATOM   3879  N  ND2 . ASN A  1  496 ? 61.058  310.597 228.483 1.00 25.61  ? 496  ASN A ND2 1 
ATOM   3880  N  N   . GLY A  1  497 ? 55.609  309.414 229.290 1.00 30.70  ? 497  GLY A N   1 
ATOM   3881  C  CA  . GLY A  1  497 ? 54.184  309.772 229.211 1.00 27.70  ? 497  GLY A CA  1 
ATOM   3882  C  C   . GLY A  1  497 ? 53.631  310.366 227.916 1.00 31.47  ? 497  GLY A C   1 
ATOM   3883  O  O   . GLY A  1  497 ? 54.368  310.446 226.897 1.00 27.87  ? 497  GLY A O   1 
ATOM   3884  N  N   . CYS A  1  498 ? 52.304  310.615 227.896 1.00 28.56  ? 498  CYS A N   1 
ATOM   3885  C  CA  . CYS A  1  498 ? 51.571  310.943 226.688 1.00 30.21  ? 498  CYS A CA  1 
ATOM   3886  C  C   . CYS A  1  498 ? 50.713  312.136 227.015 1.00 31.52  ? 498  CYS A C   1 
ATOM   3887  O  O   . CYS A  1  498 ? 49.698  311.933 227.645 1.00 34.45  ? 498  CYS A O   1 
ATOM   3888  C  CB  . CYS A  1  498 ? 50.598  309.833 226.263 1.00 26.70  ? 498  CYS A CB  1 
ATOM   3889  S  SG  . CYS A  1  498 ? 51.440  308.289 225.954 1.00 31.72  ? 498  CYS A SG  1 
ATOM   3890  N  N   . PRO A  1  499 ? 51.003  313.335 226.453 1.00 32.32  ? 499  PRO A N   1 
ATOM   3891  C  CA  . PRO A  1  499 ? 52.221  313.607 225.656 1.00 32.29  ? 499  PRO A CA  1 
ATOM   3892  C  C   . PRO A  1  499 ? 53.340  313.827 226.613 1.00 33.99  ? 499  PRO A C   1 
ATOM   3893  O  O   . PRO A  1  499 ? 53.089  314.153 227.775 1.00 33.26  ? 499  PRO A O   1 
ATOM   3894  C  CB  . PRO A  1  499 ? 51.929  314.923 224.958 1.00 32.14  ? 499  PRO A CB  1 
ATOM   3895  C  CG  . PRO A  1  499 ? 50.865  315.621 225.900 1.00 30.86  ? 499  PRO A CG  1 
ATOM   3896  C  CD  . PRO A  1  499 ? 50.102  314.486 226.572 1.00 32.66  ? 499  PRO A CD  1 
ATOM   3897  N  N   . PRO A  1  500 ? 54.606  313.691 226.146 1.00 33.57  ? 500  PRO A N   1 
ATOM   3898  C  CA  . PRO A  1  500 ? 55.630  313.963 227.109 1.00 30.08  ? 500  PRO A CA  1 
ATOM   3899  C  C   . PRO A  1  500 ? 55.862  315.404 227.394 1.00 32.41  ? 500  PRO A C   1 
ATOM   3900  O  O   . PRO A  1  500 ? 55.373  316.297 226.686 1.00 35.09  ? 500  PRO A O   1 
ATOM   3901  C  CB  . PRO A  1  500 ? 56.899  313.300 226.480 1.00 33.02  ? 500  PRO A CB  1 
ATOM   3902  C  CG  . PRO A  1  500 ? 56.646  313.342 224.919 1.00 30.42  ? 500  PRO A CG  1 
ATOM   3903  C  CD  . PRO A  1  500 ? 55.104  313.273 224.810 1.00 33.67  ? 500  PRO A CD  1 
ATOM   3904  N  N   . PRO A  1  501 ? 56.544  315.712 228.516 1.00 32.73  ? 501  PRO A N   1 
ATOM   3905  C  CA  . PRO A  1  501 ? 56.640  317.163 228.800 1.00 32.01  ? 501  PRO A CA  1 
ATOM   3906  C  C   . PRO A  1  501 ? 57.461  317.897 227.752 1.00 32.41  ? 501  PRO A C   1 
ATOM   3907  O  O   . PRO A  1  501 ? 58.287  317.244 227.108 1.00 30.64  ? 501  PRO A O   1 
ATOM   3908  C  CB  . PRO A  1  501 ? 57.382  317.223 230.141 1.00 30.96  ? 501  PRO A CB  1 
ATOM   3909  C  CG  . PRO A  1  501 ? 57.276  315.838 230.715 1.00 35.78  ? 501  PRO A CG  1 
ATOM   3910  C  CD  . PRO A  1  501 ? 57.136  314.855 229.550 1.00 30.56  ? 501  PRO A CD  1 
ATOM   3911  N  N   . TYR A  1  502 ? 57.312  319.220 227.665 1.00 30.78  ? 502  TYR A N   1 
ATOM   3912  C  CA  . TYR A  1  502 ? 58.052  320.057 226.760 1.00 31.72  ? 502  TYR A CA  1 
ATOM   3913  C  C   . TYR A  1  502 ? 59.480  319.722 226.770 1.00 34.93  ? 502  TYR A C   1 
ATOM   3914  O  O   . TYR A  1  502 ? 60.076  319.387 225.664 1.00 35.62  ? 502  TYR A O   1 
ATOM   3915  C  CB  . TYR A  1  502 ? 57.829  321.489 227.160 1.00 33.79  ? 502  TYR A CB  1 
ATOM   3916  C  CG  . TYR A  1  502 ? 58.335  322.562 226.152 1.00 33.48  ? 502  TYR A CG  1 
ATOM   3917  C  CD1 . TYR A  1  502 ? 59.602  323.153 226.298 1.00 31.21  ? 502  TYR A CD1 1 
ATOM   3918  C  CD2 . TYR A  1  502 ? 57.587  322.883 225.037 1.00 34.59  ? 502  TYR A CD2 1 
ATOM   3919  C  CE1 . TYR A  1  502 ? 60.061  324.116 225.416 1.00 32.65  ? 502  TYR A CE1 1 
ATOM   3920  C  CE2 . TYR A  1  502 ? 58.045  323.859 224.166 1.00 35.49  ? 502  TYR A CE2 1 
ATOM   3921  C  CZ  . TYR A  1  502 ? 59.257  324.467 224.392 1.00 30.37  ? 502  TYR A CZ  1 
ATOM   3922  O  OH  . TYR A  1  502 ? 59.642  325.431 223.506 1.00 37.76  ? 502  TYR A OH  1 
ATOM   3923  N  N   . HIS A  1  503 ? 60.059  319.628 227.985 1.00 33.49  ? 503  HIS A N   1 
ATOM   3924  C  CA  . HIS A  1  503 ? 61.522  319.258 228.081 1.00 34.05  ? 503  HIS A CA  1 
ATOM   3925  C  C   . HIS A  1  503 ? 61.560  317.826 228.621 1.00 33.60  ? 503  HIS A C   1 
ATOM   3926  O  O   . HIS A  1  503 ? 61.106  317.596 229.766 1.00 31.34  ? 503  HIS A O   1 
ATOM   3927  C  CB  . HIS A  1  503 ? 62.342  320.173 229.080 1.00 33.95  ? 503  HIS A CB  1 
ATOM   3928  C  CG  . HIS A  1  503 ? 62.540  321.615 228.610 1.00 38.91  ? 503  HIS A CG  1 
ATOM   3929  N  ND1 . HIS A  1  503 ? 63.274  321.938 227.472 1.00 42.35  ? 503  HIS A ND1 1 
ATOM   3930  C  CD2 . HIS A  1  503 ? 62.163  322.807 229.154 1.00 38.22  ? 503  HIS A CD2 1 
ATOM   3931  C  CE1 . HIS A  1  503 ? 63.304  323.252 227.318 1.00 43.57  ? 503  HIS A CE1 1 
ATOM   3932  N  NE2 . HIS A  1  503 ? 62.611  323.799 228.304 1.00 45.66  ? 503  HIS A NE2 1 
ATOM   3933  N  N   . THR A  1  504 ? 62.164  316.873 227.882 1.00 32.52  ? 504  THR A N   1 
ATOM   3934  C  CA  . THR A  1  504 ? 62.395  315.485 228.414 1.00 29.39  ? 504  THR A CA  1 
ATOM   3935  C  C   . THR A  1  504 ? 63.929  315.277 228.465 1.00 30.78  ? 504  THR A C   1 
ATOM   3936  O  O   . THR A  1  504 ? 64.705  315.985 227.760 1.00 29.77  ? 504  THR A O   1 
ATOM   3937  C  CB  . THR A  1  504 ? 61.750  314.403 227.490 1.00 30.46  ? 504  THR A CB  1 
ATOM   3938  O  OG1 . THR A  1  504 ? 61.775  314.873 226.131 1.00 29.49  ? 504  THR A OG1 1 
ATOM   3939  C  CG2 . THR A  1  504 ? 60.266  314.172 227.887 1.00 32.20  ? 504  THR A CG2 1 
ATOM   3940  N  N   . PHE A  1  505 ? 64.339  314.317 229.274 1.00 29.81  ? 505  PHE A N   1 
ATOM   3941  C  CA  . PHE A  1  505 ? 65.709  313.913 229.428 1.00 31.49  ? 505  PHE A CA  1 
ATOM   3942  C  C   . PHE A  1  505 ? 66.492  315.139 229.865 1.00 32.14  ? 505  PHE A C   1 
ATOM   3943  O  O   . PHE A  1  505 ? 67.691  315.256 229.561 1.00 32.99  ? 505  PHE A O   1 
ATOM   3944  C  CB  . PHE A  1  505 ? 66.258  313.280 228.099 1.00 31.82  ? 505  PHE A CB  1 
ATOM   3945  C  CG  . PHE A  1  505 ? 65.464  312.028 227.719 1.00 28.89  ? 505  PHE A CG  1 
ATOM   3946  C  CD1 . PHE A  1  505 ? 65.622  310.887 228.464 1.00 32.34  ? 505  PHE A CD1 1 
ATOM   3947  C  CD2 . PHE A  1  505 ? 64.529  312.076 226.654 1.00 28.46  ? 505  PHE A CD2 1 
ATOM   3948  C  CE1 . PHE A  1  505 ? 64.921  309.718 228.169 1.00 29.69  ? 505  PHE A CE1 1 
ATOM   3949  C  CE2 . PHE A  1  505 ? 63.752  310.948 226.314 1.00 31.18  ? 505  PHE A CE2 1 
ATOM   3950  C  CZ  . PHE A  1  505 ? 63.945  309.737 227.067 1.00 32.89  ? 505  PHE A CZ  1 
ATOM   3951  N  N   . GLU A  1  506 ? 65.840  316.006 230.649 1.00 30.43  ? 506  GLU A N   1 
ATOM   3952  C  CA  . GLU A  1  506 ? 66.670  317.029 231.377 1.00 33.44  ? 506  GLU A CA  1 
ATOM   3953  C  C   . GLU A  1  506 ? 67.755  316.417 232.261 1.00 32.16  ? 506  GLU A C   1 
ATOM   3954  O  O   . GLU A  1  506 ? 68.925  316.870 232.327 1.00 30.88  ? 506  GLU A O   1 
ATOM   3955  C  CB  . GLU A  1  506 ? 65.781  317.883 232.212 1.00 33.62  ? 506  GLU A CB  1 
ATOM   3956  C  CG  . GLU A  1  506 ? 64.900  318.678 231.374 1.00 41.09  ? 506  GLU A CG  1 
ATOM   3957  C  CD  . GLU A  1  506 ? 63.994  319.588 232.215 1.00 51.06  ? 506  GLU A CD  1 
ATOM   3958  O  OE1 . GLU A  1  506 ? 63.075  319.084 232.884 1.00 52.46  ? 506  GLU A OE1 1 
ATOM   3959  O  OE2 . GLU A  1  506 ? 64.205  320.818 232.209 1.00 55.79  ? 506  GLU A OE2 1 
ATOM   3960  N  N   . GLU A  1  507 ? 67.401  315.324 232.932 1.00 31.64  ? 507  GLU A N   1 
ATOM   3961  C  CA  . GLU A  1  507 ? 68.447  314.445 233.480 1.00 30.53  ? 507  GLU A CA  1 
ATOM   3962  C  C   . GLU A  1  507 ? 68.546  313.330 232.483 1.00 31.81  ? 507  GLU A C   1 
ATOM   3963  O  O   . GLU A  1  507 ? 67.511  312.732 232.239 1.00 29.17  ? 507  GLU A O   1 
ATOM   3964  C  CB  . GLU A  1  507 ? 67.937  313.840 234.824 1.00 33.13  ? 507  GLU A CB  1 
ATOM   3965  C  CG  . GLU A  1  507 ? 68.799  312.783 235.385 1.00 33.51  ? 507  GLU A CG  1 
ATOM   3966  C  CD  . GLU A  1  507 ? 68.673  312.655 236.929 1.00 42.49  ? 507  GLU A CD  1 
ATOM   3967  O  OE1 . GLU A  1  507 ? 69.682  312.984 237.651 1.00 37.08  ? 507  GLU A OE1 1 
ATOM   3968  O  OE2 . GLU A  1  507 ? 67.539  312.294 237.323 1.00 43.69  ? 507  GLU A OE2 1 
ATOM   3969  N  N   . PRO A  1  508 ? 69.756  313.035 231.904 1.00 29.36  ? 508  PRO A N   1 
ATOM   3970  C  CA  . PRO A  1  508 ? 69.844  311.975 230.940 1.00 32.12  ? 508  PRO A CA  1 
ATOM   3971  C  C   . PRO A  1  508 ? 69.577  310.585 231.541 1.00 34.55  ? 508  PRO A C   1 
ATOM   3972  O  O   . PRO A  1  508 ? 69.703  310.421 232.781 1.00 35.76  ? 508  PRO A O   1 
ATOM   3973  C  CB  . PRO A  1  508 ? 71.315  312.053 230.456 1.00 33.87  ? 508  PRO A CB  1 
ATOM   3974  C  CG  . PRO A  1  508 ? 72.136  312.670 231.636 1.00 31.27  ? 508  PRO A CG  1 
ATOM   3975  C  CD  . PRO A  1  508 ? 71.064  313.709 232.126 1.00 33.41  ? 508  PRO A CD  1 
ATOM   3976  N  N   . THR A  1  509 ? 69.207  309.597 230.707 1.00 32.57  ? 509  THR A N   1 
ATOM   3977  C  CA  . THR A  1  509 ? 69.209  308.207 231.117 1.00 31.70  ? 509  THR A CA  1 
ATOM   3978  C  C   . THR A  1  509 ? 70.519  307.729 231.764 1.00 32.91  ? 509  THR A C   1 
ATOM   3979  O  O   . THR A  1  509 ? 71.574  308.192 231.416 1.00 32.00  ? 509  THR A O   1 
ATOM   3980  C  CB  . THR A  1  509 ? 68.889  307.274 229.931 1.00 33.80  ? 509  THR A CB  1 
ATOM   3981  O  OG1 . THR A  1  509 ? 69.970  307.317 228.954 1.00 29.14  ? 509  THR A OG1 1 
ATOM   3982  C  CG2 . THR A  1  509 ? 67.515  307.684 229.331 1.00 28.80  ? 509  THR A CG2 1 
ATOM   3983  N  N   . TYR A  1  510 ? 70.435  306.677 232.584 1.00 31.76  ? 510  TYR A N   1 
ATOM   3984  C  CA  . TYR A  1  510 ? 71.590  306.107 233.119 1.00 31.18  ? 510  TYR A CA  1 
ATOM   3985  C  C   . TYR A  1  510 ? 71.768  304.779 232.345 1.00 31.80  ? 510  TYR A C   1 
ATOM   3986  O  O   . TYR A  1  510 ? 70.836  303.975 232.325 1.00 30.96  ? 510  TYR A O   1 
ATOM   3987  C  CB  . TYR A  1  510 ? 71.284  305.819 234.619 1.00 30.25  ? 510  TYR A CB  1 
ATOM   3988  C  CG  . TYR A  1  510 ? 72.323  304.956 235.234 1.00 31.48  ? 510  TYR A CG  1 
ATOM   3989  C  CD1 . TYR A  1  510 ? 72.316  303.575 235.068 1.00 34.36  ? 510  TYR A CD1 1 
ATOM   3990  C  CD2 . TYR A  1  510 ? 73.397  305.572 235.956 1.00 35.60  ? 510  TYR A CD2 1 
ATOM   3991  C  CE1 . TYR A  1  510 ? 73.306  302.738 235.663 1.00 37.47  ? 510  TYR A CE1 1 
ATOM   3992  C  CE2 . TYR A  1  510 ? 74.378  304.790 236.589 1.00 34.94  ? 510  TYR A CE2 1 
ATOM   3993  C  CZ  . TYR A  1  510 ? 74.330  303.377 236.397 1.00 36.64  ? 510  TYR A CZ  1 
ATOM   3994  O  OH  . TYR A  1  510 ? 75.333  302.619 236.909 1.00 38.86  ? 510  TYR A OH  1 
ATOM   3995  N  N   . VAL A  1  511 ? 72.953  304.557 231.723 1.00 29.73  ? 511  VAL A N   1 
ATOM   3996  C  CA  . VAL A  1  511 ? 73.271  303.334 231.004 1.00 30.97  ? 511  VAL A CA  1 
ATOM   3997  C  C   . VAL A  1  511 ? 74.733  302.974 231.333 1.00 33.78  ? 511  VAL A C   1 
ATOM   3998  O  O   . VAL A  1  511 ? 75.625  303.735 230.951 1.00 30.81  ? 511  VAL A O   1 
ATOM   3999  C  CB  . VAL A  1  511 ? 73.086  303.537 229.416 1.00 32.11  ? 511  VAL A CB  1 
ATOM   4000  C  CG1 . VAL A  1  511 ? 73.231  302.180 228.643 1.00 29.02  ? 511  VAL A CG1 1 
ATOM   4001  C  CG2 . VAL A  1  511 ? 71.667  304.062 229.104 1.00 30.87  ? 511  VAL A CG2 1 
ATOM   4002  N  N   . ASN A  1  512 ? 74.954  301.778 231.916 1.00 36.15  ? 512  ASN A N   1 
ATOM   4003  C  CA  . ASN A  1  512 ? 76.281  301.286 232.447 1.00 41.93  ? 512  ASN A CA  1 
ATOM   4004  C  C   . ASN A  1  512 ? 77.002  300.755 231.284 1.00 44.13  ? 512  ASN A C   1 
ATOM   4005  O  O   . ASN A  1  512 ? 76.356  300.130 230.406 1.00 40.91  ? 512  ASN A O   1 
ATOM   4006  C  CB  . ASN A  1  512 ? 76.122  299.945 233.239 1.00 41.46  ? 512  ASN A CB  1 
ATOM   4007  C  CG  . ASN A  1  512 ? 75.763  300.148 234.591 1.00 46.92  ? 512  ASN A CG  1 
ATOM   4008  O  OD1 . ASN A  1  512 ? 74.994  299.374 235.161 1.00 52.65  ? 512  ASN A OD1 1 
ATOM   4009  N  ND2 . ASN A  1  512 ? 76.303  301.189 235.180 1.00 54.41  ? 512  ASN A ND2 1 
ATOM   4010  N  N   . LEU A  1  513 ? 78.321  300.841 231.346 1.00 48.93  ? 513  LEU A N   1 
ATOM   4011  C  CA  . LEU A  1  513 ? 79.118  300.284 230.282 1.00 55.81  ? 513  LEU A CA  1 
ATOM   4012  C  C   . LEU A  1  513 ? 79.272  298.812 230.596 1.00 59.71  ? 513  LEU A C   1 
ATOM   4013  O  O   . LEU A  1  513 ? 79.118  297.960 229.684 1.00 63.89  ? 513  LEU A O   1 
ATOM   4014  C  CB  . LEU A  1  513 ? 80.491  300.927 230.224 1.00 56.59  ? 513  LEU A CB  1 
ATOM   4015  C  CG  . LEU A  1  513 ? 81.016  301.522 228.917 1.00 57.58  ? 513  LEU A CG  1 
ATOM   4016  C  CD1 . LEU A  1  513 ? 82.318  300.801 228.607 1.00 62.79  ? 513  LEU A CD1 1 
ATOM   4017  C  CD2 . LEU A  1  513 ? 80.024  301.407 227.848 1.00 57.44  ? 513  LEU A CD2 1 
ATOM   4018  N  N   . LYS A  1  514 ? 79.609  298.489 231.845 1.00 62.79  ? 514  LYS A N   1 
ATOM   4019  C  CA  . LYS A  1  514 ? 79.867  297.099 232.216 1.00 65.71  ? 514  LYS A CA  1 
ATOM   4020  C  C   . LYS A  1  514 ? 81.316  296.692 231.861 1.00 67.68  ? 514  LYS A C   1 
ATOM   4021  O  O   . LYS A  1  514 ? 81.399  295.489 231.532 1.00 68.60  ? 514  LYS A O   1 
ATOM   4022  C  CB  . LYS A  1  514 ? 78.803  296.079 231.637 1.00 64.95  ? 514  LYS A CB  1 
ATOM   4023  C  CG  . LYS A  1  514 ? 77.444  296.025 232.401 1.00 64.13  ? 514  LYS A CG  1 
ATOM   4024  C  CD  . LYS A  1  514 ? 76.303  295.334 231.676 1.00 58.49  ? 514  LYS A CD  1 
ATOM   4025  C  CE  . LYS A  1  514 ? 75.041  295.098 232.605 1.00 60.09  ? 514  LYS A CE  1 
ATOM   4026  N  NZ  . LYS A  1  514 ? 73.849  295.953 232.298 1.00 50.81  ? 514  LYS A NZ  1 
ATOM   4027  O  OXT . LYS A  1  514 ? 82.360  297.482 231.929 1.00 68.78  ? 514  LYS A OXT 1 
HETATM 4028  N  N   . FME B  2  1   ? 48.089  297.831 167.136 1.00 32.34  ? 1    FME B N   1 
HETATM 4029  C  CN  . FME B  2  1   ? 49.018  298.761 166.779 1.00 31.82  ? 1    FME B CN  1 
HETATM 4030  O  O1  . FME B  2  1   ? 49.796  298.533 166.049 1.00 40.80  ? 1    FME B O1  1 
HETATM 4031  C  CA  . FME B  2  1   ? 47.441  298.602 168.227 1.00 33.43  ? 1    FME B CA  1 
HETATM 4032  C  CB  . FME B  2  1   ? 46.450  299.538 167.614 1.00 33.24  ? 1    FME B CB  1 
HETATM 4033  C  CG  . FME B  2  1   ? 45.441  298.503 167.006 1.00 39.89  ? 1    FME B CG  1 
HETATM 4034  S  SD  . FME B  2  1   ? 44.041  299.339 166.383 1.00 40.46  ? 1    FME B SD  1 
HETATM 4035  C  CE  . FME B  2  1   ? 43.621  300.227 167.839 1.00 56.43  ? 1    FME B CE  1 
HETATM 4036  C  C   . FME B  2  1   ? 46.884  297.832 169.387 1.00 33.38  ? 1    FME B C   1 
HETATM 4037  O  O   . FME B  2  1   ? 46.577  296.622 169.227 1.00 34.08  ? 1    FME B O   1 
ATOM   4038  N  N   . ALA B  2  2   ? 46.653  298.529 170.489 1.00 30.58  ? 2    ALA B N   1 
ATOM   4039  C  CA  . ALA B  2  2   ? 45.935  297.948 171.643 1.00 33.14  ? 2    ALA B CA  1 
ATOM   4040  C  C   . ALA B  2  2   ? 44.500  297.791 171.280 1.00 31.85  ? 2    ALA B C   1 
ATOM   4041  O  O   . ALA B  2  2   ? 43.978  298.628 170.517 1.00 30.54  ? 2    ALA B O   1 
ATOM   4042  C  CB  . ALA B  2  2   ? 45.972  298.925 172.907 1.00 31.19  ? 2    ALA B CB  1 
ATOM   4043  N  N   . TYR B  2  3   ? 43.842  296.831 171.924 1.00 31.97  ? 3    TYR B N   1 
ATOM   4044  C  CA  . TYR B  2  3   ? 42.398  296.570 171.727 1.00 33.06  ? 3    TYR B CA  1 
ATOM   4045  C  C   . TYR B  2  3   ? 41.660  296.631 173.100 1.00 34.18  ? 3    TYR B C   1 
ATOM   4046  O  O   . TYR B  2  3   ? 42.287  296.553 174.151 1.00 33.59  ? 3    TYR B O   1 
ATOM   4047  C  CB  . TYR B  2  3   ? 42.175  295.162 171.055 1.00 33.99  ? 3    TYR B CB  1 
ATOM   4048  C  CG  . TYR B  2  3   ? 43.051  294.084 171.650 1.00 33.77  ? 3    TYR B CG  1 
ATOM   4049  C  CD1 . TYR B  2  3   ? 42.700  293.399 172.831 1.00 30.14  ? 3    TYR B CD1 1 
ATOM   4050  C  CD2 . TYR B  2  3   ? 44.267  293.793 171.067 1.00 33.05  ? 3    TYR B CD2 1 
ATOM   4051  C  CE1 . TYR B  2  3   ? 43.611  292.406 173.432 1.00 34.08  ? 3    TYR B CE1 1 
ATOM   4052  C  CE2 . TYR B  2  3   ? 45.109  292.832 171.629 1.00 33.27  ? 3    TYR B CE2 1 
ATOM   4053  C  CZ  . TYR B  2  3   ? 44.805  292.156 172.793 1.00 34.42  ? 3    TYR B CZ  1 
ATOM   4054  O  OH  . TYR B  2  3   ? 45.771  291.223 173.309 1.00 33.87  ? 3    TYR B OH  1 
ATOM   4055  N  N   . PRO B  2  4   ? 40.332  296.753 173.102 1.00 36.48  ? 4    PRO B N   1 
ATOM   4056  C  CA  . PRO B  2  4   ? 39.679  296.867 174.417 1.00 35.85  ? 4    PRO B CA  1 
ATOM   4057  C  C   . PRO B  2  4   ? 39.900  295.727 175.387 1.00 37.72  ? 4    PRO B C   1 
ATOM   4058  O  O   . PRO B  2  4   ? 39.960  294.529 174.988 1.00 34.03  ? 4    PRO B O   1 
ATOM   4059  C  CB  . PRO B  2  4   ? 38.196  297.046 174.058 1.00 38.04  ? 4    PRO B CB  1 
ATOM   4060  C  CG  . PRO B  2  4   ? 38.202  297.572 172.564 1.00 36.77  ? 4    PRO B CG  1 
ATOM   4061  C  CD  . PRO B  2  4   ? 39.426  296.946 171.948 1.00 34.98  ? 4    PRO B CD  1 
ATOM   4062  N  N   . MET B  2  5   ? 40.073  296.103 176.669 1.00 40.73  ? 5    MET B N   1 
ATOM   4063  C  CA  . MET B  2  5   ? 40.382  295.154 177.770 1.00 43.89  ? 5    MET B CA  1 
ATOM   4064  C  C   . MET B  2  5   ? 41.730  294.433 177.668 1.00 42.77  ? 5    MET B C   1 
ATOM   4065  O  O   . MET B  2  5   ? 41.940  293.416 178.328 1.00 46.36  ? 5    MET B O   1 
ATOM   4066  C  CB  . MET B  2  5   ? 39.233  294.159 177.938 1.00 44.81  ? 5    MET B CB  1 
ATOM   4067  C  CG  . MET B  2  5   ? 37.982  294.934 178.413 1.00 50.21  ? 5    MET B CG  1 
ATOM   4068  S  SD  . MET B  2  5   ? 36.544  293.861 178.508 1.00 58.33  ? 5    MET B SD  1 
ATOM   4069  C  CE  . MET B  2  5   ? 37.320  292.860 179.860 1.00 53.77  ? 5    MET B CE  1 
ATOM   4070  N  N   . GLN B  2  6   ? 42.644  294.907 176.846 1.00 38.84  ? 6    GLN B N   1 
ATOM   4071  C  CA  . GLN B  2  6   ? 43.902  294.217 176.775 1.00 36.51  ? 6    GLN B CA  1 
ATOM   4072  C  C   . GLN B  2  6   ? 44.619  294.217 178.151 1.00 36.18  ? 6    GLN B C   1 
ATOM   4073  O  O   . GLN B  2  6   ? 44.544  295.258 178.865 1.00 35.60  ? 6    GLN B O   1 
ATOM   4074  C  CB  . GLN B  2  6   ? 44.790  294.926 175.777 1.00 36.20  ? 6    GLN B CB  1 
ATOM   4075  C  CG  . GLN B  2  6   ? 46.023  294.232 175.446 1.00 35.66  ? 6    GLN B CG  1 
ATOM   4076  C  CD  . GLN B  2  6   ? 46.708  294.910 174.249 1.00 33.52  ? 6    GLN B CD  1 
ATOM   4077  O  OE1 . GLN B  2  6   ? 46.053  295.492 173.466 1.00 36.95  ? 6    GLN B OE1 1 
ATOM   4078  N  NE2 . GLN B  2  6   ? 48.015  294.854 174.169 1.00 33.96  ? 6    GLN B NE2 1 
ATOM   4079  N  N   . LEU B  2  7   ? 45.266  293.092 178.485 1.00 31.63  ? 7    LEU B N   1 
ATOM   4080  C  CA  . LEU B  2  7   ? 45.941  292.898 179.767 1.00 34.16  ? 7    LEU B CA  1 
ATOM   4081  C  C   . LEU B  2  7   ? 47.432  292.956 179.560 1.00 34.33  ? 7    LEU B C   1 
ATOM   4082  O  O   . LEU B  2  7   ? 48.128  293.503 180.394 1.00 33.40  ? 7    LEU B O   1 
ATOM   4083  C  CB  . LEU B  2  7   ? 45.563  291.574 180.411 1.00 33.01  ? 7    LEU B CB  1 
ATOM   4084  C  CG  . LEU B  2  7   ? 44.078  291.292 180.733 1.00 37.13  ? 7    LEU B CG  1 
ATOM   4085  C  CD1 . LEU B  2  7   ? 44.011  289.987 181.615 1.00 38.67  ? 7    LEU B CD1 1 
ATOM   4086  C  CD2 . LEU B  2  7   ? 43.472  292.442 181.599 1.00 34.67  ? 7    LEU B CD2 1 
ATOM   4087  N  N   . GLY B  2  8   ? 47.935  292.388 178.441 1.00 32.42  ? 8    GLY B N   1 
ATOM   4088  C  CA  . GLY B  2  8   ? 49.393  292.302 178.284 1.00 29.59  ? 8    GLY B CA  1 
ATOM   4089  C  C   . GLY B  2  8   ? 49.878  293.091 177.073 1.00 29.03  ? 8    GLY B C   1 
ATOM   4090  O  O   . GLY B  2  8   ? 49.203  294.007 176.618 1.00 29.88  ? 8    GLY B O   1 
ATOM   4091  N  N   . PHE B  2  9   ? 51.046  292.714 176.551 1.00 29.02  ? 9    PHE B N   1 
ATOM   4092  C  CA  . PHE B  2  9   ? 51.641  293.439 175.446 1.00 33.03  ? 9    PHE B CA  1 
ATOM   4093  C  C   . PHE B  2  9   ? 50.808  293.274 174.148 1.00 33.58  ? 9    PHE B C   1 
ATOM   4094  O  O   . PHE B  2  9   ? 50.115  292.281 174.015 1.00 32.24  ? 9    PHE B O   1 
ATOM   4095  C  CB  . PHE B  2  9   ? 53.013  292.914 175.141 1.00 31.63  ? 9    PHE B CB  1 
ATOM   4096  C  CG  . PHE B  2  9   ? 54.070  293.357 176.132 1.00 33.84  ? 9    PHE B CG  1 
ATOM   4097  C  CD1 . PHE B  2  9   ? 54.600  292.449 177.040 1.00 34.24  ? 9    PHE B CD1 1 
ATOM   4098  C  CD2 . PHE B  2  9   ? 54.529  294.719 176.170 1.00 35.65  ? 9    PHE B CD2 1 
ATOM   4099  C  CE1 . PHE B  2  9   ? 55.559  292.847 177.977 1.00 33.34  ? 9    PHE B CE1 1 
ATOM   4100  C  CE2 . PHE B  2  9   ? 55.513  295.133 177.123 1.00 34.00  ? 9    PHE B CE2 1 
ATOM   4101  C  CZ  . PHE B  2  9   ? 56.053  294.179 177.997 1.00 33.34  ? 9    PHE B CZ  1 
ATOM   4102  N  N   . GLN B  2  10  ? 50.921  294.242 173.224 1.00 34.02  ? 10   GLN B N   1 
ATOM   4103  C  CA  . GLN B  2  10  ? 50.422  294.043 171.812 1.00 35.53  ? 10   GLN B CA  1 
ATOM   4104  C  C   . GLN B  2  10  ? 51.136  292.810 171.235 1.00 36.07  ? 10   GLN B C   1 
ATOM   4105  O  O   . GLN B  2  10  ? 52.350  292.526 171.587 1.00 35.55  ? 10   GLN B O   1 
ATOM   4106  C  CB  . GLN B  2  10  ? 50.725  295.342 171.013 1.00 32.71  ? 10   GLN B CB  1 
ATOM   4107  C  CG  . GLN B  2  10  ? 49.974  296.580 171.660 1.00 30.14  ? 10   GLN B CG  1 
ATOM   4108  C  CD  . GLN B  2  10  ? 50.239  297.945 170.987 1.00 36.65  ? 10   GLN B CD  1 
ATOM   4109  O  OE1 . GLN B  2  10  ? 50.140  299.002 171.639 1.00 33.01  ? 10   GLN B OE1 1 
ATOM   4110  N  NE2 . GLN B  2  10  ? 50.558  297.921 169.718 1.00 29.15  ? 10   GLN B NE2 1 
ATOM   4111  N  N   . ASP B  2  11  ? 50.482  292.106 170.283 1.00 36.99  ? 11   ASP B N   1 
ATOM   4112  C  CA  . ASP B  2  11  ? 51.171  290.959 169.650 1.00 35.80  ? 11   ASP B CA  1 
ATOM   4113  C  C   . ASP B  2  11  ? 52.419  291.456 168.958 1.00 35.09  ? 11   ASP B C   1 
ATOM   4114  O  O   . ASP B  2  11  ? 52.433  292.546 168.422 1.00 35.43  ? 11   ASP B O   1 
ATOM   4115  C  CB  . ASP B  2  11  ? 50.298  290.293 168.559 1.00 36.18  ? 11   ASP B CB  1 
ATOM   4116  C  CG  . ASP B  2  11  ? 49.109  289.550 169.093 1.00 36.48  ? 11   ASP B CG  1 
ATOM   4117  O  OD1 . ASP B  2  11  ? 48.371  288.972 168.243 1.00 33.78  ? 11   ASP B OD1 1 
ATOM   4118  O  OD2 . ASP B  2  11  ? 48.875  289.419 170.294 1.00 32.11  ? 11   ASP B OD2 1 
ATOM   4119  N  N   . ALA B  2  12  ? 53.478  290.658 168.953 1.00 35.27  ? 12   ALA B N   1 
ATOM   4120  C  CA  . ALA B  2  12  ? 54.708  291.061 168.300 1.00 39.09  ? 12   ALA B CA  1 
ATOM   4121  C  C   . ALA B  2  12  ? 54.644  291.095 166.728 1.00 40.22  ? 12   ALA B C   1 
ATOM   4122  O  O   . ALA B  2  12  ? 54.165  290.187 166.089 1.00 39.34  ? 12   ALA B O   1 
ATOM   4123  C  CB  . ALA B  2  12  ? 55.840  290.136 168.718 1.00 37.51  ? 12   ALA B CB  1 
ATOM   4124  N  N   . THR B  2  13  ? 55.254  292.135 166.164 1.00 42.65  ? 13   THR B N   1 
ATOM   4125  C  CA  . THR B  2  13  ? 55.319  292.412 164.764 1.00 43.45  ? 13   THR B CA  1 
ATOM   4126  C  C   . THR B  2  13  ? 56.728  292.087 164.306 1.00 43.88  ? 13   THR B C   1 
ATOM   4127  O  O   . THR B  2  13  ? 56.957  291.967 163.118 1.00 41.86  ? 13   THR B O   1 
ATOM   4128  C  CB  . THR B  2  13  ? 55.171  293.929 164.530 1.00 45.27  ? 13   THR B CB  1 
ATOM   4129  O  OG1 . THR B  2  13  ? 53.967  294.375 165.106 1.00 45.96  ? 13   THR B OG1 1 
ATOM   4130  C  CG2 . THR B  2  13  ? 55.096  294.303 162.973 1.00 46.27  ? 13   THR B CG2 1 
ATOM   4131  N  N   . SER B  2  14  ? 57.696  292.037 165.229 1.00 43.76  ? 14   SER B N   1 
ATOM   4132  C  CA  . SER B  2  14  ? 59.083  291.776 164.828 1.00 45.05  ? 14   SER B CA  1 
ATOM   4133  C  C   . SER B  2  14  ? 59.602  290.668 165.703 1.00 46.71  ? 14   SER B C   1 
ATOM   4134  O  O   . SER B  2  14  ? 58.972  290.411 166.762 1.00 42.32  ? 14   SER B O   1 
ATOM   4135  C  CB  . SER B  2  14  ? 59.920  293.041 164.976 1.00 44.52  ? 14   SER B CB  1 
ATOM   4136  O  OG  . SER B  2  14  ? 60.199  293.283 166.343 1.00 50.64  ? 14   SER B OG  1 
ATOM   4137  N  N   . PRO B  2  15  ? 60.666  289.929 165.242 1.00 48.70  ? 15   PRO B N   1 
ATOM   4138  C  CA  . PRO B  2  15  ? 61.301  288.810 166.030 1.00 48.61  ? 15   PRO B CA  1 
ATOM   4139  C  C   . PRO B  2  15  ? 61.810  289.266 167.409 1.00 48.62  ? 15   PRO B C   1 
ATOM   4140  O  O   . PRO B  2  15  ? 61.752  288.496 168.355 1.00 48.77  ? 15   PRO B O   1 
ATOM   4141  C  CB  . PRO B  2  15  ? 62.503  288.386 165.162 1.00 48.87  ? 15   PRO B CB  1 
ATOM   4142  C  CG  . PRO B  2  15  ? 62.009  288.643 163.706 1.00 49.06  ? 15   PRO B CG  1 
ATOM   4143  C  CD  . PRO B  2  15  ? 61.236  290.019 163.871 1.00 48.30  ? 15   PRO B CD  1 
ATOM   4144  N  N   . ILE B  2  16  ? 62.206  290.533 167.511 1.00 46.85  ? 16   ILE B N   1 
ATOM   4145  C  CA  . ILE B  2  16  ? 62.702  291.101 168.726 1.00 47.29  ? 16   ILE B CA  1 
ATOM   4146  C  C   . ILE B  2  16  ? 61.595  291.363 169.731 1.00 46.09  ? 16   ILE B C   1 
ATOM   4147  O  O   . ILE B  2  16  ? 61.689  290.883 170.882 1.00 44.42  ? 16   ILE B O   1 
ATOM   4148  C  CB  . ILE B  2  16  ? 63.554  292.302 168.425 1.00 48.63  ? 16   ILE B CB  1 
ATOM   4149  C  CG1 . ILE B  2  16  ? 64.892  291.700 167.964 1.00 52.96  ? 16   ILE B CG1 1 
ATOM   4150  C  CG2 . ILE B  2  16  ? 63.747  293.222 169.719 1.00 50.77  ? 16   ILE B CG2 1 
ATOM   4151  C  CD1 . ILE B  2  16  ? 65.563  290.616 169.027 1.00 59.24  ? 16   ILE B CD1 1 
ATOM   4152  N  N   . MET B  2  17  ? 60.517  292.024 169.283 1.00 42.84  ? 17   MET B N   1 
ATOM   4153  C  CA  . MET B  2  17  ? 59.335  291.984 170.083 1.00 42.14  ? 17   MET B CA  1 
ATOM   4154  C  C   . MET B  2  17  ? 58.972  290.566 170.548 1.00 42.97  ? 17   MET B C   1 
ATOM   4155  O  O   . MET B  2  17  ? 58.555  290.398 171.711 1.00 42.01  ? 17   MET B O   1 
ATOM   4156  C  CB  . MET B  2  17  ? 58.144  292.718 169.471 1.00 40.83  ? 17   MET B CB  1 
ATOM   4157  C  CG  . MET B  2  17  ? 57.067  292.929 170.489 1.00 41.88  ? 17   MET B CG  1 
ATOM   4158  S  SD  . MET B  2  17  ? 57.673  294.020 171.920 1.00 41.77  ? 17   MET B SD  1 
ATOM   4159  C  CE  . MET B  2  17  ? 56.612  293.491 173.188 1.00 39.00  ? 17   MET B CE  1 
ATOM   4160  N  N   . GLU B  2  18  ? 59.107  289.535 169.695 1.00 41.92  ? 18   GLU B N   1 
ATOM   4161  C  CA  . GLU B  2  18  ? 58.646  288.194 170.147 1.00 43.46  ? 18   GLU B CA  1 
ATOM   4162  C  C   . GLU B  2  18  ? 59.473  287.636 171.284 1.00 41.89  ? 18   GLU B C   1 
ATOM   4163  O  O   . GLU B  2  18  ? 58.922  287.061 172.196 1.00 41.73  ? 18   GLU B O   1 
ATOM   4164  C  CB  . GLU B  2  18  ? 58.738  287.194 169.049 1.00 43.86  ? 18   GLU B CB  1 
ATOM   4165  C  CG  . GLU B  2  18  ? 57.794  287.443 167.888 1.00 51.40  ? 18   GLU B CG  1 
ATOM   4166  C  CD  . GLU B  2  18  ? 57.994  286.309 166.767 1.00 62.26  ? 18   GLU B CD  1 
ATOM   4167  O  OE1 . GLU B  2  18  ? 58.311  286.677 165.561 1.00 57.94  ? 18   GLU B OE1 1 
ATOM   4168  O  OE2 . GLU B  2  18  ? 57.878  285.077 167.182 1.00 59.41  ? 18   GLU B OE2 1 
ATOM   4169  N  N   . GLU B  2  19  ? 60.793  287.682 171.125 1.00 42.47  ? 19   GLU B N   1 
ATOM   4170  C  CA  . GLU B  2  19  ? 61.781  287.514 172.178 1.00 43.59  ? 19   GLU B CA  1 
ATOM   4171  C  C   . GLU B  2  19  ? 61.396  288.206 173.509 1.00 41.43  ? 19   GLU B C   1 
ATOM   4172  O  O   . GLU B  2  19  ? 61.494  287.623 174.589 1.00 42.91  ? 19   GLU B O   1 
ATOM   4173  C  CB  . GLU B  2  19  ? 63.079  288.216 171.702 1.00 44.30  ? 19   GLU B CB  1 
ATOM   4174  C  CG  . GLU B  2  19  ? 64.044  287.321 170.979 1.00 52.78  ? 19   GLU B CG  1 
ATOM   4175  C  CD  . GLU B  2  19  ? 64.329  285.975 171.732 1.00 63.50  ? 19   GLU B CD  1 
ATOM   4176  O  OE1 . GLU B  2  19  ? 65.150  285.193 171.208 1.00 68.95  ? 19   GLU B OE1 1 
ATOM   4177  O  OE2 . GLU B  2  19  ? 63.736  285.670 172.807 1.00 70.96  ? 19   GLU B OE2 1 
ATOM   4178  N  N   . LEU B  2  20  ? 60.991  289.462 173.438 1.00 39.97  ? 20   LEU B N   1 
ATOM   4179  C  CA  . LEU B  2  20  ? 60.660  290.191 174.646 1.00 39.87  ? 20   LEU B CA  1 
ATOM   4180  C  C   . LEU B  2  20  ? 59.434  289.604 175.285 1.00 37.88  ? 20   LEU B C   1 
ATOM   4181  O  O   . LEU B  2  20  ? 59.348  289.546 176.542 1.00 36.45  ? 20   LEU B O   1 
ATOM   4182  C  CB  . LEU B  2  20  ? 60.408  291.715 174.378 1.00 38.63  ? 20   LEU B CB  1 
ATOM   4183  C  CG  . LEU B  2  20  ? 61.632  292.564 174.081 1.00 44.78  ? 20   LEU B CG  1 
ATOM   4184  C  CD1 . LEU B  2  20  ? 61.227  294.096 173.760 1.00 40.17  ? 20   LEU B CD1 1 
ATOM   4185  C  CD2 . LEU B  2  20  ? 62.639  292.387 175.283 1.00 43.10  ? 20   LEU B CD2 1 
ATOM   4186  N  N   . LEU B  2  21  ? 58.455  289.175 174.483 1.00 37.35  ? 21   LEU B N   1 
ATOM   4187  C  CA  . LEU B  2  21  ? 57.253  288.560 175.108 1.00 35.52  ? 21   LEU B CA  1 
ATOM   4188  C  C   . LEU B  2  21  ? 57.637  287.290 175.859 1.00 34.79  ? 21   LEU B C   1 
ATOM   4189  O  O   . LEU B  2  21  ? 57.125  287.042 176.947 1.00 34.35  ? 21   LEU B O   1 
ATOM   4190  C  CB  . LEU B  2  21  ? 56.158  288.133 174.094 1.00 35.75  ? 21   LEU B CB  1 
ATOM   4191  C  CG  . LEU B  2  21  ? 55.539  289.264 173.250 1.00 37.09  ? 21   LEU B CG  1 
ATOM   4192  C  CD1 . LEU B  2  21  ? 54.596  288.710 172.043 1.00 31.42  ? 21   LEU B CD1 1 
ATOM   4193  C  CD2 . LEU B  2  21  ? 54.812  290.283 174.137 1.00 35.30  ? 21   LEU B CD2 1 
ATOM   4194  N  N   . HIS B  2  22  ? 58.532  286.480 175.299 1.00 36.54  ? 22   HIS B N   1 
ATOM   4195  C  CA  . HIS B  2  22  ? 58.859  285.201 175.990 1.00 36.42  ? 22   HIS B CA  1 
ATOM   4196  C  C   . HIS B  2  22  ? 59.659  285.494 177.277 1.00 37.43  ? 22   HIS B C   1 
ATOM   4197  O  O   . HIS B  2  22  ? 59.407  284.868 178.387 1.00 36.02  ? 22   HIS B O   1 
ATOM   4198  C  CB  . HIS B  2  22  ? 59.650  284.253 175.024 1.00 39.39  ? 22   HIS B CB  1 
ATOM   4199  C  CG  . HIS B  2  22  ? 58.822  283.839 173.821 1.00 43.93  ? 22   HIS B CG  1 
ATOM   4200  N  ND1 . HIS B  2  22  ? 57.550  283.275 173.947 1.00 45.33  ? 22   HIS B ND1 1 
ATOM   4201  C  CD2 . HIS B  2  22  ? 59.034  283.999 172.483 1.00 46.63  ? 22   HIS B CD2 1 
ATOM   4202  C  CE1 . HIS B  2  22  ? 57.034  283.092 172.735 1.00 45.54  ? 22   HIS B CE1 1 
ATOM   4203  N  NE2 . HIS B  2  22  ? 57.914  283.519 171.830 1.00 47.97  ? 22   HIS B NE2 1 
ATOM   4204  N  N   . PHE B  2  23  ? 60.615  286.415 177.140 1.00 34.99  ? 23   PHE B N   1 
ATOM   4205  C  CA  . PHE B  2  23  ? 61.353  286.913 178.325 1.00 37.79  ? 23   PHE B CA  1 
ATOM   4206  C  C   . PHE B  2  23  ? 60.437  287.566 179.412 1.00 37.91  ? 23   PHE B C   1 
ATOM   4207  O  O   . PHE B  2  23  ? 60.627  287.361 180.631 1.00 39.04  ? 23   PHE B O   1 
ATOM   4208  C  CB  . PHE B  2  23  ? 62.509  287.845 177.898 1.00 36.60  ? 23   PHE B CB  1 
ATOM   4209  C  CG  . PHE B  2  23  ? 63.180  288.543 179.098 1.00 42.83  ? 23   PHE B CG  1 
ATOM   4210  C  CD1 . PHE B  2  23  ? 63.037  289.924 179.313 1.00 43.44  ? 23   PHE B CD1 1 
ATOM   4211  C  CD2 . PHE B  2  23  ? 63.937  287.821 179.983 1.00 45.42  ? 23   PHE B CD2 1 
ATOM   4212  C  CE1 . PHE B  2  23  ? 63.622  290.537 180.418 1.00 43.84  ? 23   PHE B CE1 1 
ATOM   4213  C  CE2 . PHE B  2  23  ? 64.547  288.466 181.109 1.00 42.76  ? 23   PHE B CE2 1 
ATOM   4214  C  CZ  . PHE B  2  23  ? 64.351  289.766 181.311 1.00 41.90  ? 23   PHE B CZ  1 
ATOM   4215  N  N   . HIS B  2  24  ? 59.392  288.312 178.994 1.00 37.56  ? 24   HIS B N   1 
ATOM   4216  C  CA  . HIS B  2  24  ? 58.426  288.858 179.997 1.00 36.46  ? 24   HIS B CA  1 
ATOM   4217  C  C   . HIS B  2  24  ? 57.700  287.721 180.650 1.00 37.36  ? 24   HIS B C   1 
ATOM   4218  O  O   . HIS B  2  24  ? 57.382  287.800 181.861 1.00 34.86  ? 24   HIS B O   1 
ATOM   4219  C  CB  . HIS B  2  24  ? 57.366  289.794 179.376 1.00 36.32  ? 24   HIS B CB  1 
ATOM   4220  C  CG  . HIS B  2  24  ? 56.340  290.315 180.354 1.00 34.13  ? 24   HIS B CG  1 
ATOM   4221  N  ND1 . HIS B  2  24  ? 54.989  290.080 180.191 1.00 33.62  ? 24   HIS B ND1 1 
ATOM   4222  C  CD2 . HIS B  2  24  ? 56.459  291.092 181.476 1.00 31.76  ? 24   HIS B CD2 1 
ATOM   4223  C  CE1 . HIS B  2  24  ? 54.325  290.646 181.186 1.00 34.69  ? 24   HIS B CE1 1 
ATOM   4224  N  NE2 . HIS B  2  24  ? 55.185  291.293 181.962 1.00 31.27  ? 24   HIS B NE2 1 
ATOM   4225  N  N   . ASP B  2  25  ? 57.352  286.696 179.848 1.00 37.18  ? 25   ASP B N   1 
ATOM   4226  C  CA  . ASP B  2  25  ? 56.599  285.519 180.425 1.00 39.97  ? 25   ASP B CA  1 
ATOM   4227  C  C   . ASP B  2  25  ? 57.451  284.808 181.540 1.00 39.50  ? 25   ASP B C   1 
ATOM   4228  O  O   . ASP B  2  25  ? 56.960  284.504 182.630 1.00 40.16  ? 25   ASP B O   1 
ATOM   4229  C  CB  . ASP B  2  25  ? 56.184  284.501 179.317 1.00 38.86  ? 25   ASP B CB  1 
ATOM   4230  C  CG  . ASP B  2  25  ? 55.010  284.947 178.513 1.00 40.42  ? 25   ASP B CG  1 
ATOM   4231  O  OD1 . ASP B  2  25  ? 54.218  285.818 178.933 1.00 37.43  ? 25   ASP B OD1 1 
ATOM   4232  O  OD2 . ASP B  2  25  ? 54.814  284.354 177.425 1.00 42.14  ? 25   ASP B OD2 1 
ATOM   4233  N  N   . HIS B  2  26  ? 58.720  284.540 181.231 1.00 39.86  ? 26   HIS B N   1 
ATOM   4234  C  CA  . HIS B  2  26  ? 59.718  284.020 182.207 1.00 41.74  ? 26   HIS B CA  1 
ATOM   4235  C  C   . HIS B  2  26  ? 59.799  284.852 183.465 1.00 41.91  ? 26   HIS B C   1 
ATOM   4236  O  O   . HIS B  2  26  ? 59.754  284.304 184.566 1.00 42.42  ? 26   HIS B O   1 
ATOM   4237  C  CB  . HIS B  2  26  ? 61.113  283.917 181.507 1.00 42.63  ? 26   HIS B CB  1 
ATOM   4238  C  CG  . HIS B  2  26  ? 62.314  283.750 182.427 1.00 49.31  ? 26   HIS B CG  1 
ATOM   4239  N  ND1 . HIS B  2  26  ? 62.737  282.509 182.897 1.00 49.39  ? 26   HIS B ND1 1 
ATOM   4240  C  CD2 . HIS B  2  26  ? 63.256  284.656 182.848 1.00 49.81  ? 26   HIS B CD2 1 
ATOM   4241  C  CE1 . HIS B  2  26  ? 63.858  282.668 183.597 1.00 53.40  ? 26   HIS B CE1 1 
ATOM   4242  N  NE2 . HIS B  2  26  ? 64.194  283.953 183.583 1.00 54.65  ? 26   HIS B NE2 1 
ATOM   4243  N  N   . THR B  2  27  ? 59.903  286.170 183.316 1.00 40.99  ? 27   THR B N   1 
ATOM   4244  C  CA  . THR B  2  27  ? 60.037  287.072 184.420 1.00 40.90  ? 27   THR B CA  1 
ATOM   4245  C  C   . THR B  2  27  ? 58.812  287.122 185.258 1.00 42.91  ? 27   THR B C   1 
ATOM   4246  O  O   . THR B  2  27  ? 58.930  287.051 186.491 1.00 42.32  ? 27   THR B O   1 
ATOM   4247  C  CB  . THR B  2  27  ? 60.450  288.520 183.981 1.00 42.00  ? 27   THR B CB  1 
ATOM   4248  O  OG1 . THR B  2  27  ? 61.628  288.427 183.154 1.00 40.07  ? 27   THR B OG1 1 
ATOM   4249  C  CG2 . THR B  2  27  ? 60.804  289.455 185.166 1.00 37.04  ? 27   THR B CG2 1 
ATOM   4250  N  N   . LEU B  2  28  ? 57.643  287.265 184.627 1.00 42.88  ? 28   LEU B N   1 
ATOM   4251  C  CA  . LEU B  2  28  ? 56.422  287.363 185.332 1.00 45.09  ? 28   LEU B CA  1 
ATOM   4252  C  C   . LEU B  2  28  ? 56.044  285.999 186.026 1.00 46.19  ? 28   LEU B C   1 
ATOM   4253  O  O   . LEU B  2  28  ? 55.384  285.970 187.065 1.00 45.96  ? 28   LEU B O   1 
ATOM   4254  C  CB  . LEU B  2  28  ? 55.315  287.888 184.400 1.00 44.77  ? 28   LEU B CB  1 
ATOM   4255  C  CG  . LEU B  2  28  ? 53.934  288.114 184.974 1.00 47.79  ? 28   LEU B CG  1 
ATOM   4256  C  CD1 . LEU B  2  28  ? 53.963  289.219 186.098 1.00 48.75  ? 28   LEU B CD1 1 
ATOM   4257  C  CD2 . LEU B  2  28  ? 52.871  288.390 183.868 1.00 48.58  ? 28   LEU B CD2 1 
ATOM   4258  N  N   . MET B  2  29  ? 56.485  284.872 185.498 1.00 47.55  ? 29   MET B N   1 
ATOM   4259  C  CA  . MET B  2  29  ? 56.303  283.652 186.263 1.00 50.26  ? 29   MET B CA  1 
ATOM   4260  C  C   . MET B  2  29  ? 56.927  283.871 187.651 1.00 51.47  ? 29   MET B C   1 
ATOM   4261  O  O   . MET B  2  29  ? 56.199  283.812 188.684 1.00 53.23  ? 29   MET B O   1 
ATOM   4262  C  CB  . MET B  2  29  ? 57.026  282.532 185.570 1.00 51.70  ? 29   MET B CB  1 
ATOM   4263  C  CG  . MET B  2  29  ? 56.737  281.142 186.196 1.00 58.02  ? 29   MET B CG  1 
ATOM   4264  S  SD  . MET B  2  29  ? 57.644  279.872 185.334 1.00 72.88  ? 29   MET B SD  1 
ATOM   4265  C  CE  . MET B  2  29  ? 59.277  280.503 184.792 1.00 70.64  ? 29   MET B CE  1 
ATOM   4266  N  N   . ILE B  2  30  ? 58.259  284.127 187.652 1.00 50.26  ? 30   ILE B N   1 
ATOM   4267  C  CA  . ILE B  2  30  ? 59.057  284.479 188.886 1.00 49.55  ? 30   ILE B CA  1 
ATOM   4268  C  C   . ILE B  2  30  ? 58.421  285.507 189.786 1.00 48.28  ? 30   ILE B C   1 
ATOM   4269  O  O   . ILE B  2  30  ? 58.237  285.303 191.009 1.00 46.86  ? 30   ILE B O   1 
ATOM   4270  C  CB  . ILE B  2  30  ? 60.491  284.875 188.515 1.00 49.29  ? 30   ILE B CB  1 
ATOM   4271  C  CG1 . ILE B  2  30  ? 61.183  283.672 187.897 1.00 49.70  ? 30   ILE B CG1 1 
ATOM   4272  C  CG2 . ILE B  2  30  ? 61.261  285.435 189.730 1.00 51.08  ? 30   ILE B CG2 1 
ATOM   4273  C  CD1 . ILE B  2  30  ? 62.305  284.042 186.946 1.00 47.36  ? 30   ILE B CD1 1 
ATOM   4274  N  N   . VAL B  2  31  ? 58.024  286.605 189.183 1.00 47.44  ? 31   VAL B N   1 
ATOM   4275  C  CA  . VAL B  2  31  ? 57.260  287.612 189.896 1.00 49.27  ? 31   VAL B CA  1 
ATOM   4276  C  C   . VAL B  2  31  ? 56.023  287.043 190.641 1.00 51.93  ? 31   VAL B C   1 
ATOM   4277  O  O   . VAL B  2  31  ? 55.698  287.523 191.788 1.00 50.65  ? 31   VAL B O   1 
ATOM   4278  C  CB  . VAL B  2  31  ? 56.893  288.793 188.966 1.00 50.18  ? 31   VAL B CB  1 
ATOM   4279  C  CG1 . VAL B  2  31  ? 55.781  289.641 189.486 1.00 50.18  ? 31   VAL B CG1 1 
ATOM   4280  C  CG2 . VAL B  2  31  ? 58.175  289.663 188.704 1.00 48.43  ? 31   VAL B CG2 1 
ATOM   4281  N  N   . PHE B  2  32  ? 55.372  286.029 190.027 1.00 50.68  ? 32   PHE B N   1 
ATOM   4282  C  CA  . PHE B  2  32  ? 54.137  285.547 190.572 1.00 52.03  ? 32   PHE B CA  1 
ATOM   4283  C  C   . PHE B  2  32  ? 54.322  284.688 191.778 1.00 53.12  ? 32   PHE B C   1 
ATOM   4284  O  O   . PHE B  2  32  ? 53.645  284.963 192.781 1.00 55.32  ? 32   PHE B O   1 
ATOM   4285  C  CB  . PHE B  2  32  ? 53.295  284.797 189.533 1.00 50.98  ? 32   PHE B CB  1 
ATOM   4286  C  CG  . PHE B  2  32  ? 52.417  285.735 188.699 1.00 49.57  ? 32   PHE B CG  1 
ATOM   4287  C  CD1 . PHE B  2  32  ? 52.250  285.534 187.294 1.00 49.42  ? 32   PHE B CD1 1 
ATOM   4288  C  CD2 . PHE B  2  32  ? 51.791  286.849 189.302 1.00 49.72  ? 32   PHE B CD2 1 
ATOM   4289  C  CE1 . PHE B  2  32  ? 51.399  286.391 186.513 1.00 45.00  ? 32   PHE B CE1 1 
ATOM   4290  C  CE2 . PHE B  2  32  ? 50.984  287.786 188.512 1.00 48.59  ? 32   PHE B CE2 1 
ATOM   4291  C  CZ  . PHE B  2  32  ? 50.774  287.534 187.126 1.00 46.47  ? 32   PHE B CZ  1 
ATOM   4292  N  N   . LEU B  2  33  ? 55.105  283.616 191.594 1.00 52.41  ? 33   LEU B N   1 
ATOM   4293  C  CA  . LEU B  2  33  ? 55.880  282.887 192.607 1.00 53.84  ? 33   LEU B CA  1 
ATOM   4294  C  C   . LEU B  2  33  ? 56.259  283.708 193.831 1.00 53.36  ? 33   LEU B C   1 
ATOM   4295  O  O   . LEU B  2  33  ? 55.640  283.579 194.901 1.00 54.33  ? 33   LEU B O   1 
ATOM   4296  C  CB  . LEU B  2  33  ? 57.161  282.428 191.997 1.00 52.69  ? 33   LEU B CB  1 
ATOM   4297  C  CG  . LEU B  2  33  ? 57.001  281.022 191.620 1.00 56.06  ? 33   LEU B CG  1 
ATOM   4298  C  CD1 . LEU B  2  33  ? 55.476  280.775 191.482 1.00 60.69  ? 33   LEU B CD1 1 
ATOM   4299  C  CD2 . LEU B  2  33  ? 57.704  280.856 190.349 1.00 59.32  ? 33   LEU B CD2 1 
ATOM   4300  N  N   . ILE B  2  34  ? 57.197  284.651 193.628 1.00 50.35  ? 34   ILE B N   1 
ATOM   4301  C  CA  . ILE B  2  34  ? 57.603  285.444 194.734 1.00 46.13  ? 34   ILE B CA  1 
ATOM   4302  C  C   . ILE B  2  34  ? 56.461  286.094 195.463 1.00 46.60  ? 34   ILE B C   1 
ATOM   4303  O  O   . ILE B  2  34  ? 56.442  286.098 196.710 1.00 42.10  ? 34   ILE B O   1 
ATOM   4304  C  CB  . ILE B  2  34  ? 58.656  286.471 194.379 1.00 45.45  ? 34   ILE B CB  1 
ATOM   4305  C  CG1 . ILE B  2  34  ? 59.879  285.751 193.898 1.00 40.38  ? 34   ILE B CG1 1 
ATOM   4306  C  CG2 . ILE B  2  34  ? 58.909  287.362 195.644 1.00 38.88  ? 34   ILE B CG2 1 
ATOM   4307  C  CD1 . ILE B  2  34  ? 60.830  286.629 193.068 1.00 41.67  ? 34   ILE B CD1 1 
ATOM   4308  N  N   . SER B  2  35  ? 55.534  286.693 194.729 1.00 47.60  ? 35   SER B N   1 
ATOM   4309  C  CA  . SER B  2  35  ? 54.498  287.519 195.374 1.00 50.80  ? 35   SER B CA  1 
ATOM   4310  C  C   . SER B  2  35  ? 53.517  286.615 196.140 1.00 54.14  ? 35   SER B C   1 
ATOM   4311  O  O   . SER B  2  35  ? 52.976  287.040 197.201 1.00 55.23  ? 35   SER B O   1 
ATOM   4312  C  CB  . SER B  2  35  ? 53.675  288.328 194.339 1.00 52.46  ? 35   SER B CB  1 
ATOM   4313  O  OG  . SER B  2  35  ? 53.270  287.405 193.305 1.00 50.60  ? 35   SER B OG  1 
ATOM   4314  N  N   . SER B  2  36  ? 53.302  285.418 195.596 1.00 54.36  ? 36   SER B N   1 
ATOM   4315  C  CA  . SER B  2  36  ? 52.377  284.478 196.148 1.00 57.32  ? 36   SER B CA  1 
ATOM   4316  C  C   . SER B  2  36  ? 52.986  283.775 197.384 1.00 58.23  ? 36   SER B C   1 
ATOM   4317  O  O   . SER B  2  36  ? 52.389  283.849 198.450 1.00 57.96  ? 36   SER B O   1 
ATOM   4318  C  CB  . SER B  2  36  ? 51.879  283.473 195.103 1.00 56.63  ? 36   SER B CB  1 
ATOM   4319  O  OG  . SER B  2  36  ? 52.825  282.431 194.858 1.00 58.71  ? 36   SER B OG  1 
ATOM   4320  N  N   . LEU B  2  37  ? 54.166  283.167 197.210 1.00 57.35  ? 37   LEU B N   1 
ATOM   4321  C  CA  . LEU B  2  37  ? 55.046  282.781 198.313 1.00 57.28  ? 37   LEU B CA  1 
ATOM   4322  C  C   . LEU B  2  37  ? 55.047  283.760 199.478 1.00 56.15  ? 37   LEU B C   1 
ATOM   4323  O  O   . LEU B  2  37  ? 54.782  283.350 200.620 1.00 56.69  ? 37   LEU B O   1 
ATOM   4324  C  CB  . LEU B  2  37  ? 56.455  282.529 197.825 1.00 57.71  ? 37   LEU B CB  1 
ATOM   4325  C  CG  . LEU B  2  37  ? 57.390  282.061 198.935 1.00 61.66  ? 37   LEU B CG  1 
ATOM   4326  C  CD1 . LEU B  2  37  ? 57.191  280.517 199.128 1.00 65.26  ? 37   LEU B CD1 1 
ATOM   4327  C  CD2 . LEU B  2  37  ? 58.846  282.450 198.633 1.00 61.52  ? 37   LEU B CD2 1 
ATOM   4328  N  N   . VAL B  2  38  ? 55.299  285.047 199.222 1.00 54.53  ? 38   VAL B N   1 
ATOM   4329  C  CA  . VAL B  2  38  ? 55.173  286.083 200.219 1.00 52.32  ? 38   VAL B CA  1 
ATOM   4330  C  C   . VAL B  2  38  ? 53.770  286.258 200.872 1.00 54.84  ? 38   VAL B C   1 
ATOM   4331  O  O   . VAL B  2  38  ? 53.661  286.466 202.147 1.00 52.65  ? 38   VAL B O   1 
ATOM   4332  C  CB  . VAL B  2  38  ? 55.654  287.457 199.739 1.00 51.79  ? 38   VAL B CB  1 
ATOM   4333  C  CG1 . VAL B  2  38  ? 55.282  288.556 200.702 1.00 47.65  ? 38   VAL B CG1 1 
ATOM   4334  C  CG2 . VAL B  2  38  ? 57.153  287.478 199.629 1.00 53.29  ? 38   VAL B CG2 1 
ATOM   4335  N  N   . LEU B  2  39  ? 52.708  286.299 200.045 1.00 54.60  ? 39   LEU B N   1 
ATOM   4336  C  CA  . LEU B  2  39  ? 51.348  286.713 200.572 1.00 55.61  ? 39   LEU B CA  1 
ATOM   4337  C  C   . LEU B  2  39  ? 50.978  285.626 201.576 1.00 55.29  ? 39   LEU B C   1 
ATOM   4338  O  O   . LEU B  2  39  ? 50.348  285.848 202.652 1.00 54.74  ? 39   LEU B O   1 
ATOM   4339  C  CB  . LEU B  2  39  ? 50.298  286.656 199.465 1.00 56.00  ? 39   LEU B CB  1 
ATOM   4340  C  CG  . LEU B  2  39  ? 48.872  286.865 199.984 1.00 57.57  ? 39   LEU B CG  1 
ATOM   4341  C  CD1 . LEU B  2  39  ? 48.668  288.220 200.663 1.00 55.61  ? 39   LEU B CD1 1 
ATOM   4342  C  CD2 . LEU B  2  39  ? 47.948  286.674 198.798 1.00 60.17  ? 39   LEU B CD2 1 
ATOM   4343  N  N   . TYR B  2  40  ? 51.446  284.463 201.154 1.00 53.35  ? 40   TYR B N   1 
ATOM   4344  C  CA  . TYR B  2  40  ? 51.193  283.272 201.731 1.00 53.10  ? 40   TYR B CA  1 
ATOM   4345  C  C   . TYR B  2  40  ? 51.928  283.076 203.094 1.00 53.04  ? 40   TYR B C   1 
ATOM   4346  O  O   . TYR B  2  40  ? 51.262  282.800 204.110 1.00 52.85  ? 40   TYR B O   1 
ATOM   4347  C  CB  . TYR B  2  40  ? 51.657  282.196 200.809 1.00 52.46  ? 40   TYR B CB  1 
ATOM   4348  C  CG  . TYR B  2  40  ? 51.453  280.929 201.541 1.00 55.84  ? 40   TYR B CG  1 
ATOM   4349  C  CD1 . TYR B  2  40  ? 50.144  280.500 201.833 1.00 64.12  ? 40   TYR B CD1 1 
ATOM   4350  C  CD2 . TYR B  2  40  ? 52.527  280.224 202.093 1.00 60.30  ? 40   TYR B CD2 1 
ATOM   4351  C  CE1 . TYR B  2  40  ? 49.922  279.353 202.613 1.00 63.44  ? 40   TYR B CE1 1 
ATOM   4352  C  CE2 . TYR B  2  40  ? 52.322  279.094 202.873 1.00 53.54  ? 40   TYR B CE2 1 
ATOM   4353  C  CZ  . TYR B  2  40  ? 51.033  278.671 203.110 1.00 60.09  ? 40   TYR B CZ  1 
ATOM   4354  O  OH  . TYR B  2  40  ? 50.794  277.532 203.831 1.00 64.86  ? 40   TYR B OH  1 
ATOM   4355  N  N   . ILE B  2  41  ? 53.278  283.061 203.062 1.00 51.28  ? 41   ILE B N   1 
ATOM   4356  C  CA  . ILE B  2  41  ? 54.099  283.131 204.280 1.00 48.75  ? 41   ILE B CA  1 
ATOM   4357  C  C   . ILE B  2  41  ? 53.540  284.134 205.219 1.00 48.04  ? 41   ILE B C   1 
ATOM   4358  O  O   . ILE B  2  41  ? 53.369  283.833 206.388 1.00 49.13  ? 41   ILE B O   1 
ATOM   4359  C  CB  . ILE B  2  41  ? 55.544  283.416 204.041 1.00 47.52  ? 41   ILE B CB  1 
ATOM   4360  C  CG1 . ILE B  2  41  ? 56.132  282.222 203.381 1.00 48.15  ? 41   ILE B CG1 1 
ATOM   4361  C  CG2 . ILE B  2  41  ? 56.287  283.692 205.418 1.00 43.17  ? 41   ILE B CG2 1 
ATOM   4362  C  CD1 . ILE B  2  41  ? 57.385  282.657 202.643 1.00 49.89  ? 41   ILE B CD1 1 
ATOM   4363  N  N   . ILE B  2  42  ? 53.182  285.297 204.734 1.00 46.88  ? 42   ILE B N   1 
ATOM   4364  C  CA  . ILE B  2  42  ? 52.530  286.222 205.620 1.00 47.85  ? 42   ILE B CA  1 
ATOM   4365  C  C   . ILE B  2  42  ? 51.263  285.701 206.308 1.00 47.59  ? 42   ILE B C   1 
ATOM   4366  O  O   . ILE B  2  42  ? 51.051  285.980 207.506 1.00 45.28  ? 42   ILE B O   1 
ATOM   4367  C  CB  . ILE B  2  42  ? 52.166  287.558 204.956 1.00 49.32  ? 42   ILE B CB  1 
ATOM   4368  C  CG1 . ILE B  2  42  ? 53.010  288.682 205.590 1.00 51.02  ? 42   ILE B CG1 1 
ATOM   4369  C  CG2 . ILE B  2  42  ? 50.789  288.059 205.393 1.00 53.58  ? 42   ILE B CG2 1 
ATOM   4370  C  CD1 . ILE B  2  42  ? 52.576  290.111 205.140 1.00 52.25  ? 42   ILE B CD1 1 
ATOM   4371  N  N   . SER B  2  43  ? 50.368  285.033 205.556 1.00 44.61  ? 43   SER B N   1 
ATOM   4372  C  CA  . SER B  2  43  ? 49.112  284.663 206.181 1.00 44.66  ? 43   SER B CA  1 
ATOM   4373  C  C   . SER B  2  43  ? 49.446  283.491 207.130 1.00 42.62  ? 43   SER B C   1 
ATOM   4374  O  O   . SER B  2  43  ? 48.829  283.341 208.116 1.00 42.74  ? 43   SER B O   1 
ATOM   4375  C  CB  . SER B  2  43  ? 48.040  284.333 205.144 1.00 46.08  ? 43   SER B CB  1 
ATOM   4376  O  OG  . SER B  2  43  ? 48.497  283.236 204.428 1.00 45.79  ? 43   SER B OG  1 
ATOM   4377  N  N   . LEU B  2  44  ? 50.495  282.747 206.846 1.00 40.85  ? 44   LEU B N   1 
ATOM   4378  C  CA  . LEU B  2  44  ? 50.935  281.766 207.746 1.00 41.51  ? 44   LEU B CA  1 
ATOM   4379  C  C   . LEU B  2  44  ? 51.380  282.318 209.144 1.00 41.80  ? 44   LEU B C   1 
ATOM   4380  O  O   . LEU B  2  44  ? 50.987  281.707 210.210 1.00 41.33  ? 44   LEU B O   1 
ATOM   4381  C  CB  . LEU B  2  44  ? 52.079  281.041 207.128 1.00 39.53  ? 44   LEU B CB  1 
ATOM   4382  C  CG  . LEU B  2  44  ? 52.580  279.756 207.789 1.00 46.87  ? 44   LEU B CG  1 
ATOM   4383  C  CD1 . LEU B  2  44  ? 51.523  278.582 207.606 1.00 46.91  ? 44   LEU B CD1 1 
ATOM   4384  C  CD2 . LEU B  2  44  ? 53.959  279.389 207.216 1.00 46.12  ? 44   LEU B CD2 1 
ATOM   4385  N  N   . MET B  2  45  ? 52.234  283.362 209.138 1.00 38.72  ? 45   MET B N   1 
ATOM   4386  C  CA  . MET B  2  45  ? 52.710  284.089 210.369 1.00 38.92  ? 45   MET B CA  1 
ATOM   4387  C  C   . MET B  2  45  ? 51.561  284.590 211.196 1.00 36.97  ? 45   MET B C   1 
ATOM   4388  O  O   . MET B  2  45  ? 51.684  284.710 212.385 1.00 37.22  ? 45   MET B O   1 
ATOM   4389  C  CB  . MET B  2  45  ? 53.550  285.299 210.025 1.00 36.84  ? 45   MET B CB  1 
ATOM   4390  C  CG  . MET B  2  45  ? 54.703  285.033 209.209 1.00 40.82  ? 45   MET B CG  1 
ATOM   4391  S  SD  . MET B  2  45  ? 55.937  283.894 209.800 1.00 44.30  ? 45   MET B SD  1 
ATOM   4392  C  CE  . MET B  2  45  ? 55.438  282.344 209.182 1.00 42.52  ? 45   MET B CE  1 
ATOM   4393  N  N   . LEU B  2  46  ? 50.444  284.895 210.560 1.00 37.18  ? 46   LEU B N   1 
ATOM   4394  C  CA  . LEU B  2  46  ? 49.325  285.614 211.158 1.00 37.97  ? 46   LEU B CA  1 
ATOM   4395  C  C   . LEU B  2  46  ? 48.113  284.730 211.533 1.00 38.49  ? 46   LEU B C   1 
ATOM   4396  O  O   . LEU B  2  46  ? 47.095  285.215 212.000 1.00 39.68  ? 46   LEU B O   1 
ATOM   4397  C  CB  . LEU B  2  46  ? 48.834  286.670 210.138 1.00 38.99  ? 46   LEU B CB  1 
ATOM   4398  C  CG  . LEU B  2  46  ? 49.844  287.793 209.807 1.00 40.49  ? 46   LEU B CG  1 
ATOM   4399  C  CD1 . LEU B  2  46  ? 49.374  288.756 208.619 1.00 43.00  ? 46   LEU B CD1 1 
ATOM   4400  C  CD2 . LEU B  2  46  ? 50.114  288.596 211.130 1.00 36.24  ? 46   LEU B CD2 1 
ATOM   4401  N  N   . THR B  2  47  ? 48.194  283.428 211.294 1.00 37.08  ? 47   THR B N   1 
ATOM   4402  C  CA  . THR B  2  47  ? 46.998  282.646 211.561 1.00 35.30  ? 47   THR B CA  1 
ATOM   4403  C  C   . THR B  2  47  ? 47.223  281.575 212.694 1.00 35.07  ? 47   THR B C   1 
ATOM   4404  O  O   . THR B  2  47  ? 46.628  280.479 212.634 1.00 36.16  ? 47   THR B O   1 
ATOM   4405  C  CB  . THR B  2  47  ? 46.581  281.964 210.299 1.00 36.16  ? 47   THR B CB  1 
ATOM   4406  O  OG1 . THR B  2  47  ? 47.763  281.406 209.686 1.00 33.44  ? 47   THR B OG1 1 
ATOM   4407  C  CG2 . THR B  2  47  ? 45.895  282.977 209.313 1.00 39.03  ? 47   THR B CG2 1 
ATOM   4408  N  N   . THR B  2  48  ? 48.122  281.838 213.654 1.00 33.51  ? 48   THR B N   1 
ATOM   4409  C  CA  . THR B  2  48  ? 48.290  280.878 214.785 1.00 33.42  ? 48   THR B CA  1 
ATOM   4410  C  C   . THR B  2  48  ? 48.314  281.605 216.150 1.00 35.22  ? 48   THR B C   1 
ATOM   4411  O  O   . THR B  2  48  ? 48.923  282.701 216.265 1.00 33.21  ? 48   THR B O   1 
ATOM   4412  C  CB  . THR B  2  48  ? 49.532  279.912 214.628 1.00 32.99  ? 48   THR B CB  1 
ATOM   4413  O  OG1 . THR B  2  48  ? 49.601  279.082 215.790 1.00 37.04  ? 48   THR B OG1 1 
ATOM   4414  C  CG2 . THR B  2  48  ? 50.901  280.652 214.555 1.00 28.97  ? 48   THR B CG2 1 
ATOM   4415  N  N   . LYS B  2  49  ? 47.693  280.979 217.179 1.00 36.28  ? 49   LYS B N   1 
ATOM   4416  C  CA  . LYS B  2  49  ? 47.788  281.440 218.614 1.00 36.62  ? 49   LYS B CA  1 
ATOM   4417  C  C   . LYS B  2  49  ? 49.049  280.989 219.307 1.00 34.96  ? 49   LYS B C   1 
ATOM   4418  O  O   . LYS B  2  49  ? 49.360  281.492 220.369 1.00 32.27  ? 49   LYS B O   1 
ATOM   4419  C  CB  . LYS B  2  49  ? 46.588  280.981 219.448 1.00 38.10  ? 49   LYS B CB  1 
ATOM   4420  C  CG  . LYS B  2  49  ? 45.270  281.543 218.987 1.00 44.79  ? 49   LYS B CG  1 
ATOM   4421  C  CD  . LYS B  2  49  ? 45.192  283.025 219.233 1.00 54.96  ? 49   LYS B CD  1 
ATOM   4422  C  CE  . LYS B  2  49  ? 43.752  283.428 219.746 1.00 60.42  ? 49   LYS B CE  1 
ATOM   4423  N  NZ  . LYS B  2  49  ? 42.631  282.531 219.183 1.00 60.94  ? 49   LYS B NZ  1 
ATOM   4424  N  N   . LEU B  2  50  ? 49.798  280.081 218.682 1.00 34.53  ? 50   LEU B N   1 
ATOM   4425  C  CA  . LEU B  2  50  ? 51.096  279.615 219.209 1.00 33.40  ? 50   LEU B CA  1 
ATOM   4426  C  C   . LEU B  2  50  ? 52.090  280.753 219.194 1.00 35.86  ? 50   LEU B C   1 
ATOM   4427  O  O   . LEU B  2  50  ? 52.119  281.534 218.194 1.00 33.06  ? 50   LEU B O   1 
ATOM   4428  C  CB  . LEU B  2  50  ? 51.638  278.480 218.323 1.00 33.43  ? 50   LEU B CB  1 
ATOM   4429  C  CG  . LEU B  2  50  ? 50.722  277.252 218.420 1.00 35.52  ? 50   LEU B CG  1 
ATOM   4430  C  CD1 . LEU B  2  50  ? 51.214  276.217 217.444 1.00 32.98  ? 50   LEU B CD1 1 
ATOM   4431  C  CD2 . LEU B  2  50  ? 50.776  276.675 219.896 1.00 36.62  ? 50   LEU B CD2 1 
ATOM   4432  N  N   . THR B  2  51  ? 52.891  280.904 220.238 1.00 34.59  ? 51   THR B N   1 
ATOM   4433  C  CA  . THR B  2  51  ? 53.812  282.027 220.233 1.00 35.94  ? 51   THR B CA  1 
ATOM   4434  C  C   . THR B  2  51  ? 55.191  281.579 220.488 1.00 36.40  ? 51   THR B C   1 
ATOM   4435  O  O   . THR B  2  51  ? 55.408  280.493 221.019 1.00 36.47  ? 51   THR B O   1 
ATOM   4436  C  CB  . THR B  2  51  ? 53.406  283.108 221.274 1.00 36.43  ? 51   THR B CB  1 
ATOM   4437  O  OG1 . THR B  2  51  ? 53.336  282.457 222.529 1.00 37.83  ? 51   THR B OG1 1 
ATOM   4438  C  CG2 . THR B  2  51  ? 52.017  283.641 220.982 1.00 33.10  ? 51   THR B CG2 1 
ATOM   4439  N  N   . HIS B  2  52  ? 56.149  282.433 220.147 1.00 35.71  ? 52   HIS B N   1 
ATOM   4440  C  CA  . HIS B  2  52  ? 57.554  282.218 220.427 1.00 36.28  ? 52   HIS B CA  1 
ATOM   4441  C  C   . HIS B  2  52  ? 58.188  283.582 220.320 1.00 37.04  ? 52   HIS B C   1 
ATOM   4442  O  O   . HIS B  2  52  ? 58.423  284.089 219.160 1.00 35.30  ? 52   HIS B O   1 
ATOM   4443  C  CB  . HIS B  2  52  ? 58.199  281.317 219.394 1.00 37.29  ? 52   HIS B CB  1 
ATOM   4444  C  CG  . HIS B  2  52  ? 59.692  281.120 219.571 1.00 41.59  ? 52   HIS B CG  1 
ATOM   4445  N  ND1 . HIS B  2  52  ? 60.437  280.291 218.751 1.00 43.66  ? 52   HIS B ND1 1 
ATOM   4446  C  CD2 . HIS B  2  52  ? 60.572  281.620 220.477 1.00 44.93  ? 52   HIS B CD2 1 
ATOM   4447  C  CE1 . HIS B  2  52  ? 61.698  280.273 219.154 1.00 42.28  ? 52   HIS B CE1 1 
ATOM   4448  N  NE2 . HIS B  2  52  ? 61.812  281.102 220.180 1.00 45.29  ? 52   HIS B NE2 1 
ATOM   4449  N  N   . THR B  2  53  ? 58.354  284.245 221.476 1.00 38.85  ? 53   THR B N   1 
ATOM   4450  C  CA  . THR B  2  53  ? 58.666  285.683 221.508 1.00 41.32  ? 53   THR B CA  1 
ATOM   4451  C  C   . THR B  2  53  ? 60.066  285.978 222.015 1.00 44.87  ? 53   THR B C   1 
ATOM   4452  O  O   . THR B  2  53  ? 60.469  287.145 222.141 1.00 45.82  ? 53   THR B O   1 
ATOM   4453  C  CB  . THR B  2  53  ? 57.706  286.494 222.367 1.00 41.32  ? 53   THR B CB  1 
ATOM   4454  O  OG1 . THR B  2  53  ? 57.727  285.960 223.699 1.00 42.41  ? 53   THR B OG1 1 
ATOM   4455  C  CG2 . THR B  2  53  ? 56.277  286.507 221.813 1.00 39.56  ? 53   THR B CG2 1 
ATOM   4456  N  N   . SER B  2  54  ? 60.841  284.946 222.306 1.00 47.47  ? 54   SER B N   1 
ATOM   4457  C  CA  . SER B  2  54  ? 62.173  285.193 222.796 1.00 50.44  ? 54   SER B CA  1 
ATOM   4458  C  C   . SER B  2  54  ? 63.093  285.475 221.614 1.00 52.31  ? 54   SER B C   1 
ATOM   4459  O  O   . SER B  2  54  ? 62.689  285.271 220.437 1.00 52.94  ? 54   SER B O   1 
ATOM   4460  C  CB  . SER B  2  54  ? 62.676  283.997 223.634 1.00 50.40  ? 54   SER B CB  1 
ATOM   4461  O  OG  . SER B  2  54  ? 62.317  282.767 223.078 1.00 52.45  ? 54   SER B OG  1 
ATOM   4462  N  N   . THR B  2  55  ? 64.314  285.943 221.895 1.00 52.62  ? 55   THR B N   1 
ATOM   4463  C  CA  . THR B  2  55  ? 65.291  286.211 220.816 1.00 53.54  ? 55   THR B CA  1 
ATOM   4464  C  C   . THR B  2  55  ? 65.533  285.016 219.877 1.00 54.88  ? 55   THR B C   1 
ATOM   4465  O  O   . THR B  2  55  ? 65.876  283.906 220.337 1.00 54.08  ? 55   THR B O   1 
ATOM   4466  C  CB  . THR B  2  55  ? 66.666  286.644 221.383 1.00 52.99  ? 55   THR B CB  1 
ATOM   4467  O  OG1 . THR B  2  55  ? 66.461  287.831 222.144 1.00 52.03  ? 55   THR B OG1 1 
ATOM   4468  C  CG2 . THR B  2  55  ? 67.793  286.849 220.230 1.00 52.13  ? 55   THR B CG2 1 
ATOM   4469  N  N   . MET B  2  56  ? 65.418  285.293 218.566 1.00 55.67  ? 56   MET B N   1 
ATOM   4470  C  CA  . MET B  2  56  ? 65.646  284.291 217.499 1.00 57.75  ? 56   MET B CA  1 
ATOM   4471  C  C   . MET B  2  56  ? 66.994  284.513 216.796 1.00 59.17  ? 56   MET B C   1 
ATOM   4472  O  O   . MET B  2  56  ? 67.384  285.675 216.522 1.00 58.64  ? 56   MET B O   1 
ATOM   4473  C  CB  . MET B  2  56  ? 64.472  284.305 216.515 1.00 56.87  ? 56   MET B CB  1 
ATOM   4474  C  CG  . MET B  2  56  ? 63.103  284.014 217.206 1.00 56.02  ? 56   MET B CG  1 
ATOM   4475  S  SD  . MET B  2  56  ? 61.813  284.108 215.912 1.00 57.11  ? 56   MET B SD  1 
ATOM   4476  C  CE  . MET B  2  56  ? 60.253  283.520 216.696 1.00 41.67  ? 56   MET B CE  1 
ATOM   4477  N  N   . ASP B  2  57  ? 67.736  283.419 216.558 1.00 61.37  ? 57   ASP B N   1 
ATOM   4478  C  CA  . ASP B  2  57  ? 69.002  283.500 215.798 1.00 63.40  ? 57   ASP B CA  1 
ATOM   4479  C  C   . ASP B  2  57  ? 68.808  283.653 214.237 1.00 63.01  ? 57   ASP B C   1 
ATOM   4480  O  O   . ASP B  2  57  ? 68.065  282.903 213.642 1.00 61.91  ? 57   ASP B O   1 
ATOM   4481  C  CB  . ASP B  2  57  ? 69.945  282.347 216.138 1.00 65.39  ? 57   ASP B CB  1 
ATOM   4482  C  CG  . ASP B  2  57  ? 71.421  282.711 215.865 1.00 70.77  ? 57   ASP B CG  1 
ATOM   4483  O  OD1 . ASP B  2  57  ? 72.190  282.850 216.859 1.00 75.04  ? 57   ASP B OD1 1 
ATOM   4484  O  OD2 . ASP B  2  57  ? 71.806  282.870 214.662 1.00 75.46  ? 57   ASP B OD2 1 
ATOM   4485  N  N   . ALA B  2  58  ? 69.461  284.648 213.628 1.00 62.88  ? 58   ALA B N   1 
ATOM   4486  C  CA  . ALA B  2  58  ? 69.145  285.127 212.279 1.00 64.39  ? 58   ALA B CA  1 
ATOM   4487  C  C   . ALA B  2  58  ? 70.132  284.675 211.189 1.00 66.05  ? 58   ALA B C   1 
ATOM   4488  O  O   . ALA B  2  58  ? 69.744  284.544 210.016 1.00 65.71  ? 58   ALA B O   1 
ATOM   4489  C  CB  . ALA B  2  58  ? 69.059  286.644 212.295 1.00 62.93  ? 58   ALA B CB  1 
ATOM   4490  N  N   . GLN B  2  59  ? 71.391  284.436 211.583 1.00 69.10  ? 59   GLN B N   1 
ATOM   4491  C  CA  . GLN B  2  59  ? 72.525  284.264 210.646 1.00 72.53  ? 59   GLN B CA  1 
ATOM   4492  C  C   . GLN B  2  59  ? 72.555  282.842 210.172 1.00 72.46  ? 59   GLN B C   1 
ATOM   4493  O  O   . GLN B  2  59  ? 73.300  282.039 210.754 1.00 75.35  ? 59   GLN B O   1 
ATOM   4494  C  CB  . GLN B  2  59  ? 73.881  284.590 211.340 1.00 74.24  ? 59   GLN B CB  1 
ATOM   4495  C  CG  . GLN B  2  59  ? 75.175  284.638 210.392 1.00 80.31  ? 59   GLN B CG  1 
ATOM   4496  C  CD  . GLN B  2  59  ? 75.069  285.563 209.069 1.00 87.99  ? 59   GLN B CD  1 
ATOM   4497  O  OE1 . GLN B  2  59  ? 74.293  286.564 208.976 1.00 82.74  ? 59   GLN B OE1 1 
ATOM   4498  N  NE2 . GLN B  2  59  ? 75.892  285.195 208.062 1.00 90.35  ? 59   GLN B NE2 1 
ATOM   4499  N  N   . GLU B  2  60  ? 71.766  282.517 209.151 1.00 70.97  ? 60   GLU B N   1 
ATOM   4500  C  CA  . GLU B  2  60  ? 71.388  281.109 208.811 1.00 69.24  ? 60   GLU B CA  1 
ATOM   4501  C  C   . GLU B  2  60  ? 70.181  281.187 207.906 1.00 65.67  ? 60   GLU B C   1 
ATOM   4502  O  O   . GLU B  2  60  ? 70.245  280.923 206.695 1.00 65.31  ? 60   GLU B O   1 
ATOM   4503  C  CB  . GLU B  2  60  ? 71.045  280.232 210.043 1.00 71.45  ? 60   GLU B CB  1 
ATOM   4504  C  CG  . GLU B  2  60  ? 70.501  280.994 211.364 1.00 76.63  ? 60   GLU B CG  1 
ATOM   4505  C  CD  . GLU B  2  60  ? 68.964  280.977 211.529 1.00 82.77  ? 60   GLU B CD  1 
ATOM   4506  O  OE1 . GLU B  2  60  ? 68.286  281.920 211.066 1.00 77.86  ? 60   GLU B OE1 1 
ATOM   4507  O  OE2 . GLU B  2  60  ? 68.429  279.999 212.145 1.00 91.37  ? 60   GLU B OE2 1 
ATOM   4508  N  N   . VAL B  2  61  ? 69.073  281.628 208.482 1.00 61.53  ? 61   VAL B N   1 
ATOM   4509  C  CA  . VAL B  2  61  ? 67.946  281.991 207.641 1.00 58.25  ? 61   VAL B CA  1 
ATOM   4510  C  C   . VAL B  2  61  ? 68.327  283.183 206.673 1.00 55.98  ? 61   VAL B C   1 
ATOM   4511  O  O   . VAL B  2  61  ? 67.887  283.203 205.495 1.00 53.88  ? 61   VAL B O   1 
ATOM   4512  C  CB  . VAL B  2  61  ? 66.652  282.136 208.467 1.00 58.10  ? 61   VAL B CB  1 
ATOM   4513  C  CG1 . VAL B  2  61  ? 66.530  283.514 209.112 1.00 55.24  ? 61   VAL B CG1 1 
ATOM   4514  C  CG2 . VAL B  2  61  ? 65.458  281.821 207.603 1.00 62.22  ? 61   VAL B CG2 1 
ATOM   4515  N  N   . GLU B  2  62  ? 69.213  284.077 207.145 1.00 52.53  ? 62   GLU B N   1 
ATOM   4516  C  CA  . GLU B  2  62  ? 69.767  285.135 206.286 1.00 51.95  ? 62   GLU B CA  1 
ATOM   4517  C  C   . GLU B  2  62  ? 70.547  284.624 205.092 1.00 50.18  ? 62   GLU B C   1 
ATOM   4518  O  O   . GLU B  2  62  ? 70.533  285.255 204.008 1.00 50.42  ? 62   GLU B O   1 
ATOM   4519  C  CB  . GLU B  2  62  ? 70.593  286.158 207.071 1.00 50.12  ? 62   GLU B CB  1 
ATOM   4520  C  CG  . GLU B  2  62  ? 69.683  286.746 208.163 1.00 54.49  ? 62   GLU B CG  1 
ATOM   4521  C  CD  . GLU B  2  62  ? 69.669  288.272 208.260 1.00 54.26  ? 62   GLU B CD  1 
ATOM   4522  O  OE1 . GLU B  2  62  ? 68.777  288.776 209.015 1.00 51.76  ? 62   GLU B OE1 1 
ATOM   4523  O  OE2 . GLU B  2  62  ? 70.537  288.915 207.607 1.00 49.86  ? 62   GLU B OE2 1 
ATOM   4524  N  N   . THR B  2  63  ? 71.200  283.498 205.286 1.00 48.71  ? 63   THR B N   1 
ATOM   4525  C  CA  . THR B  2  63  ? 71.851  282.842 204.166 1.00 50.62  ? 63   THR B CA  1 
ATOM   4526  C  C   . THR B  2  63  ? 70.864  282.503 203.072 1.00 50.04  ? 63   THR B C   1 
ATOM   4527  O  O   . THR B  2  63  ? 71.103  282.838 201.897 1.00 49.31  ? 63   THR B O   1 
ATOM   4528  C  CB  . THR B  2  63  ? 72.666  281.609 204.581 1.00 50.38  ? 63   THR B CB  1 
ATOM   4529  O  OG1 . THR B  2  63  ? 73.673  282.050 205.531 1.00 54.93  ? 63   THR B OG1 1 
ATOM   4530  C  CG2 . THR B  2  63  ? 73.362  281.049 203.351 1.00 50.92  ? 63   THR B CG2 1 
ATOM   4531  N  N   . ILE B  2  64  ? 69.733  281.928 203.469 1.00 48.95  ? 64   ILE B N   1 
ATOM   4532  C  CA  . ILE B  2  64  ? 68.808  281.416 202.443 1.00 51.98  ? 64   ILE B CA  1 
ATOM   4533  C  C   . ILE B  2  64  ? 68.242  282.630 201.749 1.00 50.99  ? 64   ILE B C   1 
ATOM   4534  O  O   . ILE B  2  64  ? 68.196  282.766 200.544 1.00 51.42  ? 64   ILE B O   1 
ATOM   4535  C  CB  . ILE B  2  64  ? 67.581  280.590 203.031 1.00 51.34  ? 64   ILE B CB  1 
ATOM   4536  C  CG1 . ILE B  2  64  ? 68.046  279.474 204.002 1.00 56.01  ? 64   ILE B CG1 1 
ATOM   4537  C  CG2 . ILE B  2  64  ? 66.685  280.047 201.866 1.00 52.78  ? 64   ILE B CG2 1 
ATOM   4538  C  CD1 . ILE B  2  64  ? 69.318  278.730 203.590 1.00 60.70  ? 64   ILE B CD1 1 
ATOM   4539  N  N   . TRP B  2  65  ? 67.785  283.558 202.541 1.00 51.80  ? 65   TRP B N   1 
ATOM   4540  C  CA  . TRP B  2  65  ? 67.016  284.596 201.912 1.00 52.75  ? 65   TRP B CA  1 
ATOM   4541  C  C   . TRP B  2  65  ? 67.833  285.796 201.311 1.00 50.53  ? 65   TRP B C   1 
ATOM   4542  O  O   . TRP B  2  65  ? 67.324  286.782 200.912 1.00 51.66  ? 65   TRP B O   1 
ATOM   4543  C  CB  . TRP B  2  65  ? 65.802  284.877 202.795 1.00 53.65  ? 65   TRP B CB  1 
ATOM   4544  C  CG  . TRP B  2  65  ? 66.080  285.697 203.975 1.00 53.91  ? 65   TRP B CG  1 
ATOM   4545  C  CD1 . TRP B  2  65  ? 67.010  286.702 204.086 1.00 53.73  ? 65   TRP B CD1 1 
ATOM   4546  C  CD2 . TRP B  2  65  ? 65.363  285.632 205.226 1.00 52.50  ? 65   TRP B CD2 1 
ATOM   4547  N  NE1 . TRP B  2  65  ? 66.885  287.306 205.391 1.00 58.44  ? 65   TRP B NE1 1 
ATOM   4548  C  CE2 . TRP B  2  65  ? 65.884  286.663 206.080 1.00 52.66  ? 65   TRP B CE2 1 
ATOM   4549  C  CE3 . TRP B  2  65  ? 64.333  284.792 205.711 1.00 52.58  ? 65   TRP B CE3 1 
ATOM   4550  C  CZ2 . TRP B  2  65  ? 65.426  286.860 207.384 1.00 52.31  ? 65   TRP B CZ2 1 
ATOM   4551  C  CZ3 . TRP B  2  65  ? 63.879  285.019 207.000 1.00 50.44  ? 65   TRP B CZ3 1 
ATOM   4552  C  CH2 . TRP B  2  65  ? 64.406  286.044 207.806 1.00 48.50  ? 65   TRP B CH2 1 
ATOM   4553  N  N   . THR B  2  66  ? 69.124  285.606 201.194 1.00 49.50  ? 66   THR B N   1 
ATOM   4554  C  CA  . THR B  2  66  ? 69.982  286.448 200.437 1.00 49.34  ? 66   THR B CA  1 
ATOM   4555  C  C   . THR B  2  66  ? 70.447  285.649 199.168 1.00 49.41  ? 66   THR B C   1 
ATOM   4556  O  O   . THR B  2  66  ? 70.370  286.187 198.017 1.00 47.94  ? 66   THR B O   1 
ATOM   4557  C  CB  . THR B  2  66  ? 71.121  286.869 201.391 1.00 51.05  ? 66   THR B CB  1 
ATOM   4558  O  OG1 . THR B  2  66  ? 71.254  288.298 201.478 1.00 56.10  ? 66   THR B OG1 1 
ATOM   4559  C  CG2 . THR B  2  66  ? 72.372  286.176 201.084 1.00 49.61  ? 66   THR B CG2 1 
ATOM   4560  N  N   . ILE B  2  67  ? 70.868  284.384 199.367 1.00 46.71  ? 67   ILE B N   1 
ATOM   4561  C  CA  . ILE B  2  67  ? 71.360  283.535 198.259 1.00 48.51  ? 67   ILE B CA  1 
ATOM   4562  C  C   . ILE B  2  67  ? 70.256  283.150 197.274 1.00 46.54  ? 67   ILE B C   1 
ATOM   4563  O  O   . ILE B  2  67  ? 70.474  283.150 196.061 1.00 47.36  ? 67   ILE B O   1 
ATOM   4564  C  CB  . ILE B  2  67  ? 72.005  282.228 198.759 1.00 47.58  ? 67   ILE B CB  1 
ATOM   4565  C  CG1 . ILE B  2  67  ? 73.135  282.506 199.764 1.00 52.68  ? 67   ILE B CG1 1 
ATOM   4566  C  CG2 . ILE B  2  67  ? 72.482  281.368 197.585 1.00 52.48  ? 67   ILE B CG2 1 
ATOM   4567  C  CD1 . ILE B  2  67  ? 74.543  282.977 199.169 1.00 60.15  ? 67   ILE B CD1 1 
ATOM   4568  N  N   . LEU B  2  68  ? 69.086  282.796 197.792 1.00 45.34  ? 68   LEU B N   1 
ATOM   4569  C  CA  . LEU B  2  68  ? 67.976  282.416 196.876 1.00 46.66  ? 68   LEU B CA  1 
ATOM   4570  C  C   . LEU B  2  68  ? 67.593  283.587 195.955 1.00 45.23  ? 68   LEU B C   1 
ATOM   4571  O  O   . LEU B  2  68  ? 67.542  283.419 194.727 1.00 43.25  ? 68   LEU B O   1 
ATOM   4572  C  CB  . LEU B  2  68  ? 66.762  281.913 197.649 1.00 47.91  ? 68   LEU B CB  1 
ATOM   4573  C  CG  . LEU B  2  68  ? 66.739  280.377 197.759 1.00 55.15  ? 68   LEU B CG  1 
ATOM   4574  C  CD1 . LEU B  2  68  ? 68.086  279.765 198.205 1.00 59.17  ? 68   LEU B CD1 1 
ATOM   4575  C  CD2 . LEU B  2  68  ? 65.507  279.877 198.584 1.00 60.09  ? 68   LEU B CD2 1 
ATOM   4576  N  N   . PRO B  2  69  ? 67.334  284.786 196.559 1.00 43.57  ? 69   PRO B N   1 
ATOM   4577  C  CA  . PRO B  2  69  ? 67.177  286.021 195.710 1.00 42.08  ? 69   PRO B CA  1 
ATOM   4578  C  C   . PRO B  2  69  ? 68.290  286.261 194.745 1.00 39.57  ? 69   PRO B C   1 
ATOM   4579  O  O   . PRO B  2  69  ? 68.006  286.557 193.605 1.00 40.72  ? 69   PRO B O   1 
ATOM   4580  C  CB  . PRO B  2  69  ? 66.990  287.164 196.737 1.00 41.04  ? 69   PRO B CB  1 
ATOM   4581  C  CG  . PRO B  2  69  ? 66.334  286.457 197.897 1.00 43.87  ? 69   PRO B CG  1 
ATOM   4582  C  CD  . PRO B  2  69  ? 67.082  285.101 197.984 1.00 44.77  ? 69   PRO B CD  1 
ATOM   4583  N  N   . ALA B  2  70  ? 69.552  286.185 195.159 1.00 38.96  ? 70   ALA B N   1 
ATOM   4584  C  CA  . ALA B  2  70  ? 70.643  286.374 194.231 1.00 38.14  ? 70   ALA B CA  1 
ATOM   4585  C  C   . ALA B  2  70  ? 70.546  285.359 193.038 1.00 40.42  ? 70   ALA B C   1 
ATOM   4586  O  O   . ALA B  2  70  ? 70.792  285.683 191.843 1.00 38.98  ? 70   ALA B O   1 
ATOM   4587  C  CB  . ALA B  2  70  ? 72.020  286.229 194.990 1.00 39.11  ? 70   ALA B CB  1 
ATOM   4588  N  N   . ILE B  2  71  ? 70.212  284.116 193.362 1.00 42.29  ? 71   ILE B N   1 
ATOM   4589  C  CA  . ILE B  2  71  ? 70.070  283.123 192.317 1.00 42.02  ? 71   ILE B CA  1 
ATOM   4590  C  C   . ILE B  2  71  ? 68.988  283.491 191.338 1.00 42.36  ? 71   ILE B C   1 
ATOM   4591  O  O   . ILE B  2  71  ? 69.212  283.434 190.071 1.00 42.15  ? 71   ILE B O   1 
ATOM   4592  C  CB  . ILE B  2  71  ? 69.818  281.698 192.891 1.00 43.30  ? 71   ILE B CB  1 
ATOM   4593  C  CG1 . ILE B  2  71  ? 71.170  281.182 193.479 1.00 43.47  ? 71   ILE B CG1 1 
ATOM   4594  C  CG2 . ILE B  2  71  ? 69.327  280.781 191.683 1.00 42.80  ? 71   ILE B CG2 1 
ATOM   4595  C  CD1 . ILE B  2  71  ? 71.017  279.965 194.346 1.00 48.99  ? 71   ILE B CD1 1 
ATOM   4596  N  N   . ILE B  2  72  ? 67.827  283.831 191.891 1.00 41.48  ? 72   ILE B N   1 
ATOM   4597  C  CA  . ILE B  2  72  ? 66.715  284.259 191.063 1.00 42.45  ? 72   ILE B CA  1 
ATOM   4598  C  C   . ILE B  2  72  ? 67.050  285.482 190.175 1.00 43.51  ? 72   ILE B C   1 
ATOM   4599  O  O   . ILE B  2  72  ? 66.687  285.530 188.979 1.00 45.86  ? 72   ILE B O   1 
ATOM   4600  C  CB  . ILE B  2  72  ? 65.514  284.586 191.894 1.00 41.74  ? 72   ILE B CB  1 
ATOM   4601  C  CG1 . ILE B  2  72  ? 64.963  283.298 192.517 1.00 39.20  ? 72   ILE B CG1 1 
ATOM   4602  C  CG2 . ILE B  2  72  ? 64.487  285.473 191.085 1.00 40.54  ? 72   ILE B CG2 1 
ATOM   4603  C  CD1 . ILE B  2  72  ? 64.301  283.592 193.843 1.00 40.82  ? 72   ILE B CD1 1 
ATOM   4604  N  N   . LEU B  2  73  ? 67.769  286.446 190.700 1.00 41.64  ? 73   LEU B N   1 
ATOM   4605  C  CA  . LEU B  2  73  ? 68.117  287.563 189.874 1.00 41.71  ? 73   LEU B CA  1 
ATOM   4606  C  C   . LEU B  2  73  ? 69.051  287.120 188.759 1.00 42.17  ? 73   LEU B C   1 
ATOM   4607  O  O   . LEU B  2  73  ? 68.952  287.615 187.619 1.00 42.21  ? 73   LEU B O   1 
ATOM   4608  C  CB  . LEU B  2  73  ? 68.782  288.693 190.695 1.00 40.92  ? 73   LEU B CB  1 
ATOM   4609  C  CG  . LEU B  2  73  ? 67.858  289.357 191.695 1.00 39.71  ? 73   LEU B CG  1 
ATOM   4610  C  CD1 . LEU B  2  73  ? 68.799  290.154 192.605 1.00 38.65  ? 73   LEU B CD1 1 
ATOM   4611  C  CD2 . LEU B  2  73  ? 66.763  290.235 191.012 1.00 43.23  ? 73   LEU B CD2 1 
ATOM   4612  N  N   . ILE B  2  74  ? 69.933  286.191 189.045 1.00 41.42  ? 74   ILE B N   1 
ATOM   4613  C  CA  . ILE B  2  74  ? 70.779  285.697 187.938 1.00 44.32  ? 74   ILE B CA  1 
ATOM   4614  C  C   . ILE B  2  74  ? 69.947  284.938 186.800 1.00 45.03  ? 74   ILE B C   1 
ATOM   4615  O  O   . ILE B  2  74  ? 70.121  285.192 185.605 1.00 46.10  ? 74   ILE B O   1 
ATOM   4616  C  CB  . ILE B  2  74  ? 71.942  284.884 188.446 1.00 43.64  ? 74   ILE B CB  1 
ATOM   4617  C  CG1 . ILE B  2  74  ? 72.952  285.763 189.170 1.00 43.29  ? 74   ILE B CG1 1 
ATOM   4618  C  CG2 . ILE B  2  74  ? 72.731  284.323 187.254 1.00 47.17  ? 74   ILE B CG2 1 
ATOM   4619  C  CD1 . ILE B  2  74  ? 73.733  284.992 190.345 1.00 44.09  ? 74   ILE B CD1 1 
ATOM   4620  N  N   . LEU B  2  75  ? 69.006  284.103 187.211 1.00 44.92  ? 75   LEU B N   1 
ATOM   4621  C  CA  . LEU B  2  75  ? 68.007  283.514 186.291 1.00 46.52  ? 75   LEU B CA  1 
ATOM   4622  C  C   . LEU B  2  75  ? 67.177  284.545 185.479 1.00 47.03  ? 75   LEU B C   1 
ATOM   4623  O  O   . LEU B  2  75  ? 66.623  284.161 184.402 1.00 46.14  ? 75   LEU B O   1 
ATOM   4624  C  CB  . LEU B  2  75  ? 67.003  282.679 187.046 1.00 45.88  ? 75   LEU B CB  1 
ATOM   4625  C  CG  . LEU B  2  75  ? 67.508  281.242 187.293 1.00 49.08  ? 75   LEU B CG  1 
ATOM   4626  C  CD1 . LEU B  2  75  ? 68.989  281.087 187.084 1.00 52.17  ? 75   LEU B CD1 1 
ATOM   4627  C  CD2 . LEU B  2  75  ? 67.080  280.801 188.568 1.00 49.61  ? 75   LEU B CD2 1 
ATOM   4628  N  N   . ILE B  2  76  ? 67.087  285.801 185.958 1.00 43.97  ? 76   ILE B N   1 
ATOM   4629  C  CA  . ILE B  2  76  ? 66.464  286.855 185.178 1.00 43.20  ? 76   ILE B CA  1 
ATOM   4630  C  C   . ILE B  2  76  ? 67.517  287.582 184.314 1.00 45.38  ? 76   ILE B C   1 
ATOM   4631  O  O   . ILE B  2  76  ? 67.279  287.915 183.124 1.00 46.04  ? 76   ILE B O   1 
ATOM   4632  C  CB  . ILE B  2  76  ? 65.756  287.850 186.067 1.00 44.74  ? 76   ILE B CB  1 
ATOM   4633  C  CG1 . ILE B  2  76  ? 64.687  287.114 186.883 1.00 40.51  ? 76   ILE B CG1 1 
ATOM   4634  C  CG2 . ILE B  2  76  ? 65.189  288.994 185.217 1.00 40.72  ? 76   ILE B CG2 1 
ATOM   4635  C  CD1 . ILE B  2  76  ? 63.936  287.941 187.831 1.00 45.80  ? 76   ILE B CD1 1 
ATOM   4636  N  N   . ALA B  2  77  ? 68.702  287.791 184.868 1.00 45.53  ? 77   ALA B N   1 
ATOM   4637  C  CA  . ALA B  2  77  ? 69.664  288.655 184.189 1.00 47.21  ? 77   ALA B CA  1 
ATOM   4638  C  C   . ALA B  2  77  ? 70.202  287.961 182.946 1.00 47.52  ? 77   ALA B C   1 
ATOM   4639  O  O   . ALA B  2  77  ? 70.436  288.658 181.945 1.00 48.28  ? 77   ALA B O   1 
ATOM   4640  C  CB  . ALA B  2  77  ? 70.854  289.086 185.103 1.00 46.65  ? 77   ALA B CB  1 
ATOM   4641  N  N   . LEU B  2  78  ? 70.398  286.622 183.013 1.00 47.84  ? 78   LEU B N   1 
ATOM   4642  C  CA  . LEU B  2  78  ? 71.065  285.886 181.918 1.00 48.23  ? 78   LEU B CA  1 
ATOM   4643  C  C   . LEU B  2  78  ? 70.312  286.098 180.567 1.00 46.47  ? 78   LEU B C   1 
ATOM   4644  O  O   . LEU B  2  78  ? 70.896  286.596 179.573 1.00 46.08  ? 78   LEU B O   1 
ATOM   4645  C  CB  . LEU B  2  78  ? 71.160  284.408 182.291 1.00 49.42  ? 78   LEU B CB  1 
ATOM   4646  C  CG  . LEU B  2  78  ? 72.529  284.000 182.846 1.00 53.74  ? 78   LEU B CG  1 
ATOM   4647  C  CD1 . LEU B  2  78  ? 73.249  285.162 183.421 1.00 58.79  ? 78   LEU B CD1 1 
ATOM   4648  C  CD2 . LEU B  2  78  ? 72.260  282.946 183.881 1.00 57.05  ? 78   LEU B CD2 1 
ATOM   4649  N  N   . PRO B  2  79  ? 69.024  285.774 180.554 1.00 45.25  ? 79   PRO B N   1 
ATOM   4650  C  CA  . PRO B  2  79  ? 68.240  286.001 179.303 1.00 45.63  ? 79   PRO B CA  1 
ATOM   4651  C  C   . PRO B  2  79  ? 68.011  287.452 179.020 1.00 44.22  ? 79   PRO B C   1 
ATOM   4652  O  O   . PRO B  2  79  ? 67.958  287.855 177.859 1.00 45.99  ? 79   PRO B O   1 
ATOM   4653  C  CB  . PRO B  2  79  ? 66.896  285.269 179.555 1.00 45.60  ? 79   PRO B CB  1 
ATOM   4654  C  CG  . PRO B  2  79  ? 66.813  285.122 181.091 1.00 46.07  ? 79   PRO B CG  1 
ATOM   4655  C  CD  . PRO B  2  79  ? 68.254  285.078 181.605 1.00 45.97  ? 79   PRO B CD  1 
ATOM   4656  N  N   . SER B  2  80  ? 67.893  288.257 180.079 1.00 45.07  ? 80   SER B N   1 
ATOM   4657  C  CA  . SER B  2  80  ? 67.801  289.726 179.924 1.00 44.14  ? 80   SER B CA  1 
ATOM   4658  C  C   . SER B  2  80  ? 69.015  290.218 179.134 1.00 43.92  ? 80   SER B C   1 
ATOM   4659  O  O   . SER B  2  80  ? 68.890  290.949 178.158 1.00 44.79  ? 80   SER B O   1 
ATOM   4660  C  CB  . SER B  2  80  ? 67.735  290.466 181.322 1.00 44.37  ? 80   SER B CB  1 
ATOM   4661  O  OG  . SER B  2  80  ? 67.325  291.819 181.121 1.00 40.80  ? 80   SER B OG  1 
ATOM   4662  N  N   . LEU B  2  81  ? 70.199  289.785 179.525 1.00 43.94  ? 81   LEU B N   1 
ATOM   4663  C  CA  . LEU B  2  81  ? 71.374  290.381 178.894 1.00 45.16  ? 81   LEU B CA  1 
ATOM   4664  C  C   . LEU B  2  81  ? 71.598  289.805 177.479 1.00 46.10  ? 81   LEU B C   1 
ATOM   4665  O  O   . LEU B  2  81  ? 72.114  290.455 176.589 1.00 43.86  ? 81   LEU B O   1 
ATOM   4666  C  CB  . LEU B  2  81  ? 72.580  290.136 179.768 1.00 44.19  ? 81   LEU B CB  1 
ATOM   4667  C  CG  . LEU B  2  81  ? 72.506  290.919 181.101 1.00 47.98  ? 81   LEU B CG  1 
ATOM   4668  C  CD1 . LEU B  2  81  ? 73.890  290.830 181.681 1.00 46.89  ? 81   LEU B CD1 1 
ATOM   4669  C  CD2 . LEU B  2  81  ? 72.143  292.457 180.959 1.00 44.11  ? 81   LEU B CD2 1 
ATOM   4670  N  N   . ARG B  2  82  ? 71.213  288.556 177.312 1.00 47.77  ? 82   ARG B N   1 
ATOM   4671  C  CA  . ARG B  2  82  ? 71.372  287.915 175.990 1.00 50.40  ? 82   ARG B CA  1 
ATOM   4672  C  C   . ARG B  2  82  ? 70.532  288.716 174.967 1.00 49.46  ? 82   ARG B C   1 
ATOM   4673  O  O   . ARG B  2  82  ? 71.025  289.050 173.876 1.00 50.89  ? 82   ARG B O   1 
ATOM   4674  C  CB  . ARG B  2  82  ? 70.949  286.452 176.074 1.00 51.90  ? 82   ARG B CB  1 
ATOM   4675  C  CG  . ARG B  2  82  ? 70.890  285.687 174.666 1.00 59.68  ? 82   ARG B CG  1 
ATOM   4676  C  CD  . ARG B  2  82  ? 70.374  284.210 174.759 1.00 69.34  ? 82   ARG B CD  1 
ATOM   4677  N  NE  . ARG B  2  82  ? 69.044  284.205 175.373 1.00 77.27  ? 82   ARG B NE  1 
ATOM   4678  C  CZ  . ARG B  2  82  ? 67.888  284.445 174.743 1.00 80.23  ? 82   ARG B CZ  1 
ATOM   4679  N  NH1 . ARG B  2  82  ? 67.828  284.663 173.416 1.00 77.39  ? 82   ARG B NH1 1 
ATOM   4680  N  NH2 . ARG B  2  82  ? 66.770  284.461 175.478 1.00 81.90  ? 82   ARG B NH2 1 
ATOM   4681  N  N   . ILE B  2  83  ? 69.314  289.079 175.340 1.00 48.48  ? 83   ILE B N   1 
ATOM   4682  C  CA  . ILE B  2  83  ? 68.428  289.870 174.463 1.00 48.73  ? 83   ILE B CA  1 
ATOM   4683  C  C   . ILE B  2  83  ? 69.039  291.244 174.207 1.00 49.04  ? 83   ILE B C   1 
ATOM   4684  O  O   . ILE B  2  83  ? 69.068  291.758 173.056 1.00 48.06  ? 83   ILE B O   1 
ATOM   4685  C  CB  . ILE B  2  83  ? 66.931  289.971 175.026 1.00 49.01  ? 83   ILE B CB  1 
ATOM   4686  C  CG1 . ILE B  2  83  ? 66.267  288.574 175.074 1.00 48.29  ? 83   ILE B CG1 1 
ATOM   4687  C  CG2 . ILE B  2  83  ? 66.085  290.953 174.215 1.00 48.07  ? 83   ILE B CG2 1 
ATOM   4688  C  CD1 . ILE B  2  83  ? 64.974  288.581 175.655 1.00 47.81  ? 83   ILE B CD1 1 
ATOM   4689  N  N   . LEU B  2  84  ? 69.544  291.861 175.271 1.00 47.64  ? 84   LEU B N   1 
ATOM   4690  C  CA  . LEU B  2  84  ? 70.131  293.172 175.127 1.00 46.62  ? 84   LEU B CA  1 
ATOM   4691  C  C   . LEU B  2  84  ? 71.234  293.155 174.057 1.00 46.77  ? 84   LEU B C   1 
ATOM   4692  O  O   . LEU B  2  84  ? 71.257  293.993 173.157 1.00 45.65  ? 84   LEU B O   1 
ATOM   4693  C  CB  . LEU B  2  84  ? 70.732  293.614 176.506 1.00 46.60  ? 84   LEU B CB  1 
ATOM   4694  C  CG  . LEU B  2  84  ? 71.543  294.919 176.519 1.00 44.52  ? 84   LEU B CG  1 
ATOM   4695  C  CD1 . LEU B  2  84  ? 70.644  296.034 176.251 1.00 41.86  ? 84   LEU B CD1 1 
ATOM   4696  C  CD2 . LEU B  2  84  ? 72.334  295.109 177.925 1.00 41.46  ? 84   LEU B CD2 1 
ATOM   4697  N  N   . TYR B  2  85  ? 72.175  292.232 174.209 1.00 47.49  ? 85   TYR B N   1 
ATOM   4698  C  CA  . TYR B  2  85  ? 73.299  292.172 173.280 1.00 51.55  ? 85   TYR B CA  1 
ATOM   4699  C  C   . TYR B  2  85  ? 72.930  291.659 171.859 1.00 54.40  ? 85   TYR B C   1 
ATOM   4700  O  O   . TYR B  2  85  ? 73.447  292.176 170.836 1.00 55.46  ? 85   TYR B O   1 
ATOM   4701  C  CB  . TYR B  2  85  ? 74.402  291.362 173.891 1.00 48.82  ? 85   TYR B CB  1 
ATOM   4702  C  CG  . TYR B  2  85  ? 75.146  292.177 174.874 1.00 48.83  ? 85   TYR B CG  1 
ATOM   4703  C  CD1 . TYR B  2  85  ? 74.816  292.129 176.254 1.00 43.67  ? 85   TYR B CD1 1 
ATOM   4704  C  CD2 . TYR B  2  85  ? 76.122  293.068 174.444 1.00 43.59  ? 85   TYR B CD2 1 
ATOM   4705  C  CE1 . TYR B  2  85  ? 75.501  292.934 177.190 1.00 43.84  ? 85   TYR B CE1 1 
ATOM   4706  C  CE2 . TYR B  2  85  ? 76.799  293.920 175.390 1.00 43.86  ? 85   TYR B CE2 1 
ATOM   4707  C  CZ  . TYR B  2  85  ? 76.489  293.819 176.756 1.00 44.38  ? 85   TYR B CZ  1 
ATOM   4708  O  OH  . TYR B  2  85  ? 77.191  294.606 177.670 1.00 45.31  ? 85   TYR B OH  1 
ATOM   4709  N  N   . MET B  2  86  ? 72.011  290.697 171.804 1.00 57.12  ? 86   MET B N   1 
ATOM   4710  C  CA  . MET B  2  86  ? 71.453  290.225 170.504 1.00 61.29  ? 86   MET B CA  1 
ATOM   4711  C  C   . MET B  2  86  ? 70.872  291.409 169.682 1.00 61.85  ? 86   MET B C   1 
ATOM   4712  O  O   . MET B  2  86  ? 71.293  291.624 168.531 1.00 62.06  ? 86   MET B O   1 
ATOM   4713  C  CB  . MET B  2  86  ? 70.543  288.992 170.700 1.00 61.14  ? 86   MET B CB  1 
ATOM   4714  C  CG  . MET B  2  86  ? 69.255  288.879 169.917 1.00 68.89  ? 86   MET B CG  1 
ATOM   4715  S  SD  . MET B  2  86  ? 68.063  287.781 170.815 1.00 78.54  ? 86   MET B SD  1 
ATOM   4716  C  CE  . MET B  2  86  ? 69.080  286.409 171.417 1.00 73.68  ? 86   MET B CE  1 
ATOM   4717  N  N   . MET B  2  87  ? 70.024  292.228 170.297 1.00 62.61  ? 87   MET B N   1 
ATOM   4718  C  CA  . MET B  2  87  ? 69.510  293.437 169.645 1.00 62.99  ? 87   MET B CA  1 
ATOM   4719  C  C   . MET B  2  87  ? 70.612  294.460 169.301 1.00 62.58  ? 87   MET B C   1 
ATOM   4720  O  O   . MET B  2  87  ? 70.477  295.205 168.349 1.00 61.78  ? 87   MET B O   1 
ATOM   4721  C  CB  . MET B  2  87  ? 68.500  294.138 170.532 1.00 63.90  ? 87   MET B CB  1 
ATOM   4722  C  CG  . MET B  2  87  ? 67.394  293.235 171.154 1.00 70.25  ? 87   MET B CG  1 
ATOM   4723  S  SD  . MET B  2  87  ? 66.086  294.189 172.059 1.00 84.02  ? 87   MET B SD  1 
ATOM   4724  C  CE  . MET B  2  87  ? 67.002  295.280 173.272 1.00 75.26  ? 87   MET B CE  1 
ATOM   4725  N  N   . ASP B  2  88  ? 71.677  294.531 170.105 1.00 61.12  ? 88   ASP B N   1 
ATOM   4726  C  CA  . ASP B  2  88  ? 72.801  295.412 169.763 1.00 61.04  ? 88   ASP B CA  1 
ATOM   4727  C  C   . ASP B  2  88  ? 73.671  294.941 168.552 1.00 60.54  ? 88   ASP B C   1 
ATOM   4728  O  O   . ASP B  2  88  ? 74.364  295.741 167.975 1.00 59.55  ? 88   ASP B O   1 
ATOM   4729  C  CB  . ASP B  2  88  ? 73.685  295.685 170.980 1.00 58.86  ? 88   ASP B CB  1 
ATOM   4730  C  CG  . ASP B  2  88  ? 74.753  296.739 170.701 1.00 59.99  ? 88   ASP B CG  1 
ATOM   4731  O  OD1 . ASP B  2  88  ? 75.958  296.366 170.583 1.00 59.96  ? 88   ASP B OD1 1 
ATOM   4732  O  OD2 . ASP B  2  88  ? 74.411  297.949 170.584 1.00 54.55  ? 88   ASP B OD2 1 
ATOM   4733  N  N   . GLU B  2  89  ? 73.626  293.650 168.211 1.00 62.49  ? 89   GLU B N   1 
ATOM   4734  C  CA  . GLU B  2  89  ? 74.397  293.016 167.154 1.00 64.81  ? 89   GLU B CA  1 
ATOM   4735  C  C   . GLU B  2  89  ? 74.194  293.703 165.775 1.00 65.34  ? 89   GLU B C   1 
ATOM   4736  O  O   . GLU B  2  89  ? 73.056  294.062 165.451 1.00 63.16  ? 89   GLU B O   1 
ATOM   4737  C  CB  . GLU B  2  89  ? 73.878  291.606 167.023 1.00 66.05  ? 89   GLU B CB  1 
ATOM   4738  C  CG  . GLU B  2  89  ? 74.678  290.511 167.677 1.00 72.87  ? 89   GLU B CG  1 
ATOM   4739  C  CD  . GLU B  2  89  ? 73.866  289.177 167.714 1.00 82.66  ? 89   GLU B CD  1 
ATOM   4740  O  OE1 . GLU B  2  89  ? 72.937  288.964 166.868 1.00 85.11  ? 89   GLU B OE1 1 
ATOM   4741  O  OE2 . GLU B  2  89  ? 74.132  288.357 168.629 1.00 86.21  ? 89   GLU B OE2 1 
ATOM   4742  N  N   . ILE B  2  90  ? 75.291  293.837 165.001 1.00 66.43  ? 90   ILE B N   1 
ATOM   4743  C  CA  . ILE B  2  90  ? 75.313  294.480 163.648 1.00 69.12  ? 90   ILE B CA  1 
ATOM   4744  C  C   . ILE B  2  90  ? 74.286  293.835 162.686 1.00 69.56  ? 90   ILE B C   1 
ATOM   4745  O  O   . ILE B  2  90  ? 74.130  292.592 162.640 1.00 69.72  ? 90   ILE B O   1 
ATOM   4746  C  CB  . ILE B  2  90  ? 76.728  294.426 162.951 1.00 69.58  ? 90   ILE B CB  1 
ATOM   4747  C  CG1 . ILE B  2  90  ? 77.850  294.907 163.891 1.00 70.67  ? 90   ILE B CG1 1 
ATOM   4748  C  CG2 . ILE B  2  90  ? 76.726  295.195 161.605 1.00 68.95  ? 90   ILE B CG2 1 
ATOM   4749  C  CD1 . ILE B  2  90  ? 79.296  294.587 163.386 1.00 72.84  ? 90   ILE B CD1 1 
ATOM   4750  N  N   . ASN B  2  91  ? 73.581  294.633 161.899 1.00 69.54  ? 91   ASN B N   1 
ATOM   4751  C  CA  . ASN B  2  91  ? 72.633  293.926 160.999 1.00 69.53  ? 91   ASN B CA  1 
ATOM   4752  C  C   . ASN B  2  91  ? 72.561  294.335 159.559 1.00 67.58  ? 91   ASN B C   1 
ATOM   4753  O  O   . ASN B  2  91  ? 71.921  293.641 158.756 1.00 70.75  ? 91   ASN B O   1 
ATOM   4754  C  CB  . ASN B  2  91  ? 71.212  293.884 161.556 1.00 70.08  ? 91   ASN B CB  1 
ATOM   4755  C  CG  . ASN B  2  91  ? 70.779  295.223 162.146 1.00 72.48  ? 91   ASN B CG  1 
ATOM   4756  O  OD1 . ASN B  2  91  ? 70.195  295.246 163.235 1.00 74.49  ? 91   ASN B OD1 1 
ATOM   4757  N  ND2 . ASN B  2  91  ? 71.087  296.350 161.439 1.00 71.13  ? 91   ASN B ND2 1 
ATOM   4758  N  N   . ASN B  2  92  ? 73.171  295.441 159.215 1.00 63.29  ? 92   ASN B N   1 
ATOM   4759  C  CA  . ASN B  2  92  ? 73.135  295.817 157.818 1.00 60.49  ? 92   ASN B CA  1 
ATOM   4760  C  C   . ASN B  2  92  ? 71.756  296.191 157.281 1.00 55.70  ? 92   ASN B C   1 
ATOM   4761  O  O   . ASN B  2  92  ? 71.012  295.387 156.734 1.00 54.91  ? 92   ASN B O   1 
ATOM   4762  C  CB  . ASN B  2  92  ? 73.854  294.795 156.962 1.00 62.03  ? 92   ASN B CB  1 
ATOM   4763  C  CG  . ASN B  2  92  ? 75.340  294.700 157.334 1.00 67.58  ? 92   ASN B CG  1 
ATOM   4764  O  OD1 . ASN B  2  92  ? 75.928  295.659 157.888 1.00 72.85  ? 92   ASN B OD1 1 
ATOM   4765  N  ND2 . ASN B  2  92  ? 75.953  293.539 157.045 1.00 71.90  ? 92   ASN B ND2 1 
ATOM   4766  N  N   . PRO B  2  93  ? 71.419  297.454 157.456 1.00 51.64  ? 93   PRO B N   1 
ATOM   4767  C  CA  . PRO B  2  93  ? 70.112  297.898 157.020 1.00 47.95  ? 93   PRO B CA  1 
ATOM   4768  C  C   . PRO B  2  93  ? 70.153  298.112 155.496 1.00 45.11  ? 93   PRO B C   1 
ATOM   4769  O  O   . PRO B  2  93  ? 71.216  298.369 154.944 1.00 42.71  ? 93   PRO B O   1 
ATOM   4770  C  CB  . PRO B  2  93  ? 69.953  299.208 157.752 1.00 44.78  ? 93   PRO B CB  1 
ATOM   4771  C  CG  . PRO B  2  93  ? 71.325  299.658 157.970 1.00 49.89  ? 93   PRO B CG  1 
ATOM   4772  C  CD  . PRO B  2  93  ? 72.240  298.538 158.036 1.00 49.77  ? 93   PRO B CD  1 
ATOM   4773  N  N   . SER B  2  94  ? 68.986  298.052 154.849 1.00 43.64  ? 94   SER B N   1 
ATOM   4774  C  CA  . SER B  2  94  ? 68.870  298.358 153.386 1.00 41.92  ? 94   SER B CA  1 
ATOM   4775  C  C   . SER B  2  94  ? 68.391  299.761 153.146 1.00 39.10  ? 94   SER B C   1 
ATOM   4776  O  O   . SER B  2  94  ? 68.415  300.166 152.027 1.00 36.52  ? 94   SER B O   1 
ATOM   4777  C  CB  . SER B  2  94  ? 67.772  297.533 152.697 1.00 41.75  ? 94   SER B CB  1 
ATOM   4778  O  OG  . SER B  2  94  ? 67.637  296.232 153.170 1.00 48.50  ? 94   SER B OG  1 
ATOM   4779  N  N   . LEU B  2  95  ? 67.950  300.490 154.186 1.00 35.79  ? 95   LEU B N   1 
ATOM   4780  C  CA  . LEU B  2  95  ? 67.229  301.732 154.065 1.00 33.62  ? 95   LEU B CA  1 
ATOM   4781  C  C   . LEU B  2  95  ? 67.508  302.531 155.363 1.00 34.71  ? 95   LEU B C   1 
ATOM   4782  O  O   . LEU B  2  95  ? 67.525  301.897 156.457 1.00 32.84  ? 95   LEU B O   1 
ATOM   4783  C  CB  . LEU B  2  95  ? 65.703  301.360 153.997 1.00 35.74  ? 95   LEU B CB  1 
ATOM   4784  C  CG  . LEU B  2  95  ? 64.779  302.550 154.004 1.00 35.72  ? 95   LEU B CG  1 
ATOM   4785  C  CD1 . LEU B  2  95  ? 65.176  303.318 152.760 1.00 38.53  ? 95   LEU B CD1 1 
ATOM   4786  C  CD2 . LEU B  2  95  ? 63.349  302.159 154.039 1.00 33.20  ? 95   LEU B CD2 1 
ATOM   4787  N  N   . THR B  2  96  ? 67.680  303.864 155.287 1.00 30.29  ? 96   THR B N   1 
ATOM   4788  C  CA  . THR B  2  96  ? 67.682  304.699 156.526 1.00 29.91  ? 96   THR B CA  1 
ATOM   4789  C  C   . THR B  2  96  ? 66.637  305.750 156.354 1.00 30.61  ? 96   THR B C   1 
ATOM   4790  O  O   . THR B  2  96  ? 66.546  306.388 155.230 1.00 28.85  ? 96   THR B O   1 
ATOM   4791  C  CB  . THR B  2  96  ? 69.071  305.459 156.657 1.00 29.59  ? 96   THR B CB  1 
ATOM   4792  O  OG1 . THR B  2  96  ? 70.126  304.489 156.711 1.00 29.89  ? 96   THR B OG1 1 
ATOM   4793  C  CG2 . THR B  2  96  ? 69.093  306.461 157.894 1.00 29.44  ? 96   THR B CG2 1 
ATOM   4794  N  N   . VAL B  2  97  ? 65.835  305.921 157.407 1.00 28.63  ? 97   VAL B N   1 
ATOM   4795  C  CA  . VAL B  2  97  ? 64.810  306.937 157.428 1.00 28.59  ? 97   VAL B CA  1 
ATOM   4796  C  C   . VAL B  2  97  ? 65.107  307.803 158.672 1.00 31.23  ? 97   VAL B C   1 
ATOM   4797  O  O   . VAL B  2  97  ? 65.493  307.257 159.711 1.00 31.77  ? 97   VAL B O   1 
ATOM   4798  C  CB  . VAL B  2  97  ? 63.433  306.270 157.467 1.00 27.14  ? 97   VAL B CB  1 
ATOM   4799  C  CG1 . VAL B  2  97  ? 62.203  307.311 157.618 1.00 24.74  ? 97   VAL B CG1 1 
ATOM   4800  C  CG2 . VAL B  2  97  ? 63.274  305.305 156.216 1.00 31.56  ? 97   VAL B CG2 1 
ATOM   4801  N  N   . LYS B  2  98  ? 64.988  309.115 158.570 1.00 29.31  ? 98   LYS B N   1 
ATOM   4802  C  CA  . LYS B  2  98  ? 65.116  309.967 159.710 1.00 27.67  ? 98   LYS B CA  1 
ATOM   4803  C  C   . LYS B  2  98  ? 63.746  310.379 160.137 1.00 29.86  ? 98   LYS B C   1 
ATOM   4804  O  O   . LYS B  2  98  ? 62.851  310.575 159.293 1.00 30.23  ? 98   LYS B O   1 
ATOM   4805  C  CB  . LYS B  2  98  ? 65.919  311.195 159.386 1.00 25.57  ? 98   LYS B CB  1 
ATOM   4806  C  CG  . LYS B  2  98  ? 67.417  310.897 159.231 1.00 28.30  ? 98   LYS B CG  1 
ATOM   4807  C  CD  . LYS B  2  98  ? 67.992  312.025 158.403 1.00 22.42  ? 98   LYS B CD  1 
ATOM   4808  C  CE  . LYS B  2  98  ? 67.761  311.758 156.818 1.00 20.60  ? 98   LYS B CE  1 
ATOM   4809  N  NZ  . LYS B  2  98  ? 68.043  313.109 156.121 1.00 27.12  ? 98   LYS B NZ  1 
ATOM   4810  N  N   . THR B  2  99  ? 63.546  310.548 161.438 1.00 28.76  ? 99   THR B N   1 
ATOM   4811  C  CA  . THR B  2  99  ? 62.348  311.254 161.840 1.00 31.38  ? 99   THR B CA  1 
ATOM   4812  C  C   . THR B  2  99  ? 62.706  312.360 162.798 1.00 30.88  ? 99   THR B C   1 
ATOM   4813  O  O   . THR B  2  99  ? 63.609  312.142 163.627 1.00 32.09  ? 99   THR B O   1 
ATOM   4814  C  CB  . THR B  2  99  ? 61.348  310.307 162.442 1.00 30.01  ? 99   THR B CB  1 
ATOM   4815  O  OG1 . THR B  2  99  ? 60.180  311.069 162.848 1.00 30.94  ? 99   THR B OG1 1 
ATOM   4816  C  CG2 . THR B  2  99  ? 61.947  309.582 163.724 1.00 28.96  ? 99   THR B CG2 1 
ATOM   4817  N  N   . MET B  2  100 ? 62.063  313.539 162.651 1.00 31.57  ? 100  MET B N   1 
ATOM   4818  C  CA  . MET B  2  100 ? 62.307  314.708 163.476 1.00 30.52  ? 100  MET B CA  1 
ATOM   4819  C  C   . MET B  2  100 ? 61.024  314.990 164.239 1.00 30.42  ? 100  MET B C   1 
ATOM   4820  O  O   . MET B  2  100 ? 59.954  315.127 163.627 1.00 28.20  ? 100  MET B O   1 
ATOM   4821  C  CB  . MET B  2  100 ? 62.717  315.957 162.712 1.00 29.13  ? 100  MET B CB  1 
ATOM   4822  C  CG  . MET B  2  100 ? 63.768  315.599 161.680 1.00 32.24  ? 100  MET B CG  1 
ATOM   4823  S  SD  . MET B  2  100 ? 65.463  315.310 162.449 1.00 36.20  ? 100  MET B SD  1 
ATOM   4824  C  CE  . MET B  2  100 ? 65.857  316.815 163.280 1.00 31.54  ? 100  MET B CE  1 
ATOM   4825  N  N   . GLY B  2  101 ? 61.175  315.115 165.592 1.00 30.54  ? 101  GLY B N   1 
ATOM   4826  C  CA  . GLY B  2  101 ? 60.102  315.518 166.458 1.00 26.02  ? 101  GLY B CA  1 
ATOM   4827  C  C   . GLY B  2  101 ? 59.914  316.990 166.422 1.00 25.94  ? 101  GLY B C   1 
ATOM   4828  O  O   . GLY B  2  101 ? 60.897  317.764 166.297 1.00 25.34  ? 101  GLY B O   1 
ATOM   4829  N  N   . HIS B  2  102 ? 58.634  317.387 166.542 1.00 25.12  ? 102  HIS B N   1 
ATOM   4830  C  CA  . HIS B  2  102 ? 58.284  318.789 166.650 1.00 26.86  ? 102  HIS B CA  1 
ATOM   4831  C  C   . HIS B  2  102 ? 57.038  318.939 167.517 1.00 27.88  ? 102  HIS B C   1 
ATOM   4832  O  O   . HIS B  2  102 ? 56.244  318.012 167.632 1.00 26.84  ? 102  HIS B O   1 
ATOM   4833  C  CB  . HIS B  2  102 ? 57.707  319.286 165.263 1.00 27.17  ? 102  HIS B CB  1 
ATOM   4834  C  CG  . HIS B  2  102 ? 58.664  319.090 164.117 1.00 27.72  ? 102  HIS B CG  1 
ATOM   4835  N  ND1 . HIS B  2  102 ? 59.596  320.037 163.794 1.00 25.72  ? 102  HIS B ND1 1 
ATOM   4836  C  CD2 . HIS B  2  102 ? 58.809  318.079 163.197 1.00 27.69  ? 102  HIS B CD2 1 
ATOM   4837  C  CE1 . HIS B  2  102 ? 60.308  319.622 162.736 1.00 28.52  ? 102  HIS B CE1 1 
ATOM   4838  N  NE2 . HIS B  2  102 ? 59.861  318.424 162.378 1.00 30.20  ? 102  HIS B NE2 1 
ATOM   4839  N  N   . GLN B  2  103 ? 56.775  320.165 167.941 1.00 26.27  ? 103  GLN B N   1 
ATOM   4840  C  CA  . GLN B  2  103 ? 55.583  320.477 168.637 1.00 28.56  ? 103  GLN B CA  1 
ATOM   4841  C  C   . GLN B  2  103 ? 54.480  320.914 167.620 1.00 29.71  ? 103  GLN B C   1 
ATOM   4842  O  O   . GLN B  2  103 ? 54.607  321.975 167.020 1.00 31.31  ? 103  GLN B O   1 
ATOM   4843  C  CB  . GLN B  2  103 ? 55.896  321.656 169.597 1.00 28.14  ? 103  GLN B CB  1 
ATOM   4844  C  CG  . GLN B  2  103 ? 56.747  321.251 170.922 1.00 25.32  ? 103  GLN B CG  1 
ATOM   4845  C  CD  . GLN B  2  103 ? 56.879  322.508 171.789 1.00 28.50  ? 103  GLN B CD  1 
ATOM   4846  O  OE1 . GLN B  2  103 ? 57.200  323.562 171.259 1.00 30.41  ? 103  GLN B OE1 1 
ATOM   4847  N  NE2 . GLN B  2  103 ? 56.552  322.431 173.078 1.00 26.65  ? 103  GLN B NE2 1 
ATOM   4848  N  N   . TRP B  2  104 ? 53.426  320.098 167.387 1.00 30.36  ? 104  TRP B N   1 
ATOM   4849  C  CA  . TRP B  2  104 ? 53.336  318.727 167.798 1.00 28.87  ? 104  TRP B CA  1 
ATOM   4850  C  C   . TRP B  2  104 ? 52.974  317.860 166.584 1.00 30.33  ? 104  TRP B C   1 
ATOM   4851  O  O   . TRP B  2  104 ? 51.779  317.698 166.235 1.00 30.33  ? 104  TRP B O   1 
ATOM   4852  C  CB  . TRP B  2  104 ? 52.202  318.629 168.868 1.00 29.26  ? 104  TRP B CB  1 
ATOM   4853  C  CG  . TRP B  2  104 ? 52.634  319.329 170.161 1.00 29.03  ? 104  TRP B CG  1 
ATOM   4854  C  CD1 . TRP B  2  104 ? 53.367  318.754 171.184 1.00 25.61  ? 104  TRP B CD1 1 
ATOM   4855  C  CD2 . TRP B  2  104 ? 52.477  320.739 170.521 1.00 26.47  ? 104  TRP B CD2 1 
ATOM   4856  N  NE1 . TRP B  2  104 ? 53.599  319.725 172.183 1.00 26.78  ? 104  TRP B NE1 1 
ATOM   4857  C  CE2 . TRP B  2  104 ? 53.029  320.910 171.827 1.00 28.77  ? 104  TRP B CE2 1 
ATOM   4858  C  CE3 . TRP B  2  104 ? 51.900  321.853 169.885 1.00 30.50  ? 104  TRP B CE3 1 
ATOM   4859  C  CZ2 . TRP B  2  104 ? 53.066  322.134 172.480 1.00 30.36  ? 104  TRP B CZ2 1 
ATOM   4860  C  CZ3 . TRP B  2  104 ? 51.906  323.027 170.517 1.00 30.60  ? 104  TRP B CZ3 1 
ATOM   4861  C  CH2 . TRP B  2  104 ? 52.469  323.174 171.882 1.00 26.34  ? 104  TRP B CH2 1 
ATOM   4862  N  N   . TYR B  2  105 ? 53.995  317.268 165.981 1.00 29.54  ? 105  TYR B N   1 
ATOM   4863  C  CA  . TYR B  2  105 ? 53.827  316.315 164.824 1.00 27.39  ? 105  TYR B CA  1 
ATOM   4864  C  C   . TYR B  2  105 ? 55.224  315.798 164.509 1.00 27.79  ? 105  TYR B C   1 
ATOM   4865  O  O   . TYR B  2  105 ? 56.268  316.230 165.079 1.00 29.78  ? 105  TYR B O   1 
ATOM   4866  C  CB  . TYR B  2  105 ? 53.250  317.110 163.578 1.00 28.73  ? 105  TYR B CB  1 
ATOM   4867  C  CG  . TYR B  2  105 ? 54.254  318.139 163.094 1.00 27.76  ? 105  TYR B CG  1 
ATOM   4868  C  CD1 . TYR B  2  105 ? 54.316  319.443 163.674 1.00 27.60  ? 105  TYR B CD1 1 
ATOM   4869  C  CD2 . TYR B  2  105 ? 55.147  317.813 162.063 1.00 30.91  ? 105  TYR B CD2 1 
ATOM   4870  C  CE1 . TYR B  2  105 ? 55.276  320.388 163.186 1.00 33.91  ? 105  TYR B CE1 1 
ATOM   4871  C  CE2 . TYR B  2  105 ? 56.096  318.764 161.535 1.00 30.06  ? 105  TYR B CE2 1 
ATOM   4872  C  CZ  . TYR B  2  105 ? 56.115  320.028 162.102 1.00 32.69  ? 105  TYR B CZ  1 
ATOM   4873  O  OH  . TYR B  2  105 ? 57.051  320.929 161.606 1.00 34.80  ? 105  TYR B OH  1 
ATOM   4874  N  N   . TRP B  2  106 ? 55.304  314.780 163.674 1.00 29.45  ? 106  TRP B N   1 
ATOM   4875  C  CA  . TRP B  2  106 ? 56.572  314.169 163.313 1.00 29.38  ? 106  TRP B CA  1 
ATOM   4876  C  C   . TRP B  2  106 ? 56.827  314.506 161.834 1.00 29.41  ? 106  TRP B C   1 
ATOM   4877  O  O   . TRP B  2  106 ? 55.896  314.565 161.040 1.00 28.93  ? 106  TRP B O   1 
ATOM   4878  C  CB  . TRP B  2  106 ? 56.553  312.637 163.422 1.00 28.82  ? 106  TRP B CB  1 
ATOM   4879  C  CG  . TRP B  2  106 ? 56.365  312.211 164.867 1.00 30.56  ? 106  TRP B CG  1 
ATOM   4880  C  CD1 . TRP B  2  106 ? 55.198  311.923 165.497 1.00 28.84  ? 106  TRP B CD1 1 
ATOM   4881  C  CD2 . TRP B  2  106 ? 57.431  312.105 165.847 1.00 24.78  ? 106  TRP B CD2 1 
ATOM   4882  N  NE1 . TRP B  2  106 ? 55.490  311.586 166.867 1.00 30.08  ? 106  TRP B NE1 1 
ATOM   4883  C  CE2 . TRP B  2  106 ? 56.851  311.701 167.072 1.00 30.57  ? 106  TRP B CE2 1 
ATOM   4884  C  CE3 . TRP B  2  106 ? 58.825  312.235 165.758 1.00 28.65  ? 106  TRP B CE3 1 
ATOM   4885  C  CZ2 . TRP B  2  106 ? 57.636  311.463 168.272 1.00 27.26  ? 106  TRP B CZ2 1 
ATOM   4886  C  CZ3 . TRP B  2  106 ? 59.598  312.010 166.969 1.00 28.83  ? 106  TRP B CZ3 1 
ATOM   4887  C  CH2 . TRP B  2  106 ? 58.972  311.617 168.164 1.00 30.18  ? 106  TRP B CH2 1 
ATOM   4888  N  N   . SER B  2  107 ? 58.081  314.730 161.495 1.00 29.32  ? 107  SER B N   1 
ATOM   4889  C  CA  . SER B  2  107 ? 58.436  314.837 160.080 1.00 30.53  ? 107  SER B CA  1 
ATOM   4890  C  C   . SER B  2  107 ? 59.370  313.652 159.780 1.00 31.01  ? 107  SER B C   1 
ATOM   4891  O  O   . SER B  2  107 ? 59.967  313.080 160.707 1.00 27.16  ? 107  SER B O   1 
ATOM   4892  C  CB  . SER B  2  107 ? 59.035  316.217 159.782 1.00 31.00  ? 107  SER B CB  1 
ATOM   4893  O  OG  . SER B  2  107 ? 60.382  316.338 160.322 1.00 32.02  ? 107  SER B OG  1 
ATOM   4894  N  N   . TYR B  2  108 ? 59.362  313.159 158.531 1.00 29.91  ? 108  TYR B N   1 
ATOM   4895  C  CA  . TYR B  2  108 ? 60.135  311.990 158.138 1.00 31.09  ? 108  TYR B CA  1 
ATOM   4896  C  C   . TYR B  2  108 ? 61.028  312.324 156.913 1.00 31.61  ? 108  TYR B C   1 
ATOM   4897  O  O   . TYR B  2  108 ? 60.642  313.097 156.099 1.00 30.90  ? 108  TYR B O   1 
ATOM   4898  C  CB  . TYR B  2  108 ? 59.178  310.827 157.726 1.00 30.29  ? 108  TYR B CB  1 
ATOM   4899  C  CG  . TYR B  2  108 ? 58.412  310.420 158.985 1.00 33.64  ? 108  TYR B CG  1 
ATOM   4900  C  CD1 . TYR B  2  108 ? 58.976  309.522 159.897 1.00 28.06  ? 108  TYR B CD1 1 
ATOM   4901  C  CD2 . TYR B  2  108 ? 57.144  310.999 159.291 1.00 33.65  ? 108  TYR B CD2 1 
ATOM   4902  C  CE1 . TYR B  2  108 ? 58.312  309.180 161.079 1.00 27.16  ? 108  TYR B CE1 1 
ATOM   4903  C  CE2 . TYR B  2  108 ? 56.441  310.628 160.428 1.00 26.95  ? 108  TYR B CE2 1 
ATOM   4904  C  CZ  . TYR B  2  108 ? 57.085  309.692 161.325 1.00 31.45  ? 108  TYR B CZ  1 
ATOM   4905  O  OH  . TYR B  2  108 ? 56.449  309.343 162.471 1.00 27.79  ? 108  TYR B OH  1 
ATOM   4906  N  N   . GLU B  2  109 ? 62.231  311.795 156.811 1.00 32.04  ? 109  GLU B N   1 
ATOM   4907  C  CA  . GLU B  2  109 ? 63.092  312.237 155.723 1.00 29.86  ? 109  GLU B CA  1 
ATOM   4908  C  C   . GLU B  2  109 ? 63.572  310.907 155.165 1.00 31.68  ? 109  GLU B C   1 
ATOM   4909  O  O   . GLU B  2  109 ? 63.985  310.051 155.939 1.00 34.03  ? 109  GLU B O   1 
ATOM   4910  C  CB  . GLU B  2  109 ? 64.235  313.102 156.197 1.00 30.18  ? 109  GLU B CB  1 
ATOM   4911  C  CG  . GLU B  2  109 ? 63.749  314.360 156.968 1.00 30.85  ? 109  GLU B CG  1 
ATOM   4912  C  CD  . GLU B  2  109 ? 64.913  315.187 157.495 1.00 31.73  ? 109  GLU B CD  1 
ATOM   4913  O  OE1 . GLU B  2  109 ? 64.642  316.252 158.129 1.00 33.47  ? 109  GLU B OE1 1 
ATOM   4914  O  OE2 . GLU B  2  109 ? 66.095  314.847 157.169 1.00 32.00  ? 109  GLU B OE2 1 
ATOM   4915  N  N   . TYR B  2  110 ? 63.515  310.686 153.851 1.00 30.10  ? 110  TYR B N   1 
ATOM   4916  C  CA  . TYR B  2  110 ? 64.070  309.435 153.327 1.00 30.10  ? 110  TYR B CA  1 
ATOM   4917  C  C   . TYR B  2  110 ? 65.017  309.949 152.287 1.00 32.17  ? 110  TYR B C   1 
ATOM   4918  O  O   . TYR B  2  110 ? 64.576  310.296 151.161 1.00 30.88  ? 110  TYR B O   1 
ATOM   4919  C  CB  . TYR B  2  110 ? 63.043  308.547 152.600 1.00 30.48  ? 110  TYR B CB  1 
ATOM   4920  C  CG  . TYR B  2  110 ? 61.865  307.993 153.346 1.00 30.80  ? 110  TYR B CG  1 
ATOM   4921  C  CD1 . TYR B  2  110 ? 61.671  306.582 153.449 1.00 28.44  ? 110  TYR B CD1 1 
ATOM   4922  C  CD2 . TYR B  2  110 ? 60.919  308.863 153.964 1.00 30.84  ? 110  TYR B CD2 1 
ATOM   4923  C  CE1 . TYR B  2  110 ? 60.538  306.085 154.064 1.00 30.21  ? 110  TYR B CE1 1 
ATOM   4924  C  CE2 . TYR B  2  110 ? 59.782  308.338 154.609 1.00 28.13  ? 110  TYR B CE2 1 
ATOM   4925  C  CZ  . TYR B  2  110 ? 59.590  306.987 154.664 1.00 27.15  ? 110  TYR B CZ  1 
ATOM   4926  O  OH  . TYR B  2  110 ? 58.397  306.477 155.252 1.00 27.12  ? 110  TYR B OH  1 
ATOM   4927  N  N   . THR B  2  111 ? 66.320  310.054 152.646 1.00 31.39  ? 111  THR B N   1 
ATOM   4928  C  CA  . THR B  2  111 ? 67.250  310.721 151.726 1.00 30.41  ? 111  THR B CA  1 
ATOM   4929  C  C   . THR B  2  111 ? 68.382  309.799 151.341 1.00 30.81  ? 111  THR B C   1 
ATOM   4930  O  O   . THR B  2  111 ? 69.451  310.260 150.947 1.00 31.73  ? 111  THR B O   1 
ATOM   4931  C  CB  . THR B  2  111 ? 67.755  312.072 152.284 1.00 31.29  ? 111  THR B CB  1 
ATOM   4932  O  OG1 . THR B  2  111 ? 68.374  311.803 153.550 1.00 33.64  ? 111  THR B OG1 1 
ATOM   4933  C  CG2 . THR B  2  111 ? 66.527  312.981 152.606 1.00 28.62  ? 111  THR B CG2 1 
ATOM   4934  N  N   . ASP B  2  112 ? 68.157  308.491 151.313 1.00 31.17  ? 112  ASP B N   1 
ATOM   4935  C  CA  . ASP B  2  112 ? 69.235  307.678 150.743 1.00 34.63  ? 112  ASP B CA  1 
ATOM   4936  C  C   . ASP B  2  112 ? 69.479  308.006 149.219 1.00 37.03  ? 112  ASP B C   1 
ATOM   4937  O  O   . ASP B  2  112 ? 70.636  307.921 148.769 1.00 38.33  ? 112  ASP B O   1 
ATOM   4938  C  CB  . ASP B  2  112 ? 68.949  306.209 150.838 1.00 34.33  ? 112  ASP B CB  1 
ATOM   4939  C  CG  . ASP B  2  112 ? 69.197  305.661 152.194 1.00 34.39  ? 112  ASP B CG  1 
ATOM   4940  O  OD1 . ASP B  2  112 ? 70.189  306.017 152.823 1.00 33.84  ? 112  ASP B OD1 1 
ATOM   4941  O  OD2 . ASP B  2  112 ? 68.425  304.789 152.559 1.00 29.75  ? 112  ASP B OD2 1 
ATOM   4942  N  N   . TYR B  2  113 ? 68.432  308.390 148.479 1.00 39.95  ? 113  TYR B N   1 
ATOM   4943  C  CA  . TYR B  2  113 ? 68.526  308.524 146.972 1.00 44.39  ? 113  TYR B CA  1 
ATOM   4944  C  C   . TYR B  2  113 ? 67.954  309.817 146.487 1.00 43.80  ? 113  TYR B C   1 
ATOM   4945  O  O   . TYR B  2  113 ? 68.620  310.503 145.788 1.00 45.10  ? 113  TYR B O   1 
ATOM   4946  C  CB  . TYR B  2  113 ? 67.741  307.449 146.219 1.00 48.05  ? 113  TYR B CB  1 
ATOM   4947  C  CG  . TYR B  2  113 ? 67.960  306.062 146.731 1.00 55.27  ? 113  TYR B CG  1 
ATOM   4948  C  CD1 . TYR B  2  113 ? 69.223  305.420 146.576 1.00 62.73  ? 113  TYR B CD1 1 
ATOM   4949  C  CD2 . TYR B  2  113 ? 66.929  305.367 147.387 1.00 59.50  ? 113  TYR B CD2 1 
ATOM   4950  C  CE1 . TYR B  2  113 ? 69.468  304.101 147.115 1.00 62.15  ? 113  TYR B CE1 1 
ATOM   4951  C  CE2 . TYR B  2  113 ? 67.154  304.052 147.914 1.00 64.13  ? 113  TYR B CE2 1 
ATOM   4952  C  CZ  . TYR B  2  113 ? 68.426  303.436 147.751 1.00 63.55  ? 113  TYR B CZ  1 
ATOM   4953  O  OH  . TYR B  2  113 ? 68.633  302.147 148.208 1.00 65.07  ? 113  TYR B OH  1 
ATOM   4954  N  N   . GLU B  2  114 ? 66.705  310.106 146.809 1.00 41.67  ? 114  GLU B N   1 
ATOM   4955  C  CA  . GLU B  2  114 ? 66.039  311.384 146.501 1.00 42.72  ? 114  GLU B CA  1 
ATOM   4956  C  C   . GLU B  2  114 ? 65.795  312.228 147.753 1.00 42.64  ? 114  GLU B C   1 
ATOM   4957  O  O   . GLU B  2  114 ? 65.973  311.731 148.861 1.00 43.36  ? 114  GLU B O   1 
ATOM   4958  C  CB  . GLU B  2  114 ? 64.643  311.091 145.854 1.00 43.48  ? 114  GLU B CB  1 
ATOM   4959  C  CG  . GLU B  2  114 ? 64.683  310.112 144.687 1.00 47.59  ? 114  GLU B CG  1 
ATOM   4960  C  CD  . GLU B  2  114 ? 65.321  310.734 143.455 1.00 56.89  ? 114  GLU B CD  1 
ATOM   4961  O  OE1 . GLU B  2  114 ? 65.706  309.963 142.516 1.00 62.51  ? 114  GLU B OE1 1 
ATOM   4962  O  OE2 . GLU B  2  114 ? 65.465  311.993 143.447 1.00 57.10  ? 114  GLU B OE2 1 
ATOM   4963  N  N   . ASP B  2  115 ? 65.425  313.502 147.616 1.00 41.62  ? 115  ASP B N   1 
ATOM   4964  C  CA  . ASP B  2  115 ? 65.028  314.215 148.784 1.00 43.57  ? 115  ASP B CA  1 
ATOM   4965  C  C   . ASP B  2  115 ? 63.496  314.065 149.092 1.00 42.25  ? 115  ASP B C   1 
ATOM   4966  O  O   . ASP B  2  115 ? 62.659  314.835 148.625 1.00 42.03  ? 115  ASP B O   1 
ATOM   4967  C  CB  . ASP B  2  115 ? 65.655  315.631 148.853 1.00 47.04  ? 115  ASP B CB  1 
ATOM   4968  C  CG  . ASP B  2  115 ? 67.166  315.566 149.475 1.00 56.78  ? 115  ASP B CG  1 
ATOM   4969  O  OD1 . ASP B  2  115 ? 67.518  316.352 150.485 1.00 63.97  ? 115  ASP B OD1 1 
ATOM   4970  O  OD2 . ASP B  2  115 ? 67.982  314.662 149.011 1.00 61.56  ? 115  ASP B OD2 1 
ATOM   4971  N  N   . LEU B  2  116 ? 63.139  312.962 149.734 1.00 36.17  ? 116  LEU B N   1 
ATOM   4972  C  CA  . LEU B  2  116 ? 61.781  312.805 150.054 1.00 36.08  ? 116  LEU B CA  1 
ATOM   4973  C  C   . LEU B  2  116 ? 61.632  313.234 151.572 1.00 36.11  ? 116  LEU B C   1 
ATOM   4974  O  O   . LEU B  2  116 ? 62.394  312.723 152.433 1.00 35.27  ? 116  LEU B O   1 
ATOM   4975  C  CB  . LEU B  2  116 ? 61.386  311.360 149.809 1.00 33.18  ? 116  LEU B CB  1 
ATOM   4976  C  CG  . LEU B  2  116 ? 59.993  310.988 150.410 1.00 40.08  ? 116  LEU B CG  1 
ATOM   4977  C  CD1 . LEU B  2  116 ? 58.907  311.897 149.948 1.00 44.29  ? 116  LEU B CD1 1 
ATOM   4978  C  CD2 . LEU B  2  116 ? 59.718  309.604 150.056 1.00 41.98  ? 116  LEU B CD2 1 
ATOM   4979  N  N   . SER B  2  117 ? 60.733  314.151 151.863 1.00 34.32  ? 117  SER B N   1 
ATOM   4980  C  CA  . SER B  2  117 ? 60.388  314.449 153.271 1.00 35.88  ? 117  SER B CA  1 
ATOM   4981  C  C   . SER B  2  117 ? 58.950  314.989 153.335 1.00 35.21  ? 117  SER B C   1 
ATOM   4982  O  O   . SER B  2  117 ? 58.408  315.516 152.342 1.00 32.46  ? 117  SER B O   1 
ATOM   4983  C  CB  . SER B  2  117 ? 61.417  315.409 153.873 1.00 36.05  ? 117  SER B CB  1 
ATOM   4984  O  OG  . SER B  2  117 ? 61.146  316.711 153.412 1.00 38.90  ? 117  SER B OG  1 
ATOM   4985  N  N   . PHE B  2  118 ? 58.266  314.705 154.430 1.00 30.66  ? 118  PHE B N   1 
ATOM   4986  C  CA  . PHE B  2  118 ? 56.923  315.274 154.682 1.00 31.27  ? 118  PHE B CA  1 
ATOM   4987  C  C   . PHE B  2  118 ? 56.579  315.277 156.229 1.00 30.61  ? 118  PHE B C   1 
ATOM   4988  O  O   . PHE B  2  118 ? 57.250  314.590 156.971 1.00 28.68  ? 118  PHE B O   1 
ATOM   4989  C  CB  . PHE B  2  118 ? 55.898  314.349 154.020 1.00 30.32  ? 118  PHE B CB  1 
ATOM   4990  C  CG  . PHE B  2  118 ? 56.047  312.930 154.392 1.00 33.18  ? 118  PHE B CG  1 
ATOM   4991  C  CD1 . PHE B  2  118 ? 55.311  312.385 155.510 1.00 31.69  ? 118  PHE B CD1 1 
ATOM   4992  C  CD2 . PHE B  2  118 ? 56.932  312.077 153.648 1.00 31.16  ? 118  PHE B CD2 1 
ATOM   4993  C  CE1 . PHE B  2  118 ? 55.421  311.075 155.846 1.00 29.61  ? 118  PHE B CE1 1 
ATOM   4994  C  CE2 . PHE B  2  118 ? 57.039  310.701 154.010 1.00 27.75  ? 118  PHE B CE2 1 
ATOM   4995  C  CZ  . PHE B  2  118 ? 56.259  310.222 155.159 1.00 32.70  ? 118  PHE B CZ  1 
ATOM   4996  N  N   . ASP B  2  119 ? 55.398  315.840 156.592 1.00 32.03  ? 119  ASP B N   1 
ATOM   4997  C  CA  . ASP B  2  119 ? 55.045  316.082 157.957 1.00 31.11  ? 119  ASP B CA  1 
ATOM   4998  C  C   . ASP B  2  119 ? 53.916  315.084 158.179 1.00 30.95  ? 119  ASP B C   1 
ATOM   4999  O  O   . ASP B  2  119 ? 53.183  314.789 157.217 1.00 30.16  ? 119  ASP B O   1 
ATOM   5000  C  CB  . ASP B  2  119 ? 54.529  317.496 158.091 1.00 28.84  ? 119  ASP B CB  1 
ATOM   5001  C  CG  . ASP B  2  119 ? 55.630  318.539 158.038 1.00 29.90  ? 119  ASP B CG  1 
ATOM   5002  O  OD1 . ASP B  2  119 ? 56.798  318.245 158.203 1.00 32.95  ? 119  ASP B OD1 1 
ATOM   5003  O  OD2 . ASP B  2  119 ? 55.313  319.700 157.834 1.00 35.54  ? 119  ASP B OD2 1 
ATOM   5004  N  N   . SER B  2  120 ? 53.694  314.702 159.430 1.00 30.71  ? 120  SER B N   1 
ATOM   5005  C  CA  . SER B  2  120 ? 52.725  313.641 159.790 1.00 29.94  ? 120  SER B CA  1 
ATOM   5006  C  C   . SER B  2  120 ? 52.056  314.113 161.043 1.00 30.38  ? 120  SER B C   1 
ATOM   5007  O  O   . SER B  2  120 ? 52.705  314.213 162.138 1.00 30.80  ? 120  SER B O   1 
ATOM   5008  C  CB  . SER B  2  120 ? 53.505  312.336 159.926 1.00 29.11  ? 120  SER B CB  1 
ATOM   5009  O  OG  . SER B  2  120 ? 52.640  311.293 160.311 1.00 32.58  ? 120  SER B OG  1 
ATOM   5010  N  N   . TYR B  2  121 ? 50.774  314.470 160.895 1.00 29.54  ? 121  TYR B N   1 
ATOM   5011  C  CA  . TYR B  2  121 ? 49.972  315.096 161.904 1.00 28.17  ? 121  TYR B CA  1 
ATOM   5012  C  C   . TYR B  2  121 ? 48.795  314.218 162.228 1.00 30.46  ? 121  TYR B C   1 
ATOM   5013  O  O   . TYR B  2  121 ? 48.154  313.625 161.361 1.00 31.48  ? 121  TYR B O   1 
ATOM   5014  C  CB  . TYR B  2  121 ? 49.322  316.429 161.390 1.00 29.62  ? 121  TYR B CB  1 
ATOM   5015  C  CG  . TYR B  2  121 ? 50.152  317.665 161.505 1.00 29.03  ? 121  TYR B CG  1 
ATOM   5016  C  CD1 . TYR B  2  121 ? 49.995  318.570 162.640 1.00 30.79  ? 121  TYR B CD1 1 
ATOM   5017  C  CD2 . TYR B  2  121 ? 51.155  317.947 160.548 1.00 31.51  ? 121  TYR B CD2 1 
ATOM   5018  C  CE1 . TYR B  2  121 ? 50.756  319.772 162.698 1.00 29.80  ? 121  TYR B CE1 1 
ATOM   5019  C  CE2 . TYR B  2  121 ? 51.907  319.111 160.637 1.00 34.39  ? 121  TYR B CE2 1 
ATOM   5020  C  CZ  . TYR B  2  121 ? 51.693  320.012 161.756 1.00 29.27  ? 121  TYR B CZ  1 
ATOM   5021  O  OH  . TYR B  2  121 ? 52.419  321.181 161.754 1.00 33.34  ? 121  TYR B OH  1 
ATOM   5022  N  N   . MET B  2  122 ? 48.401  314.182 163.496 1.00 29.33  ? 122  MET B N   1 
ATOM   5023  C  CA  . MET B  2  122 ? 47.199  313.474 163.886 1.00 27.36  ? 122  MET B CA  1 
ATOM   5024  C  C   . MET B  2  122 ? 45.927  313.893 163.090 1.00 29.39  ? 122  MET B C   1 
ATOM   5025  O  O   . MET B  2  122 ? 45.710  315.069 162.818 1.00 28.95  ? 122  MET B O   1 
ATOM   5026  C  CB  . MET B  2  122 ? 46.955  313.719 165.401 1.00 28.14  ? 122  MET B CB  1 
ATOM   5027  C  CG  . MET B  2  122 ? 45.842  312.829 166.017 1.00 27.21  ? 122  MET B CG  1 
ATOM   5028  S  SD  . MET B  2  122 ? 45.567  313.268 167.735 1.00 29.40  ? 122  MET B SD  1 
ATOM   5029  C  CE  . MET B  2  122 ? 44.309  314.451 167.606 1.00 30.28  ? 122  MET B CE  1 
ATOM   5030  N  N   . ILE B  2  123 ? 45.069  312.931 162.770 1.00 30.78  ? 123  ILE B N   1 
ATOM   5031  C  CA  . ILE B  2  123 ? 43.715  313.300 162.184 1.00 31.97  ? 123  ILE B CA  1 
ATOM   5032  C  C   . ILE B  2  123 ? 42.874  313.792 163.349 1.00 31.55  ? 123  ILE B C   1 
ATOM   5033  O  O   . ILE B  2  123 ? 42.641  313.027 164.311 1.00 33.58  ? 123  ILE B O   1 
ATOM   5034  C  CB  . ILE B  2  123 ? 42.986  312.057 161.467 1.00 32.04  ? 123  ILE B CB  1 
ATOM   5035  C  CG1 . ILE B  2  123 ? 43.855  311.527 160.300 1.00 33.99  ? 123  ILE B CG1 1 
ATOM   5036  C  CG2 . ILE B  2  123 ? 41.505  312.406 161.094 1.00 31.69  ? 123  ILE B CG2 1 
ATOM   5037  C  CD1 . ILE B  2  123 ? 44.065  312.569 159.184 1.00 38.22  ? 123  ILE B CD1 1 
ATOM   5038  N  N   . PRO B  2  124 ? 42.366  315.030 163.273 1.00 33.27  ? 124  PRO B N   1 
ATOM   5039  C  CA  . PRO B  2  124 ? 41.436  315.500 164.283 1.00 33.39  ? 124  PRO B CA  1 
ATOM   5040  C  C   . PRO B  2  124 ? 40.198  314.595 164.361 1.00 34.09  ? 124  PRO B C   1 
ATOM   5041  O  O   . PRO B  2  124 ? 39.758  314.020 163.360 1.00 33.46  ? 124  PRO B O   1 
ATOM   5042  C  CB  . PRO B  2  124 ? 41.149  316.974 163.854 1.00 34.02  ? 124  PRO B CB  1 
ATOM   5043  C  CG  . PRO B  2  124 ? 42.361  317.358 162.929 1.00 35.22  ? 124  PRO B CG  1 
ATOM   5044  C  CD  . PRO B  2  124 ? 42.603  316.063 162.223 1.00 33.56  ? 124  PRO B CD  1 
ATOM   5045  N  N   . THR B  2  125 ? 39.748  314.362 165.578 1.00 33.07  ? 125  THR B N   1 
ATOM   5046  C  CA  . THR B  2  125 ? 38.565  313.538 165.804 1.00 34.93  ? 125  THR B CA  1 
ATOM   5047  C  C   . THR B  2  125 ? 37.384  313.884 164.901 1.00 35.76  ? 125  THR B C   1 
ATOM   5048  O  O   . THR B  2  125 ? 36.622  312.971 164.518 1.00 37.76  ? 125  THR B O   1 
ATOM   5049  C  CB  . THR B  2  125 ? 38.089  313.549 167.358 1.00 34.61  ? 125  THR B CB  1 
ATOM   5050  O  OG1 . THR B  2  125 ? 39.270  313.154 168.091 1.00 34.32  ? 125  THR B OG1 1 
ATOM   5051  C  CG2 . THR B  2  125 ? 36.866  312.505 167.658 1.00 28.21  ? 125  THR B CG2 1 
ATOM   5052  N  N   . SER B  2  126 ? 37.129  315.170 164.703 1.00 37.91  ? 126  SER B N   1 
ATOM   5053  C  CA  . SER B  2  126 ? 35.932  315.572 163.915 1.00 39.80  ? 126  SER B CA  1 
ATOM   5054  C  C   . SER B  2  126 ? 36.185  315.278 162.439 1.00 41.19  ? 126  SER B C   1 
ATOM   5055  O  O   . SER B  2  126 ? 35.234  315.312 161.641 1.00 40.40  ? 126  SER B O   1 
ATOM   5056  C  CB  . SER B  2  126 ? 35.610  317.097 164.074 1.00 41.18  ? 126  SER B CB  1 
ATOM   5057  O  OG  . SER B  2  126 ? 36.753  317.878 163.644 1.00 38.10  ? 126  SER B OG  1 
ATOM   5058  N  N   . GLU B  2  127 ? 37.434  314.954 162.052 1.00 39.81  ? 127  GLU B N   1 
ATOM   5059  C  CA  . GLU B  2  127 ? 37.720  314.665 160.634 1.00 39.08  ? 127  GLU B CA  1 
ATOM   5060  C  C   . GLU B  2  127 ? 37.995  313.231 160.399 1.00 37.55  ? 127  GLU B C   1 
ATOM   5061  O  O   . GLU B  2  127 ? 38.301  312.888 159.279 1.00 35.47  ? 127  GLU B O   1 
ATOM   5062  C  CB  . GLU B  2  127 ? 38.914  315.471 160.133 1.00 38.94  ? 127  GLU B CB  1 
ATOM   5063  C  CG  . GLU B  2  127 ? 38.557  316.924 160.235 1.00 44.03  ? 127  GLU B CG  1 
ATOM   5064  C  CD  . GLU B  2  127 ? 39.704  317.791 159.871 1.00 48.63  ? 127  GLU B CD  1 
ATOM   5065  O  OE1 . GLU B  2  127 ? 39.689  318.958 160.270 1.00 55.07  ? 127  GLU B OE1 1 
ATOM   5066  O  OE2 . GLU B  2  127 ? 40.653  317.302 159.238 1.00 49.07  ? 127  GLU B OE2 1 
ATOM   5067  N  N   . LEU B  2  128 ? 37.912  312.379 161.428 1.00 35.09  ? 128  LEU B N   1 
ATOM   5068  C  CA  . LEU B  2  128 ? 38.074  310.924 161.196 1.00 36.40  ? 128  LEU B CA  1 
ATOM   5069  C  C   . LEU B  2  128 ? 37.108  310.347 160.138 1.00 36.04  ? 128  LEU B C   1 
ATOM   5070  O  O   . LEU B  2  128 ? 35.929  310.691 160.137 1.00 34.34  ? 128  LEU B O   1 
ATOM   5071  C  CB  . LEU B  2  128 ? 37.806  310.106 162.473 1.00 33.64  ? 128  LEU B CB  1 
ATOM   5072  C  CG  . LEU B  2  128 ? 38.913  310.332 163.577 1.00 32.13  ? 128  LEU B CG  1 
ATOM   5073  C  CD1 . LEU B  2  128 ? 38.316  309.556 164.837 1.00 34.47  ? 128  LEU B CD1 1 
ATOM   5074  C  CD2 . LEU B  2  128 ? 40.327  309.792 163.092 1.00 29.11  ? 128  LEU B CD2 1 
ATOM   5075  N  N   . LYS B  2  129 ? 37.605  309.441 159.309 1.00 36.22  ? 129  LYS B N   1 
ATOM   5076  C  CA  . LYS B  2  129 ? 36.721  308.736 158.409 1.00 39.02  ? 129  LYS B CA  1 
ATOM   5077  C  C   . LYS B  2  129 ? 36.214  307.539 159.172 1.00 41.48  ? 129  LYS B C   1 
ATOM   5078  O  O   . LYS B  2  129 ? 36.952  307.021 160.021 1.00 40.68  ? 129  LYS B O   1 
ATOM   5079  C  CB  . LYS B  2  129 ? 37.484  308.322 157.194 1.00 38.43  ? 129  LYS B CB  1 
ATOM   5080  C  CG  . LYS B  2  129 ? 38.027  309.596 156.500 1.00 41.56  ? 129  LYS B CG  1 
ATOM   5081  C  CD  . LYS B  2  129 ? 37.903  309.545 154.994 1.00 55.60  ? 129  LYS B CD  1 
ATOM   5082  C  CE  . LYS B  2  129 ? 38.938  310.457 154.334 1.00 58.52  ? 129  LYS B CE  1 
ATOM   5083  N  NZ  . LYS B  2  129 ? 40.284  309.712 154.369 1.00 68.46  ? 129  LYS B NZ  1 
ATOM   5084  N  N   . PRO B  2  130 ? 34.966  307.097 158.849 1.00 42.35  ? 130  PRO B N   1 
ATOM   5085  C  CA  . PRO B  2  130 ? 34.240  306.067 159.569 1.00 41.54  ? 130  PRO B CA  1 
ATOM   5086  C  C   . PRO B  2  130 ? 35.113  304.866 159.706 1.00 39.86  ? 130  PRO B C   1 
ATOM   5087  O  O   . PRO B  2  130 ? 35.758  304.461 158.747 1.00 39.51  ? 130  PRO B O   1 
ATOM   5088  C  CB  . PRO B  2  130 ? 32.996  305.789 158.689 1.00 42.19  ? 130  PRO B CB  1 
ATOM   5089  C  CG  . PRO B  2  130 ? 32.726  307.170 158.008 1.00 46.04  ? 130  PRO B CG  1 
ATOM   5090  C  CD  . PRO B  2  130 ? 34.164  307.674 157.725 1.00 44.18  ? 130  PRO B CD  1 
ATOM   5091  N  N   . GLY B  2  131 ? 35.248  304.401 160.959 1.00 39.20  ? 131  GLY B N   1 
ATOM   5092  C  CA  . GLY B  2  131 ? 36.028  303.216 161.256 1.00 36.64  ? 131  GLY B CA  1 
ATOM   5093  C  C   . GLY B  2  131 ? 37.512  303.569 161.579 1.00 37.38  ? 131  GLY B C   1 
ATOM   5094  O  O   . GLY B  2  131 ? 38.329  302.696 161.921 1.00 37.72  ? 131  GLY B O   1 
ATOM   5095  N  N   . GLU B  2  132 ? 37.896  304.805 161.445 1.00 33.60  ? 132  GLU B N   1 
ATOM   5096  C  CA  . GLU B  2  132 ? 39.246  305.158 161.873 1.00 32.78  ? 132  GLU B CA  1 
ATOM   5097  C  C   . GLU B  2  132 ? 39.290  305.407 163.425 1.00 32.87  ? 132  GLU B C   1 
ATOM   5098  O  O   . GLU B  2  132 ? 38.270  305.658 164.055 1.00 32.89  ? 132  GLU B O   1 
ATOM   5099  C  CB  . GLU B  2  132 ? 39.702  306.406 161.156 1.00 32.60  ? 132  GLU B CB  1 
ATOM   5100  C  CG  . GLU B  2  132 ? 40.070  306.131 159.731 1.00 36.58  ? 132  GLU B CG  1 
ATOM   5101  C  CD  . GLU B  2  132 ? 40.703  307.359 159.016 1.00 43.87  ? 132  GLU B CD  1 
ATOM   5102  O  OE1 . GLU B  2  132 ? 41.515  306.998 158.230 1.00 45.85  ? 132  GLU B OE1 1 
ATOM   5103  O  OE2 . GLU B  2  132 ? 40.420  308.602 159.203 1.00 37.31  ? 132  GLU B OE2 1 
ATOM   5104  N  N   . LEU B  2  133 ? 40.515  305.381 163.941 1.00 34.16  ? 133  LEU B N   1 
ATOM   5105  C  CA  . LEU B  2  133 ? 40.892  305.391 165.383 1.00 33.08  ? 133  LEU B CA  1 
ATOM   5106  C  C   . LEU B  2  133 ? 41.239  306.777 165.910 1.00 30.46  ? 133  LEU B C   1 
ATOM   5107  O  O   . LEU B  2  133 ? 42.226  307.415 165.526 1.00 30.59  ? 133  LEU B O   1 
ATOM   5108  C  CB  . LEU B  2  133 ? 42.090  304.440 165.605 1.00 30.71  ? 133  LEU B CB  1 
ATOM   5109  C  CG  . LEU B  2  133 ? 41.706  303.005 165.157 1.00 37.78  ? 133  LEU B CG  1 
ATOM   5110  C  CD1 . LEU B  2  133 ? 42.977  302.301 164.819 1.00 37.04  ? 133  LEU B CD1 1 
ATOM   5111  C  CD2 . LEU B  2  133 ? 40.890  302.241 166.292 1.00 40.01  ? 133  LEU B CD2 1 
ATOM   5112  N  N   . ARG B  2  134 ? 40.372  307.222 166.790 1.00 31.22  ? 134  ARG B N   1 
ATOM   5113  C  CA  . ARG B  2  134 ? 40.552  308.464 167.547 1.00 26.91  ? 134  ARG B CA  1 
ATOM   5114  C  C   . ARG B  2  134 ? 41.987  308.510 168.163 1.00 28.51  ? 134  ARG B C   1 
ATOM   5115  O  O   . ARG B  2  134 ? 42.468  307.493 168.764 1.00 25.14  ? 134  ARG B O   1 
ATOM   5116  C  CB  . ARG B  2  134 ? 39.516  308.507 168.640 1.00 26.69  ? 134  ARG B CB  1 
ATOM   5117  C  CG  . ARG B  2  134 ? 39.180  309.942 169.086 1.00 24.82  ? 134  ARG B CG  1 
ATOM   5118  C  CD  . ARG B  2  134 ? 38.152  310.014 170.192 1.00 29.61  ? 134  ARG B CD  1 
ATOM   5119  N  NE  . ARG B  2  134 ? 38.583  309.288 171.365 1.00 30.88  ? 134  ARG B NE  1 
ATOM   5120  C  CZ  . ARG B  2  134 ? 39.158  309.870 172.414 1.00 32.88  ? 134  ARG B CZ  1 
ATOM   5121  N  NH1 . ARG B  2  134 ? 39.307  311.182 172.439 1.00 24.89  ? 134  ARG B NH1 1 
ATOM   5122  N  NH2 . ARG B  2  134 ? 39.567  309.123 173.429 1.00 29.75  ? 134  ARG B NH2 1 
ATOM   5123  N  N   . LEU B  2  135 ? 42.680  309.624 167.897 1.00 25.13  ? 135  LEU B N   1 
ATOM   5124  C  CA  . LEU B  2  135 ? 44.019  309.933 168.417 1.00 26.71  ? 135  LEU B CA  1 
ATOM   5125  C  C   . LEU B  2  135 ? 45.182  309.230 167.832 1.00 25.85  ? 135  LEU B C   1 
ATOM   5126  O  O   . LEU B  2  135 ? 46.360  309.521 168.211 1.00 27.96  ? 135  LEU B O   1 
ATOM   5127  C  CB  . LEU B  2  135 ? 44.100  309.924 170.002 1.00 25.64  ? 135  LEU B CB  1 
ATOM   5128  C  CG  . LEU B  2  135 ? 42.937  310.559 170.786 1.00 25.67  ? 135  LEU B CG  1 
ATOM   5129  C  CD1 . LEU B  2  135 ? 43.258  310.559 172.298 1.00 25.13  ? 135  LEU B CD1 1 
ATOM   5130  C  CD2 . LEU B  2  135 ? 42.617  311.978 170.206 1.00 25.61  ? 135  LEU B CD2 1 
ATOM   5131  N  N   . LEU B  2  136 ? 44.890  308.257 166.980 1.00 26.86  ? 136  LEU B N   1 
ATOM   5132  C  CA  . LEU B  2  136 ? 45.930  307.264 166.454 1.00 28.30  ? 136  LEU B CA  1 
ATOM   5133  C  C   . LEU B  2  136 ? 46.318  307.479 164.949 1.00 29.14  ? 136  LEU B C   1 
ATOM   5134  O  O   . LEU B  2  136 ? 47.492  307.279 164.520 1.00 28.54  ? 136  LEU B O   1 
ATOM   5135  C  CB  . LEU B  2  136 ? 45.498  305.836 166.716 1.00 25.99  ? 136  LEU B CB  1 
ATOM   5136  C  CG  . LEU B  2  136 ? 45.690  305.377 168.210 1.00 26.92  ? 136  LEU B CG  1 
ATOM   5137  C  CD1 . LEU B  2  136 ? 45.201  303.941 168.160 1.00 27.72  ? 136  LEU B CD1 1 
ATOM   5138  C  CD2 . LEU B  2  136 ? 47.251  305.519 168.628 1.00 22.74  ? 136  LEU B CD2 1 
ATOM   5139  N  N   . GLU B  2  137 ? 45.310  307.890 164.178 1.00 29.82  ? 137  GLU B N   1 
ATOM   5140  C  CA  . GLU B  2  137 ? 45.532  308.094 162.696 1.00 29.34  ? 137  GLU B CA  1 
ATOM   5141  C  C   . GLU B  2  137 ? 46.280  309.366 162.441 1.00 28.43  ? 137  GLU B C   1 
ATOM   5142  O  O   . GLU B  2  137 ? 46.153  310.367 163.205 1.00 28.38  ? 137  GLU B O   1 
ATOM   5143  C  CB  . GLU B  2  137 ? 44.188  308.205 161.872 1.00 29.91  ? 137  GLU B CB  1 
ATOM   5144  C  CG  . GLU B  2  137 ? 43.200  307.111 162.157 1.00 28.50  ? 137  GLU B CG  1 
ATOM   5145  C  CD  . GLU B  2  137 ? 43.636  305.716 161.781 1.00 33.05  ? 137  GLU B CD  1 
ATOM   5146  O  OE1 . GLU B  2  137 ? 42.880  304.798 162.167 1.00 34.15  ? 137  GLU B OE1 1 
ATOM   5147  O  OE2 . GLU B  2  137 ? 44.678  305.486 161.096 1.00 31.21  ? 137  GLU B OE2 1 
ATOM   5148  N  N   . VAL B  2  138 ? 47.026  309.338 161.333 1.00 29.15  ? 138  VAL B N   1 
ATOM   5149  C  CA  . VAL B  2  138 ? 47.764  310.489 160.794 1.00 29.80  ? 138  VAL B CA  1 
ATOM   5150  C  C   . VAL B  2  138 ? 47.339  310.778 159.332 1.00 30.64  ? 138  VAL B C   1 
ATOM   5151  O  O   . VAL B  2  138 ? 46.828  309.864 158.640 1.00 29.25  ? 138  VAL B O   1 
ATOM   5152  C  CB  . VAL B  2  138 ? 49.303  310.280 160.897 1.00 28.80  ? 138  VAL B CB  1 
ATOM   5153  C  CG1 . VAL B  2  138 ? 49.787  310.160 162.424 1.00 26.13  ? 138  VAL B CG1 1 
ATOM   5154  C  CG2 . VAL B  2  138 ? 49.767  309.177 160.081 1.00 29.48  ? 138  VAL B CG2 1 
ATOM   5155  N  N   . ASP B  2  139 ? 47.511  312.020 158.880 1.00 31.16  ? 139  ASP B N   1 
ATOM   5156  C  CA  . ASP B  2  139 ? 47.336  312.292 157.440 1.00 30.66  ? 139  ASP B CA  1 
ATOM   5157  C  C   . ASP B  2  139 ? 48.347  311.501 156.562 1.00 30.75  ? 139  ASP B C   1 
ATOM   5158  O  O   . ASP B  2  139 ? 47.925  310.867 155.565 1.00 30.53  ? 139  ASP B O   1 
ATOM   5159  C  CB  . ASP B  2  139 ? 47.325  313.819 157.166 1.00 29.74  ? 139  ASP B CB  1 
ATOM   5160  C  CG  . ASP B  2  139 ? 48.618  314.545 157.659 1.00 29.95  ? 139  ASP B CG  1 
ATOM   5161  O  OD1 . ASP B  2  139 ? 48.719  315.807 157.478 1.00 27.69  ? 139  ASP B OD1 1 
ATOM   5162  O  OD2 . ASP B  2  139 ? 49.564  313.924 158.175 1.00 34.59  ? 139  ASP B OD2 1 
ATOM   5163  N  N   . ASN B  2  140 ? 49.650  311.593 156.842 1.00 29.30  ? 140  ASN B N   1 
ATOM   5164  C  CA  . ASN B  2  140 ? 50.678  310.933 156.057 1.00 30.26  ? 140  ASN B CA  1 
ATOM   5165  C  C   . ASN B  2  140 ? 51.391  309.869 156.838 1.00 30.78  ? 140  ASN B C   1 
ATOM   5166  O  O   . ASN B  2  140 ? 52.172  310.251 157.719 1.00 30.68  ? 140  ASN B O   1 
ATOM   5167  C  CB  . ASN B  2  140 ? 51.715  311.988 155.655 1.00 30.64  ? 140  ASN B CB  1 
ATOM   5168  C  CG  . ASN B  2  140 ? 51.054  313.096 154.810 1.00 40.31  ? 140  ASN B CG  1 
ATOM   5169  O  OD1 . ASN B  2  140 ? 50.123  312.740 154.109 1.00 37.44  ? 140  ASN B OD1 1 
ATOM   5170  N  ND2 . ASN B  2  140 ? 51.394  314.373 154.973 1.00 36.14  ? 140  ASN B ND2 1 
ATOM   5171  N  N   . ARG B  2  141 ? 51.249  308.587 156.452 1.00 29.43  ? 141  ARG B N   1 
ATOM   5172  C  CA  . ARG B  2  141 ? 51.820  307.463 157.204 1.00 30.52  ? 141  ARG B CA  1 
ATOM   5173  C  C   . ARG B  2  141 ? 53.271  307.282 156.804 1.00 31.40  ? 141  ARG B C   1 
ATOM   5174  O  O   . ARG B  2  141 ? 53.679  307.756 155.744 1.00 30.81  ? 141  ARG B O   1 
ATOM   5175  C  CB  . ARG B  2  141 ? 51.048  306.197 157.017 1.00 30.94  ? 141  ARG B CB  1 
ATOM   5176  C  CG  . ARG B  2  141 ? 49.575  306.270 157.502 1.00 26.14  ? 141  ARG B CG  1 
ATOM   5177  C  CD  . ARG B  2  141 ? 48.770  305.020 157.032 1.00 26.82  ? 141  ARG B CD  1 
ATOM   5178  N  NE  . ARG B  2  141 ? 47.345  305.200 157.320 1.00 29.30  ? 141  ARG B NE  1 
ATOM   5179  C  CZ  . ARG B  2  141 ? 46.390  304.489 156.778 1.00 28.25  ? 141  ARG B CZ  1 
ATOM   5180  N  NH1 . ARG B  2  141 ? 46.711  303.596 155.862 1.00 32.76  ? 141  ARG B NH1 1 
ATOM   5181  N  NH2 . ARG B  2  141 ? 45.134  304.682 157.118 1.00 33.66  ? 141  ARG B NH2 1 
ATOM   5182  N  N   . VAL B  2  142 ? 54.048  306.571 157.638 1.00 30.11  ? 142  VAL B N   1 
ATOM   5183  C  CA  . VAL B  2  142 ? 55.456  306.269 157.406 1.00 30.15  ? 142  VAL B CA  1 
ATOM   5184  C  C   . VAL B  2  142 ? 55.404  304.929 156.617 1.00 30.12  ? 142  VAL B C   1 
ATOM   5185  O  O   . VAL B  2  142 ? 55.363  303.801 157.191 1.00 29.10  ? 142  VAL B O   1 
ATOM   5186  C  CB  . VAL B  2  142 ? 56.202  306.028 158.782 1.00 32.10  ? 142  VAL B CB  1 
ATOM   5187  C  CG1 . VAL B  2  142 ? 57.721  305.861 158.520 1.00 29.43  ? 142  VAL B CG1 1 
ATOM   5188  C  CG2 . VAL B  2  142 ? 55.874  307.176 159.693 1.00 28.53  ? 142  VAL B CG2 1 
ATOM   5189  N  N   . VAL B  2  143 ? 55.298  305.031 155.271 1.00 30.04  ? 143  VAL B N   1 
ATOM   5190  C  CA  . VAL B  2  143 ? 55.329  303.790 154.448 1.00 27.29  ? 143  VAL B CA  1 
ATOM   5191  C  C   . VAL B  2  143 ? 56.762  303.185 154.500 1.00 27.04  ? 143  VAL B C   1 
ATOM   5192  O  O   . VAL B  2  143 ? 57.734  303.904 154.321 1.00 24.66  ? 143  VAL B O   1 
ATOM   5193  C  CB  . VAL B  2  143 ? 54.855  304.164 153.025 1.00 28.39  ? 143  VAL B CB  1 
ATOM   5194  C  CG1 . VAL B  2  143 ? 54.775  302.869 152.108 1.00 28.10  ? 143  VAL B CG1 1 
ATOM   5195  C  CG2 . VAL B  2  143 ? 53.400  304.746 153.178 1.00 25.28  ? 143  VAL B CG2 1 
ATOM   5196  N  N   . LEU B  2  144 ? 56.880  301.862 154.643 1.00 27.47  ? 144  LEU B N   1 
ATOM   5197  C  CA  . LEU B  2  144 ? 58.149  301.258 154.756 1.00 27.80  ? 144  LEU B CA  1 
ATOM   5198  C  C   . LEU B  2  144 ? 58.015  299.882 154.116 1.00 30.10  ? 144  LEU B C   1 
ATOM   5199  O  O   . LEU B  2  144 ? 56.910  299.305 154.112 1.00 30.66  ? 144  LEU B O   1 
ATOM   5200  C  CB  . LEU B  2  144 ? 58.492  301.058 156.254 1.00 27.99  ? 144  LEU B CB  1 
ATOM   5201  C  CG  . LEU B  2  144 ? 58.798  302.331 157.090 1.00 28.18  ? 144  LEU B CG  1 
ATOM   5202  C  CD1 . LEU B  2  144 ? 58.847  302.008 158.631 1.00 30.01  ? 144  LEU B CD1 1 
ATOM   5203  C  CD2 . LEU B  2  144 ? 60.123  303.056 156.630 1.00 23.84  ? 144  LEU B CD2 1 
ATOM   5204  N  N   . PRO B  2  145 ? 59.133  299.318 153.603 1.00 30.81  ? 145  PRO B N   1 
ATOM   5205  C  CA  . PRO B  2  145 ? 59.068  297.958 153.009 1.00 32.44  ? 145  PRO B CA  1 
ATOM   5206  C  C   . PRO B  2  145 ? 59.083  296.878 154.116 1.00 34.73  ? 145  PRO B C   1 
ATOM   5207  O  O   . PRO B  2  145 ? 59.920  296.974 155.056 1.00 34.89  ? 145  PRO B O   1 
ATOM   5208  C  CB  . PRO B  2  145 ? 60.342  297.902 152.105 1.00 31.14  ? 145  PRO B CB  1 
ATOM   5209  C  CG  . PRO B  2  145 ? 61.347  298.864 152.778 1.00 33.51  ? 145  PRO B CG  1 
ATOM   5210  C  CD  . PRO B  2  145 ? 60.455  299.956 153.468 1.00 28.94  ? 145  PRO B CD  1 
ATOM   5211  N  N   . MET B  2  146 ? 58.129  295.936 154.070 1.00 34.88  ? 146  MET B N   1 
ATOM   5212  C  CA  . MET B  2  146 ? 58.082  294.852 155.007 1.00 34.78  ? 146  MET B CA  1 
ATOM   5213  C  C   . MET B  2  146 ? 59.297  293.909 154.811 1.00 35.25  ? 146  MET B C   1 
ATOM   5214  O  O   . MET B  2  146 ? 59.904  293.877 153.713 1.00 35.43  ? 146  MET B O   1 
ATOM   5215  C  CB  . MET B  2  146 ? 56.778  294.106 154.795 1.00 34.05  ? 146  MET B CB  1 
ATOM   5216  C  CG  . MET B  2  146 ? 56.828  293.281 153.480 1.00 33.71  ? 146  MET B CG  1 
ATOM   5217  S  SD  . MET B  2  146 ? 55.093  292.568 153.270 1.00 40.69  ? 146  MET B SD  1 
ATOM   5218  C  CE  . MET B  2  146 ? 55.368  291.527 151.846 1.00 44.25  ? 146  MET B CE  1 
ATOM   5219  N  N   . GLU B  2  147 ? 59.618  293.088 155.837 1.00 35.43  ? 147  GLU B N   1 
ATOM   5220  C  CA  . GLU B  2  147 ? 60.686  292.051 155.708 1.00 35.70  ? 147  GLU B CA  1 
ATOM   5221  C  C   . GLU B  2  147 ? 62.058  292.558 155.348 1.00 38.40  ? 147  GLU B C   1 
ATOM   5222  O  O   . GLU B  2  147 ? 62.874  291.819 154.713 1.00 39.89  ? 147  GLU B O   1 
ATOM   5223  C  CB  . GLU B  2  147 ? 60.268  291.008 154.684 1.00 34.79  ? 147  GLU B CB  1 
ATOM   5224  C  CG  . GLU B  2  147 ? 58.907  290.392 155.206 1.00 34.35  ? 147  GLU B CG  1 
ATOM   5225  C  CD  . GLU B  2  147 ? 58.351  289.345 154.182 1.00 42.96  ? 147  GLU B CD  1 
ATOM   5226  O  OE1 . GLU B  2  147 ? 57.916  288.216 154.519 1.00 40.17  ? 147  GLU B OE1 1 
ATOM   5227  O  OE2 . GLU B  2  147 ? 58.303  289.701 153.010 1.00 47.10  ? 147  GLU B OE2 1 
ATOM   5228  N  N   . MET B  2  148 ? 62.345  293.795 155.744 1.00 38.13  ? 148  MET B N   1 
ATOM   5229  C  CA  . MET B  2  148 ? 63.673  294.394 155.529 1.00 39.60  ? 148  MET B CA  1 
ATOM   5230  C  C   . MET B  2  148 ? 64.115  295.149 156.776 1.00 37.82  ? 148  MET B C   1 
ATOM   5231  O  O   . MET B  2  148 ? 63.287  295.752 157.531 1.00 37.81  ? 148  MET B O   1 
ATOM   5232  C  CB  . MET B  2  148 ? 63.634  295.384 154.364 1.00 38.57  ? 148  MET B CB  1 
ATOM   5233  C  CG  . MET B  2  148 ? 63.108  294.646 153.027 1.00 51.01  ? 148  MET B CG  1 
ATOM   5234  S  SD  . MET B  2  148 ? 63.575  295.667 151.602 1.00 60.09  ? 148  MET B SD  1 
ATOM   5235  C  CE  . MET B  2  148 ? 65.241  294.997 151.381 1.00 58.82  ? 148  MET B CE  1 
ATOM   5236  N  N   . THR B  2  149 ? 65.413  295.108 156.965 1.00 38.40  ? 149  THR B N   1 
ATOM   5237  C  CA  . THR B  2  149 ? 66.107  295.821 158.059 1.00 37.57  ? 149  THR B CA  1 
ATOM   5238  C  C   . THR B  2  149 ? 66.215  297.302 157.702 1.00 36.83  ? 149  THR B C   1 
ATOM   5239  O  O   . THR B  2  149 ? 66.881  297.667 156.713 1.00 35.56  ? 149  THR B O   1 
ATOM   5240  C  CB  . THR B  2  149 ? 67.533  295.193 158.353 1.00 38.10  ? 149  THR B CB  1 
ATOM   5241  O  OG1 . THR B  2  149 ? 67.310  293.860 158.761 1.00 38.62  ? 149  THR B OG1 1 
ATOM   5242  C  CG2 . THR B  2  149 ? 68.279  295.961 159.607 1.00 32.80  ? 149  THR B CG2 1 
ATOM   5243  N  N   . ILE B  2  150 ? 65.554  298.133 158.534 1.00 34.91  ? 150  ILE B N   1 
ATOM   5244  C  CA  . ILE B  2  150 ? 65.535  299.581 158.320 1.00 32.47  ? 150  ILE B CA  1 
ATOM   5245  C  C   . ILE B  2  150 ? 66.287  300.231 159.471 1.00 34.41  ? 150  ILE B C   1 
ATOM   5246  O  O   . ILE B  2  150 ? 66.077  299.845 160.653 1.00 33.41  ? 150  ILE B O   1 
ATOM   5247  C  CB  . ILE B  2  150 ? 64.086  300.076 158.239 1.00 34.60  ? 150  ILE B CB  1 
ATOM   5248  C  CG1 . ILE B  2  150 ? 63.441  299.354 156.996 1.00 30.95  ? 150  ILE B CG1 1 
ATOM   5249  C  CG2 . ILE B  2  150 ? 64.038  301.658 158.086 1.00 31.51  ? 150  ILE B CG2 1 
ATOM   5250  C  CD1 . ILE B  2  150 ? 61.936  299.289 157.041 1.00 36.32  ? 150  ILE B CD1 1 
ATOM   5251  N  N   . ARG B  2  151 ? 67.111  301.216 159.169 1.00 31.82  ? 151  ARG B N   1 
ATOM   5252  C  CA  . ARG B  2  151 ? 67.710  302.032 160.221 1.00 32.65  ? 151  ARG B CA  1 
ATOM   5253  C  C   . ARG B  2  151 ? 66.822  303.239 160.443 1.00 31.43  ? 151  ARG B C   1 
ATOM   5254  O  O   . ARG B  2  151 ? 66.651  303.989 159.521 1.00 33.00  ? 151  ARG B O   1 
ATOM   5255  C  CB  . ARG B  2  151 ? 69.114  302.490 159.815 1.00 29.73  ? 151  ARG B CB  1 
ATOM   5256  C  CG  . ARG B  2  151 ? 69.688  303.492 160.755 1.00 28.18  ? 151  ARG B CG  1 
ATOM   5257  C  CD  . ARG B  2  151 ? 71.082  304.018 160.224 1.00 30.56  ? 151  ARG B CD  1 
ATOM   5258  N  NE  . ARG B  2  151 ? 72.106  302.964 160.053 1.00 32.19  ? 151  ARG B NE  1 
ATOM   5259  C  CZ  . ARG B  2  151 ? 72.790  302.726 158.901 1.00 34.73  ? 151  ARG B CZ  1 
ATOM   5260  N  NH1 . ARG B  2  151 ? 72.507  303.390 157.769 1.00 30.99  ? 151  ARG B NH1 1 
ATOM   5261  N  NH2 . ARG B  2  151 ? 73.752  301.782 158.875 1.00 35.30  ? 151  ARG B NH2 1 
ATOM   5262  N  N   . MET B  2  152 ? 66.265  303.450 161.629 1.00 29.92  ? 152  MET B N   1 
ATOM   5263  C  CA  . MET B  2  152 ? 65.576  304.702 161.923 1.00 33.22  ? 152  MET B CA  1 
ATOM   5264  C  C   . MET B  2  152 ? 66.533  305.635 162.628 1.00 34.11  ? 152  MET B C   1 
ATOM   5265  O  O   . MET B  2  152 ? 67.221  305.170 163.570 1.00 36.95  ? 152  MET B O   1 
ATOM   5266  C  CB  . MET B  2  152 ? 64.413  304.440 162.871 1.00 32.78  ? 152  MET B CB  1 
ATOM   5267  C  CG  . MET B  2  152 ? 63.317  303.663 162.270 1.00 37.22  ? 152  MET B CG  1 
ATOM   5268  S  SD  . MET B  2  152 ? 62.501  304.610 160.876 1.00 43.54  ? 152  MET B SD  1 
ATOM   5269  C  CE  . MET B  2  152 ? 62.437  306.394 161.369 1.00 29.49  ? 152  MET B CE  1 
ATOM   5270  N  N   . LEU B  2  153 ? 66.620  306.901 162.249 1.00 30.11  ? 153  LEU B N   1 
ATOM   5271  C  CA  . LEU B  2  153 ? 67.429  307.817 163.059 1.00 30.29  ? 153  LEU B CA  1 
ATOM   5272  C  C   . LEU B  2  153 ? 66.497  308.868 163.569 1.00 30.68  ? 153  LEU B C   1 
ATOM   5273  O  O   . LEU B  2  153 ? 65.661  309.315 162.834 1.00 30.25  ? 153  LEU B O   1 
ATOM   5274  C  CB  . LEU B  2  153 ? 68.521  308.544 162.196 1.00 29.84  ? 153  LEU B CB  1 
ATOM   5275  C  CG  . LEU B  2  153 ? 69.668  307.660 161.699 1.00 31.17  ? 153  LEU B CG  1 
ATOM   5276  C  CD1 . LEU B  2  153 ? 70.484  308.426 160.656 1.00 27.52  ? 153  LEU B CD1 1 
ATOM   5277  C  CD2 . LEU B  2  153 ? 70.533  307.199 162.827 1.00 29.70  ? 153  LEU B CD2 1 
ATOM   5278  N  N   . VAL B  2  154 ? 66.618  309.286 164.825 1.00 30.44  ? 154  VAL B N   1 
ATOM   5279  C  CA  . VAL B  2  154 ? 65.541  310.034 165.471 1.00 27.32  ? 154  VAL B CA  1 
ATOM   5280  C  C   . VAL B  2  154 ? 66.201  311.231 166.088 1.00 29.16  ? 154  VAL B C   1 
ATOM   5281  O  O   . VAL B  2  154 ? 67.262  311.052 166.803 1.00 28.90  ? 154  VAL B O   1 
ATOM   5282  C  CB  . VAL B  2  154 ? 64.951  309.184 166.661 1.00 27.49  ? 154  VAL B CB  1 
ATOM   5283  C  CG1 . VAL B  2  154 ? 63.809  309.924 167.414 1.00 26.28  ? 154  VAL B CG1 1 
ATOM   5284  C  CG2 . VAL B  2  154 ? 64.436  307.753 166.135 1.00 22.76  ? 154  VAL B CG2 1 
ATOM   5285  N  N   . SER B  2  155 ? 65.569  312.410 165.918 1.00 28.12  ? 155  SER B N   1 
ATOM   5286  C  CA  . SER B  2  155 ? 66.050  313.654 166.483 1.00 28.01  ? 155  SER B CA  1 
ATOM   5287  C  C   . SER B  2  155 ? 64.866  314.570 166.657 1.00 27.15  ? 155  SER B C   1 
ATOM   5288  O  O   . SER B  2  155 ? 63.730  314.162 166.460 1.00 26.05  ? 155  SER B O   1 
ATOM   5289  C  CB  . SER B  2  155 ? 67.131  314.310 165.613 1.00 26.54  ? 155  SER B CB  1 
ATOM   5290  O  OG  . SER B  2  155 ? 67.787  315.260 166.434 1.00 25.31  ? 155  SER B OG  1 
ATOM   5291  N  N   . SER B  2  156 ? 65.158  315.795 167.073 1.00 26.40  ? 156  SER B N   1 
ATOM   5292  C  CA  . SER B  2  156 ? 64.054  316.799 167.236 1.00 28.97  ? 156  SER B CA  1 
ATOM   5293  C  C   . SER B  2  156 ? 64.482  318.136 166.780 1.00 27.14  ? 156  SER B C   1 
ATOM   5294  O  O   . SER B  2  156 ? 65.671  318.475 166.811 1.00 28.90  ? 156  SER B O   1 
ATOM   5295  C  CB  . SER B  2  156 ? 63.773  316.959 168.775 1.00 29.43  ? 156  SER B CB  1 
ATOM   5296  O  OG  . SER B  2  156 ? 62.816  317.970 169.045 1.00 27.12  ? 156  SER B OG  1 
ATOM   5297  N  N   . GLU B  2  157 ? 63.530  318.969 166.379 1.00 27.65  ? 157  GLU B N   1 
ATOM   5298  C  CA  . GLU B  2  157 ? 63.976  320.315 166.120 1.00 27.43  ? 157  GLU B CA  1 
ATOM   5299  C  C   . GLU B  2  157 ? 63.503  321.311 167.167 1.00 30.38  ? 157  GLU B C   1 
ATOM   5300  O  O   . GLU B  2  157 ? 63.597  322.474 166.931 1.00 27.77  ? 157  GLU B O   1 
ATOM   5301  C  CB  . GLU B  2  157 ? 63.521  320.755 164.690 1.00 28.25  ? 157  GLU B CB  1 
ATOM   5302  C  CG  . GLU B  2  157 ? 64.332  320.013 163.702 1.00 31.52  ? 157  GLU B CG  1 
ATOM   5303  C  CD  . GLU B  2  157 ? 64.002  320.357 162.242 1.00 38.98  ? 157  GLU B CD  1 
ATOM   5304  O  OE1 . GLU B  2  157 ? 64.283  319.551 161.400 1.00 39.44  ? 157  GLU B OE1 1 
ATOM   5305  O  OE2 . GLU B  2  157 ? 63.485  321.434 161.958 1.00 38.41  ? 157  GLU B OE2 1 
ATOM   5306  N  N   . ASP B  2  158 ? 62.957  320.861 168.318 1.00 29.76  ? 158  ASP B N   1 
ATOM   5307  C  CA  . ASP B  2  158 ? 62.533  321.816 169.350 1.00 29.29  ? 158  ASP B CA  1 
ATOM   5308  C  C   . ASP B  2  158 ? 62.771  321.146 170.750 1.00 27.39  ? 158  ASP B C   1 
ATOM   5309  O  O   . ASP B  2  158 ? 63.929  321.103 171.173 1.00 28.81  ? 158  ASP B O   1 
ATOM   5310  C  CB  . ASP B  2  158 ? 61.115  322.408 169.148 1.00 28.30  ? 158  ASP B CB  1 
ATOM   5311  C  CG  . ASP B  2  158 ? 60.041  321.390 168.834 1.00 32.80  ? 158  ASP B CG  1 
ATOM   5312  O  OD1 . ASP B  2  158 ? 59.940  320.279 169.417 1.00 28.70  ? 158  ASP B OD1 1 
ATOM   5313  O  OD2 . ASP B  2  158 ? 59.162  321.765 168.028 1.00 30.04  ? 158  ASP B OD2 1 
ATOM   5314  N  N   . VAL B  2  159 ? 61.741  320.626 171.390 1.00 26.41  ? 159  VAL B N   1 
ATOM   5315  C  CA  . VAL B  2  159 ? 61.894  320.058 172.753 1.00 25.99  ? 159  VAL B CA  1 
ATOM   5316  C  C   . VAL B  2  159 ? 62.135  318.533 172.635 1.00 27.17  ? 159  VAL B C   1 
ATOM   5317  O  O   . VAL B  2  159 ? 62.251  318.011 171.546 1.00 26.91  ? 159  VAL B O   1 
ATOM   5318  C  CB  . VAL B  2  159 ? 60.670  320.362 173.601 1.00 25.78  ? 159  VAL B CB  1 
ATOM   5319  C  CG1 . VAL B  2  159 ? 60.459  321.893 173.582 1.00 27.03  ? 159  VAL B CG1 1 
ATOM   5320  C  CG2 . VAL B  2  159 ? 59.315  319.638 173.012 1.00 23.55  ? 159  VAL B CG2 1 
ATOM   5321  N  N   . LEU B  2  160 ? 62.259  317.830 173.749 1.00 24.69  ? 160  LEU B N   1 
ATOM   5322  C  CA  . LEU B  2  160 ? 62.389  316.381 173.600 1.00 25.09  ? 160  LEU B CA  1 
ATOM   5323  C  C   . LEU B  2  160 ? 61.005  315.799 173.160 1.00 26.58  ? 160  LEU B C   1 
ATOM   5324  O  O   . LEU B  2  160 ? 59.943  316.287 173.615 1.00 26.07  ? 160  LEU B O   1 
ATOM   5325  C  CB  . LEU B  2  160 ? 62.746  315.766 174.957 1.00 24.11  ? 160  LEU B CB  1 
ATOM   5326  C  CG  . LEU B  2  160 ? 63.912  316.365 175.765 1.00 25.05  ? 160  LEU B CG  1 
ATOM   5327  C  CD1 . LEU B  2  160 ? 64.022  315.786 177.160 1.00 26.88  ? 160  LEU B CD1 1 
ATOM   5328  C  CD2 . LEU B  2  160 ? 65.190  316.064 175.008 1.00 23.53  ? 160  LEU B CD2 1 
ATOM   5329  N  N   . HIS B  2  161 ? 61.049  314.696 172.363 1.00 26.79  ? 161  HIS B N   1 
ATOM   5330  C  CA  . HIS B  2  161 ? 59.893  313.903 172.120 1.00 25.46  ? 161  HIS B CA  1 
ATOM   5331  C  C   . HIS B  2  161 ? 60.422  312.508 172.230 1.00 24.57  ? 161  HIS B C   1 
ATOM   5332  O  O   . HIS B  2  161 ? 61.613  312.272 172.590 1.00 26.61  ? 161  HIS B O   1 
ATOM   5333  C  CB  . HIS B  2  161 ? 59.384  314.191 170.662 1.00 25.19  ? 161  HIS B CB  1 
ATOM   5334  C  CG  . HIS B  2  161 ? 58.964  315.611 170.469 1.00 24.48  ? 161  HIS B CG  1 
ATOM   5335  N  ND1 . HIS B  2  161 ? 57.656  316.029 170.694 1.00 19.64  ? 161  HIS B ND1 1 
ATOM   5336  C  CD2 . HIS B  2  161 ? 59.647  316.686 170.004 1.00 22.42  ? 161  HIS B CD2 1 
ATOM   5337  C  CE1 . HIS B  2  161 ? 57.572  317.316 170.386 1.00 24.82  ? 161  HIS B CE1 1 
ATOM   5338  N  NE2 . HIS B  2  161 ? 58.776  317.754 170.000 1.00 23.18  ? 161  HIS B NE2 1 
ATOM   5339  N  N   . SER B  2  162 ? 59.595  311.542 171.938 1.00 25.63  ? 162  SER B N   1 
ATOM   5340  C  CA  . SER B  2  162 ? 60.185  310.219 171.880 1.00 26.10  ? 162  SER B CA  1 
ATOM   5341  C  C   . SER B  2  162 ? 59.353  309.407 170.942 1.00 27.77  ? 162  SER B C   1 
ATOM   5342  O  O   . SER B  2  162 ? 58.110  309.322 171.024 1.00 23.89  ? 162  SER B O   1 
ATOM   5343  C  CB  . SER B  2  162 ? 60.335  309.553 173.280 1.00 29.30  ? 162  SER B CB  1 
ATOM   5344  O  OG  . SER B  2  162 ? 60.751  308.212 173.236 1.00 28.24  ? 162  SER B OG  1 
ATOM   5345  N  N   . TRP B  2  163 ? 60.077  308.713 170.052 1.00 28.78  ? 163  TRP B N   1 
ATOM   5346  C  CA  . TRP B  2  163 ? 59.419  307.951 168.905 1.00 29.34  ? 163  TRP B CA  1 
ATOM   5347  C  C   . TRP B  2  163 ? 59.255  306.474 169.296 1.00 29.10  ? 163  TRP B C   1 
ATOM   5348  O  O   . TRP B  2  163 ? 60.264  305.801 169.533 1.00 29.11  ? 163  TRP B O   1 
ATOM   5349  C  CB  . TRP B  2  163 ? 60.311  308.137 167.655 1.00 28.33  ? 163  TRP B CB  1 
ATOM   5350  C  CG  . TRP B  2  163 ? 59.607  307.800 166.308 1.00 29.36  ? 163  TRP B CG  1 
ATOM   5351  C  CD1 . TRP B  2  163 ? 58.814  308.602 165.562 1.00 29.03  ? 163  TRP B CD1 1 
ATOM   5352  C  CD2 . TRP B  2  163 ? 59.721  306.550 165.589 1.00 29.85  ? 163  TRP B CD2 1 
ATOM   5353  N  NE1 . TRP B  2  163 ? 58.416  307.914 164.397 1.00 25.83  ? 163  TRP B NE1 1 
ATOM   5354  C  CE2 . TRP B  2  163 ? 59.005  306.689 164.374 1.00 29.10  ? 163  TRP B CE2 1 
ATOM   5355  C  CE3 . TRP B  2  163 ? 60.429  305.352 165.824 1.00 30.88  ? 163  TRP B CE3 1 
ATOM   5356  C  CZ2 . TRP B  2  163 ? 58.886  305.648 163.440 1.00 28.83  ? 163  TRP B CZ2 1 
ATOM   5357  C  CZ3 . TRP B  2  163 ? 60.324  304.307 164.844 1.00 32.12  ? 163  TRP B CZ3 1 
ATOM   5358  C  CH2 . TRP B  2  163 ? 59.504  304.453 163.716 1.00 30.66  ? 163  TRP B CH2 1 
ATOM   5359  N  N   . ALA B  2  164 ? 57.994  306.033 169.431 1.00 25.47  ? 164  ALA B N   1 
ATOM   5360  C  CA  . ALA B  2  164 ? 57.665  304.768 169.955 1.00 28.10  ? 164  ALA B CA  1 
ATOM   5361  C  C   . ALA B  2  164 ? 56.722  303.954 169.040 1.00 27.94  ? 164  ALA B C   1 
ATOM   5362  O  O   . ALA B  2  164 ? 55.782  304.487 168.469 1.00 30.20  ? 164  ALA B O   1 
ATOM   5363  C  CB  . ALA B  2  164 ? 57.065  304.917 171.385 1.00 27.15  ? 164  ALA B CB  1 
ATOM   5364  N  N   . VAL B  2  165 ? 56.912  302.646 168.926 1.00 29.43  ? 165  VAL B N   1 
ATOM   5365  C  CA  . VAL B  2  165 ? 55.959  301.757 168.230 1.00 28.43  ? 165  VAL B CA  1 
ATOM   5366  C  C   . VAL B  2  165 ? 56.008  300.461 169.077 1.00 30.04  ? 165  VAL B C   1 
ATOM   5367  O  O   . VAL B  2  165 ? 56.930  299.617 168.932 1.00 29.11  ? 165  VAL B O   1 
ATOM   5368  C  CB  . VAL B  2  165 ? 56.311  301.422 166.719 1.00 29.49  ? 165  VAL B CB  1 
ATOM   5369  C  CG1 . VAL B  2  165 ? 55.188  300.497 166.097 1.00 31.14  ? 165  VAL B CG1 1 
ATOM   5370  C  CG2 . VAL B  2  165 ? 56.665  302.722 165.885 1.00 30.46  ? 165  VAL B CG2 1 
ATOM   5371  N  N   . PRO B  2  166 ? 55.054  300.332 170.005 1.00 31.29  ? 166  PRO B N   1 
ATOM   5372  C  CA  . PRO B  2  166 ? 55.089  299.211 170.970 1.00 32.28  ? 166  PRO B CA  1 
ATOM   5373  C  C   . PRO B  2  166 ? 55.117  297.824 170.301 1.00 32.76  ? 166  PRO B C   1 
ATOM   5374  O  O   . PRO B  2  166 ? 55.823  296.957 170.756 1.00 35.12  ? 166  PRO B O   1 
ATOM   5375  C  CB  . PRO B  2  166 ? 53.771  299.418 171.791 1.00 32.32  ? 166  PRO B CB  1 
ATOM   5376  C  CG  . PRO B  2  166 ? 53.664  300.994 171.783 1.00 32.62  ? 166  PRO B CG  1 
ATOM   5377  C  CD  . PRO B  2  166 ? 53.968  301.313 170.292 1.00 29.65  ? 166  PRO B CD  1 
ATOM   5378  N  N   . SER B  2  167 ? 54.370  297.611 169.219 1.00 32.00  ? 167  SER B N   1 
ATOM   5379  C  CA  . SER B  2  167 ? 54.353  296.275 168.579 1.00 35.40  ? 167  SER B CA  1 
ATOM   5380  C  C   . SER B  2  167 ? 55.684  295.866 167.962 1.00 35.08  ? 167  SER B C   1 
ATOM   5381  O  O   . SER B  2  167 ? 55.948  294.663 167.750 1.00 36.73  ? 167  SER B O   1 
ATOM   5382  C  CB  . SER B  2  167 ? 53.233  296.071 167.556 1.00 31.12  ? 167  SER B CB  1 
ATOM   5383  O  OG  . SER B  2  167 ? 53.165  297.099 166.644 1.00 38.25  ? 167  SER B OG  1 
ATOM   5384  N  N   . LEU B  2  168 ? 56.579  296.817 167.821 1.00 35.65  ? 168  LEU B N   1 
ATOM   5385  C  CA  . LEU B  2  168 ? 57.872  296.463 167.330 1.00 36.67  ? 168  LEU B CA  1 
ATOM   5386  C  C   . LEU B  2  168 ? 58.870  296.543 168.445 1.00 35.85  ? 168  LEU B C   1 
ATOM   5387  O  O   . LEU B  2  168 ? 60.002  296.377 168.161 1.00 36.97  ? 168  LEU B O   1 
ATOM   5388  C  CB  . LEU B  2  168 ? 58.294  297.423 166.213 1.00 35.52  ? 168  LEU B CB  1 
ATOM   5389  C  CG  . LEU B  2  168 ? 57.701  297.031 164.817 1.00 43.67  ? 168  LEU B CG  1 
ATOM   5390  C  CD1 . LEU B  2  168 ? 57.805  298.108 163.848 1.00 40.18  ? 168  LEU B CD1 1 
ATOM   5391  C  CD2 . LEU B  2  168 ? 58.567  295.944 164.216 1.00 47.84  ? 168  LEU B CD2 1 
ATOM   5392  N  N   . GLY B  2  169 ? 58.464  296.795 169.690 1.00 35.18  ? 169  GLY B N   1 
ATOM   5393  C  CA  . GLY B  2  169 ? 59.436  296.921 170.768 1.00 35.40  ? 169  GLY B CA  1 
ATOM   5394  C  C   . GLY B  2  169 ? 60.317  298.172 170.683 1.00 35.40  ? 169  GLY B C   1 
ATOM   5395  O  O   . GLY B  2  169 ? 61.504  298.194 171.146 1.00 38.33  ? 169  GLY B O   1 
ATOM   5396  N  N   . LEU B  2  170 ? 59.800  299.221 170.038 1.00 34.15  ? 170  LEU B N   1 
ATOM   5397  C  CA  . LEU B  2  170 ? 60.615  300.409 169.774 1.00 31.45  ? 170  LEU B CA  1 
ATOM   5398  C  C   . LEU B  2  170 ? 60.224  301.607 170.625 1.00 29.84  ? 170  LEU B C   1 
ATOM   5399  O  O   . LEU B  2  170 ? 59.037  301.951 170.737 1.00 29.72  ? 170  LEU B O   1 
ATOM   5400  C  CB  . LEU B  2  170 ? 60.460  300.885 168.306 1.00 33.68  ? 170  LEU B CB  1 
ATOM   5401  C  CG  . LEU B  2  170 ? 60.858  299.909 167.150 1.00 40.87  ? 170  LEU B CG  1 
ATOM   5402  C  CD1 . LEU B  2  170 ? 60.635  300.532 165.759 1.00 40.99  ? 170  LEU B CD1 1 
ATOM   5403  C  CD2 . LEU B  2  170 ? 62.344  299.612 167.247 1.00 43.54  ? 170  LEU B CD2 1 
ATOM   5404  N  N   . LYS B  2  171 ? 61.231  302.289 171.099 1.00 26.70  ? 171  LYS B N   1 
ATOM   5405  C  CA  . LYS B  2  171 ? 61.097  303.636 171.835 1.00 29.11  ? 171  LYS B CA  1 
ATOM   5406  C  C   . LYS B  2  171 ? 62.483  304.256 171.866 1.00 30.18  ? 171  LYS B C   1 
ATOM   5407  O  O   . LYS B  2  171 ? 63.406  303.754 172.565 1.00 31.95  ? 171  LYS B O   1 
ATOM   5408  C  CB  . LYS B  2  171 ? 60.492  303.524 173.219 1.00 29.01  ? 171  LYS B CB  1 
ATOM   5409  C  CG  . LYS B  2  171 ? 60.248  304.908 173.874 1.00 26.52  ? 171  LYS B CG  1 
ATOM   5410  C  CD  . LYS B  2  171 ? 59.480  304.892 175.215 1.00 30.43  ? 171  LYS B CD  1 
ATOM   5411  C  CE  . LYS B  2  171 ? 58.013  304.246 175.052 1.00 29.57  ? 171  LYS B CE  1 
ATOM   5412  N  NZ  . LYS B  2  171 ? 58.090  302.931 175.774 1.00 33.02  ? 171  LYS B NZ  1 
ATOM   5413  N  N   . THR B  2  172 ? 62.648  305.352 171.112 1.00 30.80  ? 172  THR B N   1 
ATOM   5414  C  CA  . THR B  2  172 ? 63.940  306.060 171.066 1.00 29.79  ? 172  THR B CA  1 
ATOM   5415  C  C   . THR B  2  172 ? 63.608  307.514 171.253 1.00 31.17  ? 172  THR B C   1 
ATOM   5416  O  O   . THR B  2  172 ? 62.823  308.126 170.452 1.00 29.66  ? 172  THR B O   1 
ATOM   5417  C  CB  . THR B  2  172 ? 64.606  305.865 169.639 1.00 31.34  ? 172  THR B CB  1 
ATOM   5418  O  OG1 . THR B  2  172 ? 64.902  304.509 169.561 1.00 31.61  ? 172  THR B OG1 1 
ATOM   5419  C  CG2 . THR B  2  172 ? 65.833  306.596 169.430 1.00 27.82  ? 172  THR B CG2 1 
ATOM   5420  N  N   . ASP B  2  173 ? 64.268  308.130 172.241 1.00 29.31  ? 173  ASP B N   1 
ATOM   5421  C  CA  . ASP B  2  173 ? 64.002  309.536 172.442 1.00 28.72  ? 173  ASP B CA  1 
ATOM   5422  C  C   . ASP B  2  173 ? 64.524  310.393 171.338 1.00 28.38  ? 173  ASP B C   1 
ATOM   5423  O  O   . ASP B  2  173 ? 65.613  310.104 170.755 1.00 30.83  ? 173  ASP B O   1 
ATOM   5424  C  CB  . ASP B  2  173 ? 64.589  310.050 173.809 1.00 26.18  ? 173  ASP B CB  1 
ATOM   5425  C  CG  . ASP B  2  173 ? 63.914  309.436 175.079 1.00 27.75  ? 173  ASP B CG  1 
ATOM   5426  O  OD1 . ASP B  2  173 ? 62.881  308.669 175.028 1.00 30.13  ? 173  ASP B OD1 1 
ATOM   5427  O  OD2 . ASP B  2  173 ? 64.395  309.823 176.180 1.00 26.83  ? 173  ASP B OD2 1 
ATOM   5428  N  N   . ALA B  2  174 ? 63.864  311.534 171.173 1.00 27.50  ? 174  ALA B N   1 
ATOM   5429  C  CA  . ALA B  2  174 ? 64.115  312.483 170.079 1.00 29.99  ? 174  ALA B CA  1 
ATOM   5430  C  C   . ALA B  2  174 ? 64.644  313.729 170.747 1.00 28.85  ? 174  ALA B C   1 
ATOM   5431  O  O   . ALA B  2  174 ? 63.910  314.498 171.325 1.00 28.10  ? 174  ALA B O   1 
ATOM   5432  C  CB  . ALA B  2  174 ? 62.767  312.786 169.369 1.00 28.64  ? 174  ALA B CB  1 
ATOM   5433  N  N   . ILE B  2  175 ? 65.939  313.936 170.646 1.00 28.78  ? 175  ILE B N   1 
ATOM   5434  C  CA  . ILE B  2  175 ? 66.641  315.034 171.333 1.00 28.25  ? 175  ILE B CA  1 
ATOM   5435  C  C   . ILE B  2  175 ? 67.334  315.974 170.334 1.00 29.90  ? 175  ILE B C   1 
ATOM   5436  O  O   . ILE B  2  175 ? 68.164  315.492 169.497 1.00 29.66  ? 175  ILE B O   1 
ATOM   5437  C  CB  . ILE B  2  175 ? 67.747  314.378 172.180 1.00 26.81  ? 175  ILE B CB  1 
ATOM   5438  C  CG1 . ILE B  2  175 ? 67.041  313.540 173.295 1.00 27.70  ? 175  ILE B CG1 1 
ATOM   5439  C  CG2 . ILE B  2  175 ? 68.702  315.415 172.982 1.00 23.84  ? 175  ILE B CG2 1 
ATOM   5440  C  CD1 . ILE B  2  175 ? 67.763  312.312 173.828 1.00 32.13  ? 175  ILE B CD1 1 
ATOM   5441  N  N   . PRO B  2  176 ? 67.130  317.312 170.502 1.00 28.81  ? 176  PRO B N   1 
ATOM   5442  C  CA  . PRO B  2  176 ? 67.693  318.214 169.567 1.00 28.42  ? 176  PRO B CA  1 
ATOM   5443  C  C   . PRO B  2  176 ? 69.255  318.198 169.661 1.00 31.06  ? 176  PRO B C   1 
ATOM   5444  O  O   . PRO B  2  176 ? 69.836  318.096 170.782 1.00 31.47  ? 176  PRO B O   1 
ATOM   5445  C  CB  . PRO B  2  176 ? 67.125  319.570 169.995 1.00 24.91  ? 176  PRO B CB  1 
ATOM   5446  C  CG  . PRO B  2  176 ? 66.979  319.422 171.561 1.00 26.41  ? 176  PRO B CG  1 
ATOM   5447  C  CD  . PRO B  2  176 ? 66.358  317.996 171.565 1.00 27.42  ? 176  PRO B CD  1 
ATOM   5448  N  N   . GLY B  2  177 ? 69.933  318.289 168.509 1.00 27.80  ? 177  GLY B N   1 
ATOM   5449  C  CA  . GLY B  2  177 ? 71.428  318.304 168.569 1.00 28.54  ? 177  GLY B CA  1 
ATOM   5450  C  C   . GLY B  2  177 ? 71.891  316.892 168.597 1.00 30.44  ? 177  GLY B C   1 
ATOM   5451  O  O   . GLY B  2  177 ? 73.101  316.635 168.593 1.00 24.89  ? 177  GLY B O   1 
ATOM   5452  N  N   . ARG B  2  178 ? 70.952  315.903 168.622 1.00 26.27  ? 178  ARG B N   1 
ATOM   5453  C  CA  . ARG B  2  178 ? 71.515  314.522 168.717 1.00 26.38  ? 178  ARG B CA  1 
ATOM   5454  C  C   . ARG B  2  178 ? 70.849  313.596 167.682 1.00 28.76  ? 178  ARG B C   1 
ATOM   5455  O  O   . ARG B  2  178 ? 69.676  313.843 167.384 1.00 29.64  ? 178  ARG B O   1 
ATOM   5456  C  CB  . ARG B  2  178 ? 71.103  313.893 170.101 1.00 26.46  ? 178  ARG B CB  1 
ATOM   5457  C  CG  . ARG B  2  178 ? 71.912  312.556 170.485 1.00 25.49  ? 178  ARG B CG  1 
ATOM   5458  C  CD  . ARG B  2  178 ? 71.214  312.048 171.815 1.00 29.71  ? 178  ARG B CD  1 
ATOM   5459  N  NE  . ARG B  2  178 ? 71.672  310.758 172.300 1.00 32.55  ? 178  ARG B NE  1 
ATOM   5460  C  CZ  . ARG B  2  178 ? 72.702  310.644 173.150 1.00 39.18  ? 178  ARG B CZ  1 
ATOM   5461  N  NH1 . ARG B  2  178 ? 73.250  311.747 173.585 1.00 29.70  ? 178  ARG B NH1 1 
ATOM   5462  N  NH2 . ARG B  2  178 ? 73.118  309.474 173.642 1.00 35.53  ? 178  ARG B NH2 1 
ATOM   5463  N  N   . LEU B  2  179 ? 71.476  312.490 167.267 1.00 25.87  ? 179  LEU B N   1 
ATOM   5464  C  CA  . LEU B  2  179 ? 70.878  311.700 166.207 1.00 29.41  ? 179  LEU B CA  1 
ATOM   5465  C  C   . LEU B  2  179 ? 70.787  310.263 166.692 1.00 30.94  ? 179  LEU B C   1 
ATOM   5466  O  O   . LEU B  2  179 ? 71.793  309.514 166.649 1.00 33.46  ? 179  LEU B O   1 
ATOM   5467  C  CB  . LEU B  2  179 ? 71.752  311.857 164.940 1.00 30.88  ? 179  LEU B CB  1 
ATOM   5468  C  CG  . LEU B  2  179 ? 71.220  311.428 163.548 1.00 29.85  ? 179  LEU B CG  1 
ATOM   5469  C  CD1 . LEU B  2  179 ? 69.955  312.233 163.179 1.00 28.92  ? 179  LEU B CD1 1 
ATOM   5470  C  CD2 . LEU B  2  179 ? 72.423  311.683 162.447 1.00 29.26  ? 179  LEU B CD2 1 
ATOM   5471  N  N   . ASN B  2  180 ? 69.672  309.844 167.253 1.00 30.02  ? 180  ASN B N   1 
ATOM   5472  C  CA  . ASN B  2  180 ? 69.695  308.469 167.851 1.00 29.84  ? 180  ASN B CA  1 
ATOM   5473  C  C   . ASN B  2  180 ? 69.305  307.351 166.903 1.00 32.50  ? 180  ASN B C   1 
ATOM   5474  O  O   . ASN B  2  180 ? 68.240  307.449 166.266 1.00 33.49  ? 180  ASN B O   1 
ATOM   5475  C  CB  . ASN B  2  180 ? 68.694  308.413 168.994 1.00 28.99  ? 180  ASN B CB  1 
ATOM   5476  C  CG  . ASN B  2  180 ? 69.305  308.906 170.386 1.00 29.94  ? 180  ASN B CG  1 
ATOM   5477  O  OD1 . ASN B  2  180 ? 70.515  308.854 170.589 1.00 29.19  ? 180  ASN B OD1 1 
ATOM   5478  N  ND2 . ASN B  2  180 ? 68.420  309.366 171.303 1.00 28.39  ? 180  ASN B ND2 1 
ATOM   5479  N  N   . GLN B  2  181 ? 70.028  306.251 166.899 1.00 31.00  ? 181  GLN B N   1 
ATOM   5480  C  CA  . GLN B  2  181 ? 69.766  305.210 165.967 1.00 35.10  ? 181  GLN B CA  1 
ATOM   5481  C  C   . GLN B  2  181 ? 68.998  304.010 166.564 1.00 36.23  ? 181  GLN B C   1 
ATOM   5482  O  O   . GLN B  2  181 ? 69.235  303.578 167.748 1.00 33.23  ? 181  GLN B O   1 
ATOM   5483  C  CB  . GLN B  2  181 ? 71.113  304.675 165.460 1.00 36.19  ? 181  GLN B CB  1 
ATOM   5484  C  CG  . GLN B  2  181 ? 71.059  303.437 164.456 1.00 33.70  ? 181  GLN B CG  1 
ATOM   5485  C  CD  . GLN B  2  181 ? 72.488  303.185 164.014 1.00 40.09  ? 181  GLN B CD  1 
ATOM   5486  O  OE1 . GLN B  2  181 ? 73.347  302.698 164.792 1.00 36.11  ? 181  GLN B OE1 1 
ATOM   5487  N  NE2 . GLN B  2  181 ? 72.796  303.664 162.881 1.00 32.54  ? 181  GLN B NE2 1 
ATOM   5488  N  N   . THR B  2  182 ? 68.097  303.436 165.775 1.00 33.93  ? 182  THR B N   1 
ATOM   5489  C  CA  . THR B  2  182 ? 67.421  302.169 166.224 1.00 36.15  ? 182  THR B CA  1 
ATOM   5490  C  C   . THR B  2  182 ? 67.140  301.382 164.910 1.00 37.05  ? 182  THR B C   1 
ATOM   5491  O  O   . THR B  2  182 ? 67.159  301.986 163.843 1.00 37.42  ? 182  THR B O   1 
ATOM   5492  C  CB  . THR B  2  182 ? 66.157  302.431 167.022 1.00 37.28  ? 182  THR B CB  1 
ATOM   5493  O  OG1 . THR B  2  182 ? 65.712  301.180 167.609 1.00 39.40  ? 182  THR B OG1 1 
ATOM   5494  C  CG2 . THR B  2  182 ? 65.016  302.927 166.195 1.00 31.54  ? 182  THR B CG2 1 
ATOM   5495  N  N   . THR B  2  183 ? 66.979  300.065 164.923 1.00 37.09  ? 183  THR B N   1 
ATOM   5496  C  CA  . THR B  2  183 ? 66.617  299.411 163.671 1.00 38.01  ? 183  THR B CA  1 
ATOM   5497  C  C   . THR B  2  183 ? 65.258  298.769 163.852 1.00 37.98  ? 183  THR B C   1 
ATOM   5498  O  O   . THR B  2  183 ? 64.896  298.415 164.939 1.00 38.92  ? 183  THR B O   1 
ATOM   5499  C  CB  . THR B  2  183 ? 67.546  298.305 163.426 1.00 40.43  ? 183  THR B CB  1 
ATOM   5500  O  OG1 . THR B  2  183 ? 67.391  297.483 164.555 1.00 44.45  ? 183  THR B OG1 1 
ATOM   5501  C  CG2 . THR B  2  183 ? 69.010  298.786 163.435 1.00 41.12  ? 183  THR B CG2 1 
ATOM   5502  N  N   . LEU B  2  184 ? 64.564  298.489 162.763 1.00 37.01  ? 184  LEU B N   1 
ATOM   5503  C  CA  . LEU B  2  184 ? 63.142  298.166 162.750 1.00 38.57  ? 184  LEU B CA  1 
ATOM   5504  C  C   . LEU B  2  184 ? 63.098  297.057 161.628 1.00 39.75  ? 184  LEU B C   1 
ATOM   5505  O  O   . LEU B  2  184 ? 63.760  297.187 160.606 1.00 39.64  ? 184  LEU B O   1 
ATOM   5506  C  CB  . LEU B  2  184 ? 62.461  299.500 162.339 1.00 40.19  ? 184  LEU B CB  1 
ATOM   5507  C  CG  . LEU B  2  184 ? 60.998  299.628 161.980 1.00 42.88  ? 184  LEU B CG  1 
ATOM   5508  C  CD1 . LEU B  2  184 ? 60.645  301.092 162.030 1.00 43.64  ? 184  LEU B CD1 1 
ATOM   5509  C  CD2 . LEU B  2  184 ? 60.674  299.019 160.660 1.00 33.53  ? 184  LEU B CD2 1 
ATOM   5510  N  N   . MET B  2  185 ? 62.396  295.960 161.830 1.00 39.57  ? 185  MET B N   1 
ATOM   5511  C  CA  . MET B  2  185 ? 62.216  294.966 160.777 1.00 41.54  ? 185  MET B CA  1 
ATOM   5512  C  C   . MET B  2  185 ? 60.801  294.408 161.022 1.00 40.91  ? 185  MET B C   1 
ATOM   5513  O  O   . MET B  2  185 ? 60.522  293.920 162.120 1.00 43.29  ? 185  MET B O   1 
ATOM   5514  C  CB  . MET B  2  185 ? 63.290  293.885 160.966 1.00 41.72  ? 185  MET B CB  1 
ATOM   5515  C  CG  . MET B  2  185 ? 63.614  293.062 159.639 1.00 44.42  ? 185  MET B CG  1 
ATOM   5516  S  SD  . MET B  2  185 ? 62.235  292.022 159.195 1.00 51.64  ? 185  MET B SD  1 
ATOM   5517  C  CE  . MET B  2  185 ? 62.118  290.851 160.576 1.00 48.56  ? 185  MET B CE  1 
ATOM   5518  N  N   . SER B  2  186 ? 59.855  294.571 160.103 1.00 38.24  ? 186  SER B N   1 
ATOM   5519  C  CA  . SER B  2  186 ? 58.519  293.997 160.369 1.00 36.57  ? 186  SER B CA  1 
ATOM   5520  C  C   . SER B  2  186 ? 58.394  292.680 159.652 1.00 38.36  ? 186  SER B C   1 
ATOM   5521  O  O   . SER B  2  186 ? 58.688  292.598 158.435 1.00 38.46  ? 186  SER B O   1 
ATOM   5522  C  CB  . SER B  2  186 ? 57.392  294.905 159.898 1.00 37.95  ? 186  SER B CB  1 
ATOM   5523  O  OG  . SER B  2  186 ? 56.125  294.267 160.131 1.00 32.14  ? 186  SER B OG  1 
ATOM   5524  N  N   . SER B  2  187 ? 57.992  291.612 160.367 1.00 38.17  ? 187  SER B N   1 
ATOM   5525  C  CA  . SER B  2  187 ? 57.770  290.332 159.713 1.00 37.87  ? 187  SER B CA  1 
ATOM   5526  C  C   . SER B  2  187 ? 56.452  290.340 158.888 1.00 38.08  ? 187  SER B C   1 
ATOM   5527  O  O   . SER B  2  187 ? 56.183  289.393 158.147 1.00 37.53  ? 187  SER B O   1 
ATOM   5528  C  CB  . SER B  2  187 ? 57.624  289.224 160.775 1.00 40.03  ? 187  SER B CB  1 
ATOM   5529  O  OG  . SER B  2  187 ? 58.787  289.145 161.577 1.00 39.88  ? 187  SER B OG  1 
ATOM   5530  N  N   . ARG B  2  188 ? 55.658  291.390 159.010 1.00 34.08  ? 188  ARG B N   1 
ATOM   5531  C  CA  . ARG B  2  188 ? 54.341  291.348 158.367 1.00 35.04  ? 188  ARG B CA  1 
ATOM   5532  C  C   . ARG B  2  188 ? 53.992  292.676 157.677 1.00 33.99  ? 188  ARG B C   1 
ATOM   5533  O  O   . ARG B  2  188 ? 54.487  293.720 158.107 1.00 31.14  ? 188  ARG B O   1 
ATOM   5534  C  CB  . ARG B  2  188 ? 53.279  290.994 159.361 1.00 31.95  ? 188  ARG B CB  1 
ATOM   5535  C  CG  . ARG B  2  188 ? 53.532  289.680 160.145 1.00 34.71  ? 188  ARG B CG  1 
ATOM   5536  C  CD  . ARG B  2  188 ? 52.248  289.114 160.758 1.00 35.01  ? 188  ARG B CD  1 
ATOM   5537  N  NE  . ARG B  2  188 ? 51.483  290.122 161.554 1.00 35.30  ? 188  ARG B NE  1 
ATOM   5538  C  CZ  . ARG B  2  188 ? 51.793  290.540 162.806 1.00 37.72  ? 188  ARG B CZ  1 
ATOM   5539  N  NH1 . ARG B  2  188 ? 52.811  290.015 163.481 1.00 32.50  ? 188  ARG B NH1 1 
ATOM   5540  N  NH2 . ARG B  2  188 ? 51.087  291.505 163.355 1.00 29.18  ? 188  ARG B NH2 1 
ATOM   5541  N  N   . PRO B  2  189 ? 53.045  292.645 156.697 1.00 33.99  ? 189  PRO B N   1 
ATOM   5542  C  CA  . PRO B  2  189 ? 52.594  293.920 156.253 1.00 33.39  ? 189  PRO B CA  1 
ATOM   5543  C  C   . PRO B  2  189 ? 51.592  294.414 157.263 1.00 33.70  ? 189  PRO B C   1 
ATOM   5544  O  O   . PRO B  2  189 ? 51.201  293.658 158.221 1.00 34.45  ? 189  PRO B O   1 
ATOM   5545  C  CB  . PRO B  2  189 ? 51.903  293.614 154.842 1.00 35.07  ? 189  PRO B CB  1 
ATOM   5546  C  CG  . PRO B  2  189 ? 51.269  292.259 155.105 1.00 35.86  ? 189  PRO B CG  1 
ATOM   5547  C  CD  . PRO B  2  189 ? 52.302  291.536 156.064 1.00 34.02  ? 189  PRO B CD  1 
ATOM   5548  N  N   . GLY B  2  190 ? 51.125  295.654 157.078 1.00 31.87  ? 190  GLY B N   1 
ATOM   5549  C  CA  . GLY B  2  190 ? 50.025  296.140 157.873 1.00 31.93  ? 190  GLY B CA  1 
ATOM   5550  C  C   . GLY B  2  190 ? 50.267  297.536 158.379 1.00 32.90  ? 190  GLY B C   1 
ATOM   5551  O  O   . GLY B  2  190 ? 51.149  298.211 157.915 1.00 33.29  ? 190  GLY B O   1 
ATOM   5552  N  N   . LEU B  2  191 ? 49.488  297.933 159.369 1.00 31.67  ? 191  LEU B N   1 
ATOM   5553  C  CA  . LEU B  2  191 ? 49.532  299.312 159.914 1.00 33.18  ? 191  LEU B CA  1 
ATOM   5554  C  C   . LEU B  2  191 ? 49.871  299.190 161.419 1.00 32.78  ? 191  LEU B C   1 
ATOM   5555  O  O   . LEU B  2  191 ? 49.229  298.414 162.148 1.00 31.76  ? 191  LEU B O   1 
ATOM   5556  C  CB  . LEU B  2  191 ? 48.165  299.979 159.780 1.00 32.36  ? 191  LEU B CB  1 
ATOM   5557  C  CG  . LEU B  2  191 ? 47.662  300.191 158.314 1.00 36.24  ? 191  LEU B CG  1 
ATOM   5558  C  CD1 . LEU B  2  191 ? 46.373  300.879 158.453 1.00 29.23  ? 191  LEU B CD1 1 
ATOM   5559  C  CD2 . LEU B  2  191 ? 48.617  301.101 157.640 1.00 34.10  ? 191  LEU B CD2 1 
ATOM   5560  N  N   . TYR B  2  192 ? 50.936  299.870 161.837 1.00 34.59  ? 192  TYR B N   1 
ATOM   5561  C  CA  . TYR B  2  192 ? 51.509  299.736 163.216 1.00 33.59  ? 192  TYR B CA  1 
ATOM   5562  C  C   . TYR B  2  192 ? 51.626  301.107 163.875 1.00 33.01  ? 192  TYR B C   1 
ATOM   5563  O  O   . TYR B  2  192 ? 52.277  301.978 163.291 1.00 31.56  ? 192  TYR B O   1 
ATOM   5564  C  CB  . TYR B  2  192 ? 52.867  298.979 163.247 1.00 33.04  ? 192  TYR B CB  1 
ATOM   5565  C  CG  . TYR B  2  192 ? 52.619  297.621 162.612 1.00 32.99  ? 192  TYR B CG  1 
ATOM   5566  C  CD1 . TYR B  2  192 ? 52.974  297.366 161.235 1.00 29.65  ? 192  TYR B CD1 1 
ATOM   5567  C  CD2 . TYR B  2  192 ? 51.990  296.590 163.346 1.00 34.57  ? 192  TYR B CD2 1 
ATOM   5568  C  CE1 . TYR B  2  192 ? 52.661  296.077 160.670 1.00 29.32  ? 192  TYR B CE1 1 
ATOM   5569  C  CE2 . TYR B  2  192 ? 51.658  295.330 162.777 1.00 34.75  ? 192  TYR B CE2 1 
ATOM   5570  C  CZ  . TYR B  2  192 ? 51.986  295.111 161.428 1.00 35.11  ? 192  TYR B CZ  1 
ATOM   5571  O  OH  . TYR B  2  192 ? 51.608  293.883 160.899 1.00 37.79  ? 192  TYR B OH  1 
ATOM   5572  N  N   . TYR B  2  193 ? 51.014  301.252 165.084 1.00 28.97  ? 193  TYR B N   1 
ATOM   5573  C  CA  . TYR B  2  193 ? 50.744  302.587 165.693 1.00 29.31  ? 193  TYR B CA  1 
ATOM   5574  C  C   . TYR B  2  193 ? 51.619  302.835 166.949 1.00 30.43  ? 193  TYR B C   1 
ATOM   5575  O  O   . TYR B  2  193 ? 51.891  301.858 167.652 1.00 31.72  ? 193  TYR B O   1 
ATOM   5576  C  CB  . TYR B  2  193 ? 49.298  302.639 166.153 1.00 27.56  ? 193  TYR B CB  1 
ATOM   5577  C  CG  . TYR B  2  193 ? 48.334  302.658 164.944 1.00 29.22  ? 193  TYR B CG  1 
ATOM   5578  C  CD1 . TYR B  2  193 ? 47.808  303.840 164.527 1.00 28.64  ? 193  TYR B CD1 1 
ATOM   5579  C  CD2 . TYR B  2  193 ? 47.916  301.455 164.287 1.00 27.84  ? 193  TYR B CD2 1 
ATOM   5580  C  CE1 . TYR B  2  193 ? 46.911  303.926 163.405 1.00 33.31  ? 193  TYR B CE1 1 
ATOM   5581  C  CE2 . TYR B  2  193 ? 46.994  301.517 163.168 1.00 32.30  ? 193  TYR B CE2 1 
ATOM   5582  C  CZ  . TYR B  2  193 ? 46.519  302.732 162.743 1.00 32.23  ? 193  TYR B CZ  1 
ATOM   5583  O  OH  . TYR B  2  193 ? 45.583  302.851 161.719 1.00 34.27  ? 193  TYR B OH  1 
ATOM   5584  N  N   . GLY B  2  194 ? 52.041  304.093 167.241 1.00 29.18  ? 194  GLY B N   1 
ATOM   5585  C  CA  . GLY B  2  194 ? 52.761  304.387 168.510 1.00 25.87  ? 194  GLY B CA  1 
ATOM   5586  C  C   . GLY B  2  194 ? 52.367  305.806 168.785 1.00 29.43  ? 194  GLY B C   1 
ATOM   5587  O  O   . GLY B  2  194 ? 51.640  306.459 167.946 1.00 28.63  ? 194  GLY B O   1 
ATOM   5588  N  N   . GLN B  2  195 ? 52.889  306.350 169.893 1.00 27.60  ? 195  GLN B N   1 
ATOM   5589  C  CA  . GLN B  2  195 ? 52.546  307.700 170.337 1.00 27.99  ? 195  GLN B CA  1 
ATOM   5590  C  C   . GLN B  2  195 ? 53.762  308.344 170.935 1.00 27.77  ? 195  GLN B C   1 
ATOM   5591  O  O   . GLN B  2  195 ? 54.594  307.659 171.442 1.00 28.94  ? 195  GLN B O   1 
ATOM   5592  C  CB  . GLN B  2  195 ? 51.439  307.561 171.397 1.00 26.54  ? 195  GLN B CB  1 
ATOM   5593  C  CG  . GLN B  2  195 ? 50.167  307.121 170.719 1.00 25.78  ? 195  GLN B CG  1 
ATOM   5594  C  CD  . GLN B  2  195 ? 48.978  307.031 171.667 1.00 28.87  ? 195  GLN B CD  1 
ATOM   5595  O  OE1 . GLN B  2  195 ? 48.835  306.060 172.434 1.00 28.23  ? 195  GLN B OE1 1 
ATOM   5596  N  NE2 . GLN B  2  195 ? 48.134  307.999 171.606 1.00 23.70  ? 195  GLN B NE2 1 
ATOM   5597  N  N   . CYS B  2  196 ? 53.889  309.655 170.781 1.00 27.77  ? 196  CYS B N   1 
ATOM   5598  C  CA  . CYS B  2  196 ? 54.957  310.359 171.393 1.00 27.05  ? 196  CYS B CA  1 
ATOM   5599  C  C   . CYS B  2  196 ? 55.087  310.051 172.925 1.00 27.02  ? 196  CYS B C   1 
ATOM   5600  O  O   . CYS B  2  196 ? 54.067  310.126 173.684 1.00 24.83  ? 196  CYS B O   1 
ATOM   5601  C  CB  . CYS B  2  196 ? 54.760  311.860 171.187 1.00 24.68  ? 196  CYS B CB  1 
ATOM   5602  S  SG  . CYS B  2  196 ? 56.182  312.827 171.905 1.00 27.65  ? 196  CYS B SG  1 
ATOM   5603  N  N   . SER B  2  197 ? 56.338  309.709 173.308 1.00 25.40  ? 197  SER B N   1 
ATOM   5604  C  CA  . SER B  2  197 ? 56.626  309.064 174.623 1.00 29.00  ? 197  SER B CA  1 
ATOM   5605  C  C   . SER B  2  197 ? 57.644  309.840 175.490 1.00 27.79  ? 197  SER B C   1 
ATOM   5606  O  O   . SER B  2  197 ? 58.356  309.219 176.308 1.00 25.34  ? 197  SER B O   1 
ATOM   5607  C  CB  . SER B  2  197 ? 57.093  307.588 174.367 1.00 28.83  ? 197  SER B CB  1 
ATOM   5608  O  OG  . SER B  2  197 ? 55.921  306.820 173.897 1.00 25.87  ? 197  SER B OG  1 
ATOM   5609  N  N   . GLU B  2  198 ? 57.728  311.173 175.254 1.00 25.61  ? 198  GLU B N   1 
ATOM   5610  C  CA  . GLU B  2  198 ? 58.412  312.130 176.208 1.00 26.86  ? 198  GLU B CA  1 
ATOM   5611  C  C   . GLU B  2  198 ? 57.591  313.458 176.131 1.00 29.93  ? 198  GLU B C   1 
ATOM   5612  O  O   . GLU B  2  198 ? 57.111  314.008 174.977 1.00 32.01  ? 198  GLU B O   1 
ATOM   5613  C  CB  . GLU B  2  198 ? 59.906  312.387 175.865 1.00 25.05  ? 198  GLU B CB  1 
ATOM   5614  C  CG  . GLU B  2  198 ? 60.676  313.299 176.855 1.00 22.76  ? 198  GLU B CG  1 
ATOM   5615  C  CD  . GLU B  2  198 ? 60.709  312.689 178.256 1.00 30.65  ? 198  GLU B CD  1 
ATOM   5616  O  OE1 . GLU B  2  198 ? 60.679  311.465 178.459 1.00 29.85  ? 198  GLU B OE1 1 
ATOM   5617  O  OE2 . GLU B  2  198 ? 60.682  313.475 179.180 1.00 34.71  ? 198  GLU B OE2 1 
ATOM   5618  N  N   . ILE B  2  199 ? 57.197  313.791 177.413 1.00 30.20  ? 199  ILE B N   1 
ATOM   5619  C  CA  . ILE B  2  199 ? 56.320  315.006 177.586 1.00 28.86  ? 199  ILE B CA  1 
ATOM   5620  C  C   . ILE B  2  199 ? 56.952  316.189 176.928 1.00 27.86  ? 199  ILE B C   1 
ATOM   5621  O  O   . ILE B  2  199 ? 58.144  316.535 177.223 1.00 26.83  ? 199  ILE B O   1 
ATOM   5622  C  CB  . ILE B  2  199 ? 55.894  315.310 179.042 1.00 29.79  ? 199  ILE B CB  1 
ATOM   5623  C  CG1 . ILE B  2  199 ? 54.882  316.470 179.032 1.00 29.18  ? 199  ILE B CG1 1 
ATOM   5624  C  CG2 . ILE B  2  199 ? 57.118  315.798 179.887 1.00 26.36  ? 199  ILE B CG2 1 
ATOM   5625  C  CD1 . ILE B  2  199 ? 54.328  316.832 180.506 1.00 25.72  ? 199  ILE B CD1 1 
ATOM   5626  N  N   . CYS B  2  200 ? 56.224  316.799 175.982 1.00 26.95  ? 200  CYS B N   1 
ATOM   5627  C  CA  . CYS B  2  200 ? 56.763  317.873 175.078 1.00 27.89  ? 200  CYS B CA  1 
ATOM   5628  C  C   . CYS B  2  200 ? 55.747  319.013 175.039 1.00 31.19  ? 200  CYS B C   1 
ATOM   5629  O  O   . CYS B  2  200 ? 55.781  319.899 174.121 1.00 31.61  ? 200  CYS B O   1 
ATOM   5630  C  CB  . CYS B  2  200 ? 56.894  317.285 173.598 1.00 28.63  ? 200  CYS B CB  1 
ATOM   5631  S  SG  . CYS B  2  200 ? 55.302  316.452 173.087 1.00 29.06  ? 200  CYS B SG  1 
ATOM   5632  N  N   . GLY B  2  201 ? 54.818  319.051 176.017 1.00 28.48  ? 201  GLY B N   1 
ATOM   5633  C  CA  . GLY B  2  201 ? 53.992  320.231 176.103 1.00 27.20  ? 201  GLY B CA  1 
ATOM   5634  C  C   . GLY B  2  201 ? 52.511  319.926 175.948 1.00 29.57  ? 201  GLY B C   1 
ATOM   5635  O  O   . GLY B  2  201 ? 52.139  318.799 176.116 1.00 29.00  ? 201  GLY B O   1 
ATOM   5636  N  N   . SER B  2  202 ? 51.690  320.961 175.690 1.00 29.96  ? 202  SER B N   1 
ATOM   5637  C  CA  . SER B  2  202 ? 50.190  320.866 175.543 1.00 34.87  ? 202  SER B CA  1 
ATOM   5638  C  C   . SER B  2  202 ? 49.707  319.682 174.761 1.00 34.00  ? 202  SER B C   1 
ATOM   5639  O  O   . SER B  2  202 ? 48.639  319.190 175.046 1.00 38.85  ? 202  SER B O   1 
ATOM   5640  C  CB  . SER B  2  202 ? 49.737  322.052 174.621 1.00 34.53  ? 202  SER B CB  1 
ATOM   5641  O  OG  . SER B  2  202 ? 49.706  323.112 175.476 1.00 48.00  ? 202  SER B OG  1 
ATOM   5642  N  N   . ASN B  2  203 ? 50.372  319.314 173.657 1.00 31.95  ? 203  ASN B N   1 
ATOM   5643  C  CA  . ASN B  2  203 ? 49.798  318.324 172.692 1.00 32.09  ? 203  ASN B CA  1 
ATOM   5644  C  C   . ASN B  2  203 ? 50.649  317.070 172.587 1.00 31.41  ? 203  ASN B C   1 
ATOM   5645  O  O   . ASN B  2  203 ? 50.609  316.348 171.618 1.00 29.70  ? 203  ASN B O   1 
ATOM   5646  C  CB  . ASN B  2  203 ? 49.505  318.958 171.284 1.00 31.30  ? 203  ASN B CB  1 
ATOM   5647  C  CG  . ASN B  2  203 ? 48.339  320.055 171.343 1.00 37.46  ? 203  ASN B CG  1 
ATOM   5648  O  OD1 . ASN B  2  203 ? 47.521  320.019 172.156 1.00 43.30  ? 203  ASN B OD1 1 
ATOM   5649  N  ND2 . ASN B  2  203 ? 48.368  320.994 170.479 1.00 52.66  ? 203  ASN B ND2 1 
ATOM   5650  N  N   . HIS B  2  204 ? 51.436  316.819 173.637 1.00 30.38  ? 204  HIS B N   1 
ATOM   5651  C  CA  . HIS B  2  204 ? 52.098  315.505 173.826 1.00 28.00  ? 204  HIS B CA  1 
ATOM   5652  C  C   . HIS B  2  204 ? 51.202  314.320 173.521 1.00 26.83  ? 204  HIS B C   1 
ATOM   5653  O  O   . HIS B  2  204 ? 51.669  313.357 173.035 1.00 26.57  ? 204  HIS B O   1 
ATOM   5654  C  CB  . HIS B  2  204 ? 52.441  315.439 175.380 1.00 26.30  ? 204  HIS B CB  1 
ATOM   5655  C  CG  . HIS B  2  204 ? 53.125  314.176 175.801 1.00 28.11  ? 204  HIS B CG  1 
ATOM   5656  N  ND1 . HIS B  2  204 ? 54.180  313.594 175.065 1.00 28.60  ? 204  HIS B ND1 1 
ATOM   5657  C  CD2 . HIS B  2  204 ? 52.996  313.435 176.922 1.00 23.73  ? 204  HIS B CD2 1 
ATOM   5658  C  CE1 . HIS B  2  204 ? 54.623  312.537 175.732 1.00 26.71  ? 204  HIS B CE1 1 
ATOM   5659  N  NE2 . HIS B  2  204 ? 53.948  312.441 176.875 1.00 30.24  ? 204  HIS B NE2 1 
ATOM   5660  N  N   . SER B  2  205 ? 49.904  314.371 173.938 1.00 27.43  ? 205  SER B N   1 
ATOM   5661  C  CA  . SER B  2  205 ? 48.934  313.282 173.769 1.00 27.02  ? 205  SER B CA  1 
ATOM   5662  C  C   . SER B  2  205 ? 48.477  313.111 172.301 1.00 28.11  ? 205  SER B C   1 
ATOM   5663  O  O   . SER B  2  205 ? 47.834  312.105 172.007 1.00 30.26  ? 205  SER B O   1 
ATOM   5664  C  CB  . SER B  2  205 ? 47.666  313.566 174.504 1.00 27.90  ? 205  SER B CB  1 
ATOM   5665  O  OG  . SER B  2  205 ? 47.932  313.783 175.867 1.00 30.93  ? 205  SER B OG  1 
ATOM   5666  N  N   . PHE B  2  206 ? 48.834  314.059 171.417 1.00 30.73  ? 206  PHE B N   1 
ATOM   5667  C  CA  . PHE B  2  206 ? 48.248  314.126 170.069 1.00 29.78  ? 206  PHE B CA  1 
ATOM   5668  C  C   . PHE B  2  206 ? 49.284  314.259 168.958 1.00 30.09  ? 206  PHE B C   1 
ATOM   5669  O  O   . PHE B  2  206 ? 49.099  315.029 168.018 1.00 28.80  ? 206  PHE B O   1 
ATOM   5670  C  CB  . PHE B  2  206 ? 47.229  315.305 170.046 1.00 32.14  ? 206  PHE B CB  1 
ATOM   5671  C  CG  . PHE B  2  206 ? 46.308  315.339 171.263 1.00 32.86  ? 206  PHE B CG  1 
ATOM   5672  C  CD1 . PHE B  2  206 ? 46.368  316.381 172.183 1.00 30.29  ? 206  PHE B CD1 1 
ATOM   5673  C  CD2 . PHE B  2  206 ? 45.370  314.340 171.451 1.00 27.83  ? 206  PHE B CD2 1 
ATOM   5674  C  CE1 . PHE B  2  206 ? 45.497  316.423 173.291 1.00 31.72  ? 206  PHE B CE1 1 
ATOM   5675  C  CE2 . PHE B  2  206 ? 44.454  314.354 172.574 1.00 25.54  ? 206  PHE B CE2 1 
ATOM   5676  C  CZ  . PHE B  2  206 ? 44.504  315.406 173.515 1.00 28.30  ? 206  PHE B CZ  1 
ATOM   5677  N  N   . MET B  2  207 ? 50.393  313.496 168.997 1.00 29.02  ? 207  MET B N   1 
ATOM   5678  C  CA  . MET B  2  207 ? 51.296  313.436 167.790 1.00 27.71  ? 207  MET B CA  1 
ATOM   5679  C  C   . MET B  2  207 ? 51.724  311.952 167.613 1.00 26.11  ? 207  MET B C   1 
ATOM   5680  O  O   . MET B  2  207 ? 52.903  311.571 167.887 1.00 28.78  ? 207  MET B O   1 
ATOM   5681  C  CB  . MET B  2  207 ? 52.519  314.413 167.965 1.00 27.54  ? 207  MET B CB  1 
ATOM   5682  C  CG  . MET B  2  207 ? 53.122  314.416 169.376 1.00 26.37  ? 207  MET B CG  1 
ATOM   5683  S  SD  . MET B  2  207 ? 54.596  315.522 169.394 1.00 28.98  ? 207  MET B SD  1 
ATOM   5684  C  CE  . MET B  2  207 ? 55.664  314.733 168.315 1.00 20.39  ? 207  MET B CE  1 
ATOM   5685  N  N   . PRO B  2  208 ? 50.807  311.107 167.102 1.00 26.25  ? 208  PRO B N   1 
ATOM   5686  C  CA  . PRO B  2  208 ? 51.023  309.676 166.932 1.00 26.82  ? 208  PRO B CA  1 
ATOM   5687  C  C   . PRO B  2  208 ? 51.883  309.288 165.741 1.00 28.16  ? 208  PRO B C   1 
ATOM   5688  O  O   . PRO B  2  208 ? 52.279  310.162 164.938 1.00 30.25  ? 208  PRO B O   1 
ATOM   5689  C  CB  . PRO B  2  208 ? 49.587  309.106 166.822 1.00 26.43  ? 208  PRO B CB  1 
ATOM   5690  C  CG  . PRO B  2  208 ? 48.834  310.167 166.043 1.00 24.83  ? 208  PRO B CG  1 
ATOM   5691  C  CD  . PRO B  2  208 ? 49.407  311.498 166.668 1.00 26.95  ? 208  PRO B CD  1 
ATOM   5692  N  N   . ILE B  2  209 ? 52.256  307.993 165.706 1.00 31.95  ? 209  ILE B N   1 
ATOM   5693  C  CA  . ILE B  2  209 ? 53.149  307.434 164.709 1.00 28.96  ? 209  ILE B CA  1 
ATOM   5694  C  C   . ILE B  2  209 ? 52.370  306.353 164.082 1.00 31.51  ? 209  ILE B C   1 
ATOM   5695  O  O   . ILE B  2  209 ? 51.802  305.575 164.795 1.00 28.79  ? 209  ILE B O   1 
ATOM   5696  C  CB  . ILE B  2  209 ? 54.339  306.843 165.333 1.00 29.42  ? 209  ILE B CB  1 
ATOM   5697  C  CG1 . ILE B  2  209 ? 55.144  308.022 165.936 1.00 30.43  ? 209  ILE B CG1 1 
ATOM   5698  C  CG2 . ILE B  2  209 ? 55.205  306.155 164.279 1.00 27.51  ? 209  ILE B CG2 1 
ATOM   5699  C  CD1 . ILE B  2  209 ? 55.558  307.894 167.330 1.00 32.57  ? 209  ILE B CD1 1 
ATOM   5700  N  N   . VAL B  2  210 ? 52.289  306.313 162.737 1.00 30.09  ? 210  VAL B N   1 
ATOM   5701  C  CA  . VAL B  2  210 ? 51.607  305.203 162.058 1.00 29.48  ? 210  VAL B CA  1 
ATOM   5702  C  C   . VAL B  2  210 ? 52.557  304.691 160.952 1.00 30.68  ? 210  VAL B C   1 
ATOM   5703  O  O   . VAL B  2  210 ? 52.957  305.457 160.047 1.00 30.07  ? 210  VAL B O   1 
ATOM   5704  C  CB  . VAL B  2  210 ? 50.253  305.559 161.372 1.00 30.76  ? 210  VAL B CB  1 
ATOM   5705  C  CG1 . VAL B  2  210 ? 49.654  304.275 160.732 1.00 28.54  ? 210  VAL B CG1 1 
ATOM   5706  C  CG2 . VAL B  2  210 ? 49.301  306.207 162.388 1.00 27.12  ? 210  VAL B CG2 1 
ATOM   5707  N  N   . LEU B  2  211 ? 52.988  303.465 161.113 1.00 31.06  ? 211  LEU B N   1 
ATOM   5708  C  CA  . LEU B  2  211 ? 53.879  302.829 160.104 1.00 32.88  ? 211  LEU B CA  1 
ATOM   5709  C  C   . LEU B  2  211 ? 52.999  302.043 159.162 1.00 33.24  ? 211  LEU B C   1 
ATOM   5710  O  O   . LEU B  2  211 ? 52.061  301.333 159.622 1.00 32.45  ? 211  LEU B O   1 
ATOM   5711  C  CB  . LEU B  2  211 ? 54.871  301.856 160.793 1.00 31.69  ? 211  LEU B CB  1 
ATOM   5712  C  CG  . LEU B  2  211 ? 55.708  302.360 161.986 1.00 32.71  ? 211  LEU B CG  1 
ATOM   5713  C  CD1 . LEU B  2  211 ? 56.764  301.304 162.213 1.00 30.09  ? 211  LEU B CD1 1 
ATOM   5714  C  CD2 . LEU B  2  211 ? 56.485  303.672 161.670 1.00 22.00  ? 211  LEU B CD2 1 
ATOM   5715  N  N   . GLU B  2  212 ? 53.300  302.164 157.866 1.00 33.31  ? 212  GLU B N   1 
ATOM   5716  C  CA  . GLU B  2  212 ? 52.560  301.346 156.835 1.00 30.16  ? 212  GLU B CA  1 
ATOM   5717  C  C   . GLU B  2  212 ? 53.533  300.395 156.141 1.00 30.02  ? 212  GLU B C   1 
ATOM   5718  O  O   . GLU B  2  212 ? 54.416  300.821 155.445 1.00 30.07  ? 212  GLU B O   1 
ATOM   5719  C  CB  . GLU B  2  212 ? 51.718  302.228 155.866 1.00 30.80  ? 212  GLU B CB  1 
ATOM   5720  C  CG  . GLU B  2  212 ? 51.107  301.453 154.707 1.00 27.08  ? 212  GLU B CG  1 
ATOM   5721  C  CD  . GLU B  2  212 ? 50.144  302.296 153.890 1.00 37.47  ? 212  GLU B CD  1 
ATOM   5722  O  OE1 . GLU B  2  212 ? 49.096  302.808 154.459 1.00 30.42  ? 212  GLU B OE1 1 
ATOM   5723  O  OE2 . GLU B  2  212 ? 50.485  302.420 152.698 1.00 34.85  ? 212  GLU B OE2 1 
ATOM   5724  N  N   . LEU B  2  213 ? 53.438  299.087 156.420 1.00 30.09  ? 213  LEU B N   1 
ATOM   5725  C  CA  . LEU B  2  213 ? 54.435  298.123 155.963 1.00 29.89  ? 213  LEU B CA  1 
ATOM   5726  C  C   . LEU B  2  213 ? 53.883  297.417 154.715 1.00 29.57  ? 213  LEU B C   1 
ATOM   5727  O  O   . LEU B  2  213 ? 52.796  296.806 154.766 1.00 30.10  ? 213  LEU B O   1 
ATOM   5728  C  CB  . LEU B  2  213 ? 54.736  297.017 157.050 1.00 30.92  ? 213  LEU B CB  1 
ATOM   5729  C  CG  . LEU B  2  213 ? 55.805  297.447 158.072 1.00 33.19  ? 213  LEU B CG  1 
ATOM   5730  C  CD1 . LEU B  2  213 ? 57.209  297.519 157.479 1.00 27.44  ? 213  LEU B CD1 1 
ATOM   5731  C  CD2 . LEU B  2  213 ? 55.439  298.846 158.735 1.00 27.33  ? 213  LEU B CD2 1 
ATOM   5732  N  N   . VAL B  2  214 ? 54.610  297.533 153.621 1.00 31.37  ? 214  VAL B N   1 
ATOM   5733  C  CA  . VAL B  2  214 ? 54.123  296.937 152.297 1.00 31.04  ? 214  VAL B CA  1 
ATOM   5734  C  C   . VAL B  2  214 ? 55.338  296.324 151.577 1.00 32.10  ? 214  VAL B C   1 
ATOM   5735  O  O   . VAL B  2  214 ? 56.516  296.548 152.030 1.00 33.63  ? 214  VAL B O   1 
ATOM   5736  C  CB  . VAL B  2  214 ? 53.474  298.058 151.438 1.00 29.73  ? 214  VAL B CB  1 
ATOM   5737  C  CG1 . VAL B  2  214 ? 52.138  298.524 152.100 1.00 31.53  ? 214  VAL B CG1 1 
ATOM   5738  C  CG2 . VAL B  2  214 ? 54.522  299.199 151.046 1.00 24.06  ? 214  VAL B CG2 1 
ATOM   5739  N  N   . PRO B  2  215 ? 55.098  295.551 150.454 1.00 33.03  ? 215  PRO B N   1 
ATOM   5740  C  CA  . PRO B  2  215 ? 56.143  294.958 149.650 1.00 32.17  ? 215  PRO B CA  1 
ATOM   5741  C  C   . PRO B  2  215 ? 57.037  296.048 149.121 1.00 31.91  ? 215  PRO B C   1 
ATOM   5742  O  O   . PRO B  2  215 ? 56.580  297.198 148.853 1.00 31.79  ? 215  PRO B O   1 
ATOM   5743  C  CB  . PRO B  2  215 ? 55.360  294.282 148.503 1.00 34.11  ? 215  PRO B CB  1 
ATOM   5744  C  CG  . PRO B  2  215 ? 54.084  293.794 149.221 1.00 34.05  ? 215  PRO B CG  1 
ATOM   5745  C  CD  . PRO B  2  215 ? 53.767  295.117 149.984 1.00 32.45  ? 215  PRO B CD  1 
ATOM   5746  N  N   . LEU B  2  216 ? 58.325  295.725 149.041 1.00 32.16  ? 216  LEU B N   1 
ATOM   5747  C  CA  . LEU B  2  216 ? 59.263  296.657 148.468 1.00 32.63  ? 216  LEU B CA  1 
ATOM   5748  C  C   . LEU B  2  216 ? 58.752  297.442 147.193 1.00 36.02  ? 216  LEU B C   1 
ATOM   5749  O  O   . LEU B  2  216 ? 58.924  298.701 147.057 1.00 35.22  ? 216  LEU B O   1 
ATOM   5750  C  CB  . LEU B  2  216 ? 60.570  295.931 148.201 1.00 34.44  ? 216  LEU B CB  1 
ATOM   5751  C  CG  . LEU B  2  216 ? 61.675  296.799 147.593 1.00 34.59  ? 216  LEU B CG  1 
ATOM   5752  C  CD1 . LEU B  2  216 ? 62.120  297.912 148.595 1.00 34.96  ? 216  LEU B CD1 1 
ATOM   5753  C  CD2 . LEU B  2  216 ? 62.852  295.956 147.108 1.00 41.50  ? 216  LEU B CD2 1 
ATOM   5754  N  N   . LYS B  2  217 ? 58.104  296.751 146.231 1.00 38.55  ? 217  LYS B N   1 
ATOM   5755  C  CA  . LYS B  2  217 ? 57.823  297.425 144.963 1.00 37.72  ? 217  LYS B CA  1 
ATOM   5756  C  C   . LYS B  2  217 ? 56.797  298.458 145.195 1.00 36.91  ? 217  LYS B C   1 
ATOM   5757  O  O   . LYS B  2  217 ? 56.793  299.478 144.475 1.00 35.18  ? 217  LYS B O   1 
ATOM   5758  C  CB  . LYS B  2  217 ? 57.216  296.486 143.912 1.00 40.28  ? 217  LYS B CB  1 
ATOM   5759  C  CG  . LYS B  2  217 ? 58.081  295.249 143.607 1.00 47.04  ? 217  LYS B CG  1 
ATOM   5760  C  CD  . LYS B  2  217 ? 59.279  295.566 142.744 1.00 55.28  ? 217  LYS B CD  1 
ATOM   5761  C  CE  . LYS B  2  217 ? 58.958  295.209 141.271 1.00 59.51  ? 217  LYS B CE  1 
ATOM   5762  N  NZ  . LYS B  2  217 ? 59.738  296.183 140.415 1.00 63.17  ? 217  LYS B NZ  1 
ATOM   5763  N  N   . TYR B  2  218 ? 55.872  298.190 146.128 1.00 34.67  ? 218  TYR B N   1 
ATOM   5764  C  CA  . TYR B  2  218 ? 54.913  299.267 146.437 1.00 33.61  ? 218  TYR B CA  1 
ATOM   5765  C  C   . TYR B  2  218 ? 55.549  300.451 147.189 1.00 31.50  ? 218  TYR B C   1 
ATOM   5766  O  O   . TYR B  2  218 ? 55.190  301.556 146.938 1.00 31.94  ? 218  TYR B O   1 
ATOM   5767  C  CB  . TYR B  2  218 ? 53.759  298.737 147.220 1.00 34.27  ? 218  TYR B CB  1 
ATOM   5768  C  CG  . TYR B  2  218 ? 52.744  297.918 146.419 1.00 35.92  ? 218  TYR B CG  1 
ATOM   5769  C  CD1 . TYR B  2  218 ? 51.554  298.493 145.965 1.00 36.94  ? 218  TYR B CD1 1 
ATOM   5770  C  CD2 . TYR B  2  218 ? 52.949  296.559 146.171 1.00 35.48  ? 218  TYR B CD2 1 
ATOM   5771  C  CE1 . TYR B  2  218 ? 50.585  297.724 145.251 1.00 38.42  ? 218  TYR B CE1 1 
ATOM   5772  C  CE2 . TYR B  2  218 ? 51.994  295.768 145.461 1.00 32.97  ? 218  TYR B CE2 1 
ATOM   5773  C  CZ  . TYR B  2  218 ? 50.820  296.374 145.048 1.00 37.73  ? 218  TYR B CZ  1 
ATOM   5774  O  OH  . TYR B  2  218 ? 49.882  295.664 144.382 1.00 41.08  ? 218  TYR B OH  1 
ATOM   5775  N  N   . PHE B  2  219 ? 56.524  300.204 148.108 1.00 31.38  ? 219  PHE B N   1 
ATOM   5776  C  CA  . PHE B  2  219 ? 57.242  301.252 148.776 1.00 29.79  ? 219  PHE B CA  1 
ATOM   5777  C  C   . PHE B  2  219 ? 57.998  302.115 147.752 1.00 30.56  ? 219  PHE B C   1 
ATOM   5778  O  O   . PHE B  2  219 ? 58.114  303.376 147.853 1.00 28.17  ? 219  PHE B O   1 
ATOM   5779  C  CB  . PHE B  2  219 ? 58.311  300.626 149.718 1.00 28.50  ? 219  PHE B CB  1 
ATOM   5780  C  CG  . PHE B  2  219 ? 59.303  301.641 150.229 1.00 30.47  ? 219  PHE B CG  1 
ATOM   5781  C  CD1 . PHE B  2  219 ? 58.886  302.613 151.167 1.00 27.59  ? 219  PHE B CD1 1 
ATOM   5782  C  CD2 . PHE B  2  219 ? 60.644  301.567 149.882 1.00 30.52  ? 219  PHE B CD2 1 
ATOM   5783  C  CE1 . PHE B  2  219 ? 59.767  303.518 151.645 1.00 28.67  ? 219  PHE B CE1 1 
ATOM   5784  C  CE2 . PHE B  2  219 ? 61.554  302.489 150.343 1.00 26.51  ? 219  PHE B CE2 1 
ATOM   5785  C  CZ  . PHE B  2  219 ? 61.122  303.478 151.270 1.00 27.32  ? 219  PHE B CZ  1 
ATOM   5786  N  N   . GLU B  2  220 ? 58.569  301.457 146.749 1.00 31.70  ? 220  GLU B N   1 
ATOM   5787  C  CA  . GLU B  2  220 ? 59.361  302.280 145.795 1.00 33.05  ? 220  GLU B CA  1 
ATOM   5788  C  C   . GLU B  2  220 ? 58.468  303.203 144.946 1.00 32.29  ? 220  GLU B C   1 
ATOM   5789  O  O   . GLU B  2  220 ? 58.774  304.393 144.704 1.00 33.94  ? 220  GLU B O   1 
ATOM   5790  C  CB  . GLU B  2  220 ? 60.248  301.391 144.862 1.00 34.09  ? 220  GLU B CB  1 
ATOM   5791  C  CG  . GLU B  2  220 ? 61.237  300.462 145.503 1.00 37.69  ? 220  GLU B CG  1 
ATOM   5792  C  CD  . GLU B  2  220 ? 61.656  299.328 144.512 1.00 41.53  ? 220  GLU B CD  1 
ATOM   5793  O  OE1 . GLU B  2  220 ? 62.774  298.886 144.586 1.00 44.40  ? 220  GLU B OE1 1 
ATOM   5794  O  OE2 . GLU B  2  220 ? 60.877  298.866 143.646 1.00 44.06  ? 220  GLU B OE2 1 
ATOM   5795  N  N   . LYS B  2  221 ? 57.330  302.699 144.544 1.00 31.26  ? 221  LYS B N   1 
ATOM   5796  C  CA  . LYS B  2  221 ? 56.427  303.604 143.787 1.00 30.93  ? 221  LYS B CA  1 
ATOM   5797  C  C   . LYS B  2  221 ? 55.781  304.657 144.633 1.00 31.38  ? 221  LYS B C   1 
ATOM   5798  O  O   . LYS B  2  221 ? 55.615  305.810 144.172 1.00 30.75  ? 221  LYS B O   1 
ATOM   5799  C  CB  . LYS B  2  221 ? 55.358  302.810 143.122 1.00 29.26  ? 221  LYS B CB  1 
ATOM   5800  C  CG  . LYS B  2  221 ? 55.961  301.994 141.935 1.00 28.14  ? 221  LYS B CG  1 
ATOM   5801  C  CD  . LYS B  2  221 ? 54.885  300.983 141.491 1.00 36.26  ? 221  LYS B CD  1 
ATOM   5802  C  CE  . LYS B  2  221 ? 55.151  300.550 140.098 1.00 46.70  ? 221  LYS B CE  1 
ATOM   5803  N  NZ  . LYS B  2  221 ? 55.875  299.259 139.965 1.00 45.34  ? 221  LYS B NZ  1 
ATOM   5804  N  N   . TRP B  2  222 ? 55.446  304.288 145.885 1.00 30.22  ? 222  TRP B N   1 
ATOM   5805  C  CA  . TRP B  2  222 ? 54.982  305.283 146.815 1.00 29.97  ? 222  TRP B CA  1 
ATOM   5806  C  C   . TRP B  2  222 ? 56.022  306.381 147.007 1.00 29.17  ? 222  TRP B C   1 
ATOM   5807  O  O   . TRP B  2  222 ? 55.723  307.624 146.950 1.00 29.51  ? 222  TRP B O   1 
ATOM   5808  C  CB  . TRP B  2  222 ? 54.680  304.587 148.146 1.00 31.10  ? 222  TRP B CB  1 
ATOM   5809  C  CG  . TRP B  2  222 ? 54.418  305.626 149.234 1.00 30.94  ? 222  TRP B CG  1 
ATOM   5810  C  CD1 . TRP B  2  222 ? 53.182  306.286 149.519 1.00 28.62  ? 222  TRP B CD1 1 
ATOM   5811  C  CD2 . TRP B  2  222 ? 55.369  306.117 150.156 1.00 28.99  ? 222  TRP B CD2 1 
ATOM   5812  N  NE1 . TRP B  2  222 ? 53.364  307.148 150.609 1.00 31.42  ? 222  TRP B NE1 1 
ATOM   5813  C  CE2 . TRP B  2  222 ? 54.704  307.086 150.993 1.00 34.30  ? 222  TRP B CE2 1 
ATOM   5814  C  CE3 . TRP B  2  222 ? 56.744  305.852 150.374 1.00 29.45  ? 222  TRP B CE3 1 
ATOM   5815  C  CZ2 . TRP B  2  222 ? 55.391  307.753 152.085 1.00 30.72  ? 222  TRP B CZ2 1 
ATOM   5816  C  CZ3 . TRP B  2  222 ? 57.393  306.503 151.404 1.00 28.17  ? 222  TRP B CZ3 1 
ATOM   5817  C  CH2 . TRP B  2  222 ? 56.729  307.459 152.249 1.00 31.08  ? 222  TRP B CH2 1 
ATOM   5818  N  N   . SER B  2  223 ? 57.314  305.968 147.137 1.00 29.88  ? 223  SER B N   1 
ATOM   5819  C  CA  . SER B  2  223 ? 58.375  306.975 147.302 1.00 29.67  ? 223  SER B CA  1 
ATOM   5820  C  C   . SER B  2  223 ? 58.463  307.924 146.147 1.00 30.77  ? 223  SER B C   1 
ATOM   5821  O  O   . SER B  2  223 ? 58.615  309.187 146.302 1.00 31.49  ? 223  SER B O   1 
ATOM   5822  C  CB  . SER B  2  223 ? 59.781  306.241 147.413 1.00 28.52  ? 223  SER B CB  1 
ATOM   5823  O  OG  . SER B  2  223 ? 59.765  305.574 148.664 1.00 35.06  ? 223  SER B OG  1 
ATOM   5824  N  N   . ALA B  2  224 ? 58.466  307.338 144.945 1.00 30.39  ? 224  ALA B N   1 
ATOM   5825  C  CA  . ALA B  2  224 ? 58.574  308.166 143.712 1.00 30.40  ? 224  ALA B CA  1 
ATOM   5826  C  C   . ALA B  2  224 ? 57.460  309.185 143.641 1.00 30.16  ? 224  ALA B C   1 
ATOM   5827  O  O   . ALA B  2  224 ? 57.696  310.363 143.311 1.00 29.92  ? 224  ALA B O   1 
ATOM   5828  C  CB  . ALA B  2  224 ? 58.493  307.154 142.473 1.00 30.90  ? 224  ALA B CB  1 
ATOM   5829  N  N   . SER B  2  225 ? 56.244  308.748 144.004 1.00 31.04  ? 225  SER B N   1 
ATOM   5830  C  CA  . SER B  2  225 ? 55.044  309.594 143.903 1.00 32.77  ? 225  SER B CA  1 
ATOM   5831  C  C   . SER B  2  225 ? 54.958  310.695 144.987 1.00 34.16  ? 225  SER B C   1 
ATOM   5832  O  O   . SER B  2  225 ? 54.067  311.529 144.906 1.00 34.26  ? 225  SER B O   1 
ATOM   5833  C  CB  . SER B  2  225 ? 53.754  308.735 144.033 1.00 29.84  ? 225  SER B CB  1 
ATOM   5834  O  OG  . SER B  2  225 ? 53.578  308.435 145.418 1.00 33.31  ? 225  SER B OG  1 
ATOM   5835  N  N   . MET B  2  226 ? 55.848  310.641 146.016 1.00 35.74  ? 226  MET B N   1 
ATOM   5836  C  CA  . MET B  2  226 ? 55.830  311.545 147.185 1.00 36.26  ? 226  MET B CA  1 
ATOM   5837  C  C   . MET B  2  226 ? 56.865  312.637 146.989 1.00 39.48  ? 226  MET B C   1 
ATOM   5838  O  O   . MET B  2  226 ? 56.926  313.547 147.811 1.00 39.59  ? 226  MET B O   1 
ATOM   5839  C  CB  . MET B  2  226 ? 56.178  310.823 148.491 1.00 35.60  ? 226  MET B CB  1 
ATOM   5840  C  CG  . MET B  2  226 ? 55.047  310.044 149.046 1.00 34.25  ? 226  MET B CG  1 
ATOM   5841  S  SD  . MET B  2  226 ? 53.693  311.046 149.600 1.00 37.80  ? 226  MET B SD  1 
ATOM   5842  C  CE  . MET B  2  226 ? 54.236  311.546 151.299 1.00 34.17  ? 226  MET B CE  1 
ATOM   5843  N  N   . LEU B  2  227 ? 57.634  312.558 145.896 1.00 38.58  ? 227  LEU B N   1 
ATOM   5844  C  CA  . LEU B  2  227 ? 58.703  313.504 145.644 1.00 39.47  ? 227  LEU B CA  1 
ATOM   5845  C  C   . LEU B  2  227 ? 58.089  314.870 145.293 1.00 41.09  ? 227  LEU B C   1 
ATOM   5846  O  O   . LEU B  2  227 ? 58.825  315.865 145.231 1.00 41.11  ? 227  LEU B O   1 
ATOM   5847  C  CB  . LEU B  2  227 ? 59.598  313.026 144.513 1.00 40.53  ? 227  LEU B CB  1 
ATOM   5848  C  CG  . LEU B  2  227 ? 60.517  311.809 144.676 1.00 41.66  ? 227  LEU B CG  1 
ATOM   5849  C  CD1 . LEU B  2  227 ? 61.438  311.768 143.418 1.00 37.40  ? 227  LEU B CD1 1 
ATOM   5850  C  CD2 . LEU B  2  227 ? 61.298  311.935 145.980 1.00 41.99  ? 227  LEU B CD2 1 
ATOM   5851  O  OXT . LEU B  2  227 ? 56.841  315.043 145.110 1.00 38.58  ? 227  LEU B OXT 1 
ATOM   5852  N  N   . HIS C  3  3   ? 66.481  322.400 236.027 1.00 53.93  ? 3    HIS C N   1 
ATOM   5853  C  CA  . HIS C  3  3   ? 67.967  322.392 235.774 1.00 54.29  ? 3    HIS C CA  1 
ATOM   5854  C  C   . HIS C  3  3   ? 68.449  321.009 235.175 1.00 50.87  ? 3    HIS C C   1 
ATOM   5855  O  O   . HIS C  3  3   ? 68.028  319.947 235.593 1.00 51.25  ? 3    HIS C O   1 
ATOM   5856  C  CB  . HIS C  3  3   ? 68.803  322.887 237.013 1.00 56.03  ? 3    HIS C CB  1 
ATOM   5857  C  CG  . HIS C  3  3   ? 70.299  322.826 236.794 1.00 65.26  ? 3    HIS C CG  1 
ATOM   5858  N  ND1 . HIS C  3  3   ? 71.161  322.174 237.658 1.00 72.93  ? 3    HIS C ND1 1 
ATOM   5859  C  CD2 . HIS C  3  3   ? 71.066  323.227 235.736 1.00 70.47  ? 3    HIS C CD2 1 
ATOM   5860  C  CE1 . HIS C  3  3   ? 72.396  322.219 237.164 1.00 75.90  ? 3    HIS C CE1 1 
ATOM   5861  N  NE2 . HIS C  3  3   ? 72.363  322.840 235.992 1.00 72.42  ? 3    HIS C NE2 1 
ATOM   5862  N  N   . GLN C  3  4   ? 69.315  321.059 234.180 1.00 44.52  ? 4    GLN C N   1 
ATOM   5863  C  CA  . GLN C  3  4   ? 69.648  319.917 233.401 1.00 38.37  ? 4    GLN C CA  1 
ATOM   5864  C  C   . GLN C  3  4   ? 70.872  319.339 234.012 1.00 36.80  ? 4    GLN C C   1 
ATOM   5865  O  O   . GLN C  3  4   ? 71.660  320.063 234.682 1.00 33.57  ? 4    GLN C O   1 
ATOM   5866  C  CB  . GLN C  3  4   ? 69.912  320.391 231.938 1.00 38.74  ? 4    GLN C CB  1 
ATOM   5867  C  CG  . GLN C  3  4   ? 71.135  321.243 231.807 1.00 34.97  ? 4    GLN C CG  1 
ATOM   5868  C  CD  . GLN C  3  4   ? 71.439  321.803 230.418 1.00 34.30  ? 4    GLN C CD  1 
ATOM   5869  O  OE1 . GLN C  3  4   ? 70.669  322.572 229.869 1.00 32.52  ? 4    GLN C OE1 1 
ATOM   5870  N  NE2 . GLN C  3  4   ? 72.666  321.493 229.904 1.00 30.09  ? 4    GLN C NE2 1 
ATOM   5871  N  N   . THR C  3  5   ? 71.025  318.042 233.858 1.00 34.31  ? 5    THR C N   1 
ATOM   5872  C  CA  . THR C  3  5   ? 72.282  317.366 234.139 1.00 34.94  ? 5    THR C CA  1 
ATOM   5873  C  C   . THR C  3  5   ? 72.888  316.623 232.940 1.00 33.45  ? 5    THR C C   1 
ATOM   5874  O  O   . THR C  3  5   ? 73.671  315.636 233.056 1.00 32.79  ? 5    THR C O   1 
ATOM   5875  C  CB  . THR C  3  5   ? 72.142  316.437 235.345 1.00 37.74  ? 5    THR C CB  1 
ATOM   5876  O  OG1 . THR C  3  5   ? 71.132  315.472 235.076 1.00 36.74  ? 5    THR C OG1 1 
ATOM   5877  C  CG2 . THR C  3  5   ? 71.758  317.254 236.645 1.00 35.27  ? 5    THR C CG2 1 
ATOM   5878  N  N   . HIS C  3  6   ? 72.589  317.128 231.764 1.00 30.01  ? 6    HIS C N   1 
ATOM   5879  C  CA  . HIS C  3  6   ? 73.407  316.759 230.583 1.00 30.14  ? 6    HIS C CA  1 
ATOM   5880  C  C   . HIS C  3  6   ? 74.240  318.055 230.169 1.00 30.42  ? 6    HIS C C   1 
ATOM   5881  O  O   . HIS C  3  6   ? 73.983  319.130 230.709 1.00 31.51  ? 6    HIS C O   1 
ATOM   5882  C  CB  . HIS C  3  6   ? 72.476  316.291 229.457 1.00 27.27  ? 6    HIS C CB  1 
ATOM   5883  C  CG  . HIS C  3  6   ? 71.506  317.360 229.059 1.00 24.83  ? 6    HIS C CG  1 
ATOM   5884  N  ND1 . HIS C  3  6   ? 71.935  318.486 228.385 1.00 25.95  ? 6    HIS C ND1 1 
ATOM   5885  C  CD2 . HIS C  3  6   ? 70.164  317.517 229.243 1.00 24.59  ? 6    HIS C CD2 1 
ATOM   5886  C  CE1 . HIS C  3  6   ? 70.898  319.326 228.202 1.00 27.54  ? 6    HIS C CE1 1 
ATOM   5887  N  NE2 . HIS C  3  6   ? 69.809  318.758 228.694 1.00 25.42  ? 6    HIS C NE2 1 
ATOM   5888  N  N   . ALA C  3  7   ? 75.186  317.938 229.224 1.00 29.79  ? 7    ALA C N   1 
ATOM   5889  C  CA  . ALA C  3  7   ? 75.962  319.068 228.774 1.00 30.03  ? 7    ALA C CA  1 
ATOM   5890  C  C   . ALA C  3  7   ? 75.522  319.779 227.505 1.00 30.10  ? 7    ALA C C   1 
ATOM   5891  O  O   . ALA C  3  7   ? 76.274  320.672 226.967 1.00 31.79  ? 7    ALA C O   1 
ATOM   5892  C  CB  . ALA C  3  7   ? 77.517  318.703 228.687 1.00 30.24  ? 7    ALA C CB  1 
ATOM   5893  N  N   . TYR C  3  8   ? 74.296  319.508 227.053 1.00 29.86  ? 8    TYR C N   1 
ATOM   5894  C  CA  . TYR C  3  8   ? 73.888  320.033 225.735 1.00 29.74  ? 8    TYR C CA  1 
ATOM   5895  C  C   . TYR C  3  8   ? 73.238  321.306 225.862 1.00 31.42  ? 8    TYR C C   1 
ATOM   5896  O  O   . TYR C  3  8   ? 72.807  321.653 226.966 1.00 33.48  ? 8    TYR C O   1 
ATOM   5897  C  CB  . TYR C  3  8   ? 73.045  319.066 224.956 1.00 28.99  ? 8    TYR C CB  1 
ATOM   5898  C  CG  . TYR C  3  8   ? 73.794  317.866 224.673 1.00 30.56  ? 8    TYR C CG  1 
ATOM   5899  C  CD1 . TYR C  3  8   ? 74.806  317.830 223.659 1.00 31.96  ? 8    TYR C CD1 1 
ATOM   5900  C  CD2 . TYR C  3  8   ? 73.574  316.725 225.482 1.00 33.34  ? 8    TYR C CD2 1 
ATOM   5901  C  CE1 . TYR C  3  8   ? 75.508  316.633 223.433 1.00 31.14  ? 8    TYR C CE1 1 
ATOM   5902  C  CE2 . TYR C  3  8   ? 74.273  315.575 225.269 1.00 34.26  ? 8    TYR C CE2 1 
ATOM   5903  C  CZ  . TYR C  3  8   ? 75.213  315.526 224.245 1.00 35.09  ? 8    TYR C CZ  1 
ATOM   5904  O  OH  . TYR C  3  8   ? 75.843  314.318 224.097 1.00 39.61  ? 8    TYR C OH  1 
ATOM   5905  N  N   . HIS C  3  9   ? 73.200  322.057 224.758 1.00 32.21  ? 9    HIS C N   1 
ATOM   5906  C  CA  . HIS C  3  9   ? 72.662  323.441 224.811 1.00 30.72  ? 9    HIS C CA  1 
ATOM   5907  C  C   . HIS C  3  9   ? 71.161  323.572 224.401 1.00 32.42  ? 9    HIS C C   1 
ATOM   5908  O  O   . HIS C  3  9   ? 70.786  323.346 223.188 1.00 30.31  ? 9    HIS C O   1 
ATOM   5909  C  CB  . HIS C  3  9   ? 73.535  324.332 223.914 1.00 30.55  ? 9    HIS C CB  1 
ATOM   5910  C  CG  . HIS C  3  9   ? 73.142  325.777 223.939 1.00 31.95  ? 9    HIS C CG  1 
ATOM   5911  N  ND1 . HIS C  3  9   ? 73.511  326.661 222.944 1.00 29.87  ? 9    HIS C ND1 1 
ATOM   5912  C  CD2 . HIS C  3  9   ? 72.573  326.534 224.918 1.00 29.24  ? 9    HIS C CD2 1 
ATOM   5913  C  CE1 . HIS C  3  9   ? 73.055  327.874 223.227 1.00 32.52  ? 9    HIS C CE1 1 
ATOM   5914  N  NE2 . HIS C  3  9   ? 72.501  327.829 224.436 1.00 33.67  ? 9    HIS C NE2 1 
ATOM   5915  N  N   . MET C  3  10  ? 70.287  323.983 225.354 1.00 31.50  ? 10   MET C N   1 
ATOM   5916  C  CA  . MET C  3  10  ? 68.870  324.320 225.028 1.00 33.17  ? 10   MET C CA  1 
ATOM   5917  C  C   . MET C  3  10  ? 68.867  325.805 224.682 1.00 34.59  ? 10   MET C C   1 
ATOM   5918  O  O   . MET C  3  10  ? 69.343  326.639 225.491 1.00 34.04  ? 10   MET C O   1 
ATOM   5919  C  CB  . MET C  3  10  ? 67.901  323.989 226.181 1.00 33.06  ? 10   MET C CB  1 
ATOM   5920  C  CG  . MET C  3  10  ? 67.951  322.570 226.725 1.00 35.89  ? 10   MET C CG  1 
ATOM   5921  S  SD  . MET C  3  10  ? 67.321  321.392 225.470 1.00 36.17  ? 10   MET C SD  1 
ATOM   5922  C  CE  . MET C  3  10  ? 68.882  320.866 224.729 1.00 38.66  ? 10   MET C CE  1 
ATOM   5923  N  N   . VAL C  3  11  ? 68.428  326.149 223.449 1.00 34.08  ? 11   VAL C N   1 
ATOM   5924  C  CA  . VAL C  3  11  ? 68.611  327.543 222.902 1.00 30.76  ? 11   VAL C CA  1 
ATOM   5925  C  C   . VAL C  3  11  ? 67.329  328.311 223.239 1.00 31.32  ? 11   VAL C C   1 
ATOM   5926  O  O   . VAL C  3  11  ? 66.175  327.717 223.228 1.00 29.57  ? 11   VAL C O   1 
ATOM   5927  C  CB  . VAL C  3  11  ? 68.885  327.430 221.348 1.00 33.32  ? 11   VAL C CB  1 
ATOM   5928  C  CG1 . VAL C  3  11  ? 69.058  328.775 220.671 1.00 28.28  ? 11   VAL C CG1 1 
ATOM   5929  C  CG2 . VAL C  3  11  ? 70.213  326.624 221.162 1.00 27.43  ? 11   VAL C CG2 1 
ATOM   5930  N  N   . ASN C  3  12  ? 67.508  329.597 223.585 1.00 31.09  ? 12   ASN C N   1 
ATOM   5931  C  CA  . ASN C  3  12  ? 66.362  330.449 223.875 1.00 34.10  ? 12   ASN C CA  1 
ATOM   5932  C  C   . ASN C  3  12  ? 65.518  330.551 222.585 1.00 33.68  ? 12   ASN C C   1 
ATOM   5933  O  O   . ASN C  3  12  ? 66.092  330.729 221.489 1.00 35.18  ? 12   ASN C O   1 
ATOM   5934  C  CB  . ASN C  3  12  ? 66.742  331.910 224.310 1.00 32.64  ? 12   ASN C CB  1 
ATOM   5935  C  CG  . ASN C  3  12  ? 67.666  332.004 225.558 1.00 30.29  ? 12   ASN C CG  1 
ATOM   5936  O  OD1 . ASN C  3  12  ? 68.247  333.034 225.774 1.00 32.44  ? 12   ASN C OD1 1 
ATOM   5937  N  ND2 . ASN C  3  12  ? 67.753  330.969 226.380 1.00 27.97  ? 12   ASN C ND2 1 
ATOM   5938  N  N   . PRO C  3  13  ? 64.170  330.544 222.714 1.00 33.16  ? 13   PRO C N   1 
ATOM   5939  C  CA  . PRO C  3  13  ? 63.338  330.774 221.554 1.00 31.58  ? 13   PRO C CA  1 
ATOM   5940  C  C   . PRO C  3  13  ? 63.862  331.989 220.747 1.00 31.85  ? 13   PRO C C   1 
ATOM   5941  O  O   . PRO C  3  13  ? 64.232  333.047 221.330 1.00 31.57  ? 13   PRO C O   1 
ATOM   5942  C  CB  . PRO C  3  13  ? 61.891  330.986 222.151 1.00 29.20  ? 13   PRO C CB  1 
ATOM   5943  C  CG  . PRO C  3  13  ? 61.871  330.238 223.399 1.00 28.67  ? 13   PRO C CG  1 
ATOM   5944  C  CD  . PRO C  3  13  ? 63.359  330.397 223.958 1.00 35.03  ? 13   PRO C CD  1 
ATOM   5945  N  N   . SER C  3  14  ? 63.918  331.857 219.400 1.00 29.59  ? 14   SER C N   1 
ATOM   5946  C  CA  . SER C  3  14  ? 64.608  332.800 218.575 1.00 29.15  ? 14   SER C CA  1 
ATOM   5947  C  C   . SER C  3  14  ? 63.824  333.174 217.373 1.00 28.30  ? 14   SER C C   1 
ATOM   5948  O  O   . SER C  3  14  ? 63.182  332.320 216.806 1.00 30.52  ? 14   SER C O   1 
ATOM   5949  C  CB  . SER C  3  14  ? 65.955  332.180 218.126 1.00 30.35  ? 14   SER C CB  1 
ATOM   5950  O  OG  . SER C  3  14  ? 66.650  333.080 217.250 1.00 31.98  ? 14   SER C OG  1 
ATOM   5951  N  N   . PRO C  3  15  ? 63.822  334.467 216.976 1.00 29.58  ? 15   PRO C N   1 
ATOM   5952  C  CA  . PRO C  3  15  ? 63.130  334.947 215.753 1.00 28.30  ? 15   PRO C CA  1 
ATOM   5953  C  C   . PRO C  3  15  ? 63.922  334.751 214.441 1.00 29.39  ? 15   PRO C C   1 
ATOM   5954  O  O   . PRO C  3  15  ? 63.313  334.835 213.371 1.00 28.01  ? 15   PRO C O   1 
ATOM   5955  C  CB  . PRO C  3  15  ? 62.919  336.412 216.029 1.00 29.07  ? 15   PRO C CB  1 
ATOM   5956  C  CG  . PRO C  3  15  ? 64.092  336.837 216.836 1.00 31.56  ? 15   PRO C CG  1 
ATOM   5957  C  CD  . PRO C  3  15  ? 64.459  335.584 217.720 1.00 29.83  ? 15   PRO C CD  1 
ATOM   5958  N  N   . TRP C  3  16  ? 65.233  334.419 214.527 1.00 29.26  ? 16   TRP C N   1 
ATOM   5959  C  CA  . TRP C  3  16  ? 66.119  334.374 213.378 1.00 28.85  ? 16   TRP C CA  1 
ATOM   5960  C  C   . TRP C  3  16  ? 65.774  333.269 212.349 1.00 28.65  ? 16   TRP C C   1 
ATOM   5961  O  O   . TRP C  3  16  ? 65.927  333.507 211.160 1.00 29.47  ? 16   TRP C O   1 
ATOM   5962  C  CB  . TRP C  3  16  ? 67.627  334.431 213.774 1.00 28.77  ? 16   TRP C CB  1 
ATOM   5963  C  CG  . TRP C  3  16  ? 67.918  335.523 214.874 1.00 30.28  ? 16   TRP C CG  1 
ATOM   5964  C  CD1 . TRP C  3  16  ? 68.676  335.415 216.017 1.00 29.93  ? 16   TRP C CD1 1 
ATOM   5965  C  CD2 . TRP C  3  16  ? 67.342  336.850 214.883 1.00 30.59  ? 16   TRP C CD2 1 
ATOM   5966  N  NE1 . TRP C  3  16  ? 68.621  336.653 216.745 1.00 30.89  ? 16   TRP C NE1 1 
ATOM   5967  C  CE2 . TRP C  3  16  ? 67.770  337.505 216.072 1.00 30.43  ? 16   TRP C CE2 1 
ATOM   5968  C  CE3 . TRP C  3  16  ? 66.462  337.524 214.008 1.00 29.30  ? 16   TRP C CE3 1 
ATOM   5969  C  CZ2 . TRP C  3  16  ? 67.385  338.824 216.375 1.00 30.10  ? 16   TRP C CZ2 1 
ATOM   5970  C  CZ3 . TRP C  3  16  ? 66.099  338.869 214.316 1.00 31.51  ? 16   TRP C CZ3 1 
ATOM   5971  C  CH2 . TRP C  3  16  ? 66.545  339.471 215.509 1.00 30.30  ? 16   TRP C CH2 1 
ATOM   5972  N  N   . PRO C  3  17  ? 65.372  332.049 212.797 1.00 29.35  ? 17   PRO C N   1 
ATOM   5973  C  CA  . PRO C  3  17  ? 64.866  331.076 211.833 1.00 29.86  ? 17   PRO C CA  1 
ATOM   5974  C  C   . PRO C  3  17  ? 63.766  331.620 210.924 1.00 30.77  ? 17   PRO C C   1 
ATOM   5975  O  O   . PRO C  3  17  ? 63.870  331.465 209.700 1.00 30.29  ? 17   PRO C O   1 
ATOM   5976  C  CB  . PRO C  3  17  ? 64.356  329.911 212.741 1.00 29.16  ? 17   PRO C CB  1 
ATOM   5977  C  CG  . PRO C  3  17  ? 65.426  329.944 213.789 1.00 29.02  ? 17   PRO C CG  1 
ATOM   5978  C  CD  . PRO C  3  17  ? 65.453  331.449 214.135 1.00 24.55  ? 17   PRO C CD  1 
ATOM   5979  N  N   . LEU C  3  18  ? 62.768  332.322 211.493 1.00 31.44  ? 18   LEU C N   1 
ATOM   5980  C  CA  . LEU C  3  18  ? 61.715  332.883 210.679 1.00 30.37  ? 18   LEU C CA  1 
ATOM   5981  C  C   . LEU C  3  18  ? 62.187  334.062 209.847 1.00 30.27  ? 18   LEU C C   1 
ATOM   5982  O  O   . LEU C  3  18  ? 61.912  334.135 208.664 1.00 30.04  ? 18   LEU C O   1 
ATOM   5983  C  CB  . LEU C  3  18  ? 60.489  333.237 211.594 1.00 31.12  ? 18   LEU C CB  1 
ATOM   5984  C  CG  . LEU C  3  18  ? 59.349  333.974 210.842 1.00 33.79  ? 18   LEU C CG  1 
ATOM   5985  C  CD1 . LEU C  3  18  ? 58.711  332.841 209.986 1.00 29.80  ? 18   LEU C CD1 1 
ATOM   5986  C  CD2 . LEU C  3  18  ? 58.324  334.431 211.857 1.00 35.37  ? 18   LEU C CD2 1 
ATOM   5987  N  N   . THR C  3  19  ? 63.011  334.974 210.387 1.00 30.91  ? 19   THR C N   1 
ATOM   5988  C  CA  . THR C  3  19  ? 63.463  336.058 209.542 1.00 30.99  ? 19   THR C CA  1 
ATOM   5989  C  C   . THR C  3  19  ? 64.387  335.475 208.375 1.00 31.95  ? 19   THR C C   1 
ATOM   5990  O  O   . THR C  3  19  ? 64.376  335.962 207.271 1.00 34.74  ? 19   THR C O   1 
ATOM   5991  C  CB  . THR C  3  19  ? 64.186  337.196 210.338 1.00 30.15  ? 19   THR C CB  1 
ATOM   5992  O  OG1 . THR C  3  19  ? 65.432  336.690 210.903 1.00 30.48  ? 19   THR C OG1 1 
ATOM   5993  C  CG2 . THR C  3  19  ? 63.279  337.790 211.420 1.00 26.57  ? 19   THR C CG2 1 
ATOM   5994  N  N   . GLY C  3  20  ? 65.136  334.434 208.651 1.00 29.98  ? 20   GLY C N   1 
ATOM   5995  C  CA  . GLY C  3  20  ? 66.022  333.767 207.639 1.00 30.79  ? 20   GLY C CA  1 
ATOM   5996  C  C   . GLY C  3  20  ? 65.196  333.138 206.539 1.00 30.61  ? 20   GLY C C   1 
ATOM   5997  O  O   . GLY C  3  20  ? 65.491  333.320 205.338 1.00 33.58  ? 20   GLY C O   1 
ATOM   5998  N  N   . ALA C  3  21  ? 64.134  332.460 206.933 1.00 31.33  ? 21   ALA C N   1 
ATOM   5999  C  CA  . ALA C  3  21  ? 63.186  331.852 205.984 1.00 31.44  ? 21   ALA C CA  1 
ATOM   6000  C  C   . ALA C  3  21  ? 62.529  332.932 205.122 1.00 32.64  ? 21   ALA C C   1 
ATOM   6001  O  O   . ALA C  3  21  ? 62.371  332.754 203.903 1.00 32.09  ? 21   ALA C O   1 
ATOM   6002  C  CB  . ALA C  3  21  ? 62.131  331.053 206.709 1.00 30.96  ? 21   ALA C CB  1 
ATOM   6003  N  N   . LEU C  3  22  ? 62.114  334.048 205.720 1.00 31.16  ? 22   LEU C N   1 
ATOM   6004  C  CA  . LEU C  3  22  ? 61.410  335.062 204.938 1.00 30.98  ? 22   LEU C CA  1 
ATOM   6005  C  C   . LEU C  3  22  ? 62.372  335.722 204.024 1.00 31.57  ? 22   LEU C C   1 
ATOM   6006  O  O   . LEU C  3  22  ? 62.033  336.065 202.934 1.00 31.83  ? 22   LEU C O   1 
ATOM   6007  C  CB  . LEU C  3  22  ? 60.647  336.087 205.833 1.00 29.92  ? 22   LEU C CB  1 
ATOM   6008  C  CG  . LEU C  3  22  ? 59.495  335.361 206.592 1.00 31.82  ? 22   LEU C CG  1 
ATOM   6009  C  CD1 . LEU C  3  22  ? 58.740  336.337 207.563 1.00 31.71  ? 22   LEU C CD1 1 
ATOM   6010  C  CD2 . LEU C  3  22  ? 58.351  334.670 205.663 1.00 32.39  ? 22   LEU C CD2 1 
ATOM   6011  N  N   . SER C  3  23  ? 63.607  335.841 204.452 1.00 30.95  ? 23   SER C N   1 
ATOM   6012  C  CA  . SER C  3  23  ? 64.614  336.485 203.641 1.00 32.78  ? 23   SER C CA  1 
ATOM   6013  C  C   . SER C  3  23  ? 64.893  335.648 202.381 1.00 31.81  ? 23   SER C C   1 
ATOM   6014  O  O   . SER C  3  23  ? 65.097  336.176 201.261 1.00 31.49  ? 23   SER C O   1 
ATOM   6015  C  CB  . SER C  3  23  ? 65.827  336.827 204.598 1.00 33.59  ? 23   SER C CB  1 
ATOM   6016  O  OG  . SER C  3  23  ? 66.777  335.815 204.453 1.00 45.66  ? 23   SER C OG  1 
ATOM   6017  N  N   . ALA C  3  24  ? 64.757  334.326 202.523 1.00 30.64  ? 24   ALA C N   1 
ATOM   6018  C  CA  . ALA C  3  24  ? 64.946  333.349 201.367 1.00 29.81  ? 24   ALA C CA  1 
ATOM   6019  C  C   . ALA C  3  24  ? 63.825  333.529 200.424 1.00 28.05  ? 24   ALA C C   1 
ATOM   6020  O  O   . ALA C  3  24  ? 64.037  333.613 199.198 1.00 29.27  ? 24   ALA C O   1 
ATOM   6021  C  CB  . ALA C  3  24  ? 64.977  331.878 201.904 1.00 25.40  ? 24   ALA C CB  1 
ATOM   6022  N  N   . LEU C  3  25  ? 62.612  333.672 200.953 1.00 30.61  ? 25   LEU C N   1 
ATOM   6023  C  CA  . LEU C  3  25  ? 61.421  333.956 200.072 1.00 28.48  ? 25   LEU C CA  1 
ATOM   6024  C  C   . LEU C  3  25  ? 61.572  335.315 199.330 1.00 29.82  ? 25   LEU C C   1 
ATOM   6025  O  O   . LEU C  3  25  ? 61.247  335.416 198.145 1.00 31.56  ? 25   LEU C O   1 
ATOM   6026  C  CB  . LEU C  3  25  ? 60.169  334.060 200.985 1.00 27.28  ? 25   LEU C CB  1 
ATOM   6027  C  CG  . LEU C  3  25  ? 58.888  334.619 200.294 1.00 27.55  ? 25   LEU C CG  1 
ATOM   6028  C  CD1 . LEU C  3  25  ? 58.482  333.536 199.185 1.00 21.55  ? 25   LEU C CD1 1 
ATOM   6029  C  CD2 . LEU C  3  25  ? 57.660  334.679 201.208 1.00 29.09  ? 25   LEU C CD2 1 
ATOM   6030  N  N   . LEU C  3  26  ? 62.018  336.368 200.042 1.00 30.23  ? 26   LEU C N   1 
ATOM   6031  C  CA  . LEU C  3  26  ? 62.269  337.702 199.430 1.00 30.95  ? 26   LEU C CA  1 
ATOM   6032  C  C   . LEU C  3  26  ? 63.370  337.660 198.418 1.00 32.14  ? 26   LEU C C   1 
ATOM   6033  O  O   . LEU C  3  26  ? 63.217  338.321 197.395 1.00 32.54  ? 26   LEU C O   1 
ATOM   6034  C  CB  . LEU C  3  26  ? 62.557  338.791 200.527 1.00 30.93  ? 26   LEU C CB  1 
ATOM   6035  C  CG  . LEU C  3  26  ? 61.376  338.923 201.527 1.00 32.68  ? 26   LEU C CG  1 
ATOM   6036  C  CD1 . LEU C  3  26  ? 61.705  339.903 202.733 1.00 30.34  ? 26   LEU C CD1 1 
ATOM   6037  C  CD2 . LEU C  3  26  ? 60.046  339.185 200.858 1.00 33.47  ? 26   LEU C CD2 1 
ATOM   6038  N  N   . MET C  3  27  ? 64.487  336.942 198.671 1.00 29.91  ? 27   MET C N   1 
ATOM   6039  C  CA  . MET C  3  27  ? 65.547  336.899 197.694 1.00 30.25  ? 27   MET C CA  1 
ATOM   6040  C  C   . MET C  3  27  ? 65.174  336.127 196.446 1.00 30.40  ? 27   MET C C   1 
ATOM   6041  O  O   . MET C  3  27  ? 65.495  336.545 195.335 1.00 28.34  ? 27   MET C O   1 
ATOM   6042  C  CB  . MET C  3  27  ? 66.846  336.261 198.263 1.00 32.25  ? 27   MET C CB  1 
ATOM   6043  C  CG  . MET C  3  27  ? 67.476  337.061 199.395 1.00 32.18  ? 27   MET C CG  1 
ATOM   6044  S  SD  . MET C  3  27  ? 69.110  336.425 199.895 1.00 37.28  ? 27   MET C SD  1 
ATOM   6045  C  CE  . MET C  3  27  ? 68.635  335.015 200.854 1.00 31.45  ? 27   MET C CE  1 
ATOM   6046  N  N   . THR C  3  28  ? 64.465  335.022 196.625 1.00 30.74  ? 28   THR C N   1 
ATOM   6047  C  CA  . THR C  3  28  ? 63.931  334.243 195.459 1.00 31.31  ? 28   THR C CA  1 
ATOM   6048  C  C   . THR C  3  28  ? 62.779  334.898 194.630 1.00 32.01  ? 28   THR C C   1 
ATOM   6049  O  O   . THR C  3  28  ? 62.902  334.881 193.397 1.00 31.51  ? 28   THR C O   1 
ATOM   6050  C  CB  . THR C  3  28  ? 63.551  332.769 195.871 1.00 30.23  ? 28   THR C CB  1 
ATOM   6051  O  OG1 . THR C  3  28  ? 62.584  332.775 196.935 1.00 30.03  ? 28   THR C OG1 1 
ATOM   6052  C  CG2 . THR C  3  28  ? 64.781  331.987 196.405 1.00 28.59  ? 28   THR C CG2 1 
ATOM   6053  N  N   . SER C  3  29  ? 61.652  335.297 195.279 1.00 32.39  ? 29   SER C N   1 
ATOM   6054  C  CA  . SER C  3  29  ? 60.729  336.308 194.761 1.00 36.04  ? 29   SER C CA  1 
ATOM   6055  C  C   . SER C  3  29  ? 61.434  337.447 194.091 1.00 35.51  ? 29   SER C C   1 
ATOM   6056  O  O   . SER C  3  29  ? 61.111  337.852 193.001 1.00 35.28  ? 29   SER C O   1 
ATOM   6057  C  CB  . SER C  3  29  ? 60.048  336.995 195.983 1.00 34.53  ? 29   SER C CB  1 
ATOM   6058  O  OG  . SER C  3  29  ? 58.995  336.191 196.172 1.00 48.49  ? 29   SER C OG  1 
ATOM   6059  N  N   . GLY C  3  30  ? 62.430  337.975 194.808 1.00 35.07  ? 30   GLY C N   1 
ATOM   6060  C  CA  . GLY C  3  30  ? 63.226  339.074 194.272 1.00 34.50  ? 30   GLY C CA  1 
ATOM   6061  C  C   . GLY C  3  30  ? 63.921  338.835 192.990 1.00 34.07  ? 30   GLY C C   1 
ATOM   6062  O  O   . GLY C  3  30  ? 63.866  339.705 192.078 1.00 33.83  ? 30   GLY C O   1 
ATOM   6063  N  N   . LEU C  3  31  ? 64.606  337.675 192.871 1.00 33.70  ? 31   LEU C N   1 
ATOM   6064  C  CA  . LEU C  3  31  ? 65.339  337.339 191.632 1.00 32.68  ? 31   LEU C CA  1 
ATOM   6065  C  C   . LEU C  3  31  ? 64.342  337.121 190.480 1.00 31.82  ? 31   LEU C C   1 
ATOM   6066  O  O   . LEU C  3  31  ? 64.591  337.456 189.307 1.00 33.52  ? 31   LEU C O   1 
ATOM   6067  C  CB  . LEU C  3  31  ? 66.141  336.050 191.834 1.00 32.76  ? 31   LEU C CB  1 
ATOM   6068  C  CG  . LEU C  3  31  ? 67.420  336.190 192.584 1.00 33.74  ? 31   LEU C CG  1 
ATOM   6069  C  CD1 . LEU C  3  31  ? 68.010  334.839 192.961 1.00 38.48  ? 31   LEU C CD1 1 
ATOM   6070  C  CD2 . LEU C  3  31  ? 68.314  336.963 191.502 1.00 32.30  ? 31   LEU C CD2 1 
ATOM   6071  N  N   . THR C  3  32  ? 63.208  336.541 190.833 1.00 31.76  ? 32   THR C N   1 
ATOM   6072  C  CA  . THR C  3  32  ? 62.116  336.380 189.877 1.00 32.79  ? 32   THR C CA  1 
ATOM   6073  C  C   . THR C  3  32  ? 61.646  337.730 189.345 1.00 34.13  ? 32   THR C C   1 
ATOM   6074  O  O   . THR C  3  32  ? 61.534  337.922 188.147 1.00 34.91  ? 32   THR C O   1 
ATOM   6075  C  CB  . THR C  3  32  ? 60.897  335.578 190.505 1.00 33.98  ? 32   THR C CB  1 
ATOM   6076  O  OG1 . THR C  3  32  ? 61.360  334.294 190.998 1.00 33.55  ? 32   THR C OG1 1 
ATOM   6077  C  CG2 . THR C  3  32  ? 59.803  335.317 189.456 1.00 31.73  ? 32   THR C CG2 1 
ATOM   6078  N  N   . MET C  3  33  ? 61.335  338.637 190.242 1.00 33.84  ? 33   MET C N   1 
ATOM   6079  C  CA  . MET C  3  33  ? 60.910  340.020 189.908 1.00 35.74  ? 33   MET C CA  1 
ATOM   6080  C  C   . MET C  3  33  ? 61.961  340.718 189.045 1.00 33.05  ? 33   MET C C   1 
ATOM   6081  O  O   . MET C  3  33  ? 61.638  341.405 188.104 1.00 33.68  ? 33   MET C O   1 
ATOM   6082  C  CB  . MET C  3  33  ? 60.609  340.762 191.230 1.00 35.94  ? 33   MET C CB  1 
ATOM   6083  C  CG  . MET C  3  33  ? 59.234  341.492 191.405 1.00 50.94  ? 33   MET C CG  1 
ATOM   6084  S  SD  . MET C  3  33  ? 57.633  340.911 190.599 1.00 58.29  ? 33   MET C SD  1 
ATOM   6085  C  CE  . MET C  3  33  ? 56.442  342.363 190.429 1.00 57.11  ? 33   MET C CE  1 
ATOM   6086  N  N   . TRP C  3  34  ? 63.230  340.538 189.373 1.00 33.11  ? 34   TRP C N   1 
ATOM   6087  C  CA  . TRP C  3  34  ? 64.323  341.129 188.669 1.00 32.40  ? 34   TRP C CA  1 
ATOM   6088  C  C   . TRP C  3  34  ? 64.417  340.568 187.242 1.00 35.57  ? 34   TRP C C   1 
ATOM   6089  O  O   . TRP C  3  34  ? 64.545  341.333 186.255 1.00 34.54  ? 34   TRP C O   1 
ATOM   6090  C  CB  . TRP C  3  34  ? 65.608  340.832 189.390 1.00 34.14  ? 34   TRP C CB  1 
ATOM   6091  C  CG  . TRP C  3  34  ? 66.741  341.526 188.771 1.00 35.88  ? 34   TRP C CG  1 
ATOM   6092  C  CD1 . TRP C  3  34  ? 66.767  342.821 188.315 1.00 39.33  ? 34   TRP C CD1 1 
ATOM   6093  C  CD2 . TRP C  3  34  ? 68.065  341.007 188.584 1.00 39.10  ? 34   TRP C CD2 1 
ATOM   6094  N  NE1 . TRP C  3  34  ? 68.024  343.112 187.831 1.00 40.30  ? 34   TRP C NE1 1 
ATOM   6095  C  CE2 . TRP C  3  34  ? 68.834  342.017 187.983 1.00 37.40  ? 34   TRP C CE2 1 
ATOM   6096  C  CE3 . TRP C  3  34  ? 68.671  339.777 188.873 1.00 41.97  ? 34   TRP C CE3 1 
ATOM   6097  C  CZ2 . TRP C  3  34  ? 70.164  341.847 187.644 1.00 41.00  ? 34   TRP C CZ2 1 
ATOM   6098  C  CZ3 . TRP C  3  34  ? 70.045  339.587 188.498 1.00 41.88  ? 34   TRP C CZ3 1 
ATOM   6099  C  CH2 . TRP C  3  34  ? 70.749  340.625 187.891 1.00 41.83  ? 34   TRP C CH2 1 
ATOM   6100  N  N   . PHE C  3  35  ? 64.400  339.240 187.140 1.00 35.15  ? 35   PHE C N   1 
ATOM   6101  C  CA  . PHE C  3  35  ? 64.506  338.507 185.862 1.00 36.45  ? 35   PHE C CA  1 
ATOM   6102  C  C   . PHE C  3  35  ? 63.295  338.763 184.943 1.00 36.06  ? 35   PHE C C   1 
ATOM   6103  O  O   . PHE C  3  35  ? 63.434  338.714 183.773 1.00 36.07  ? 35   PHE C O   1 
ATOM   6104  C  CB  . PHE C  3  35  ? 64.629  336.935 186.134 1.00 33.70  ? 35   PHE C CB  1 
ATOM   6105  C  CG  . PHE C  3  35  ? 66.059  336.438 186.603 1.00 35.19  ? 35   PHE C CG  1 
ATOM   6106  C  CD1 . PHE C  3  35  ? 67.161  337.165 186.339 1.00 34.99  ? 35   PHE C CD1 1 
ATOM   6107  C  CD2 . PHE C  3  35  ? 66.246  335.152 187.232 1.00 31.10  ? 35   PHE C CD2 1 
ATOM   6108  C  CE1 . PHE C  3  35  ? 68.508  336.659 186.704 1.00 37.44  ? 35   PHE C CE1 1 
ATOM   6109  C  CE2 . PHE C  3  35  ? 67.524  334.677 187.613 1.00 34.39  ? 35   PHE C CE2 1 
ATOM   6110  C  CZ  . PHE C  3  35  ? 68.654  335.378 187.316 1.00 34.06  ? 35   PHE C CZ  1 
ATOM   6111  N  N   . HIS C  3  36  ? 62.099  338.898 185.476 1.00 37.49  ? 36   HIS C N   1 
ATOM   6112  C  CA  . HIS C  3  36  ? 60.902  338.897 184.674 1.00 39.82  ? 36   HIS C CA  1 
ATOM   6113  C  C   . HIS C  3  36  ? 60.071  340.202 184.751 1.00 45.38  ? 36   HIS C C   1 
ATOM   6114  O  O   . HIS C  3  36  ? 59.191  340.404 183.909 1.00 47.33  ? 36   HIS C O   1 
ATOM   6115  C  CB  . HIS C  3  36  ? 59.987  337.798 185.071 1.00 38.29  ? 36   HIS C CB  1 
ATOM   6116  C  CG  . HIS C  3  36  ? 60.538  336.451 184.742 1.00 38.44  ? 36   HIS C CG  1 
ATOM   6117  N  ND1 . HIS C  3  36  ? 60.602  335.991 183.452 1.00 33.98  ? 36   HIS C ND1 1 
ATOM   6118  C  CD2 . HIS C  3  36  ? 61.198  335.547 185.506 1.00 32.44  ? 36   HIS C CD2 1 
ATOM   6119  C  CE1 . HIS C  3  36  ? 61.180  334.800 183.444 1.00 37.18  ? 36   HIS C CE1 1 
ATOM   6120  N  NE2 . HIS C  3  36  ? 61.553  334.503 184.680 1.00 38.04  ? 36   HIS C NE2 1 
ATOM   6121  N  N   . PHE C  3  37  ? 60.244  341.032 185.779 1.00 47.23  ? 37   PHE C N   1 
ATOM   6122  C  CA  . PHE C  3  37  ? 59.276  342.131 185.951 1.00 49.18  ? 37   PHE C CA  1 
ATOM   6123  C  C   . PHE C  3  37  ? 60.045  343.410 186.153 1.00 50.28  ? 37   PHE C C   1 
ATOM   6124  O  O   . PHE C  3  37  ? 59.549  344.332 186.777 1.00 53.07  ? 37   PHE C O   1 
ATOM   6125  C  CB  . PHE C  3  37  ? 58.346  341.830 187.082 1.00 48.15  ? 37   PHE C CB  1 
ATOM   6126  C  CG  . PHE C  3  37  ? 57.513  340.531 186.871 1.00 52.61  ? 37   PHE C CG  1 
ATOM   6127  C  CD1 . PHE C  3  37  ? 56.402  340.513 186.047 1.00 53.33  ? 37   PHE C CD1 1 
ATOM   6128  C  CD2 . PHE C  3  37  ? 57.873  339.315 187.495 1.00 51.22  ? 37   PHE C CD2 1 
ATOM   6129  C  CE1 . PHE C  3  37  ? 55.691  339.322 185.861 1.00 50.80  ? 37   PHE C CE1 1 
ATOM   6130  C  CE2 . PHE C  3  37  ? 57.142  338.153 187.306 1.00 52.63  ? 37   PHE C CE2 1 
ATOM   6131  C  CZ  . PHE C  3  37  ? 56.041  338.177 186.496 1.00 49.34  ? 37   PHE C CZ  1 
ATOM   6132  N  N   . ASN C  3  38  ? 61.287  343.380 185.691 1.00 50.36  ? 38   ASN C N   1 
ATOM   6133  C  CA  . ASN C  3  38  ? 62.235  344.424 185.729 1.00 51.99  ? 38   ASN C CA  1 
ATOM   6134  C  C   . ASN C  3  38  ? 62.364  345.351 186.973 1.00 50.85  ? 38   ASN C C   1 
ATOM   6135  O  O   . ASN C  3  38  ? 62.480  346.633 186.843 1.00 50.27  ? 38   ASN C O   1 
ATOM   6136  C  CB  . ASN C  3  38  ? 62.187  345.242 184.425 1.00 55.25  ? 38   ASN C CB  1 
ATOM   6137  C  CG  . ASN C  3  38  ? 63.613  345.819 184.074 1.00 63.02  ? 38   ASN C CG  1 
ATOM   6138  O  OD1 . ASN C  3  38  ? 64.688  345.180 184.381 1.00 74.25  ? 38   ASN C OD1 1 
ATOM   6139  N  ND2 . ASN C  3  38  ? 63.624  347.047 183.542 1.00 69.63  ? 38   ASN C ND2 1 
ATOM   6140  N  N   . SER C  3  39  ? 62.396  344.747 188.154 1.00 46.29  ? 39   SER C N   1 
ATOM   6141  C  CA  . SER C  3  39  ? 62.373  345.513 189.375 1.00 46.35  ? 39   SER C CA  1 
ATOM   6142  C  C   . SER C  3  39  ? 63.295  344.845 190.385 1.00 46.97  ? 39   SER C C   1 
ATOM   6143  O  O   . SER C  3  39  ? 63.304  343.608 190.477 1.00 44.56  ? 39   SER C O   1 
ATOM   6144  C  CB  . SER C  3  39  ? 60.991  345.536 189.935 1.00 46.23  ? 39   SER C CB  1 
ATOM   6145  O  OG  . SER C  3  39  ? 61.041  346.256 191.155 1.00 50.48  ? 39   SER C OG  1 
ATOM   6146  N  N   . MET C  3  40  ? 64.053  345.645 191.128 1.00 44.66  ? 40   MET C N   1 
ATOM   6147  C  CA  . MET C  3  40  ? 64.990  345.116 192.066 1.00 45.64  ? 40   MET C CA  1 
ATOM   6148  C  C   . MET C  3  40  ? 64.630  345.214 193.523 1.00 44.19  ? 40   MET C C   1 
ATOM   6149  O  O   . MET C  3  40  ? 65.433  344.872 194.398 1.00 43.53  ? 40   MET C O   1 
ATOM   6150  C  CB  . MET C  3  40  ? 66.296  345.773 191.824 1.00 46.91  ? 40   MET C CB  1 
ATOM   6151  C  CG  . MET C  3  40  ? 66.951  344.988 190.767 1.00 54.42  ? 40   MET C CG  1 
ATOM   6152  S  SD  . MET C  3  40  ? 68.690  344.935 191.076 1.00 72.85  ? 40   MET C SD  1 
ATOM   6153  C  CE  . MET C  3  40  ? 68.915  346.728 190.945 1.00 59.27  ? 40   MET C CE  1 
ATOM   6154  N  N   . THR C  3  41  ? 63.423  345.686 193.768 1.00 41.85  ? 41   THR C N   1 
ATOM   6155  C  CA  . THR C  3  41  ? 62.986  346.108 195.078 1.00 42.69  ? 41   THR C CA  1 
ATOM   6156  C  C   . THR C  3  41  ? 62.914  344.920 196.059 1.00 40.41  ? 41   THR C C   1 
ATOM   6157  O  O   . THR C  3  41  ? 63.531  344.998 197.125 1.00 38.53  ? 41   THR C O   1 
ATOM   6158  C  CB  . THR C  3  41  ? 61.563  346.732 194.965 1.00 43.73  ? 41   THR C CB  1 
ATOM   6159  O  OG1 . THR C  3  41  ? 61.693  347.980 194.284 1.00 49.93  ? 41   THR C OG1 1 
ATOM   6160  C  CG2 . THR C  3  41  ? 60.908  346.956 196.326 1.00 43.97  ? 41   THR C CG2 1 
ATOM   6161  N  N   . LEU C  3  42  ? 62.121  343.900 195.724 1.00 39.18  ? 42   LEU C N   1 
ATOM   6162  C  CA  . LEU C  3  42  ? 62.066  342.643 196.555 1.00 38.40  ? 42   LEU C CA  1 
ATOM   6163  C  C   . LEU C  3  42  ? 63.485  342.112 196.810 1.00 36.31  ? 42   LEU C C   1 
ATOM   6164  O  O   . LEU C  3  42  ? 63.799  341.790 197.915 1.00 36.44  ? 42   LEU C O   1 
ATOM   6165  C  CB  . LEU C  3  42  ? 61.263  341.518 195.940 1.00 37.60  ? 42   LEU C CB  1 
ATOM   6166  C  CG  . LEU C  3  42  ? 59.734  341.430 196.134 1.00 40.83  ? 42   LEU C CG  1 
ATOM   6167  C  CD1 . LEU C  3  42  ? 59.126  340.330 195.316 1.00 36.24  ? 42   LEU C CD1 1 
ATOM   6168  C  CD2 . LEU C  3  42  ? 59.397  341.328 197.655 1.00 39.99  ? 42   LEU C CD2 1 
ATOM   6169  N  N   . LEU C  3  43  ? 64.317  342.004 195.782 1.00 34.36  ? 43   LEU C N   1 
ATOM   6170  C  CA  . LEU C  3  43  ? 65.613  341.452 195.965 1.00 34.28  ? 43   LEU C CA  1 
ATOM   6171  C  C   . LEU C  3  43  ? 66.432  342.228 196.970 1.00 36.18  ? 43   LEU C C   1 
ATOM   6172  O  O   . LEU C  3  43  ? 67.177  341.642 197.825 1.00 35.33  ? 43   LEU C O   1 
ATOM   6173  C  CB  . LEU C  3  43  ? 66.310  341.243 194.583 1.00 33.00  ? 43   LEU C CB  1 
ATOM   6174  C  CG  . LEU C  3  43  ? 67.794  340.809 194.553 1.00 35.06  ? 43   LEU C CG  1 
ATOM   6175  C  CD1 . LEU C  3  43  ? 67.979  339.456 195.280 1.00 38.33  ? 43   LEU C CD1 1 
ATOM   6176  C  CD2 . LEU C  3  43  ? 68.237  340.697 193.145 1.00 29.33  ? 43   LEU C CD2 1 
ATOM   6177  N  N   . MET C  3  44  ? 66.361  343.562 196.867 1.00 36.98  ? 44   MET C N   1 
ATOM   6178  C  CA  . MET C  3  44  ? 67.131  344.426 197.787 1.00 37.84  ? 44   MET C CA  1 
ATOM   6179  C  C   . MET C  3  44  ? 66.669  344.242 199.224 1.00 35.39  ? 44   MET C C   1 
ATOM   6180  O  O   . MET C  3  44  ? 67.510  344.189 200.081 1.00 34.93  ? 44   MET C O   1 
ATOM   6181  C  CB  . MET C  3  44  ? 67.073  345.913 197.359 1.00 40.25  ? 44   MET C CB  1 
ATOM   6182  C  CG  . MET C  3  44  ? 67.801  346.136 195.971 1.00 48.23  ? 44   MET C CG  1 
ATOM   6183  S  SD  . MET C  3  44  ? 69.505  345.370 195.989 1.00 71.64  ? 44   MET C SD  1 
ATOM   6184  C  CE  . MET C  3  44  ? 69.852  344.585 194.372 1.00 67.95  ? 44   MET C CE  1 
ATOM   6185  N  N   . ILE C  3  45  ? 65.346  344.134 199.464 1.00 34.29  ? 45   ILE C N   1 
ATOM   6186  C  CA  . ILE C  3  45  ? 64.820  343.871 200.755 1.00 34.94  ? 45   ILE C CA  1 
ATOM   6187  C  C   . ILE C  3  45  ? 65.269  342.474 201.277 1.00 35.39  ? 45   ILE C C   1 
ATOM   6188  O  O   . ILE C  3  45  ? 65.773  342.405 202.404 1.00 36.72  ? 45   ILE C O   1 
ATOM   6189  C  CB  . ILE C  3  45  ? 63.247  343.957 200.799 1.00 37.66  ? 45   ILE C CB  1 
ATOM   6190  C  CG1 . ILE C  3  45  ? 62.724  345.400 200.402 1.00 35.94  ? 45   ILE C CG1 1 
ATOM   6191  C  CG2 . ILE C  3  45  ? 62.760  343.574 202.196 1.00 36.26  ? 45   ILE C CG2 1 
ATOM   6192  C  CD1 . ILE C  3  45  ? 61.271  345.271 199.913 1.00 39.95  ? 45   ILE C CD1 1 
ATOM   6193  N  N   . GLY C  3  46  ? 65.129  341.374 200.477 1.00 33.54  ? 46   GLY C N   1 
ATOM   6194  C  CA  . GLY C  3  46  ? 65.571  340.052 200.979 1.00 32.22  ? 46   GLY C CA  1 
ATOM   6195  C  C   . GLY C  3  46  ? 67.079  339.999 201.163 1.00 32.55  ? 46   GLY C C   1 
ATOM   6196  O  O   . GLY C  3  46  ? 67.559  339.356 202.108 1.00 31.64  ? 46   GLY C O   1 
ATOM   6197  N  N   . LEU C  3  47  ? 67.864  340.690 200.346 1.00 31.79  ? 47   LEU C N   1 
ATOM   6198  C  CA  . LEU C  3  47  ? 69.301  340.707 200.670 1.00 33.73  ? 47   LEU C CA  1 
ATOM   6199  C  C   . LEU C  3  47  ? 69.625  341.412 201.986 1.00 35.31  ? 47   LEU C C   1 
ATOM   6200  O  O   . LEU C  3  47  ? 70.477  340.959 202.781 1.00 33.86  ? 47   LEU C O   1 
ATOM   6201  C  CB  . LEU C  3  47  ? 70.123  341.320 199.553 1.00 35.28  ? 47   LEU C CB  1 
ATOM   6202  C  CG  . LEU C  3  47  ? 70.252  340.600 198.171 1.00 37.37  ? 47   LEU C CG  1 
ATOM   6203  C  CD1 . LEU C  3  47  ? 70.812  341.567 197.126 1.00 36.48  ? 47   LEU C CD1 1 
ATOM   6204  C  CD2 . LEU C  3  47  ? 71.166  339.398 198.300 1.00 35.55  ? 47   LEU C CD2 1 
ATOM   6205  N  N   . THR C  3  48  ? 68.890  342.494 202.248 1.00 35.11  ? 48   THR C N   1 
ATOM   6206  C  CA  . THR C  3  48  ? 69.089  343.226 203.480 1.00 35.09  ? 48   THR C CA  1 
ATOM   6207  C  C   . THR C  3  48  ? 68.685  342.377 204.714 1.00 33.00  ? 48   THR C C   1 
ATOM   6208  O  O   . THR C  3  48  ? 69.457  342.271 205.636 1.00 33.58  ? 48   THR C O   1 
ATOM   6209  C  CB  . THR C  3  48  ? 68.333  344.571 203.468 1.00 35.61  ? 48   THR C CB  1 
ATOM   6210  O  OG1 . THR C  3  48  ? 68.702  345.349 202.301 1.00 33.93  ? 48   THR C OG1 1 
ATOM   6211  C  CG2 . THR C  3  48  ? 68.612  345.343 204.768 1.00 35.90  ? 48   THR C CG2 1 
ATOM   6212  N  N   . THR C  3  49  ? 67.506  341.771 204.699 1.00 33.08  ? 49   THR C N   1 
ATOM   6213  C  CA  . THR C  3  49  ? 67.052  340.971 205.836 1.00 32.77  ? 49   THR C CA  1 
ATOM   6214  C  C   . THR C  3  49  ? 67.931  339.713 206.010 1.00 31.62  ? 49   THR C C   1 
ATOM   6215  O  O   . THR C  3  49  ? 68.097  339.140 207.092 1.00 31.16  ? 49   THR C O   1 
ATOM   6216  C  CB  . THR C  3  49  ? 65.553  340.614 205.721 1.00 33.36  ? 49   THR C CB  1 
ATOM   6217  O  OG1 . THR C  3  49  ? 65.295  339.903 204.513 1.00 33.41  ? 49   THR C OG1 1 
ATOM   6218  C  CG2 . THR C  3  49  ? 64.676  341.909 205.715 1.00 37.67  ? 49   THR C CG2 1 
ATOM   6219  N  N   . ASN C  3  50  ? 68.406  339.201 204.899 1.00 30.76  ? 50   ASN C N   1 
ATOM   6220  C  CA  . ASN C  3  50  ? 69.275  338.051 205.028 1.00 32.09  ? 50   ASN C CA  1 
ATOM   6221  C  C   . ASN C  3  50  ? 70.532  338.461 205.819 1.00 31.43  ? 50   ASN C C   1 
ATOM   6222  O  O   . ASN C  3  50  ? 70.980  337.755 206.666 1.00 31.10  ? 50   ASN C O   1 
ATOM   6223  C  CB  . ASN C  3  50  ? 69.612  337.521 203.633 1.00 31.15  ? 50   ASN C CB  1 
ATOM   6224  C  CG  . ASN C  3  50  ? 70.501  336.259 203.706 1.00 36.52  ? 50   ASN C CG  1 
ATOM   6225  O  OD1 . ASN C  3  50  ? 70.036  335.201 204.120 1.00 39.07  ? 50   ASN C OD1 1 
ATOM   6226  N  ND2 . ASN C  3  50  ? 71.777  336.414 203.431 1.00 37.17  ? 50   ASN C ND2 1 
ATOM   6227  N  N   . MET C  3  51  ? 71.153  339.597 205.467 1.00 33.16  ? 51   MET C N   1 
ATOM   6228  C  CA  . MET C  3  51  ? 72.399  340.045 206.110 1.00 34.59  ? 51   MET C CA  1 
ATOM   6229  C  C   . MET C  3  51  ? 72.135  340.257 207.573 1.00 32.67  ? 51   MET C C   1 
ATOM   6230  O  O   . MET C  3  51  ? 72.959  339.903 208.463 1.00 33.92  ? 51   MET C O   1 
ATOM   6231  C  CB  . MET C  3  51  ? 72.822  341.425 205.533 1.00 33.85  ? 51   MET C CB  1 
ATOM   6232  C  CG  . MET C  3  51  ? 73.191  341.298 204.063 1.00 45.50  ? 51   MET C CG  1 
ATOM   6233  S  SD  . MET C  3  51  ? 74.430  339.980 203.771 1.00 62.68  ? 51   MET C SD  1 
ATOM   6234  C  CE  . MET C  3  51  ? 73.778  339.160 202.253 1.00 63.40  ? 51   MET C CE  1 
ATOM   6235  N  N   . LEU C  3  52  ? 70.998  340.889 207.829 1.00 32.21  ? 52   LEU C N   1 
ATOM   6236  C  CA  . LEU C  3  52  ? 70.601  341.227 209.255 1.00 32.34  ? 52   LEU C CA  1 
ATOM   6237  C  C   . LEU C  3  52  ? 70.379  339.900 210.011 1.00 32.98  ? 52   LEU C C   1 
ATOM   6238  O  O   . LEU C  3  52  ? 70.779  339.736 211.199 1.00 32.64  ? 52   LEU C O   1 
ATOM   6239  C  CB  . LEU C  3  52  ? 69.284  341.978 209.296 1.00 30.78  ? 52   LEU C CB  1 
ATOM   6240  C  CG  . LEU C  3  52  ? 69.329  343.471 208.848 1.00 33.54  ? 52   LEU C CG  1 
ATOM   6241  C  CD1 . LEU C  3  52  ? 67.853  344.056 208.624 1.00 27.34  ? 52   LEU C CD1 1 
ATOM   6242  C  CD2 . LEU C  3  52  ? 70.122  344.342 209.809 1.00 32.72  ? 52   LEU C CD2 1 
ATOM   6243  N  N   . THR C  3  53  ? 69.671  338.964 209.364 1.00 31.38  ? 53   THR C N   1 
ATOM   6244  C  CA  . THR C  3  53  ? 69.520  337.614 210.031 1.00 30.43  ? 53   THR C CA  1 
ATOM   6245  C  C   . THR C  3  53  ? 70.852  336.969 210.339 1.00 30.32  ? 53   THR C C   1 
ATOM   6246  O  O   . THR C  3  53  ? 71.061  336.529 211.466 1.00 29.95  ? 53   THR C O   1 
ATOM   6247  C  CB  . THR C  3  53  ? 68.703  336.628 209.131 1.00 31.57  ? 53   THR C CB  1 
ATOM   6248  O  OG1 . THR C  3  53  ? 67.426  337.254 208.916 1.00 32.55  ? 53   THR C OG1 1 
ATOM   6249  C  CG2 . THR C  3  53  ? 68.504  335.227 209.862 1.00 27.14  ? 53   THR C CG2 1 
ATOM   6250  N  N   . MET C  3  54  ? 71.742  336.847 209.349 1.00 28.42  ? 54   MET C N   1 
ATOM   6251  C  CA  . MET C  3  54  ? 73.019  336.236 209.669 1.00 29.81  ? 54   MET C CA  1 
ATOM   6252  C  C   . MET C  3  54  ? 73.721  337.018 210.755 1.00 30.76  ? 54   MET C C   1 
ATOM   6253  O  O   . MET C  3  54  ? 74.357  336.433 211.616 1.00 31.95  ? 54   MET C O   1 
ATOM   6254  C  CB  . MET C  3  54  ? 73.962  336.257 208.424 1.00 30.11  ? 54   MET C CB  1 
ATOM   6255  C  CG  . MET C  3  54  ? 73.527  335.162 207.427 1.00 33.55  ? 54   MET C CG  1 
ATOM   6256  S  SD  . MET C  3  54  ? 74.488  335.200 205.907 1.00 38.72  ? 54   MET C SD  1 
ATOM   6257  C  CE  . MET C  3  54  ? 73.983  336.732 205.159 1.00 43.14  ? 54   MET C CE  1 
ATOM   6258  N  N   . TYR C  3  55  ? 73.682  338.331 210.672 1.00 31.36  ? 55   TYR C N   1 
ATOM   6259  C  CA  . TYR C  3  55  ? 74.431  339.153 211.676 1.00 32.61  ? 55   TYR C CA  1 
ATOM   6260  C  C   . TYR C  3  55  ? 73.884  338.843 213.095 1.00 31.33  ? 55   TYR C C   1 
ATOM   6261  O  O   . TYR C  3  55  ? 74.605  338.464 213.991 1.00 30.72  ? 55   TYR C O   1 
ATOM   6262  C  CB  . TYR C  3  55  ? 74.291  340.700 211.387 1.00 36.78  ? 55   TYR C CB  1 
ATOM   6263  C  CG  . TYR C  3  55  ? 74.875  341.506 212.558 1.00 37.73  ? 55   TYR C CG  1 
ATOM   6264  C  CD1 . TYR C  3  55  ? 76.253  341.578 212.732 1.00 42.75  ? 55   TYR C CD1 1 
ATOM   6265  C  CD2 . TYR C  3  55  ? 74.046  342.043 213.570 1.00 38.40  ? 55   TYR C CD2 1 
ATOM   6266  C  CE1 . TYR C  3  55  ? 76.821  342.227 213.881 1.00 47.49  ? 55   TYR C CE1 1 
ATOM   6267  C  CE2 . TYR C  3  55  ? 74.600  342.677 214.681 1.00 43.35  ? 55   TYR C CE2 1 
ATOM   6268  C  CZ  . TYR C  3  55  ? 75.988  342.748 214.845 1.00 47.41  ? 55   TYR C CZ  1 
ATOM   6269  O  OH  . TYR C  3  55  ? 76.545  343.398 215.956 1.00 54.68  ? 55   TYR C OH  1 
ATOM   6270  N  N   . GLN C  3  56  ? 72.576  338.935 213.296 1.00 29.78  ? 56   GLN C N   1 
ATOM   6271  C  CA  . GLN C  3  56  ? 72.112  338.703 214.614 1.00 29.71  ? 56   GLN C CA  1 
ATOM   6272  C  C   . GLN C  3  56  ? 72.236  337.257 215.047 1.00 28.88  ? 56   GLN C C   1 
ATOM   6273  O  O   . GLN C  3  56  ? 72.448  336.965 216.203 1.00 29.23  ? 56   GLN C O   1 
ATOM   6274  C  CB  . GLN C  3  56  ? 70.687  339.171 214.721 1.00 32.18  ? 56   GLN C CB  1 
ATOM   6275  C  CG  . GLN C  3  56  ? 70.595  340.769 214.772 1.00 32.36  ? 56   GLN C CG  1 
ATOM   6276  C  CD  . GLN C  3  56  ? 69.228  341.310 214.336 1.00 38.92  ? 56   GLN C CD  1 
ATOM   6277  O  OE1 . GLN C  3  56  ? 68.447  341.885 215.146 1.00 34.29  ? 56   GLN C OE1 1 
ATOM   6278  N  NE2 . GLN C  3  56  ? 68.894  341.081 213.090 1.00 32.48  ? 56   GLN C NE2 1 
ATOM   6279  N  N   . TRP C  3  57  ? 71.983  336.314 214.152 1.00 28.45  ? 57   TRP C N   1 
ATOM   6280  C  CA  . TRP C  3  57  ? 71.982  334.872 214.558 1.00 24.48  ? 57   TRP C CA  1 
ATOM   6281  C  C   . TRP C  3  57  ? 73.405  334.538 214.986 1.00 25.83  ? 57   TRP C C   1 
ATOM   6282  O  O   . TRP C  3  57  ? 73.639  333.930 216.051 1.00 27.46  ? 57   TRP C O   1 
ATOM   6283  C  CB  . TRP C  3  57  ? 71.616  334.015 213.289 1.00 24.43  ? 57   TRP C CB  1 
ATOM   6284  C  CG  . TRP C  3  57  ? 71.412  332.425 213.535 1.00 24.90  ? 57   TRP C CG  1 
ATOM   6285  C  CD1 . TRP C  3  57  ? 72.137  331.605 214.311 1.00 24.71  ? 57   TRP C CD1 1 
ATOM   6286  C  CD2 . TRP C  3  57  ? 70.412  331.621 212.902 1.00 26.36  ? 57   TRP C CD2 1 
ATOM   6287  N  NE1 . TRP C  3  57  ? 71.661  330.286 214.200 1.00 27.05  ? 57   TRP C NE1 1 
ATOM   6288  C  CE2 . TRP C  3  57  ? 70.573  330.291 213.365 1.00 28.93  ? 57   TRP C CE2 1 
ATOM   6289  C  CE3 . TRP C  3  57  ? 69.411  331.905 211.958 1.00 29.30  ? 57   TRP C CE3 1 
ATOM   6290  C  CZ2 . TRP C  3  57  ? 69.799  329.232 212.905 1.00 26.26  ? 57   TRP C CZ2 1 
ATOM   6291  C  CZ3 . TRP C  3  57  ? 68.590  330.819 211.507 1.00 26.59  ? 57   TRP C CZ3 1 
ATOM   6292  C  CH2 . TRP C  3  57  ? 68.776  329.522 212.024 1.00 27.17  ? 57   TRP C CH2 1 
ATOM   6293  N  N   . TRP C  3  58  ? 74.382  334.880 214.164 1.00 27.55  ? 58   TRP C N   1 
ATOM   6294  C  CA  . TRP C  3  58  ? 75.786  334.557 214.639 1.00 28.01  ? 58   TRP C CA  1 
ATOM   6295  C  C   . TRP C  3  58  ? 76.265  335.377 215.851 1.00 29.58  ? 58   TRP C C   1 
ATOM   6296  O  O   . TRP C  3  58  ? 77.041  334.865 216.683 1.00 30.10  ? 58   TRP C O   1 
ATOM   6297  C  CB  . TRP C  3  58  ? 76.763  334.665 213.481 1.00 28.29  ? 58   TRP C CB  1 
ATOM   6298  C  CG  . TRP C  3  58  ? 76.527  333.418 212.500 1.00 30.14  ? 58   TRP C CG  1 
ATOM   6299  C  CD1 . TRP C  3  58  ? 76.310  332.088 212.881 1.00 31.96  ? 58   TRP C CD1 1 
ATOM   6300  C  CD2 . TRP C  3  58  ? 76.543  333.427 211.068 1.00 29.97  ? 58   TRP C CD2 1 
ATOM   6301  N  NE1 . TRP C  3  58  ? 76.212  331.288 211.758 1.00 27.52  ? 58   TRP C NE1 1 
ATOM   6302  C  CE2 . TRP C  3  58  ? 76.327  332.083 210.637 1.00 33.60  ? 58   TRP C CE2 1 
ATOM   6303  C  CE3 . TRP C  3  58  ? 76.744  334.422 210.100 1.00 27.69  ? 58   TRP C CE3 1 
ATOM   6304  C  CZ2 . TRP C  3  58  ? 76.265  331.724 209.256 1.00 30.13  ? 58   TRP C CZ2 1 
ATOM   6305  C  CZ3 . TRP C  3  58  ? 76.703  334.059 208.678 1.00 30.07  ? 58   TRP C CZ3 1 
ATOM   6306  C  CH2 . TRP C  3  58  ? 76.447  332.701 208.304 1.00 30.68  ? 58   TRP C CH2 1 
ATOM   6307  N  N   . ARG C  3  59  ? 75.852  336.650 215.929 1.00 30.32  ? 59   ARG C N   1 
ATOM   6308  C  CA  . ARG C  3  59  ? 76.061  337.442 217.153 1.00 30.50  ? 59   ARG C CA  1 
ATOM   6309  C  C   . ARG C  3  59  ? 75.613  336.614 218.374 1.00 30.35  ? 59   ARG C C   1 
ATOM   6310  O  O   . ARG C  3  59  ? 76.366  336.498 219.356 1.00 30.47  ? 59   ARG C O   1 
ATOM   6311  C  CB  . ARG C  3  59  ? 75.219  338.752 217.081 1.00 29.01  ? 59   ARG C CB  1 
ATOM   6312  C  CG  . ARG C  3  59  ? 75.401  339.756 218.358 1.00 27.55  ? 59   ARG C CG  1 
ATOM   6313  C  CD  . ARG C  3  59  ? 74.138  340.615 218.238 1.00 28.50  ? 59   ARG C CD  1 
ATOM   6314  N  NE  . ARG C  3  59  ? 72.926  339.849 218.516 1.00 29.49  ? 59   ARG C NE  1 
ATOM   6315  C  CZ  . ARG C  3  59  ? 71.709  340.390 218.504 1.00 30.00  ? 59   ARG C CZ  1 
ATOM   6316  N  NH1 . ARG C  3  59  ? 71.561  341.656 218.244 1.00 35.57  ? 59   ARG C NH1 1 
ATOM   6317  N  NH2 . ARG C  3  59  ? 70.635  339.683 218.706 1.00 29.19  ? 59   ARG C NH2 1 
ATOM   6318  N  N   . ASP C  3  60  ? 74.351  336.102 218.341 1.00 30.76  ? 60   ASP C N   1 
ATOM   6319  C  CA  . ASP C  3  60  ? 73.804  335.282 219.392 1.00 28.61  ? 60   ASP C CA  1 
ATOM   6320  C  C   . ASP C  3  60  ? 74.623  334.061 219.698 1.00 29.76  ? 60   ASP C C   1 
ATOM   6321  O  O   . ASP C  3  60  ? 74.806  333.729 220.868 1.00 32.23  ? 60   ASP C O   1 
ATOM   6322  C  CB  . ASP C  3  60  ? 72.323  334.893 219.119 1.00 30.30  ? 60   ASP C CB  1 
ATOM   6323  C  CG  . ASP C  3  60  ? 71.376  336.076 219.179 1.00 33.34  ? 60   ASP C CG  1 
ATOM   6324  O  OD1 . ASP C  3  60  ? 71.829  337.171 219.516 1.00 30.84  ? 60   ASP C OD1 1 
ATOM   6325  O  OD2 . ASP C  3  60  ? 70.161  335.913 218.820 1.00 31.56  ? 60   ASP C OD2 1 
ATOM   6326  N  N   . VAL C  3  61  ? 75.142  333.346 218.696 1.00 28.95  ? 61   VAL C N   1 
ATOM   6327  C  CA  . VAL C  3  61  ? 76.028  332.181 218.962 1.00 28.50  ? 61   VAL C CA  1 
ATOM   6328  C  C   . VAL C  3  61  ? 77.288  332.598 219.776 1.00 30.70  ? 61   VAL C C   1 
ATOM   6329  O  O   . VAL C  3  61  ? 77.756  331.884 220.664 1.00 27.81  ? 61   VAL C O   1 
ATOM   6330  C  CB  . VAL C  3  61  ? 76.435  331.472 217.574 1.00 30.47  ? 61   VAL C CB  1 
ATOM   6331  C  CG1 . VAL C  3  61  ? 77.377  330.344 217.774 1.00 25.44  ? 61   VAL C CG1 1 
ATOM   6332  C  CG2 . VAL C  3  61  ? 75.042  330.896 216.990 1.00 25.87  ? 61   VAL C CG2 1 
ATOM   6333  N  N   . ILE C  3  62  ? 77.834  333.766 219.421 1.00 29.79  ? 62   ILE C N   1 
ATOM   6334  C  CA  . ILE C  3  62  ? 79.029  334.330 220.113 1.00 32.51  ? 62   ILE C CA  1 
ATOM   6335  C  C   . ILE C  3  62  ? 78.632  334.661 221.614 1.00 30.43  ? 62   ILE C C   1 
ATOM   6336  O  O   . ILE C  3  62  ? 79.352  334.244 222.577 1.00 29.96  ? 62   ILE C O   1 
ATOM   6337  C  CB  . ILE C  3  62  ? 79.575  335.577 219.374 1.00 32.82  ? 62   ILE C CB  1 
ATOM   6338  C  CG1 . ILE C  3  62  ? 80.156  335.134 217.998 1.00 35.00  ? 62   ILE C CG1 1 
ATOM   6339  C  CG2 . ILE C  3  62  ? 80.653  336.297 220.296 1.00 33.51  ? 62   ILE C CG2 1 
ATOM   6340  C  CD1 . ILE C  3  62  ? 80.394  336.250 217.063 1.00 34.91  ? 62   ILE C CD1 1 
ATOM   6341  N  N   . ARG C  3  63  ? 77.425  335.214 221.772 1.00 30.36  ? 63   ARG C N   1 
ATOM   6342  C  CA  . ARG C  3  63  ? 76.838  335.486 223.121 1.00 31.16  ? 63   ARG C CA  1 
ATOM   6343  C  C   . ARG C  3  63  ? 76.718  334.211 223.950 1.00 32.07  ? 63   ARG C C   1 
ATOM   6344  O  O   . ARG C  3  63  ? 77.103  334.186 225.154 1.00 30.82  ? 63   ARG C O   1 
ATOM   6345  C  CB  . ARG C  3  63  ? 75.465  336.181 223.022 1.00 29.71  ? 63   ARG C CB  1 
ATOM   6346  C  CG  . ARG C  3  63  ? 75.600  337.682 222.516 1.00 31.27  ? 63   ARG C CG  1 
ATOM   6347  C  CD  . ARG C  3  63  ? 74.241  338.253 222.207 1.00 27.67  ? 63   ARG C CD  1 
ATOM   6348  N  NE  . ARG C  3  63  ? 74.342  339.657 221.900 1.00 29.12  ? 63   ARG C NE  1 
ATOM   6349  C  CZ  . ARG C  3  63  ? 73.285  340.464 221.794 1.00 30.50  ? 63   ARG C CZ  1 
ATOM   6350  N  NH1 . ARG C  3  63  ? 72.083  339.965 222.032 1.00 30.37  ? 63   ARG C NH1 1 
ATOM   6351  N  NH2 . ARG C  3  63  ? 73.428  341.771 221.556 1.00 32.66  ? 63   ARG C NH2 1 
ATOM   6352  N  N   . GLU C  3  64  ? 76.308  333.121 223.273 1.00 32.04  ? 64   GLU C N   1 
ATOM   6353  C  CA  . GLU C  3  64  ? 75.907  331.865 223.942 1.00 30.43  ? 64   GLU C CA  1 
ATOM   6354  C  C   . GLU C  3  64  ? 77.162  331.178 224.336 1.00 28.46  ? 64   GLU C C   1 
ATOM   6355  O  O   . GLU C  3  64  ? 77.195  330.407 225.267 1.00 28.57  ? 64   GLU C O   1 
ATOM   6356  C  CB  . GLU C  3  64  ? 75.084  330.977 222.988 1.00 30.70  ? 64   GLU C CB  1 
ATOM   6357  C  CG  . GLU C  3  64  ? 73.588  331.482 222.817 1.00 33.91  ? 64   GLU C CG  1 
ATOM   6358  C  CD  . GLU C  3  64  ? 72.856  330.923 221.582 1.00 33.96  ? 64   GLU C CD  1 
ATOM   6359  O  OE1 . GLU C  3  64  ? 71.620  331.217 221.467 1.00 33.34  ? 64   GLU C OE1 1 
ATOM   6360  O  OE2 . GLU C  3  64  ? 73.517  330.213 220.734 1.00 33.91  ? 64   GLU C OE2 1 
ATOM   6361  N  N   . SER C  3  65  ? 78.240  331.465 223.640 1.00 30.32  ? 65   SER C N   1 
ATOM   6362  C  CA  . SER C  3  65  ? 79.483  330.729 223.860 1.00 29.87  ? 65   SER C CA  1 
ATOM   6363  C  C   . SER C  3  65  ? 80.545  331.530 224.630 1.00 29.84  ? 65   SER C C   1 
ATOM   6364  O  O   . SER C  3  65  ? 80.951  331.166 225.729 1.00 30.04  ? 65   SER C O   1 
ATOM   6365  C  CB  . SER C  3  65  ? 80.087  330.234 222.484 1.00 27.41  ? 65   SER C CB  1 
ATOM   6366  O  OG  . SER C  3  65  ? 80.218  331.280 221.548 1.00 28.85  ? 65   SER C OG  1 
ATOM   6367  N  N   . THR C  3  66  ? 81.118  332.546 224.009 1.00 31.72  ? 66   THR C N   1 
ATOM   6368  C  CA  . THR C  3  66  ? 82.138  333.378 224.701 1.00 29.84  ? 66   THR C CA  1 
ATOM   6369  C  C   . THR C  3  66  ? 81.521  333.954 225.974 1.00 31.46  ? 66   THR C C   1 
ATOM   6370  O  O   . THR C  3  66  ? 82.223  334.028 227.057 1.00 31.41  ? 66   THR C O   1 
ATOM   6371  C  CB  . THR C  3  66  ? 82.606  334.485 223.766 1.00 30.83  ? 66   THR C CB  1 
ATOM   6372  O  OG1 . THR C  3  66  ? 82.958  333.861 222.506 1.00 29.49  ? 66   THR C OG1 1 
ATOM   6373  C  CG2 . THR C  3  66  ? 83.897  335.197 224.326 1.00 30.48  ? 66   THR C CG2 1 
ATOM   6374  N  N   . PHE C  3  67  ? 80.252  334.386 225.901 1.00 30.47  ? 67   PHE C N   1 
ATOM   6375  C  CA  . PHE C  3  67  ? 79.732  335.258 226.982 1.00 31.26  ? 67   PHE C CA  1 
ATOM   6376  C  C   . PHE C  3  67  ? 78.964  334.459 228.028 1.00 32.65  ? 67   PHE C C   1 
ATOM   6377  O  O   . PHE C  3  67  ? 79.030  334.776 229.242 1.00 34.99  ? 67   PHE C O   1 
ATOM   6378  C  CB  . PHE C  3  67  ? 78.927  336.493 226.490 1.00 29.25  ? 67   PHE C CB  1 
ATOM   6379  C  CG  . PHE C  3  67  ? 79.694  337.420 225.541 1.00 28.95  ? 67   PHE C CG  1 
ATOM   6380  C  CD1 . PHE C  3  67  ? 79.000  338.179 224.609 1.00 27.53  ? 67   PHE C CD1 1 
ATOM   6381  C  CD2 . PHE C  3  67  ? 81.079  337.578 225.625 1.00 31.01  ? 67   PHE C CD2 1 
ATOM   6382  C  CE1 . PHE C  3  67  ? 79.657  339.002 223.665 1.00 28.09  ? 67   PHE C CE1 1 
ATOM   6383  C  CE2 . PHE C  3  67  ? 81.767  338.396 224.699 1.00 26.89  ? 67   PHE C CE2 1 
ATOM   6384  C  CZ  . PHE C  3  67  ? 81.043  339.106 223.714 1.00 27.98  ? 67   PHE C CZ  1 
ATOM   6385  N  N   . GLN C  3  68  ? 78.285  333.390 227.611 1.00 31.78  ? 68   GLN C N   1 
ATOM   6386  C  CA  . GLN C  3  68  ? 77.411  332.651 228.506 1.00 30.80  ? 68   GLN C CA  1 
ATOM   6387  C  C   . GLN C  3  68  ? 77.944  331.237 228.849 1.00 30.27  ? 68   GLN C C   1 
ATOM   6388  O  O   . GLN C  3  68  ? 77.401  330.626 229.721 1.00 30.16  ? 68   GLN C O   1 
ATOM   6389  C  CB  . GLN C  3  68  ? 76.005  332.525 227.930 1.00 29.86  ? 68   GLN C CB  1 
ATOM   6390  C  CG  . GLN C  3  68  ? 75.269  333.893 227.751 1.00 29.65  ? 68   GLN C CG  1 
ATOM   6391  C  CD  . GLN C  3  68  ? 73.823  333.668 227.310 1.00 34.21  ? 68   GLN C CD  1 
ATOM   6392  O  OE1 . GLN C  3  68  ? 72.889  334.360 227.722 1.00 33.21  ? 68   GLN C OE1 1 
ATOM   6393  N  NE2 . GLN C  3  68  ? 73.635  332.716 226.425 1.00 29.43  ? 68   GLN C NE2 1 
ATOM   6394  N  N   . GLY C  3  69  ? 78.961  330.746 228.133 1.00 30.05  ? 69   GLY C N   1 
ATOM   6395  C  CA  . GLY C  3  69  ? 79.647  329.452 228.444 1.00 28.05  ? 69   GLY C CA  1 
ATOM   6396  C  C   . GLY C  3  69  ? 78.865  328.126 228.028 1.00 29.93  ? 69   GLY C C   1 
ATOM   6397  O  O   . GLY C  3  69  ? 79.120  327.072 228.607 1.00 28.78  ? 69   GLY C O   1 
ATOM   6398  N  N   . HIS C  3  70  ? 77.885  328.175 227.079 1.00 30.28  ? 70   HIS C N   1 
ATOM   6399  C  CA  . HIS C  3  70  ? 77.105  326.965 226.741 1.00 32.30  ? 70   HIS C CA  1 
ATOM   6400  C  C   . HIS C  3  70  ? 77.883  325.988 225.850 1.00 30.39  ? 70   HIS C C   1 
ATOM   6401  O  O   . HIS C  3  70  ? 77.471  324.868 225.673 1.00 30.53  ? 70   HIS C O   1 
ATOM   6402  C  CB  . HIS C  3  70  ? 75.837  327.375 226.046 1.00 33.34  ? 70   HIS C CB  1 
ATOM   6403  C  CG  . HIS C  3  70  ? 74.896  328.125 226.966 1.00 33.04  ? 70   HIS C CG  1 
ATOM   6404  N  ND1 . HIS C  3  70  ? 74.146  327.483 227.941 1.00 33.63  ? 70   HIS C ND1 1 
ATOM   6405  C  CD2 . HIS C  3  70  ? 74.555  329.442 227.032 1.00 32.79  ? 70   HIS C CD2 1 
ATOM   6406  C  CE1 . HIS C  3  70  ? 73.435  328.394 228.613 1.00 32.75  ? 70   HIS C CE1 1 
ATOM   6407  N  NE2 . HIS C  3  70  ? 73.634  329.574 228.051 1.00 30.98  ? 70   HIS C NE2 1 
ATOM   6408  N  N   . HIS C  3  71  ? 79.092  326.370 225.382 1.00 30.23  ? 71   HIS C N   1 
ATOM   6409  C  CA  . HIS C  3  71  ? 79.810  325.418 224.548 1.00 28.05  ? 71   HIS C CA  1 
ATOM   6410  C  C   . HIS C  3  71  ? 80.681  324.576 225.366 1.00 26.99  ? 71   HIS C C   1 
ATOM   6411  O  O   . HIS C  3  71  ? 81.943  324.669 225.332 1.00 27.00  ? 71   HIS C O   1 
ATOM   6412  C  CB  . HIS C  3  71  ? 80.544  326.119 223.349 1.00 27.58  ? 71   HIS C CB  1 
ATOM   6413  C  CG  . HIS C  3  71  ? 79.587  326.712 222.340 1.00 29.28  ? 71   HIS C CG  1 
ATOM   6414  N  ND1 . HIS C  3  71  ? 79.955  327.032 221.047 1.00 27.69  ? 71   HIS C ND1 1 
ATOM   6415  C  CD2 . HIS C  3  71  ? 78.261  327.018 222.448 1.00 27.92  ? 71   HIS C CD2 1 
ATOM   6416  C  CE1 . HIS C  3  71  ? 78.921  327.564 220.419 1.00 25.39  ? 71   HIS C CE1 1 
ATOM   6417  N  NE2 . HIS C  3  71  ? 77.875  327.570 221.242 1.00 23.98  ? 71   HIS C NE2 1 
ATOM   6418  N  N   . THR C  3  72  ? 80.053  323.596 226.017 1.00 29.16  ? 72   THR C N   1 
ATOM   6419  C  CA  . THR C  3  72  ? 80.778  322.467 226.576 1.00 27.78  ? 72   THR C CA  1 
ATOM   6420  C  C   . THR C  3  72  ? 81.446  321.631 225.418 1.00 29.81  ? 72   THR C C   1 
ATOM   6421  O  O   . THR C  3  72  ? 81.189  321.883 224.244 1.00 29.19  ? 72   THR C O   1 
ATOM   6422  C  CB  . THR C  3  72  ? 79.829  321.524 227.240 1.00 29.17  ? 72   THR C CB  1 
ATOM   6423  O  OG1 . THR C  3  72  ? 78.756  321.198 226.319 1.00 30.81  ? 72   THR C OG1 1 
ATOM   6424  C  CG2 . THR C  3  72  ? 79.139  322.308 228.474 1.00 29.12  ? 72   THR C CG2 1 
ATOM   6425  N  N   . PRO C  3  73  ? 82.405  320.737 225.788 1.00 32.44  ? 73   PRO C N   1 
ATOM   6426  C  CA  . PRO C  3  73  ? 83.091  319.882 224.809 1.00 32.85  ? 73   PRO C CA  1 
ATOM   6427  C  C   . PRO C  3  73  ? 82.068  319.191 223.972 1.00 33.71  ? 73   PRO C C   1 
ATOM   6428  O  O   . PRO C  3  73  ? 82.361  318.969 222.788 1.00 33.65  ? 73   PRO C O   1 
ATOM   6429  C  CB  . PRO C  3  73  ? 83.865  318.878 225.667 1.00 30.23  ? 73   PRO C CB  1 
ATOM   6430  C  CG  . PRO C  3  73  ? 84.426  319.930 226.953 1.00 35.56  ? 73   PRO C CG  1 
ATOM   6431  C  CD  . PRO C  3  73  ? 82.981  320.607 227.158 1.00 29.54  ? 73   PRO C CD  1 
ATOM   6432  N  N   . ALA C  3  74  ? 80.917  318.848 224.563 1.00 31.45  ? 74   ALA C N   1 
ATOM   6433  C  CA  . ALA C  3  74  ? 79.941  318.009 223.806 1.00 31.95  ? 74   ALA C CA  1 
ATOM   6434  C  C   . ALA C  3  74  ? 79.313  318.869 222.745 1.00 32.29  ? 74   ALA C C   1 
ATOM   6435  O  O   . ALA C  3  74  ? 79.210  318.420 221.608 1.00 35.64  ? 74   ALA C O   1 
ATOM   6436  C  CB  . ALA C  3  74  ? 78.863  317.439 224.707 1.00 32.65  ? 74   ALA C CB  1 
ATOM   6437  N  N   . VAL C  3  75  ? 78.907  320.081 223.102 1.00 31.56  ? 75   VAL C N   1 
ATOM   6438  C  CA  . VAL C  3  75  ? 78.392  321.139 222.164 1.00 29.89  ? 75   VAL C CA  1 
ATOM   6439  C  C   . VAL C  3  75  ? 79.421  321.444 221.082 1.00 29.71  ? 75   VAL C C   1 
ATOM   6440  O  O   . VAL C  3  75  ? 79.127  321.430 219.880 1.00 29.94  ? 75   VAL C O   1 
ATOM   6441  C  CB  . VAL C  3  75  ? 77.921  322.363 222.891 1.00 27.74  ? 75   VAL C CB  1 
ATOM   6442  C  CG1 . VAL C  3  75  ? 77.467  323.491 221.908 1.00 28.81  ? 75   VAL C CG1 1 
ATOM   6443  C  CG2 . VAL C  3  75  ? 76.610  321.961 223.804 1.00 30.28  ? 75   VAL C CG2 1 
ATOM   6444  N  N   . GLN C  3  76  ? 80.670  321.590 221.502 1.00 28.26  ? 76   GLN C N   1 
ATOM   6445  C  CA  . GLN C  3  76  ? 81.683  321.970 220.509 1.00 28.54  ? 76   GLN C CA  1 
ATOM   6446  C  C   . GLN C  3  76  ? 81.836  320.815 219.516 1.00 29.11  ? 76   GLN C C   1 
ATOM   6447  O  O   . GLN C  3  76  ? 82.039  321.042 218.284 1.00 29.79  ? 76   GLN C O   1 
ATOM   6448  C  CB  . GLN C  3  76  ? 83.041  322.239 221.254 1.00 29.18  ? 76   GLN C CB  1 
ATOM   6449  C  CG  . GLN C  3  76  ? 83.848  323.213 220.499 1.00 36.50  ? 76   GLN C CG  1 
ATOM   6450  C  CD  . GLN C  3  76  ? 85.216  323.473 221.064 1.00 34.26  ? 76   GLN C CD  1 
ATOM   6451  O  OE1 . GLN C  3  76  ? 85.442  323.377 222.323 1.00 35.55  ? 76   GLN C OE1 1 
ATOM   6452  N  NE2 . GLN C  3  76  ? 86.135  323.867 220.164 1.00 30.87  ? 76   GLN C NE2 1 
ATOM   6453  N  N   . LYS C  3  77  ? 81.793  319.569 220.014 1.00 30.29  ? 77   LYS C N   1 
ATOM   6454  C  CA  . LYS C  3  77  ? 81.959  318.388 219.124 1.00 32.66  ? 77   LYS C CA  1 
ATOM   6455  C  C   . LYS C  3  77  ? 80.818  318.308 218.092 1.00 31.33  ? 77   LYS C C   1 
ATOM   6456  O  O   . LYS C  3  77  ? 81.036  317.910 216.943 1.00 31.44  ? 77   LYS C O   1 
ATOM   6457  C  CB  . LYS C  3  77  ? 81.864  317.165 219.967 1.00 34.02  ? 77   LYS C CB  1 
ATOM   6458  C  CG  . LYS C  3  77  ? 82.881  316.116 219.792 1.00 47.09  ? 77   LYS C CG  1 
ATOM   6459  C  CD  . LYS C  3  77  ? 82.337  314.990 218.975 1.00 57.40  ? 77   LYS C CD  1 
ATOM   6460  C  CE  . LYS C  3  77  ? 82.905  313.592 219.384 1.00 64.57  ? 77   LYS C CE  1 
ATOM   6461  N  NZ  . LYS C  3  77  ? 84.362  313.392 219.009 1.00 68.47  ? 77   LYS C NZ  1 
ATOM   6462  N  N   . GLY C  3  78  ? 79.587  318.581 218.502 1.00 30.64  ? 78   GLY C N   1 
ATOM   6463  C  CA  . GLY C  3  78  ? 78.501  318.624 217.529 1.00 28.63  ? 78   GLY C CA  1 
ATOM   6464  C  C   . GLY C  3  78  ? 78.749  319.678 216.461 1.00 31.05  ? 78   GLY C C   1 
ATOM   6465  O  O   . GLY C  3  78  ? 78.528  319.406 215.230 1.00 31.21  ? 78   GLY C O   1 
ATOM   6466  N  N   . LEU C  3  79  ? 79.150  320.894 216.871 1.00 30.44  ? 79   LEU C N   1 
ATOM   6467  C  CA  . LEU C  3  79  ? 79.525  321.930 215.904 1.00 31.54  ? 79   LEU C CA  1 
ATOM   6468  C  C   . LEU C  3  79  ? 80.595  321.534 214.913 1.00 30.32  ? 79   LEU C C   1 
ATOM   6469  O  O   . LEU C  3  79  ? 80.513  321.898 213.700 1.00 27.67  ? 79   LEU C O   1 
ATOM   6470  C  CB  . LEU C  3  79  ? 79.888  323.319 216.587 1.00 30.68  ? 79   LEU C CB  1 
ATOM   6471  C  CG  . LEU C  3  79  ? 78.668  324.009 217.314 1.00 29.07  ? 79   LEU C CG  1 
ATOM   6472  C  CD1 . LEU C  3  79  ? 79.159  324.984 218.466 1.00 26.40  ? 79   LEU C CD1 1 
ATOM   6473  C  CD2 . LEU C  3  79  ? 77.620  324.737 216.467 1.00 30.01  ? 79   LEU C CD2 1 
ATOM   6474  N  N   . ARG C  3  80  ? 81.567  320.741 215.373 1.00 30.02  ? 80   ARG C N   1 
ATOM   6475  C  CA  . ARG C  3  80  ? 82.615  320.274 214.475 1.00 30.29  ? 80   ARG C CA  1 
ATOM   6476  C  C   . ARG C  3  80  ? 81.976  319.313 213.429 1.00 32.36  ? 80   ARG C C   1 
ATOM   6477  O  O   . ARG C  3  80  ? 82.283  319.425 212.257 1.00 30.01  ? 80   ARG C O   1 
ATOM   6478  C  CB  . ARG C  3  80  ? 83.608  319.435 215.220 1.00 29.51  ? 80   ARG C CB  1 
ATOM   6479  C  CG  . ARG C  3  80  ? 84.518  320.288 216.259 1.00 29.16  ? 80   ARG C CG  1 
ATOM   6480  C  CD  . ARG C  3  80  ? 85.558  319.358 216.960 1.00 42.26  ? 80   ARG C CD  1 
ATOM   6481  N  NE  . ARG C  3  80  ? 86.790  320.146 216.960 1.00 55.41  ? 80   ARG C NE  1 
ATOM   6482  C  CZ  . ARG C  3  80  ? 87.824  319.927 216.148 1.00 55.00  ? 80   ARG C CZ  1 
ATOM   6483  N  NH1 . ARG C  3  80  ? 87.935  318.831 215.288 1.00 51.91  ? 80   ARG C NH1 1 
ATOM   6484  N  NH2 . ARG C  3  80  ? 88.782  320.810 216.217 1.00 62.04  ? 80   ARG C NH2 1 
ATOM   6485  N  N   . TYR C  3  81  ? 81.111  318.396 213.872 1.00 28.83  ? 81   TYR C N   1 
ATOM   6486  C  CA  . TYR C  3  81  ? 80.325  317.515 212.905 1.00 29.57  ? 81   TYR C CA  1 
ATOM   6487  C  C   . TYR C  3  81  ? 79.552  318.411 211.967 1.00 30.12  ? 81   TYR C C   1 
ATOM   6488  O  O   . TYR C  3  81  ? 79.612  318.172 210.769 1.00 31.12  ? 81   TYR C O   1 
ATOM   6489  C  CB  . TYR C  3  81  ? 79.367  316.610 213.625 1.00 30.42  ? 81   TYR C CB  1 
ATOM   6490  C  CG  . TYR C  3  81  ? 80.082  315.446 214.293 1.00 38.87  ? 81   TYR C CG  1 
ATOM   6491  C  CD1 . TYR C  3  81  ? 80.892  314.580 213.562 1.00 41.75  ? 81   TYR C CD1 1 
ATOM   6492  C  CD2 . TYR C  3  81  ? 79.889  315.193 215.655 1.00 41.22  ? 81   TYR C CD2 1 
ATOM   6493  C  CE1 . TYR C  3  81  ? 81.557  313.495 214.208 1.00 46.93  ? 81   TYR C CE1 1 
ATOM   6494  C  CE2 . TYR C  3  81  ? 80.557  314.158 216.313 1.00 46.54  ? 81   TYR C CE2 1 
ATOM   6495  C  CZ  . TYR C  3  81  ? 81.394  313.325 215.605 1.00 48.51  ? 81   TYR C CZ  1 
ATOM   6496  O  OH  . TYR C  3  81  ? 82.017  312.298 216.307 1.00 46.73  ? 81   TYR C OH  1 
ATOM   6497  N  N   . GLY C  3  82  ? 78.839  319.413 212.471 1.00 26.97  ? 82   GLY C N   1 
ATOM   6498  C  CA  . GLY C  3  82  ? 77.954  320.188 211.600 1.00 27.68  ? 82   GLY C CA  1 
ATOM   6499  C  C   . GLY C  3  82  ? 78.749  320.934 210.553 1.00 29.93  ? 82   GLY C C   1 
ATOM   6500  O  O   . GLY C  3  82  ? 78.352  320.993 209.415 1.00 28.35  ? 82   GLY C O   1 
ATOM   6501  N  N   . MET C  3  83  ? 79.935  321.428 210.931 1.00 28.35  ? 83   MET C N   1 
ATOM   6502  C  CA  . MET C  3  83  ? 80.751  322.118 209.973 1.00 27.55  ? 83   MET C CA  1 
ATOM   6503  C  C   . MET C  3  83  ? 81.268  321.148 208.908 1.00 26.60  ? 83   MET C C   1 
ATOM   6504  O  O   . MET C  3  83  ? 81.267  321.500 207.719 1.00 27.31  ? 83   MET C O   1 
ATOM   6505  C  CB  . MET C  3  83  ? 81.893  322.939 210.575 1.00 28.56  ? 83   MET C CB  1 
ATOM   6506  C  CG  . MET C  3  83  ? 82.584  323.880 209.607 1.00 28.12  ? 83   MET C CG  1 
ATOM   6507  S  SD  . MET C  3  83  ? 81.527  325.281 209.203 1.00 31.27  ? 83   MET C SD  1 
ATOM   6508  C  CE  . MET C  3  83  ? 82.197  325.816 207.729 1.00 26.75  ? 83   MET C CE  1 
ATOM   6509  N  N   . ILE C  3  84  ? 81.794  320.012 209.317 1.00 24.80  ? 84   ILE C N   1 
ATOM   6510  C  CA  . ILE C  3  84  ? 82.305  319.094 208.368 1.00 28.84  ? 84   ILE C CA  1 
ATOM   6511  C  C   . ILE C  3  84  ? 81.206  318.676 207.326 1.00 29.53  ? 84   ILE C C   1 
ATOM   6512  O  O   . ILE C  3  84  ? 81.467  318.623 206.091 1.00 29.65  ? 84   ILE C O   1 
ATOM   6513  C  CB  . ILE C  3  84  ? 82.882  317.894 209.178 1.00 30.01  ? 84   ILE C CB  1 
ATOM   6514  C  CG1 . ILE C  3  84  ? 84.221  318.311 209.821 1.00 28.58  ? 84   ILE C CG1 1 
ATOM   6515  C  CG2 . ILE C  3  84  ? 83.092  316.619 208.231 1.00 31.41  ? 84   ILE C CG2 1 
ATOM   6516  C  CD1 . ILE C  3  84  ? 84.685  317.268 210.940 1.00 33.41  ? 84   ILE C CD1 1 
ATOM   6517  N  N   . LEU C  3  85  ? 79.984  318.390 207.829 1.00 28.20  ? 85   LEU C N   1 
ATOM   6518  C  CA  . LEU C  3  85  ? 78.840  317.986 206.999 1.00 26.96  ? 85   LEU C CA  1 
ATOM   6519  C  C   . LEU C  3  85  ? 78.504  319.063 206.048 1.00 25.89  ? 85   LEU C C   1 
ATOM   6520  O  O   . LEU C  3  85  ? 78.214  318.799 204.868 1.00 27.89  ? 85   LEU C O   1 
ATOM   6521  C  CB  . LEU C  3  85  ? 77.607  317.629 207.867 1.00 24.18  ? 85   LEU C CB  1 
ATOM   6522  C  CG  . LEU C  3  85  ? 77.968  316.373 208.736 1.00 27.72  ? 85   LEU C CG  1 
ATOM   6523  C  CD1 . LEU C  3  85  ? 76.920  316.114 209.815 1.00 26.72  ? 85   LEU C CD1 1 
ATOM   6524  C  CD2 . LEU C  3  85  ? 78.209  315.052 207.939 1.00 24.97  ? 85   LEU C CD2 1 
ATOM   6525  N  N   . PHE C  3  86  ? 78.552  320.305 206.523 1.00 25.20  ? 86   PHE C N   1 
ATOM   6526  C  CA  . PHE C  3  86  ? 78.305  321.472 205.675 1.00 27.91  ? 86   PHE C CA  1 
ATOM   6527  C  C   . PHE C  3  86  ? 79.239  321.556 204.486 1.00 26.80  ? 86   PHE C C   1 
ATOM   6528  O  O   . PHE C  3  86  ? 78.815  321.747 203.301 1.00 27.72  ? 86   PHE C O   1 
ATOM   6529  C  CB  . PHE C  3  86  ? 78.310  322.729 206.511 1.00 26.81  ? 86   PHE C CB  1 
ATOM   6530  C  CG  . PHE C  3  86  ? 78.042  324.011 205.636 1.00 30.75  ? 86   PHE C CG  1 
ATOM   6531  C  CD1 . PHE C  3  86  ? 76.735  324.310 205.133 1.00 34.26  ? 86   PHE C CD1 1 
ATOM   6532  C  CD2 . PHE C  3  86  ? 79.105  324.860 205.332 1.00 31.22  ? 86   PHE C CD2 1 
ATOM   6533  C  CE1 . PHE C  3  86  ? 76.547  325.378 204.318 1.00 35.96  ? 86   PHE C CE1 1 
ATOM   6534  C  CE2 . PHE C  3  86  ? 78.922  326.005 204.463 1.00 35.95  ? 86   PHE C CE2 1 
ATOM   6535  C  CZ  . PHE C  3  86  ? 77.623  326.231 203.969 1.00 32.90  ? 86   PHE C CZ  1 
ATOM   6536  N  N   . ILE C  3  87  ? 80.527  321.427 204.774 1.00 27.39  ? 87   ILE C N   1 
ATOM   6537  C  CA  . ILE C  3  87  ? 81.568  321.509 203.731 1.00 26.85  ? 87   ILE C CA  1 
ATOM   6538  C  C   . ILE C  3  87  ? 81.358  320.296 202.726 1.00 27.65  ? 87   ILE C C   1 
ATOM   6539  O  O   . ILE C  3  87  ? 81.438  320.457 201.505 1.00 30.50  ? 87   ILE C O   1 
ATOM   6540  C  CB  . ILE C  3  87  ? 82.972  321.435 204.409 1.00 25.00  ? 87   ILE C CB  1 
ATOM   6541  C  CG1 . ILE C  3  87  ? 83.207  322.803 205.124 1.00 25.62  ? 87   ILE C CG1 1 
ATOM   6542  C  CG2 . ILE C  3  87  ? 84.067  321.226 203.303 1.00 24.90  ? 87   ILE C CG2 1 
ATOM   6543  C  CD1 . ILE C  3  87  ? 84.514  322.793 205.934 1.00 28.83  ? 87   ILE C CD1 1 
ATOM   6544  N  N   . ILE C  3  88  ? 81.071  319.130 203.245 1.00 27.94  ? 88   ILE C N   1 
ATOM   6545  C  CA  . ILE C  3  88  ? 80.689  317.964 202.347 1.00 29.11  ? 88   ILE C CA  1 
ATOM   6546  C  C   . ILE C  3  88  ? 79.571  318.332 201.334 1.00 30.53  ? 88   ILE C C   1 
ATOM   6547  O  O   . ILE C  3  88  ? 79.752  318.099 200.077 1.00 30.18  ? 88   ILE C O   1 
ATOM   6548  C  CB  . ILE C  3  88  ? 80.340  316.689 203.106 1.00 28.77  ? 88   ILE C CB  1 
ATOM   6549  C  CG1 . ILE C  3  88  ? 81.658  316.209 203.776 1.00 30.46  ? 88   ILE C CG1 1 
ATOM   6550  C  CG2 . ILE C  3  88  ? 79.719  315.583 202.089 1.00 26.73  ? 88   ILE C CG2 1 
ATOM   6551  C  CD1 . ILE C  3  88  ? 81.490  315.094 204.859 1.00 22.32  ? 88   ILE C CD1 1 
ATOM   6552  N  N   . SER C  3  89  ? 78.501  318.956 201.840 1.00 29.89  ? 89   SER C N   1 
ATOM   6553  C  CA  . SER C  3  89  ? 77.398  319.366 200.971 1.00 29.66  ? 89   SER C CA  1 
ATOM   6554  C  C   . SER C  3  89  ? 77.864  320.402 199.914 1.00 30.44  ? 89   SER C C   1 
ATOM   6555  O  O   . SER C  3  89  ? 77.424  320.290 198.754 1.00 28.74  ? 89   SER C O   1 
ATOM   6556  C  CB  . SER C  3  89  ? 76.209  319.885 201.823 1.00 30.23  ? 89   SER C CB  1 
ATOM   6557  O  OG  . SER C  3  89  ? 76.459  321.305 202.190 1.00 32.29  ? 89   SER C OG  1 
ATOM   6558  N  N   . GLU C  3  90  ? 78.847  321.303 200.257 1.00 29.02  ? 90   GLU C N   1 
ATOM   6559  C  CA  . GLU C  3  90  ? 79.388  322.229 199.299 1.00 30.39  ? 90   GLU C CA  1 
ATOM   6560  C  C   . GLU C  3  90  ? 80.299  321.564 198.278 1.00 28.11  ? 90   GLU C C   1 
ATOM   6561  O  O   . GLU C  3  90  ? 80.338  321.976 197.169 1.00 27.67  ? 90   GLU C O   1 
ATOM   6562  C  CB  . GLU C  3  90  ? 80.211  323.330 200.025 1.00 32.03  ? 90   GLU C CB  1 
ATOM   6563  C  CG  . GLU C  3  90  ? 79.310  324.011 201.016 1.00 35.92  ? 90   GLU C CG  1 
ATOM   6564  C  CD  . GLU C  3  90  ? 79.041  325.344 200.522 1.00 50.38  ? 90   GLU C CD  1 
ATOM   6565  O  OE1 . GLU C  3  90  ? 78.326  325.435 199.488 1.00 50.78  ? 90   GLU C OE1 1 
ATOM   6566  O  OE2 . GLU C  3  90  ? 79.663  326.290 201.132 1.00 48.40  ? 90   GLU C OE2 1 
ATOM   6567  N  N   . VAL C  3  91  ? 80.975  320.519 198.680 1.00 27.76  ? 91   VAL C N   1 
ATOM   6568  C  CA  . VAL C  3  91  ? 81.808  319.800 197.784 1.00 29.84  ? 91   VAL C CA  1 
ATOM   6569  C  C   . VAL C  3  91  ? 80.903  319.117 196.762 1.00 27.68  ? 91   VAL C C   1 
ATOM   6570  O  O   . VAL C  3  91  ? 81.198  319.115 195.555 1.00 28.58  ? 91   VAL C O   1 
ATOM   6571  C  CB  . VAL C  3  91  ? 82.641  318.738 198.533 1.00 31.09  ? 91   VAL C CB  1 
ATOM   6572  C  CG1 . VAL C  3  91  ? 83.251  317.696 197.519 1.00 29.42  ? 91   VAL C CG1 1 
ATOM   6573  C  CG2 . VAL C  3  91  ? 83.818  319.400 199.358 1.00 30.99  ? 91   VAL C CG2 1 
ATOM   6574  N  N   . LEU C  3  92  ? 79.799  318.502 197.211 1.00 27.65  ? 92   LEU C N   1 
ATOM   6575  C  CA  . LEU C  3  92  ? 78.867  317.865 196.239 1.00 26.44  ? 92   LEU C CA  1 
ATOM   6576  C  C   . LEU C  3  92  ? 78.273  318.884 195.292 1.00 25.94  ? 92   LEU C C   1 
ATOM   6577  O  O   . LEU C  3  92  ? 78.039  318.627 194.126 1.00 26.34  ? 92   LEU C O   1 
ATOM   6578  C  CB  . LEU C  3  92  ? 77.828  317.040 196.951 1.00 23.39  ? 92   LEU C CB  1 
ATOM   6579  C  CG  . LEU C  3  92  ? 78.246  315.573 197.309 1.00 26.32  ? 92   LEU C CG  1 
ATOM   6580  C  CD1 . LEU C  3  92  ? 78.273  314.842 195.967 1.00 27.58  ? 92   LEU C CD1 1 
ATOM   6581  C  CD2 . LEU C  3  92  ? 79.734  315.535 197.916 1.00 26.55  ? 92   LEU C CD2 1 
ATOM   6582  N  N   . PHE C  3  93  ? 77.959  320.064 195.811 1.00 26.40  ? 93   PHE C N   1 
ATOM   6583  C  CA  . PHE C  3  93  ? 77.500  321.170 194.935 1.00 28.34  ? 93   PHE C CA  1 
ATOM   6584  C  C   . PHE C  3  93  ? 78.519  321.470 193.823 1.00 27.78  ? 93   PHE C C   1 
ATOM   6585  O  O   . PHE C  3  93  ? 78.131  321.505 192.655 1.00 29.85  ? 93   PHE C O   1 
ATOM   6586  C  CB  . PHE C  3  93  ? 77.192  322.407 195.840 1.00 27.40  ? 93   PHE C CB  1 
ATOM   6587  C  CG  . PHE C  3  93  ? 76.585  323.570 195.105 1.00 31.85  ? 93   PHE C CG  1 
ATOM   6588  C  CD1 . PHE C  3  93  ? 75.332  323.479 194.565 1.00 28.68  ? 93   PHE C CD1 1 
ATOM   6589  C  CD2 . PHE C  3  93  ? 77.310  324.770 194.967 1.00 36.10  ? 93   PHE C CD2 1 
ATOM   6590  C  CE1 . PHE C  3  93  ? 74.735  324.492 193.927 1.00 32.20  ? 93   PHE C CE1 1 
ATOM   6591  C  CE2 . PHE C  3  93  ? 76.734  325.838 194.294 1.00 41.68  ? 93   PHE C CE2 1 
ATOM   6592  C  CZ  . PHE C  3  93  ? 75.385  325.699 193.758 1.00 37.77  ? 93   PHE C CZ  1 
ATOM   6593  N  N   . PHE C  3  94  ? 79.821  321.650 194.125 1.00 28.44  ? 94   PHE C N   1 
ATOM   6594  C  CA  . PHE C  3  94  ? 80.774  321.943 193.072 1.00 27.19  ? 94   PHE C CA  1 
ATOM   6595  C  C   . PHE C  3  94  ? 80.879  320.768 192.148 1.00 29.44  ? 94   PHE C C   1 
ATOM   6596  O  O   . PHE C  3  94  ? 81.111  320.916 190.953 1.00 29.36  ? 94   PHE C O   1 
ATOM   6597  C  CB  . PHE C  3  94  ? 82.193  322.294 193.622 1.00 26.63  ? 94   PHE C CB  1 
ATOM   6598  C  CG  . PHE C  3  94  ? 82.260  323.751 193.987 1.00 29.42  ? 94   PHE C CG  1 
ATOM   6599  C  CD1 . PHE C  3  94  ? 81.956  324.156 195.256 1.00 30.91  ? 94   PHE C CD1 1 
ATOM   6600  C  CD2 . PHE C  3  94  ? 82.427  324.750 192.968 1.00 29.97  ? 94   PHE C CD2 1 
ATOM   6601  C  CE1 . PHE C  3  94  ? 81.965  325.560 195.592 1.00 32.53  ? 94   PHE C CE1 1 
ATOM   6602  C  CE2 . PHE C  3  94  ? 82.465  326.106 193.297 1.00 32.82  ? 94   PHE C CE2 1 
ATOM   6603  C  CZ  . PHE C  3  94  ? 82.184  326.527 194.611 1.00 30.04  ? 94   PHE C CZ  1 
ATOM   6604  N  N   . THR C  3  95  ? 80.819  319.568 192.715 1.00 27.44  ? 95   THR C N   1 
ATOM   6605  C  CA  . THR C  3  95  ? 80.825  318.354 191.885 1.00 29.96  ? 95   THR C CA  1 
ATOM   6606  C  C   . THR C  3  95  ? 79.832  318.392 190.679 1.00 28.62  ? 95   THR C C   1 
ATOM   6607  O  O   . THR C  3  95  ? 80.159  317.909 189.583 1.00 31.17  ? 95   THR C O   1 
ATOM   6608  C  CB  . THR C  3  95  ? 80.541  317.151 192.831 1.00 31.10  ? 95   THR C CB  1 
ATOM   6609  O  OG1 . THR C  3  95  ? 81.723  317.000 193.716 1.00 33.51  ? 95   THR C OG1 1 
ATOM   6610  C  CG2 . THR C  3  95  ? 80.419  315.926 192.119 1.00 38.95  ? 95   THR C CG2 1 
ATOM   6611  N  N   . GLY C  3  96  ? 78.629  318.882 190.854 1.00 26.94  ? 96   GLY C N   1 
ATOM   6612  C  CA  . GLY C  3  96  ? 77.712  318.891 189.720 1.00 29.61  ? 96   GLY C CA  1 
ATOM   6613  C  C   . GLY C  3  96  ? 78.236  319.847 188.634 1.00 32.02  ? 96   GLY C C   1 
ATOM   6614  O  O   . GLY C  3  96  ? 78.002  319.580 187.472 1.00 32.23  ? 96   GLY C O   1 
ATOM   6615  N  N   . PHE C  3  97  ? 78.921  320.927 189.011 1.00 31.50  ? 97   PHE C N   1 
ATOM   6616  C  CA  . PHE C  3  97  ? 79.585  321.871 188.005 1.00 31.60  ? 97   PHE C CA  1 
ATOM   6617  C  C   . PHE C  3  97  ? 80.832  321.306 187.365 1.00 30.98  ? 97   PHE C C   1 
ATOM   6618  O  O   . PHE C  3  97  ? 81.048  321.475 186.173 1.00 29.07  ? 97   PHE C O   1 
ATOM   6619  C  CB  . PHE C  3  97  ? 79.902  323.212 188.688 1.00 32.12  ? 97   PHE C CB  1 
ATOM   6620  C  CG  . PHE C  3  97  ? 78.672  323.927 189.104 1.00 35.00  ? 97   PHE C CG  1 
ATOM   6621  C  CD1 . PHE C  3  97  ? 77.809  324.392 188.155 1.00 36.10  ? 97   PHE C CD1 1 
ATOM   6622  C  CD2 . PHE C  3  97  ? 78.342  324.130 190.442 1.00 39.11  ? 97   PHE C CD2 1 
ATOM   6623  C  CE1 . PHE C  3  97  ? 76.639  325.022 188.553 1.00 35.45  ? 97   PHE C CE1 1 
ATOM   6624  C  CE2 . PHE C  3  97  ? 77.118  324.758 190.794 1.00 40.79  ? 97   PHE C CE2 1 
ATOM   6625  C  CZ  . PHE C  3  97  ? 76.312  325.150 189.856 1.00 37.32  ? 97   PHE C CZ  1 
ATOM   6626  N  N   . PHE C  3  98  ? 81.590  320.480 188.118 1.00 29.97  ? 98   PHE C N   1 
ATOM   6627  C  CA  . PHE C  3  98  ? 82.664  319.762 187.489 1.00 30.99  ? 98   PHE C CA  1 
ATOM   6628  C  C   . PHE C  3  98  ? 82.142  318.720 186.478 1.00 31.80  ? 98   PHE C C   1 
ATOM   6629  O  O   . PHE C  3  98  ? 82.757  318.506 185.391 1.00 32.91  ? 98   PHE C O   1 
ATOM   6630  C  CB  . PHE C  3  98  ? 83.576  319.128 188.512 1.00 29.34  ? 98   PHE C CB  1 
ATOM   6631  C  CG  . PHE C  3  98  ? 84.534  320.124 189.100 1.00 33.11  ? 98   PHE C CG  1 
ATOM   6632  C  CD1 . PHE C  3  98  ? 85.781  320.372 188.489 1.00 37.17  ? 98   PHE C CD1 1 
ATOM   6633  C  CD2 . PHE C  3  98  ? 84.200  320.822 190.243 1.00 34.58  ? 98   PHE C CD2 1 
ATOM   6634  C  CE1 . PHE C  3  98  ? 86.741  321.345 189.039 1.00 37.19  ? 98   PHE C CE1 1 
ATOM   6635  C  CE2 . PHE C  3  98  ? 85.088  321.782 190.833 1.00 36.09  ? 98   PHE C CE2 1 
ATOM   6636  C  CZ  . PHE C  3  98  ? 86.377  322.071 190.220 1.00 37.61  ? 98   PHE C CZ  1 
ATOM   6637  N  N   . TRP C  3  99  ? 81.060  318.061 186.857 1.00 31.01  ? 99   TRP C N   1 
ATOM   6638  C  CA  . TRP C  3  99  ? 80.461  317.067 185.992 1.00 29.31  ? 99   TRP C CA  1 
ATOM   6639  C  C   . TRP C  3  99  ? 80.008  317.760 184.686 1.00 27.14  ? 99   TRP C C   1 
ATOM   6640  O  O   . TRP C  3  99  ? 80.305  317.299 183.575 1.00 28.85  ? 99   TRP C O   1 
ATOM   6641  C  CB  . TRP C  3  99  ? 79.264  316.442 186.735 1.00 25.42  ? 99   TRP C CB  1 
ATOM   6642  C  CG  . TRP C  3  99  ? 78.616  315.263 186.010 1.00 29.79  ? 99   TRP C CG  1 
ATOM   6643  C  CD1 . TRP C  3  99  ? 78.642  314.931 184.649 1.00 33.40  ? 99   TRP C CD1 1 
ATOM   6644  C  CD2 . TRP C  3  99  ? 77.818  314.236 186.638 1.00 30.26  ? 99   TRP C CD2 1 
ATOM   6645  N  NE1 . TRP C  3  99  ? 77.915  313.752 184.447 1.00 28.97  ? 99   TRP C NE1 1 
ATOM   6646  C  CE2 . TRP C  3  99  ? 77.368  313.356 185.628 1.00 30.55  ? 99   TRP C CE2 1 
ATOM   6647  C  CE3 . TRP C  3  99  ? 77.379  314.045 187.983 1.00 33.22  ? 99   TRP C CE3 1 
ATOM   6648  C  CZ2 . TRP C  3  99  ? 76.563  312.222 185.903 1.00 25.73  ? 99   TRP C CZ2 1 
ATOM   6649  C  CZ3 . TRP C  3  99  ? 76.509  312.885 188.262 1.00 32.68  ? 99   TRP C CZ3 1 
ATOM   6650  C  CH2 . TRP C  3  99  ? 76.160  312.007 187.227 1.00 29.95  ? 99   TRP C CH2 1 
ATOM   6651  N  N   . ALA C  3  100 ? 79.230  318.854 184.805 1.00 28.05  ? 100  ALA C N   1 
ATOM   6652  C  CA  . ALA C  3  100 ? 78.848  319.696 183.600 1.00 26.95  ? 100  ALA C CA  1 
ATOM   6653  C  C   . ALA C  3  100 ? 80.086  320.041 182.751 1.00 27.32  ? 100  ALA C C   1 
ATOM   6654  O  O   . ALA C  3  100 ? 80.108  319.856 181.524 1.00 29.07  ? 100  ALA C O   1 
ATOM   6655  C  CB  . ALA C  3  100 ? 78.139  320.936 184.063 1.00 26.91  ? 100  ALA C CB  1 
ATOM   6656  N  N   . PHE C  3  101 ? 81.156  320.553 183.385 1.00 28.50  ? 101  PHE C N   1 
ATOM   6657  C  CA  . PHE C  3  101 ? 82.393  320.874 182.624 1.00 27.51  ? 101  PHE C CA  1 
ATOM   6658  C  C   . PHE C  3  101 ? 82.975  319.732 181.846 1.00 28.08  ? 101  PHE C C   1 
ATOM   6659  O  O   . PHE C  3  101 ? 83.232  319.795 180.579 1.00 27.65  ? 101  PHE C O   1 
ATOM   6660  C  CB  . PHE C  3  101 ? 83.494  321.431 183.588 1.00 27.23  ? 101  PHE C CB  1 
ATOM   6661  C  CG  . PHE C  3  101 ? 84.822  321.614 182.881 1.00 29.77  ? 101  PHE C CG  1 
ATOM   6662  C  CD1 . PHE C  3  101 ? 84.934  322.578 181.858 1.00 28.30  ? 101  PHE C CD1 1 
ATOM   6663  C  CD2 . PHE C  3  101 ? 85.894  320.698 183.112 1.00 27.16  ? 101  PHE C CD2 1 
ATOM   6664  C  CE1 . PHE C  3  101 ? 86.159  322.725 181.140 1.00 33.60  ? 101  PHE C CE1 1 
ATOM   6665  C  CE2 . PHE C  3  101 ? 87.079  320.848 182.457 1.00 33.37  ? 101  PHE C CE2 1 
ATOM   6666  C  CZ  . PHE C  3  101 ? 87.241  321.842 181.470 1.00 29.42  ? 101  PHE C CZ  1 
ATOM   6667  N  N   . TYR C  3  102 ? 83.166  318.606 182.524 1.00 28.97  ? 102  TYR C N   1 
ATOM   6668  C  CA  . TYR C  3  102 ? 83.745  317.450 181.843 1.00 31.02  ? 102  TYR C CA  1 
ATOM   6669  C  C   . TYR C  3  102 ? 82.842  316.829 180.755 1.00 31.15  ? 102  TYR C C   1 
ATOM   6670  O  O   . TYR C  3  102 ? 83.289  316.356 179.701 1.00 28.97  ? 102  TYR C O   1 
ATOM   6671  C  CB  . TYR C  3  102 ? 84.169  316.366 182.882 1.00 31.74  ? 102  TYR C CB  1 
ATOM   6672  C  CG  . TYR C  3  102 ? 85.578  316.758 183.484 1.00 32.65  ? 102  TYR C CG  1 
ATOM   6673  C  CD1 . TYR C  3  102 ? 85.724  317.165 184.768 1.00 36.47  ? 102  TYR C CD1 1 
ATOM   6674  C  CD2 . TYR C  3  102 ? 86.722  316.681 182.675 1.00 35.68  ? 102  TYR C CD2 1 
ATOM   6675  C  CE1 . TYR C  3  102 ? 86.946  317.535 185.295 1.00 38.42  ? 102  TYR C CE1 1 
ATOM   6676  C  CE2 . TYR C  3  102 ? 87.967  317.000 183.166 1.00 43.84  ? 102  TYR C CE2 1 
ATOM   6677  C  CZ  . TYR C  3  102 ? 88.090  317.433 184.497 1.00 41.40  ? 102  TYR C CZ  1 
ATOM   6678  O  OH  . TYR C  3  102 ? 89.419  317.765 184.941 1.00 41.28  ? 102  TYR C OH  1 
ATOM   6679  N  N   . HIS C  3  103 ? 81.556  316.791 181.012 1.00 29.89  ? 103  HIS C N   1 
ATOM   6680  C  CA  . HIS C  3  103 ? 80.664  316.247 180.040 1.00 26.22  ? 103  HIS C CA  1 
ATOM   6681  C  C   . HIS C  3  103 ? 80.783  317.022 178.758 1.00 29.49  ? 103  HIS C C   1 
ATOM   6682  O  O   . HIS C  3  103 ? 80.729  316.408 177.679 1.00 31.73  ? 103  HIS C O   1 
ATOM   6683  C  CB  . HIS C  3  103 ? 79.226  316.447 180.617 1.00 28.05  ? 103  HIS C CB  1 
ATOM   6684  C  CG  . HIS C  3  103 ? 78.138  315.956 179.705 1.00 27.63  ? 103  HIS C CG  1 
ATOM   6685  N  ND1 . HIS C  3  103 ? 77.572  314.695 179.807 1.00 27.62  ? 103  HIS C ND1 1 
ATOM   6686  C  CD2 . HIS C  3  103 ? 77.589  316.525 178.600 1.00 31.70  ? 103  HIS C CD2 1 
ATOM   6687  C  CE1 . HIS C  3  103 ? 76.681  314.524 178.820 1.00 32.49  ? 103  HIS C CE1 1 
ATOM   6688  N  NE2 . HIS C  3  103 ? 76.660  315.633 178.085 1.00 31.31  ? 103  HIS C NE2 1 
ATOM   6689  N  N   . SER C  3  104 ? 80.802  318.348 178.821 1.00 29.03  ? 104  SER C N   1 
ATOM   6690  C  CA  . SER C  3  104 ? 80.786  319.226 177.640 1.00 34.67  ? 104  SER C CA  1 
ATOM   6691  C  C   . SER C  3  104 ? 82.148  319.285 176.975 1.00 33.61  ? 104  SER C C   1 
ATOM   6692  O  O   . SER C  3  104 ? 82.215  319.315 175.799 1.00 33.65  ? 104  SER C O   1 
ATOM   6693  C  CB  . SER C  3  104 ? 80.536  320.652 178.055 1.00 37.23  ? 104  SER C CB  1 
ATOM   6694  O  OG  . SER C  3  104 ? 79.326  320.649 178.815 1.00 45.55  ? 104  SER C OG  1 
ATOM   6695  N  N   . SER C  3  105 ? 83.210  319.219 177.757 1.00 32.45  ? 105  SER C N   1 
ATOM   6696  C  CA  . SER C  3  105 ? 84.572  319.262 177.164 1.00 33.48  ? 105  SER C CA  1 
ATOM   6697  C  C   . SER C  3  105 ? 85.179  317.993 176.650 1.00 35.47  ? 105  SER C C   1 
ATOM   6698  O  O   . SER C  3  105 ? 86.039  318.065 175.757 1.00 36.08  ? 105  SER C O   1 
ATOM   6699  C  CB  . SER C  3  105 ? 85.513  319.944 178.139 1.00 33.11  ? 105  SER C CB  1 
ATOM   6700  O  OG  . SER C  3  105 ? 85.641  319.161 179.308 1.00 31.88  ? 105  SER C OG  1 
ATOM   6701  N  N   . LEU C  3  106 ? 84.768  316.851 177.217 1.00 33.06  ? 106  LEU C N   1 
ATOM   6702  C  CA  . LEU C  3  106 ? 85.197  315.506 176.799 1.00 35.40  ? 106  LEU C CA  1 
ATOM   6703  C  C   . LEU C  3  106 ? 84.507  315.047 175.499 1.00 36.64  ? 106  LEU C C   1 
ATOM   6704  O  O   . LEU C  3  106 ? 85.070  314.264 174.767 1.00 36.31  ? 106  LEU C O   1 
ATOM   6705  C  CB  . LEU C  3  106 ? 84.936  314.470 177.913 1.00 33.50  ? 106  LEU C CB  1 
ATOM   6706  C  CG  . LEU C  3  106 ? 85.792  314.688 179.162 1.00 35.94  ? 106  LEU C CG  1 
ATOM   6707  C  CD1 . LEU C  3  106 ? 85.383  313.620 180.245 1.00 35.63  ? 106  LEU C CD1 1 
ATOM   6708  C  CD2 . LEU C  3  106 ? 87.267  314.417 178.720 1.00 38.58  ? 106  LEU C CD2 1 
ATOM   6709  N  N   . ALA C  3  107 ? 83.344  315.612 175.156 1.00 36.24  ? 107  ALA C N   1 
ATOM   6710  C  CA  . ALA C  3  107 ? 82.607  315.182 173.954 1.00 37.25  ? 107  ALA C CA  1 
ATOM   6711  C  C   . ALA C  3  107 ? 82.076  316.442 173.225 1.00 35.49  ? 107  ALA C C   1 
ATOM   6712  O  O   . ALA C  3  107 ? 80.877  316.656 173.160 1.00 36.42  ? 107  ALA C O   1 
ATOM   6713  C  CB  . ALA C  3  107 ? 81.378  314.291 174.389 1.00 37.98  ? 107  ALA C CB  1 
ATOM   6714  N  N   . PRO C  3  108 ? 82.972  317.283 172.731 1.00 35.39  ? 108  PRO C N   1 
ATOM   6715  C  CA  . PRO C  3  108 ? 82.519  318.581 172.216 1.00 33.71  ? 108  PRO C CA  1 
ATOM   6716  C  C   . PRO C  3  108 ? 81.607  318.407 171.002 1.00 31.47  ? 108  PRO C C   1 
ATOM   6717  O  O   . PRO C  3  108 ? 81.900  317.587 170.112 1.00 30.21  ? 108  PRO C O   1 
ATOM   6718  C  CB  . PRO C  3  108 ? 83.854  319.350 171.957 1.00 35.29  ? 108  PRO C CB  1 
ATOM   6719  C  CG  . PRO C  3  108 ? 84.904  318.266 171.834 1.00 35.78  ? 108  PRO C CG  1 
ATOM   6720  C  CD  . PRO C  3  108 ? 84.439  317.115 172.706 1.00 32.82  ? 108  PRO C CD  1 
ATOM   6721  N  N   . THR C  3  109 ? 80.483  319.113 170.935 1.00 32.48  ? 109  THR C N   1 
ATOM   6722  C  CA  . THR C  3  109 ? 79.493  318.773 169.910 1.00 32.35  ? 109  THR C CA  1 
ATOM   6723  C  C   . THR C  3  109 ? 79.888  319.509 168.605 1.00 33.43  ? 109  THR C C   1 
ATOM   6724  O  O   . THR C  3  109 ? 80.836  320.308 168.596 1.00 32.58  ? 109  THR C O   1 
ATOM   6725  C  CB  . THR C  3  109 ? 78.104  319.211 170.342 1.00 33.16  ? 109  THR C CB  1 
ATOM   6726  O  OG1 . THR C  3  109 ? 78.094  320.670 170.456 1.00 35.00  ? 109  THR C OG1 1 
ATOM   6727  C  CG2 . THR C  3  109 ? 77.760  318.623 171.734 1.00 34.17  ? 109  THR C CG2 1 
ATOM   6728  N  N   . PRO C  3  110 ? 79.214  319.183 167.476 1.00 33.83  ? 110  PRO C N   1 
ATOM   6729  C  CA  . PRO C  3  110 ? 79.588  319.912 166.211 1.00 33.83  ? 110  PRO C CA  1 
ATOM   6730  C  C   . PRO C  3  110 ? 79.406  321.440 166.304 1.00 33.96  ? 110  PRO C C   1 
ATOM   6731  O  O   . PRO C  3  110 ? 80.122  322.151 165.569 1.00 34.32  ? 110  PRO C O   1 
ATOM   6732  C  CB  . PRO C  3  110 ? 78.534  319.400 165.185 1.00 32.17  ? 110  PRO C CB  1 
ATOM   6733  C  CG  . PRO C  3  110 ? 78.343  317.849 165.608 1.00 32.97  ? 110  PRO C CG  1 
ATOM   6734  C  CD  . PRO C  3  110 ? 78.266  318.044 167.230 1.00 33.72  ? 110  PRO C CD  1 
ATOM   6735  N  N   . GLU C  3  111 ? 78.367  321.918 167.019 1.00 33.73  ? 111  GLU C N   1 
ATOM   6736  C  CA  . GLU C  3  111 ? 78.211  323.390 167.202 1.00 33.20  ? 111  GLU C CA  1 
ATOM   6737  C  C   . GLU C  3  111 ? 79.475  324.122 167.641 1.00 34.27  ? 111  GLU C C   1 
ATOM   6738  O  O   . GLU C  3  111 ? 79.595  325.336 167.409 1.00 35.32  ? 111  GLU C O   1 
ATOM   6739  C  CB  . GLU C  3  111 ? 77.108  323.730 168.185 1.00 32.75  ? 111  GLU C CB  1 
ATOM   6740  C  CG  . GLU C  3  111 ? 75.641  323.313 167.670 1.00 31.25  ? 111  GLU C CG  1 
ATOM   6741  C  CD  . GLU C  3  111 ? 75.183  321.880 167.986 1.00 35.62  ? 111  GLU C CD  1 
ATOM   6742  O  OE1 . GLU C  3  111 ? 75.975  321.051 168.483 1.00 38.11  ? 111  GLU C OE1 1 
ATOM   6743  O  OE2 . GLU C  3  111 ? 73.961  321.598 167.837 1.00 39.63  ? 111  GLU C OE2 1 
ATOM   6744  N  N   . LEU C  3  112 ? 80.340  323.447 168.401 1.00 32.03  ? 112  LEU C N   1 
ATOM   6745  C  CA  . LEU C  3  112 ? 81.529  324.081 168.942 1.00 33.49  ? 112  LEU C CA  1 
ATOM   6746  C  C   . LEU C  3  112 ? 82.627  323.988 167.887 1.00 33.94  ? 112  LEU C C   1 
ATOM   6747  O  O   . LEU C  3  112 ? 83.756  324.398 168.155 1.00 32.40  ? 112  LEU C O   1 
ATOM   6748  C  CB  . LEU C  3  112 ? 82.110  323.302 170.182 1.00 31.55  ? 112  LEU C CB  1 
ATOM   6749  C  CG  . LEU C  3  112 ? 81.047  323.228 171.300 1.00 35.82  ? 112  LEU C CG  1 
ATOM   6750  C  CD1 . LEU C  3  112 ? 81.649  322.638 172.527 1.00 33.26  ? 112  LEU C CD1 1 
ATOM   6751  C  CD2 . LEU C  3  112 ? 80.645  324.614 171.616 1.00 33.19  ? 112  LEU C CD2 1 
ATOM   6752  N  N   . GLY C  3  113 ? 82.385  323.277 166.791 1.00 33.86  ? 113  GLY C N   1 
ATOM   6753  C  CA  . GLY C  3  113 ? 83.584  322.930 166.008 1.00 35.55  ? 113  GLY C CA  1 
ATOM   6754  C  C   . GLY C  3  113 ? 84.016  321.496 166.235 1.00 36.97  ? 113  GLY C C   1 
ATOM   6755  O  O   . GLY C  3  113 ? 84.945  321.039 165.633 1.00 36.94  ? 113  GLY C O   1 
ATOM   6756  N  N   . GLY C  3  114 ? 83.308  320.744 167.076 1.00 38.03  ? 114  GLY C N   1 
ATOM   6757  C  CA  . GLY C  3  114 ? 83.781  319.446 167.467 1.00 34.89  ? 114  GLY C CA  1 
ATOM   6758  C  C   . GLY C  3  114 ? 85.104  319.368 168.174 1.00 35.77  ? 114  GLY C C   1 
ATOM   6759  O  O   . GLY C  3  114 ? 85.765  318.307 168.136 1.00 37.85  ? 114  GLY C O   1 
ATOM   6760  N  N   . CYS C  3  115 ? 85.529  320.422 168.854 1.00 34.82  ? 115  CYS C N   1 
ATOM   6761  C  CA  . CYS C  3  115 ? 86.861  320.492 169.503 1.00 34.89  ? 115  CYS C CA  1 
ATOM   6762  C  C   . CYS C  3  115 ? 86.732  321.293 170.820 1.00 34.71  ? 115  CYS C C   1 
ATOM   6763  O  O   . CYS C  3  115 ? 85.734  322.032 170.985 1.00 35.96  ? 115  CYS C O   1 
ATOM   6764  C  CB  . CYS C  3  115 ? 87.886  321.222 168.597 1.00 35.15  ? 115  CYS C CB  1 
ATOM   6765  S  SG  . CYS C  3  115 ? 87.333  322.883 168.012 1.00 40.54  ? 115  CYS C SG  1 
ATOM   6766  N  N   . TRP C  3  116 ? 87.706  321.132 171.739 1.00 34.95  ? 116  TRP C N   1 
ATOM   6767  C  CA  . TRP C  3  116 ? 87.762  321.895 172.959 1.00 34.33  ? 116  TRP C CA  1 
ATOM   6768  C  C   . TRP C  3  116 ? 89.172  322.480 173.042 1.00 36.38  ? 116  TRP C C   1 
ATOM   6769  O  O   . TRP C  3  116 ? 90.140  321.741 172.870 1.00 38.16  ? 116  TRP C O   1 
ATOM   6770  C  CB  . TRP C  3  116 ? 87.570  321.013 174.207 1.00 35.20  ? 116  TRP C CB  1 
ATOM   6771  C  CG  . TRP C  3  116 ? 87.260  321.861 175.405 1.00 30.62  ? 116  TRP C CG  1 
ATOM   6772  C  CD1 . TRP C  3  116 ? 88.127  322.331 176.334 1.00 32.19  ? 116  TRP C CD1 1 
ATOM   6773  C  CD2 . TRP C  3  116 ? 85.961  322.414 175.716 1.00 29.29  ? 116  TRP C CD2 1 
ATOM   6774  N  NE1 . TRP C  3  116 ? 87.460  323.173 177.230 1.00 32.82  ? 116  TRP C NE1 1 
ATOM   6775  C  CE2 . TRP C  3  116 ? 86.107  323.174 176.910 1.00 30.36  ? 116  TRP C CE2 1 
ATOM   6776  C  CE3 . TRP C  3  116 ? 84.652  322.221 175.159 1.00 32.22  ? 116  TRP C CE3 1 
ATOM   6777  C  CZ2 . TRP C  3  116 ? 85.015  323.801 177.552 1.00 30.43  ? 116  TRP C CZ2 1 
ATOM   6778  C  CZ3 . TRP C  3  116 ? 83.538  322.876 175.793 1.00 34.01  ? 116  TRP C CZ3 1 
ATOM   6779  C  CH2 . TRP C  3  116 ? 83.713  323.629 176.991 1.00 30.47  ? 116  TRP C CH2 1 
ATOM   6780  N  N   . PRO C  3  117 ? 89.327  323.779 173.350 1.00 36.37  ? 117  PRO C N   1 
ATOM   6781  C  CA  . PRO C  3  117 ? 88.250  324.752 173.501 1.00 35.87  ? 117  PRO C CA  1 
ATOM   6782  C  C   . PRO C  3  117 ? 87.508  324.926 172.163 1.00 35.21  ? 117  PRO C C   1 
ATOM   6783  O  O   . PRO C  3  117 ? 88.058  324.587 171.142 1.00 35.08  ? 117  PRO C O   1 
ATOM   6784  C  CB  . PRO C  3  117 ? 88.970  326.013 173.924 1.00 36.25  ? 117  PRO C CB  1 
ATOM   6785  C  CG  . PRO C  3  117 ? 90.522  325.650 173.920 1.00 36.51  ? 117  PRO C CG  1 
ATOM   6786  C  CD  . PRO C  3  117 ? 90.694  324.319 173.561 1.00 36.44  ? 117  PRO C CD  1 
ATOM   6787  N  N   . PRO C  3  118 ? 86.245  325.395 172.188 1.00 34.19  ? 118  PRO C N   1 
ATOM   6788  C  CA  . PRO C  3  118 ? 85.471  325.522 170.988 1.00 33.08  ? 118  PRO C CA  1 
ATOM   6789  C  C   . PRO C  3  118 ? 86.206  326.491 170.006 1.00 34.66  ? 118  PRO C C   1 
ATOM   6790  O  O   . PRO C  3  118 ? 87.027  327.382 170.428 1.00 31.51  ? 118  PRO C O   1 
ATOM   6791  C  CB  . PRO C  3  118 ? 84.192  326.194 171.457 1.00 33.59  ? 118  PRO C CB  1 
ATOM   6792  C  CG  . PRO C  3  118 ? 84.024  325.656 172.896 1.00 32.60  ? 118  PRO C CG  1 
ATOM   6793  C  CD  . PRO C  3  118 ? 85.466  325.714 173.403 1.00 32.17  ? 118  PRO C CD  1 
ATOM   6794  N  N   . THR C  3  119 ? 85.876  326.340 168.719 1.00 33.50  ? 119  THR C N   1 
ATOM   6795  C  CA  . THR C  3  119 ? 86.293  327.360 167.725 1.00 34.39  ? 119  THR C CA  1 
ATOM   6796  C  C   . THR C  3  119 ? 85.841  328.728 168.217 1.00 34.44  ? 119  THR C C   1 
ATOM   6797  O  O   . THR C  3  119 ? 84.646  328.921 168.671 1.00 34.35  ? 119  THR C O   1 
ATOM   6798  C  CB  . THR C  3  119 ? 85.619  327.062 166.374 1.00 34.23  ? 119  THR C CB  1 
ATOM   6799  O  OG1 . THR C  3  119 ? 86.086  325.803 165.924 1.00 32.28  ? 119  THR C OG1 1 
ATOM   6800  C  CG2 . THR C  3  119 ? 85.899  328.169 165.304 1.00 37.77  ? 119  THR C CG2 1 
ATOM   6801  N  N   . GLY C  3  120 ? 86.784  329.691 168.128 1.00 33.80  ? 120  GLY C N   1 
ATOM   6802  C  CA  . GLY C  3  120 ? 86.473  331.097 168.403 1.00 33.99  ? 120  GLY C CA  1 
ATOM   6803  C  C   . GLY C  3  120 ? 86.634  331.410 169.887 1.00 34.71  ? 120  GLY C C   1 
ATOM   6804  O  O   . GLY C  3  120 ? 86.318  332.530 170.330 1.00 34.46  ? 120  GLY C O   1 
ATOM   6805  N  N   . ILE C  3  121 ? 87.054  330.433 170.695 1.00 33.67  ? 121  ILE C N   1 
ATOM   6806  C  CA  . ILE C  3  121 ? 87.339  330.741 172.138 1.00 32.84  ? 121  ILE C CA  1 
ATOM   6807  C  C   . ILE C  3  121 ? 88.848  330.874 172.316 1.00 33.96  ? 121  ILE C C   1 
ATOM   6808  O  O   . ILE C  3  121 ? 89.609  329.908 171.913 1.00 32.71  ? 121  ILE C O   1 
ATOM   6809  C  CB  . ILE C  3  121 ? 86.841  329.546 173.083 1.00 30.77  ? 121  ILE C CB  1 
ATOM   6810  C  CG1 . ILE C  3  121 ? 85.230  329.513 173.159 1.00 31.45  ? 121  ILE C CG1 1 
ATOM   6811  C  CG2 . ILE C  3  121 ? 87.516  329.746 174.441 1.00 30.26  ? 121  ILE C CG2 1 
ATOM   6812  C  CD1 . ILE C  3  121 ? 84.544  330.757 173.964 1.00 30.83  ? 121  ILE C CD1 1 
ATOM   6813  N  N   . HIS C  3  122 ? 89.326  331.963 172.957 1.00 34.98  ? 122  HIS C N   1 
ATOM   6814  C  CA  . HIS C  3  122 ? 90.770  332.045 173.225 1.00 38.20  ? 122  HIS C CA  1 
ATOM   6815  C  C   . HIS C  3  122 ? 91.003  332.039 174.758 1.00 38.34  ? 122  HIS C C   1 
ATOM   6816  O  O   . HIS C  3  122 ? 90.765  333.045 175.404 1.00 35.26  ? 122  HIS C O   1 
ATOM   6817  C  CB  . HIS C  3  122 ? 91.372  333.257 172.476 1.00 42.51  ? 122  HIS C CB  1 
ATOM   6818  C  CG  . HIS C  3  122 ? 91.016  333.250 171.007 1.00 49.55  ? 122  HIS C CG  1 
ATOM   6819  N  ND1 . HIS C  3  122 ? 91.731  332.517 170.073 1.00 57.75  ? 122  HIS C ND1 1 
ATOM   6820  C  CD2 . HIS C  3  122 ? 89.939  333.757 170.342 1.00 52.47  ? 122  HIS C CD2 1 
ATOM   6821  C  CE1 . HIS C  3  122 ? 91.129  332.604 168.893 1.00 59.56  ? 122  HIS C CE1 1 
ATOM   6822  N  NE2 . HIS C  3  122 ? 90.047  333.361 169.026 1.00 56.01  ? 122  HIS C NE2 1 
ATOM   6823  N  N   . PRO C  3  123 ? 91.348  330.850 175.356 1.00 38.57  ? 123  PRO C N   1 
ATOM   6824  C  CA  . PRO C  3  123 ? 91.449  330.722 176.834 1.00 39.36  ? 123  PRO C CA  1 
ATOM   6825  C  C   . PRO C  3  123 ? 92.507  331.692 177.354 1.00 40.47  ? 123  PRO C C   1 
ATOM   6826  O  O   . PRO C  3  123 ? 93.421  332.072 176.597 1.00 40.07  ? 123  PRO C O   1 
ATOM   6827  C  CB  . PRO C  3  123 ? 92.061  329.300 177.027 1.00 39.66  ? 123  PRO C CB  1 
ATOM   6828  C  CG  . PRO C  3  123 ? 91.491  328.492 175.857 1.00 42.08  ? 123  PRO C CG  1 
ATOM   6829  C  CD  . PRO C  3  123 ? 91.695  329.561 174.688 1.00 38.91  ? 123  PRO C CD  1 
ATOM   6830  N  N   . LEU C  3  124 ? 92.453  331.971 178.667 1.00 41.08  ? 124  LEU C N   1 
ATOM   6831  C  CA  . LEU C  3  124 ? 93.524  332.697 179.409 1.00 40.04  ? 124  LEU C CA  1 
ATOM   6832  C  C   . LEU C  3  124 ? 94.720  331.785 179.437 1.00 38.86  ? 124  LEU C C   1 
ATOM   6833  O  O   . LEU C  3  124 ? 94.600  330.567 179.383 1.00 37.62  ? 124  LEU C O   1 
ATOM   6834  C  CB  . LEU C  3  124 ? 93.032  332.986 180.829 1.00 40.33  ? 124  LEU C CB  1 
ATOM   6835  C  CG  . LEU C  3  124 ? 91.668  333.705 180.785 1.00 43.22  ? 124  LEU C CG  1 
ATOM   6836  C  CD1 . LEU C  3  124 ? 90.965  333.749 182.163 1.00 43.12  ? 124  LEU C CD1 1 
ATOM   6837  C  CD2 . LEU C  3  124 ? 91.884  335.133 180.175 1.00 46.69  ? 124  LEU C CD2 1 
ATOM   6838  N  N   . ASN C  3  125 ? 95.905  332.355 179.477 1.00 38.96  ? 125  ASN C N   1 
ATOM   6839  C  CA  . ASN C  3  125 ? 97.064  331.521 179.650 1.00 37.08  ? 125  ASN C CA  1 
ATOM   6840  C  C   . ASN C  3  125 ? 97.087  331.055 181.101 1.00 36.52  ? 125  ASN C C   1 
ATOM   6841  O  O   . ASN C  3  125 ? 97.131  331.870 182.002 1.00 38.24  ? 125  ASN C O   1 
ATOM   6842  C  CB  . ASN C  3  125 ? 98.302  332.399 179.321 1.00 37.19  ? 125  ASN C CB  1 
ATOM   6843  C  CG  . ASN C  3  125 ? 99.643  331.608 179.435 1.00 39.00  ? 125  ASN C CG  1 
ATOM   6844  O  OD1 . ASN C  3  125 ? 99.791  330.599 180.139 1.00 36.75  ? 125  ASN C OD1 1 
ATOM   6845  N  ND2 . ASN C  3  125 ? 100.640 332.113 178.741 1.00 45.25  ? 125  ASN C ND2 1 
ATOM   6846  N  N   . PRO C  3  126 ? 97.108  329.745 181.348 1.00 36.77  ? 126  PRO C N   1 
ATOM   6847  C  CA  . PRO C  3  126 ? 97.097  329.345 182.771 1.00 36.39  ? 126  PRO C CA  1 
ATOM   6848  C  C   . PRO C  3  126 ? 98.396  329.738 183.514 1.00 37.52  ? 126  PRO C C   1 
ATOM   6849  O  O   . PRO C  3  126 ? 98.441  329.664 184.759 1.00 36.51  ? 126  PRO C O   1 
ATOM   6850  C  CB  . PRO C  3  126 ? 96.927  327.792 182.736 1.00 36.26  ? 126  PRO C CB  1 
ATOM   6851  C  CG  . PRO C  3  126 ? 97.146  327.382 181.350 1.00 36.67  ? 126  PRO C CG  1 
ATOM   6852  C  CD  . PRO C  3  126 ? 97.159  328.592 180.429 1.00 34.56  ? 126  PRO C CD  1 
ATOM   6853  N  N   . LEU C  3  127 ? 99.437  330.149 182.777 1.00 36.49  ? 127  LEU C N   1 
ATOM   6854  C  CA  . LEU C  3  127 ? 100.643 330.573 183.477 1.00 37.42  ? 127  LEU C CA  1 
ATOM   6855  C  C   . LEU C  3  127 ? 100.691 332.007 183.861 1.00 37.47  ? 127  LEU C C   1 
ATOM   6856  O  O   . LEU C  3  127 ? 101.697 332.463 184.424 1.00 38.26  ? 127  LEU C O   1 
ATOM   6857  C  CB  . LEU C  3  127 ? 101.898 330.318 182.639 1.00 40.17  ? 127  LEU C CB  1 
ATOM   6858  C  CG  . LEU C  3  127 ? 102.477 328.909 182.512 1.00 44.38  ? 127  LEU C CG  1 
ATOM   6859  C  CD1 . LEU C  3  127 ? 102.130 328.024 183.641 1.00 51.54  ? 127  LEU C CD1 1 
ATOM   6860  C  CD2 . LEU C  3  127 ? 102.071 328.303 181.220 1.00 53.65  ? 127  LEU C CD2 1 
ATOM   6861  N  N   . GLU C  3  128 ? 99.660  332.772 183.601 1.00 36.66  ? 128  GLU C N   1 
ATOM   6862  C  CA  . GLU C  3  128 ? 99.712  334.168 183.957 1.00 37.05  ? 128  GLU C CA  1 
ATOM   6863  C  C   . GLU C  3  128 ? 98.964  334.414 185.231 1.00 36.16  ? 128  GLU C C   1 
ATOM   6864  O  O   . GLU C  3  128 ? 99.386  333.911 186.274 1.00 37.38  ? 128  GLU C O   1 
ATOM   6865  C  CB  . GLU C  3  128 ? 99.229  335.035 182.791 1.00 38.18  ? 128  GLU C CB  1 
ATOM   6866  C  CG  . GLU C  3  128 ? 100.214 334.794 181.645 1.00 42.84  ? 128  GLU C CG  1 
ATOM   6867  C  CD  . GLU C  3  128 ? 99.884  335.549 180.322 1.00 51.33  ? 128  GLU C CD  1 
ATOM   6868  O  OE1 . GLU C  3  128 ? 100.801 335.550 179.472 1.00 59.74  ? 128  GLU C OE1 1 
ATOM   6869  O  OE2 . GLU C  3  128 ? 98.746  336.045 180.085 1.00 51.01  ? 128  GLU C OE2 1 
ATOM   6870  N  N   . VAL C  3  129 ? 97.864  335.153 185.192 1.00 36.34  ? 129  VAL C N   1 
ATOM   6871  C  CA  . VAL C  3  129 ? 97.151  335.472 186.459 1.00 36.18  ? 129  VAL C CA  1 
ATOM   6872  C  C   . VAL C  3  129 ? 96.551  334.208 187.125 1.00 34.52  ? 129  VAL C C   1 
ATOM   6873  O  O   . VAL C  3  129 ? 96.500  334.148 188.362 1.00 36.88  ? 129  VAL C O   1 
ATOM   6874  C  CB  . VAL C  3  129 ? 96.073  336.629 186.273 1.00 36.19  ? 129  VAL C CB  1 
ATOM   6875  C  CG1 . VAL C  3  129 ? 95.260  336.908 187.560 1.00 34.89  ? 129  VAL C CG1 1 
ATOM   6876  C  CG2 . VAL C  3  129 ? 96.730  337.941 185.811 1.00 40.89  ? 129  VAL C CG2 1 
ATOM   6877  N  N   . PRO C  3  130 ? 96.067  333.180 186.344 1.00 32.80  ? 130  PRO C N   1 
ATOM   6878  C  CA  . PRO C  3  130 ? 95.615  331.969 187.089 1.00 30.99  ? 130  PRO C CA  1 
ATOM   6879  C  C   . PRO C  3  130 ? 96.694  331.319 187.946 1.00 31.62  ? 130  PRO C C   1 
ATOM   6880  O  O   . PRO C  3  130 ? 96.417  330.824 189.035 1.00 30.03  ? 130  PRO C O   1 
ATOM   6881  C  CB  . PRO C  3  130 ? 95.131  330.999 185.939 1.00 31.30  ? 130  PRO C CB  1 
ATOM   6882  C  CG  . PRO C  3  130 ? 94.530  332.107 184.896 1.00 32.48  ? 130  PRO C CG  1 
ATOM   6883  C  CD  . PRO C  3  130 ? 95.703  333.116 184.921 1.00 32.84  ? 130  PRO C CD  1 
ATOM   6884  N  N   . LEU C  3  131 ? 97.949  331.297 187.482 1.00 30.21  ? 131  LEU C N   1 
ATOM   6885  C  CA  . LEU C  3  131 ? 99.058  330.721 188.297 1.00 30.41  ? 131  LEU C CA  1 
ATOM   6886  C  C   . LEU C  3  131 ? 99.255  331.645 189.520 1.00 32.57  ? 131  LEU C C   1 
ATOM   6887  O  O   . LEU C  3  131 ? 99.473  331.167 190.619 1.00 34.51  ? 131  LEU C O   1 
ATOM   6888  C  CB  . LEU C  3  131 ? 100.374 330.666 187.440 1.00 30.33  ? 131  LEU C CB  1 
ATOM   6889  C  CG  . LEU C  3  131 ? 101.564 330.067 188.168 1.00 31.00  ? 131  LEU C CG  1 
ATOM   6890  C  CD1 . LEU C  3  131 ? 101.226 328.605 188.650 1.00 39.18  ? 131  LEU C CD1 1 
ATOM   6891  C  CD2 . LEU C  3  131 ? 102.795 330.078 187.324 1.00 38.80  ? 131  LEU C CD2 1 
ATOM   6892  N  N   . LEU C  3  132 ? 99.242  332.954 189.313 1.00 32.25  ? 132  LEU C N   1 
ATOM   6893  C  CA  . LEU C  3  132 ? 99.355  333.894 190.392 1.00 33.05  ? 132  LEU C CA  1 
ATOM   6894  C  C   . LEU C  3  132 ? 98.239  333.643 191.470 1.00 32.54  ? 132  LEU C C   1 
ATOM   6895  O  O   . LEU C  3  132 ? 98.541  333.460 192.658 1.00 33.38  ? 132  LEU C O   1 
ATOM   6896  C  CB  . LEU C  3  132 ? 99.198  335.326 189.846 1.00 32.21  ? 132  LEU C CB  1 
ATOM   6897  C  CG  . LEU C  3  132 ? 99.206  336.470 190.917 1.00 36.00  ? 132  LEU C CG  1 
ATOM   6898  C  CD1 . LEU C  3  132 ? 100.481 336.509 191.764 1.00 38.27  ? 132  LEU C CD1 1 
ATOM   6899  C  CD2 . LEU C  3  132 ? 99.146  337.853 190.213 1.00 34.97  ? 132  LEU C CD2 1 
ATOM   6900  N  N   . ASN C  3  133 ? 96.975  333.650 191.060 1.00 30.87  ? 133  ASN C N   1 
ATOM   6901  C  CA  . ASN C  3  133 ? 95.891  333.204 191.939 1.00 32.35  ? 133  ASN C CA  1 
ATOM   6902  C  C   . ASN C  3  133 ? 96.158  331.933 192.702 1.00 31.87  ? 133  ASN C C   1 
ATOM   6903  O  O   . ASN C  3  133 ? 95.827  331.849 193.871 1.00 32.16  ? 133  ASN C O   1 
ATOM   6904  C  CB  . ASN C  3  133 ? 94.623  333.038 191.116 1.00 33.51  ? 133  ASN C CB  1 
ATOM   6905  C  CG  . ASN C  3  133 ? 93.994  334.327 190.828 1.00 39.33  ? 133  ASN C CG  1 
ATOM   6906  O  OD1 . ASN C  3  133 ? 94.050  335.230 191.639 1.00 49.17  ? 133  ASN C OD1 1 
ATOM   6907  N  ND2 . ASN C  3  133 ? 93.356  334.436 189.703 1.00 50.42  ? 133  ASN C ND2 1 
ATOM   6908  N  N   . THR C  3  134 ? 96.662  330.896 192.026 1.00 32.75  ? 134  THR C N   1 
ATOM   6909  C  CA  . THR C  3  134 ? 97.028  329.642 192.667 1.00 31.16  ? 134  THR C CA  1 
ATOM   6910  C  C   . THR C  3  134 ? 98.104  329.901 193.766 1.00 33.30  ? 134  THR C C   1 
ATOM   6911  O  O   . THR C  3  134 ? 97.998  329.389 194.875 1.00 31.41  ? 134  THR C O   1 
ATOM   6912  C  CB  . THR C  3  134 ? 97.573  328.663 191.616 1.00 33.05  ? 134  THR C CB  1 
ATOM   6913  O  OG1 . THR C  3  134 ? 96.561  328.540 190.609 1.00 30.51  ? 134  THR C OG1 1 
ATOM   6914  C  CG2 . THR C  3  134 ? 97.779  327.221 192.258 1.00 29.83  ? 134  THR C CG2 1 
ATOM   6915  N  N   . SER C  3  135 ? 99.150  330.709 193.470 1.00 33.18  ? 135  SER C N   1 
ATOM   6916  C  CA  . SER C  3  135 ? 100.205 330.848 194.483 1.00 32.90  ? 135  SER C CA  1 
ATOM   6917  C  C   . SER C  3  135 ? 99.571  331.633 195.651 1.00 30.60  ? 135  SER C C   1 
ATOM   6918  O  O   . SER C  3  135 ? 99.957  331.490 196.838 1.00 31.61  ? 135  SER C O   1 
ATOM   6919  C  CB  . SER C  3  135 ? 101.408 331.596 193.937 1.00 31.37  ? 135  SER C CB  1 
ATOM   6920  O  OG  . SER C  3  135 ? 101.108 332.950 193.652 1.00 35.33  ? 135  SER C OG  1 
ATOM   6921  N  N   . VAL C  3  136 ? 98.614  332.489 195.337 1.00 31.69  ? 136  VAL C N   1 
ATOM   6922  C  CA  . VAL C  3  136 ? 98.041  333.354 196.382 1.00 31.30  ? 136  VAL C CA  1 
ATOM   6923  C  C   . VAL C  3  136 ? 97.239  332.571 197.369 1.00 31.99  ? 136  VAL C C   1 
ATOM   6924  O  O   . VAL C  3  136 ? 97.378  332.774 198.612 1.00 31.19  ? 136  VAL C O   1 
ATOM   6925  C  CB  . VAL C  3  136 ? 97.226  334.549 195.785 1.00 33.59  ? 136  VAL C CB  1 
ATOM   6926  C  CG1 . VAL C  3  136 ? 96.318  335.184 196.791 1.00 27.03  ? 136  VAL C CG1 1 
ATOM   6927  C  CG2 . VAL C  3  136 ? 98.252  335.608 195.202 1.00 31.80  ? 136  VAL C CG2 1 
ATOM   6928  N  N   . LEU C  3  137 ? 96.492  331.604 196.852 1.00 31.96  ? 137  LEU C N   1 
ATOM   6929  C  CA  . LEU C  3  137 ? 95.603  330.845 197.723 1.00 31.08  ? 137  LEU C CA  1 
ATOM   6930  C  C   . LEU C  3  137 ? 96.422  329.773 198.452 1.00 31.30  ? 137  LEU C C   1 
ATOM   6931  O  O   . LEU C  3  137 ? 96.240  329.553 199.657 1.00 29.35  ? 137  LEU C O   1 
ATOM   6932  C  CB  . LEU C  3  137 ? 94.408  330.236 196.942 1.00 31.78  ? 137  LEU C CB  1 
ATOM   6933  C  CG  . LEU C  3  137 ? 93.166  331.105 196.628 1.00 32.50  ? 137  LEU C CG  1 
ATOM   6934  C  CD1 . LEU C  3  137 ? 91.926  330.113 196.239 1.00 29.27  ? 137  LEU C CD1 1 
ATOM   6935  C  CD2 . LEU C  3  137 ? 92.809  331.919 197.853 1.00 27.21  ? 137  LEU C CD2 1 
ATOM   6936  N  N   . LEU C  3  138 ? 97.353  329.117 197.747 1.00 27.71  ? 138  LEU C N   1 
ATOM   6937  C  CA  . LEU C  3  138 ? 98.220  328.237 198.471 1.00 30.41  ? 138  LEU C CA  1 
ATOM   6938  C  C   . LEU C  3  138 ? 98.992  328.972 199.634 1.00 32.43  ? 138  LEU C C   1 
ATOM   6939  O  O   . LEU C  3  138 ? 99.197  328.409 200.699 1.00 31.00  ? 138  LEU C O   1 
ATOM   6940  C  CB  . LEU C  3  138 ? 99.276  327.698 197.507 1.00 32.03  ? 138  LEU C CB  1 
ATOM   6941  C  CG  . LEU C  3  138 ? 98.632  326.580 196.615 1.00 32.25  ? 138  LEU C CG  1 
ATOM   6942  C  CD1 . LEU C  3  138 ? 99.720  326.286 195.601 1.00 37.79  ? 138  LEU C CD1 1 
ATOM   6943  C  CD2 . LEU C  3  138 ? 98.210  325.262 197.493 1.00 34.34  ? 138  LEU C CD2 1 
ATOM   6944  N  N   . ALA C  3  139 ? 99.489  330.189 199.356 1.00 30.99  ? 139  ALA C N   1 
ATOM   6945  C  CA  . ALA C  3  139 ? 100.229 330.971 200.397 1.00 30.60  ? 139  ALA C CA  1 
ATOM   6946  C  C   . ALA C  3  139 ? 99.308  331.227 201.607 1.00 29.65  ? 139  ALA C C   1 
ATOM   6947  O  O   . ALA C  3  139 ? 99.793  331.199 202.774 1.00 30.64  ? 139  ALA C O   1 
ATOM   6948  C  CB  . ALA C  3  139 ? 100.762 332.296 199.820 1.00 29.87  ? 139  ALA C CB  1 
ATOM   6949  N  N   . SER C  3  140 ? 98.026  331.555 201.362 1.00 28.02  ? 140  SER C N   1 
ATOM   6950  C  CA  . SER C  3  140 ? 97.133  331.942 202.408 1.00 26.35  ? 140  SER C CA  1 
ATOM   6951  C  C   . SER C  3  140 ? 96.806  330.666 203.259 1.00 27.89  ? 140  SER C C   1 
ATOM   6952  O  O   . SER C  3  140 ? 96.511  330.767 204.490 1.00 27.65  ? 140  SER C O   1 
ATOM   6953  C  CB  . SER C  3  140 ? 95.796  332.528 201.757 1.00 26.28  ? 140  SER C CB  1 
ATOM   6954  O  OG  . SER C  3  140 ? 95.022  331.394 201.226 1.00 29.03  ? 140  SER C OG  1 
ATOM   6955  N  N   . GLY C  3  141 ? 96.882  329.472 202.650 1.00 25.50  ? 141  GLY C N   1 
ATOM   6956  C  CA  . GLY C  3  141 ? 96.751  328.221 203.455 1.00 23.97  ? 141  GLY C CA  1 
ATOM   6957  C  C   . GLY C  3  141 ? 97.967  328.006 204.363 1.00 27.88  ? 141  GLY C C   1 
ATOM   6958  O  O   . GLY C  3  141 ? 97.811  327.489 205.477 1.00 28.60  ? 141  GLY C O   1 
ATOM   6959  N  N   . VAL C  3  142 ? 99.157  328.488 203.943 1.00 25.99  ? 142  VAL C N   1 
ATOM   6960  C  CA  . VAL C  3  142 ? 100.336 328.418 204.871 1.00 27.75  ? 142  VAL C CA  1 
ATOM   6961  C  C   . VAL C  3  142 ? 100.157 329.501 205.971 1.00 29.01  ? 142  VAL C C   1 
ATOM   6962  O  O   . VAL C  3  142 ? 100.337 329.196 207.169 1.00 30.12  ? 142  VAL C O   1 
ATOM   6963  C  CB  . VAL C  3  142 ? 101.706 328.676 204.115 1.00 24.72  ? 142  VAL C CB  1 
ATOM   6964  C  CG1 . VAL C  3  142 ? 103.042 328.720 205.073 1.00 26.42  ? 142  VAL C CG1 1 
ATOM   6965  C  CG2 . VAL C  3  142 ? 101.891 327.572 202.933 1.00 28.47  ? 142  VAL C CG2 1 
ATOM   6966  N  N   . SER C  3  143 ? 99.800  330.726 205.592 1.00 29.12  ? 143  SER C N   1 
ATOM   6967  C  CA  . SER C  3  143 ? 99.725  331.804 206.623 1.00 30.80  ? 143  SER C CA  1 
ATOM   6968  C  C   . SER C  3  143 ? 98.561  331.500 207.580 1.00 29.95  ? 143  SER C C   1 
ATOM   6969  O  O   . SER C  3  143 ? 98.697  331.754 208.775 1.00 30.51  ? 143  SER C O   1 
ATOM   6970  C  CB  . SER C  3  143 ? 99.565  333.218 205.998 1.00 32.47  ? 143  SER C CB  1 
ATOM   6971  O  OG  . SER C  3  143 ? 98.359  333.263 205.217 1.00 33.95  ? 143  SER C OG  1 
ATOM   6972  N  N   . ILE C  3  144 ? 97.451  330.890 207.132 1.00 30.75  ? 144  ILE C N   1 
ATOM   6973  C  CA  . ILE C  3  144 ? 96.439  330.591 208.169 1.00 29.71  ? 144  ILE C CA  1 
ATOM   6974  C  C   . ILE C  3  144 ? 96.846  329.470 209.152 1.00 30.10  ? 144  ILE C C   1 
ATOM   6975  O  O   . ILE C  3  144 ? 96.400  329.393 210.260 1.00 29.99  ? 144  ILE C O   1 
ATOM   6976  C  CB  . ILE C  3  144 ? 95.022  330.288 207.526 1.00 30.38  ? 144  ILE C CB  1 
ATOM   6977  C  CG1 . ILE C  3  144 ? 93.835  330.641 208.499 1.00 27.43  ? 144  ILE C CG1 1 
ATOM   6978  C  CG2 . ILE C  3  144 ? 94.994  328.842 206.840 1.00 27.75  ? 144  ILE C CG2 1 
ATOM   6979  C  CD1 . ILE C  3  144 ? 92.526  330.140 207.831 1.00 36.68  ? 144  ILE C CD1 1 
ATOM   6980  N  N   . THR C  3  145 ? 97.730  328.604 208.731 1.00 28.70  ? 145  THR C N   1 
ATOM   6981  C  CA  . THR C  3  145 ? 98.179  327.499 209.583 1.00 31.17  ? 145  THR C CA  1 
ATOM   6982  C  C   . THR C  3  145 ? 99.169  328.138 210.592 1.00 29.34  ? 145  THR C C   1 
ATOM   6983  O  O   . THR C  3  145 ? 99.174  327.759 211.737 1.00 30.38  ? 145  THR C O   1 
ATOM   6984  C  CB  . THR C  3  145 ? 98.966  326.421 208.718 1.00 29.60  ? 145  THR C CB  1 
ATOM   6985  O  OG1 . THR C  3  145 ? 98.054  326.037 207.677 1.00 30.61  ? 145  THR C OG1 1 
ATOM   6986  C  CG2 . THR C  3  145 ? 99.387  325.212 209.634 1.00 30.08  ? 145  THR C CG2 1 
ATOM   6987  N  N   . TRP C  3  146 ? 99.965  329.098 210.154 1.00 28.33  ? 146  TRP C N   1 
ATOM   6988  C  CA  . TRP C  3  146 ? 100.766 329.886 211.122 1.00 28.72  ? 146  TRP C CA  1 
ATOM   6989  C  C   . TRP C  3  146 ? 99.835  330.590 212.134 1.00 27.57  ? 146  TRP C C   1 
ATOM   6990  O  O   . TRP C  3  146 ? 100.064 330.534 213.338 1.00 27.63  ? 146  TRP C O   1 
ATOM   6991  C  CB  . TRP C  3  146 ? 101.656 330.935 210.368 1.00 28.25  ? 146  TRP C CB  1 
ATOM   6992  C  CG  . TRP C  3  146 ? 102.303 332.011 211.258 1.00 31.87  ? 146  TRP C CG  1 
ATOM   6993  C  CD1 . TRP C  3  146 ? 102.715 331.908 212.593 1.00 32.59  ? 146  TRP C CD1 1 
ATOM   6994  C  CD2 . TRP C  3  146 ? 102.681 333.312 210.822 1.00 31.37  ? 146  TRP C CD2 1 
ATOM   6995  N  NE1 . TRP C  3  146 ? 103.258 333.124 213.019 1.00 30.62  ? 146  TRP C NE1 1 
ATOM   6996  C  CE2 . TRP C  3  146 ? 103.217 334.002 211.949 1.00 30.66  ? 146  TRP C CE2 1 
ATOM   6997  C  CE3 . TRP C  3  146 ? 102.510 334.005 209.593 1.00 27.73  ? 146  TRP C CE3 1 
ATOM   6998  C  CZ2 . TRP C  3  146 ? 103.667 335.351 211.866 1.00 29.47  ? 146  TRP C CZ2 1 
ATOM   6999  C  CZ3 . TRP C  3  146 ? 102.968 335.355 209.517 1.00 31.87  ? 146  TRP C CZ3 1 
ATOM   7000  C  CH2 . TRP C  3  146 ? 103.529 335.995 210.661 1.00 29.28  ? 146  TRP C CH2 1 
ATOM   7001  N  N   . ALA C  3  147 ? 98.792  331.227 211.660 1.00 28.16  ? 147  ALA C N   1 
ATOM   7002  C  CA  . ALA C  3  147 ? 97.784  331.843 212.571 1.00 28.42  ? 147  ALA C CA  1 
ATOM   7003  C  C   . ALA C  3  147 ? 97.270  330.896 213.584 1.00 28.73  ? 147  ALA C C   1 
ATOM   7004  O  O   . ALA C  3  147 ? 97.130  331.228 214.804 1.00 29.94  ? 147  ALA C O   1 
ATOM   7005  C  CB  . ALA C  3  147 ? 96.579  332.337 211.752 1.00 25.85  ? 147  ALA C CB  1 
ATOM   7006  N  N   . HIS C  3  148 ? 96.877  329.714 213.106 1.00 30.28  ? 148  HIS C N   1 
ATOM   7007  C  CA  . HIS C  3  148 ? 96.341  328.659 213.988 1.00 30.99  ? 148  HIS C CA  1 
ATOM   7008  C  C   . HIS C  3  148 ? 97.348  328.219 215.084 1.00 29.12  ? 148  HIS C C   1 
ATOM   7009  O  O   . HIS C  3  148 ? 97.062  328.189 216.269 1.00 27.91  ? 148  HIS C O   1 
ATOM   7010  C  CB  . HIS C  3  148 ? 95.927  327.432 213.160 1.00 32.03  ? 148  HIS C CB  1 
ATOM   7011  C  CG  . HIS C  3  148 ? 95.200  326.439 214.002 1.00 36.77  ? 148  HIS C CG  1 
ATOM   7012  N  ND1 . HIS C  3  148 ? 95.229  325.076 213.802 1.00 44.01  ? 148  HIS C ND1 1 
ATOM   7013  C  CD2 . HIS C  3  148 ? 94.440  326.638 215.106 1.00 38.07  ? 148  HIS C CD2 1 
ATOM   7014  C  CE1 . HIS C  3  148 ? 94.482  324.485 214.717 1.00 41.15  ? 148  HIS C CE1 1 
ATOM   7015  N  NE2 . HIS C  3  148 ? 93.986  325.418 215.510 1.00 40.94  ? 148  HIS C NE2 1 
ATOM   7016  N  N   . HIS C  3  149 ? 98.588  327.880 214.692 1.00 30.08  ? 149  HIS C N   1 
ATOM   7017  C  CA  . HIS C  3  149 ? 99.627  327.616 215.710 1.00 28.35  ? 149  HIS C CA  1 
ATOM   7018  C  C   . HIS C  3  149 ? 99.945  328.725 216.632 1.00 27.60  ? 149  HIS C C   1 
ATOM   7019  O  O   . HIS C  3  149 ? 100.176 328.492 217.805 1.00 29.01  ? 149  HIS C O   1 
ATOM   7020  C  CB  . HIS C  3  149 ? 100.903 327.074 215.019 1.00 29.61  ? 149  HIS C CB  1 
ATOM   7021  C  CG  . HIS C  3  149 ? 100.660 325.719 214.462 1.00 32.54  ? 149  HIS C CG  1 
ATOM   7022  N  ND1 . HIS C  3  149 ? 100.836 324.575 215.211 1.00 38.87  ? 149  HIS C ND1 1 
ATOM   7023  C  CD2 . HIS C  3  149 ? 100.159 325.311 213.266 1.00 36.51  ? 149  HIS C CD2 1 
ATOM   7024  C  CE1 . HIS C  3  149 ? 100.531 323.515 214.474 1.00 36.49  ? 149  HIS C CE1 1 
ATOM   7025  N  NE2 . HIS C  3  149 ? 100.140 323.935 213.285 1.00 33.86  ? 149  HIS C NE2 1 
ATOM   7026  N  N   . SER C  3  150 ? 99.948  329.952 216.161 1.00 29.30  ? 150  SER C N   1 
ATOM   7027  C  CA  . SER C  3  150 ? 100.167 331.092 217.099 1.00 29.70  ? 150  SER C CA  1 
ATOM   7028  C  C   . SER C  3  150 ? 99.070  331.172 218.134 1.00 32.40  ? 150  SER C C   1 
ATOM   7029  O  O   . SER C  3  150 ? 99.355  331.391 219.368 1.00 31.34  ? 150  SER C O   1 
ATOM   7030  C  CB  . SER C  3  150 ? 100.180 332.427 216.339 1.00 31.84  ? 150  SER C CB  1 
ATOM   7031  O  OG  . SER C  3  150 ? 101.388 332.546 215.546 1.00 34.58  ? 150  SER C OG  1 
ATOM   7032  N  N   . LEU C  3  151 ? 97.788  331.115 217.688 1.00 30.46  ? 151  LEU C N   1 
ATOM   7033  C  CA  . LEU C  3  151 ? 96.683  331.102 218.635 1.00 30.76  ? 151  LEU C CA  1 
ATOM   7034  C  C   . LEU C  3  151 ? 96.821  329.953 219.731 1.00 31.44  ? 151  LEU C C   1 
ATOM   7035  O  O   . LEU C  3  151 ? 96.637  330.131 220.968 1.00 31.54  ? 151  LEU C O   1 
ATOM   7036  C  CB  . LEU C  3  151 ? 95.320  330.918 217.806 1.00 28.11  ? 151  LEU C CB  1 
ATOM   7037  C  CG  . LEU C  3  151 ? 94.118  330.934 218.750 1.00 31.94  ? 151  LEU C CG  1 
ATOM   7038  C  CD1 . LEU C  3  151 ? 94.059  332.309 219.604 1.00 28.96  ? 151  LEU C CD1 1 
ATOM   7039  C  CD2 . LEU C  3  151 ? 92.846  330.785 217.945 1.00 28.85  ? 151  LEU C CD2 1 
ATOM   7040  N  N   . MET C  3  152 ? 97.035  328.727 219.279 1.00 31.73  ? 152  MET C N   1 
ATOM   7041  C  CA  . MET C  3  152 ? 97.276  327.631 220.184 1.00 33.50  ? 152  MET C CA  1 
ATOM   7042  C  C   . MET C  3  152 ? 98.502  327.866 221.083 1.00 34.40  ? 152  MET C C   1 
ATOM   7043  O  O   . MET C  3  152 ? 98.505  327.405 222.203 1.00 34.09  ? 152  MET C O   1 
ATOM   7044  C  CB  . MET C  3  152 ? 97.456  326.309 219.368 1.00 31.88  ? 152  MET C CB  1 
ATOM   7045  C  CG  . MET C  3  152 ? 96.197  325.815 218.683 1.00 37.10  ? 152  MET C CG  1 
ATOM   7046  S  SD  . MET C  3  152 ? 96.595  324.167 217.887 1.00 42.95  ? 152  MET C SD  1 
ATOM   7047  C  CE  . MET C  3  152 ? 97.655  324.575 216.614 1.00 39.22  ? 152  MET C CE  1 
ATOM   7048  N  N   . GLU C  3  153 ? 99.554  328.522 220.586 1.00 34.11  ? 153  GLU C N   1 
ATOM   7049  C  CA  . GLU C  3  153 ? 100.717 328.802 221.433 1.00 33.70  ? 153  GLU C CA  1 
ATOM   7050  C  C   . GLU C  3  153 ? 100.508 330.042 222.285 1.00 34.43  ? 153  GLU C C   1 
ATOM   7051  O  O   . GLU C  3  153 ? 101.394 330.498 222.993 1.00 34.79  ? 153  GLU C O   1 
ATOM   7052  C  CB  . GLU C  3  153 ? 102.035 328.845 220.591 1.00 33.52  ? 153  GLU C CB  1 
ATOM   7053  C  CG  . GLU C  3  153 ? 102.258 327.451 219.998 1.00 35.31  ? 153  GLU C CG  1 
ATOM   7054  C  CD  . GLU C  3  153 ? 103.381 327.430 219.016 1.00 37.93  ? 153  GLU C CD  1 
ATOM   7055  O  OE1 . GLU C  3  153 ? 103.407 326.534 218.169 1.00 37.95  ? 153  GLU C OE1 1 
ATOM   7056  O  OE2 . GLU C  3  153 ? 104.252 328.309 219.104 1.00 40.04  ? 153  GLU C OE2 1 
ATOM   7057  N  N   . GLY C  3  154 ? 99.309  330.585 222.307 1.00 34.20  ? 154  GLY C N   1 
ATOM   7058  C  CA  . GLY C  3  154 ? 99.104  331.666 223.224 1.00 32.93  ? 154  GLY C CA  1 
ATOM   7059  C  C   . GLY C  3  154 ? 99.579  333.010 222.729 1.00 33.99  ? 154  GLY C C   1 
ATOM   7060  O  O   . GLY C  3  154 ? 99.627  333.972 223.536 1.00 34.65  ? 154  GLY C O   1 
ATOM   7061  N  N   . ASP C  3  155 ? 99.915  333.118 221.438 1.00 32.31  ? 155  ASP C N   1 
ATOM   7062  C  CA  . ASP C  3  155 ? 100.628 334.319 220.897 1.00 32.08  ? 155  ASP C CA  1 
ATOM   7063  C  C   . ASP C  3  155 ? 99.663  335.237 220.123 1.00 32.86  ? 155  ASP C C   1 
ATOM   7064  O  O   . ASP C  3  155 ? 99.372  335.027 218.935 1.00 32.85  ? 155  ASP C O   1 
ATOM   7065  C  CB  . ASP C  3  155 ? 101.792 333.871 220.006 1.00 32.70  ? 155  ASP C CB  1 
ATOM   7066  C  CG  . ASP C  3  155 ? 102.632 335.022 219.486 1.00 33.19  ? 155  ASP C CG  1 
ATOM   7067  O  OD1 . ASP C  3  155 ? 102.132 336.138 219.407 1.00 35.30  ? 155  ASP C OD1 1 
ATOM   7068  O  OD2 . ASP C  3  155 ? 103.765 334.790 219.036 1.00 36.65  ? 155  ASP C OD2 1 
ATOM   7069  N  N   . ARG C  3  156 ? 99.205  336.302 220.763 1.00 31.54  ? 156  ARG C N   1 
ATOM   7070  C  CA  . ARG C  3  156 ? 98.167  337.133 220.189 1.00 31.97  ? 156  ARG C CA  1 
ATOM   7071  C  C   . ARG C  3  156 ? 98.630  337.952 218.970 1.00 33.14  ? 156  ARG C C   1 
ATOM   7072  O  O   . ARG C  3  156 ? 97.912  338.085 217.954 1.00 31.55  ? 156  ARG C O   1 
ATOM   7073  C  CB  . ARG C  3  156 ? 97.642  338.077 221.294 1.00 32.38  ? 156  ARG C CB  1 
ATOM   7074  C  CG  . ARG C  3  156 ? 96.914  339.295 220.756 1.00 30.83  ? 156  ARG C CG  1 
ATOM   7075  C  CD  . ARG C  3  156 ? 96.462  340.203 221.967 1.00 30.35  ? 156  ARG C CD  1 
ATOM   7076  N  NE  . ARG C  3  156 ? 95.704  341.387 221.506 1.00 30.26  ? 156  ARG C NE  1 
ATOM   7077  C  CZ  . ARG C  3  156 ? 94.398  341.407 221.261 1.00 32.60  ? 156  ARG C CZ  1 
ATOM   7078  N  NH1 . ARG C  3  156 ? 93.713  340.297 221.355 1.00 26.72  ? 156  ARG C NH1 1 
ATOM   7079  N  NH2 . ARG C  3  156 ? 93.778  342.516 220.836 1.00 26.35  ? 156  ARG C NH2 1 
ATOM   7080  N  N   . LYS C  3  157 ? 99.825  338.544 219.087 1.00 32.31  ? 157  LYS C N   1 
ATOM   7081  C  CA  . LYS C  3  157 ? 100.259 339.452 218.090 1.00 32.66  ? 157  LYS C CA  1 
ATOM   7082  C  C   . LYS C  3  157 ? 100.502 338.656 216.789 1.00 31.45  ? 157  LYS C C   1 
ATOM   7083  O  O   . LYS C  3  157 ? 100.190 339.159 215.711 1.00 31.65  ? 157  LYS C O   1 
ATOM   7084  C  CB  . LYS C  3  157 ? 101.575 340.149 218.555 1.00 34.28  ? 157  LYS C CB  1 
ATOM   7085  C  CG  . LYS C  3  157 ? 102.236 340.888 217.447 1.00 35.43  ? 157  LYS C CG  1 
ATOM   7086  C  CD  . LYS C  3  157 ? 103.539 341.670 217.877 1.00 44.45  ? 157  LYS C CD  1 
ATOM   7087  C  CE  . LYS C  3  157 ? 104.675 340.718 218.151 1.00 52.58  ? 157  LYS C CE  1 
ATOM   7088  N  NZ  . LYS C  3  157 ? 106.033 341.298 217.729 1.00 60.50  ? 157  LYS C NZ  1 
ATOM   7089  N  N   . HIS C  3  158 ? 101.181 337.513 216.855 1.00 29.31  ? 158  HIS C N   1 
ATOM   7090  C  CA  . HIS C  3  158 ? 101.466 336.755 215.636 1.00 30.37  ? 158  HIS C CA  1 
ATOM   7091  C  C   . HIS C  3  158 ? 100.234 336.049 215.068 1.00 30.31  ? 158  HIS C C   1 
ATOM   7092  O  O   . HIS C  3  158 ? 100.135 335.825 213.818 1.00 31.38  ? 158  HIS C O   1 
ATOM   7093  C  CB  . HIS C  3  158 ? 102.603 335.783 215.861 1.00 31.92  ? 158  HIS C CB  1 
ATOM   7094  C  CG  . HIS C  3  158 ? 103.932 336.492 216.052 1.00 30.48  ? 158  HIS C CG  1 
ATOM   7095  N  ND1 . HIS C  3  158 ? 104.661 336.369 217.207 1.00 34.94  ? 158  HIS C ND1 1 
ATOM   7096  C  CD2 . HIS C  3  158 ? 104.600 337.379 215.293 1.00 35.49  ? 158  HIS C CD2 1 
ATOM   7097  C  CE1 . HIS C  3  158 ? 105.772 337.088 217.126 1.00 35.02  ? 158  HIS C CE1 1 
ATOM   7098  N  NE2 . HIS C  3  158 ? 105.767 337.705 215.964 1.00 34.29  ? 158  HIS C NE2 1 
ATOM   7099  N  N   . MET C  3  159 ? 99.259  335.830 215.947 1.00 29.58  ? 159  MET C N   1 
ATOM   7100  C  CA  . MET C  3  159 ? 97.929  335.303 215.488 1.00 31.54  ? 159  MET C CA  1 
ATOM   7101  C  C   . MET C  3  159 ? 97.326  336.391 214.537 1.00 30.88  ? 159  MET C C   1 
ATOM   7102  O  O   . MET C  3  159 ? 97.080  336.131 213.361 1.00 30.93  ? 159  MET C O   1 
ATOM   7103  C  CB  . MET C  3  159 ? 97.021  334.924 216.677 1.00 28.76  ? 159  MET C CB  1 
ATOM   7104  C  CG  . MET C  3  159 ? 95.826  334.035 216.165 1.00 33.44  ? 159  MET C CG  1 
ATOM   7105  S  SD  . MET C  3  159 ? 94.736  335.069 215.121 1.00 34.36  ? 159  MET C SD  1 
ATOM   7106  C  CE  . MET C  3  159 ? 93.081  334.285 215.595 1.00 31.39  ? 159  MET C CE  1 
ATOM   7107  N  N   . LEU C  3  160 ? 97.112  337.606 215.059 1.00 31.27  ? 160  LEU C N   1 
ATOM   7108  C  CA  . LEU C  3  160 ? 96.634  338.760 214.286 1.00 29.10  ? 160  LEU C CA  1 
ATOM   7109  C  C   . LEU C  3  160 ? 97.433  339.063 213.018 1.00 30.38  ? 160  LEU C C   1 
ATOM   7110  O  O   . LEU C  3  160 ? 96.846  339.289 211.985 1.00 31.38  ? 160  LEU C O   1 
ATOM   7111  C  CB  . LEU C  3  160 ? 96.564  340.060 215.190 1.00 28.72  ? 160  LEU C CB  1 
ATOM   7112  C  CG  . LEU C  3  160 ? 95.565  339.961 216.328 1.00 28.28  ? 160  LEU C CG  1 
ATOM   7113  C  CD1 . LEU C  3  160 ? 95.824  340.935 217.517 1.00 28.94  ? 160  LEU C CD1 1 
ATOM   7114  C  CD2 . LEU C  3  160 ? 94.117  340.125 215.703 1.00 27.94  ? 160  LEU C CD2 1 
ATOM   7115  N  N   . GLN C  3  161 ? 98.762  339.112 213.088 1.00 28.48  ? 161  GLN C N   1 
ATOM   7116  C  CA  . GLN C  3  161 ? 99.556  339.271 211.889 1.00 30.74  ? 161  GLN C CA  1 
ATOM   7117  C  C   . GLN C  3  161 ? 99.311  338.184 210.780 1.00 30.58  ? 161  GLN C C   1 
ATOM   7118  O  O   . GLN C  3  161 ? 99.075  338.540 209.622 1.00 31.14  ? 161  GLN C O   1 
ATOM   7119  C  CB  . GLN C  3  161 ? 100.979 339.216 212.354 1.00 32.21  ? 161  GLN C CB  1 
ATOM   7120  C  CG  . GLN C  3  161 ? 102.030 339.924 211.640 1.00 42.23  ? 161  GLN C CG  1 
ATOM   7121  C  CD  . GLN C  3  161 ? 103.353 339.868 212.452 1.00 47.10  ? 161  GLN C CD  1 
ATOM   7122  O  OE1 . GLN C  3  161 ? 104.221 339.079 212.110 1.00 46.41  ? 161  GLN C OE1 1 
ATOM   7123  N  NE2 . GLN C  3  161 ? 103.496 340.718 213.558 1.00 53.88  ? 161  GLN C NE2 1 
ATOM   7124  N  N   . ALA C  3  162 ? 99.459  336.886 211.116 1.00 28.89  ? 162  ALA C N   1 
ATOM   7125  C  CA  . ALA C  3  162 ? 99.234  335.775 210.156 1.00 28.65  ? 162  ALA C CA  1 
ATOM   7126  C  C   . ALA C  3  162 ? 97.795  335.809 209.666 1.00 27.49  ? 162  ALA C C   1 
ATOM   7127  O  O   . ALA C  3  162 ? 97.486  335.601 208.458 1.00 27.46  ? 162  ALA C O   1 
ATOM   7128  C  CB  . ALA C  3  162 ? 99.458  334.466 210.872 1.00 26.80  ? 162  ALA C CB  1 
ATOM   7129  N  N   . LEU C  3  163 ? 96.876  336.073 210.572 1.00 27.87  ? 163  LEU C N   1 
ATOM   7130  C  CA  . LEU C  3  163 ? 95.441  336.132 210.079 1.00 28.87  ? 163  LEU C CA  1 
ATOM   7131  C  C   . LEU C  3  163 ? 95.224  337.287 209.134 1.00 31.02  ? 163  LEU C C   1 
ATOM   7132  O  O   . LEU C  3  163 ? 94.524  337.164 208.149 1.00 33.21  ? 163  LEU C O   1 
ATOM   7133  C  CB  . LEU C  3  163 ? 94.501  336.257 211.255 1.00 26.96  ? 163  LEU C CB  1 
ATOM   7134  C  CG  . LEU C  3  163 ? 92.980  336.200 210.925 1.00 29.71  ? 163  LEU C CG  1 
ATOM   7135  C  CD1 . LEU C  3  163 ? 92.545  335.014 209.938 1.00 28.56  ? 163  LEU C CD1 1 
ATOM   7136  C  CD2 . LEU C  3  163 ? 92.251  336.007 212.264 1.00 28.61  ? 163  LEU C CD2 1 
ATOM   7137  N  N   . PHE C  3  164 ? 95.861  338.430 209.404 1.00 31.59  ? 164  PHE C N   1 
ATOM   7138  C  CA  . PHE C  3  164 ? 95.805  339.578 208.502 1.00 31.47  ? 164  PHE C CA  1 
ATOM   7139  C  C   . PHE C  3  164 ? 96.372  339.317 207.127 1.00 31.13  ? 164  PHE C C   1 
ATOM   7140  O  O   . PHE C  3  164 ? 95.751  339.654 206.113 1.00 31.09  ? 164  PHE C O   1 
ATOM   7141  C  CB  . PHE C  3  164 ? 96.514  340.826 209.154 1.00 31.82  ? 164  PHE C CB  1 
ATOM   7142  C  CG  . PHE C  3  164 ? 96.447  342.066 208.293 1.00 34.69  ? 164  PHE C CG  1 
ATOM   7143  C  CD1 . PHE C  3  164 ? 95.263  342.817 208.207 1.00 39.38  ? 164  PHE C CD1 1 
ATOM   7144  C  CD2 . PHE C  3  164 ? 97.524  342.430 207.492 1.00 36.40  ? 164  PHE C CD2 1 
ATOM   7145  C  CE1 . PHE C  3  164 ? 95.212  343.980 207.383 1.00 42.81  ? 164  PHE C CE1 1 
ATOM   7146  C  CE2 . PHE C  3  164 ? 97.478  343.619 206.652 1.00 40.28  ? 164  PHE C CE2 1 
ATOM   7147  C  CZ  . PHE C  3  164 ? 96.321  344.378 206.634 1.00 41.14  ? 164  PHE C CZ  1 
ATOM   7148  N  N   . ILE C  3  165 ? 97.547  338.710 207.088 1.00 32.14  ? 165  ILE C N   1 
ATOM   7149  C  CA  . ILE C  3  165 ? 98.167  338.279 205.826 1.00 30.61  ? 165  ILE C CA  1 
ATOM   7150  C  C   . ILE C  3  165 ? 97.220  337.348 205.038 1.00 30.98  ? 165  ILE C C   1 
ATOM   7151  O  O   . ILE C  3  165 ? 97.013  337.489 203.812 1.00 30.31  ? 165  ILE C O   1 
ATOM   7152  C  CB  . ILE C  3  165 ? 99.516  337.584 206.150 1.00 30.88  ? 165  ILE C CB  1 
ATOM   7153  C  CG1 . ILE C  3  165 ? 100.559 338.666 206.496 1.00 31.61  ? 165  ILE C CG1 1 
ATOM   7154  C  CG2 . ILE C  3  165 ? 99.956  336.725 204.983 1.00 27.56  ? 165  ILE C CG2 1 
ATOM   7155  C  CD1 . ILE C  3  165 ? 101.699 338.169 207.371 1.00 32.10  ? 165  ILE C CD1 1 
ATOM   7156  N  N   . THR C  3  166 ? 96.601  336.417 205.755 1.00 29.72  ? 166  THR C N   1 
ATOM   7157  C  CA  . THR C  3  166 ? 95.665  335.473 205.143 1.00 30.53  ? 166  THR C CA  1 
ATOM   7158  C  C   . THR C  3  166 ? 94.513  336.194 204.498 1.00 31.83  ? 166  THR C C   1 
ATOM   7159  O  O   . THR C  3  166 ? 94.152  335.867 203.371 1.00 34.16  ? 166  THR C O   1 
ATOM   7160  C  CB  . THR C  3  166 ? 95.064  334.449 206.207 1.00 31.15  ? 166  THR C CB  1 
ATOM   7161  O  OG1 . THR C  3  166 ? 96.166  333.786 206.875 1.00 32.22  ? 166  THR C OG1 1 
ATOM   7162  C  CG2 . THR C  3  166 ? 94.216  333.415 205.494 1.00 26.14  ? 166  THR C CG2 1 
ATOM   7163  N  N   . ILE C  3  167 ? 93.915  337.178 205.190 1.00 31.12  ? 167  ILE C N   1 
ATOM   7164  C  CA  . ILE C  3  167 ? 92.773  337.879 204.632 1.00 31.30  ? 167  ILE C CA  1 
ATOM   7165  C  C   . ILE C  3  167 ? 93.228  338.811 203.483 1.00 32.29  ? 167  ILE C C   1 
ATOM   7166  O  O   . ILE C  3  167 ? 92.539  338.920 202.492 1.00 31.98  ? 167  ILE C O   1 
ATOM   7167  C  CB  . ILE C  3  167 ? 92.142  338.727 205.722 1.00 33.76  ? 167  ILE C CB  1 
ATOM   7168  C  CG1 . ILE C  3  167 ? 91.443  337.815 206.768 1.00 28.34  ? 167  ILE C CG1 1 
ATOM   7169  C  CG2 . ILE C  3  167 ? 91.234  339.841 205.133 1.00 32.51  ? 167  ILE C CG2 1 
ATOM   7170  C  CD1 . ILE C  3  167 ? 91.313  338.516 208.197 1.00 33.40  ? 167  ILE C CD1 1 
ATOM   7171  N  N   . THR C  3  168 ? 94.415  339.418 203.602 1.00 29.10  ? 168  THR C N   1 
ATOM   7172  C  CA  . THR C  3  168 ? 94.875  340.263 202.516 1.00 29.75  ? 168  THR C CA  1 
ATOM   7173  C  C   . THR C  3  168 ? 95.057  339.401 201.243 1.00 30.31  ? 168  THR C C   1 
ATOM   7174  O  O   . THR C  3  168 ? 94.830  339.819 200.085 1.00 32.67  ? 168  THR C O   1 
ATOM   7175  C  CB  . THR C  3  168 ? 96.249  340.848 202.956 1.00 30.56  ? 168  THR C CB  1 
ATOM   7176  O  OG1 . THR C  3  168 ? 96.048  341.677 204.122 1.00 30.06  ? 168  THR C OG1 1 
ATOM   7177  C  CG2 . THR C  3  168 ? 96.846  341.725 201.823 1.00 32.56  ? 168  THR C CG2 1 
ATOM   7178  N  N   . LEU C  3  169 ? 95.618  338.208 201.417 1.00 30.42  ? 169  LEU C N   1 
ATOM   7179  C  CA  . LEU C  3  169 ? 95.727  337.280 200.236 1.00 29.85  ? 169  LEU C CA  1 
ATOM   7180  C  C   . LEU C  3  169 ? 94.322  336.910 199.664 1.00 28.88  ? 169  LEU C C   1 
ATOM   7181  O  O   . LEU C  3  169 ? 94.157  336.868 198.431 1.00 30.56  ? 169  LEU C O   1 
ATOM   7182  C  CB  . LEU C  3  169 ? 96.544  336.056 200.617 1.00 30.30  ? 169  LEU C CB  1 
ATOM   7183  C  CG  . LEU C  3  169 ? 98.030  336.415 200.863 1.00 32.93  ? 169  LEU C CG  1 
ATOM   7184  C  CD1 . LEU C  3  169 ? 98.607  335.274 201.652 1.00 30.42  ? 169  LEU C CD1 1 
ATOM   7185  C  CD2 . LEU C  3  169 ? 98.883  336.656 199.592 1.00 34.24  ? 169  LEU C CD2 1 
ATOM   7186  N  N   . GLY C  3  170 ? 93.303  336.649 200.503 1.00 30.27  ? 170  GLY C N   1 
ATOM   7187  C  CA  . GLY C  3  170 ? 91.955  336.361 199.977 1.00 27.83  ? 170  GLY C CA  1 
ATOM   7188  C  C   . GLY C  3  170 ? 91.471  337.494 199.104 1.00 31.40  ? 170  GLY C C   1 
ATOM   7189  O  O   . GLY C  3  170 ? 90.832  337.323 198.048 1.00 31.70  ? 170  GLY C O   1 
ATOM   7190  N  N   . VAL C  3  171 ? 91.707  338.716 199.607 1.00 31.16  ? 171  VAL C N   1 
ATOM   7191  C  CA  . VAL C  3  171 ? 91.217  339.908 198.975 1.00 32.25  ? 171  VAL C CA  1 
ATOM   7192  C  C   . VAL C  3  171 ? 92.005  340.130 197.687 1.00 32.24  ? 171  VAL C C   1 
ATOM   7193  O  O   . VAL C  3  171 ? 91.430  340.511 196.703 1.00 32.13  ? 171  VAL C O   1 
ATOM   7194  C  CB  . VAL C  3  171 ? 91.400  341.157 199.949 1.00 32.87  ? 171  VAL C CB  1 
ATOM   7195  C  CG1 . VAL C  3  171 ? 91.358  342.454 199.150 1.00 35.74  ? 171  VAL C CG1 1 
ATOM   7196  C  CG2 . VAL C  3  171 ? 90.375  341.154 201.078 1.00 33.18  ? 171  VAL C CG2 1 
ATOM   7197  N  N   . TYR C  3  172 ? 93.342  339.916 197.701 1.00 32.62  ? 172  TYR C N   1 
ATOM   7198  C  CA  . TYR C  3  172 ? 94.120  340.006 196.489 1.00 32.96  ? 172  TYR C CA  1 
ATOM   7199  C  C   . TYR C  3  172 ? 93.561  339.011 195.432 1.00 34.53  ? 172  TYR C C   1 
ATOM   7200  O  O   . TYR C  3  172 ? 93.408  339.372 194.259 1.00 35.67  ? 172  TYR C O   1 
ATOM   7201  C  CB  . TYR C  3  172 ? 95.567  339.655 196.823 1.00 31.92  ? 172  TYR C CB  1 
ATOM   7202  C  CG  . TYR C  3  172 ? 96.588  339.821 195.739 1.00 35.36  ? 172  TYR C CG  1 
ATOM   7203  C  CD1 . TYR C  3  172 ? 96.444  340.796 194.691 1.00 39.15  ? 172  TYR C CD1 1 
ATOM   7204  C  CD2 . TYR C  3  172 ? 97.822  339.171 195.858 1.00 36.66  ? 172  TYR C CD2 1 
ATOM   7205  C  CE1 . TYR C  3  172 ? 97.457  341.000 193.740 1.00 37.48  ? 172  TYR C CE1 1 
ATOM   7206  C  CE2 . TYR C  3  172 ? 98.836  339.369 194.936 1.00 38.13  ? 172  TYR C CE2 1 
ATOM   7207  C  CZ  . TYR C  3  172 ? 98.659  340.294 193.876 1.00 38.13  ? 172  TYR C CZ  1 
ATOM   7208  O  OH  . TYR C  3  172 ? 99.724  340.418 193.006 1.00 39.22  ? 172  TYR C OH  1 
ATOM   7209  N  N   . PHE C  3  173 ? 93.382  337.736 195.826 1.00 35.08  ? 173  PHE C N   1 
ATOM   7210  C  CA  . PHE C  3  173 ? 92.726  336.721 194.929 1.00 33.59  ? 173  PHE C CA  1 
ATOM   7211  C  C   . PHE C  3  173 ? 91.425  337.316 194.329 1.00 33.05  ? 173  PHE C C   1 
ATOM   7212  O  O   . PHE C  3  173 ? 91.180  337.207 193.116 1.00 31.46  ? 173  PHE C O   1 
ATOM   7213  C  CB  . PHE C  3  173 ? 92.444  335.374 195.660 1.00 35.27  ? 173  PHE C CB  1 
ATOM   7214  C  CG  . PHE C  3  173 ? 91.702  334.372 194.773 1.00 32.85  ? 173  PHE C CG  1 
ATOM   7215  C  CD1 . PHE C  3  173 ? 92.416  333.484 194.020 1.00 31.43  ? 173  PHE C CD1 1 
ATOM   7216  C  CD2 . PHE C  3  173 ? 90.308  334.490 194.604 1.00 34.42  ? 173  PHE C CD2 1 
ATOM   7217  C  CE1 . PHE C  3  173 ? 91.720  332.613 193.149 1.00 35.84  ? 173  PHE C CE1 1 
ATOM   7218  C  CE2 . PHE C  3  173 ? 89.590  333.647 193.760 1.00 36.62  ? 173  PHE C CE2 1 
ATOM   7219  C  CZ  . PHE C  3  173 ? 90.290  332.701 193.020 1.00 27.41  ? 173  PHE C CZ  1 
ATOM   7220  N  N   . THR C  3  174 ? 90.579  337.920 195.179 1.00 34.30  ? 174  THR C N   1 
ATOM   7221  C  CA  . THR C  3  174 ? 89.245  338.395 194.716 1.00 33.34  ? 174  THR C CA  1 
ATOM   7222  C  C   . THR C  3  174 ? 89.484  339.600 193.717 1.00 36.20  ? 174  THR C C   1 
ATOM   7223  O  O   . THR C  3  174 ? 88.886  339.657 192.645 1.00 35.44  ? 174  THR C O   1 
ATOM   7224  C  CB  . THR C  3  174 ? 88.393  338.801 195.917 1.00 35.31  ? 174  THR C CB  1 
ATOM   7225  O  OG1 . THR C  3  174 ? 88.241  337.668 196.821 1.00 35.80  ? 174  THR C OG1 1 
ATOM   7226  C  CG2 . THR C  3  174 ? 87.013  339.328 195.461 1.00 31.25  ? 174  THR C CG2 1 
ATOM   7227  N  N   . LEU C  3  175 ? 90.431  340.494 194.007 1.00 35.62  ? 175  LEU C N   1 
ATOM   7228  C  CA  . LEU C  3  175 ? 90.616  341.577 193.063 1.00 36.61  ? 175  LEU C CA  1 
ATOM   7229  C  C   . LEU C  3  175 ? 91.226  341.060 191.809 1.00 34.79  ? 175  LEU C C   1 
ATOM   7230  O  O   . LEU C  3  175 ? 90.936  341.576 190.743 1.00 34.80  ? 175  LEU C O   1 
ATOM   7231  C  CB  . LEU C  3  175 ? 91.495  342.708 193.620 1.00 39.26  ? 175  LEU C CB  1 
ATOM   7232  C  CG  . LEU C  3  175 ? 90.789  343.332 194.832 1.00 41.73  ? 175  LEU C CG  1 
ATOM   7233  C  CD1 . LEU C  3  175 ? 91.875  344.048 195.604 1.00 38.27  ? 175  LEU C CD1 1 
ATOM   7234  C  CD2 . LEU C  3  175 ? 89.550  344.205 194.458 1.00 44.16  ? 175  LEU C CD2 1 
ATOM   7235  N  N   . LEU C  3  176 ? 92.123  340.080 191.909 1.00 33.46  ? 176  LEU C N   1 
ATOM   7236  C  CA  . LEU C  3  176 ? 92.764  339.545 190.676 1.00 33.55  ? 176  LEU C CA  1 
ATOM   7237  C  C   . LEU C  3  176 ? 91.690  338.939 189.842 1.00 32.43  ? 176  LEU C C   1 
ATOM   7238  O  O   . LEU C  3  176 ? 91.712  339.063 188.623 1.00 31.48  ? 176  LEU C O   1 
ATOM   7239  C  CB  . LEU C  3  176 ? 93.867  338.482 190.957 1.00 31.09  ? 176  LEU C CB  1 
ATOM   7240  C  CG  . LEU C  3  176 ? 95.144  339.151 191.488 1.00 36.11  ? 176  LEU C CG  1 
ATOM   7241  C  CD1 . LEU C  3  176 ? 96.031  338.129 192.235 1.00 33.06  ? 176  LEU C CD1 1 
ATOM   7242  C  CD2 . LEU C  3  176 ? 95.947  339.896 190.367 1.00 34.65  ? 176  LEU C CD2 1 
ATOM   7243  N  N   . GLN C  3  177 ? 90.775  338.199 190.488 1.00 33.94  ? 177  GLN C N   1 
ATOM   7244  C  CA  . GLN C  3  177 ? 89.717  337.550 189.743 1.00 34.71  ? 177  GLN C CA  1 
ATOM   7245  C  C   . GLN C  3  177 ? 88.765  338.566 189.065 1.00 36.65  ? 177  GLN C C   1 
ATOM   7246  O  O   . GLN C  3  177 ? 88.366  338.344 187.918 1.00 35.90  ? 177  GLN C O   1 
ATOM   7247  C  CB  . GLN C  3  177 ? 88.941  336.565 190.612 1.00 35.47  ? 177  GLN C CB  1 
ATOM   7248  C  CG  . GLN C  3  177 ? 88.278  335.569 189.779 1.00 41.31  ? 177  GLN C CG  1 
ATOM   7249  C  CD  . GLN C  3  177 ? 89.203  334.447 189.170 1.00 46.57  ? 177  GLN C CD  1 
ATOM   7250  O  OE1 . GLN C  3  177 ? 90.254  334.695 188.506 1.00 44.71  ? 177  GLN C OE1 1 
ATOM   7251  N  NE2 . GLN C  3  177 ? 88.746  333.212 189.339 1.00 42.06  ? 177  GLN C NE2 1 
ATOM   7252  N  N   . ALA C  3  178 ? 88.412  339.638 189.769 1.00 35.69  ? 178  ALA C N   1 
ATOM   7253  C  CA  . ALA C  3  178 ? 87.522  340.704 189.217 1.00 37.88  ? 178  ALA C CA  1 
ATOM   7254  C  C   . ALA C  3  178 ? 88.151  341.335 187.971 1.00 36.22  ? 178  ALA C C   1 
ATOM   7255  O  O   . ALA C  3  178 ? 87.494  341.505 186.943 1.00 36.93  ? 178  ALA C O   1 
ATOM   7256  C  CB  . ALA C  3  178 ? 87.223  341.787 190.289 1.00 36.43  ? 178  ALA C CB  1 
ATOM   7257  N  N   . SER C  3  179 ? 89.461  341.546 188.011 1.00 36.63  ? 179  SER C N   1 
ATOM   7258  C  CA  . SER C  3  179 ? 90.158  342.083 186.858 1.00 35.41  ? 179  SER C CA  1 
ATOM   7259  C  C   . SER C  3  179 ? 90.207  341.055 185.748 1.00 36.15  ? 179  SER C C   1 
ATOM   7260  O  O   . SER C  3  179 ? 89.963  341.369 184.582 1.00 36.56  ? 179  SER C O   1 
ATOM   7261  C  CB  . SER C  3  179 ? 91.533  342.497 187.305 1.00 35.74  ? 179  SER C CB  1 
ATOM   7262  O  OG  . SER C  3  179 ? 92.487  342.262 186.291 1.00 40.53  ? 179  SER C OG  1 
ATOM   7263  N  N   . GLU C  3  180 ? 90.452  339.792 186.074 1.00 35.69  ? 180  GLU C N   1 
ATOM   7264  C  CA  . GLU C  3  180 ? 90.415  338.688 185.040 1.00 35.04  ? 180  GLU C CA  1 
ATOM   7265  C  C   . GLU C  3  180 ? 89.096  338.600 184.343 1.00 33.54  ? 180  GLU C C   1 
ATOM   7266  O  O   . GLU C  3  180 ? 89.004  338.420 183.084 1.00 31.87  ? 180  GLU C O   1 
ATOM   7267  C  CB  . GLU C  3  180 ? 90.814  337.332 185.637 1.00 35.00  ? 180  GLU C CB  1 
ATOM   7268  C  CG  . GLU C  3  180 ? 92.300  337.257 185.907 1.00 45.90  ? 180  GLU C CG  1 
ATOM   7269  C  CD  . GLU C  3  180 ? 93.013  336.584 184.703 1.00 56.74  ? 180  GLU C CD  1 
ATOM   7270  O  OE1 . GLU C  3  180 ? 92.966  335.320 184.660 1.00 62.74  ? 180  GLU C OE1 1 
ATOM   7271  O  OE2 . GLU C  3  180 ? 93.549  337.303 183.829 1.00 56.17  ? 180  GLU C OE2 1 
ATOM   7272  N  N   . TYR C  3  181 ? 88.039  338.796 185.126 1.00 33.27  ? 181  TYR C N   1 
ATOM   7273  C  CA  . TYR C  3  181 ? 86.678  338.765 184.562 1.00 33.04  ? 181  TYR C CA  1 
ATOM   7274  C  C   . TYR C  3  181 ? 86.490  339.927 183.572 1.00 34.76  ? 181  TYR C C   1 
ATOM   7275  O  O   . TYR C  3  181 ? 85.977  339.748 182.470 1.00 36.10  ? 181  TYR C O   1 
ATOM   7276  C  CB  . TYR C  3  181 ? 85.652  338.890 185.684 1.00 32.38  ? 181  TYR C CB  1 
ATOM   7277  C  CG  . TYR C  3  181 ? 85.230  337.528 186.336 1.00 31.97  ? 181  TYR C CG  1 
ATOM   7278  C  CD1 . TYR C  3  181 ? 86.065  336.423 186.292 1.00 32.66  ? 181  TYR C CD1 1 
ATOM   7279  C  CD2 . TYR C  3  181 ? 84.011  337.410 186.977 1.00 31.09  ? 181  TYR C CD2 1 
ATOM   7280  C  CE1 . TYR C  3  181 ? 85.684  335.174 186.878 1.00 35.45  ? 181  TYR C CE1 1 
ATOM   7281  C  CE2 . TYR C  3  181 ? 83.591  336.207 187.557 1.00 31.42  ? 181  TYR C CE2 1 
ATOM   7282  C  CZ  . TYR C  3  181 ? 84.398  335.117 187.516 1.00 32.52  ? 181  TYR C CZ  1 
ATOM   7283  O  OH  . TYR C  3  181 ? 83.957  333.915 188.055 1.00 35.09  ? 181  TYR C OH  1 
ATOM   7284  N  N   . TYR C  3  182 ? 86.819  341.131 184.002 1.00 33.80  ? 182  TYR C N   1 
ATOM   7285  C  CA  . TYR C  3  182 ? 86.827  342.276 183.078 1.00 36.70  ? 182  TYR C CA  1 
ATOM   7286  C  C   . TYR C  3  182 ? 87.668  342.073 181.808 1.00 35.20  ? 182  TYR C C   1 
ATOM   7287  O  O   . TYR C  3  182 ? 87.180  342.340 180.730 1.00 34.99  ? 182  TYR C O   1 
ATOM   7288  C  CB  . TYR C  3  182 ? 87.177  343.598 183.821 1.00 34.03  ? 182  TYR C CB  1 
ATOM   7289  C  CG  . TYR C  3  182 ? 86.869  344.791 182.921 1.00 38.97  ? 182  TYR C CG  1 
ATOM   7290  C  CD1 . TYR C  3  182 ? 87.905  345.555 182.411 1.00 37.64  ? 182  TYR C CD1 1 
ATOM   7291  C  CD2 . TYR C  3  182 ? 85.538  345.123 182.554 1.00 37.52  ? 182  TYR C CD2 1 
ATOM   7292  C  CE1 . TYR C  3  182 ? 87.656  346.675 181.581 1.00 42.46  ? 182  TYR C CE1 1 
ATOM   7293  C  CE2 . TYR C  3  182 ? 85.277  346.228 181.719 1.00 40.35  ? 182  TYR C CE2 1 
ATOM   7294  C  CZ  . TYR C  3  182 ? 86.370  347.010 181.260 1.00 43.94  ? 182  TYR C CZ  1 
ATOM   7295  O  OH  . TYR C  3  182 ? 86.217  348.099 180.436 1.00 45.43  ? 182  TYR C OH  1 
ATOM   7296  N  N   . GLU C  3  183 ? 88.892  341.541 181.943 1.00 36.18  ? 183  GLU C N   1 
ATOM   7297  C  CA  . GLU C  3  183 ? 89.842  341.422 180.849 1.00 35.05  ? 183  GLU C CA  1 
ATOM   7298  C  C   . GLU C  3  183 ? 89.482  340.284 179.913 1.00 36.14  ? 183  GLU C C   1 
ATOM   7299  O  O   . GLU C  3  183 ? 89.879  340.312 178.743 1.00 35.66  ? 183  GLU C O   1 
ATOM   7300  C  CB  . GLU C  3  183 ? 91.289  341.239 181.400 1.00 36.02  ? 183  GLU C CB  1 
ATOM   7301  C  CG  . GLU C  3  183 ? 91.766  342.449 182.225 1.00 40.54  ? 183  GLU C CG  1 
ATOM   7302  C  CD  . GLU C  3  183 ? 91.855  343.731 181.362 1.00 43.97  ? 183  GLU C CD  1 
ATOM   7303  O  OE1 . GLU C  3  183 ? 91.568  344.796 181.891 1.00 42.91  ? 183  GLU C OE1 1 
ATOM   7304  O  OE2 . GLU C  3  183 ? 92.134  343.663 180.135 1.00 45.18  ? 183  GLU C OE2 1 
ATOM   7305  N  N   . ALA C  3  184 ? 88.721  339.269 180.382 1.00 34.84  ? 184  ALA C N   1 
ATOM   7306  C  CA  . ALA C  3  184 ? 88.533  338.031 179.565 1.00 35.07  ? 184  ALA C CA  1 
ATOM   7307  C  C   . ALA C  3  184 ? 87.842  338.383 178.227 1.00 34.65  ? 184  ALA C C   1 
ATOM   7308  O  O   . ALA C  3  184 ? 86.860  339.089 178.272 1.00 36.97  ? 184  ALA C O   1 
ATOM   7309  C  CB  . ALA C  3  184 ? 87.643  336.976 180.354 1.00 33.48  ? 184  ALA C CB  1 
ATOM   7310  N  N   . PRO C  3  185 ? 88.349  337.905 177.066 1.00 35.44  ? 185  PRO C N   1 
ATOM   7311  C  CA  . PRO C  3  185 ? 87.700  338.148 175.752 1.00 34.86  ? 185  PRO C CA  1 
ATOM   7312  C  C   . PRO C  3  185 ? 86.444  337.314 175.544 1.00 36.57  ? 185  PRO C C   1 
ATOM   7313  O  O   . PRO C  3  185 ? 85.726  337.537 174.576 1.00 38.82  ? 185  PRO C O   1 
ATOM   7314  C  CB  . PRO C  3  185 ? 88.759  337.709 174.719 1.00 34.47  ? 185  PRO C CB  1 
ATOM   7315  C  CG  . PRO C  3  185 ? 89.573  336.610 175.501 1.00 37.21  ? 185  PRO C CG  1 
ATOM   7316  C  CD  . PRO C  3  185 ? 89.600  337.093 176.944 1.00 34.13  ? 185  PRO C CD  1 
ATOM   7317  N  N   . PHE C  3  186 ? 86.161  336.387 176.464 1.00 34.56  ? 186  PHE C N   1 
ATOM   7318  C  CA  . PHE C  3  186 ? 84.964  335.528 176.328 1.00 31.94  ? 186  PHE C CA  1 
ATOM   7319  C  C   . PHE C  3  186 ? 84.048  335.862 177.550 1.00 31.12  ? 186  PHE C C   1 
ATOM   7320  O  O   . PHE C  3  186 ? 84.527  336.375 178.574 1.00 29.90  ? 186  PHE C O   1 
ATOM   7321  C  CB  . PHE C  3  186 ? 85.380  334.033 176.258 1.00 30.96  ? 186  PHE C CB  1 
ATOM   7322  C  CG  . PHE C  3  186 ? 86.211  333.614 177.421 1.00 34.05  ? 186  PHE C CG  1 
ATOM   7323  C  CD1 . PHE C  3  186 ? 85.606  333.180 178.592 1.00 30.96  ? 186  PHE C CD1 1 
ATOM   7324  C  CD2 . PHE C  3  186 ? 87.611  333.647 177.339 1.00 32.23  ? 186  PHE C CD2 1 
ATOM   7325  C  CE1 . PHE C  3  186 ? 86.394  332.783 179.675 1.00 33.41  ? 186  PHE C CE1 1 
ATOM   7326  C  CE2 . PHE C  3  186 ? 88.412  333.314 178.430 1.00 33.92  ? 186  PHE C CE2 1 
ATOM   7327  C  CZ  . PHE C  3  186 ? 87.800  332.931 179.615 1.00 33.36  ? 186  PHE C CZ  1 
ATOM   7328  N  N   . THR C  3  187 ? 82.752  335.596 177.426 1.00 30.33  ? 187  THR C N   1 
ATOM   7329  C  CA  . THR C  3  187 ? 81.775  335.962 178.446 1.00 29.86  ? 187  THR C CA  1 
ATOM   7330  C  C   . THR C  3  187 ? 80.964  334.721 178.816 1.00 29.86  ? 187  THR C C   1 
ATOM   7331  O  O   . THR C  3  187 ? 81.173  333.605 178.264 1.00 30.68  ? 187  THR C O   1 
ATOM   7332  C  CB  . THR C  3  187 ? 80.794  337.012 177.879 1.00 29.59  ? 187  THR C CB  1 
ATOM   7333  O  OG1 . THR C  3  187 ? 79.876  336.367 176.986 1.00 29.56  ? 187  THR C OG1 1 
ATOM   7334  C  CG2 . THR C  3  187 ? 81.566  338.209 177.099 1.00 29.90  ? 187  THR C CG2 1 
ATOM   7335  N  N   . ILE C  3  188 ? 80.041  334.917 179.723 1.00 30.88  ? 188  ILE C N   1 
ATOM   7336  C  CA  . ILE C  3  188 ? 79.183  333.812 180.185 1.00 32.17  ? 188  ILE C CA  1 
ATOM   7337  C  C   . ILE C  3  188 ? 78.288  333.399 179.035 1.00 32.53  ? 188  ILE C C   1 
ATOM   7338  O  O   . ILE C  3  188 ? 77.816  332.248 179.027 1.00 28.96  ? 188  ILE C O   1 
ATOM   7339  C  CB  . ILE C  3  188 ? 78.340  334.181 181.425 1.00 31.62  ? 188  ILE C CB  1 
ATOM   7340  C  CG1 . ILE C  3  188 ? 77.755  332.943 182.127 1.00 32.29  ? 188  ILE C CG1 1 
ATOM   7341  C  CG2 . ILE C  3  188 ? 77.183  335.174 181.051 1.00 32.89  ? 188  ILE C CG2 1 
ATOM   7342  C  CD1 . ILE C  3  188 ? 77.113  333.368 183.510 1.00 31.42  ? 188  ILE C CD1 1 
ATOM   7343  N  N   . SER C  3  189 ? 78.033  334.310 178.049 1.00 30.80  ? 189  SER C N   1 
ATOM   7344  C  CA  . SER C  3  189 ? 77.136  333.916 176.979 1.00 30.51  ? 189  SER C CA  1 
ATOM   7345  C  C   . SER C  3  189 ? 77.891  333.219 175.821 1.00 30.70  ? 189  SER C C   1 
ATOM   7346  O  O   . SER C  3  189 ? 77.328  332.889 174.780 1.00 31.60  ? 189  SER C O   1 
ATOM   7347  C  CB  . SER C  3  189 ? 76.307  335.085 176.474 1.00 32.01  ? 189  SER C CB  1 
ATOM   7348  O  OG  . SER C  3  189 ? 77.158  336.041 175.885 1.00 31.18  ? 189  SER C OG  1 
ATOM   7349  N  N   . ASP C  3  190 ? 79.171  332.909 175.987 1.00 31.13  ? 190  ASP C N   1 
ATOM   7350  C  CA  . ASP C  3  190 ? 79.941  332.333 174.892 1.00 30.22  ? 190  ASP C CA  1 
ATOM   7351  C  C   . ASP C  3  190 ? 79.858  330.815 175.018 1.00 30.02  ? 190  ASP C C   1 
ATOM   7352  O  O   . ASP C  3  190 ? 80.913  330.111 175.172 1.00 29.60  ? 190  ASP C O   1 
ATOM   7353  C  CB  . ASP C  3  190 ? 81.381  332.838 174.921 1.00 31.35  ? 190  ASP C CB  1 
ATOM   7354  C  CG  . ASP C  3  190 ? 81.512  334.261 174.255 1.00 33.38  ? 190  ASP C CG  1 
ATOM   7355  O  OD1 . ASP C  3  190 ? 80.568  334.662 173.609 1.00 30.16  ? 190  ASP C OD1 1 
ATOM   7356  O  OD2 . ASP C  3  190 ? 82.475  335.017 174.499 1.00 32.29  ? 190  ASP C OD2 1 
ATOM   7357  N  N   . GLY C  3  191 ? 78.645  330.300 174.843 1.00 29.80  ? 191  GLY C N   1 
ATOM   7358  C  CA  . GLY C  3  191 ? 78.450  328.869 174.749 1.00 29.23  ? 191  GLY C CA  1 
ATOM   7359  C  C   . GLY C  3  191 ? 78.797  328.212 176.090 1.00 29.84  ? 191  GLY C C   1 
ATOM   7360  O  O   . GLY C  3  191 ? 78.900  328.896 177.153 1.00 29.98  ? 191  GLY C O   1 
ATOM   7361  N  N   . VAL C  3  192 ? 78.981  326.900 176.016 1.00 28.84  ? 192  VAL C N   1 
ATOM   7362  C  CA  . VAL C  3  192 ? 79.178  326.100 177.222 1.00 30.18  ? 192  VAL C CA  1 
ATOM   7363  C  C   . VAL C  3  192 ? 80.603  326.349 177.747 1.00 30.86  ? 192  VAL C C   1 
ATOM   7364  O  O   . VAL C  3  192 ? 80.891  326.142 178.956 1.00 30.78  ? 192  VAL C O   1 
ATOM   7365  C  CB  . VAL C  3  192 ? 78.875  324.618 176.820 1.00 29.89  ? 192  VAL C CB  1 
ATOM   7366  C  CG1 . VAL C  3  192 ? 80.121  323.983 176.092 1.00 29.35  ? 192  VAL C CG1 1 
ATOM   7367  C  CG2 . VAL C  3  192 ? 78.477  323.856 177.972 1.00 36.63  ? 192  VAL C CG2 1 
ATOM   7368  N  N   . TYR C  3  193 ? 81.521  326.861 176.901 1.00 28.75  ? 193  TYR C N   1 
ATOM   7369  C  CA  . TYR C  3  193 ? 82.847  327.198 177.497 1.00 29.03  ? 193  TYR C CA  1 
ATOM   7370  C  C   . TYR C  3  193 ? 82.649  328.352 178.524 1.00 29.90  ? 193  TYR C C   1 
ATOM   7371  O  O   . TYR C  3  193 ? 83.118  328.302 179.687 1.00 28.63  ? 193  TYR C O   1 
ATOM   7372  C  CB  . TYR C  3  193 ? 83.899  327.609 176.415 1.00 29.24  ? 193  TYR C CB  1 
ATOM   7373  C  CG  . TYR C  3  193 ? 85.266  327.964 177.004 1.00 25.90  ? 193  TYR C CG  1 
ATOM   7374  C  CD1 . TYR C  3  193 ? 86.294  327.020 177.054 1.00 27.98  ? 193  TYR C CD1 1 
ATOM   7375  C  CD2 . TYR C  3  193 ? 85.507  329.240 177.557 1.00 33.70  ? 193  TYR C CD2 1 
ATOM   7376  C  CE1 . TYR C  3  193 ? 87.602  327.343 177.667 1.00 31.16  ? 193  TYR C CE1 1 
ATOM   7377  C  CE2 . TYR C  3  193 ? 86.699  329.535 178.126 1.00 32.05  ? 193  TYR C CE2 1 
ATOM   7378  C  CZ  . TYR C  3  193 ? 87.759  328.599 178.185 1.00 32.74  ? 193  TYR C CZ  1 
ATOM   7379  O  OH  . TYR C  3  193 ? 88.960  328.991 178.774 1.00 38.27  ? 193  TYR C OH  1 
ATOM   7380  N  N   . GLY C  3  194 ? 82.014  329.442 178.066 1.00 30.04  ? 194  GLY C N   1 
ATOM   7381  C  CA  . GLY C  3  194 ? 81.745  330.605 178.958 1.00 26.85  ? 194  GLY C CA  1 
ATOM   7382  C  C   . GLY C  3  194 ? 80.892  330.148 180.133 1.00 28.91  ? 194  GLY C C   1 
ATOM   7383  O  O   . GLY C  3  194 ? 81.072  330.606 181.270 1.00 26.69  ? 194  GLY C O   1 
ATOM   7384  N  N   . SER C  3  195 ? 79.879  329.317 179.829 1.00 27.99  ? 195  SER C N   1 
ATOM   7385  C  CA  . SER C  3  195 ? 78.926  328.916 180.863 1.00 29.97  ? 195  SER C CA  1 
ATOM   7386  C  C   . SER C  3  195 ? 79.632  328.231 181.989 1.00 30.47  ? 195  SER C C   1 
ATOM   7387  O  O   . SER C  3  195 ? 79.459  328.612 183.123 1.00 29.45  ? 195  SER C O   1 
ATOM   7388  C  CB  . SER C  3  195 ? 77.794  327.957 180.309 1.00 26.80  ? 195  SER C CB  1 
ATOM   7389  O  OG  . SER C  3  195 ? 77.084  328.575 179.214 1.00 29.10  ? 195  SER C OG  1 
ATOM   7390  N  N   . THR C  3  196 ? 80.379  327.191 181.647 1.00 29.89  ? 196  THR C N   1 
ATOM   7391  C  CA  . THR C  3  196 ? 81.038  326.425 182.683 1.00 32.34  ? 196  THR C CA  1 
ATOM   7392  C  C   . THR C  3  196 ? 82.122  327.273 183.351 1.00 32.89  ? 196  THR C C   1 
ATOM   7393  O  O   . THR C  3  196 ? 82.296  327.183 184.580 1.00 34.14  ? 196  THR C O   1 
ATOM   7394  C  CB  . THR C  3  196 ? 81.696  325.202 182.118 1.00 31.76  ? 196  THR C CB  1 
ATOM   7395  O  OG1 . THR C  3  196 ? 82.652  325.575 181.048 1.00 32.56  ? 196  THR C OG1 1 
ATOM   7396  C  CG2 . THR C  3  196 ? 80.656  324.168 181.697 1.00 28.10  ? 196  THR C CG2 1 
ATOM   7397  N  N   . PHE C  3  197 ? 82.862  328.069 182.573 1.00 30.99  ? 197  PHE C N   1 
ATOM   7398  C  CA  . PHE C  3  197 ? 83.975  328.897 183.157 1.00 31.45  ? 197  PHE C CA  1 
ATOM   7399  C  C   . PHE C  3  197 ? 83.450  329.800 184.231 1.00 30.67  ? 197  PHE C C   1 
ATOM   7400  O  O   . PHE C  3  197 ? 83.925  329.813 185.358 1.00 32.34  ? 197  PHE C O   1 
ATOM   7401  C  CB  . PHE C  3  197 ? 84.607  329.799 182.097 1.00 30.67  ? 197  PHE C CB  1 
ATOM   7402  C  CG  . PHE C  3  197 ? 85.793  330.559 182.608 1.00 31.69  ? 197  PHE C CG  1 
ATOM   7403  C  CD1 . PHE C  3  197 ? 87.062  329.980 182.544 1.00 30.75  ? 197  PHE C CD1 1 
ATOM   7404  C  CD2 . PHE C  3  197 ? 85.610  331.752 183.234 1.00 28.96  ? 197  PHE C CD2 1 
ATOM   7405  C  CE1 . PHE C  3  197 ? 88.191  330.674 183.024 1.00 35.03  ? 197  PHE C CE1 1 
ATOM   7406  C  CE2 . PHE C  3  197 ? 86.724  332.533 183.725 1.00 30.25  ? 197  PHE C CE2 1 
ATOM   7407  C  CZ  . PHE C  3  197 ? 88.035  331.970 183.609 1.00 29.53  ? 197  PHE C CZ  1 
ATOM   7408  N  N   . PHE C  3  198 ? 82.499  330.611 183.831 1.00 30.54  ? 198  PHE C N   1 
ATOM   7409  C  CA  . PHE C  3  198 ? 82.011  331.620 184.705 1.00 32.16  ? 198  PHE C CA  1 
ATOM   7410  C  C   . PHE C  3  198 ? 81.184  331.110 185.837 1.00 31.12  ? 198  PHE C C   1 
ATOM   7411  O  O   . PHE C  3  198 ? 81.281  331.701 186.915 1.00 30.81  ? 198  PHE C O   1 
ATOM   7412  C  CB  . PHE C  3  198 ? 81.310  332.831 183.975 1.00 31.65  ? 198  PHE C CB  1 
ATOM   7413  C  CG  . PHE C  3  198 ? 82.318  333.728 183.237 1.00 34.32  ? 198  PHE C CG  1 
ATOM   7414  C  CD1 . PHE C  3  198 ? 82.479  333.601 181.844 1.00 30.08  ? 198  PHE C CD1 1 
ATOM   7415  C  CD2 . PHE C  3  198 ? 83.276  334.493 183.983 1.00 30.97  ? 198  PHE C CD2 1 
ATOM   7416  C  CE1 . PHE C  3  198 ? 83.501  334.362 181.138 1.00 30.09  ? 198  PHE C CE1 1 
ATOM   7417  C  CE2 . PHE C  3  198 ? 84.208  335.283 183.370 1.00 30.04  ? 198  PHE C CE2 1 
ATOM   7418  C  CZ  . PHE C  3  198 ? 84.347  335.237 181.899 1.00 30.63  ? 198  PHE C CZ  1 
ATOM   7419  N  N   . VAL C  3  199 ? 80.304  330.124 185.595 1.00 28.95  ? 199  VAL C N   1 
ATOM   7420  C  CA  . VAL C  3  199 ? 79.464  329.731 186.716 1.00 30.34  ? 199  VAL C CA  1 
ATOM   7421  C  C   . VAL C  3  199 ? 80.286  328.939 187.754 1.00 28.54  ? 199  VAL C C   1 
ATOM   7422  O  O   . VAL C  3  199 ? 80.173  329.178 188.938 1.00 28.73  ? 199  VAL C O   1 
ATOM   7423  C  CB  . VAL C  3  199 ? 78.240  328.890 186.243 1.00 29.93  ? 199  VAL C CB  1 
ATOM   7424  C  CG1 . VAL C  3  199 ? 77.514  328.331 187.363 1.00 30.56  ? 199  VAL C CG1 1 
ATOM   7425  C  CG2 . VAL C  3  199 ? 77.306  329.788 185.389 1.00 26.96  ? 199  VAL C CG2 1 
ATOM   7426  N  N   . ALA C  3  200 ? 81.176  328.060 187.313 1.00 29.11  ? 200  ALA C N   1 
ATOM   7427  C  CA  . ALA C  3  200 ? 82.053  327.336 188.306 1.00 30.08  ? 200  ALA C CA  1 
ATOM   7428  C  C   . ALA C  3  200 ? 83.004  328.304 189.027 1.00 29.39  ? 200  ALA C C   1 
ATOM   7429  O  O   . ALA C  3  200 ? 83.108  328.234 190.246 1.00 27.66  ? 200  ALA C O   1 
ATOM   7430  C  CB  . ALA C  3  200 ? 82.827  326.262 187.660 1.00 28.67  ? 200  ALA C CB  1 
ATOM   7431  N  N   . THR C  3  201 ? 83.788  329.130 188.288 1.00 28.58  ? 201  THR C N   1 
ATOM   7432  C  CA  . THR C  3  201 ? 84.724  330.017 188.982 1.00 27.16  ? 201  THR C CA  1 
ATOM   7433  C  C   . THR C  3  201 ? 83.961  331.109 189.694 1.00 27.97  ? 201  THR C C   1 
ATOM   7434  O  O   . THR C  3  201 ? 84.473  331.703 190.669 1.00 29.15  ? 201  THR C O   1 
ATOM   7435  C  CB  . THR C  3  201 ? 85.819  330.715 188.043 1.00 27.29  ? 201  THR C CB  1 
ATOM   7436  O  OG1 . THR C  3  201 ? 85.143  331.662 187.146 1.00 30.95  ? 201  THR C OG1 1 
ATOM   7437  C  CG2 . THR C  3  201 ? 86.555  329.574 187.292 1.00 25.29  ? 201  THR C CG2 1 
ATOM   7438  N  N   . GLY C  3  202 ? 82.723  331.376 189.229 1.00 27.80  ? 202  GLY C N   1 
ATOM   7439  C  CA  . GLY C  3  202 ? 81.985  332.419 189.830 1.00 29.13  ? 202  GLY C CA  1 
ATOM   7440  C  C   . GLY C  3  202 ? 81.448  331.902 191.174 1.00 30.77  ? 202  GLY C C   1 
ATOM   7441  O  O   . GLY C  3  202 ? 81.517  332.643 192.172 1.00 33.21  ? 202  GLY C O   1 
ATOM   7442  N  N   . PHE C  3  203 ? 80.875  330.703 191.245 1.00 30.55  ? 203  PHE C N   1 
ATOM   7443  C  CA  . PHE C  3  203 ? 80.470  330.161 192.622 1.00 28.97  ? 203  PHE C CA  1 
ATOM   7444  C  C   . PHE C  3  203 ? 81.730  330.066 193.481 1.00 29.19  ? 203  PHE C C   1 
ATOM   7445  O  O   . PHE C  3  203 ? 81.676  330.349 194.675 1.00 29.38  ? 203  PHE C O   1 
ATOM   7446  C  CB  . PHE C  3  203 ? 79.750  328.890 192.574 1.00 30.19  ? 203  PHE C CB  1 
ATOM   7447  C  CG  . PHE C  3  203 ? 78.249  329.052 192.422 1.00 31.26  ? 203  PHE C CG  1 
ATOM   7448  C  CD1 . PHE C  3  203 ? 77.469  329.568 193.460 1.00 34.95  ? 203  PHE C CD1 1 
ATOM   7449  C  CD2 . PHE C  3  203 ? 77.639  328.688 191.248 1.00 29.45  ? 203  PHE C CD2 1 
ATOM   7450  C  CE1 . PHE C  3  203 ? 76.077  329.768 193.290 1.00 30.17  ? 203  PHE C CE1 1 
ATOM   7451  C  CE2 . PHE C  3  203 ? 76.264  328.918 191.096 1.00 29.42  ? 203  PHE C CE2 1 
ATOM   7452  C  CZ  . PHE C  3  203 ? 75.515  329.396 192.160 1.00 31.65  ? 203  PHE C CZ  1 
ATOM   7453  N  N   . HIS C  3  204 ? 82.871  329.655 192.886 1.00 29.16  ? 204  HIS C N   1 
ATOM   7454  C  CA  . HIS C  3  204 ? 84.129  329.596 193.714 1.00 29.34  ? 204  HIS C CA  1 
ATOM   7455  C  C   . HIS C  3  204 ? 84.476  330.956 194.260 1.00 29.81  ? 204  HIS C C   1 
ATOM   7456  O  O   . HIS C  3  204 ? 84.722  331.130 195.457 1.00 32.54  ? 204  HIS C O   1 
ATOM   7457  C  CB  . HIS C  3  204 ? 85.348  329.003 192.940 1.00 29.92  ? 204  HIS C CB  1 
ATOM   7458  C  CG  . HIS C  3  204 ? 86.581  329.028 193.747 1.00 30.91  ? 204  HIS C CG  1 
ATOM   7459  N  ND1 . HIS C  3  204 ? 87.532  330.022 193.623 1.00 30.80  ? 204  HIS C ND1 1 
ATOM   7460  C  CD2 . HIS C  3  204 ? 86.977  328.234 194.779 1.00 30.02  ? 204  HIS C CD2 1 
ATOM   7461  C  CE1 . HIS C  3  204 ? 88.482  329.823 194.529 1.00 29.09  ? 204  HIS C CE1 1 
ATOM   7462  N  NE2 . HIS C  3  204 ? 88.187  328.721 195.214 1.00 32.30  ? 204  HIS C NE2 1 
ATOM   7463  N  N   . GLY C  3  205 ? 84.413  332.000 193.431 1.00 32.01  ? 205  GLY C N   1 
ATOM   7464  C  CA  . GLY C  3  205 ? 84.653  333.390 193.927 1.00 28.09  ? 205  GLY C CA  1 
ATOM   7465  C  C   . GLY C  3  205 ? 83.750  333.905 195.014 1.00 30.16  ? 205  GLY C C   1 
ATOM   7466  O  O   . GLY C  3  205 ? 84.204  334.545 195.992 1.00 31.31  ? 205  GLY C O   1 
ATOM   7467  N  N   . LEU C  3  206 ? 82.463  333.590 194.922 1.00 29.89  ? 206  LEU C N   1 
ATOM   7468  C  CA  . LEU C  3  206 ? 81.559  333.819 196.017 1.00 30.61  ? 206  LEU C CA  1 
ATOM   7469  C  C   . LEU C  3  206 ? 82.010  333.126 197.314 1.00 30.08  ? 206  LEU C C   1 
ATOM   7470  O  O   . LEU C  3  206 ? 81.975  333.745 198.347 1.00 32.13  ? 206  LEU C O   1 
ATOM   7471  C  CB  . LEU C  3  206 ? 80.186  333.281 195.623 1.00 31.06  ? 206  LEU C CB  1 
ATOM   7472  C  CG  . LEU C  3  206 ? 79.107  333.344 196.736 1.00 36.92  ? 206  LEU C CG  1 
ATOM   7473  C  CD1 . LEU C  3  206 ? 78.980  334.841 197.210 1.00 35.85  ? 206  LEU C CD1 1 
ATOM   7474  C  CD2 . LEU C  3  206 ? 77.719  332.863 196.255 1.00 37.87  ? 206  LEU C CD2 1 
ATOM   7475  N  N   . HIS C  3  207 ? 82.447  331.873 197.241 1.00 31.29  ? 207  HIS C N   1 
ATOM   7476  C  CA  . HIS C  3  207 ? 82.930  331.163 198.456 1.00 31.91  ? 207  HIS C CA  1 
ATOM   7477  C  C   . HIS C  3  207 ? 84.187  331.823 199.012 1.00 31.31  ? 207  HIS C C   1 
ATOM   7478  O  O   . HIS C  3  207 ? 84.382  331.802 200.191 1.00 32.47  ? 207  HIS C O   1 
ATOM   7479  C  CB  . HIS C  3  207 ? 83.173  329.676 198.160 1.00 31.39  ? 207  HIS C CB  1 
ATOM   7480  C  CG  . HIS C  3  207 ? 81.910  328.906 198.096 1.00 35.24  ? 207  HIS C CG  1 
ATOM   7481  N  ND1 . HIS C  3  207 ? 81.014  329.031 197.051 1.00 40.32  ? 207  HIS C ND1 1 
ATOM   7482  C  CD2 . HIS C  3  207 ? 81.299  328.142 199.016 1.00 37.13  ? 207  HIS C CD2 1 
ATOM   7483  C  CE1 . HIS C  3  207 ? 79.923  328.337 197.318 1.00 39.80  ? 207  HIS C CE1 1 
ATOM   7484  N  NE2 . HIS C  3  207 ? 80.086  327.755 198.488 1.00 37.23  ? 207  HIS C NE2 1 
ATOM   7485  N  N   . VAL C  3  208 ? 85.024  332.404 198.146 1.00 31.75  ? 208  VAL C N   1 
ATOM   7486  C  CA  . VAL C  3  208 ? 86.265  333.076 198.576 1.00 31.50  ? 208  VAL C CA  1 
ATOM   7487  C  C   . VAL C  3  208 ? 85.802  334.374 199.353 1.00 31.04  ? 208  VAL C C   1 
ATOM   7488  O  O   . VAL C  3  208 ? 86.381  334.719 200.402 1.00 32.65  ? 208  VAL C O   1 
ATOM   7489  C  CB  . VAL C  3  208 ? 87.236  333.463 197.399 1.00 32.42  ? 208  VAL C CB  1 
ATOM   7490  C  CG1 . VAL C  3  208 ? 88.367  334.383 197.929 1.00 31.75  ? 208  VAL C CG1 1 
ATOM   7491  C  CG2 . VAL C  3  208 ? 87.842  332.184 196.667 1.00 32.20  ? 208  VAL C CG2 1 
ATOM   7492  N  N   . ILE C  3  209 ? 84.780  335.056 198.848 1.00 29.91  ? 209  ILE C N   1 
ATOM   7493  C  CA  . ILE C  3  209 ? 84.257  336.187 199.500 1.00 32.19  ? 209  ILE C CA  1 
ATOM   7494  C  C   . ILE C  3  209 ? 83.645  335.811 200.867 1.00 32.30  ? 209  ILE C C   1 
ATOM   7495  O  O   . ILE C  3  209 ? 83.894  336.515 201.904 1.00 32.07  ? 209  ILE C O   1 
ATOM   7496  C  CB  . ILE C  3  209 ? 83.253  336.962 198.613 1.00 32.18  ? 209  ILE C CB  1 
ATOM   7497  C  CG1 . ILE C  3  209 ? 84.026  337.687 197.500 1.00 35.61  ? 209  ILE C CG1 1 
ATOM   7498  C  CG2 . ILE C  3  209 ? 82.462  338.002 199.468 1.00 33.03  ? 209  ILE C CG2 1 
ATOM   7499  C  CD1 . ILE C  3  209 ? 83.202  337.966 196.322 1.00 34.48  ? 209  ILE C CD1 1 
ATOM   7500  N  N   . ILE C  3  210 ? 82.833  334.751 200.885 1.00 32.36  ? 210  ILE C N   1 
ATOM   7501  C  CA  . ILE C  3  210 ? 82.287  334.250 202.166 1.00 30.76  ? 210  ILE C CA  1 
ATOM   7502  C  C   . ILE C  3  210 ? 83.405  333.861 203.162 1.00 32.07  ? 210  ILE C C   1 
ATOM   7503  O  O   . ILE C  3  210 ? 83.345  334.238 204.323 1.00 32.78  ? 210  ILE C O   1 
ATOM   7504  C  CB  . ILE C  3  210 ? 81.329  333.070 201.918 1.00 32.54  ? 210  ILE C CB  1 
ATOM   7505  C  CG1 . ILE C  3  210 ? 80.037  333.556 201.156 1.00 32.86  ? 210  ILE C CG1 1 
ATOM   7506  C  CG2 . ILE C  3  210 ? 81.005  332.359 203.223 1.00 27.54  ? 210  ILE C CG2 1 
ATOM   7507  C  CD1 . ILE C  3  210 ? 79.274  332.312 200.518 1.00 33.74  ? 210  ILE C CD1 1 
ATOM   7508  N  N   . GLY C  3  211 ? 84.374  333.041 202.717 1.00 28.97  ? 211  GLY C N   1 
ATOM   7509  C  CA  . GLY C  3  211 ? 85.541  332.608 203.510 1.00 29.34  ? 211  GLY C CA  1 
ATOM   7510  C  C   . GLY C  3  211 ? 86.317  333.785 204.067 1.00 29.45  ? 211  GLY C C   1 
ATOM   7511  O  O   . GLY C  3  211 ? 86.692  333.752 205.253 1.00 28.81  ? 211  GLY C O   1 
ATOM   7512  N  N   . SER C  3  212 ? 86.545  334.799 203.217 1.00 29.33  ? 212  SER C N   1 
ATOM   7513  C  CA  . SER C  3  212 ? 87.259  336.032 203.591 1.00 30.25  ? 212  SER C CA  1 
ATOM   7514  C  C   . SER C  3  212 ? 86.434  336.781 204.667 1.00 31.02  ? 212  SER C C   1 
ATOM   7515  O  O   . SER C  3  212 ? 86.973  337.208 205.693 1.00 30.65  ? 212  SER C O   1 
ATOM   7516  C  CB  . SER C  3  212 ? 87.524  336.901 202.367 1.00 31.17  ? 212  SER C CB  1 
ATOM   7517  O  OG  . SER C  3  212 ? 88.565  336.349 201.515 1.00 31.31  ? 212  SER C OG  1 
ATOM   7518  N  N   . THR C  3  213 ? 85.115  336.862 204.485 1.00 30.99  ? 213  THR C N   1 
ATOM   7519  C  CA  . THR C  3  213 ? 84.257  337.515 205.450 1.00 29.59  ? 213  THR C CA  1 
ATOM   7520  C  C   . THR C  3  213 ? 84.379  336.770 206.767 1.00 30.94  ? 213  THR C C   1 
ATOM   7521  O  O   . THR C  3  213 ? 84.508  337.397 207.812 1.00 30.63  ? 213  THR C O   1 
ATOM   7522  C  CB  . THR C  3  213 ? 82.786  337.529 204.952 1.00 30.98  ? 213  THR C CB  1 
ATOM   7523  O  OG1 . THR C  3  213 ? 82.744  338.325 203.743 1.00 35.15  ? 213  THR C OG1 1 
ATOM   7524  C  CG2 . THR C  3  213 ? 81.881  338.204 205.986 1.00 30.99  ? 213  THR C CG2 1 
ATOM   7525  N  N   . PHE C  3  214 ? 84.403  335.418 206.725 1.00 29.41  ? 214  PHE C N   1 
ATOM   7526  C  CA  . PHE C  3  214 ? 84.415  334.593 207.939 1.00 29.37  ? 214  PHE C CA  1 
ATOM   7527  C  C   . PHE C  3  214 ? 85.761  334.861 208.627 1.00 30.31  ? 214  PHE C C   1 
ATOM   7528  O  O   . PHE C  3  214 ? 85.815  335.054 209.868 1.00 31.52  ? 214  PHE C O   1 
ATOM   7529  C  CB  . PHE C  3  214 ? 84.234  333.099 207.548 1.00 28.43  ? 214  PHE C CB  1 
ATOM   7530  C  CG  . PHE C  3  214 ? 83.826  332.152 208.710 1.00 30.69  ? 214  PHE C CG  1 
ATOM   7531  C  CD1 . PHE C  3  214 ? 83.688  332.611 210.014 1.00 27.03  ? 214  PHE C CD1 1 
ATOM   7532  C  CD2 . PHE C  3  214 ? 83.663  330.790 208.463 1.00 30.61  ? 214  PHE C CD2 1 
ATOM   7533  C  CE1 . PHE C  3  214 ? 83.363  331.716 211.081 1.00 27.64  ? 214  PHE C CE1 1 
ATOM   7534  C  CE2 . PHE C  3  214 ? 83.373  329.871 209.482 1.00 33.42  ? 214  PHE C CE2 1 
ATOM   7535  C  CZ  . PHE C  3  214 ? 83.169  330.360 210.835 1.00 31.18  ? 214  PHE C CZ  1 
ATOM   7536  N  N   . LEU C  3  215 ? 86.846  334.910 207.871 1.00 28.13  ? 215  LEU C N   1 
ATOM   7537  C  CA  . LEU C  3  215 ? 88.125  335.187 208.506 1.00 28.88  ? 215  LEU C CA  1 
ATOM   7538  C  C   . LEU C  3  215 ? 88.139  336.608 209.146 1.00 29.67  ? 215  LEU C C   1 
ATOM   7539  O  O   . LEU C  3  215 ? 88.665  336.762 210.223 1.00 31.53  ? 215  LEU C O   1 
ATOM   7540  C  CB  . LEU C  3  215 ? 89.276  335.086 207.503 1.00 29.94  ? 215  LEU C CB  1 
ATOM   7541  C  CG  . LEU C  3  215 ? 89.554  333.708 206.851 1.00 29.38  ? 215  LEU C CG  1 
ATOM   7542  C  CD1 . LEU C  3  215 ? 90.638  333.865 205.717 1.00 30.42  ? 215  LEU C CD1 1 
ATOM   7543  C  CD2 . LEU C  3  215 ? 89.993  332.752 208.009 1.00 27.80  ? 215  LEU C CD2 1 
ATOM   7544  N  N   . ILE C  3  216 ? 87.550  337.604 208.493 1.00 30.38  ? 216  ILE C N   1 
ATOM   7545  C  CA  . ILE C  3  216 ? 87.444  338.948 209.070 1.00 30.33  ? 216  ILE C CA  1 
ATOM   7546  C  C   . ILE C  3  216 ? 86.645  338.959 210.385 1.00 31.85  ? 216  ILE C C   1 
ATOM   7547  O  O   . ILE C  3  216 ? 87.049  339.643 211.340 1.00 31.27  ? 216  ILE C O   1 
ATOM   7548  C  CB  . ILE C  3  216 ? 86.864  339.931 208.066 1.00 31.43  ? 216  ILE C CB  1 
ATOM   7549  C  CG1 . ILE C  3  216 ? 87.831  340.042 206.872 1.00 31.03  ? 216  ILE C CG1 1 
ATOM   7550  C  CG2 . ILE C  3  216 ? 86.527  341.340 208.747 1.00 29.14  ? 216  ILE C CG2 1 
ATOM   7551  C  CD1 . ILE C  3  216 ? 87.230  340.812 205.591 1.00 28.14  ? 216  ILE C CD1 1 
ATOM   7552  N  N   . VAL C  3  217 ? 85.570  338.149 210.457 1.00 31.00  ? 217  VAL C N   1 
ATOM   7553  C  CA  . VAL C  3  217 ? 84.834  337.983 211.688 1.00 31.15  ? 217  VAL C CA  1 
ATOM   7554  C  C   . VAL C  3  217 ? 85.770  337.472 212.788 1.00 31.18  ? 217  VAL C C   1 
ATOM   7555  O  O   . VAL C  3  217 ? 85.808  338.065 213.846 1.00 32.78  ? 217  VAL C O   1 
ATOM   7556  C  CB  . VAL C  3  217 ? 83.571  337.106 211.526 1.00 31.94  ? 217  VAL C CB  1 
ATOM   7557  C  CG1 . VAL C  3  217 ? 83.035  336.719 212.904 1.00 30.91  ? 217  VAL C CG1 1 
ATOM   7558  C  CG2 . VAL C  3  217 ? 82.496  337.842 210.630 1.00 31.19  ? 217  VAL C CG2 1 
ATOM   7559  N  N   . CYS C  3  218 ? 86.521  336.398 212.529 1.00 30.87  ? 218  CYS C N   1 
ATOM   7560  C  CA  . CYS C  3  218 ? 87.539  335.834 213.456 1.00 31.46  ? 218  CYS C CA  1 
ATOM   7561  C  C   . CYS C  3  218 ? 88.619  336.873 213.805 1.00 30.15  ? 218  CYS C C   1 
ATOM   7562  O  O   . CYS C  3  218 ? 89.019  336.911 214.947 1.00 30.49  ? 218  CYS C O   1 
ATOM   7563  C  CB  . CYS C  3  218 ? 88.221  334.582 212.892 1.00 31.20  ? 218  CYS C CB  1 
ATOM   7564  S  SG  . CYS C  3  218 ? 87.032  333.232 212.542 1.00 33.67  ? 218  CYS C SG  1 
ATOM   7565  N  N   . PHE C  3  219 ? 89.032  337.712 212.840 1.00 29.87  ? 219  PHE C N   1 
ATOM   7566  C  CA  . PHE C  3  219 ? 89.992  338.748 213.127 1.00 31.33  ? 219  PHE C CA  1 
ATOM   7567  C  C   . PHE C  3  219 ? 89.421  339.706 214.227 1.00 30.48  ? 219  PHE C C   1 
ATOM   7568  O  O   . PHE C  3  219 ? 90.113  340.067 215.143 1.00 32.50  ? 219  PHE C O   1 
ATOM   7569  C  CB  . PHE C  3  219 ? 90.337  339.555 211.857 1.00 30.13  ? 219  PHE C CB  1 
ATOM   7570  C  CG  . PHE C  3  219 ? 91.442  340.535 212.067 1.00 32.34  ? 219  PHE C CG  1 
ATOM   7571  C  CD1 . PHE C  3  219 ? 92.815  340.102 211.983 1.00 29.65  ? 219  PHE C CD1 1 
ATOM   7572  C  CD2 . PHE C  3  219 ? 91.138  341.905 212.438 1.00 30.59  ? 219  PHE C CD2 1 
ATOM   7573  C  CE1 . PHE C  3  219 ? 93.861  341.085 212.182 1.00 32.22  ? 219  PHE C CE1 1 
ATOM   7574  C  CE2 . PHE C  3  219 ? 92.188  342.889 212.640 1.00 33.35  ? 219  PHE C CE2 1 
ATOM   7575  C  CZ  . PHE C  3  219 ? 93.559  342.451 212.539 1.00 34.03  ? 219  PHE C CZ  1 
ATOM   7576  N  N   . PHE C  3  220 ? 88.179  340.165 214.070 1.00 31.90  ? 220  PHE C N   1 
ATOM   7577  C  CA  . PHE C  3  220 ? 87.641  341.053 215.053 1.00 31.51  ? 220  PHE C CA  1 
ATOM   7578  C  C   . PHE C  3  220 ? 87.385  340.415 216.407 1.00 32.94  ? 220  PHE C C   1 
ATOM   7579  O  O   . PHE C  3  220 ? 87.561  341.047 217.471 1.00 33.12  ? 220  PHE C O   1 
ATOM   7580  C  CB  . PHE C  3  220 ? 86.433  341.820 214.495 1.00 31.29  ? 220  PHE C CB  1 
ATOM   7581  C  CG  . PHE C  3  220 ? 86.883  342.966 213.548 1.00 36.77  ? 220  PHE C CG  1 
ATOM   7582  C  CD1 . PHE C  3  220 ? 87.549  344.117 214.073 1.00 42.52  ? 220  PHE C CD1 1 
ATOM   7583  C  CD2 . PHE C  3  220 ? 86.776  342.834 212.151 1.00 35.00  ? 220  PHE C CD2 1 
ATOM   7584  C  CE1 . PHE C  3  220 ? 87.996  345.178 213.211 1.00 42.79  ? 220  PHE C CE1 1 
ATOM   7585  C  CE2 . PHE C  3  220 ? 87.213  343.879 211.248 1.00 41.35  ? 220  PHE C CE2 1 
ATOM   7586  C  CZ  . PHE C  3  220 ? 87.834  345.048 211.773 1.00 42.09  ? 220  PHE C CZ  1 
ATOM   7587  N  N   . ARG C  3  221 ? 86.952  339.170 216.390 1.00 29.46  ? 221  ARG C N   1 
ATOM   7588  C  CA  . ARG C  3  221 ? 86.826  338.460 217.653 1.00 30.17  ? 221  ARG C CA  1 
ATOM   7589  C  C   . ARG C  3  221 ? 88.164  338.257 218.341 1.00 30.49  ? 221  ARG C C   1 
ATOM   7590  O  O   . ARG C  3  221 ? 88.268  338.324 219.522 1.00 32.33  ? 221  ARG C O   1 
ATOM   7591  C  CB  . ARG C  3  221 ? 86.117  337.141 217.370 1.00 27.95  ? 221  ARG C CB  1 
ATOM   7592  C  CG  . ARG C  3  221 ? 84.606  337.333 216.820 1.00 29.19  ? 221  ARG C CG  1 
ATOM   7593  C  CD  . ARG C  3  221 ? 83.990  335.925 216.872 1.00 26.84  ? 221  ARG C CD  1 
ATOM   7594  N  NE  . ARG C  3  221 ? 83.896  335.370 218.221 1.00 28.39  ? 221  ARG C NE  1 
ATOM   7595  C  CZ  . ARG C  3  221 ? 83.779  334.061 218.519 1.00 28.83  ? 221  ARG C CZ  1 
ATOM   7596  N  NH1 . ARG C  3  221 ? 83.950  333.161 217.538 1.00 26.42  ? 221  ARG C NH1 1 
ATOM   7597  N  NH2 . ARG C  3  221 ? 83.695  333.633 219.812 1.00 23.69  ? 221  ARG C NH2 1 
ATOM   7598  N  N   . GLN C  3  222 ? 89.191  337.936 217.591 1.00 32.48  ? 222  GLN C N   1 
ATOM   7599  C  CA  . GLN C  3  222 ? 90.533  337.820 218.168 1.00 31.19  ? 222  GLN C CA  1 
ATOM   7600  C  C   . GLN C  3  222 ? 90.925  339.165 218.772 1.00 31.38  ? 222  GLN C C   1 
ATOM   7601  O  O   . GLN C  3  222 ? 91.335  339.182 219.870 1.00 31.69  ? 222  GLN C O   1 
ATOM   7602  C  CB  . GLN C  3  222 ? 91.513  337.473 217.087 1.00 29.87  ? 222  GLN C CB  1 
ATOM   7603  C  CG  . GLN C  3  222 ? 92.979  337.408 217.492 1.00 28.72  ? 222  GLN C CG  1 
ATOM   7604  C  CD  . GLN C  3  222 ? 93.306  336.500 218.685 1.00 28.89  ? 222  GLN C CD  1 
ATOM   7605  O  OE1 . GLN C  3  222 ? 92.473  335.758 219.185 1.00 32.40  ? 222  GLN C OE1 1 
ATOM   7606  N  NE2 . GLN C  3  222 ? 94.511  336.665 219.216 1.00 24.95  ? 222  GLN C NE2 1 
ATOM   7607  N  N   . LEU C  3  223 ? 90.877  340.271 218.004 1.00 33.74  ? 223  LEU C N   1 
ATOM   7608  C  CA  . LEU C  3  223 ? 91.076  341.621 218.528 1.00 36.25  ? 223  LEU C CA  1 
ATOM   7609  C  C   . LEU C  3  223 ? 90.382  341.873 219.886 1.00 36.27  ? 223  LEU C C   1 
ATOM   7610  O  O   . LEU C  3  223 ? 90.989  342.505 220.787 1.00 36.44  ? 223  LEU C O   1 
ATOM   7611  C  CB  . LEU C  3  223 ? 90.515  342.618 217.533 1.00 36.98  ? 223  LEU C CB  1 
ATOM   7612  C  CG  . LEU C  3  223 ? 91.407  343.250 216.513 1.00 40.02  ? 223  LEU C CG  1 
ATOM   7613  C  CD1 . LEU C  3  223 ? 90.640  344.484 216.044 1.00 44.15  ? 223  LEU C CD1 1 
ATOM   7614  C  CD2 . LEU C  3  223 ? 92.798  343.661 217.158 1.00 39.22  ? 223  LEU C CD2 1 
ATOM   7615  N  N   . LYS C  3  224 ? 89.125  341.384 219.995 1.00 35.09  ? 224  LYS C N   1 
ATOM   7616  C  CA  . LYS C  3  224 ? 88.343  341.421 221.251 1.00 33.70  ? 224  LYS C CA  1 
ATOM   7617  C  C   . LYS C  3  224 ? 88.613  340.332 222.300 1.00 32.67  ? 224  LYS C C   1 
ATOM   7618  O  O   . LYS C  3  224 ? 87.897  340.283 223.328 1.00 31.67  ? 224  LYS C O   1 
ATOM   7619  C  CB  . LYS C  3  224 ? 86.852  341.473 220.963 1.00 34.23  ? 224  LYS C CB  1 
ATOM   7620  C  CG  . LYS C  3  224 ? 86.490  342.669 220.165 1.00 38.07  ? 224  LYS C CG  1 
ATOM   7621  C  CD  . LYS C  3  224 ? 85.079  342.573 219.681 1.00 48.22  ? 224  LYS C CD  1 
ATOM   7622  C  CE  . LYS C  3  224 ? 84.790  343.784 218.771 1.00 56.01  ? 224  LYS C CE  1 
ATOM   7623  N  NZ  . LYS C  3  224 ? 85.188  345.104 219.413 1.00 60.34  ? 224  LYS C NZ  1 
ATOM   7624  N  N   . PHE C  3  225 ? 89.678  339.516 222.085 1.00 31.89  ? 225  PHE C N   1 
ATOM   7625  C  CA  . PHE C  3  225 ? 90.097  338.506 223.031 1.00 30.33  ? 225  PHE C CA  1 
ATOM   7626  C  C   . PHE C  3  225 ? 89.043  337.336 223.210 1.00 32.07  ? 225  PHE C C   1 
ATOM   7627  O  O   . PHE C  3  225 ? 89.036  336.662 224.246 1.00 33.76  ? 225  PHE C O   1 
ATOM   7628  C  CB  . PHE C  3  225 ? 90.354  339.140 224.402 1.00 29.99  ? 225  PHE C CB  1 
ATOM   7629  C  CG  . PHE C  3  225 ? 91.510  340.141 224.439 1.00 28.62  ? 225  PHE C CG  1 
ATOM   7630  C  CD1 . PHE C  3  225 ? 91.278  341.509 224.113 1.00 30.76  ? 225  PHE C CD1 1 
ATOM   7631  C  CD2 . PHE C  3  225 ? 92.787  339.692 224.700 1.00 26.75  ? 225  PHE C CD2 1 
ATOM   7632  C  CE1 . PHE C  3  225 ? 92.353  342.477 224.146 1.00 32.01  ? 225  PHE C CE1 1 
ATOM   7633  C  CE2 . PHE C  3  225 ? 93.889  340.657 224.754 1.00 33.10  ? 225  PHE C CE2 1 
ATOM   7634  C  CZ  . PHE C  3  225 ? 93.657  341.999 224.475 1.00 33.93  ? 225  PHE C CZ  1 
ATOM   7635  N  N   . HIS C  3  226 ? 88.213  337.040 222.210 1.00 30.88  ? 226  HIS C N   1 
ATOM   7636  C  CA  . HIS C  3  226 ? 87.161  336.043 222.471 1.00 32.03  ? 226  HIS C CA  1 
ATOM   7637  C  C   . HIS C  3  226 ? 87.807  334.673 222.508 1.00 32.01  ? 226  HIS C C   1 
ATOM   7638  O  O   . HIS C  3  226 ? 87.322  333.810 223.209 1.00 32.35  ? 226  HIS C O   1 
ATOM   7639  C  CB  . HIS C  3  226 ? 86.077  335.986 221.375 1.00 30.53  ? 226  HIS C CB  1 
ATOM   7640  C  CG  . HIS C  3  226 ? 85.198  337.198 221.289 1.00 31.27  ? 226  HIS C CG  1 
ATOM   7641  N  ND1 . HIS C  3  226 ? 84.120  337.251 220.436 1.00 28.38  ? 226  HIS C ND1 1 
ATOM   7642  C  CD2 . HIS C  3  226 ? 85.174  338.355 221.998 1.00 31.59  ? 226  HIS C CD2 1 
ATOM   7643  C  CE1 . HIS C  3  226 ? 83.531  338.427 220.544 1.00 32.48  ? 226  HIS C CE1 1 
ATOM   7644  N  NE2 . HIS C  3  226 ? 84.123  339.094 221.516 1.00 27.05  ? 226  HIS C NE2 1 
ATOM   7645  N  N   . PHE C  3  227 ? 88.894  334.465 221.754 1.00 32.03  ? 227  PHE C N   1 
ATOM   7646  C  CA  . PHE C  3  227 ? 89.379  333.052 221.612 1.00 31.61  ? 227  PHE C CA  1 
ATOM   7647  C  C   . PHE C  3  227 ? 90.359  332.734 222.731 1.00 31.77  ? 227  PHE C C   1 
ATOM   7648  O  O   . PHE C  3  227 ? 91.204  333.591 223.068 1.00 30.34  ? 227  PHE C O   1 
ATOM   7649  C  CB  . PHE C  3  227 ? 90.097  332.825 220.245 1.00 30.87  ? 227  PHE C CB  1 
ATOM   7650  C  CG  . PHE C  3  227 ? 89.234  333.127 219.028 1.00 29.16  ? 227  PHE C CG  1 
ATOM   7651  C  CD1 . PHE C  3  227 ? 88.015  332.492 218.871 1.00 31.79  ? 227  PHE C CD1 1 
ATOM   7652  C  CD2 . PHE C  3  227 ? 89.733  333.947 217.990 1.00 28.03  ? 227  PHE C CD2 1 
ATOM   7653  C  CE1 . PHE C  3  227 ? 87.217  332.679 217.709 1.00 34.36  ? 227  PHE C CE1 1 
ATOM   7654  C  CE2 . PHE C  3  227 ? 88.919  334.198 216.828 1.00 30.90  ? 227  PHE C CE2 1 
ATOM   7655  C  CZ  . PHE C  3  227 ? 87.639  333.538 216.732 1.00 30.36  ? 227  PHE C CZ  1 
ATOM   7656  N  N   . THR C  3  228 ? 90.247  331.515 223.288 1.00 30.77  ? 228  THR C N   1 
ATOM   7657  C  CA  . THR C  3  228 ? 91.287  331.078 224.171 1.00 31.48  ? 228  THR C CA  1 
ATOM   7658  C  C   . THR C  3  228 ? 92.251  330.239 223.361 1.00 32.59  ? 228  THR C C   1 
ATOM   7659  O  O   . THR C  3  228 ? 91.964  329.877 222.205 1.00 33.68  ? 228  THR C O   1 
ATOM   7660  C  CB  . THR C  3  228 ? 90.762  330.351 225.372 1.00 30.18  ? 228  THR C CB  1 
ATOM   7661  O  OG1 . THR C  3  228 ? 90.409  329.017 224.965 1.00 32.64  ? 228  THR C OG1 1 
ATOM   7662  C  CG2 . THR C  3  228 ? 89.619  331.104 226.009 1.00 32.37  ? 228  THR C CG2 1 
ATOM   7663  N  N   . SER C  3  229 ? 93.422  329.961 223.910 1.00 33.64  ? 229  SER C N   1 
ATOM   7664  C  CA  . SER C  3  229 ? 94.399  329.164 223.217 1.00 35.34  ? 229  SER C CA  1 
ATOM   7665  C  C   . SER C  3  229 ? 93.886  327.718 222.970 1.00 36.84  ? 229  SER C C   1 
ATOM   7666  O  O   . SER C  3  229 ? 94.391  326.986 222.089 1.00 36.74  ? 229  SER C O   1 
ATOM   7667  C  CB  . SER C  3  229 ? 95.741  329.194 224.023 1.00 36.28  ? 229  SER C CB  1 
ATOM   7668  O  OG  . SER C  3  229 ? 95.488  328.755 225.339 1.00 38.31  ? 229  SER C OG  1 
ATOM   7669  N  N   . ASN C  3  230 ? 92.842  327.329 223.709 1.00 37.68  ? 230  ASN C N   1 
ATOM   7670  C  CA  . ASN C  3  230 ? 92.232  326.012 223.517 1.00 38.70  ? 230  ASN C CA  1 
ATOM   7671  C  C   . ASN C  3  230 ? 90.823  325.958 222.997 1.00 35.67  ? 230  ASN C C   1 
ATOM   7672  O  O   . ASN C  3  230 ? 90.438  324.904 222.537 1.00 33.91  ? 230  ASN C O   1 
ATOM   7673  C  CB  . ASN C  3  230 ? 92.097  325.284 224.815 1.00 42.87  ? 230  ASN C CB  1 
ATOM   7674  C  CG  . ASN C  3  230 ? 93.087  324.293 224.953 1.00 52.64  ? 230  ASN C CG  1 
ATOM   7675  O  OD1 . ASN C  3  230 ? 93.181  323.375 224.093 1.00 64.27  ? 230  ASN C OD1 1 
ATOM   7676  N  ND2 . ASN C  3  230 ? 93.905  324.414 226.017 1.00 58.21  ? 230  ASN C ND2 1 
ATOM   7677  N  N   . HIS C  3  231 ? 90.064  327.047 223.077 1.00 32.17  ? 231  HIS C N   1 
ATOM   7678  C  CA  . HIS C  3  231 ? 88.671  327.036 222.642 1.00 30.90  ? 231  HIS C CA  1 
ATOM   7679  C  C   . HIS C  3  231 ? 88.511  328.165 221.607 1.00 31.31  ? 231  HIS C C   1 
ATOM   7680  O  O   . HIS C  3  231 ? 88.562  329.374 221.934 1.00 32.23  ? 231  HIS C O   1 
ATOM   7681  C  CB  . HIS C  3  231 ? 87.717  327.187 223.845 1.00 29.24  ? 231  HIS C CB  1 
ATOM   7682  C  CG  . HIS C  3  231 ? 86.274  326.927 223.534 1.00 31.52  ? 231  HIS C CG  1 
ATOM   7683  N  ND1 . HIS C  3  231 ? 85.356  326.597 224.498 1.00 32.41  ? 231  HIS C ND1 1 
ATOM   7684  C  CD2 . HIS C  3  231 ? 85.578  326.992 222.372 1.00 31.50  ? 231  HIS C CD2 1 
ATOM   7685  C  CE1 . HIS C  3  231 ? 84.175  326.358 223.937 1.00 29.48  ? 231  HIS C CE1 1 
ATOM   7686  N  NE2 . HIS C  3  231 ? 84.268  326.667 222.660 1.00 32.25  ? 231  HIS C NE2 1 
ATOM   7687  N  N   . HIS C  3  232 ? 88.404  327.794 220.318 1.00 30.20  ? 232  HIS C N   1 
ATOM   7688  C  CA  . HIS C  3  232 ? 88.287  328.772 219.272 1.00 30.36  ? 232  HIS C CA  1 
ATOM   7689  C  C   . HIS C  3  232 ? 87.671  328.112 218.027 1.00 31.34  ? 232  HIS C C   1 
ATOM   7690  O  O   . HIS C  3  232 ? 88.255  328.138 216.945 1.00 30.67  ? 232  HIS C O   1 
ATOM   7691  C  CB  . HIS C  3  232 ? 89.674  329.341 218.943 1.00 30.03  ? 232  HIS C CB  1 
ATOM   7692  C  CG  . HIS C  3  232 ? 90.716  328.290 218.815 1.00 30.89  ? 232  HIS C CG  1 
ATOM   7693  N  ND1 . HIS C  3  232 ? 91.639  328.044 219.807 1.00 29.96  ? 232  HIS C ND1 1 
ATOM   7694  C  CD2 . HIS C  3  232 ? 91.022  327.439 217.792 1.00 29.54  ? 232  HIS C CD2 1 
ATOM   7695  C  CE1 . HIS C  3  232 ? 92.466  327.061 219.414 1.00 33.43  ? 232  HIS C CE1 1 
ATOM   7696  N  NE2 . HIS C  3  232 ? 92.100  326.659 218.209 1.00 32.14  ? 232  HIS C NE2 1 
ATOM   7697  N  N   . PHE C  3  233 ? 86.490  327.522 218.221 1.00 31.38  ? 233  PHE C N   1 
ATOM   7698  C  CA  . PHE C  3  233 ? 85.852  326.793 217.130 1.00 33.51  ? 233  PHE C CA  1 
ATOM   7699  C  C   . PHE C  3  233 ? 85.566  327.691 215.900 1.00 32.82  ? 233  PHE C C   1 
ATOM   7700  O  O   . PHE C  3  233 ? 85.658  327.243 214.766 1.00 35.41  ? 233  PHE C O   1 
ATOM   7701  C  CB  . PHE C  3  233 ? 84.567  326.065 217.487 1.00 32.84  ? 233  PHE C CB  1 
ATOM   7702  C  CG  . PHE C  3  233 ? 84.080  325.255 216.318 1.00 35.20  ? 233  PHE C CG  1 
ATOM   7703  C  CD1 . PHE C  3  233 ? 82.918  325.589 215.654 1.00 34.88  ? 233  PHE C CD1 1 
ATOM   7704  C  CD2 . PHE C  3  233 ? 84.882  324.214 215.831 1.00 36.10  ? 233  PHE C CD2 1 
ATOM   7705  C  CE1 . PHE C  3  233 ? 82.527  324.855 214.507 1.00 29.88  ? 233  PHE C CE1 1 
ATOM   7706  C  CE2 . PHE C  3  233 ? 84.530  323.550 214.656 1.00 36.85  ? 233  PHE C CE2 1 
ATOM   7707  C  CZ  . PHE C  3  233 ? 83.318  323.848 214.040 1.00 31.84  ? 233  PHE C CZ  1 
ATOM   7708  N  N   . GLY C  3  234 ? 85.168  328.911 216.137 1.00 31.27  ? 234  GLY C N   1 
ATOM   7709  C  CA  . GLY C  3  234 ? 84.858  329.854 215.012 1.00 30.50  ? 234  GLY C CA  1 
ATOM   7710  C  C   . GLY C  3  234 ? 86.083  329.938 214.138 1.00 31.29  ? 234  GLY C C   1 
ATOM   7711  O  O   . GLY C  3  234 ? 85.975  329.867 212.902 1.00 31.07  ? 234  GLY C O   1 
ATOM   7712  N  N   . PHE C  3  235 ? 87.255  330.103 214.757 1.00 29.78  ? 235  PHE C N   1 
ATOM   7713  C  CA  . PHE C  3  235 ? 88.510  330.119 213.953 1.00 29.62  ? 235  PHE C CA  1 
ATOM   7714  C  C   . PHE C  3  235 ? 88.802  328.784 213.232 1.00 30.00  ? 235  PHE C C   1 
ATOM   7715  O  O   . PHE C  3  235 ? 89.182  328.797 212.053 1.00 29.05  ? 235  PHE C O   1 
ATOM   7716  C  CB  . PHE C  3  235 ? 89.733  330.496 214.828 1.00 28.59  ? 235  PHE C CB  1 
ATOM   7717  C  CG  . PHE C  3  235 ? 90.999  330.438 214.079 1.00 31.83  ? 235  PHE C CG  1 
ATOM   7718  C  CD1 . PHE C  3  235 ? 91.451  331.593 213.355 1.00 37.02  ? 235  PHE C CD1 1 
ATOM   7719  C  CD2 . PHE C  3  235 ? 91.727  329.238 214.009 1.00 34.11  ? 235  PHE C CD2 1 
ATOM   7720  C  CE1 . PHE C  3  235 ? 92.631  331.545 212.578 1.00 37.09  ? 235  PHE C CE1 1 
ATOM   7721  C  CE2 . PHE C  3  235 ? 92.914  329.177 213.173 1.00 32.48  ? 235  PHE C CE2 1 
ATOM   7722  C  CZ  . PHE C  3  235 ? 93.341  330.349 212.505 1.00 31.57  ? 235  PHE C CZ  1 
ATOM   7723  N  N   . GLU C  3  236 ? 88.716  327.631 213.945 1.00 28.97  ? 236  GLU C N   1 
ATOM   7724  C  CA  . GLU C  3  236 ? 88.790  326.379 213.231 1.00 30.34  ? 236  GLU C CA  1 
ATOM   7725  C  C   . GLU C  3  236 ? 87.876  326.205 212.038 1.00 30.73  ? 236  GLU C C   1 
ATOM   7726  O  O   . GLU C  3  236 ? 88.375  325.792 210.974 1.00 31.67  ? 236  GLU C O   1 
ATOM   7727  C  CB  . GLU C  3  236 ? 88.662  325.155 214.178 1.00 29.16  ? 236  GLU C CB  1 
ATOM   7728  C  CG  . GLU C  3  236 ? 89.932  325.316 215.058 1.00 44.38  ? 236  GLU C CG  1 
ATOM   7729  C  CD  . GLU C  3  236 ? 90.459  324.035 215.525 1.00 54.79  ? 236  GLU C CD  1 
ATOM   7730  O  OE1 . GLU C  3  236 ? 90.549  324.017 216.761 1.00 62.60  ? 236  GLU C OE1 1 
ATOM   7731  O  OE2 . GLU C  3  236 ? 90.767  323.107 214.722 1.00 54.30  ? 236  GLU C OE2 1 
ATOM   7732  N  N   . ALA C  3  237 ? 86.550  326.399 212.218 1.00 28.88  ? 237  ALA C N   1 
ATOM   7733  C  CA  . ALA C  3  237 ? 85.626  326.334 211.149 1.00 27.94  ? 237  ALA C CA  1 
ATOM   7734  C  C   . ALA C  3  237 ? 86.021  327.232 209.949 1.00 30.42  ? 237  ALA C C   1 
ATOM   7735  O  O   . ALA C  3  237 ? 85.922  326.811 208.764 1.00 32.21  ? 237  ALA C O   1 
ATOM   7736  C  CB  . ALA C  3  237 ? 84.217  326.792 211.696 1.00 27.15  ? 237  ALA C CB  1 
ATOM   7737  N  N   . ALA C  3  238 ? 86.463  328.455 210.213 1.00 29.67  ? 238  ALA C N   1 
ATOM   7738  C  CA  . ALA C  3  238 ? 86.778  329.335 209.131 1.00 28.95  ? 238  ALA C CA  1 
ATOM   7739  C  C   . ALA C  3  238 ? 88.042  328.810 208.448 1.00 29.55  ? 238  ALA C C   1 
ATOM   7740  O  O   . ALA C  3  238 ? 88.161  328.963 207.218 1.00 29.51  ? 238  ALA C O   1 
ATOM   7741  C  CB  . ALA C  3  238 ? 86.990  330.727 209.648 1.00 29.15  ? 238  ALA C CB  1 
ATOM   7742  N  N   . ALA C  3  239 ? 88.959  328.194 209.199 1.00 28.52  ? 239  ALA C N   1 
ATOM   7743  C  CA  . ALA C  3  239 ? 90.216  327.610 208.581 1.00 28.88  ? 239  ALA C CA  1 
ATOM   7744  C  C   . ALA C  3  239 ? 89.845  326.358 207.706 1.00 30.52  ? 239  ALA C C   1 
ATOM   7745  O  O   . ALA C  3  239 ? 90.422  326.216 206.612 1.00 29.08  ? 239  ALA C O   1 
ATOM   7746  C  CB  . ALA C  3  239 ? 91.264  327.113 209.633 1.00 28.19  ? 239  ALA C CB  1 
ATOM   7747  N  N   . TRP C  3  240 ? 89.021  325.433 208.260 1.00 27.64  ? 240  TRP C N   1 
ATOM   7748  C  CA  . TRP C  3  240 ? 88.492  324.319 207.423 1.00 30.13  ? 240  TRP C CA  1 
ATOM   7749  C  C   . TRP C  3  240 ? 87.792  324.806 206.159 1.00 30.48  ? 240  TRP C C   1 
ATOM   7750  O  O   . TRP C  3  240 ? 88.053  324.290 205.068 1.00 30.25  ? 240  TRP C O   1 
ATOM   7751  C  CB  . TRP C  3  240 ? 87.468  323.531 208.155 1.00 26.47  ? 240  TRP C CB  1 
ATOM   7752  C  CG  . TRP C  3  240 ? 88.035  322.863 209.385 1.00 29.62  ? 240  TRP C CG  1 
ATOM   7753  C  CD1 . TRP C  3  240 ? 89.420  322.759 209.788 1.00 32.63  ? 240  TRP C CD1 1 
ATOM   7754  C  CD2 . TRP C  3  240 ? 87.267  322.215 210.401 1.00 30.18  ? 240  TRP C CD2 1 
ATOM   7755  N  NE1 . TRP C  3  240 ? 89.470  322.040 210.973 1.00 31.95  ? 240  TRP C NE1 1 
ATOM   7756  C  CE2 . TRP C  3  240 ? 88.186  321.712 211.379 1.00 33.28  ? 240  TRP C CE2 1 
ATOM   7757  C  CE3 . TRP C  3  240 ? 85.873  322.024 210.592 1.00 32.67  ? 240  TRP C CE3 1 
ATOM   7758  C  CZ2 . TRP C  3  240 ? 87.739  321.004 212.554 1.00 31.14  ? 240  TRP C CZ2 1 
ATOM   7759  C  CZ3 . TRP C  3  240 ? 85.419  321.279 211.728 1.00 30.37  ? 240  TRP C CZ3 1 
ATOM   7760  C  CH2 . TRP C  3  240 ? 86.366  320.753 212.671 1.00 32.61  ? 240  TRP C CH2 1 
ATOM   7761  N  N   . TYR C  3  241 ? 86.968  325.840 206.291 1.00 28.42  ? 241  TYR C N   1 
ATOM   7762  C  CA  . TYR C  3  241 ? 86.229  326.320 205.114 1.00 28.50  ? 241  TYR C CA  1 
ATOM   7763  C  C   . TYR C  3  241 ? 87.241  326.930 204.118 1.00 30.14  ? 241  TYR C C   1 
ATOM   7764  O  O   . TYR C  3  241 ? 87.091  326.831 202.890 1.00 29.09  ? 241  TYR C O   1 
ATOM   7765  C  CB  . TYR C  3  241 ? 85.291  327.383 205.567 1.00 29.90  ? 241  TYR C CB  1 
ATOM   7766  C  CG  . TYR C  3  241 ? 84.279  327.791 204.544 1.00 32.23  ? 241  TYR C CG  1 
ATOM   7767  C  CD1 . TYR C  3  241 ? 83.187  326.965 204.256 1.00 37.66  ? 241  TYR C CD1 1 
ATOM   7768  C  CD2 . TYR C  3  241 ? 84.385  328.972 203.880 1.00 33.61  ? 241  TYR C CD2 1 
ATOM   7769  C  CE1 . TYR C  3  241 ? 82.187  327.388 203.275 1.00 33.55  ? 241  TYR C CE1 1 
ATOM   7770  C  CE2 . TYR C  3  241 ? 83.467  329.345 202.889 1.00 36.60  ? 241  TYR C CE2 1 
ATOM   7771  C  CZ  . TYR C  3  241 ? 82.394  328.527 202.585 1.00 32.75  ? 241  TYR C CZ  1 
ATOM   7772  O  OH  . TYR C  3  241 ? 81.425  328.990 201.733 1.00 39.73  ? 241  TYR C OH  1 
ATOM   7773  N  N   . TRP C  3  242 ? 88.309  327.537 204.684 1.00 26.38  ? 242  TRP C N   1 
ATOM   7774  C  CA  . TRP C  3  242 ? 89.327  328.190 203.859 1.00 29.29  ? 242  TRP C CA  1 
ATOM   7775  C  C   . TRP C  3  242 ? 90.143  327.211 203.028 1.00 28.73  ? 242  TRP C C   1 
ATOM   7776  O  O   . TRP C  3  242 ? 90.418  327.451 201.811 1.00 27.97  ? 242  TRP C O   1 
ATOM   7777  C  CB  . TRP C  3  242 ? 90.245  329.182 204.743 1.00 26.97  ? 242  TRP C CB  1 
ATOM   7778  C  CG  . TRP C  3  242 ? 91.029  330.133 203.887 1.00 29.46  ? 242  TRP C CG  1 
ATOM   7779  C  CD1 . TRP C  3  242 ? 92.423  330.103 203.663 1.00 27.69  ? 242  TRP C CD1 1 
ATOM   7780  C  CD2 . TRP C  3  242 ? 90.499  331.205 203.036 1.00 24.12  ? 242  TRP C CD2 1 
ATOM   7781  N  NE1 . TRP C  3  242 ? 92.729  331.075 202.737 1.00 28.08  ? 242  TRP C NE1 1 
ATOM   7782  C  CE2 . TRP C  3  242 ? 91.566  331.737 202.344 1.00 28.78  ? 242  TRP C CE2 1 
ATOM   7783  C  CE3 . TRP C  3  242 ? 89.192  331.722 202.800 1.00 26.57  ? 242  TRP C CE3 1 
ATOM   7784  C  CZ2 . TRP C  3  242 ? 91.424  332.858 201.487 1.00 29.28  ? 242  TRP C CZ2 1 
ATOM   7785  C  CZ3 . TRP C  3  242 ? 89.023  332.726 201.886 1.00 26.06  ? 242  TRP C CZ3 1 
ATOM   7786  C  CH2 . TRP C  3  242 ? 90.154  333.303 201.243 1.00 31.74  ? 242  TRP C CH2 1 
ATOM   7787  N  N   . HIS C  3  243 ? 90.551  326.096 203.661 1.00 28.71  ? 243  HIS C N   1 
ATOM   7788  C  CA  . HIS C  3  243 ? 91.202  324.992 202.965 1.00 30.39  ? 243  HIS C CA  1 
ATOM   7789  C  C   . HIS C  3  243 ? 90.288  324.381 201.864 1.00 30.30  ? 243  HIS C C   1 
ATOM   7790  O  O   . HIS C  3  243 ? 90.744  324.048 200.738 1.00 31.66  ? 243  HIS C O   1 
ATOM   7791  C  CB  . HIS C  3  243 ? 91.603  323.942 204.006 1.00 28.77  ? 243  HIS C CB  1 
ATOM   7792  C  CG  . HIS C  3  243 ? 92.736  324.434 204.882 1.00 33.73  ? 243  HIS C CG  1 
ATOM   7793  N  ND1 . HIS C  3  243 ? 93.881  324.963 204.356 1.00 33.39  ? 243  HIS C ND1 1 
ATOM   7794  C  CD2 . HIS C  3  243 ? 92.914  324.448 206.225 1.00 35.06  ? 243  HIS C CD2 1 
ATOM   7795  C  CE1 . HIS C  3  243 ? 94.711  325.327 205.315 1.00 36.30  ? 243  HIS C CE1 1 
ATOM   7796  N  NE2 . HIS C  3  243 ? 94.137  325.021 206.469 1.00 36.20  ? 243  HIS C NE2 1 
ATOM   7797  N  N   . PHE C  3  244 ? 89.001  324.313 202.169 1.00 27.05  ? 244  PHE C N   1 
ATOM   7798  C  CA  . PHE C  3  244 ? 88.008  323.851 201.198 1.00 26.31  ? 244  PHE C CA  1 
ATOM   7799  C  C   . PHE C  3  244 ? 88.062  324.763 200.004 1.00 28.50  ? 244  PHE C C   1 
ATOM   7800  O  O   . PHE C  3  244 ? 88.157  324.312 198.848 1.00 30.59  ? 244  PHE C O   1 
ATOM   7801  C  CB  . PHE C  3  244 ? 86.628  323.902 201.891 1.00 26.55  ? 244  PHE C CB  1 
ATOM   7802  C  CG  . PHE C  3  244 ? 85.460  324.005 200.913 1.00 31.19  ? 244  PHE C CG  1 
ATOM   7803  C  CD1 . PHE C  3  244 ? 84.745  325.177 200.793 1.00 32.23  ? 244  PHE C CD1 1 
ATOM   7804  C  CD2 . PHE C  3  244 ? 85.110  322.906 200.073 1.00 35.33  ? 244  PHE C CD2 1 
ATOM   7805  C  CE1 . PHE C  3  244 ? 83.620  325.352 199.876 1.00 33.36  ? 244  PHE C CE1 1 
ATOM   7806  C  CE2 . PHE C  3  244 ? 83.985  323.071 199.133 1.00 26.50  ? 244  PHE C CE2 1 
ATOM   7807  C  CZ  . PHE C  3  244 ? 83.298  324.332 198.995 1.00 29.36  ? 244  PHE C CZ  1 
ATOM   7808  N  N   . VAL C  3  245 ? 87.962  326.068 200.228 1.00 28.01  ? 245  VAL C N   1 
ATOM   7809  C  CA  . VAL C  3  245 ? 87.991  327.003 199.095 1.00 30.48  ? 245  VAL C CA  1 
ATOM   7810  C  C   . VAL C  3  245 ? 89.339  326.869 198.273 1.00 30.25  ? 245  VAL C C   1 
ATOM   7811  O  O   . VAL C  3  245 ? 89.351  326.920 197.030 1.00 30.42  ? 245  VAL C O   1 
ATOM   7812  C  CB  . VAL C  3  245 ? 87.804  328.445 199.716 1.00 32.12  ? 245  VAL C CB  1 
ATOM   7813  C  CG1 . VAL C  3  245 ? 88.235  329.459 198.790 1.00 35.48  ? 245  VAL C CG1 1 
ATOM   7814  C  CG2 . VAL C  3  245 ? 86.315  328.643 199.931 1.00 37.56  ? 245  VAL C CG2 1 
ATOM   7815  N  N   . ASP C  3  246 ? 90.481  326.668 198.951 1.00 29.45  ? 246  ASP C N   1 
ATOM   7816  C  CA  . ASP C  3  246 ? 91.747  326.478 198.268 1.00 31.48  ? 246  ASP C CA  1 
ATOM   7817  C  C   . ASP C  3  246 ? 91.719  325.180 197.439 1.00 31.52  ? 246  ASP C C   1 
ATOM   7818  O  O   . ASP C  3  246 ? 92.233  325.142 196.320 1.00 33.35  ? 246  ASP C O   1 
ATOM   7819  C  CB  . ASP C  3  246 ? 92.884  326.255 199.332 1.00 32.18  ? 246  ASP C CB  1 
ATOM   7820  C  CG  . ASP C  3  246 ? 94.288  326.267 198.705 1.00 42.29  ? 246  ASP C CG  1 
ATOM   7821  O  OD1 . ASP C  3  246 ? 94.346  326.534 197.449 1.00 46.07  ? 246  ASP C OD1 1 
ATOM   7822  O  OD2 . ASP C  3  246 ? 95.339  326.017 199.431 1.00 44.43  ? 246  ASP C OD2 1 
ATOM   7823  N  N   . VAL C  3  247 ? 91.188  324.085 197.981 1.00 29.36  ? 247  VAL C N   1 
ATOM   7824  C  CA  . VAL C  3  247 ? 91.198  322.826 197.259 1.00 31.88  ? 247  VAL C CA  1 
ATOM   7825  C  C   . VAL C  3  247 ? 90.273  322.906 196.032 1.00 31.34  ? 247  VAL C C   1 
ATOM   7826  O  O   . VAL C  3  247 ? 90.639  322.393 194.955 1.00 30.79  ? 247  VAL C O   1 
ATOM   7827  C  CB  . VAL C  3  247 ? 90.862  321.578 198.163 1.00 32.61  ? 247  VAL C CB  1 
ATOM   7828  C  CG1 . VAL C  3  247 ? 90.726  320.321 197.301 1.00 32.90  ? 247  VAL C CG1 1 
ATOM   7829  C  CG2 . VAL C  3  247 ? 91.896  321.463 199.302 1.00 32.87  ? 247  VAL C CG2 1 
ATOM   7830  N  N   . VAL C  3  248 ? 89.123  323.544 196.191 1.00 29.94  ? 248  VAL C N   1 
ATOM   7831  C  CA  . VAL C  3  248 ? 88.244  323.712 195.047 1.00 29.19  ? 248  VAL C CA  1 
ATOM   7832  C  C   . VAL C  3  248 ? 88.985  324.513 193.975 1.00 29.95  ? 248  VAL C C   1 
ATOM   7833  O  O   . VAL C  3  248 ? 88.903  324.181 192.778 1.00 31.18  ? 248  VAL C O   1 
ATOM   7834  C  CB  . VAL C  3  248 ? 86.952  324.457 195.378 1.00 28.20  ? 248  VAL C CB  1 
ATOM   7835  C  CG1 . VAL C  3  248 ? 86.189  324.835 194.077 1.00 29.47  ? 248  VAL C CG1 1 
ATOM   7836  C  CG2 . VAL C  3  248 ? 86.054  323.535 196.252 1.00 26.90  ? 248  VAL C CG2 1 
ATOM   7837  N  N   . TRP C  3  249 ? 89.672  325.574 194.363 1.00 28.45  ? 249  TRP C N   1 
ATOM   7838  C  CA  . TRP C  3  249 ? 90.448  326.327 193.381 1.00 29.24  ? 249  TRP C CA  1 
ATOM   7839  C  C   . TRP C  3  249 ? 91.446  325.406 192.633 1.00 30.49  ? 249  TRP C C   1 
ATOM   7840  O  O   . TRP C  3  249 ? 91.607  325.524 191.385 1.00 30.51  ? 249  TRP C O   1 
ATOM   7841  C  CB  . TRP C  3  249 ? 91.310  327.439 194.027 1.00 28.98  ? 249  TRP C CB  1 
ATOM   7842  C  CG  . TRP C  3  249 ? 92.200  328.099 192.947 1.00 31.07  ? 249  TRP C CG  1 
ATOM   7843  C  CD1 . TRP C  3  249 ? 93.601  328.010 192.804 1.00 28.89  ? 249  TRP C CD1 1 
ATOM   7844  C  CD2 . TRP C  3  249 ? 91.741  328.891 191.829 1.00 32.05  ? 249  TRP C CD2 1 
ATOM   7845  N  NE1 . TRP C  3  249 ? 93.995  328.650 191.625 1.00 30.51  ? 249  TRP C NE1 1 
ATOM   7846  C  CE2 . TRP C  3  249 ? 92.891  329.233 191.043 1.00 30.45  ? 249  TRP C CE2 1 
ATOM   7847  C  CE3 . TRP C  3  249 ? 90.481  329.323 191.397 1.00 28.51  ? 249  TRP C CE3 1 
ATOM   7848  C  CZ2 . TRP C  3  249 ? 92.787  330.001 189.857 1.00 31.78  ? 249  TRP C CZ2 1 
ATOM   7849  C  CZ3 . TRP C  3  249 ? 90.398  330.157 190.264 1.00 30.36  ? 249  TRP C CZ3 1 
ATOM   7850  C  CH2 . TRP C  3  249 ? 91.531  330.494 189.517 1.00 28.46  ? 249  TRP C CH2 1 
ATOM   7851  N  N   . LEU C  3  250 ? 92.212  324.626 193.372 1.00 30.81  ? 250  LEU C N   1 
ATOM   7852  C  CA  . LEU C  3  250 ? 93.200  323.690 192.737 1.00 30.88  ? 250  LEU C CA  1 
ATOM   7853  C  C   . LEU C  3  250 ? 92.553  322.769 191.695 1.00 31.88  ? 250  LEU C C   1 
ATOM   7854  O  O   . LEU C  3  250 ? 93.143  322.505 190.628 1.00 31.06  ? 250  LEU C O   1 
ATOM   7855  C  CB  . LEU C  3  250 ? 93.900  322.855 193.767 1.00 31.28  ? 250  LEU C CB  1 
ATOM   7856  C  CG  . LEU C  3  250 ? 94.829  323.614 194.687 1.00 35.25  ? 250  LEU C CG  1 
ATOM   7857  C  CD1 . LEU C  3  250 ? 95.313  322.784 195.951 1.00 33.79  ? 250  LEU C CD1 1 
ATOM   7858  C  CD2 . LEU C  3  250 ? 96.021  324.264 193.946 1.00 39.50  ? 250  LEU C CD2 1 
ATOM   7859  N  N   . PHE C  3  251 ? 91.325  322.319 191.967 1.00 31.37  ? 251  PHE C N   1 
ATOM   7860  C  CA  . PHE C  3  251 ? 90.644  321.483 191.008 1.00 31.95  ? 251  PHE C CA  1 
ATOM   7861  C  C   . PHE C  3  251 ? 90.191  322.326 189.812 1.00 32.47  ? 251  PHE C C   1 
ATOM   7862  O  O   . PHE C  3  251 ? 90.206  321.822 188.680 1.00 31.40  ? 251  PHE C O   1 
ATOM   7863  C  CB  . PHE C  3  251 ? 89.422  320.851 191.661 1.00 32.16  ? 251  PHE C CB  1 
ATOM   7864  C  CG  . PHE C  3  251 ? 89.732  319.549 192.324 1.00 34.01  ? 251  PHE C CG  1 
ATOM   7865  C  CD1 . PHE C  3  251 ? 90.210  319.505 193.632 1.00 35.33  ? 251  PHE C CD1 1 
ATOM   7866  C  CD2 . PHE C  3  251 ? 89.650  318.328 191.589 1.00 39.92  ? 251  PHE C CD2 1 
ATOM   7867  C  CE1 . PHE C  3  251 ? 90.610  318.258 194.226 1.00 37.62  ? 251  PHE C CE1 1 
ATOM   7868  C  CE2 . PHE C  3  251 ? 89.982  317.091 192.201 1.00 43.37  ? 251  PHE C CE2 1 
ATOM   7869  C  CZ  . PHE C  3  251 ? 90.477  317.063 193.524 1.00 40.52  ? 251  PHE C CZ  1 
ATOM   7870  N  N   . LEU C  3  252 ? 89.688  323.554 190.049 1.00 31.48  ? 252  LEU C N   1 
ATOM   7871  C  CA  . LEU C  3  252 ? 89.305  324.468 188.934 1.00 31.69  ? 252  LEU C CA  1 
ATOM   7872  C  C   . LEU C  3  252 ? 90.506  324.758 188.062 1.00 31.59  ? 252  LEU C C   1 
ATOM   7873  O  O   . LEU C  3  252 ? 90.422  324.739 186.811 1.00 30.70  ? 252  LEU C O   1 
ATOM   7874  C  CB  . LEU C  3  252 ? 88.674  325.817 189.450 1.00 30.64  ? 252  LEU C CB  1 
ATOM   7875  C  CG  . LEU C  3  252 ? 87.289  325.621 190.148 1.00 32.20  ? 252  LEU C CG  1 
ATOM   7876  C  CD1 . LEU C  3  252 ? 86.994  326.973 190.836 1.00 27.40  ? 252  LEU C CD1 1 
ATOM   7877  C  CD2 . LEU C  3  252 ? 86.317  325.353 189.096 1.00 27.63  ? 252  LEU C CD2 1 
ATOM   7878  N  N   . TYR C  3  253 ? 91.637  325.032 188.705 1.00 32.07  ? 253  TYR C N   1 
ATOM   7879  C  CA  . TYR C  3  253 ? 92.868  325.414 188.009 1.00 31.35  ? 253  TYR C CA  1 
ATOM   7880  C  C   . TYR C  3  253 ? 93.321  324.263 187.059 1.00 33.72  ? 253  TYR C C   1 
ATOM   7881  O  O   . TYR C  3  253 ? 93.483  324.445 185.841 1.00 32.64  ? 253  TYR C O   1 
ATOM   7882  C  CB  . TYR C  3  253 ? 93.972  325.792 188.998 1.00 30.81  ? 253  TYR C CB  1 
ATOM   7883  C  CG  . TYR C  3  253 ? 95.201  326.274 188.293 1.00 30.85  ? 253  TYR C CG  1 
ATOM   7884  C  CD1 . TYR C  3  253 ? 95.199  327.501 187.546 1.00 31.76  ? 253  TYR C CD1 1 
ATOM   7885  C  CD2 . TYR C  3  253 ? 96.302  325.455 188.195 1.00 40.35  ? 253  TYR C CD2 1 
ATOM   7886  C  CE1 . TYR C  3  253 ? 96.345  327.915 186.789 1.00 37.76  ? 253  TYR C CE1 1 
ATOM   7887  C  CE2 . TYR C  3  253 ? 97.446  325.883 187.497 1.00 44.47  ? 253  TYR C CE2 1 
ATOM   7888  C  CZ  . TYR C  3  253 ? 97.473  327.104 186.804 1.00 40.51  ? 253  TYR C CZ  1 
ATOM   7889  O  OH  . TYR C  3  253 ? 98.648  327.414 186.107 1.00 37.33  ? 253  TYR C OH  1 
ATOM   7890  N  N   . VAL C  3  254 ? 93.461  323.068 187.628 1.00 32.92  ? 254  VAL C N   1 
ATOM   7891  C  CA  . VAL C  3  254 ? 93.891  321.893 186.937 1.00 34.24  ? 254  VAL C CA  1 
ATOM   7892  C  C   . VAL C  3  254 ? 92.861  321.532 185.790 1.00 34.43  ? 254  VAL C C   1 
ATOM   7893  O  O   . VAL C  3  254 ? 93.253  321.300 184.639 1.00 34.14  ? 254  VAL C O   1 
ATOM   7894  C  CB  . VAL C  3  254 ? 93.958  320.721 187.963 1.00 35.48  ? 254  VAL C CB  1 
ATOM   7895  C  CG1 . VAL C  3  254 ? 93.974  319.460 187.132 1.00 37.97  ? 254  VAL C CG1 1 
ATOM   7896  C  CG2 . VAL C  3  254 ? 95.342  320.881 188.738 1.00 36.78  ? 254  VAL C CG2 1 
ATOM   7897  N  N   . SER C  3  255 ? 91.558  321.527 186.117 1.00 30.72  ? 255  SER C N   1 
ATOM   7898  C  CA  . SER C  3  255 ? 90.503  321.222 185.159 1.00 31.59  ? 255  SER C CA  1 
ATOM   7899  C  C   . SER C  3  255 ? 90.176  322.221 184.136 1.00 31.32  ? 255  SER C C   1 
ATOM   7900  O  O   . SER C  3  255 ? 90.251  321.915 182.951 1.00 32.73  ? 255  SER C O   1 
ATOM   7901  C  CB  . SER C  3  255 ? 89.148  320.851 185.812 1.00 30.24  ? 255  SER C CB  1 
ATOM   7902  O  OG  . SER C  3  255 ? 89.472  319.787 186.650 1.00 33.79  ? 255  SER C OG  1 
ATOM   7903  N  N   . ILE C  3  256 ? 89.769  323.413 184.546 1.00 31.86  ? 256  ILE C N   1 
ATOM   7904  C  CA  . ILE C  3  256 ? 89.225  324.379 183.575 1.00 32.19  ? 256  ILE C CA  1 
ATOM   7905  C  C   . ILE C  3  256 ? 90.338  325.193 182.889 1.00 35.03  ? 256  ILE C C   1 
ATOM   7906  O  O   . ILE C  3  256 ? 90.376  325.340 181.659 1.00 35.11  ? 256  ILE C O   1 
ATOM   7907  C  CB  . ILE C  3  256 ? 88.166  325.242 184.246 1.00 33.95  ? 256  ILE C CB  1 
ATOM   7908  C  CG1 . ILE C  3  256 ? 87.027  324.285 184.697 1.00 33.26  ? 256  ILE C CG1 1 
ATOM   7909  C  CG2 . ILE C  3  256 ? 87.700  326.482 183.323 1.00 31.10  ? 256  ILE C CG2 1 
ATOM   7910  C  CD1 . ILE C  3  256 ? 85.795  325.028 185.269 1.00 35.62  ? 256  ILE C CD1 1 
ATOM   7911  N  N   . TYR C  3  257 ? 91.293  325.642 183.675 1.00 34.22  ? 257  TYR C N   1 
ATOM   7912  C  CA  . TYR C  3  257 ? 92.253  326.612 183.164 1.00 35.99  ? 257  TYR C CA  1 
ATOM   7913  C  C   . TYR C  3  257 ? 93.384  325.869 182.445 1.00 37.08  ? 257  TYR C C   1 
ATOM   7914  O  O   . TYR C  3  257 ? 93.860  326.300 181.427 1.00 39.44  ? 257  TYR C O   1 
ATOM   7915  C  CB  . TYR C  3  257 ? 92.841  327.422 184.334 1.00 30.91  ? 257  TYR C CB  1 
ATOM   7916  C  CG  . TYR C  3  257 ? 91.954  328.466 184.931 1.00 33.84  ? 257  TYR C CG  1 
ATOM   7917  C  CD1 . TYR C  3  257 ? 92.024  329.809 184.463 1.00 32.48  ? 257  TYR C CD1 1 
ATOM   7918  C  CD2 . TYR C  3  257 ? 91.045  328.141 185.943 1.00 34.83  ? 257  TYR C CD2 1 
ATOM   7919  C  CE1 . TYR C  3  257 ? 91.265  330.799 185.049 1.00 37.03  ? 257  TYR C CE1 1 
ATOM   7920  C  CE2 . TYR C  3  257 ? 90.273  329.119 186.548 1.00 36.81  ? 257  TYR C CE2 1 
ATOM   7921  C  CZ  . TYR C  3  257 ? 90.388  330.449 186.084 1.00 33.14  ? 257  TYR C CZ  1 
ATOM   7922  O  OH  . TYR C  3  257 ? 89.663  331.434 186.658 1.00 32.20  ? 257  TYR C OH  1 
ATOM   7923  N  N   . TRP C  3  258 ? 93.816  324.746 182.996 1.00 36.32  ? 258  TRP C N   1 
ATOM   7924  C  CA  . TRP C  3  258 ? 94.949  324.075 182.478 1.00 39.08  ? 258  TRP C CA  1 
ATOM   7925  C  C   . TRP C  3  258 ? 94.524  322.981 181.448 1.00 38.99  ? 258  TRP C C   1 
ATOM   7926  O  O   . TRP C  3  258 ? 94.718  323.111 180.222 1.00 36.48  ? 258  TRP C O   1 
ATOM   7927  C  CB  . TRP C  3  258 ? 95.746  323.506 183.654 1.00 41.76  ? 258  TRP C CB  1 
ATOM   7928  C  CG  . TRP C  3  258 ? 97.070  322.978 183.276 1.00 47.64  ? 258  TRP C CG  1 
ATOM   7929  C  CD1 . TRP C  3  258 ? 97.683  323.066 182.030 1.00 53.34  ? 258  TRP C CD1 1 
ATOM   7930  C  CD2 . TRP C  3  258 ? 97.993  322.256 184.119 1.00 53.47  ? 258  TRP C CD2 1 
ATOM   7931  N  NE1 . TRP C  3  258 ? 98.915  322.438 182.056 1.00 56.96  ? 258  TRP C NE1 1 
ATOM   7932  C  CE2 . TRP C  3  258 ? 99.131  321.909 183.305 1.00 57.87  ? 258  TRP C CE2 1 
ATOM   7933  C  CE3 . TRP C  3  258 ? 97.979  321.857 185.477 1.00 57.14  ? 258  TRP C CE3 1 
ATOM   7934  C  CZ2 . TRP C  3  258 ? 100.254 321.204 183.820 1.00 52.98  ? 258  TRP C CZ2 1 
ATOM   7935  C  CZ3 . TRP C  3  258 ? 99.103  321.149 185.996 1.00 52.90  ? 258  TRP C CZ3 1 
ATOM   7936  C  CH2 . TRP C  3  258 ? 100.217 320.832 185.158 1.00 53.01  ? 258  TRP C CH2 1 
ATOM   7937  N  N   . TRP C  3  259 ? 93.970  321.900 181.956 1.00 39.01  ? 259  TRP C N   1 
ATOM   7938  C  CA  . TRP C  3  259 ? 93.530  320.800 181.118 1.00 39.84  ? 259  TRP C CA  1 
ATOM   7939  C  C   . TRP C  3  259 ? 92.504  321.261 180.059 1.00 42.23  ? 259  TRP C C   1 
ATOM   7940  O  O   . TRP C  3  259 ? 92.587  320.764 178.934 1.00 42.10  ? 259  TRP C O   1 
ATOM   7941  C  CB  . TRP C  3  259 ? 92.965  319.615 181.941 1.00 40.54  ? 259  TRP C CB  1 
ATOM   7942  C  CG  . TRP C  3  259 ? 92.439  318.480 181.113 1.00 43.58  ? 259  TRP C CG  1 
ATOM   7943  C  CD1 . TRP C  3  259 ? 93.180  317.375 180.608 1.00 44.48  ? 259  TRP C CD1 1 
ATOM   7944  C  CD2 . TRP C  3  259 ? 91.078  318.312 180.608 1.00 45.91  ? 259  TRP C CD2 1 
ATOM   7945  N  NE1 . TRP C  3  259 ? 92.320  316.565 179.853 1.00 49.82  ? 259  TRP C NE1 1 
ATOM   7946  C  CE2 . TRP C  3  259 ? 91.047  317.091 179.856 1.00 45.06  ? 259  TRP C CE2 1 
ATOM   7947  C  CE3 . TRP C  3  259 ? 89.889  319.084 180.696 1.00 42.26  ? 259  TRP C CE3 1 
ATOM   7948  C  CZ2 . TRP C  3  259 ? 89.882  316.649 179.196 1.00 43.50  ? 259  TRP C CZ2 1 
ATOM   7949  C  CZ3 . TRP C  3  259 ? 88.733  318.638 180.032 1.00 41.21  ? 259  TRP C CZ3 1 
ATOM   7950  C  CH2 . TRP C  3  259 ? 88.733  317.429 179.327 1.00 42.99  ? 259  TRP C CH2 1 
ATOM   7951  N  N   . GLY C  3  260 ? 91.585  322.176 180.381 1.00 40.40  ? 260  GLY C N   1 
ATOM   7952  C  CA  . GLY C  3  260 ? 90.547  322.637 179.431 1.00 41.60  ? 260  GLY C CA  1 
ATOM   7953  C  C   . GLY C  3  260 ? 90.999  323.743 178.467 1.00 44.56  ? 260  GLY C C   1 
ATOM   7954  O  O   . GLY C  3  260 ? 90.198  324.339 177.754 1.00 46.72  ? 260  GLY C O   1 
ATOM   7955  N  N   . SER C  3  261 ? 92.300  324.012 178.420 1.00 45.19  ? 261  SER C N   1 
ATOM   7956  C  CA  . SER C  3  261 ? 92.843  325.081 177.636 1.00 46.22  ? 261  SER C CA  1 
ATOM   7957  C  C   . SER C  3  261 ? 93.391  324.508 176.330 1.00 46.48  ? 261  SER C C   1 
ATOM   7958  O  O   . SER C  3  261 ? 93.844  325.313 175.592 1.00 49.29  ? 261  SER C O   1 
ATOM   7959  C  CB  . SER C  3  261 ? 93.940  325.887 178.410 1.00 46.49  ? 261  SER C CB  1 
ATOM   7960  O  OG  . SER C  3  261 ? 95.169  325.144 178.541 1.00 48.59  ? 261  SER C OG  1 
ATOM   7961  O  OXT . SER C  3  261 ? 93.438  323.323 175.941 1.00 47.63  ? 261  SER C OXT 1 
ATOM   7962  N  N   . SER D  4  4   ? 41.561  298.938 241.295 1.00 65.19  ? 4    SER D N   1 
ATOM   7963  C  CA  . SER D  4  4   ? 40.542  299.753 240.526 1.00 66.02  ? 4    SER D CA  1 
ATOM   7964  C  C   . SER D  4  4   ? 41.154  301.025 239.891 1.00 64.11  ? 4    SER D C   1 
ATOM   7965  O  O   . SER D  4  4   ? 41.950  300.835 238.994 1.00 67.11  ? 4    SER D O   1 
ATOM   7966  C  CB  . SER D  4  4   ? 39.202  299.994 241.276 1.00 66.83  ? 4    SER D CB  1 
ATOM   7967  O  OG  . SER D  4  4   ? 38.844  298.874 242.083 1.00 70.92  ? 4    SER D OG  1 
ATOM   7968  N  N   . VAL D  4  5   ? 40.850  302.260 240.338 1.00 60.03  ? 5    VAL D N   1 
ATOM   7969  C  CA  . VAL D  4  5   ? 41.087  303.542 239.579 1.00 57.44  ? 5    VAL D CA  1 
ATOM   7970  C  C   . VAL D  4  5   ? 42.562  303.843 239.132 1.00 55.16  ? 5    VAL D C   1 
ATOM   7971  O  O   . VAL D  4  5   ? 43.426  304.040 239.965 1.00 54.67  ? 5    VAL D O   1 
ATOM   7972  C  CB  . VAL D  4  5   ? 40.429  304.797 240.303 1.00 57.91  ? 5    VAL D CB  1 
ATOM   7973  C  CG1 . VAL D  4  5   ? 40.772  306.164 239.572 1.00 55.98  ? 5    VAL D CG1 1 
ATOM   7974  C  CG2 . VAL D  4  5   ? 38.866  304.569 240.556 1.00 57.74  ? 5    VAL D CG2 1 
ATOM   7975  N  N   . VAL D  4  6   ? 42.829  303.884 237.825 1.00 50.45  ? 6    VAL D N   1 
ATOM   7976  C  CA  . VAL D  4  6   ? 44.181  304.199 237.337 1.00 48.20  ? 6    VAL D CA  1 
ATOM   7977  C  C   . VAL D  4  6   ? 44.401  305.665 236.981 1.00 46.68  ? 6    VAL D C   1 
ATOM   7978  O  O   . VAL D  4  6   ? 43.515  306.275 236.412 1.00 46.14  ? 6    VAL D O   1 
ATOM   7979  C  CB  . VAL D  4  6   ? 44.470  303.325 236.131 1.00 48.71  ? 6    VAL D CB  1 
ATOM   7980  C  CG1 . VAL D  4  6   ? 45.891  303.642 235.534 1.00 45.64  ? 6    VAL D CG1 1 
ATOM   7981  C  CG2 . VAL D  4  6   ? 44.294  301.842 236.549 1.00 47.56  ? 6    VAL D CG2 1 
ATOM   7982  N  N   . LYS D  4  7   ? 45.541  306.247 237.333 1.00 45.94  ? 7    LYS D N   1 
ATOM   7983  C  CA  . LYS D  4  7   ? 45.777  307.681 237.090 1.00 48.61  ? 7    LYS D CA  1 
ATOM   7984  C  C   . LYS D  4  7   ? 46.953  307.914 236.159 1.00 50.17  ? 7    LYS D C   1 
ATOM   7985  O  O   . LYS D  4  7   ? 47.898  307.139 236.139 1.00 50.46  ? 7    LYS D O   1 
ATOM   7986  C  CB  . LYS D  4  7   ? 45.918  308.479 238.417 1.00 50.14  ? 7    LYS D CB  1 
ATOM   7987  C  CG  . LYS D  4  7   ? 44.819  308.057 239.434 1.00 52.35  ? 7    LYS D CG  1 
ATOM   7988  C  CD  . LYS D  4  7   ? 44.516  309.129 240.484 1.00 64.19  ? 7    LYS D CD  1 
ATOM   7989  C  CE  . LYS D  4  7   ? 44.174  308.436 241.792 1.00 62.33  ? 7    LYS D CE  1 
ATOM   7990  N  NZ  . LYS D  4  7   ? 45.439  307.837 242.456 1.00 68.42  ? 7    LYS D NZ  1 
ATOM   7991  N  N   . SER D  4  8   ? 46.799  308.937 235.329 1.00 52.79  ? 8    SER D N   1 
ATOM   7992  C  CA  . SER D  4  8   ? 47.784  309.382 234.378 1.00 55.17  ? 8    SER D CA  1 
ATOM   7993  C  C   . SER D  4  8   ? 49.092  309.699 235.085 1.00 56.16  ? 8    SER D C   1 
ATOM   7994  O  O   . SER D  4  8   ? 50.145  309.474 234.543 1.00 56.56  ? 8    SER D O   1 
ATOM   7995  C  CB  . SER D  4  8   ? 47.360  310.721 233.765 1.00 55.28  ? 8    SER D CB  1 
ATOM   7996  O  OG  . SER D  4  8   ? 45.986  310.810 233.505 1.00 57.26  ? 8    SER D OG  1 
ATOM   7997  N  N   . GLU D  4  9   ? 49.026  310.342 236.244 1.00 57.91  ? 9    GLU D N   1 
ATOM   7998  C  CA  . GLU D  4  9   ? 50.260  310.785 236.901 1.00 58.96  ? 9    GLU D CA  1 
ATOM   7999  C  C   . GLU D  4  9   ? 51.043  309.562 237.528 1.00 57.33  ? 9    GLU D C   1 
ATOM   8000  O  O   . GLU D  4  9   ? 52.181  309.717 238.001 1.00 56.26  ? 9    GLU D O   1 
ATOM   8001  C  CB  . GLU D  4  9   ? 49.974  311.891 237.911 1.00 60.33  ? 9    GLU D CB  1 
ATOM   8002  C  CG  . GLU D  4  9   ? 48.945  311.552 238.996 1.00 65.50  ? 9    GLU D CG  1 
ATOM   8003  C  CD  . GLU D  4  9   ? 47.456  311.788 238.543 1.00 74.90  ? 9    GLU D CD  1 
ATOM   8004  O  OE1 . GLU D  4  9   ? 46.589  311.734 239.443 1.00 79.37  ? 9    GLU D OE1 1 
ATOM   8005  O  OE2 . GLU D  4  9   ? 47.134  312.012 237.326 1.00 77.58  ? 9    GLU D OE2 1 
ATOM   8006  N  N   . ASP D  4  10  ? 50.410  308.361 237.509 1.00 54.29  ? 10   ASP D N   1 
ATOM   8007  C  CA  . ASP D  4  10  ? 51.088  307.076 237.779 1.00 50.30  ? 10   ASP D CA  1 
ATOM   8008  C  C   . ASP D  4  10  ? 51.885  306.473 236.551 1.00 47.47  ? 10   ASP D C   1 
ATOM   8009  O  O   . ASP D  4  10  ? 52.406  305.369 236.648 1.00 45.71  ? 10   ASP D O   1 
ATOM   8010  C  CB  . ASP D  4  10  ? 50.063  306.071 238.270 1.00 49.90  ? 10   ASP D CB  1 
ATOM   8011  C  CG  . ASP D  4  10  ? 49.539  306.415 239.687 1.00 51.60  ? 10   ASP D CG  1 
ATOM   8012  O  OD1 . ASP D  4  10  ? 50.107  307.334 240.339 1.00 47.21  ? 10   ASP D OD1 1 
ATOM   8013  O  OD2 . ASP D  4  10  ? 48.605  305.733 240.115 1.00 47.67  ? 10   ASP D OD2 1 
ATOM   8014  N  N   . TYR D  4  11  ? 51.994  307.195 235.434 1.00 46.02  ? 11   TYR D N   1 
ATOM   8015  C  CA  . TYR D  4  11  ? 52.617  306.593 234.224 1.00 44.36  ? 11   TYR D CA  1 
ATOM   8016  C  C   . TYR D  4  11  ? 53.971  306.013 234.503 1.00 41.79  ? 11   TYR D C   1 
ATOM   8017  O  O   . TYR D  4  11  ? 54.327  304.979 233.921 1.00 38.87  ? 11   TYR D O   1 
ATOM   8018  C  CB  . TYR D  4  11  ? 52.724  307.592 232.960 1.00 49.42  ? 11   TYR D CB  1 
ATOM   8019  C  CG  . TYR D  4  11  ? 53.874  308.729 233.099 1.00 53.51  ? 11   TYR D CG  1 
ATOM   8020  C  CD1 . TYR D  4  11  ? 55.239  308.422 232.976 1.00 53.00  ? 11   TYR D CD1 1 
ATOM   8021  C  CD2 . TYR D  4  11  ? 53.553  310.056 233.336 1.00 54.62  ? 11   TYR D CD2 1 
ATOM   8022  C  CE1 . TYR D  4  11  ? 56.189  309.368 233.128 1.00 52.73  ? 11   TYR D CE1 1 
ATOM   8023  C  CE2 . TYR D  4  11  ? 54.508  311.001 233.434 1.00 53.08  ? 11   TYR D CE2 1 
ATOM   8024  C  CZ  . TYR D  4  11  ? 55.814  310.651 233.393 1.00 55.94  ? 11   TYR D CZ  1 
ATOM   8025  O  OH  . TYR D  4  11  ? 56.768  311.654 233.527 1.00 57.18  ? 11   TYR D OH  1 
ATOM   8026  N  N   . ALA D  4  12  ? 54.781  306.645 235.367 1.00 38.03  ? 12   ALA D N   1 
ATOM   8027  C  CA  . ALA D  4  12  ? 56.191  306.130 235.588 1.00 36.95  ? 12   ALA D CA  1 
ATOM   8028  C  C   . ALA D  4  12  ? 56.335  304.922 236.562 1.00 36.51  ? 12   ALA D C   1 
ATOM   8029  O  O   . ALA D  4  12  ? 57.457  304.441 236.758 1.00 35.42  ? 12   ALA D O   1 
ATOM   8030  C  CB  . ALA D  4  12  ? 57.144  307.245 236.079 1.00 36.48  ? 12   ALA D CB  1 
ATOM   8031  N  N   . LEU D  4  13  ? 55.196  304.430 237.084 1.00 35.95  ? 13   LEU D N   1 
ATOM   8032  C  CA  . LEU D  4  13  ? 55.158  303.338 238.060 1.00 35.01  ? 13   LEU D CA  1 
ATOM   8033  C  C   . LEU D  4  13  ? 54.720  302.042 237.339 1.00 35.88  ? 13   LEU D C   1 
ATOM   8034  O  O   . LEU D  4  13  ? 54.018  302.093 236.330 1.00 32.24  ? 13   LEU D O   1 
ATOM   8035  C  CB  . LEU D  4  13  ? 54.173  303.711 239.198 1.00 36.95  ? 13   LEU D CB  1 
ATOM   8036  C  CG  . LEU D  4  13  ? 54.564  304.848 240.186 1.00 40.59  ? 13   LEU D CG  1 
ATOM   8037  C  CD1 . LEU D  4  13  ? 53.322  305.187 240.967 1.00 43.25  ? 13   LEU D CD1 1 
ATOM   8038  C  CD2 . LEU D  4  13  ? 55.703  304.468 241.134 1.00 38.98  ? 13   LEU D CD2 1 
ATOM   8039  N  N   . PRO D  4  14  ? 55.183  300.862 237.815 1.00 36.01  ? 14   PRO D N   1 
ATOM   8040  C  CA  . PRO D  4  14  ? 54.675  299.611 237.224 1.00 34.71  ? 14   PRO D CA  1 
ATOM   8041  C  C   . PRO D  4  14  ? 53.136  299.610 237.263 1.00 36.03  ? 14   PRO D C   1 
ATOM   8042  O  O   . PRO D  4  14  ? 52.502  300.106 238.215 1.00 32.27  ? 14   PRO D O   1 
ATOM   8043  C  CB  . PRO D  4  14  ? 55.251  298.531 238.160 1.00 36.17  ? 14   PRO D CB  1 
ATOM   8044  C  CG  . PRO D  4  14  ? 56.527  299.138 238.673 1.00 36.97  ? 14   PRO D CG  1 
ATOM   8045  C  CD  . PRO D  4  14  ? 56.204  300.630 238.860 1.00 36.03  ? 14   PRO D CD  1 
ATOM   8046  N  N   . SER D  4  15  ? 52.526  299.055 236.215 1.00 34.99  ? 15   SER D N   1 
ATOM   8047  C  CA  . SER D  4  15  ? 51.122  299.105 236.122 1.00 36.15  ? 15   SER D CA  1 
ATOM   8048  C  C   . SER D  4  15  ? 50.596  297.686 235.886 1.00 35.90  ? 15   SER D C   1 
ATOM   8049  O  O   . SER D  4  15  ? 51.360  296.704 235.704 1.00 36.88  ? 15   SER D O   1 
ATOM   8050  C  CB  . SER D  4  15  ? 50.768  300.084 234.964 1.00 35.26  ? 15   SER D CB  1 
ATOM   8051  O  OG  . SER D  4  15  ? 51.266  299.551 233.760 1.00 37.83  ? 15   SER D OG  1 
ATOM   8052  N  N   . TYR D  4  16  ? 49.286  297.579 235.918 1.00 35.32  ? 16   TYR D N   1 
ATOM   8053  C  CA  . TYR D  4  16  ? 48.621  296.316 235.776 1.00 35.14  ? 16   TYR D CA  1 
ATOM   8054  C  C   . TYR D  4  16  ? 48.253  296.147 234.284 1.00 38.16  ? 16   TYR D C   1 
ATOM   8055  O  O   . TYR D  4  16  ? 47.821  297.142 233.672 1.00 37.32  ? 16   TYR D O   1 
ATOM   8056  C  CB  . TYR D  4  16  ? 47.353  296.322 236.629 1.00 34.23  ? 16   TYR D CB  1 
ATOM   8057  C  CG  . TYR D  4  16  ? 46.630  294.974 236.422 1.00 36.21  ? 16   TYR D CG  1 
ATOM   8058  C  CD1 . TYR D  4  16  ? 46.993  293.826 237.172 1.00 36.40  ? 16   TYR D CD1 1 
ATOM   8059  C  CD2 . TYR D  4  16  ? 45.695  294.803 235.375 1.00 37.62  ? 16   TYR D CD2 1 
ATOM   8060  C  CE1 . TYR D  4  16  ? 46.406  292.618 236.926 1.00 32.45  ? 16   TYR D CE1 1 
ATOM   8061  C  CE2 . TYR D  4  16  ? 45.171  293.542 235.106 1.00 33.66  ? 16   TYR D CE2 1 
ATOM   8062  C  CZ  . TYR D  4  16  ? 45.519  292.479 235.937 1.00 29.58  ? 16   TYR D CZ  1 
ATOM   8063  O  OH  . TYR D  4  16  ? 44.938  291.259 235.678 1.00 31.44  ? 16   TYR D OH  1 
ATOM   8064  N  N   . VAL D  4  17  ? 48.375  294.914 233.731 1.00 37.69  ? 17   VAL D N   1 
ATOM   8065  C  CA  . VAL D  4  17  ? 47.953  294.570 232.384 1.00 37.86  ? 17   VAL D CA  1 
ATOM   8066  C  C   . VAL D  4  17  ? 47.452  293.152 232.295 1.00 36.69  ? 17   VAL D C   1 
ATOM   8067  O  O   . VAL D  4  17  ? 47.927  292.257 233.020 1.00 37.09  ? 17   VAL D O   1 
ATOM   8068  C  CB  . VAL D  4  17  ? 49.063  294.646 231.269 1.00 41.07  ? 17   VAL D CB  1 
ATOM   8069  C  CG1 . VAL D  4  17  ? 49.533  295.999 231.098 1.00 47.18  ? 17   VAL D CG1 1 
ATOM   8070  C  CG2 . VAL D  4  17  ? 50.282  293.725 231.477 1.00 35.56  ? 17   VAL D CG2 1 
ATOM   8071  N  N   . ASP D  4  18  ? 46.458  292.966 231.439 1.00 33.69  ? 18   ASP D N   1 
ATOM   8072  C  CA  . ASP D  4  18  ? 45.979  291.662 231.035 1.00 35.45  ? 18   ASP D CA  1 
ATOM   8073  C  C   . ASP D  4  18  ? 46.502  291.319 229.662 1.00 36.53  ? 18   ASP D C   1 
ATOM   8074  O  O   . ASP D  4  18  ? 46.023  291.906 228.679 1.00 37.59  ? 18   ASP D O   1 
ATOM   8075  C  CB  . ASP D  4  18  ? 44.452  291.653 231.065 1.00 33.93  ? 18   ASP D CB  1 
ATOM   8076  C  CG  . ASP D  4  18  ? 43.908  291.515 232.536 1.00 37.99  ? 18   ASP D CG  1 
ATOM   8077  O  OD1 . ASP D  4  18  ? 42.782  291.969 232.844 1.00 35.40  ? 18   ASP D OD1 1 
ATOM   8078  O  OD2 . ASP D  4  18  ? 44.662  290.949 233.395 1.00 37.96  ? 18   ASP D OD2 1 
ATOM   8079  N  N   . ARG D  4  19  ? 47.458  290.395 229.590 1.00 38.73  ? 19   ARG D N   1 
ATOM   8080  C  CA  . ARG D  4  19  ? 48.032  289.944 228.304 1.00 40.00  ? 19   ARG D CA  1 
ATOM   8081  C  C   . ARG D  4  19  ? 48.416  288.509 228.386 1.00 38.24  ? 19   ARG D C   1 
ATOM   8082  O  O   . ARG D  4  19  ? 49.113  288.189 229.328 1.00 38.56  ? 19   ARG D O   1 
ATOM   8083  C  CB  . ARG D  4  19  ? 49.396  290.670 228.042 1.00 40.65  ? 19   ARG D CB  1 
ATOM   8084  C  CG  . ARG D  4  19  ? 49.167  292.126 227.657 1.00 52.54  ? 19   ARG D CG  1 
ATOM   8085  C  CD  . ARG D  4  19  ? 50.415  292.859 227.124 1.00 60.47  ? 19   ARG D CD  1 
ATOM   8086  N  NE  . ARG D  4  19  ? 51.692  292.177 227.287 1.00 65.51  ? 19   ARG D NE  1 
ATOM   8087  C  CZ  . ARG D  4  19  ? 52.448  291.765 226.276 1.00 71.66  ? 19   ARG D CZ  1 
ATOM   8088  N  NH1 . ARG D  4  19  ? 53.636  291.177 226.574 1.00 69.28  ? 19   ARG D NH1 1 
ATOM   8089  N  NH2 . ARG D  4  19  ? 52.031  291.978 224.959 1.00 77.05  ? 19   ARG D NH2 1 
ATOM   8090  N  N   . ARG D  4  20  ? 48.038  287.708 227.390 1.00 36.85  ? 20   ARG D N   1 
ATOM   8091  C  CA  . ARG D  4  20  ? 48.230  286.233 227.274 1.00 39.36  ? 20   ARG D CA  1 
ATOM   8092  C  C   . ARG D  4  20  ? 49.708  285.971 227.540 1.00 38.04  ? 20   ARG D C   1 
ATOM   8093  O  O   . ARG D  4  20  ? 50.055  284.953 228.168 1.00 40.21  ? 20   ARG D O   1 
ATOM   8094  C  CB  . ARG D  4  20  ? 48.104  285.712 225.771 1.00 38.69  ? 20   ARG D CB  1 
ATOM   8095  C  CG  . ARG D  4  20  ? 46.828  285.808 225.081 1.00 44.54  ? 20   ARG D CG  1 
ATOM   8096  C  CD  . ARG D  4  20  ? 47.020  285.791 223.576 1.00 43.49  ? 20   ARG D CD  1 
ATOM   8097  N  NE  . ARG D  4  20  ? 47.512  284.512 223.382 1.00 50.15  ? 20   ARG D NE  1 
ATOM   8098  C  CZ  . ARG D  4  20  ? 48.050  283.996 222.309 1.00 45.20  ? 20   ARG D CZ  1 
ATOM   8099  N  NH1 . ARG D  4  20  ? 48.318  284.635 221.158 1.00 39.71  ? 20   ARG D NH1 1 
ATOM   8100  N  NH2 . ARG D  4  20  ? 48.369  282.751 222.481 1.00 42.92  ? 20   ARG D NH2 1 
ATOM   8101  N  N   . ASP D  4  21  ? 50.572  286.832 226.983 1.00 36.96  ? 21   ASP D N   1 
ATOM   8102  C  CA  . ASP D  4  21  ? 52.021  286.621 226.924 1.00 38.59  ? 21   ASP D CA  1 
ATOM   8103  C  C   . ASP D  4  21  ? 52.748  287.219 228.125 1.00 37.52  ? 21   ASP D C   1 
ATOM   8104  O  O   . ASP D  4  21  ? 53.973  287.124 228.210 1.00 39.36  ? 21   ASP D O   1 
ATOM   8105  C  CB  . ASP D  4  21  ? 52.646  287.130 225.518 1.00 38.10  ? 21   ASP D CB  1 
ATOM   8106  C  CG  . ASP D  4  21  ? 52.347  288.602 225.203 1.00 42.07  ? 21   ASP D CG  1 
ATOM   8107  O  OD1 . ASP D  4  21  ? 51.472  289.128 225.877 1.00 49.33  ? 21   ASP D OD1 1 
ATOM   8108  O  OD2 . ASP D  4  21  ? 52.912  289.248 224.214 1.00 48.84  ? 21   ASP D OD2 1 
ATOM   8109  N  N   . TYR D  4  22  ? 52.016  287.822 229.085 1.00 38.27  ? 22   TYR D N   1 
ATOM   8110  C  CA  . TYR D  4  22  ? 52.649  288.448 230.304 1.00 35.95  ? 22   TYR D CA  1 
ATOM   8111  C  C   . TYR D  4  22  ? 51.682  288.080 231.476 1.00 36.23  ? 22   TYR D C   1 
ATOM   8112  O  O   . TYR D  4  22  ? 50.961  288.967 232.064 1.00 34.82  ? 22   TYR D O   1 
ATOM   8113  C  CB  . TYR D  4  22  ? 52.769  289.960 230.176 1.00 34.09  ? 22   TYR D CB  1 
ATOM   8114  C  CG  . TYR D  4  22  ? 53.807  290.581 231.074 1.00 35.46  ? 22   TYR D CG  1 
ATOM   8115  C  CD1 . TYR D  4  22  ? 55.168  290.383 230.835 1.00 40.01  ? 22   TYR D CD1 1 
ATOM   8116  C  CD2 . TYR D  4  22  ? 53.436  291.382 232.161 1.00 33.79  ? 22   TYR D CD2 1 
ATOM   8117  C  CE1 . TYR D  4  22  ? 56.137  290.937 231.670 1.00 34.68  ? 22   TYR D CE1 1 
ATOM   8118  C  CE2 . TYR D  4  22  ? 54.386  291.899 233.001 1.00 28.35  ? 22   TYR D CE2 1 
ATOM   8119  C  CZ  . TYR D  4  22  ? 55.709  291.739 232.706 1.00 30.91  ? 22   TYR D CZ  1 
ATOM   8120  O  OH  . TYR D  4  22  ? 56.653  292.284 233.517 1.00 33.43  ? 22   TYR D OH  1 
ATOM   8121  N  N   . PRO D  4  23  ? 51.524  286.757 231.695 1.00 35.03  ? 23   PRO D N   1 
ATOM   8122  C  CA  . PRO D  4  23  ? 50.455  286.255 232.635 1.00 34.32  ? 23   PRO D CA  1 
ATOM   8123  C  C   . PRO D  4  23  ? 50.522  286.860 234.058 1.00 32.23  ? 23   PRO D C   1 
ATOM   8124  O  O   . PRO D  4  23  ? 49.457  287.048 234.660 1.00 31.21  ? 23   PRO D O   1 
ATOM   8125  C  CB  . PRO D  4  23  ? 50.751  284.745 232.744 1.00 31.85  ? 23   PRO D CB  1 
ATOM   8126  C  CG  . PRO D  4  23  ? 52.251  284.636 232.228 1.00 33.56  ? 23   PRO D CG  1 
ATOM   8127  C  CD  . PRO D  4  23  ? 52.321  285.641 231.133 1.00 34.49  ? 23   PRO D CD  1 
ATOM   8128  N  N   . LEU D  4  24  ? 51.742  287.172 234.529 1.00 31.70  ? 24   LEU D N   1 
ATOM   8129  C  CA  . LEU D  4  24  ? 51.942  287.657 235.895 1.00 33.11  ? 24   LEU D CA  1 
ATOM   8130  C  C   . LEU D  4  24  ? 52.453  289.102 235.905 1.00 32.14  ? 24   LEU D C   1 
ATOM   8131  O  O   . LEU D  4  24  ? 53.649  289.349 235.894 1.00 31.60  ? 24   LEU D O   1 
ATOM   8132  C  CB  . LEU D  4  24  ? 52.807  286.714 236.801 1.00 31.91  ? 24   LEU D CB  1 
ATOM   8133  C  CG  . LEU D  4  24  ? 52.346  285.263 236.925 1.00 31.86  ? 24   LEU D CG  1 
ATOM   8134  C  CD1 . LEU D  4  24  ? 53.367  284.458 237.804 1.00 30.27  ? 24   LEU D CD1 1 
ATOM   8135  C  CD2 . LEU D  4  24  ? 50.944  285.174 237.531 1.00 27.45  ? 24   LEU D CD2 1 
ATOM   8136  N  N   . PRO D  4  25  ? 51.517  290.063 235.932 1.00 34.31  ? 25   PRO D N   1 
ATOM   8137  C  CA  . PRO D  4  25  ? 51.836  291.513 235.695 1.00 35.24  ? 25   PRO D CA  1 
ATOM   8138  C  C   . PRO D  4  25  ? 52.521  292.049 236.936 1.00 36.76  ? 25   PRO D C   1 
ATOM   8139  O  O   . PRO D  4  25  ? 52.584  291.385 237.999 1.00 37.32  ? 25   PRO D O   1 
ATOM   8140  C  CB  . PRO D  4  25  ? 50.432  292.174 235.579 1.00 35.01  ? 25   PRO D CB  1 
ATOM   8141  C  CG  . PRO D  4  25  ? 49.423  291.082 235.613 1.00 33.86  ? 25   PRO D CG  1 
ATOM   8142  C  CD  . PRO D  4  25  ? 50.064  289.819 236.084 1.00 32.42  ? 25   PRO D CD  1 
ATOM   8143  N  N   . ASP D  4  26  ? 52.977  293.275 236.869 1.00 36.88  ? 26   ASP D N   1 
ATOM   8144  C  CA  . ASP D  4  26  ? 53.921  293.714 237.840 1.00 35.23  ? 26   ASP D CA  1 
ATOM   8145  C  C   . ASP D  4  26  ? 53.270  294.100 239.204 1.00 37.27  ? 26   ASP D C   1 
ATOM   8146  O  O   . ASP D  4  26  ? 53.978  294.220 240.131 1.00 35.39  ? 26   ASP D O   1 
ATOM   8147  C  CB  . ASP D  4  26  ? 54.588  294.928 237.311 1.00 36.90  ? 26   ASP D CB  1 
ATOM   8148  C  CG  . ASP D  4  26  ? 55.447  294.679 236.048 1.00 41.51  ? 26   ASP D CG  1 
ATOM   8149  O  OD1 . ASP D  4  26  ? 55.772  293.514 235.678 1.00 41.26  ? 26   ASP D OD1 1 
ATOM   8150  O  OD2 . ASP D  4  26  ? 55.783  295.710 235.424 1.00 41.79  ? 26   ASP D OD2 1 
ATOM   8151  N  N   . VAL D  4  27  ? 51.962  294.370 239.279 1.00 36.06  ? 27   VAL D N   1 
ATOM   8152  C  CA  . VAL D  4  27  ? 51.315  294.719 240.522 1.00 36.79  ? 27   VAL D CA  1 
ATOM   8153  C  C   . VAL D  4  27  ? 49.966  293.973 240.480 1.00 37.73  ? 27   VAL D C   1 
ATOM   8154  O  O   . VAL D  4  27  ? 49.499  293.494 239.362 1.00 36.05  ? 27   VAL D O   1 
ATOM   8155  C  CB  . VAL D  4  27  ? 50.947  296.237 240.587 1.00 36.90  ? 27   VAL D CB  1 
ATOM   8156  C  CG1 . VAL D  4  27  ? 52.154  297.093 240.627 1.00 39.68  ? 27   VAL D CG1 1 
ATOM   8157  C  CG2 . VAL D  4  27  ? 50.048  296.610 239.427 1.00 35.99  ? 27   VAL D CG2 1 
ATOM   8158  N  N   . ALA D  4  28  ? 49.323  293.865 241.671 1.00 34.93  ? 28   ALA D N   1 
ATOM   8159  C  CA  . ALA D  4  28  ? 48.010  293.234 241.807 1.00 33.81  ? 28   ALA D CA  1 
ATOM   8160  C  C   . ALA D  4  28  ? 47.030  294.172 241.232 1.00 33.85  ? 28   ALA D C   1 
ATOM   8161  O  O   . ALA D  4  28  ? 47.226  295.405 241.336 1.00 33.24  ? 28   ALA D O   1 
ATOM   8162  C  CB  . ALA D  4  28  ? 47.667  293.038 243.372 1.00 36.30  ? 28   ALA D CB  1 
ATOM   8163  N  N   . HIS D  4  29  ? 45.970  293.665 240.626 1.00 32.67  ? 29   HIS D N   1 
ATOM   8164  C  CA  . HIS D  4  29  ? 44.875  294.551 240.202 1.00 35.37  ? 29   HIS D CA  1 
ATOM   8165  C  C   . HIS D  4  29  ? 44.269  295.445 241.355 1.00 36.40  ? 29   HIS D C   1 
ATOM   8166  O  O   . HIS D  4  29  ? 43.934  296.653 241.140 1.00 35.08  ? 29   HIS D O   1 
ATOM   8167  C  CB  . HIS D  4  29  ? 43.845  293.660 239.662 1.00 33.39  ? 29   HIS D CB  1 
ATOM   8168  C  CG  . HIS D  4  29  ? 42.523  294.265 239.418 1.00 36.53  ? 29   HIS D CG  1 
ATOM   8169  N  ND1 . HIS D  4  29  ? 42.338  295.430 238.678 1.00 39.12  ? 29   HIS D ND1 1 
ATOM   8170  C  CD2 . HIS D  4  29  ? 41.293  293.758 239.645 1.00 33.59  ? 29   HIS D CD2 1 
ATOM   8171  C  CE1 . HIS D  4  29  ? 41.041  295.645 238.525 1.00 38.94  ? 29   HIS D CE1 1 
ATOM   8172  N  NE2 . HIS D  4  29  ? 40.383  294.663 239.132 1.00 38.40  ? 29   HIS D NE2 1 
ATOM   8173  N  N   . VAL D  4  30  ? 44.018  294.830 242.503 1.00 36.36  ? 30   VAL D N   1 
ATOM   8174  C  CA  . VAL D  4  30  ? 43.533  295.560 243.677 1.00 36.64  ? 30   VAL D CA  1 
ATOM   8175  C  C   . VAL D  4  30  ? 44.516  295.602 244.774 1.00 37.62  ? 30   VAL D C   1 
ATOM   8176  O  O   . VAL D  4  30  ? 44.924  294.562 245.262 1.00 37.72  ? 30   VAL D O   1 
ATOM   8177  C  CB  . VAL D  4  30  ? 42.232  294.970 244.195 1.00 38.44  ? 30   VAL D CB  1 
ATOM   8178  C  CG1 . VAL D  4  30  ? 41.706  295.848 245.396 1.00 35.88  ? 30   VAL D CG1 1 
ATOM   8179  C  CG2 . VAL D  4  30  ? 41.232  294.975 243.050 1.00 36.65  ? 30   VAL D CG2 1 
ATOM   8180  N  N   . LYS D  4  31  ? 44.923  296.801 245.180 1.00 37.09  ? 31   LYS D N   1 
ATOM   8181  C  CA  . LYS D  4  31  ? 45.962  296.856 246.158 1.00 40.67  ? 31   LYS D CA  1 
ATOM   8182  C  C   . LYS D  4  31  ? 45.412  297.252 247.544 1.00 39.74  ? 31   LYS D C   1 
ATOM   8183  O  O   . LYS D  4  31  ? 46.022  296.900 248.515 1.00 39.24  ? 31   LYS D O   1 
ATOM   8184  C  CB  . LYS D  4  31  ? 47.088  297.816 245.706 1.00 44.46  ? 31   LYS D CB  1 
ATOM   8185  C  CG  . LYS D  4  31  ? 47.123  299.212 246.378 1.00 53.84  ? 31   LYS D CG  1 
ATOM   8186  C  CD  . LYS D  4  31  ? 48.624  299.691 246.654 1.00 67.26  ? 31   LYS D CD  1 
ATOM   8187  C  CE  . LYS D  4  31  ? 48.701  301.134 247.184 1.00 64.85  ? 31   LYS D CE  1 
ATOM   8188  N  NZ  . LYS D  4  31  ? 48.186  301.861 245.963 1.00 70.97  ? 31   LYS D NZ  1 
ATOM   8189  N  N   . ASN D  4  32  ? 44.283  297.992 247.628 1.00 37.03  ? 32   ASN D N   1 
ATOM   8190  C  CA  . ASN D  4  32  ? 43.742  298.384 248.941 1.00 37.14  ? 32   ASN D CA  1 
ATOM   8191  C  C   . ASN D  4  32  ? 42.760  297.337 249.336 1.00 36.85  ? 32   ASN D C   1 
ATOM   8192  O  O   . ASN D  4  32  ? 41.861  297.026 248.533 1.00 36.75  ? 32   ASN D O   1 
ATOM   8193  C  CB  . ASN D  4  32  ? 43.036  299.768 248.853 1.00 36.35  ? 32   ASN D CB  1 
ATOM   8194  C  CG  . ASN D  4  32  ? 44.003  300.912 248.588 1.00 37.01  ? 32   ASN D CG  1 
ATOM   8195  O  OD1 . ASN D  4  32  ? 43.873  301.624 247.579 1.00 41.02  ? 32   ASN D OD1 1 
ATOM   8196  N  ND2 . ASN D  4  32  ? 44.999  301.030 249.372 1.00 35.36  ? 32   ASN D ND2 1 
ATOM   8197  N  N   . LEU D  4  33  ? 42.791  296.953 250.611 1.00 36.93  ? 33   LEU D N   1 
ATOM   8198  C  CA  . LEU D  4  33  ? 41.935  295.886 251.074 1.00 37.55  ? 33   LEU D CA  1 
ATOM   8199  C  C   . LEU D  4  33  ? 41.011  296.336 252.157 1.00 37.41  ? 33   LEU D C   1 
ATOM   8200  O  O   . LEU D  4  33  ? 41.457  296.958 253.136 1.00 37.72  ? 33   LEU D O   1 
ATOM   8201  C  CB  . LEU D  4  33  ? 42.792  294.688 251.582 1.00 36.85  ? 33   LEU D CB  1 
ATOM   8202  C  CG  . LEU D  4  33  ? 43.584  294.071 250.395 1.00 40.49  ? 33   LEU D CG  1 
ATOM   8203  C  CD1 . LEU D  4  33  ? 44.448  292.973 250.842 1.00 44.78  ? 33   LEU D CD1 1 
ATOM   8204  C  CD2 . LEU D  4  33  ? 42.759  293.749 249.129 1.00 40.37  ? 33   LEU D CD2 1 
ATOM   8205  N  N   . SER D  4  34  ? 39.769  295.918 252.072 1.00 35.93  ? 34   SER D N   1 
ATOM   8206  C  CA  . SER D  4  34  ? 38.818  296.128 253.159 1.00 36.01  ? 34   SER D CA  1 
ATOM   8207  C  C   . SER D  4  34  ? 39.101  295.195 254.351 1.00 36.50  ? 34   SER D C   1 
ATOM   8208  O  O   . SER D  4  34  ? 39.987  294.313 254.276 1.00 34.62  ? 34   SER D O   1 
ATOM   8209  C  CB  . SER D  4  34  ? 37.362  295.913 252.624 1.00 35.31  ? 34   SER D CB  1 
ATOM   8210  O  OG  . SER D  4  34  ? 37.167  294.564 252.323 1.00 37.62  ? 34   SER D OG  1 
ATOM   8211  N  N   . ALA D  4  35  ? 38.394  295.394 255.477 1.00 35.67  ? 35   ALA D N   1 
ATOM   8212  C  CA  . ALA D  4  35  ? 38.544  294.450 256.600 1.00 37.14  ? 35   ALA D CA  1 
ATOM   8213  C  C   . ALA D  4  35  ? 38.325  292.961 256.152 1.00 38.13  ? 35   ALA D C   1 
ATOM   8214  O  O   . ALA D  4  35  ? 39.124  292.094 256.531 1.00 38.11  ? 35   ALA D O   1 
ATOM   8215  C  CB  . ALA D  4  35  ? 37.615  294.822 257.835 1.00 36.06  ? 35   ALA D CB  1 
ATOM   8216  N  N   . SER D  4  36  ? 37.261  292.657 255.409 1.00 37.28  ? 36   SER D N   1 
ATOM   8217  C  CA  . SER D  4  36  ? 37.098  291.270 255.009 1.00 39.13  ? 36   SER D CA  1 
ATOM   8218  C  C   . SER D  4  36  ? 38.118  290.845 254.000 1.00 37.79  ? 36   SER D C   1 
ATOM   8219  O  O   . SER D  4  36  ? 38.518  289.710 254.099 1.00 38.56  ? 36   SER D O   1 
ATOM   8220  C  CB  . SER D  4  36  ? 35.678  290.879 254.501 1.00 38.59  ? 36   SER D CB  1 
ATOM   8221  O  OG  . SER D  4  36  ? 35.206  291.883 253.719 1.00 42.86  ? 36   SER D OG  1 
ATOM   8222  N  N   . GLN D  4  37  ? 38.551  291.718 253.074 1.00 36.05  ? 37   GLN D N   1 
ATOM   8223  C  CA  . GLN D  4  37  ? 39.538  291.324 252.115 1.00 34.56  ? 37   GLN D CA  1 
ATOM   8224  C  C   . GLN D  4  37  ? 40.815  291.069 252.845 1.00 36.74  ? 37   GLN D C   1 
ATOM   8225  O  O   . GLN D  4  37  ? 41.515  290.114 252.511 1.00 39.35  ? 37   GLN D O   1 
ATOM   8226  C  CB  . GLN D  4  37  ? 39.713  292.386 250.961 1.00 36.69  ? 37   GLN D CB  1 
ATOM   8227  C  CG  . GLN D  4  37  ? 38.405  292.451 250.144 1.00 33.45  ? 37   GLN D CG  1 
ATOM   8228  C  CD  . GLN D  4  37  ? 38.367  293.579 249.215 1.00 38.06  ? 37   GLN D CD  1 
ATOM   8229  O  OE1 . GLN D  4  37  ? 37.918  293.449 248.073 1.00 35.85  ? 37   GLN D OE1 1 
ATOM   8230  N  NE2 . GLN D  4  37  ? 38.922  294.678 249.633 1.00 35.66  ? 37   GLN D NE2 1 
ATOM   8231  N  N   . LYS D  4  38  ? 41.160  291.877 253.855 1.00 37.39  ? 38   LYS D N   1 
ATOM   8232  C  CA  . LYS D  4  38  ? 42.379  291.581 254.666 1.00 37.97  ? 38   LYS D CA  1 
ATOM   8233  C  C   . LYS D  4  38  ? 42.245  290.226 255.407 1.00 36.45  ? 38   LYS D C   1 
ATOM   8234  O  O   . LYS D  4  38  ? 43.244  289.525 255.548 1.00 34.11  ? 38   LYS D O   1 
ATOM   8235  C  CB  . LYS D  4  38  ? 42.757  292.657 255.690 1.00 38.68  ? 38   LYS D CB  1 
ATOM   8236  C  CG  . LYS D  4  38  ? 42.948  294.111 255.117 1.00 44.51  ? 38   LYS D CG  1 
ATOM   8237  C  CD  . LYS D  4  38  ? 42.653  295.187 256.292 1.00 53.92  ? 38   LYS D CD  1 
ATOM   8238  C  CE  . LYS D  4  38  ? 43.041  296.606 255.902 1.00 56.78  ? 38   LYS D CE  1 
ATOM   8239  N  NZ  . LYS D  4  38  ? 44.512  296.670 255.629 1.00 59.20  ? 38   LYS D NZ  1 
ATOM   8240  N  N   . ALA D  4  39  ? 41.049  289.889 255.920 1.00 35.88  ? 39   ALA D N   1 
ATOM   8241  C  CA  . ALA D  4  39  ? 40.902  288.562 256.614 1.00 35.60  ? 39   ALA D CA  1 
ATOM   8242  C  C   . ALA D  4  39  ? 41.096  287.420 255.537 1.00 36.79  ? 39   ALA D C   1 
ATOM   8243  O  O   . ALA D  4  39  ? 41.663  286.358 255.813 1.00 36.26  ? 39   ALA D O   1 
ATOM   8244  C  CB  . ALA D  4  39  ? 39.540  288.435 257.284 1.00 37.55  ? 39   ALA D CB  1 
ATOM   8245  N  N   . LEU D  4  40  ? 40.688  287.703 254.290 1.00 36.73  ? 40   LEU D N   1 
ATOM   8246  C  CA  . LEU D  4  40  ? 40.820  286.672 253.206 1.00 38.19  ? 40   LEU D CA  1 
ATOM   8247  C  C   . LEU D  4  40  ? 42.321  286.430 252.943 1.00 39.34  ? 40   LEU D C   1 
ATOM   8248  O  O   . LEU D  4  40  ? 42.807  285.233 252.852 1.00 39.27  ? 40   LEU D O   1 
ATOM   8249  C  CB  . LEU D  4  40  ? 40.099  287.155 251.950 1.00 38.28  ? 40   LEU D CB  1 
ATOM   8250  C  CG  . LEU D  4  40  ? 40.102  286.238 250.690 1.00 40.72  ? 40   LEU D CG  1 
ATOM   8251  C  CD1 . LEU D  4  40  ? 39.654  284.711 250.919 1.00 37.83  ? 40   LEU D CD1 1 
ATOM   8252  C  CD2 . LEU D  4  40  ? 39.224  286.948 249.692 1.00 36.10  ? 40   LEU D CD2 1 
ATOM   8253  N  N   . LYS D  4  41  ? 43.083  287.528 252.834 1.00 37.97  ? 41   LYS D N   1 
ATOM   8254  C  CA  . LYS D  4  41  ? 44.504  287.397 252.569 1.00 39.60  ? 41   LYS D CA  1 
ATOM   8255  C  C   . LYS D  4  41  ? 45.175  286.643 253.697 1.00 41.40  ? 41   LYS D C   1 
ATOM   8256  O  O   . LYS D  4  41  ? 46.072  285.850 253.412 1.00 43.40  ? 41   LYS D O   1 
ATOM   8257  C  CB  . LYS D  4  41  ? 45.212  288.747 252.288 1.00 38.44  ? 41   LYS D CB  1 
ATOM   8258  C  CG  . LYS D  4  41  ? 44.748  289.417 250.988 1.00 39.80  ? 41   LYS D CG  1 
ATOM   8259  C  CD  . LYS D  4  41  ? 44.972  288.504 249.772 1.00 37.41  ? 41   LYS D CD  1 
ATOM   8260  C  CE  . LYS D  4  41  ? 46.401  288.674 249.220 1.00 38.01  ? 41   LYS D CE  1 
ATOM   8261  N  NZ  . LYS D  4  41  ? 46.576  287.677 248.055 1.00 30.34  ? 41   LYS D NZ  1 
ATOM   8262  N  N   . GLU D  4  42  ? 44.753  286.886 254.969 1.00 41.34  ? 42   GLU D N   1 
ATOM   8263  C  CA  . GLU D  4  42  ? 45.214  286.037 256.139 1.00 40.75  ? 42   GLU D CA  1 
ATOM   8264  C  C   . GLU D  4  42  ? 44.866  284.547 255.990 1.00 37.81  ? 42   GLU D C   1 
ATOM   8265  O  O   . GLU D  4  42  ? 45.713  283.726 256.067 1.00 36.41  ? 42   GLU D O   1 
ATOM   8266  C  CB  . GLU D  4  42  ? 44.701  286.570 257.479 1.00 41.53  ? 42   GLU D CB  1 
ATOM   8267  C  CG  . GLU D  4  42  ? 45.437  287.804 257.895 1.00 47.15  ? 42   GLU D CG  1 
ATOM   8268  C  CD  . GLU D  4  42  ? 46.930  287.537 258.011 1.00 54.45  ? 42   GLU D CD  1 
ATOM   8269  O  OE1 . GLU D  4  42  ? 47.710  288.323 257.506 1.00 59.81  ? 42   GLU D OE1 1 
ATOM   8270  O  OE2 . GLU D  4  42  ? 47.345  286.516 258.595 1.00 64.08  ? 42   GLU D OE2 1 
ATOM   8271  N  N   . LYS D  4  43  ? 43.628  284.271 255.691 1.00 37.26  ? 43   LYS D N   1 
ATOM   8272  C  CA  . LYS D  4  43  ? 43.133  282.937 255.458 1.00 39.60  ? 43   LYS D CA  1 
ATOM   8273  C  C   . LYS D  4  43  ? 43.974  282.223 254.403 1.00 40.79  ? 43   LYS D C   1 
ATOM   8274  O  O   . LYS D  4  43  ? 44.252  280.997 254.483 1.00 40.72  ? 43   LYS D O   1 
ATOM   8275  C  CB  . LYS D  4  43  ? 41.660  283.029 255.036 1.00 38.95  ? 43   LYS D CB  1 
ATOM   8276  C  CG  . LYS D  4  43  ? 40.987  281.666 255.183 1.00 40.85  ? 43   LYS D CG  1 
ATOM   8277  C  CD  . LYS D  4  43  ? 39.464  281.636 254.986 1.00 39.28  ? 43   LYS D CD  1 
ATOM   8278  C  CE  . LYS D  4  43  ? 38.914  280.184 255.209 1.00 39.48  ? 43   LYS D CE  1 
ATOM   8279  N  NZ  . LYS D  4  43  ? 37.396  280.002 254.843 1.00 31.77  ? 43   LYS D NZ  1 
ATOM   8280  N  N   . GLU D  4  44  ? 44.454  283.011 253.422 1.00 41.28  ? 44   GLU D N   1 
ATOM   8281  C  CA  . GLU D  4  44  ? 45.164  282.449 252.296 1.00 39.90  ? 44   GLU D CA  1 
ATOM   8282  C  C   . GLU D  4  44  ? 46.566  281.940 252.738 1.00 40.73  ? 44   GLU D C   1 
ATOM   8283  O  O   . GLU D  4  44  ? 47.151  281.085 252.059 1.00 39.30  ? 44   GLU D O   1 
ATOM   8284  C  CB  . GLU D  4  44  ? 45.274  283.524 251.179 1.00 40.96  ? 44   GLU D CB  1 
ATOM   8285  C  CG  . GLU D  4  44  ? 46.035  283.072 249.906 1.00 37.26  ? 44   GLU D CG  1 
ATOM   8286  C  CD  . GLU D  4  44  ? 46.292  284.254 248.927 1.00 41.34  ? 44   GLU D CD  1 
ATOM   8287  O  OE1 . GLU D  4  44  ? 46.407  285.454 249.317 1.00 32.88  ? 44   GLU D OE1 1 
ATOM   8288  O  OE2 . GLU D  4  44  ? 46.350  283.954 247.751 1.00 35.08  ? 44   GLU D OE2 1 
ATOM   8289  N  N   . LYS D  4  45  ? 47.104  282.470 253.858 1.00 40.34  ? 45   LYS D N   1 
ATOM   8290  C  CA  . LYS D  4  45  ? 48.320  281.920 254.443 1.00 42.11  ? 45   LYS D CA  1 
ATOM   8291  C  C   . LYS D  4  45  ? 48.179  280.451 254.999 1.00 41.81  ? 45   LYS D C   1 
ATOM   8292  O  O   . LYS D  4  45  ? 49.166  279.754 255.194 1.00 42.91  ? 45   LYS D O   1 
ATOM   8293  C  CB  . LYS D  4  45  ? 48.903  282.859 255.500 1.00 43.50  ? 45   LYS D CB  1 
ATOM   8294  C  CG  . LYS D  4  45  ? 49.205  284.284 254.990 1.00 43.54  ? 45   LYS D CG  1 
ATOM   8295  C  CD  . LYS D  4  45  ? 50.324  284.836 255.857 1.00 52.51  ? 45   LYS D CD  1 
ATOM   8296  C  CE  . LYS D  4  45  ? 50.111  286.221 256.472 1.00 54.29  ? 45   LYS D CE  1 
ATOM   8297  N  NZ  . LYS D  4  45  ? 49.596  287.155 255.491 1.00 52.22  ? 45   LYS D NZ  1 
ATOM   8298  N  N   . ALA D  4  46  ? 46.945  279.985 255.137 1.00 42.64  ? 46   ALA D N   1 
ATOM   8299  C  CA  . ALA D  4  46  ? 46.609  278.639 255.627 1.00 43.45  ? 46   ALA D CA  1 
ATOM   8300  C  C   . ALA D  4  46  ? 46.298  277.727 254.440 1.00 42.97  ? 46   ALA D C   1 
ATOM   8301  O  O   . ALA D  4  46  ? 46.233  278.220 253.340 1.00 41.87  ? 46   ALA D O   1 
ATOM   8302  C  CB  . ALA D  4  46  ? 45.376  278.721 256.585 1.00 42.00  ? 46   ALA D CB  1 
ATOM   8303  N  N   . SER D  4  47  ? 46.071  276.429 254.648 1.00 41.21  ? 47   SER D N   1 
ATOM   8304  C  CA  . SER D  4  47  ? 45.733  275.537 253.521 1.00 40.73  ? 47   SER D CA  1 
ATOM   8305  C  C   . SER D  4  47  ? 44.674  276.074 252.551 1.00 41.03  ? 47   SER D C   1 
ATOM   8306  O  O   . SER D  4  47  ? 43.547  276.392 252.965 1.00 40.26  ? 47   SER D O   1 
ATOM   8307  C  CB  . SER D  4  47  ? 45.260  274.163 254.019 1.00 42.01  ? 47   SER D CB  1 
ATOM   8308  O  OG  . SER D  4  47  ? 44.709  273.369 252.969 1.00 37.56  ? 47   SER D OG  1 
ATOM   8309  N  N   . TRP D  4  48  ? 44.962  276.028 251.233 1.00 39.89  ? 48   TRP D N   1 
ATOM   8310  C  CA  . TRP D  4  48  ? 43.926  276.457 250.254 1.00 38.58  ? 48   TRP D CA  1 
ATOM   8311  C  C   . TRP D  4  48  ? 42.717  275.553 250.176 1.00 38.91  ? 48   TRP D C   1 
ATOM   8312  O  O   . TRP D  4  48  ? 41.640  275.980 249.714 1.00 36.99  ? 48   TRP D O   1 
ATOM   8313  C  CB  . TRP D  4  48  ? 44.526  276.731 248.853 1.00 38.42  ? 48   TRP D CB  1 
ATOM   8314  C  CG  . TRP D  4  48  ? 45.655  277.775 248.901 1.00 37.35  ? 48   TRP D CG  1 
ATOM   8315  C  CD1 . TRP D  4  48  ? 45.757  278.880 249.777 1.00 39.55  ? 48   TRP D CD1 1 
ATOM   8316  C  CD2 . TRP D  4  48  ? 46.824  277.833 248.056 1.00 39.99  ? 48   TRP D CD2 1 
ATOM   8317  N  NE1 . TRP D  4  48  ? 46.931  279.585 249.504 1.00 38.36  ? 48   TRP D NE1 1 
ATOM   8318  C  CE2 . TRP D  4  48  ? 47.557  279.010 248.419 1.00 36.70  ? 48   TRP D CE2 1 
ATOM   8319  C  CE3 . TRP D  4  48  ? 47.297  277.043 246.981 1.00 36.11  ? 48   TRP D CE3 1 
ATOM   8320  C  CZ2 . TRP D  4  48  ? 48.773  279.375 247.765 1.00 38.13  ? 48   TRP D CZ2 1 
ATOM   8321  C  CZ3 . TRP D  4  48  ? 48.500  277.439 246.313 1.00 36.50  ? 48   TRP D CZ3 1 
ATOM   8322  C  CH2 . TRP D  4  48  ? 49.219  278.568 246.720 1.00 36.98  ? 48   TRP D CH2 1 
ATOM   8323  N  N   . SER D  4  49  ? 42.859  274.313 250.670 1.00 39.98  ? 49   SER D N   1 
ATOM   8324  C  CA  . SER D  4  49  ? 41.705  273.370 250.754 1.00 41.98  ? 49   SER D CA  1 
ATOM   8325  C  C   . SER D  4  49  ? 40.601  273.915 251.652 1.00 42.36  ? 49   SER D C   1 
ATOM   8326  O  O   . SER D  4  49  ? 39.437  273.646 251.439 1.00 43.85  ? 49   SER D O   1 
ATOM   8327  C  CB  . SER D  4  49  ? 42.196  271.988 251.304 1.00 42.84  ? 49   SER D CB  1 
ATOM   8328  O  OG  . SER D  4  49  ? 43.049  271.347 250.346 1.00 44.14  ? 49   SER D OG  1 
ATOM   8329  N  N   . SER D  4  50  ? 40.958  274.731 252.639 1.00 42.88  ? 50   SER D N   1 
ATOM   8330  C  CA  . SER D  4  50  ? 39.924  275.337 253.530 1.00 43.73  ? 50   SER D CA  1 
ATOM   8331  C  C   . SER D  4  50  ? 39.268  276.596 252.951 1.00 43.98  ? 50   SER D C   1 
ATOM   8332  O  O   . SER D  4  50  ? 38.298  277.112 253.482 1.00 42.93  ? 50   SER D O   1 
ATOM   8333  C  CB  . SER D  4  50  ? 40.553  275.739 254.872 1.00 43.89  ? 50   SER D CB  1 
ATOM   8334  O  OG  . SER D  4  50  ? 41.158  274.628 255.479 1.00 45.11  ? 50   SER D OG  1 
ATOM   8335  N  N   . LEU D  4  51  ? 39.817  277.136 251.866 1.00 43.48  ? 51   LEU D N   1 
ATOM   8336  C  CA  . LEU D  4  51  ? 39.117  278.216 251.176 1.00 42.54  ? 51   LEU D CA  1 
ATOM   8337  C  C   . LEU D  4  51  ? 37.890  277.690 250.455 1.00 42.10  ? 51   LEU D C   1 
ATOM   8338  O  O   . LEU D  4  51  ? 37.947  276.647 249.783 1.00 43.59  ? 51   LEU D O   1 
ATOM   8339  C  CB  . LEU D  4  51  ? 40.085  278.853 250.148 1.00 40.65  ? 51   LEU D CB  1 
ATOM   8340  C  CG  . LEU D  4  51  ? 41.050  280.001 250.393 1.00 42.17  ? 51   LEU D CG  1 
ATOM   8341  C  CD1 . LEU D  4  51  ? 41.112  280.530 251.698 1.00 34.42  ? 51   LEU D CD1 1 
ATOM   8342  C  CD2 . LEU D  4  51  ? 42.495  279.884 249.700 1.00 40.65  ? 51   LEU D CD2 1 
ATOM   8343  N  N   . SER D  4  52  ? 36.802  278.444 250.503 1.00 41.35  ? 52   SER D N   1 
ATOM   8344  C  CA  . SER D  4  52  ? 35.657  278.133 249.662 1.00 42.76  ? 52   SER D CA  1 
ATOM   8345  C  C   . SER D  4  52  ? 35.941  278.520 248.166 1.00 43.24  ? 52   SER D C   1 
ATOM   8346  O  O   . SER D  4  52  ? 36.923  279.257 247.879 1.00 39.49  ? 52   SER D O   1 
ATOM   8347  C  CB  . SER D  4  52  ? 34.453  278.946 250.126 1.00 44.69  ? 52   SER D CB  1 
ATOM   8348  O  OG  . SER D  4  52  ? 34.600  280.362 249.820 1.00 46.12  ? 52   SER D OG  1 
ATOM   8349  N  N   . ILE D  4  53  ? 35.071  278.051 247.266 1.00 43.04  ? 53   ILE D N   1 
ATOM   8350  C  CA  . ILE D  4  53  ? 35.105  278.405 245.833 1.00 43.91  ? 53   ILE D CA  1 
ATOM   8351  C  C   . ILE D  4  53  ? 34.942  279.930 245.732 1.00 45.09  ? 53   ILE D C   1 
ATOM   8352  O  O   . ILE D  4  53  ? 35.810  280.627 245.134 1.00 45.12  ? 53   ILE D O   1 
ATOM   8353  C  CB  . ILE D  4  53  ? 34.064  277.624 244.991 1.00 43.44  ? 53   ILE D CB  1 
ATOM   8354  C  CG1 . ILE D  4  53  ? 34.447  276.122 244.837 1.00 43.79  ? 53   ILE D CG1 1 
ATOM   8355  C  CG2 . ILE D  4  53  ? 33.875  278.267 243.579 1.00 43.84  ? 53   ILE D CG2 1 
ATOM   8356  C  CD1 . ILE D  4  53  ? 35.884  275.804 244.179 1.00 42.58  ? 53   ILE D CD1 1 
ATOM   8357  N  N   . ASP D  4  54  ? 33.890  280.473 246.339 1.00 43.03  ? 54   ASP D N   1 
ATOM   8358  C  CA  . ASP D  4  54  ? 33.748  281.938 246.346 1.00 43.20  ? 54   ASP D CA  1 
ATOM   8359  C  C   . ASP D  4  54  ? 34.998  282.694 246.807 1.00 42.30  ? 54   ASP D C   1 
ATOM   8360  O  O   . ASP D  4  54  ? 35.372  283.662 246.196 1.00 41.98  ? 54   ASP D O   1 
ATOM   8361  C  CB  . ASP D  4  54  ? 32.530  282.382 247.160 1.00 43.87  ? 54   ASP D CB  1 
ATOM   8362  C  CG  . ASP D  4  54  ? 31.211  282.060 246.434 1.00 46.30  ? 54   ASP D CG  1 
ATOM   8363  O  OD1 . ASP D  4  54  ? 30.144  282.269 247.034 1.00 54.81  ? 54   ASP D OD1 1 
ATOM   8364  O  OD2 . ASP D  4  54  ? 31.223  281.575 245.280 1.00 43.44  ? 54   ASP D OD2 1 
ATOM   8365  N  N   . GLU D  4  55  ? 35.662  282.210 247.834 1.00 40.21  ? 55   GLU D N   1 
ATOM   8366  C  CA  . GLU D  4  55  ? 36.865  282.848 248.354 1.00 40.39  ? 55   GLU D CA  1 
ATOM   8367  C  C   . GLU D  4  55  ? 38.079  282.726 247.385 1.00 39.30  ? 55   GLU D C   1 
ATOM   8368  O  O   . GLU D  4  55  ? 38.918  283.633 247.308 1.00 37.78  ? 55   GLU D O   1 
ATOM   8369  C  CB  . GLU D  4  55  ? 37.249  282.221 249.710 1.00 40.18  ? 55   GLU D CB  1 
ATOM   8370  C  CG  . GLU D  4  55  ? 36.273  282.633 250.837 1.00 42.60  ? 55   GLU D CG  1 
ATOM   8371  C  CD  . GLU D  4  55  ? 36.586  281.967 252.206 1.00 50.58  ? 55   GLU D CD  1 
ATOM   8372  O  OE1 . GLU D  4  55  ? 36.414  282.691 253.244 1.00 51.10  ? 55   GLU D OE1 1 
ATOM   8373  O  OE2 . GLU D  4  55  ? 37.039  280.778 252.244 1.00 49.12  ? 55   GLU D OE2 1 
ATOM   8374  N  N   . LYS D  4  56  ? 38.244  281.546 246.781 1.00 37.06  ? 56   LYS D N   1 
ATOM   8375  C  CA  . LYS D  4  56  ? 39.242  281.390 245.713 1.00 37.50  ? 56   LYS D CA  1 
ATOM   8376  C  C   . LYS D  4  56  ? 38.987  282.425 244.563 1.00 35.18  ? 56   LYS D C   1 
ATOM   8377  O  O   . LYS D  4  56  ? 39.882  283.088 244.140 1.00 33.74  ? 56   LYS D O   1 
ATOM   8378  C  CB  . LYS D  4  56  ? 39.117  279.951 245.251 1.00 37.30  ? 56   LYS D CB  1 
ATOM   8379  C  CG  . LYS D  4  56  ? 39.755  279.053 246.356 1.00 38.14  ? 56   LYS D CG  1 
ATOM   8380  C  CD  . LYS D  4  56  ? 39.662  277.532 246.030 1.00 41.73  ? 56   LYS D CD  1 
ATOM   8381  C  CE  . LYS D  4  56  ? 40.683  276.735 246.929 1.00 37.60  ? 56   LYS D CE  1 
ATOM   8382  N  NZ  . LYS D  4  56  ? 40.503  275.360 246.400 1.00 35.54  ? 56   LYS D NZ  1 
ATOM   8383  N  N   . VAL D  4  57  ? 37.733  282.568 244.142 1.00 35.23  ? 57   VAL D N   1 
ATOM   8384  C  CA  . VAL D  4  57  ? 37.368  283.489 243.064 1.00 38.70  ? 57   VAL D CA  1 
ATOM   8385  C  C   . VAL D  4  57  ? 37.755  284.915 243.498 1.00 40.06  ? 57   VAL D C   1 
ATOM   8386  O  O   . VAL D  4  57  ? 38.327  285.727 242.718 1.00 39.72  ? 57   VAL D O   1 
ATOM   8387  C  CB  . VAL D  4  57  ? 35.887  283.403 242.661 1.00 38.78  ? 57   VAL D CB  1 
ATOM   8388  C  CG1 . VAL D  4  57  ? 35.516  284.624 241.765 1.00 36.48  ? 57   VAL D CG1 1 
ATOM   8389  C  CG2 . VAL D  4  57  ? 35.566  282.078 241.862 1.00 37.66  ? 57   VAL D CG2 1 
ATOM   8390  N  N   . GLU D  4  58  ? 37.446  285.224 244.750 1.00 40.46  ? 58   GLU D N   1 
ATOM   8391  C  CA  . GLU D  4  58  ? 37.656  286.570 245.257 1.00 40.16  ? 58   GLU D CA  1 
ATOM   8392  C  C   . GLU D  4  58  ? 39.127  286.819 245.318 1.00 37.62  ? 58   GLU D C   1 
ATOM   8393  O  O   . GLU D  4  58  ? 39.582  287.919 244.971 1.00 33.75  ? 58   GLU D O   1 
ATOM   8394  C  CB  . GLU D  4  58  ? 36.968  286.742 246.642 1.00 41.21  ? 58   GLU D CB  1 
ATOM   8395  C  CG  . GLU D  4  58  ? 36.910  288.174 246.989 1.00 52.80  ? 58   GLU D CG  1 
ATOM   8396  C  CD  . GLU D  4  58  ? 36.450  288.444 248.454 1.00 68.80  ? 58   GLU D CD  1 
ATOM   8397  O  OE1 . GLU D  4  58  ? 36.656  289.631 248.859 1.00 74.70  ? 58   GLU D OE1 1 
ATOM   8398  O  OE2 . GLU D  4  58  ? 35.908  287.508 249.174 1.00 69.30  ? 58   GLU D OE2 1 
ATOM   8399  N  N   . LEU D  4  59  ? 39.925  285.820 245.756 1.00 36.24  ? 59   LEU D N   1 
ATOM   8400  C  CA  . LEU D  4  59  ? 41.380  286.023 245.693 1.00 35.75  ? 59   LEU D CA  1 
ATOM   8401  C  C   . LEU D  4  59  ? 41.859  286.275 244.228 1.00 37.96  ? 59   LEU D C   1 
ATOM   8402  O  O   . LEU D  4  59  ? 42.723  287.172 244.013 1.00 39.84  ? 59   LEU D O   1 
ATOM   8403  C  CB  . LEU D  4  59  ? 42.192  284.861 246.267 1.00 36.27  ? 59   LEU D CB  1 
ATOM   8404  C  CG  . LEU D  4  59  ? 42.142  284.654 247.803 1.00 37.20  ? 59   LEU D CG  1 
ATOM   8405  C  CD1 . LEU D  4  59  ? 42.765  283.298 248.179 1.00 35.46  ? 59   LEU D CD1 1 
ATOM   8406  C  CD2 . LEU D  4  59  ? 42.830  285.859 248.401 1.00 35.05  ? 59   LEU D CD2 1 
ATOM   8407  N  N   . TYR D  4  60  ? 41.306  285.517 243.256 1.00 34.80  ? 60   TYR D N   1 
ATOM   8408  C  CA  . TYR D  4  60  ? 41.720  285.689 241.864 1.00 36.20  ? 60   TYR D CA  1 
ATOM   8409  C  C   . TYR D  4  60  ? 41.407  287.120 241.419 1.00 35.21  ? 60   TYR D C   1 
ATOM   8410  O  O   . TYR D  4  60  ? 42.258  287.820 240.871 1.00 36.44  ? 60   TYR D O   1 
ATOM   8411  C  CB  . TYR D  4  60  ? 41.043  284.650 241.002 1.00 33.98  ? 60   TYR D CB  1 
ATOM   8412  C  CG  . TYR D  4  60  ? 41.554  284.668 239.557 1.00 36.26  ? 60   TYR D CG  1 
ATOM   8413  C  CD1 . TYR D  4  60  ? 42.674  283.862 239.140 1.00 36.01  ? 60   TYR D CD1 1 
ATOM   8414  C  CD2 . TYR D  4  60  ? 40.893  285.464 238.591 1.00 35.34  ? 60   TYR D CD2 1 
ATOM   8415  C  CE1 . TYR D  4  60  ? 43.127  283.889 237.774 1.00 39.32  ? 60   TYR D CE1 1 
ATOM   8416  C  CE2 . TYR D  4  60  ? 41.391  285.567 237.215 1.00 34.90  ? 60   TYR D CE2 1 
ATOM   8417  C  CZ  . TYR D  4  60  ? 42.471  284.767 236.822 1.00 37.17  ? 60   TYR D CZ  1 
ATOM   8418  O  OH  . TYR D  4  60  ? 42.859  284.859 235.458 1.00 38.90  ? 60   TYR D OH  1 
ATOM   8419  N  N   . ARG D  4  61  ? 40.212  287.575 241.763 1.00 34.10  ? 61   ARG D N   1 
ATOM   8420  C  CA  . ARG D  4  61  ? 39.747  288.842 241.269 1.00 35.61  ? 61   ARG D CA  1 
ATOM   8421  C  C   . ARG D  4  61  ? 40.467  289.994 241.988 1.00 36.80  ? 61   ARG D C   1 
ATOM   8422  O  O   . ARG D  4  61  ? 40.438  291.091 241.500 1.00 37.28  ? 61   ARG D O   1 
ATOM   8423  C  CB  . ARG D  4  61  ? 38.206  288.980 241.381 1.00 35.55  ? 61   ARG D CB  1 
ATOM   8424  C  CG  . ARG D  4  61  ? 37.446  288.063 240.467 1.00 35.35  ? 61   ARG D CG  1 
ATOM   8425  C  CD  . ARG D  4  61  ? 37.786  288.196 238.997 1.00 36.66  ? 61   ARG D CD  1 
ATOM   8426  N  NE  . ARG D  4  61  ? 36.825  287.404 238.218 1.00 37.53  ? 61   ARG D NE  1 
ATOM   8427  C  CZ  . ARG D  4  61  ? 36.730  287.381 236.900 1.00 39.79  ? 61   ARG D CZ  1 
ATOM   8428  N  NH1 . ARG D  4  61  ? 37.503  288.186 236.151 1.00 32.45  ? 61   ARG D NH1 1 
ATOM   8429  N  NH2 . ARG D  4  61  ? 35.807  286.610 236.322 1.00 34.52  ? 61   ARG D NH2 1 
ATOM   8430  N  N   . LEU D  4  62  ? 41.164  289.736 243.099 1.00 35.32  ? 62   LEU D N   1 
ATOM   8431  C  CA  . LEU D  4  62  ? 41.950  290.759 243.747 1.00 36.67  ? 62   LEU D CA  1 
ATOM   8432  C  C   . LEU D  4  62  ? 43.306  290.968 243.002 1.00 36.45  ? 62   LEU D C   1 
ATOM   8433  O  O   . LEU D  4  62  ? 43.791  292.119 242.810 1.00 35.29  ? 62   LEU D O   1 
ATOM   8434  C  CB  . LEU D  4  62  ? 42.215  290.408 245.233 1.00 35.66  ? 62   LEU D CB  1 
ATOM   8435  C  CG  . LEU D  4  62  ? 41.042  290.682 246.218 1.00 38.17  ? 62   LEU D CG  1 
ATOM   8436  C  CD1 . LEU D  4  62  ? 41.487  290.247 247.609 1.00 30.67  ? 62   LEU D CD1 1 
ATOM   8437  C  CD2 . LEU D  4  62  ? 40.590  292.237 246.261 1.00 38.47  ? 62   LEU D CD2 1 
ATOM   8438  N  N   . LYS D  4  63  ? 43.878  289.848 242.581 1.00 35.69  ? 63   LYS D N   1 
ATOM   8439  C  CA  . LYS D  4  63  ? 45.212  289.801 241.915 1.00 36.58  ? 63   LYS D CA  1 
ATOM   8440  C  C   . LYS D  4  63  ? 45.120  290.295 240.416 1.00 34.91  ? 63   LYS D C   1 
ATOM   8441  O  O   . LYS D  4  63  ? 46.008  291.013 239.915 1.00 33.62  ? 63   LYS D O   1 
ATOM   8442  C  CB  . LYS D  4  63  ? 45.675  288.322 241.953 1.00 35.72  ? 63   LYS D CB  1 
ATOM   8443  C  CG  . LYS D  4  63  ? 47.096  288.123 241.421 1.00 39.56  ? 63   LYS D CG  1 
ATOM   8444  C  CD  . LYS D  4  63  ? 48.113  288.849 242.195 1.00 41.51  ? 63   LYS D CD  1 
ATOM   8445  C  CE  . LYS D  4  63  ? 48.915  287.869 242.978 1.00 45.20  ? 63   LYS D CE  1 
ATOM   8446  N  NZ  . LYS D  4  63  ? 50.206  288.399 243.515 1.00 43.48  ? 63   LYS D NZ  1 
ATOM   8447  N  N   . PHE D  4  64  ? 43.995  289.965 239.774 1.00 36.55  ? 64   PHE D N   1 
ATOM   8448  C  CA  . PHE D  4  64  ? 43.787  290.054 238.327 1.00 37.09  ? 64   PHE D CA  1 
ATOM   8449  C  C   . PHE D  4  64  ? 42.438  290.658 238.013 1.00 38.30  ? 64   PHE D C   1 
ATOM   8450  O  O   . PHE D  4  64  ? 41.467  290.480 238.774 1.00 38.16  ? 64   PHE D O   1 
ATOM   8451  C  CB  . PHE D  4  64  ? 43.783  288.639 237.609 1.00 34.86  ? 64   PHE D CB  1 
ATOM   8452  C  CG  . PHE D  4  64  ? 45.031  287.846 237.861 1.00 35.08  ? 64   PHE D CG  1 
ATOM   8453  C  CD1 . PHE D  4  64  ? 45.006  286.687 238.645 1.00 29.88  ? 64   PHE D CD1 1 
ATOM   8454  C  CD2 . PHE D  4  64  ? 46.267  288.370 237.431 1.00 30.93  ? 64   PHE D CD2 1 
ATOM   8455  C  CE1 . PHE D  4  64  ? 46.248  285.945 238.900 1.00 28.90  ? 64   PHE D CE1 1 
ATOM   8456  C  CE2 . PHE D  4  64  ? 47.473  287.685 237.607 1.00 33.64  ? 64   PHE D CE2 1 
ATOM   8457  C  CZ  . PHE D  4  64  ? 47.519  286.467 238.412 1.00 29.42  ? 64   PHE D CZ  1 
ATOM   8458  N  N   . LYS D  4  65  ? 42.382  291.333 236.843 1.00 38.19  ? 65   LYS D N   1 
ATOM   8459  C  CA  . LYS D  4  65  ? 41.158  291.985 236.429 1.00 37.02  ? 65   LYS D CA  1 
ATOM   8460  C  C   . LYS D  4  65  ? 40.345  290.975 235.666 1.00 37.18  ? 65   LYS D C   1 
ATOM   8461  O  O   . LYS D  4  65  ? 39.312  290.456 236.166 1.00 39.19  ? 65   LYS D O   1 
ATOM   8462  C  CB  . LYS D  4  65  ? 41.470  293.276 235.628 1.00 36.91  ? 65   LYS D CB  1 
ATOM   8463  C  CG  . LYS D  4  65  ? 40.199  294.061 235.277 1.00 36.97  ? 65   LYS D CG  1 
ATOM   8464  C  CD  . LYS D  4  65  ? 40.613  295.387 234.617 1.00 47.76  ? 65   LYS D CD  1 
ATOM   8465  C  CE  . LYS D  4  65  ? 39.387  296.113 234.178 1.00 52.10  ? 65   LYS D CE  1 
ATOM   8466  N  NZ  . LYS D  4  65  ? 39.578  296.217 232.704 1.00 66.42  ? 65   LYS D NZ  1 
ATOM   8467  N  N   . GLU D  4  66  ? 40.849  290.572 234.508 1.00 35.10  ? 66   GLU D N   1 
ATOM   8468  C  CA  . GLU D  4  66  ? 40.103  289.643 233.665 1.00 35.76  ? 66   GLU D CA  1 
ATOM   8469  C  C   . GLU D  4  66  ? 40.840  288.319 233.612 1.00 34.13  ? 66   GLU D C   1 
ATOM   8470  O  O   . GLU D  4  66  ? 42.080  288.310 233.682 1.00 34.10  ? 66   GLU D O   1 
ATOM   8471  C  CB  . GLU D  4  66  ? 40.026  290.247 232.235 1.00 37.04  ? 66   GLU D CB  1 
ATOM   8472  C  CG  . GLU D  4  66  ? 38.880  291.237 232.077 1.00 40.29  ? 66   GLU D CG  1 
ATOM   8473  C  CD  . GLU D  4  66  ? 38.702  291.632 230.599 1.00 47.29  ? 66   GLU D CD  1 
ATOM   8474  O  OE1 . GLU D  4  66  ? 37.533  291.691 230.192 1.00 46.80  ? 66   GLU D OE1 1 
ATOM   8475  O  OE2 . GLU D  4  66  ? 39.734  291.791 229.888 1.00 41.64  ? 66   GLU D OE2 1 
ATOM   8476  N  N   . SER D  4  67  ? 40.084  287.219 233.548 1.00 33.50  ? 67   SER D N   1 
ATOM   8477  C  CA  . SER D  4  67  ? 40.643  285.873 233.277 1.00 33.68  ? 67   SER D CA  1 
ATOM   8478  C  C   . SER D  4  67  ? 41.204  285.730 231.869 1.00 34.01  ? 67   SER D C   1 
ATOM   8479  O  O   . SER D  4  67  ? 40.935  286.570 230.985 1.00 34.29  ? 67   SER D O   1 
ATOM   8480  C  CB  . SER D  4  67  ? 39.616  284.785 233.453 1.00 31.91  ? 67   SER D CB  1 
ATOM   8481  O  OG  . SER D  4  67  ? 38.544  285.001 232.536 1.00 36.88  ? 67   SER D OG  1 
ATOM   8482  N  N   . PHE D  4  68  ? 42.005  284.674 231.599 1.00 33.18  ? 68   PHE D N   1 
ATOM   8483  C  CA  . PHE D  4  68  ? 42.348  284.405 230.196 1.00 31.51  ? 68   PHE D CA  1 
ATOM   8484  C  C   . PHE D  4  68  ? 41.158  284.333 229.263 1.00 33.70  ? 68   PHE D C   1 
ATOM   8485  O  O   . PHE D  4  68  ? 41.152  285.004 228.180 1.00 34.65  ? 68   PHE D O   1 
ATOM   8486  C  CB  . PHE D  4  68  ? 43.218  283.203 229.998 1.00 31.52  ? 68   PHE D CB  1 
ATOM   8487  C  CG  . PHE D  4  68  ? 44.677  283.500 230.169 1.00 27.70  ? 68   PHE D CG  1 
ATOM   8488  C  CD1 . PHE D  4  68  ? 45.123  284.138 231.307 1.00 24.20  ? 68   PHE D CD1 1 
ATOM   8489  C  CD2 . PHE D  4  68  ? 45.569  283.190 229.146 1.00 30.45  ? 68   PHE D CD2 1 
ATOM   8490  C  CE1 . PHE D  4  68  ? 46.520  284.429 231.509 1.00 29.16  ? 68   PHE D CE1 1 
ATOM   8491  C  CE2 . PHE D  4  68  ? 46.951  283.420 229.299 1.00 29.61  ? 68   PHE D CE2 1 
ATOM   8492  C  CZ  . PHE D  4  68  ? 47.445  284.061 230.470 1.00 31.16  ? 68   PHE D CZ  1 
ATOM   8493  N  N   . ALA D  4  69  ? 40.175  283.530 229.601 1.00 32.67  ? 69   ALA D N   1 
ATOM   8494  C  CA  . ALA D  4  69  ? 38.953  283.429 228.710 1.00 34.72  ? 69   ALA D CA  1 
ATOM   8495  C  C   . ALA D  4  69  ? 38.332  284.835 228.436 1.00 34.57  ? 69   ALA D C   1 
ATOM   8496  O  O   . ALA D  4  69  ? 37.924  285.171 227.323 1.00 36.50  ? 69   ALA D O   1 
ATOM   8497  C  CB  . ALA D  4  69  ? 37.968  282.530 229.342 1.00 33.75  ? 69   ALA D CB  1 
ATOM   8498  N  N   . GLU D  4  70  ? 38.219  285.672 229.470 1.00 35.49  ? 70   GLU D N   1 
ATOM   8499  C  CA  . GLU D  4  70  ? 37.692  287.044 229.294 1.00 35.31  ? 70   GLU D CA  1 
ATOM   8500  C  C   . GLU D  4  70  ? 38.574  287.906 228.448 1.00 35.43  ? 70   GLU D C   1 
ATOM   8501  O  O   . GLU D  4  70  ? 38.099  288.500 227.503 1.00 36.25  ? 70   GLU D O   1 
ATOM   8502  C  CB  . GLU D  4  70  ? 37.478  287.737 230.630 1.00 36.44  ? 70   GLU D CB  1 
ATOM   8503  C  CG  . GLU D  4  70  ? 36.256  287.276 231.342 1.00 35.07  ? 70   GLU D CG  1 
ATOM   8504  C  CD  . GLU D  4  70  ? 36.377  287.475 232.882 1.00 39.20  ? 70   GLU D CD  1 
ATOM   8505  O  OE1 . GLU D  4  70  ? 37.405  288.037 233.419 1.00 37.62  ? 70   GLU D OE1 1 
ATOM   8506  O  OE2 . GLU D  4  70  ? 35.450  286.976 233.571 1.00 37.77  ? 70   GLU D OE2 1 
ATOM   8507  N  N   . MET D  4  71  ? 39.885  287.929 228.698 1.00 36.20  ? 71   MET D N   1 
ATOM   8508  C  CA  . MET D  4  71  ? 40.705  288.830 227.949 1.00 34.61  ? 71   MET D CA  1 
ATOM   8509  C  C   . MET D  4  71  ? 40.873  288.369 226.517 1.00 38.07  ? 71   MET D C   1 
ATOM   8510  O  O   . MET D  4  71  ? 41.099  289.222 225.625 1.00 38.63  ? 71   MET D O   1 
ATOM   8511  C  CB  . MET D  4  71  ? 42.026  289.038 228.594 1.00 34.65  ? 71   MET D CB  1 
ATOM   8512  C  CG  . MET D  4  71  ? 42.997  287.945 228.369 1.00 33.77  ? 71   MET D CG  1 
ATOM   8513  S  SD  . MET D  4  71  ? 44.592  288.191 229.092 1.00 39.89  ? 71   MET D SD  1 
ATOM   8514  C  CE  . MET D  4  71  ? 44.185  287.600 230.808 1.00 35.00  ? 71   MET D CE  1 
ATOM   8515  N  N   . ASN D  4  72  ? 40.713  287.076 226.228 1.00 38.21  ? 72   ASN D N   1 
ATOM   8516  C  CA  . ASN D  4  72  ? 40.996  286.636 224.837 1.00 37.88  ? 72   ASN D CA  1 
ATOM   8517  C  C   . ASN D  4  72  ? 39.712  286.480 224.024 1.00 38.47  ? 72   ASN D C   1 
ATOM   8518  O  O   . ASN D  4  72  ? 39.733  285.845 222.962 1.00 39.10  ? 72   ASN D O   1 
ATOM   8519  C  CB  . ASN D  4  72  ? 41.710  285.296 224.791 1.00 37.57  ? 72   ASN D CB  1 
ATOM   8520  C  CG  . ASN D  4  72  ? 43.123  285.332 225.392 1.00 41.05  ? 72   ASN D CG  1 
ATOM   8521  O  OD1 . ASN D  4  72  ? 43.791  286.336 225.315 1.00 41.71  ? 72   ASN D OD1 1 
ATOM   8522  N  ND2 . ASN D  4  72  ? 43.560  284.223 226.032 1.00 39.48  ? 72   ASN D ND2 1 
ATOM   8523  N  N   . ARG D  4  73  ? 38.579  286.981 224.508 1.00 38.74  ? 73   ARG D N   1 
ATOM   8524  C  CA  . ARG D  4  73  ? 37.344  286.630 223.824 1.00 40.97  ? 73   ARG D CA  1 
ATOM   8525  C  C   . ARG D  4  73  ? 37.275  287.345 222.445 1.00 42.85  ? 73   ARG D C   1 
ATOM   8526  O  O   . ARG D  4  73  ? 37.696  288.480 222.282 1.00 42.69  ? 73   ARG D O   1 
ATOM   8527  C  CB  . ARG D  4  73  ? 36.132  286.990 224.637 1.00 42.75  ? 73   ARG D CB  1 
ATOM   8528  C  CG  . ARG D  4  73  ? 35.965  288.483 224.763 1.00 52.11  ? 73   ARG D CG  1 
ATOM   8529  C  CD  . ARG D  4  73  ? 34.682  288.766 225.554 1.00 59.67  ? 73   ARG D CD  1 
ATOM   8530  N  NE  . ARG D  4  73  ? 34.655  290.147 226.007 1.00 68.50  ? 73   ARG D NE  1 
ATOM   8531  C  CZ  . ARG D  4  73  ? 35.248  290.623 227.110 1.00 75.02  ? 73   ARG D CZ  1 
ATOM   8532  N  NH1 . ARG D  4  73  ? 35.944  289.821 227.922 1.00 75.93  ? 73   ARG D NH1 1 
ATOM   8533  N  NH2 . ARG D  4  73  ? 35.125  291.928 227.417 1.00 76.34  ? 73   ARG D NH2 1 
ATOM   8534  N  N   . SER D  4  74  ? 36.738  286.674 221.446 1.00 44.48  ? 74   SER D N   1 
ATOM   8535  C  CA  . SER D  4  74  ? 36.525  287.332 220.164 1.00 45.79  ? 74   SER D CA  1 
ATOM   8536  C  C   . SER D  4  74  ? 35.239  288.163 220.211 1.00 43.85  ? 74   SER D C   1 
ATOM   8537  O  O   . SER D  4  74  ? 34.492  288.160 221.203 1.00 42.89  ? 74   SER D O   1 
ATOM   8538  C  CB  . SER D  4  74  ? 36.621  286.313 219.048 1.00 45.93  ? 74   SER D CB  1 
ATOM   8539  O  OG  . SER D  4  74  ? 35.533  285.497 219.316 1.00 53.96  ? 74   SER D OG  1 
ATOM   8540  N  N   . THR D  4  75  ? 35.073  289.041 219.226 1.00 42.31  ? 75   THR D N   1 
ATOM   8541  C  CA  . THR D  4  75  ? 34.081  290.100 219.309 1.00 39.22  ? 75   THR D CA  1 
ATOM   8542  C  C   . THR D  4  75  ? 33.346  290.163 217.939 1.00 39.17  ? 75   THR D C   1 
ATOM   8543  O  O   . THR D  4  75  ? 33.735  289.501 216.950 1.00 36.39  ? 75   THR D O   1 
ATOM   8544  C  CB  . THR D  4  75  ? 34.679  291.515 219.633 1.00 40.06  ? 75   THR D CB  1 
ATOM   8545  O  OG1 . THR D  4  75  ? 35.297  292.072 218.439 1.00 39.82  ? 75   THR D OG1 1 
ATOM   8546  C  CG2 . THR D  4  75  ? 35.727  291.514 220.796 1.00 39.64  ? 75   THR D CG2 1 
ATOM   8547  N  N   . ASN D  4  76  ? 32.301  290.960 217.897 1.00 36.69  ? 76   ASN D N   1 
ATOM   8548  C  CA  . ASN D  4  76  ? 31.553  291.168 216.638 1.00 39.12  ? 76   ASN D CA  1 
ATOM   8549  C  C   . ASN D  4  76  ? 32.022  292.410 215.868 1.00 38.06  ? 76   ASN D C   1 
ATOM   8550  O  O   . ASN D  4  76  ? 31.329  292.840 214.924 1.00 37.98  ? 76   ASN D O   1 
ATOM   8551  C  CB  . ASN D  4  76  ? 30.065  291.327 216.963 1.00 37.96  ? 76   ASN D CB  1 
ATOM   8552  C  CG  . ASN D  4  76  ? 29.427  289.990 217.303 1.00 41.10  ? 76   ASN D CG  1 
ATOM   8553  O  OD1 . ASN D  4  76  ? 29.490  289.019 216.496 1.00 44.16  ? 76   ASN D OD1 1 
ATOM   8554  N  ND2 . ASN D  4  76  ? 28.853  289.913 218.492 1.00 44.51  ? 76   ASN D ND2 1 
ATOM   8555  N  N   . GLU D  4  77  ? 33.124  293.019 216.326 1.00 35.43  ? 77   GLU D N   1 
ATOM   8556  C  CA  . GLU D  4  77  ? 33.642  294.240 215.715 1.00 34.84  ? 77   GLU D CA  1 
ATOM   8557  C  C   . GLU D  4  77  ? 33.810  294.075 214.192 1.00 35.53  ? 77   GLU D C   1 
ATOM   8558  O  O   . GLU D  4  77  ? 33.637  295.012 213.464 1.00 35.72  ? 77   GLU D O   1 
ATOM   8559  C  CB  . GLU D  4  77  ? 35.027  294.644 216.321 1.00 33.20  ? 77   GLU D CB  1 
ATOM   8560  C  CG  . GLU D  4  77  ? 35.445  296.021 215.859 1.00 32.31  ? 77   GLU D CG  1 
ATOM   8561  C  CD  . GLU D  4  77  ? 36.951  296.358 216.218 1.00 35.56  ? 77   GLU D CD  1 
ATOM   8562  O  OE1 . GLU D  4  77  ? 37.318  297.541 216.340 1.00 32.90  ? 77   GLU D OE1 1 
ATOM   8563  O  OE2 . GLU D  4  77  ? 37.771  295.455 216.377 1.00 36.04  ? 77   GLU D OE2 1 
ATOM   8564  N  N   . TRP D  4  78  ? 34.178  292.882 213.695 1.00 35.11  ? 78   TRP D N   1 
ATOM   8565  C  CA  . TRP D  4  78  ? 34.446  292.788 212.287 1.00 35.60  ? 78   TRP D CA  1 
ATOM   8566  C  C   . TRP D  4  78  ? 33.224  293.182 211.496 1.00 36.12  ? 78   TRP D C   1 
ATOM   8567  O  O   . TRP D  4  78  ? 33.358  293.734 210.391 1.00 34.12  ? 78   TRP D O   1 
ATOM   8568  C  CB  . TRP D  4  78  ? 34.913  291.361 211.871 1.00 37.77  ? 78   TRP D CB  1 
ATOM   8569  C  CG  . TRP D  4  78  ? 33.868  290.265 212.042 1.00 43.06  ? 78   TRP D CG  1 
ATOM   8570  C  CD1 . TRP D  4  78  ? 33.632  289.492 213.199 1.00 44.06  ? 78   TRP D CD1 1 
ATOM   8571  C  CD2 . TRP D  4  78  ? 32.892  289.807 211.059 1.00 44.31  ? 78   TRP D CD2 1 
ATOM   8572  N  NE1 . TRP D  4  78  ? 32.614  288.600 212.956 1.00 42.70  ? 78   TRP D NE1 1 
ATOM   8573  C  CE2 . TRP D  4  78  ? 32.140  288.768 211.672 1.00 45.81  ? 78   TRP D CE2 1 
ATOM   8574  C  CE3 . TRP D  4  78  ? 32.610  290.155 209.707 1.00 44.70  ? 78   TRP D CE3 1 
ATOM   8575  C  CZ2 . TRP D  4  78  ? 31.079  288.104 210.991 1.00 46.56  ? 78   TRP D CZ2 1 
ATOM   8576  C  CZ3 . TRP D  4  78  ? 31.582  289.522 209.040 1.00 47.13  ? 78   TRP D CZ3 1 
ATOM   8577  C  CH2 . TRP D  4  78  ? 30.830  288.465 209.682 1.00 44.49  ? 78   TRP D CH2 1 
ATOM   8578  N  N   . LYS D  4  79  ? 32.014  292.817 211.999 1.00 33.94  ? 79   LYS D N   1 
ATOM   8579  C  CA  . LYS D  4  79  ? 30.777  293.143 211.256 1.00 35.67  ? 79   LYS D CA  1 
ATOM   8580  C  C   . LYS D  4  79  ? 30.613  294.631 211.086 1.00 35.51  ? 79   LYS D C   1 
ATOM   8581  O  O   . LYS D  4  79  ? 30.335  295.141 210.013 1.00 36.32  ? 79   LYS D O   1 
ATOM   8582  C  CB  . LYS D  4  79  ? 29.526  292.601 212.019 1.00 34.58  ? 79   LYS D CB  1 
ATOM   8583  C  CG  . LYS D  4  79  ? 29.658  291.022 212.239 1.00 36.58  ? 79   LYS D CG  1 
ATOM   8584  C  CD  . LYS D  4  79  ? 28.274  290.508 212.907 1.00 35.00  ? 79   LYS D CD  1 
ATOM   8585  C  CE  . LYS D  4  79  ? 28.372  289.071 213.437 1.00 40.55  ? 79   LYS D CE  1 
ATOM   8586  N  NZ  . LYS D  4  79  ? 27.152  288.910 214.320 1.00 38.39  ? 79   LYS D NZ  1 
ATOM   8587  N  N   . THR D  4  80  ? 30.791  295.369 212.172 1.00 36.32  ? 80   THR D N   1 
ATOM   8588  C  CA  . THR D  4  80  ? 30.735  296.831 212.067 1.00 34.58  ? 80   THR D CA  1 
ATOM   8589  C  C   . THR D  4  80  ? 31.842  297.390 211.066 1.00 35.38  ? 80   THR D C   1 
ATOM   8590  O  O   . THR D  4  80  ? 31.564  298.281 210.256 1.00 33.61  ? 80   THR D O   1 
ATOM   8591  C  CB  . THR D  4  80  ? 31.050  297.430 213.456 1.00 36.45  ? 80   THR D CB  1 
ATOM   8592  O  OG1 . THR D  4  80  ? 30.186  296.855 214.427 1.00 36.05  ? 80   THR D OG1 1 
ATOM   8593  C  CG2 . THR D  4  80  ? 30.985  298.903 213.472 1.00 33.04  ? 80   THR D CG2 1 
ATOM   8594  N  N   . VAL D  4  81  ? 33.064  296.870 211.168 1.00 34.82  ? 81   VAL D N   1 
ATOM   8595  C  CA  . VAL D  4  81  ? 34.149  297.307 210.245 1.00 34.95  ? 81   VAL D CA  1 
ATOM   8596  C  C   . VAL D  4  81  ? 33.792  297.042 208.719 1.00 34.91  ? 81   VAL D C   1 
ATOM   8597  O  O   . VAL D  4  81  ? 33.874  297.954 207.877 1.00 34.23  ? 81   VAL D O   1 
ATOM   8598  C  CB  . VAL D  4  81  ? 35.502  296.744 210.650 1.00 34.57  ? 81   VAL D CB  1 
ATOM   8599  C  CG1 . VAL D  4  81  ? 36.609  297.070 209.621 1.00 31.76  ? 81   VAL D CG1 1 
ATOM   8600  C  CG2 . VAL D  4  81  ? 36.007  297.362 212.058 1.00 29.52  ? 81   VAL D CG2 1 
ATOM   8601  N  N   . VAL D  4  82  ? 33.415  295.807 208.405 1.00 34.00  ? 82   VAL D N   1 
ATOM   8602  C  CA  . VAL D  4  82  ? 33.208  295.421 207.004 1.00 33.73  ? 82   VAL D CA  1 
ATOM   8603  C  C   . VAL D  4  82  ? 31.940  296.107 206.538 1.00 34.60  ? 82   VAL D C   1 
ATOM   8604  O  O   . VAL D  4  82  ? 31.916  296.632 205.445 1.00 33.20  ? 82   VAL D O   1 
ATOM   8605  C  CB  . VAL D  4  82  ? 33.044  293.889 206.930 1.00 34.11  ? 82   VAL D CB  1 
ATOM   8606  C  CG1 . VAL D  4  82  ? 32.544  293.495 205.503 1.00 35.83  ? 82   VAL D CG1 1 
ATOM   8607  C  CG2 . VAL D  4  82  ? 34.411  293.303 207.263 1.00 37.33  ? 82   VAL D CG2 1 
ATOM   8608  N  N   . GLY D  4  83  ? 30.884  296.143 207.390 1.00 33.00  ? 83   GLY D N   1 
ATOM   8609  C  CA  . GLY D  4  83  ? 29.640  296.846 206.983 1.00 30.19  ? 83   GLY D CA  1 
ATOM   8610  C  C   . GLY D  4  83  ? 29.805  298.322 206.755 1.00 32.76  ? 83   GLY D C   1 
ATOM   8611  O  O   . GLY D  4  83  ? 29.240  298.898 205.801 1.00 30.38  ? 83   GLY D O   1 
ATOM   8612  N  N   . ALA D  4  84  ? 30.565  298.971 207.649 1.00 32.65  ? 84   ALA D N   1 
ATOM   8613  C  CA  . ALA D  4  84  ? 30.722  300.395 207.572 1.00 32.47  ? 84   ALA D CA  1 
ATOM   8614  C  C   . ALA D  4  84  ? 31.596  300.699 206.291 1.00 33.05  ? 84   ALA D C   1 
ATOM   8615  O  O   . ALA D  4  84  ? 31.372  301.700 205.593 1.00 32.78  ? 84   ALA D O   1 
ATOM   8616  C  CB  . ALA D  4  84  ? 31.447  300.934 208.821 1.00 32.54  ? 84   ALA D CB  1 
ATOM   8617  N  N   . ALA D  4  85  ? 32.657  299.945 206.102 1.00 33.45  ? 85   ALA D N   1 
ATOM   8618  C  CA  . ALA D  4  85  ? 33.549  300.192 204.914 1.00 33.76  ? 85   ALA D CA  1 
ATOM   8619  C  C   . ALA D  4  85  ? 32.695  300.069 203.584 1.00 33.94  ? 85   ALA D C   1 
ATOM   8620  O  O   . ALA D  4  85  ? 32.820  300.851 202.657 1.00 33.22  ? 85   ALA D O   1 
ATOM   8621  C  CB  . ALA D  4  85  ? 34.617  299.145 204.863 1.00 32.00  ? 85   ALA D CB  1 
ATOM   8622  N  N   . MET D  4  86  ? 31.881  299.050 203.510 1.00 32.67  ? 86   MET D N   1 
ATOM   8623  C  CA  . MET D  4  86  ? 30.981  298.867 202.320 1.00 34.42  ? 86   MET D CA  1 
ATOM   8624  C  C   . MET D  4  86  ? 30.012  300.048 202.266 1.00 33.93  ? 86   MET D C   1 
ATOM   8625  O  O   . MET D  4  86  ? 29.674  300.523 201.194 1.00 33.61  ? 86   MET D O   1 
ATOM   8626  C  CB  . MET D  4  86  ? 30.190  297.594 202.500 1.00 33.86  ? 86   MET D CB  1 
ATOM   8627  C  CG  . MET D  4  86  ? 31.197  296.450 202.356 1.00 36.36  ? 86   MET D CG  1 
ATOM   8628  S  SD  . MET D  4  86  ? 30.233  294.912 202.228 1.00 45.27  ? 86   MET D SD  1 
ATOM   8629  C  CE  . MET D  4  86  ? 30.134  294.934 200.405 1.00 51.71  ? 86   MET D CE  1 
ATOM   8630  N  N   . PHE D  4  87  ? 29.592  300.550 203.422 1.00 31.90  ? 87   PHE D N   1 
ATOM   8631  C  CA  . PHE D  4  87  ? 28.691  301.735 203.396 1.00 33.07  ? 87   PHE D CA  1 
ATOM   8632  C  C   . PHE D  4  87  ? 29.432  302.950 202.714 1.00 32.97  ? 87   PHE D C   1 
ATOM   8633  O  O   . PHE D  4  87  ? 28.908  303.607 201.805 1.00 36.07  ? 87   PHE D O   1 
ATOM   8634  C  CB  . PHE D  4  87  ? 28.173  302.158 204.800 1.00 31.95  ? 87   PHE D CB  1 
ATOM   8635  C  CG  . PHE D  4  87  ? 27.535  303.514 204.746 1.00 36.92  ? 87   PHE D CG  1 
ATOM   8636  C  CD1 . PHE D  4  87  ? 26.177  303.630 204.280 1.00 48.79  ? 87   PHE D CD1 1 
ATOM   8637  C  CD2 . PHE D  4  87  ? 28.293  304.706 204.995 1.00 45.05  ? 87   PHE D CD2 1 
ATOM   8638  C  CE1 . PHE D  4  87  ? 25.579  304.956 204.081 1.00 47.66  ? 87   PHE D CE1 1 
ATOM   8639  C  CE2 . PHE D  4  87  ? 27.711  306.050 204.797 1.00 47.93  ? 87   PHE D CE2 1 
ATOM   8640  C  CZ  . PHE D  4  87  ? 26.337  306.148 204.337 1.00 45.80  ? 87   PHE D CZ  1 
ATOM   8641  N  N   . PHE D  4  88  ? 30.632  303.279 203.168 1.00 32.14  ? 88   PHE D N   1 
ATOM   8642  C  CA  . PHE D  4  88  ? 31.386  304.407 202.599 1.00 31.03  ? 88   PHE D CA  1 
ATOM   8643  C  C   . PHE D  4  88  ? 31.789  304.127 201.187 1.00 30.77  ? 88   PHE D C   1 
ATOM   8644  O  O   . PHE D  4  88  ? 31.872  305.029 200.402 1.00 32.52  ? 88   PHE D O   1 
ATOM   8645  C  CB  . PHE D  4  88  ? 32.601  304.738 203.424 1.00 29.44  ? 88   PHE D CB  1 
ATOM   8646  C  CG  . PHE D  4  88  ? 32.218  305.412 204.728 1.00 34.03  ? 88   PHE D CG  1 
ATOM   8647  C  CD1 . PHE D  4  88  ? 32.136  304.662 205.898 1.00 32.62  ? 88   PHE D CD1 1 
ATOM   8648  C  CD2 . PHE D  4  88  ? 31.821  306.770 204.746 1.00 38.64  ? 88   PHE D CD2 1 
ATOM   8649  C  CE1 . PHE D  4  88  ? 31.717  305.242 207.100 1.00 34.14  ? 88   PHE D CE1 1 
ATOM   8650  C  CE2 . PHE D  4  88  ? 31.375  307.342 205.952 1.00 42.08  ? 88   PHE D CE2 1 
ATOM   8651  C  CZ  . PHE D  4  88  ? 31.350  306.561 207.128 1.00 35.20  ? 88   PHE D CZ  1 
ATOM   8652  N  N   . ILE D  4  89  ? 31.994  302.876 200.842 1.00 31.45  ? 89   ILE D N   1 
ATOM   8653  C  CA  . ILE D  4  89  ? 32.291  302.576 199.467 1.00 31.69  ? 89   ILE D CA  1 
ATOM   8654  C  C   . ILE D  4  89  ? 31.058  302.812 198.620 1.00 33.15  ? 89   ILE D C   1 
ATOM   8655  O  O   . ILE D  4  89  ? 31.191  303.226 197.480 1.00 33.37  ? 89   ILE D O   1 
ATOM   8656  C  CB  . ILE D  4  89  ? 32.929  301.192 199.305 1.00 31.85  ? 89   ILE D CB  1 
ATOM   8657  C  CG1 . ILE D  4  89  ? 34.370  301.202 199.852 1.00 36.09  ? 89   ILE D CG1 1 
ATOM   8658  C  CG2 . ILE D  4  89  ? 32.994  300.747 197.786 1.00 28.48  ? 89   ILE D CG2 1 
ATOM   8659  C  CD1 . ILE D  4  89  ? 34.949  299.775 200.130 1.00 34.94  ? 89   ILE D CD1 1 
ATOM   8660  N  N   . GLY D  4  90  ? 29.875  302.415 199.138 1.00 32.76  ? 90   GLY D N   1 
ATOM   8661  C  CA  . GLY D  4  90  ? 28.671  302.656 198.478 1.00 30.57  ? 90   GLY D CA  1 
ATOM   8662  C  C   . GLY D  4  90  ? 28.489  304.129 198.356 1.00 31.76  ? 90   GLY D C   1 
ATOM   8663  O  O   . GLY D  4  90  ? 28.018  304.582 197.309 1.00 35.49  ? 90   GLY D O   1 
ATOM   8664  N  N   . PHE D  4  91  ? 28.730  304.890 199.405 1.00 29.67  ? 91   PHE D N   1 
ATOM   8665  C  CA  . PHE D  4  91  ? 28.617  306.370 199.355 1.00 30.54  ? 91   PHE D CA  1 
ATOM   8666  C  C   . PHE D  4  91  ? 29.505  306.985 198.222 1.00 29.25  ? 91   PHE D C   1 
ATOM   8667  O  O   . PHE D  4  91  ? 29.126  307.994 197.518 1.00 30.12  ? 91   PHE D O   1 
ATOM   8668  C  CB  . PHE D  4  91  ? 28.976  307.020 200.738 1.00 30.43  ? 91   PHE D CB  1 
ATOM   8669  C  CG  . PHE D  4  91  ? 29.132  308.506 200.657 1.00 31.42  ? 91   PHE D CG  1 
ATOM   8670  C  CD1 . PHE D  4  91  ? 27.996  309.312 200.732 1.00 34.60  ? 91   PHE D CD1 1 
ATOM   8671  C  CD2 . PHE D  4  91  ? 30.380  309.121 200.471 1.00 32.76  ? 91   PHE D CD2 1 
ATOM   8672  C  CE1 . PHE D  4  91  ? 28.079  310.727 200.600 1.00 35.83  ? 91   PHE D CE1 1 
ATOM   8673  C  CE2 . PHE D  4  91  ? 30.480  310.560 200.356 1.00 29.66  ? 91   PHE D CE2 1 
ATOM   8674  C  CZ  . PHE D  4  91  ? 29.315  311.328 200.400 1.00 32.45  ? 91   PHE D CZ  1 
ATOM   8675  N  N   . THR D  4  92  ? 30.685  306.405 198.034 1.00 31.08  ? 92   THR D N   1 
ATOM   8676  C  CA  . THR D  4  92  ? 31.578  306.817 196.849 1.00 29.87  ? 92   THR D CA  1 
ATOM   8677  C  C   . THR D  4  92  ? 30.875  306.744 195.489 1.00 28.15  ? 92   THR D C   1 
ATOM   8678  O  O   . THR D  4  92  ? 31.078  307.583 194.638 1.00 29.55  ? 92   THR D O   1 
ATOM   8679  C  CB  . THR D  4  92  ? 32.854  305.886 196.786 1.00 30.29  ? 92   THR D CB  1 
ATOM   8680  O  OG1 . THR D  4  92  ? 33.440  305.842 198.139 1.00 29.73  ? 92   THR D OG1 1 
ATOM   8681  C  CG2 . THR D  4  92  ? 33.828  306.476 195.793 1.00 28.41  ? 92   THR D CG2 1 
ATOM   8682  N  N   . ALA D  4  93  ? 30.122  305.677 195.255 1.00 31.52  ? 93   ALA D N   1 
ATOM   8683  C  CA  . ALA D  4  93  ? 29.335  305.525 194.030 1.00 31.31  ? 93   ALA D CA  1 
ATOM   8684  C  C   . ALA D  4  93  ? 28.412  306.717 193.886 1.00 32.48  ? 93   ALA D C   1 
ATOM   8685  O  O   . ALA D  4  93  ? 28.146  307.125 192.777 1.00 33.14  ? 93   ALA D O   1 
ATOM   8686  C  CB  . ALA D  4  93  ? 28.479  304.262 194.087 1.00 28.71  ? 93   ALA D CB  1 
ATOM   8687  N  N   . LEU D  4  94  ? 27.858  307.243 194.971 1.00 33.85  ? 94   LEU D N   1 
ATOM   8688  C  CA  . LEU D  4  94  ? 26.949  308.423 194.820 1.00 33.07  ? 94   LEU D CA  1 
ATOM   8689  C  C   . LEU D  4  94  ? 27.749  309.625 194.304 1.00 35.38  ? 94   LEU D C   1 
ATOM   8690  O  O   . LEU D  4  94  ? 27.258  310.375 193.490 1.00 35.51  ? 94   LEU D O   1 
ATOM   8691  C  CB  . LEU D  4  94  ? 26.259  308.760 196.119 1.00 33.25  ? 94   LEU D CB  1 
ATOM   8692  C  CG  . LEU D  4  94  ? 25.344  307.716 196.758 1.00 34.88  ? 94   LEU D CG  1 
ATOM   8693  C  CD1 . LEU D  4  94  ? 24.819  308.243 198.164 1.00 30.98  ? 94   LEU D CD1 1 
ATOM   8694  C  CD2 . LEU D  4  94  ? 24.171  307.339 195.844 1.00 32.35  ? 94   LEU D CD2 1 
ATOM   8695  N  N   . LEU D  4  95  ? 29.003  309.799 194.749 1.00 34.81  ? 95   LEU D N   1 
ATOM   8696  C  CA  . LEU D  4  95  ? 29.812  310.904 194.228 1.00 33.25  ? 95   LEU D CA  1 
ATOM   8697  C  C   . LEU D  4  95  ? 30.049  310.691 192.741 1.00 30.71  ? 95   LEU D C   1 
ATOM   8698  O  O   . LEU D  4  95  ? 30.125  311.633 191.962 1.00 31.31  ? 95   LEU D O   1 
ATOM   8699  C  CB  . LEU D  4  95  ? 31.189  310.936 194.947 1.00 34.88  ? 95   LEU D CB  1 
ATOM   8700  C  CG  . LEU D  4  95  ? 31.067  311.099 196.475 1.00 35.34  ? 95   LEU D CG  1 
ATOM   8701  C  CD1 . LEU D  4  95  ? 32.466  311.146 197.089 1.00 34.43  ? 95   LEU D CD1 1 
ATOM   8702  C  CD2 . LEU D  4  95  ? 30.239  312.334 196.833 1.00 36.11  ? 95   LEU D CD2 1 
ATOM   8703  N  N   . LEU D  4  96  ? 30.210  309.458 192.367 1.00 29.37  ? 96   LEU D N   1 
ATOM   8704  C  CA  . LEU D  4  96  ? 30.510  309.111 190.953 1.00 32.63  ? 96   LEU D CA  1 
ATOM   8705  C  C   . LEU D  4  96  ? 29.262  309.296 190.062 1.00 32.19  ? 96   LEU D C   1 
ATOM   8706  O  O   . LEU D  4  96  ? 29.390  309.741 188.879 1.00 33.15  ? 96   LEU D O   1 
ATOM   8707  C  CB  . LEU D  4  96  ? 31.024  307.645 190.849 1.00 30.88  ? 96   LEU D CB  1 
ATOM   8708  C  CG  . LEU D  4  96  ? 32.467  307.432 191.477 1.00 28.66  ? 96   LEU D CG  1 
ATOM   8709  C  CD1 . LEU D  4  96  ? 32.836  305.940 191.658 1.00 26.18  ? 96   LEU D CD1 1 
ATOM   8710  C  CD2 . LEU D  4  96  ? 33.414  308.090 190.483 1.00 23.73  ? 96   LEU D CD2 1 
ATOM   8711  N  N   . ILE D  4  97  ? 28.094  308.947 190.576 1.00 32.06  ? 97   ILE D N   1 
ATOM   8712  C  CA  . ILE D  4  97  ? 26.846  309.235 189.894 1.00 33.21  ? 97   ILE D CA  1 
ATOM   8713  C  C   . ILE D  4  97  ? 26.746  310.736 189.761 1.00 33.45  ? 97   ILE D C   1 
ATOM   8714  O  O   . ILE D  4  97  ? 26.528  311.254 188.648 1.00 35.92  ? 97   ILE D O   1 
ATOM   8715  C  CB  . ILE D  4  97  ? 25.639  308.701 190.645 1.00 32.12  ? 97   ILE D CB  1 
ATOM   8716  C  CG1 . ILE D  4  97  ? 25.625  307.151 190.541 1.00 32.49  ? 97   ILE D CG1 1 
ATOM   8717  C  CG2 . ILE D  4  97  ? 24.352  309.275 190.007 1.00 32.66  ? 97   ILE D CG2 1 
ATOM   8718  C  CD1 . ILE D  4  97  ? 24.967  306.523 191.792 1.00 31.48  ? 97   ILE D CD1 1 
ATOM   8719  N  N   . TRP D  4  98  ? 26.983  311.484 190.831 1.00 32.66  ? 98   TRP D N   1 
ATOM   8720  C  CA  . TRP D  4  98  ? 26.914  312.972 190.688 1.00 31.73  ? 98   TRP D CA  1 
ATOM   8721  C  C   . TRP D  4  98  ? 27.869  313.480 189.621 1.00 33.24  ? 98   TRP D C   1 
ATOM   8722  O  O   . TRP D  4  98  ? 27.535  314.380 188.749 1.00 34.60  ? 98   TRP D O   1 
ATOM   8723  C  CB  . TRP D  4  98  ? 27.231  313.646 192.060 1.00 33.50  ? 98   TRP D CB  1 
ATOM   8724  C  CG  . TRP D  4  98  ? 27.122  315.201 192.045 1.00 29.57  ? 98   TRP D CG  1 
ATOM   8725  C  CD1 . TRP D  4  98  ? 26.005  315.936 192.442 1.00 36.23  ? 98   TRP D CD1 1 
ATOM   8726  C  CD2 . TRP D  4  98  ? 28.122  316.173 191.690 1.00 32.71  ? 98   TRP D CD2 1 
ATOM   8727  N  NE1 . TRP D  4  98  ? 26.263  317.276 192.312 1.00 39.17  ? 98   TRP D NE1 1 
ATOM   8728  C  CE2 . TRP D  4  98  ? 27.532  317.456 191.820 1.00 34.43  ? 98   TRP D CE2 1 
ATOM   8729  C  CE3 . TRP D  4  98  ? 29.479  316.091 191.291 1.00 27.06  ? 98   TRP D CE3 1 
ATOM   8730  C  CZ2 . TRP D  4  98  ? 28.240  318.649 191.539 1.00 34.47  ? 98   TRP D CZ2 1 
ATOM   8731  C  CZ3 . TRP D  4  98  ? 30.161  317.240 190.962 1.00 32.41  ? 98   TRP D CZ3 1 
ATOM   8732  C  CH2 . TRP D  4  98  ? 29.576  318.527 191.157 1.00 33.49  ? 98   TRP D CH2 1 
ATOM   8733  N  N   . GLU D  4  99  ? 29.122  313.032 189.689 1.00 33.04  ? 99   GLU D N   1 
ATOM   8734  C  CA  . GLU D  4  99  ? 30.167  313.505 188.730 1.00 31.69  ? 99   GLU D CA  1 
ATOM   8735  C  C   . GLU D  4  99  ? 29.722  313.175 187.262 1.00 32.73  ? 99   GLU D C   1 
ATOM   8736  O  O   . GLU D  4  99  ? 29.855  313.954 186.292 1.00 30.93  ? 99   GLU D O   1 
ATOM   8737  C  CB  . GLU D  4  99  ? 31.444  312.664 188.959 1.00 31.22  ? 99   GLU D CB  1 
ATOM   8738  C  CG  . GLU D  4  99  ? 32.635  313.180 188.106 1.00 31.83  ? 99   GLU D CG  1 
ATOM   8739  C  CD  . GLU D  4  99  ? 33.878  312.313 188.243 1.00 31.58  ? 99   GLU D CD  1 
ATOM   8740  O  OE1 . GLU D  4  99  ? 34.960  312.880 188.244 1.00 32.46  ? 99   GLU D OE1 1 
ATOM   8741  O  OE2 . GLU D  4  99  ? 33.811  311.057 188.282 1.00 30.77  ? 99   GLU D OE2 1 
ATOM   8742  N  N   . LYS D  4  100 ? 29.208  311.983 187.083 1.00 34.16  ? 100  LYS D N   1 
ATOM   8743  C  CA  . LYS D  4  100 ? 28.719  311.622 185.733 1.00 36.55  ? 100  LYS D CA  1 
ATOM   8744  C  C   . LYS D  4  100 ? 27.576  312.539 185.245 1.00 37.98  ? 100  LYS D C   1 
ATOM   8745  O  O   . LYS D  4  100 ? 27.557  312.925 184.076 1.00 37.50  ? 100  LYS D O   1 
ATOM   8746  C  CB  . LYS D  4  100 ? 28.304  310.120 185.680 1.00 36.09  ? 100  LYS D CB  1 
ATOM   8747  C  CG  . LYS D  4  100 ? 27.730  309.642 184.293 1.00 34.29  ? 100  LYS D CG  1 
ATOM   8748  C  CD  . LYS D  4  100 ? 28.691  310.013 183.110 1.00 42.05  ? 100  LYS D CD  1 
ATOM   8749  C  CE  . LYS D  4  100 ? 27.916  310.122 181.630 1.00 51.51  ? 100  LYS D CE  1 
ATOM   8750  N  NZ  . LYS D  4  100 ? 27.643  311.678 181.042 1.00 50.45  ? 100  LYS D NZ  1 
ATOM   8751  N  N   . HIS D  4  101 ? 26.628  312.853 186.112 1.00 39.48  ? 101  HIS D N   1 
ATOM   8752  C  CA  . HIS D  4  101 ? 25.463  313.670 185.793 1.00 40.74  ? 101  HIS D CA  1 
ATOM   8753  C  C   . HIS D  4  101 ? 25.832  315.102 185.597 1.00 40.84  ? 101  HIS D C   1 
ATOM   8754  O  O   . HIS D  4  101 ? 25.373  315.704 184.681 1.00 39.20  ? 101  HIS D O   1 
ATOM   8755  C  CB  . HIS D  4  101 ? 24.481  313.660 186.935 1.00 42.01  ? 101  HIS D CB  1 
ATOM   8756  C  CG  . HIS D  4  101 ? 23.153  314.306 186.620 1.00 51.28  ? 101  HIS D CG  1 
ATOM   8757  N  ND1 . HIS D  4  101 ? 22.128  313.638 185.975 1.00 53.89  ? 101  HIS D ND1 1 
ATOM   8758  C  CD2 . HIS D  4  101 ? 22.663  315.539 186.916 1.00 54.12  ? 101  HIS D CD2 1 
ATOM   8759  C  CE1 . HIS D  4  101 ? 21.077  314.429 185.882 1.00 52.69  ? 101  HIS D CE1 1 
ATOM   8760  N  NE2 . HIS D  4  101 ? 21.387  315.596 186.415 1.00 54.98  ? 101  HIS D NE2 1 
ATOM   8761  N  N   . TYR D  4  102 ? 26.647  315.697 186.457 1.00 41.36  ? 102  TYR D N   1 
ATOM   8762  C  CA  . TYR D  4  102 ? 26.948  317.140 186.358 1.00 40.33  ? 102  TYR D CA  1 
ATOM   8763  C  C   . TYR D  4  102 ? 28.299  317.536 185.808 1.00 41.45  ? 102  TYR D C   1 
ATOM   8764  O  O   . TYR D  4  102 ? 28.458  318.688 185.473 1.00 42.56  ? 102  TYR D O   1 
ATOM   8765  C  CB  . TYR D  4  102 ? 26.844  317.854 187.765 1.00 42.67  ? 102  TYR D CB  1 
ATOM   8766  C  CG  . TYR D  4  102 ? 25.448  317.855 188.335 1.00 42.88  ? 102  TYR D CG  1 
ATOM   8767  C  CD1 . TYR D  4  102 ? 24.430  318.657 187.728 1.00 46.63  ? 102  TYR D CD1 1 
ATOM   8768  C  CD2 . TYR D  4  102 ? 25.110  317.032 189.397 1.00 38.40  ? 102  TYR D CD2 1 
ATOM   8769  C  CE1 . TYR D  4  102 ? 23.098  318.624 188.202 1.00 48.65  ? 102  TYR D CE1 1 
ATOM   8770  C  CE2 . TYR D  4  102 ? 23.747  316.988 189.904 1.00 46.83  ? 102  TYR D CE2 1 
ATOM   8771  C  CZ  . TYR D  4  102 ? 22.787  317.823 189.317 1.00 49.51  ? 102  TYR D CZ  1 
ATOM   8772  O  OH  . TYR D  4  102 ? 21.496  317.810 189.775 1.00 49.83  ? 102  TYR D OH  1 
ATOM   8773  N  N   . VAL D  4  103 ? 29.301  316.682 185.823 1.00 39.33  ? 103  VAL D N   1 
ATOM   8774  C  CA  . VAL D  4  103 ? 30.617  317.179 185.442 1.00 38.25  ? 103  VAL D CA  1 
ATOM   8775  C  C   . VAL D  4  103 ? 30.904  316.705 184.042 1.00 38.63  ? 103  VAL D C   1 
ATOM   8776  O  O   . VAL D  4  103 ? 31.333  317.480 183.211 1.00 39.24  ? 103  VAL D O   1 
ATOM   8777  C  CB  . VAL D  4  103 ? 31.753  316.691 186.413 1.00 38.76  ? 103  VAL D CB  1 
ATOM   8778  C  CG1 . VAL D  4  103 ? 33.210  317.067 185.914 1.00 37.01  ? 103  VAL D CG1 1 
ATOM   8779  C  CG2 . VAL D  4  103 ? 31.448  317.132 187.892 1.00 36.87  ? 103  VAL D CG2 1 
ATOM   8780  N  N   . TYR D  4  104 ? 30.701  315.428 183.757 1.00 37.25  ? 104  TYR D N   1 
ATOM   8781  C  CA  . TYR D  4  104 ? 31.176  314.922 182.436 1.00 36.37  ? 104  TYR D CA  1 
ATOM   8782  C  C   . TYR D  4  104 ? 30.111  315.246 181.350 1.00 36.81  ? 104  TYR D C   1 
ATOM   8783  O  O   . TYR D  4  104 ? 28.897  315.111 181.598 1.00 34.66  ? 104  TYR D O   1 
ATOM   8784  C  CB  . TYR D  4  104 ? 31.288  313.431 182.570 1.00 34.58  ? 104  TYR D CB  1 
ATOM   8785  C  CG  . TYR D  4  104 ? 32.580  312.989 183.276 1.00 35.56  ? 104  TYR D CG  1 
ATOM   8786  C  CD1 . TYR D  4  104 ? 32.585  311.879 184.114 1.00 31.13  ? 104  TYR D CD1 1 
ATOM   8787  C  CD2 . TYR D  4  104 ? 33.808  313.627 182.991 1.00 34.56  ? 104  TYR D CD2 1 
ATOM   8788  C  CE1 . TYR D  4  104 ? 33.794  311.435 184.731 1.00 33.35  ? 104  TYR D CE1 1 
ATOM   8789  C  CE2 . TYR D  4  104 ? 35.074  313.167 183.637 1.00 34.56  ? 104  TYR D CE2 1 
ATOM   8790  C  CZ  . TYR D  4  104 ? 35.010  312.069 184.487 1.00 34.40  ? 104  TYR D CZ  1 
ATOM   8791  O  OH  . TYR D  4  104 ? 36.198  311.683 185.064 1.00 35.76  ? 104  TYR D OH  1 
ATOM   8792  N  N   . GLY D  4  105 ? 30.560  315.707 180.203 1.00 37.84  ? 105  GLY D N   1 
ATOM   8793  C  CA  . GLY D  4  105 ? 29.738  315.795 179.013 1.00 39.27  ? 105  GLY D CA  1 
ATOM   8794  C  C   . GLY D  4  105 ? 29.789  314.492 178.231 1.00 40.11  ? 105  GLY D C   1 
ATOM   8795  O  O   . GLY D  4  105 ? 30.236  313.467 178.746 1.00 39.32  ? 105  GLY D O   1 
ATOM   8796  N  N   . PRO D  4  106 ? 29.250  314.504 176.995 1.00 40.92  ? 106  PRO D N   1 
ATOM   8797  C  CA  . PRO D  4  106 ? 29.164  313.338 176.076 1.00 40.09  ? 106  PRO D CA  1 
ATOM   8798  C  C   . PRO D  4  106 ? 30.563  312.885 175.703 1.00 37.37  ? 106  PRO D C   1 
ATOM   8799  O  O   . PRO D  4  106 ? 31.428  313.674 175.609 1.00 36.56  ? 106  PRO D O   1 
ATOM   8800  C  CB  . PRO D  4  106 ? 28.487  313.910 174.831 1.00 41.67  ? 106  PRO D CB  1 
ATOM   8801  C  CG  . PRO D  4  106 ? 28.528  315.472 174.993 1.00 42.80  ? 106  PRO D CG  1 
ATOM   8802  C  CD  . PRO D  4  106 ? 28.618  315.733 176.474 1.00 42.44  ? 106  PRO D CD  1 
ATOM   8803  N  N   . ILE D  4  107 ? 30.806  311.610 175.580 1.00 36.88  ? 107  ILE D N   1 
ATOM   8804  C  CA  . ILE D  4  107 ? 32.123  311.164 175.219 1.00 35.93  ? 107  ILE D CA  1 
ATOM   8805  C  C   . ILE D  4  107 ? 32.225  311.209 173.665 1.00 36.70  ? 107  ILE D C   1 
ATOM   8806  O  O   . ILE D  4  107 ? 31.209  311.430 173.005 1.00 34.16  ? 107  ILE D O   1 
ATOM   8807  C  CB  . ILE D  4  107 ? 32.291  309.725 175.692 1.00 36.97  ? 107  ILE D CB  1 
ATOM   8808  C  CG1 . ILE D  4  107 ? 31.216  308.840 175.094 1.00 34.41  ? 107  ILE D CG1 1 
ATOM   8809  C  CG2 . ILE D  4  107 ? 32.310  309.628 177.253 1.00 37.10  ? 107  ILE D CG2 1 
ATOM   8810  C  CD1 . ILE D  4  107 ? 31.643  307.332 175.156 1.00 37.03  ? 107  ILE D CD1 1 
ATOM   8811  N  N   . PRO D  4  108 ? 33.410  311.002 173.093 1.00 34.18  ? 108  PRO D N   1 
ATOM   8812  C  CA  . PRO D  4  108 ? 33.521  311.153 171.617 1.00 34.61  ? 108  PRO D CA  1 
ATOM   8813  C  C   . PRO D  4  108 ? 32.553  310.292 170.715 1.00 31.93  ? 108  PRO D C   1 
ATOM   8814  O  O   . PRO D  4  108 ? 32.071  309.211 171.137 1.00 31.62  ? 108  PRO D O   1 
ATOM   8815  C  CB  . PRO D  4  108 ? 34.996  310.873 171.362 1.00 34.10  ? 108  PRO D CB  1 
ATOM   8816  C  CG  . PRO D  4  108 ? 35.678  311.186 172.812 1.00 34.01  ? 108  PRO D CG  1 
ATOM   8817  C  CD  . PRO D  4  108 ? 34.680  310.641 173.737 1.00 36.32  ? 108  PRO D CD  1 
ATOM   8818  N  N   . HIS D  4  109 ? 32.281  310.773 169.487 1.00 32.98  ? 109  HIS D N   1 
ATOM   8819  C  CA  . HIS D  4  109 ? 31.292  310.079 168.569 1.00 33.04  ? 109  HIS D CA  1 
ATOM   8820  C  C   . HIS D  4  109 ? 31.845  308.674 168.171 1.00 33.32  ? 109  HIS D C   1 
ATOM   8821  O  O   . HIS D  4  109 ? 31.108  307.787 167.741 1.00 33.59  ? 109  HIS D O   1 
ATOM   8822  C  CB  . HIS D  4  109 ? 31.031  310.951 167.313 1.00 32.38  ? 109  HIS D CB  1 
ATOM   8823  C  CG  . HIS D  4  109 ? 32.237  311.058 166.410 1.00 37.16  ? 109  HIS D CG  1 
ATOM   8824  N  ND1 . HIS D  4  109 ? 32.493  310.154 165.395 1.00 35.60  ? 109  HIS D ND1 1 
ATOM   8825  C  CD2 . HIS D  4  109 ? 33.314  311.896 166.442 1.00 39.40  ? 109  HIS D CD2 1 
ATOM   8826  C  CE1 . HIS D  4  109 ? 33.647  310.442 164.811 1.00 39.27  ? 109  HIS D CE1 1 
ATOM   8827  N  NE2 . HIS D  4  109 ? 34.175  311.489 165.428 1.00 42.14  ? 109  HIS D NE2 1 
ATOM   8828  N  N   . THR D  4  110 ? 33.169  308.433 168.376 1.00 32.47  ? 110  THR D N   1 
ATOM   8829  C  CA  . THR D  4  110 ? 33.811  307.174 167.977 1.00 29.96  ? 110  THR D CA  1 
ATOM   8830  C  C   . THR D  4  110 ? 33.341  306.017 168.870 1.00 32.02  ? 110  THR D C   1 
ATOM   8831  O  O   . THR D  4  110 ? 33.650  304.843 168.601 1.00 33.23  ? 110  THR D O   1 
ATOM   8832  C  CB  . THR D  4  110 ? 35.370  307.249 168.062 1.00 29.79  ? 110  THR D CB  1 
ATOM   8833  O  OG1 . THR D  4  110 ? 35.709  307.696 169.396 1.00 29.34  ? 110  THR D OG1 1 
ATOM   8834  C  CG2 . THR D  4  110 ? 35.891  308.294 167.097 1.00 28.05  ? 110  THR D CG2 1 
ATOM   8835  N  N   . PHE D  4  111 ? 32.563  306.290 169.914 1.00 32.29  ? 111  PHE D N   1 
ATOM   8836  C  CA  . PHE D  4  111 ? 32.014  305.193 170.715 1.00 32.40  ? 111  PHE D CA  1 
ATOM   8837  C  C   . PHE D  4  111 ? 30.575  304.818 170.295 1.00 35.32  ? 111  PHE D C   1 
ATOM   8838  O  O   . PHE D  4  111 ? 29.954  303.990 170.925 1.00 32.14  ? 111  PHE D O   1 
ATOM   8839  C  CB  . PHE D  4  111 ? 31.979  305.576 172.202 1.00 31.36  ? 111  PHE D CB  1 
ATOM   8840  C  CG  . PHE D  4  111 ? 33.390  305.667 172.805 1.00 33.34  ? 111  PHE D CG  1 
ATOM   8841  C  CD1 . PHE D  4  111 ? 34.119  306.839 172.692 1.00 28.13  ? 111  PHE D CD1 1 
ATOM   8842  C  CD2 . PHE D  4  111 ? 33.980  304.555 173.401 1.00 28.67  ? 111  PHE D CD2 1 
ATOM   8843  C  CE1 . PHE D  4  111 ? 35.450  306.916 173.168 1.00 30.22  ? 111  PHE D CE1 1 
ATOM   8844  C  CE2 . PHE D  4  111 ? 35.333  304.673 173.934 1.00 31.93  ? 111  PHE D CE2 1 
ATOM   8845  C  CZ  . PHE D  4  111 ? 36.022  305.784 173.817 1.00 31.17  ? 111  PHE D CZ  1 
ATOM   8846  N  N   . GLU D  4  112 ? 30.063  305.411 169.221 1.00 38.00  ? 112  GLU D N   1 
ATOM   8847  C  CA  . GLU D  4  112 ? 28.666  305.115 168.832 1.00 37.87  ? 112  GLU D CA  1 
ATOM   8848  C  C   . GLU D  4  112 ? 28.737  303.749 168.244 1.00 36.84  ? 112  GLU D C   1 
ATOM   8849  O  O   . GLU D  4  112 ? 29.796  303.338 167.693 1.00 34.55  ? 112  GLU D O   1 
ATOM   8850  C  CB  . GLU D  4  112 ? 28.238  306.048 167.724 1.00 39.05  ? 112  GLU D CB  1 
ATOM   8851  C  CG  . GLU D  4  112 ? 27.837  307.450 168.245 1.00 46.68  ? 112  GLU D CG  1 
ATOM   8852  C  CD  . GLU D  4  112 ? 27.991  308.534 167.156 1.00 55.23  ? 112  GLU D CD  1 
ATOM   8853  O  OE1 . GLU D  4  112 ? 28.440  308.156 166.015 1.00 57.91  ? 112  GLU D OE1 1 
ATOM   8854  O  OE2 . GLU D  4  112 ? 27.723  309.746 167.460 1.00 57.21  ? 112  GLU D OE2 1 
ATOM   8855  N  N   . GLU D  4  113 ? 27.611  303.073 168.308 1.00 34.60  ? 113  GLU D N   1 
ATOM   8856  C  CA  . GLU D  4  113 ? 27.497  301.653 167.992 1.00 38.36  ? 113  GLU D CA  1 
ATOM   8857  C  C   . GLU D  4  113 ? 27.936  301.397 166.534 1.00 37.04  ? 113  GLU D C   1 
ATOM   8858  O  O   . GLU D  4  113 ? 28.716  300.474 166.259 1.00 37.31  ? 113  GLU D O   1 
ATOM   8859  C  CB  . GLU D  4  113 ? 26.053  301.166 168.250 1.00 38.99  ? 113  GLU D CB  1 
ATOM   8860  C  CG  . GLU D  4  113 ? 25.883  299.761 167.811 1.00 48.40  ? 113  GLU D CG  1 
ATOM   8861  C  CD  . GLU D  4  113 ? 24.463  299.183 168.039 1.00 58.39  ? 113  GLU D CD  1 
ATOM   8862  O  OE1 . GLU D  4  113 ? 23.531  299.894 168.464 1.00 60.91  ? 113  GLU D OE1 1 
ATOM   8863  O  OE2 . GLU D  4  113 ? 24.309  297.966 167.796 1.00 63.54  ? 113  GLU D OE2 1 
ATOM   8864  N  N   . GLU D  4  114 ? 27.478  302.235 165.600 1.00 37.98  ? 114  GLU D N   1 
ATOM   8865  C  CA  . GLU D  4  114 ? 27.823  302.010 164.214 1.00 38.31  ? 114  GLU D CA  1 
ATOM   8866  C  C   . GLU D  4  114 ? 29.332  302.338 163.951 1.00 37.41  ? 114  GLU D C   1 
ATOM   8867  O  O   . GLU D  4  114 ? 30.022  301.595 163.259 1.00 35.52  ? 114  GLU D O   1 
ATOM   8868  C  CB  . GLU D  4  114 ? 26.901  302.856 163.311 1.00 41.17  ? 114  GLU D CB  1 
ATOM   8869  C  CG  . GLU D  4  114 ? 27.226  302.557 161.850 1.00 47.74  ? 114  GLU D CG  1 
ATOM   8870  C  CD  . GLU D  4  114 ? 26.365  303.325 160.880 1.00 54.91  ? 114  GLU D CD  1 
ATOM   8871  O  OE1 . GLU D  4  114 ? 26.201  302.782 159.773 1.00 61.16  ? 114  GLU D OE1 1 
ATOM   8872  O  OE2 . GLU D  4  114 ? 25.908  304.452 161.196 1.00 55.25  ? 114  GLU D OE2 1 
ATOM   8873  N  N   . TRP D  4  115 ? 29.830  303.427 164.551 1.00 35.83  ? 115  TRP D N   1 
ATOM   8874  C  CA  . TRP D  4  115 ? 31.260  303.691 164.463 1.00 35.37  ? 115  TRP D CA  1 
ATOM   8875  C  C   . TRP D  4  115 ? 32.049  302.447 164.912 1.00 34.34  ? 115  TRP D C   1 
ATOM   8876  O  O   . TRP D  4  115 ? 33.001  302.053 164.272 1.00 32.95  ? 115  TRP D O   1 
ATOM   8877  C  CB  . TRP D  4  115 ? 31.668  304.842 165.356 1.00 34.44  ? 115  TRP D CB  1 
ATOM   8878  C  CG  . TRP D  4  115 ? 33.121  305.241 165.036 1.00 34.74  ? 115  TRP D CG  1 
ATOM   8879  C  CD1 . TRP D  4  115 ? 34.290  304.617 165.474 1.00 34.51  ? 115  TRP D CD1 1 
ATOM   8880  C  CD2 . TRP D  4  115 ? 33.523  306.235 164.107 1.00 33.92  ? 115  TRP D CD2 1 
ATOM   8881  N  NE1 . TRP D  4  115 ? 35.372  305.221 164.880 1.00 30.98  ? 115  TRP D NE1 1 
ATOM   8882  C  CE2 . TRP D  4  115 ? 34.936  306.238 164.071 1.00 31.09  ? 115  TRP D CE2 1 
ATOM   8883  C  CE3 . TRP D  4  115 ? 32.804  307.147 163.292 1.00 38.09  ? 115  TRP D CE3 1 
ATOM   8884  C  CZ2 . TRP D  4  115 ? 35.683  307.142 163.261 1.00 31.41  ? 115  TRP D CZ2 1 
ATOM   8885  C  CZ3 . TRP D  4  115 ? 33.490  308.069 162.523 1.00 36.14  ? 115  TRP D CZ3 1 
ATOM   8886  C  CH2 . TRP D  4  115 ? 34.968  308.073 162.507 1.00 38.69  ? 115  TRP D CH2 1 
ATOM   8887  N  N   . VAL D  4  116 ? 31.745  301.926 166.118 1.00 35.02  ? 116  VAL D N   1 
ATOM   8888  C  CA  . VAL D  4  116 ? 32.404  300.738 166.641 1.00 35.11  ? 116  VAL D CA  1 
ATOM   8889  C  C   . VAL D  4  116 ? 32.350  299.505 165.726 1.00 34.44  ? 116  VAL D C   1 
ATOM   8890  O  O   . VAL D  4  116 ? 33.348  298.748 165.591 1.00 34.42  ? 116  VAL D O   1 
ATOM   8891  C  CB  . VAL D  4  116 ? 31.868  300.417 168.111 1.00 35.77  ? 116  VAL D CB  1 
ATOM   8892  C  CG1 . VAL D  4  116 ? 32.325  299.055 168.614 1.00 38.39  ? 116  VAL D CG1 1 
ATOM   8893  C  CG2 . VAL D  4  116 ? 32.276  301.485 169.075 1.00 32.73  ? 116  VAL D CG2 1 
ATOM   8894  N  N   . ALA D  4  117 ? 31.188  299.255 165.129 1.00 33.77  ? 117  ALA D N   1 
ATOM   8895  C  CA  . ALA D  4  117 ? 31.119  298.131 164.195 1.00 33.95  ? 117  ALA D CA  1 
ATOM   8896  C  C   . ALA D  4  117 ? 32.041  298.339 163.011 1.00 32.85  ? 117  ALA D C   1 
ATOM   8897  O  O   . ALA D  4  117 ? 32.707  297.409 162.546 1.00 31.70  ? 117  ALA D O   1 
ATOM   8898  C  CB  . ALA D  4  117 ? 29.577  297.840 163.742 1.00 31.25  ? 117  ALA D CB  1 
ATOM   8899  N  N   . LYS D  4  118 ? 32.106  299.564 162.513 1.00 32.83  ? 118  LYS D N   1 
ATOM   8900  C  CA  . LYS D  4  118 ? 32.928  299.797 161.309 1.00 33.18  ? 118  LYS D CA  1 
ATOM   8901  C  C   . LYS D  4  118 ? 34.453  299.687 161.667 1.00 33.80  ? 118  LYS D C   1 
ATOM   8902  O  O   . LYS D  4  118 ? 35.209  298.973 161.006 1.00 33.91  ? 118  LYS D O   1 
ATOM   8903  C  CB  . LYS D  4  118 ? 32.593  301.176 160.727 1.00 33.35  ? 118  LYS D CB  1 
ATOM   8904  C  CG  . LYS D  4  118 ? 31.270  301.131 159.966 1.00 36.11  ? 118  LYS D CG  1 
ATOM   8905  C  CD  . LYS D  4  118 ? 30.979  302.459 159.347 1.00 42.18  ? 118  LYS D CD  1 
ATOM   8906  C  CE  . LYS D  4  118 ? 29.510  302.381 158.625 1.00 37.75  ? 118  LYS D CE  1 
ATOM   8907  N  NZ  . LYS D  4  118 ? 29.413  303.729 157.993 1.00 43.94  ? 118  LYS D NZ  1 
ATOM   8908  N  N   . GLN D  4  119 ? 34.797  300.275 162.825 1.00 33.27  ? 119  GLN D N   1 
ATOM   8909  C  CA  . GLN D  4  119 ? 36.192  300.235 163.395 1.00 33.34  ? 119  GLN D CA  1 
ATOM   8910  C  C   . GLN D  4  119 ? 36.636  298.852 163.650 1.00 31.84  ? 119  GLN D C   1 
ATOM   8911  O  O   . GLN D  4  119 ? 37.760  298.483 163.372 1.00 30.70  ? 119  GLN D O   1 
ATOM   8912  C  CB  . GLN D  4  119 ? 36.170  301.067 164.689 1.00 32.07  ? 119  GLN D CB  1 
ATOM   8913  C  CG  . GLN D  4  119 ? 37.534  301.364 165.328 1.00 33.83  ? 119  GLN D CG  1 
ATOM   8914  C  CD  . GLN D  4  119 ? 37.299  302.376 166.421 1.00 36.26  ? 119  GLN D CD  1 
ATOM   8915  O  OE1 . GLN D  4  119 ? 37.334  303.596 166.213 1.00 36.76  ? 119  GLN D OE1 1 
ATOM   8916  N  NE2 . GLN D  4  119 ? 36.986  301.874 167.566 1.00 33.91  ? 119  GLN D NE2 1 
ATOM   8917  N  N   . THR D  4  120 ? 35.739  298.056 164.209 1.00 31.87  ? 120  THR D N   1 
ATOM   8918  C  CA  . THR D  4  120 ? 36.005  296.646 164.442 1.00 32.64  ? 120  THR D CA  1 
ATOM   8919  C  C   . THR D  4  120 ? 36.287  295.883 163.116 1.00 32.97  ? 120  THR D C   1 
ATOM   8920  O  O   . THR D  4  120 ? 37.299  295.155 162.960 1.00 33.69  ? 120  THR D O   1 
ATOM   8921  C  CB  . THR D  4  120 ? 34.794  296.009 165.141 1.00 31.80  ? 120  THR D CB  1 
ATOM   8922  O  OG1 . THR D  4  120 ? 34.617  296.549 166.478 1.00 34.86  ? 120  THR D OG1 1 
ATOM   8923  C  CG2 . THR D  4  120 ? 34.983  294.442 165.264 1.00 35.62  ? 120  THR D CG2 1 
ATOM   8924  N  N   . LYS D  4  121 ? 35.432  296.073 162.109 1.00 32.15  ? 121  LYS D N   1 
ATOM   8925  C  CA  . LYS D  4  121 ? 35.784  295.496 160.789 1.00 31.46  ? 121  LYS D CA  1 
ATOM   8926  C  C   . LYS D  4  121 ? 37.144  295.971 160.287 1.00 31.30  ? 121  LYS D C   1 
ATOM   8927  O  O   . LYS D  4  121 ? 37.924  295.161 159.857 1.00 33.31  ? 121  LYS D O   1 
ATOM   8928  C  CB  . LYS D  4  121 ? 34.741  295.791 159.713 1.00 30.46  ? 121  LYS D CB  1 
ATOM   8929  C  CG  . LYS D  4  121 ? 35.158  295.039 158.435 1.00 32.13  ? 121  LYS D CG  1 
ATOM   8930  C  CD  . LYS D  4  121 ? 34.061  295.046 157.347 1.00 35.32  ? 121  LYS D CD  1 
ATOM   8931  C  CE  . LYS D  4  121 ? 34.604  294.507 155.943 1.00 37.65  ? 121  LYS D CE  1 
ATOM   8932  N  NZ  . LYS D  4  121 ? 35.357  293.289 156.164 1.00 41.03  ? 121  LYS D NZ  1 
ATOM   8933  N  N   . ARG D  4  122 ? 37.426  297.271 160.343 1.00 29.46  ? 122  ARG D N   1 
ATOM   8934  C  CA  . ARG D  4  122 ? 38.743  297.738 159.937 1.00 31.76  ? 122  ARG D CA  1 
ATOM   8935  C  C   . ARG D  4  122 ? 39.931  297.150 160.672 1.00 30.67  ? 122  ARG D C   1 
ATOM   8936  O  O   . ARG D  4  122 ? 40.987  296.942 160.107 1.00 29.61  ? 122  ARG D O   1 
ATOM   8937  C  CB  . ARG D  4  122 ? 38.755  299.260 159.975 1.00 32.87  ? 122  ARG D CB  1 
ATOM   8938  C  CG  . ARG D  4  122 ? 40.106  299.870 159.558 1.00 30.29  ? 122  ARG D CG  1 
ATOM   8939  C  CD  . ARG D  4  122 ? 39.953  301.374 159.089 1.00 30.38  ? 122  ARG D CD  1 
ATOM   8940  N  NE  . ARG D  4  122 ? 41.311  301.964 158.861 1.00 29.32  ? 122  ARG D NE  1 
ATOM   8941  C  CZ  . ARG D  4  122 ? 42.118  302.451 159.770 1.00 32.32  ? 122  ARG D CZ  1 
ATOM   8942  N  NH1 . ARG D  4  122 ? 41.796  302.384 161.070 1.00 28.15  ? 122  ARG D NH1 1 
ATOM   8943  N  NH2 . ARG D  4  122 ? 43.295  303.033 159.352 1.00 27.85  ? 122  ARG D NH2 1 
ATOM   8944  N  N   . MET D  4  123 ? 39.795  296.956 161.993 1.00 33.92  ? 123  MET D N   1 
ATOM   8945  C  CA  . MET D  4  123 ? 40.801  296.287 162.793 1.00 31.97  ? 123  MET D CA  1 
ATOM   8946  C  C   . MET D  4  123 ? 40.999  294.851 162.361 1.00 31.93  ? 123  MET D C   1 
ATOM   8947  O  O   . MET D  4  123 ? 42.149  294.433 162.206 1.00 31.96  ? 123  MET D O   1 
ATOM   8948  C  CB  . MET D  4  123 ? 40.435  296.322 164.325 1.00 30.44  ? 123  MET D CB  1 
ATOM   8949  C  CG  . MET D  4  123 ? 40.464  297.737 164.849 1.00 32.46  ? 123  MET D CG  1 
ATOM   8950  S  SD  . MET D  4  123 ? 39.865  297.831 166.609 1.00 35.97  ? 123  MET D SD  1 
ATOM   8951  C  CE  . MET D  4  123 ? 41.192  296.882 167.421 1.00 29.13  ? 123  MET D CE  1 
ATOM   8952  N  N   . LEU D  4  124 ? 39.909  294.112 162.130 1.00 31.20  ? 124  LEU D N   1 
ATOM   8953  C  CA  . LEU D  4  124 ? 40.046  292.786 161.483 1.00 33.06  ? 124  LEU D CA  1 
ATOM   8954  C  C   . LEU D  4  124 ? 40.666  292.865 160.065 1.00 33.45  ? 124  LEU D C   1 
ATOM   8955  O  O   . LEU D  4  124 ? 41.475  292.000 159.702 1.00 34.15  ? 124  LEU D O   1 
ATOM   8956  C  CB  . LEU D  4  124 ? 38.668  292.104 161.410 1.00 33.45  ? 124  LEU D CB  1 
ATOM   8957  C  CG  . LEU D  4  124 ? 38.184  291.795 162.864 1.00 37.01  ? 124  LEU D CG  1 
ATOM   8958  C  CD1 . LEU D  4  124 ? 36.667  291.374 162.782 1.00 36.41  ? 124  LEU D CD1 1 
ATOM   8959  C  CD2 . LEU D  4  124 ? 39.083  290.752 163.639 1.00 34.68  ? 124  LEU D CD2 1 
ATOM   8960  N  N   . ASP D  4  125 ? 40.278  293.877 159.258 1.00 32.43  ? 125  ASP D N   1 
ATOM   8961  C  CA  . ASP D  4  125 ? 40.868  293.978 157.922 1.00 34.60  ? 125  ASP D CA  1 
ATOM   8962  C  C   . ASP D  4  125 ? 42.373  294.223 158.021 1.00 35.11  ? 125  ASP D C   1 
ATOM   8963  O  O   . ASP D  4  125 ? 43.162  293.836 157.132 1.00 38.48  ? 125  ASP D O   1 
ATOM   8964  C  CB  . ASP D  4  125 ? 40.235  295.114 157.170 1.00 33.21  ? 125  ASP D CB  1 
ATOM   8965  C  CG  . ASP D  4  125 ? 38.826  294.788 156.683 1.00 34.13  ? 125  ASP D CG  1 
ATOM   8966  O  OD1 . ASP D  4  125 ? 38.119  295.746 156.306 1.00 34.78  ? 125  ASP D OD1 1 
ATOM   8967  O  OD2 . ASP D  4  125 ? 38.432  293.600 156.639 1.00 38.60  ? 125  ASP D OD2 1 
ATOM   8968  N  N   . MET D  4  126 ? 42.795  294.939 159.051 1.00 33.79  ? 126  MET D N   1 
ATOM   8969  C  CA  . MET D  4  126 ? 44.224  295.212 159.101 1.00 35.15  ? 126  MET D CA  1 
ATOM   8970  C  C   . MET D  4  126 ? 44.863  294.158 159.950 1.00 34.10  ? 126  MET D C   1 
ATOM   8971  O  O   . MET D  4  126 ? 46.031  294.269 160.242 1.00 35.19  ? 126  MET D O   1 
ATOM   8972  C  CB  . MET D  4  126 ? 44.586  296.644 159.592 1.00 35.31  ? 126  MET D CB  1 
ATOM   8973  C  CG  . MET D  4  126 ? 44.047  297.088 160.870 1.00 37.91  ? 126  MET D CG  1 
ATOM   8974  S  SD  . MET D  4  126 ? 44.772  298.660 161.452 1.00 44.28  ? 126  MET D SD  1 
ATOM   8975  C  CE  . MET D  4  126 ? 43.523  299.716 161.020 1.00 38.84  ? 126  MET D CE  1 
ATOM   8976  N  N   . LYS D  4  127 ? 44.081  293.143 160.353 1.00 31.58  ? 127  LYS D N   1 
ATOM   8977  C  CA  . LYS D  4  127 ? 44.596  292.018 161.132 1.00 32.43  ? 127  LYS D CA  1 
ATOM   8978  C  C   . LYS D  4  127 ? 45.318  292.460 162.466 1.00 34.04  ? 127  LYS D C   1 
ATOM   8979  O  O   . LYS D  4  127 ? 46.467  292.005 162.812 1.00 31.17  ? 127  LYS D O   1 
ATOM   8980  C  CB  . LYS D  4  127 ? 45.480  291.118 160.289 1.00 31.56  ? 127  LYS D CB  1 
ATOM   8981  C  CG  . LYS D  4  127 ? 44.721  290.676 158.850 1.00 36.87  ? 127  LYS D CG  1 
ATOM   8982  C  CD  . LYS D  4  127 ? 44.576  289.202 158.685 1.00 44.18  ? 127  LYS D CD  1 
ATOM   8983  C  CE  . LYS D  4  127 ? 44.283  288.746 157.206 1.00 37.87  ? 127  LYS D CE  1 
ATOM   8984  N  NZ  . LYS D  4  127 ? 44.884  289.603 156.036 1.00 28.99  ? 127  LYS D NZ  1 
ATOM   8985  N  N   . VAL D  4  128 ? 44.691  293.405 163.149 1.00 33.89  ? 128  VAL D N   1 
ATOM   8986  C  CA  . VAL D  4  128 ? 45.111  293.657 164.578 1.00 33.85  ? 128  VAL D CA  1 
ATOM   8987  C  C   . VAL D  4  128 ? 45.205  292.360 165.433 1.00 34.65  ? 128  VAL D C   1 
ATOM   8988  O  O   . VAL D  4  128 ? 44.243  291.532 165.532 1.00 36.47  ? 128  VAL D O   1 
ATOM   8989  C  CB  . VAL D  4  128 ? 44.218  294.710 165.243 1.00 33.27  ? 128  VAL D CB  1 
ATOM   8990  C  CG1 . VAL D  4  128 ? 44.565  294.868 166.718 1.00 31.50  ? 128  VAL D CG1 1 
ATOM   8991  C  CG2 . VAL D  4  128 ? 44.307  296.055 164.450 1.00 31.64  ? 128  VAL D CG2 1 
ATOM   8992  N  N   . ALA D  4  129 ? 46.405  292.189 166.032 1.00 34.26  ? 129  ALA D N   1 
ATOM   8993  C  CA  . ALA D  4  129 ? 46.750  291.150 166.940 1.00 32.85  ? 129  ALA D CA  1 
ATOM   8994  C  C   . ALA D  4  129 ? 46.273  289.765 166.404 1.00 33.11  ? 129  ALA D C   1 
ATOM   8995  O  O   . ALA D  4  129 ? 45.408  289.139 166.997 1.00 32.33  ? 129  ALA D O   1 
ATOM   8996  C  CB  . ALA D  4  129 ? 46.184  291.480 168.373 1.00 31.82  ? 129  ALA D CB  1 
ATOM   8997  N  N   . PRO D  4  130 ? 46.871  289.332 165.274 1.00 34.40  ? 130  PRO D N   1 
ATOM   8998  C  CA  . PRO D  4  130 ? 46.403  288.197 164.446 1.00 34.71  ? 130  PRO D CA  1 
ATOM   8999  C  C   . PRO D  4  130 ? 46.945  286.906 165.100 1.00 36.34  ? 130  PRO D C   1 
ATOM   9000  O  O   . PRO D  4  130 ? 46.428  285.826 164.795 1.00 36.01  ? 130  PRO D O   1 
ATOM   9001  C  CB  . PRO D  4  130 ? 47.120  288.437 163.094 1.00 33.48  ? 130  PRO D CB  1 
ATOM   9002  C  CG  . PRO D  4  130 ? 48.445  289.065 163.479 1.00 33.13  ? 130  PRO D CG  1 
ATOM   9003  C  CD  . PRO D  4  130 ? 48.119  289.933 164.706 1.00 33.99  ? 130  PRO D CD  1 
ATOM   9004  N  N   . ILE D  4  131 ? 47.971  287.018 165.992 1.00 34.62  ? 131  ILE D N   1 
ATOM   9005  C  CA  . ILE D  4  131 ? 48.580  285.814 166.623 1.00 35.71  ? 131  ILE D CA  1 
ATOM   9006  C  C   . ILE D  4  131 ? 47.756  285.359 167.838 1.00 36.98  ? 131  ILE D C   1 
ATOM   9007  O  O   . ILE D  4  131 ? 47.441  284.150 168.013 1.00 36.59  ? 131  ILE D O   1 
ATOM   9008  C  CB  . ILE D  4  131 ? 50.115  285.979 167.000 1.00 37.54  ? 131  ILE D CB  1 
ATOM   9009  C  CG1 . ILE D  4  131 ? 50.912  286.380 165.776 1.00 38.74  ? 131  ILE D CG1 1 
ATOM   9010  C  CG2 . ILE D  4  131 ? 50.672  284.671 167.499 1.00 37.55  ? 131  ILE D CG2 1 
ATOM   9011  C  CD1 . ILE D  4  131 ? 51.078  287.773 165.748 1.00 40.59  ? 131  ILE D CD1 1 
ATOM   9012  N  N   . GLN D  4  132 ? 47.360  286.298 168.719 1.00 35.96  ? 132  GLN D N   1 
ATOM   9013  C  CA  . GLN D  4  132 ? 46.575  285.852 169.886 1.00 35.02  ? 132  GLN D CA  1 
ATOM   9014  C  C   . GLN D  4  132 ? 45.532  286.893 170.243 1.00 35.88  ? 132  GLN D C   1 
ATOM   9015  O  O   . GLN D  4  132 ? 44.497  286.523 170.749 1.00 33.96  ? 132  GLN D O   1 
ATOM   9016  C  CB  . GLN D  4  132 ? 47.452  285.706 171.153 1.00 35.26  ? 132  GLN D CB  1 
ATOM   9017  C  CG  . GLN D  4  132 ? 48.667  284.758 171.021 1.00 38.87  ? 132  GLN D CG  1 
ATOM   9018  C  CD  . GLN D  4  132 ? 49.369  284.584 172.379 1.00 41.29  ? 132  GLN D CD  1 
ATOM   9019  O  OE1 . GLN D  4  132 ? 50.147  285.442 172.747 1.00 39.57  ? 132  GLN D OE1 1 
ATOM   9020  N  NE2 . GLN D  4  132 ? 49.047  283.482 173.142 1.00 34.12  ? 132  GLN D NE2 1 
ATOM   9021  N  N   . GLY D  4  133 ? 45.820  288.198 170.073 1.00 34.58  ? 133  GLY D N   1 
ATOM   9022  C  CA  . GLY D  4  133 ? 45.089  289.183 170.862 1.00 34.44  ? 133  GLY D CA  1 
ATOM   9023  C  C   . GLY D  4  133 ? 43.682  289.502 170.395 1.00 36.86  ? 133  GLY D C   1 
ATOM   9024  O  O   . GLY D  4  133 ? 42.766  289.782 171.226 1.00 37.38  ? 133  GLY D O   1 
ATOM   9025  N  N   . PHE D  4  134 ? 43.470  289.581 169.081 1.00 34.62  ? 134  PHE D N   1 
ATOM   9026  C  CA  . PHE D  4  134 ? 42.216  290.199 168.584 1.00 34.26  ? 134  PHE D CA  1 
ATOM   9027  C  C   . PHE D  4  134 ? 41.683  289.440 167.310 1.00 35.77  ? 134  PHE D C   1 
ATOM   9028  O  O   . PHE D  4  134 ? 40.664  288.685 167.360 1.00 35.55  ? 134  PHE D O   1 
ATOM   9029  C  CB  . PHE D  4  134 ? 42.393  291.743 168.388 1.00 32.21  ? 134  PHE D CB  1 
ATOM   9030  C  CG  . PHE D  4  134 ? 41.073  292.492 168.066 1.00 32.94  ? 134  PHE D CG  1 
ATOM   9031  C  CD1 . PHE D  4  134 ? 40.224  292.869 169.063 1.00 35.28  ? 134  PHE D CD1 1 
ATOM   9032  C  CD2 . PHE D  4  134 ? 40.664  292.745 166.678 1.00 32.46  ? 134  PHE D CD2 1 
ATOM   9033  C  CE1 . PHE D  4  134 ? 38.991  293.541 168.774 1.00 41.89  ? 134  PHE D CE1 1 
ATOM   9034  C  CE2 . PHE D  4  134 ? 39.423  293.381 166.384 1.00 39.76  ? 134  PHE D CE2 1 
ATOM   9035  C  CZ  . PHE D  4  134 ? 38.572  293.760 167.417 1.00 38.30  ? 134  PHE D CZ  1 
ATOM   9036  N  N   . SER D  4  135 ? 42.329  289.683 166.176 1.00 36.71  ? 135  SER D N   1 
ATOM   9037  C  CA  . SER D  4  135 ? 42.015  289.002 164.883 1.00 36.94  ? 135  SER D CA  1 
ATOM   9038  C  C   . SER D  4  135 ? 42.174  287.496 164.996 1.00 38.86  ? 135  SER D C   1 
ATOM   9039  O  O   . SER D  4  135 ? 41.430  286.748 164.355 1.00 38.58  ? 135  SER D O   1 
ATOM   9040  C  CB  . SER D  4  135 ? 42.906  289.584 163.779 1.00 37.00  ? 135  SER D CB  1 
ATOM   9041  O  OG  . SER D  4  135 ? 42.517  290.937 163.620 1.00 41.12  ? 135  SER D OG  1 
ATOM   9042  N  N   . ALA D  4  136 ? 43.173  287.030 165.774 1.00 39.82  ? 136  ALA D N   1 
ATOM   9043  C  CA  . ALA D  4  136 ? 43.286  285.577 166.104 1.00 39.83  ? 136  ALA D CA  1 
ATOM   9044  C  C   . ALA D  4  136 ? 41.938  285.063 166.534 1.00 40.76  ? 136  ALA D C   1 
ATOM   9045  O  O   . ALA D  4  136 ? 41.751  283.866 166.485 1.00 41.76  ? 136  ALA D O   1 
ATOM   9046  C  CB  . ALA D  4  136 ? 44.253  285.284 167.242 1.00 37.67  ? 136  ALA D CB  1 
ATOM   9047  N  N   . LYS D  4  137 ? 41.055  285.919 167.078 1.00 39.75  ? 137  LYS D N   1 
ATOM   9048  C  CA  . LYS D  4  137 ? 39.769  285.389 167.619 1.00 38.16  ? 137  LYS D CA  1 
ATOM   9049  C  C   . LYS D  4  137 ? 38.612  285.456 166.640 1.00 38.79  ? 137  LYS D C   1 
ATOM   9050  O  O   . LYS D  4  137 ? 37.479  285.110 166.973 1.00 38.63  ? 137  LYS D O   1 
ATOM   9051  C  CB  . LYS D  4  137 ? 39.388  286.092 168.966 1.00 39.56  ? 137  LYS D CB  1 
ATOM   9052  C  CG  . LYS D  4  137 ? 40.590  286.057 170.009 1.00 35.72  ? 137  LYS D CG  1 
ATOM   9053  C  CD  . LYS D  4  137 ? 40.170  286.608 171.309 1.00 41.43  ? 137  LYS D CD  1 
ATOM   9054  C  CE  . LYS D  4  137 ? 41.343  286.496 172.330 1.00 42.44  ? 137  LYS D CE  1 
ATOM   9055  N  NZ  . LYS D  4  137 ? 40.753  287.049 173.556 1.00 47.44  ? 137  LYS D NZ  1 
ATOM   9056  N  N   . TRP D  4  138 ? 38.901  285.937 165.440 1.00 37.66  ? 138  TRP D N   1 
ATOM   9057  C  CA  . TRP D  4  138 ? 37.923  286.016 164.389 1.00 37.32  ? 138  TRP D CA  1 
ATOM   9058  C  C   . TRP D  4  138 ? 38.214  284.857 163.421 1.00 37.30  ? 138  TRP D C   1 
ATOM   9059  O  O   . TRP D  4  138 ? 39.395  284.520 163.120 1.00 36.57  ? 138  TRP D O   1 
ATOM   9060  C  CB  . TRP D  4  138 ? 37.995  287.407 163.675 1.00 37.48  ? 138  TRP D CB  1 
ATOM   9061  C  CG  . TRP D  4  138 ? 37.043  287.570 162.483 1.00 34.91  ? 138  TRP D CG  1 
ATOM   9062  C  CD1 . TRP D  4  138 ? 37.357  287.413 161.138 1.00 35.86  ? 138  TRP D CD1 1 
ATOM   9063  C  CD2 . TRP D  4  138 ? 35.640  287.908 162.537 1.00 34.84  ? 138  TRP D CD2 1 
ATOM   9064  N  NE1 . TRP D  4  138 ? 36.243  287.611 160.376 1.00 36.40  ? 138  TRP D NE1 1 
ATOM   9065  C  CE2 . TRP D  4  138 ? 35.162  287.889 161.199 1.00 36.97  ? 138  TRP D CE2 1 
ATOM   9066  C  CE3 . TRP D  4  138 ? 34.744  288.176 163.587 1.00 31.67  ? 138  TRP D CE3 1 
ATOM   9067  C  CZ2 . TRP D  4  138 ? 33.818  288.206 160.854 1.00 37.92  ? 138  TRP D CZ2 1 
ATOM   9068  C  CZ3 . TRP D  4  138 ? 33.353  288.469 163.264 1.00 40.30  ? 138  TRP D CZ3 1 
ATOM   9069  C  CH2 . TRP D  4  138 ? 32.908  288.464 161.873 1.00 37.79  ? 138  TRP D CH2 1 
ATOM   9070  N  N   . ASP D  4  139 ? 37.128  284.234 162.978 1.00 38.17  ? 139  ASP D N   1 
ATOM   9071  C  CA  . ASP D  4  139 ? 37.213  283.210 161.906 1.00 40.91  ? 139  ASP D CA  1 
ATOM   9072  C  C   . ASP D  4  139 ? 37.022  283.855 160.509 1.00 39.84  ? 139  ASP D C   1 
ATOM   9073  O  O   . ASP D  4  139 ? 35.919  284.258 160.122 1.00 40.73  ? 139  ASP D O   1 
ATOM   9074  C  CB  . ASP D  4  139 ? 36.121  282.178 162.118 1.00 42.26  ? 139  ASP D CB  1 
ATOM   9075  C  CG  . ASP D  4  139 ? 36.331  280.908 161.263 1.00 47.17  ? 139  ASP D CG  1 
ATOM   9076  O  OD1 . ASP D  4  139 ? 36.790  281.002 160.093 1.00 46.86  ? 139  ASP D OD1 1 
ATOM   9077  O  OD2 . ASP D  4  139 ? 36.106  279.832 161.853 1.00 47.76  ? 139  ASP D OD2 1 
ATOM   9078  N  N   . TYR D  4  140 ? 38.091  283.935 159.758 1.00 42.16  ? 140  TYR D N   1 
ATOM   9079  C  CA  . TYR D  4  140 ? 38.092  284.614 158.513 1.00 43.46  ? 140  TYR D CA  1 
ATOM   9080  C  C   . TYR D  4  140 ? 37.455  283.696 157.440 1.00 47.66  ? 140  TYR D C   1 
ATOM   9081  O  O   . TYR D  4  140 ? 37.078  284.170 156.382 1.00 48.09  ? 140  TYR D O   1 
ATOM   9082  C  CB  . TYR D  4  140 ? 39.527  284.906 158.188 1.00 45.19  ? 140  TYR D CB  1 
ATOM   9083  C  CG  . TYR D  4  140 ? 40.045  286.156 158.913 1.00 47.45  ? 140  TYR D CG  1 
ATOM   9084  C  CD1 . TYR D  4  140 ? 39.833  287.428 158.353 1.00 44.65  ? 140  TYR D CD1 1 
ATOM   9085  C  CD2 . TYR D  4  140 ? 40.662  286.065 160.191 1.00 46.10  ? 140  TYR D CD2 1 
ATOM   9086  C  CE1 . TYR D  4  140 ? 40.244  288.556 158.989 1.00 47.93  ? 140  TYR D CE1 1 
ATOM   9087  C  CE2 . TYR D  4  140 ? 41.083  287.230 160.872 1.00 42.46  ? 140  TYR D CE2 1 
ATOM   9088  C  CZ  . TYR D  4  140 ? 40.883  288.454 160.263 1.00 43.01  ? 140  TYR D CZ  1 
ATOM   9089  O  OH  . TYR D  4  140 ? 41.292  289.620 160.797 1.00 43.36  ? 140  TYR D OH  1 
ATOM   9090  N  N   . ASP D  4  141 ? 37.328  282.398 157.723 1.00 49.55  ? 141  ASP D N   1 
ATOM   9091  C  CA  . ASP D  4  141 ? 36.618  281.491 156.840 1.00 53.13  ? 141  ASP D CA  1 
ATOM   9092  C  C   . ASP D  4  141 ? 35.128  281.548 157.032 1.00 53.73  ? 141  ASP D C   1 
ATOM   9093  O  O   . ASP D  4  141 ? 34.384  281.854 156.088 1.00 54.77  ? 141  ASP D O   1 
ATOM   9094  C  CB  . ASP D  4  141 ? 37.218  280.118 157.006 1.00 53.04  ? 141  ASP D CB  1 
ATOM   9095  C  CG  . ASP D  4  141 ? 38.573  280.099 156.418 1.00 58.48  ? 141  ASP D CG  1 
ATOM   9096  O  OD1 . ASP D  4  141 ? 39.558  279.627 157.037 1.00 63.33  ? 141  ASP D OD1 1 
ATOM   9097  O  OD2 . ASP D  4  141 ? 38.660  280.689 155.311 1.00 62.10  ? 141  ASP D OD2 1 
ATOM   9098  N  N   . LYS D  4  142 ? 34.676  281.308 158.253 1.00 53.21  ? 142  LYS D N   1 
ATOM   9099  C  CA  . LYS D  4  142 ? 33.255  281.364 158.535 1.00 52.79  ? 142  LYS D CA  1 
ATOM   9100  C  C   . LYS D  4  142 ? 32.715  282.760 158.684 1.00 52.26  ? 142  LYS D C   1 
ATOM   9101  O  O   . LYS D  4  142 ? 31.525  282.959 158.876 1.00 49.99  ? 142  LYS D O   1 
ATOM   9102  C  CB  . LYS D  4  142 ? 32.963  280.553 159.773 1.00 54.05  ? 142  LYS D CB  1 
ATOM   9103  C  CG  . LYS D  4  142 ? 33.237  279.054 159.546 1.00 58.36  ? 142  LYS D CG  1 
ATOM   9104  C  CD  . LYS D  4  142 ? 32.620  278.238 160.670 1.00 66.19  ? 142  LYS D CD  1 
ATOM   9105  C  CE  . LYS D  4  142 ? 32.644  276.767 160.305 1.00 71.86  ? 142  LYS D CE  1 
ATOM   9106  N  NZ  . LYS D  4  142 ? 32.880  275.933 161.537 1.00 78.09  ? 142  LYS D NZ  1 
ATOM   9107  N  N   . ASN D  4  143 ? 33.601  283.752 158.613 1.00 53.10  ? 143  ASN D N   1 
ATOM   9108  C  CA  . ASN D  4  143 ? 33.188  285.142 158.807 1.00 53.23  ? 143  ASN D CA  1 
ATOM   9109  C  C   . ASN D  4  143 ? 32.356  285.378 160.113 1.00 51.62  ? 143  ASN D C   1 
ATOM   9110  O  O   . ASN D  4  143 ? 31.289  286.038 160.114 1.00 50.93  ? 143  ASN D O   1 
ATOM   9111  C  CB  . ASN D  4  143 ? 32.475  285.596 157.556 1.00 55.07  ? 143  ASN D CB  1 
ATOM   9112  C  CG  . ASN D  4  143 ? 32.303  287.058 157.506 1.00 60.61  ? 143  ASN D CG  1 
ATOM   9113  O  OD1 . ASN D  4  143 ? 31.204  287.524 157.216 1.00 67.96  ? 143  ASN D OD1 1 
ATOM   9114  N  ND2 . ASN D  4  143 ? 33.368  287.811 157.755 1.00 61.34  ? 143  ASN D ND2 1 
ATOM   9115  N  N   . GLU D  4  144 ? 32.873  284.847 161.221 1.00 48.58  ? 144  GLU D N   1 
ATOM   9116  C  CA  . GLU D  4  144 ? 32.297  285.136 162.522 1.00 47.37  ? 144  GLU D CA  1 
ATOM   9117  C  C   . GLU D  4  144 ? 33.357  285.047 163.611 1.00 44.86  ? 144  GLU D C   1 
ATOM   9118  O  O   . GLU D  4  144 ? 34.473  284.607 163.344 1.00 44.07  ? 144  GLU D O   1 
ATOM   9119  C  CB  . GLU D  4  144 ? 31.174  284.139 162.805 1.00 47.44  ? 144  GLU D CB  1 
ATOM   9120  C  CG  . GLU D  4  144 ? 31.690  282.731 162.692 1.00 51.50  ? 144  GLU D CG  1 
ATOM   9121  C  CD  . GLU D  4  144 ? 30.575  281.673 162.804 1.00 59.79  ? 144  GLU D CD  1 
ATOM   9122  O  OE1 . GLU D  4  144 ? 30.926  280.510 163.139 1.00 60.39  ? 144  GLU D OE1 1 
ATOM   9123  O  OE2 . GLU D  4  144 ? 29.381  282.017 162.586 1.00 58.13  ? 144  GLU D OE2 1 
ATOM   9124  N  N   . TRP D  4  145 ? 32.989  285.461 164.838 1.00 44.51  ? 145  TRP D N   1 
ATOM   9125  C  CA  . TRP D  4  145 ? 33.884  285.297 165.988 1.00 43.46  ? 145  TRP D CA  1 
ATOM   9126  C  C   . TRP D  4  145 ? 34.034  283.800 166.203 1.00 45.61  ? 145  TRP D C   1 
ATOM   9127  O  O   . TRP D  4  145 ? 33.010  283.071 166.227 1.00 44.90  ? 145  TRP D O   1 
ATOM   9128  C  CB  . TRP D  4  145 ? 33.298  285.951 167.267 1.00 42.03  ? 145  TRP D CB  1 
ATOM   9129  C  CG  . TRP D  4  145 ? 33.275  287.440 167.146 1.00 39.85  ? 145  TRP D CG  1 
ATOM   9130  C  CD1 . TRP D  4  145 ? 32.153  288.256 166.991 1.00 36.84  ? 145  TRP D CD1 1 
ATOM   9131  C  CD2 . TRP D  4  145 ? 34.432  288.301 167.064 1.00 38.54  ? 145  TRP D CD2 1 
ATOM   9132  N  NE1 . TRP D  4  145 ? 32.580  289.580 166.852 1.00 40.12  ? 145  TRP D NE1 1 
ATOM   9133  C  CE2 . TRP D  4  145 ? 33.966  289.620 166.859 1.00 39.53  ? 145  TRP D CE2 1 
ATOM   9134  C  CE3 . TRP D  4  145 ? 35.799  288.073 167.128 1.00 32.79  ? 145  TRP D CE3 1 
ATOM   9135  C  CZ2 . TRP D  4  145 ? 34.845  290.707 166.696 1.00 38.10  ? 145  TRP D CZ2 1 
ATOM   9136  C  CZ3 . TRP D  4  145 ? 36.702  289.173 166.968 1.00 37.34  ? 145  TRP D CZ3 1 
ATOM   9137  C  CH2 . TRP D  4  145 ? 36.211  290.458 166.788 1.00 39.38  ? 145  TRP D CH2 1 
ATOM   9138  N  N   . LYS D  4  146 ? 35.265  283.322 166.365 1.00 46.56  ? 146  LYS D N   1 
ATOM   9139  C  CA  . LYS D  4  146 ? 35.441  281.941 166.833 1.00 48.67  ? 146  LYS D CA  1 
ATOM   9140  C  C   . LYS D  4  146 ? 34.613  281.666 168.067 1.00 53.05  ? 146  LYS D C   1 
ATOM   9141  O  O   . LYS D  4  146 ? 34.541  282.461 169.009 1.00 52.42  ? 146  LYS D O   1 
ATOM   9142  C  CB  . LYS D  4  146 ? 36.900  281.617 167.093 1.00 46.53  ? 146  LYS D CB  1 
ATOM   9143  C  CG  . LYS D  4  146 ? 37.736  281.841 165.864 1.00 43.47  ? 146  LYS D CG  1 
ATOM   9144  C  CD  . LYS D  4  146 ? 39.139  281.297 166.034 1.00 41.45  ? 146  LYS D CD  1 
ATOM   9145  C  CE  . LYS D  4  146 ? 39.950  281.695 164.836 1.00 38.31  ? 146  LYS D CE  1 
ATOM   9146  N  NZ  . LYS D  4  146 ? 41.380  281.518 165.149 1.00 45.41  ? 146  LYS D NZ  1 
ATOM   9147  N  N   . LYS D  4  147 ? 33.944  280.528 168.064 1.00 58.93  ? 147  LYS D N   1 
ATOM   9148  C  CA  . LYS D  4  147 ? 33.110  280.105 169.234 1.00 63.57  ? 147  LYS D CA  1 
ATOM   9149  C  C   . LYS D  4  147 ? 34.060  279.589 170.321 1.00 65.50  ? 147  LYS D C   1 
ATOM   9150  O  O   . LYS D  4  147 ? 34.716  278.572 170.054 1.00 67.93  ? 147  LYS D O   1 
ATOM   9151  C  CB  . LYS D  4  147 ? 32.124  278.998 168.830 1.00 63.90  ? 147  LYS D CB  1 
ATOM   9152  C  CG  . LYS D  4  147 ? 31.000  279.444 167.884 1.00 68.38  ? 147  LYS D CG  1 
ATOM   9153  C  CD  . LYS D  4  147 ? 31.323  279.063 166.441 1.00 78.13  ? 147  LYS D CD  1 
ATOM   9154  C  CE  . LYS D  4  147 ? 30.814  277.582 166.098 1.00 84.22  ? 147  LYS D CE  1 
ATOM   9155  N  NZ  . LYS D  4  147 ? 30.758  277.274 164.576 1.00 86.43  ? 147  LYS D NZ  1 
ATOM   9156  O  OXT . LYS D  4  147 ? 34.250  280.150 171.431 1.00 67.31  ? 147  LYS D OXT 1 
ATOM   9157  N  N   . HIS E  5  5   ? 72.786  274.742 222.249 1.00 95.18  ? 5    HIS E N   1 
ATOM   9158  C  CA  . HIS E  5  5   ? 72.229  274.936 223.638 1.00 94.98  ? 5    HIS E CA  1 
ATOM   9159  C  C   . HIS E  5  5   ? 72.436  273.767 224.605 1.00 92.59  ? 5    HIS E C   1 
ATOM   9160  O  O   . HIS E  5  5   ? 73.456  273.739 225.309 1.00 93.13  ? 5    HIS E O   1 
ATOM   9161  C  CB  . HIS E  5  5   ? 70.740  275.340 223.603 1.00 96.29  ? 5    HIS E CB  1 
ATOM   9162  C  CG  . HIS E  5  5   ? 70.520  276.782 223.268 1.00 100.88 ? 5    HIS E CG  1 
ATOM   9163  N  ND1 . HIS E  5  5   ? 69.564  277.200 222.358 1.00 104.98 ? 5    HIS E ND1 1 
ATOM   9164  C  CD2 . HIS E  5  5   ? 71.143  277.904 223.709 1.00 103.63 ? 5    HIS E CD2 1 
ATOM   9165  C  CE1 . HIS E  5  5   ? 69.597  278.520 222.266 1.00 106.14 ? 5    HIS E CE1 1 
ATOM   9166  N  NE2 . HIS E  5  5   ? 70.549  278.971 223.070 1.00 106.59 ? 5    HIS E NE2 1 
ATOM   9167  N  N   . GLU E  5  6   ? 71.485  272.810 224.608 1.00 89.36  ? 6    GLU E N   1 
ATOM   9168  C  CA  . GLU E  5  6   ? 71.292  271.780 225.680 1.00 85.38  ? 6    GLU E CA  1 
ATOM   9169  C  C   . GLU E  5  6   ? 70.112  270.854 225.350 1.00 81.92  ? 6    GLU E C   1 
ATOM   9170  O  O   . GLU E  5  6   ? 69.188  271.251 224.628 1.00 81.51  ? 6    GLU E O   1 
ATOM   9171  C  CB  . GLU E  5  6   ? 70.983  272.469 227.029 1.00 86.18  ? 6    GLU E CB  1 
ATOM   9172  C  CG  . GLU E  5  6   ? 69.916  273.627 226.884 1.00 85.88  ? 6    GLU E CG  1 
ATOM   9173  C  CD  . GLU E  5  6   ? 69.429  274.240 228.188 1.00 83.89  ? 6    GLU E CD  1 
ATOM   9174  O  OE1 . GLU E  5  6   ? 68.447  275.001 228.122 1.00 80.92  ? 6    GLU E OE1 1 
ATOM   9175  O  OE2 . GLU E  5  6   ? 70.002  273.963 229.257 1.00 83.00  ? 6    GLU E OE2 1 
ATOM   9176  N  N   . THR E  5  7   ? 70.113  269.649 225.914 1.00 77.63  ? 7    THR E N   1 
ATOM   9177  C  CA  . THR E  5  7   ? 68.965  268.748 225.787 1.00 73.88  ? 7    THR E CA  1 
ATOM   9178  C  C   . THR E  5  7   ? 67.644  269.296 226.403 1.00 70.75  ? 7    THR E C   1 
ATOM   9179  O  O   . THR E  5  7   ? 67.637  270.210 227.239 1.00 69.52  ? 7    THR E O   1 
ATOM   9180  C  CB  . THR E  5  7   ? 69.238  267.388 226.437 1.00 74.31  ? 7    THR E CB  1 
ATOM   9181  O  OG1 . THR E  5  7   ? 69.397  267.552 227.854 1.00 73.52  ? 7    THR E OG1 1 
ATOM   9182  C  CG2 . THR E  5  7   ? 70.488  266.742 225.855 1.00 75.61  ? 7    THR E CG2 1 
ATOM   9183  N  N   . ASP E  5  8   ? 66.540  268.702 225.984 1.00 66.88  ? 8    ASP E N   1 
ATOM   9184  C  CA  . ASP E  5  8   ? 65.262  268.990 226.565 1.00 64.30  ? 8    ASP E CA  1 
ATOM   9185  C  C   . ASP E  5  8   ? 65.328  268.754 228.069 1.00 63.30  ? 8    ASP E C   1 
ATOM   9186  O  O   . ASP E  5  8   ? 64.715  269.492 228.842 1.00 62.34  ? 8    ASP E O   1 
ATOM   9187  C  CB  . ASP E  5  8   ? 64.194  268.083 225.939 1.00 63.70  ? 8    ASP E CB  1 
ATOM   9188  C  CG  . ASP E  5  8   ? 63.960  268.375 224.462 1.00 62.43  ? 8    ASP E CG  1 
ATOM   9189  O  OD1 . ASP E  5  8   ? 64.488  269.382 223.925 1.00 58.42  ? 8    ASP E OD1 1 
ATOM   9190  O  OD2 . ASP E  5  8   ? 63.239  267.593 223.836 1.00 60.46  ? 8    ASP E OD2 1 
ATOM   9191  N  N   . GLU E  5  9   ? 66.062  267.708 228.472 1.00 62.31  ? 9    GLU E N   1 
ATOM   9192  C  CA  . GLU E  5  9   ? 66.090  267.254 229.867 1.00 61.32  ? 9    GLU E CA  1 
ATOM   9193  C  C   . GLU E  5  9   ? 66.805  268.279 230.723 1.00 58.86  ? 9    GLU E C   1 
ATOM   9194  O  O   . GLU E  5  9   ? 66.338  268.603 231.788 1.00 57.55  ? 9    GLU E O   1 
ATOM   9195  C  CB  . GLU E  5  9   ? 66.708  265.843 230.036 1.00 63.65  ? 9    GLU E CB  1 
ATOM   9196  C  CG  . GLU E  5  9   ? 65.872  264.666 229.449 1.00 69.62  ? 9    GLU E CG  1 
ATOM   9197  C  CD  . GLU E  5  9   ? 65.822  264.628 227.868 1.00 77.62  ? 9    GLU E CD  1 
ATOM   9198  O  OE1 . GLU E  5  9   ? 64.837  264.031 227.323 1.00 78.73  ? 9    GLU E OE1 1 
ATOM   9199  O  OE2 . GLU E  5  9   ? 66.748  265.191 227.181 1.00 78.53  ? 9    GLU E OE2 1 
ATOM   9200  N  N   . GLU E  5  10  ? 67.913  268.811 230.228 1.00 57.14  ? 10   GLU E N   1 
ATOM   9201  C  CA  . GLU E  5  10  ? 68.649  269.857 230.913 1.00 57.25  ? 10   GLU E CA  1 
ATOM   9202  C  C   . GLU E  5  10  ? 67.896  271.225 231.011 1.00 55.99  ? 10   GLU E C   1 
ATOM   9203  O  O   . GLU E  5  10  ? 68.001  271.986 232.013 1.00 54.47  ? 10   GLU E O   1 
ATOM   9204  C  CB  . GLU E  5  10  ? 69.969  270.079 230.176 1.00 58.64  ? 10   GLU E CB  1 
ATOM   9205  C  CG  . GLU E  5  10  ? 70.911  268.835 230.209 1.00 64.42  ? 10   GLU E CG  1 
ATOM   9206  C  CD  . GLU E  5  10  ? 71.955  268.805 229.056 1.00 70.92  ? 10   GLU E CD  1 
ATOM   9207  O  OE1 . GLU E  5  10  ? 72.120  269.810 228.309 1.00 70.84  ? 10   GLU E OE1 1 
ATOM   9208  O  OE2 . GLU E  5  10  ? 72.626  267.748 228.922 1.00 75.77  ? 10   GLU E OE2 1 
ATOM   9209  N  N   . PHE E  5  11  ? 67.190  271.559 229.927 1.00 53.60  ? 11   PHE E N   1 
ATOM   9210  C  CA  . PHE E  5  11  ? 66.309  272.718 229.945 1.00 51.03  ? 11   PHE E CA  1 
ATOM   9211  C  C   . PHE E  5  11  ? 65.270  272.513 231.060 1.00 48.65  ? 11   PHE E C   1 
ATOM   9212  O  O   . PHE E  5  11  ? 65.173  273.342 231.930 1.00 47.67  ? 11   PHE E O   1 
ATOM   9213  C  CB  . PHE E  5  11  ? 65.627  272.908 228.578 1.00 50.57  ? 11   PHE E CB  1 
ATOM   9214  C  CG  . PHE E  5  11  ? 64.569  273.992 228.571 1.00 49.38  ? 11   PHE E CG  1 
ATOM   9215  C  CD1 . PHE E  5  11  ? 63.249  273.706 228.897 1.00 47.43  ? 11   PHE E CD1 1 
ATOM   9216  C  CD2 . PHE E  5  11  ? 64.911  275.299 228.256 1.00 47.12  ? 11   PHE E CD2 1 
ATOM   9217  C  CE1 . PHE E  5  11  ? 62.284  274.679 228.893 1.00 46.74  ? 11   PHE E CE1 1 
ATOM   9218  C  CE2 . PHE E  5  11  ? 63.954  276.273 228.215 1.00 44.38  ? 11   PHE E CE2 1 
ATOM   9219  C  CZ  . PHE E  5  11  ? 62.636  275.975 228.535 1.00 46.11  ? 11   PHE E CZ  1 
ATOM   9220  N  N   . ASP E  5  12  ? 64.531  271.409 231.041 1.00 46.90  ? 12   ASP E N   1 
ATOM   9221  C  CA  . ASP E  5  12  ? 63.484  271.203 232.005 1.00 48.04  ? 12   ASP E CA  1 
ATOM   9222  C  C   . ASP E  5  12  ? 64.059  271.238 233.424 1.00 47.95  ? 12   ASP E C   1 
ATOM   9223  O  O   . ASP E  5  12  ? 63.447  271.798 234.347 1.00 47.84  ? 12   ASP E O   1 
ATOM   9224  C  CB  . ASP E  5  12  ? 62.783  269.864 231.781 1.00 47.20  ? 12   ASP E CB  1 
ATOM   9225  C  CG  . ASP E  5  12  ? 61.954  269.849 230.526 1.00 49.78  ? 12   ASP E CG  1 
ATOM   9226  O  OD1 . ASP E  5  12  ? 61.503  268.749 230.110 1.00 50.28  ? 12   ASP E OD1 1 
ATOM   9227  O  OD2 . ASP E  5  12  ? 61.753  270.943 229.946 1.00 47.38  ? 12   ASP E OD2 1 
ATOM   9228  N  N   . ALA E  5  13  ? 65.246  270.637 233.604 1.00 48.01  ? 13   ALA E N   1 
ATOM   9229  C  CA  . ALA E  5  13  ? 65.860  270.466 234.961 1.00 47.22  ? 13   ALA E CA  1 
ATOM   9230  C  C   . ALA E  5  13  ? 66.226  271.839 235.578 1.00 46.20  ? 13   ALA E C   1 
ATOM   9231  O  O   . ALA E  5  13  ? 66.055  272.095 236.766 1.00 45.77  ? 13   ALA E O   1 
ATOM   9232  C  CB  . ALA E  5  13  ? 67.126  269.505 234.878 1.00 46.91  ? 13   ALA E CB  1 
ATOM   9233  N  N   . ARG E  5  14  ? 66.747  272.714 234.732 1.00 46.71  ? 14   ARG E N   1 
ATOM   9234  C  CA  . ARG E  5  14  ? 67.086  274.086 235.078 1.00 46.89  ? 14   ARG E CA  1 
ATOM   9235  C  C   . ARG E  5  14  ? 65.859  274.899 235.500 1.00 44.57  ? 14   ARG E C   1 
ATOM   9236  O  O   . ARG E  5  14  ? 65.902  275.688 236.430 1.00 45.23  ? 14   ARG E O   1 
ATOM   9237  C  CB  . ARG E  5  14  ? 67.629  274.729 233.807 1.00 49.04  ? 14   ARG E CB  1 
ATOM   9238  C  CG  . ARG E  5  14  ? 68.874  275.531 234.005 1.00 56.31  ? 14   ARG E CG  1 
ATOM   9239  C  CD  . ARG E  5  14  ? 68.777  276.828 233.111 1.00 67.61  ? 14   ARG E CD  1 
ATOM   9240  N  NE  . ARG E  5  14  ? 68.661  276.444 231.710 1.00 69.49  ? 14   ARG E NE  1 
ATOM   9241  C  CZ  . ARG E  5  14  ? 67.927  277.088 230.824 1.00 71.73  ? 14   ARG E CZ  1 
ATOM   9242  N  NH1 . ARG E  5  14  ? 67.262  278.180 231.170 1.00 74.49  ? 14   ARG E NH1 1 
ATOM   9243  N  NH2 . ARG E  5  14  ? 67.870  276.627 229.591 1.00 75.07  ? 14   ARG E NH2 1 
ATOM   9244  N  N   . TRP E  5  15  ? 64.761  274.721 234.786 1.00 43.67  ? 15   TRP E N   1 
ATOM   9245  C  CA  . TRP E  5  15  ? 63.510  275.368 235.154 1.00 41.55  ? 15   TRP E CA  1 
ATOM   9246  C  C   . TRP E  5  15  ? 62.938  274.847 236.467 1.00 43.13  ? 15   TRP E C   1 
ATOM   9247  O  O   . TRP E  5  15  ? 62.544  275.678 237.330 1.00 42.54  ? 15   TRP E O   1 
ATOM   9248  C  CB  . TRP E  5  15  ? 62.503  275.337 234.020 1.00 40.61  ? 15   TRP E CB  1 
ATOM   9249  C  CG  . TRP E  5  15  ? 62.857  276.494 233.041 1.00 40.61  ? 15   TRP E CG  1 
ATOM   9250  C  CD1 . TRP E  5  15  ? 63.551  276.412 231.857 1.00 40.74  ? 15   TRP E CD1 1 
ATOM   9251  C  CD2 . TRP E  5  15  ? 62.583  277.874 233.264 1.00 37.21  ? 15   TRP E CD2 1 
ATOM   9252  N  NE1 . TRP E  5  15  ? 63.698  277.680 231.304 1.00 42.65  ? 15   TRP E NE1 1 
ATOM   9253  C  CE2 . TRP E  5  15  ? 63.145  278.597 232.169 1.00 42.67  ? 15   TRP E CE2 1 
ATOM   9254  C  CE3 . TRP E  5  15  ? 61.923  278.578 234.296 1.00 38.01  ? 15   TRP E CE3 1 
ATOM   9255  C  CZ2 . TRP E  5  15  ? 63.023  279.983 232.050 1.00 39.62  ? 15   TRP E CZ2 1 
ATOM   9256  C  CZ3 . TRP E  5  15  ? 61.855  279.956 234.215 1.00 40.88  ? 15   TRP E CZ3 1 
ATOM   9257  C  CH2 . TRP E  5  15  ? 62.341  280.644 233.066 1.00 41.48  ? 15   TRP E CH2 1 
ATOM   9258  N  N   . VAL E  5  16  ? 62.862  273.511 236.598 1.00 42.36  ? 16   VAL E N   1 
ATOM   9259  C  CA  . VAL E  5  16  ? 62.590  272.866 237.946 1.00 41.75  ? 16   VAL E CA  1 
ATOM   9260  C  C   . VAL E  5  16  ? 63.388  273.485 239.106 1.00 40.53  ? 16   VAL E C   1 
ATOM   9261  O  O   . VAL E  5  16  ? 62.806  274.016 240.080 1.00 41.56  ? 16   VAL E O   1 
ATOM   9262  C  CB  . VAL E  5  16  ? 62.717  271.350 237.873 1.00 41.39  ? 16   VAL E CB  1 
ATOM   9263  C  CG1 . VAL E  5  16  ? 62.545  270.664 239.269 1.00 40.49  ? 16   VAL E CG1 1 
ATOM   9264  C  CG2 . VAL E  5  16  ? 61.638  270.844 236.941 1.00 41.25  ? 16   VAL E CG2 1 
ATOM   9265  N  N   . THR E  5  17  ? 64.699  273.511 238.981 1.00 40.62  ? 17   THR E N   1 
ATOM   9266  C  CA  . THR E  5  17  ? 65.523  274.092 240.013 1.00 40.44  ? 17   THR E CA  1 
ATOM   9267  C  C   . THR E  5  17  ? 65.155  275.556 240.294 1.00 42.52  ? 17   THR E C   1 
ATOM   9268  O  O   . THR E  5  17  ? 65.130  275.984 241.463 1.00 42.23  ? 17   THR E O   1 
ATOM   9269  C  CB  . THR E  5  17  ? 66.947  273.988 239.537 1.00 43.85  ? 17   THR E CB  1 
ATOM   9270  O  OG1 . THR E  5  17  ? 67.248  272.597 239.379 1.00 45.74  ? 17   THR E OG1 1 
ATOM   9271  C  CG2 . THR E  5  17  ? 67.998  274.726 240.495 1.00 42.22  ? 17   THR E CG2 1 
ATOM   9272  N  N   . TYR E  5  18  ? 64.848  276.327 239.213 1.00 39.85  ? 18   TYR E N   1 
ATOM   9273  C  CA  . TYR E  5  18  ? 64.539  277.733 239.312 1.00 39.42  ? 18   TYR E CA  1 
ATOM   9274  C  C   . TYR E  5  18  ? 63.399  277.892 240.273 1.00 37.19  ? 18   TYR E C   1 
ATOM   9275  O  O   . TYR E  5  18  ? 63.487  278.663 241.260 1.00 39.02  ? 18   TYR E O   1 
ATOM   9276  C  CB  . TYR E  5  18  ? 64.199  278.321 237.873 1.00 37.63  ? 18   TYR E CB  1 
ATOM   9277  C  CG  . TYR E  5  18  ? 63.941  279.799 237.930 1.00 38.22  ? 18   TYR E CG  1 
ATOM   9278  C  CD1 . TYR E  5  18  ? 64.973  280.732 237.744 1.00 39.18  ? 18   TYR E CD1 1 
ATOM   9279  C  CD2 . TYR E  5  18  ? 62.675  280.265 238.223 1.00 38.94  ? 18   TYR E CD2 1 
ATOM   9280  C  CE1 . TYR E  5  18  ? 64.683  282.112 237.825 1.00 38.35  ? 18   TYR E CE1 1 
ATOM   9281  C  CE2 . TYR E  5  18  ? 62.402  281.572 238.307 1.00 35.55  ? 18   TYR E CE2 1 
ATOM   9282  C  CZ  . TYR E  5  18  ? 63.372  282.488 238.131 1.00 37.26  ? 18   TYR E CZ  1 
ATOM   9283  O  OH  . TYR E  5  18  ? 63.000  283.798 238.251 1.00 38.18  ? 18   TYR E OH  1 
ATOM   9284  N  N   . PHE E  5  19  ? 62.343  277.140 240.020 1.00 35.97  ? 19   PHE E N   1 
ATOM   9285  C  CA  . PHE E  5  19  ? 61.140  277.378 240.809 1.00 36.17  ? 19   PHE E CA  1 
ATOM   9286  C  C   . PHE E  5  19  ? 61.164  276.642 242.172 1.00 38.73  ? 19   PHE E C   1 
ATOM   9287  O  O   . PHE E  5  19  ? 60.394  277.049 243.114 1.00 38.24  ? 19   PHE E O   1 
ATOM   9288  C  CB  . PHE E  5  19  ? 59.929  276.911 240.090 1.00 32.79  ? 19   PHE E CB  1 
ATOM   9289  C  CG  . PHE E  5  19  ? 59.536  277.799 238.896 1.00 35.21  ? 19   PHE E CG  1 
ATOM   9290  C  CD1 . PHE E  5  19  ? 59.614  277.286 237.634 1.00 30.44  ? 19   PHE E CD1 1 
ATOM   9291  C  CD2 . PHE E  5  19  ? 59.098  279.134 239.098 1.00 34.17  ? 19   PHE E CD2 1 
ATOM   9292  C  CE1 . PHE E  5  19  ? 59.204  278.091 236.499 1.00 34.34  ? 19   PHE E CE1 1 
ATOM   9293  C  CE2 . PHE E  5  19  ? 58.687  279.954 238.055 1.00 33.96  ? 19   PHE E CE2 1 
ATOM   9294  C  CZ  . PHE E  5  19  ? 58.767  279.463 236.760 1.00 31.03  ? 19   PHE E CZ  1 
ATOM   9295  N  N   . ASN E  5  20  ? 62.041  275.627 242.261 1.00 39.18  ? 20   ASN E N   1 
ATOM   9296  C  CA  . ASN E  5  20  ? 62.217  274.873 243.579 1.00 40.69  ? 20   ASN E CA  1 
ATOM   9297  C  C   . ASN E  5  20  ? 63.011  275.685 244.594 1.00 40.79  ? 20   ASN E C   1 
ATOM   9298  O  O   . ASN E  5  20  ? 63.009  275.368 245.746 1.00 42.89  ? 20   ASN E O   1 
ATOM   9299  C  CB  . ASN E  5  20  ? 62.835  273.497 243.361 1.00 39.20  ? 20   ASN E CB  1 
ATOM   9300  C  CG  . ASN E  5  20  ? 61.800  272.475 242.987 1.00 40.60  ? 20   ASN E CG  1 
ATOM   9301  O  OD1 . ASN E  5  20  ? 60.553  272.688 243.181 1.00 35.26  ? 20   ASN E OD1 1 
ATOM   9302  N  ND2 . ASN E  5  20  ? 62.277  271.330 242.431 1.00 39.21  ? 20   ASN E ND2 1 
ATOM   9303  N  N   . LYS E  5  21  ? 63.659  276.774 244.197 1.00 41.77  ? 21   LYS E N   1 
ATOM   9304  C  CA  . LYS E  5  21  ? 64.388  277.563 245.216 1.00 41.38  ? 21   LYS E CA  1 
ATOM   9305  C  C   . LYS E  5  21  ? 63.508  277.946 246.407 1.00 41.20  ? 21   LYS E C   1 
ATOM   9306  O  O   . LYS E  5  21  ? 62.576  278.690 246.232 1.00 41.98  ? 21   LYS E O   1 
ATOM   9307  C  CB  . LYS E  5  21  ? 65.061  278.800 244.600 1.00 40.99  ? 21   LYS E CB  1 
ATOM   9308  C  CG  . LYS E  5  21  ? 66.076  279.379 245.606 1.00 43.00  ? 21   LYS E CG  1 
ATOM   9309  C  CD  . LYS E  5  21  ? 66.704  280.684 245.097 1.00 49.42  ? 21   LYS E CD  1 
ATOM   9310  C  CE  . LYS E  5  21  ? 65.731  281.859 245.243 1.00 47.09  ? 21   LYS E CE  1 
ATOM   9311  N  NZ  . LYS E  5  21  ? 66.398  283.103 244.825 1.00 50.10  ? 21   LYS E NZ  1 
ATOM   9312  N  N   . PRO E  5  22  ? 63.808  277.432 247.660 1.00 43.37  ? 22   PRO E N   1 
ATOM   9313  C  CA  . PRO E  5  22  ? 62.870  277.605 248.792 1.00 41.54  ? 22   PRO E CA  1 
ATOM   9314  C  C   . PRO E  5  22  ? 62.458  279.057 248.995 1.00 41.69  ? 22   PRO E C   1 
ATOM   9315  O  O   . PRO E  5  22  ? 61.249  279.342 249.162 1.00 41.31  ? 22   PRO E O   1 
ATOM   9316  C  CB  . PRO E  5  22  ? 63.677  277.083 250.026 1.00 43.16  ? 22   PRO E CB  1 
ATOM   9317  C  CG  . PRO E  5  22  ? 64.804  276.219 249.438 1.00 43.72  ? 22   PRO E CG  1 
ATOM   9318  C  CD  . PRO E  5  22  ? 65.023  276.660 248.030 1.00 41.91  ? 22   PRO E CD  1 
ATOM   9319  N  N   . ASP E  5  23  ? 63.445  279.958 249.023 1.00 40.76  ? 23   ASP E N   1 
ATOM   9320  C  CA  . ASP E  5  23  ? 63.202  281.372 249.297 1.00 42.53  ? 23   ASP E CA  1 
ATOM   9321  C  C   . ASP E  5  23  ? 63.075  282.148 247.943 1.00 41.55  ? 23   ASP E C   1 
ATOM   9322  O  O   . ASP E  5  23  ? 63.335  283.343 247.898 1.00 41.91  ? 23   ASP E O   1 
ATOM   9323  C  CB  . ASP E  5  23  ? 64.335  281.990 250.128 1.00 43.04  ? 23   ASP E CB  1 
ATOM   9324  C  CG  . ASP E  5  23  ? 65.711  281.848 249.433 1.00 49.58  ? 23   ASP E CG  1 
ATOM   9325  O  OD1 . ASP E  5  23  ? 66.639  282.597 249.799 1.00 51.31  ? 23   ASP E OD1 1 
ATOM   9326  O  OD2 . ASP E  5  23  ? 65.904  280.956 248.549 1.00 53.65  ? 23   ASP E OD2 1 
ATOM   9327  N  N   . ILE E  5  24  ? 62.644  281.488 246.878 1.00 41.07  ? 24   ILE E N   1 
ATOM   9328  C  CA  . ILE E  5  24  ? 62.234  282.260 245.638 1.00 39.29  ? 24   ILE E CA  1 
ATOM   9329  C  C   . ILE E  5  24  ? 61.316  283.480 246.012 1.00 39.51  ? 24   ILE E C   1 
ATOM   9330  O  O   . ILE E  5  24  ? 60.304  283.335 246.700 1.00 43.01  ? 24   ILE E O   1 
ATOM   9331  C  CB  . ILE E  5  24  ? 61.605  281.308 244.606 1.00 38.06  ? 24   ILE E CB  1 
ATOM   9332  C  CG1 . ILE E  5  24  ? 61.345  282.068 243.260 1.00 38.74  ? 24   ILE E CG1 1 
ATOM   9333  C  CG2 . ILE E  5  24  ? 60.295  280.625 245.133 1.00 36.33  ? 24   ILE E CG2 1 
ATOM   9334  C  CD1 . ILE E  5  24  ? 60.779  281.246 242.156 1.00 35.40  ? 24   ILE E CD1 1 
ATOM   9335  N  N   . ASP E  5  25  ? 61.618  284.709 245.596 1.00 39.68  ? 25   ASP E N   1 
ATOM   9336  C  CA  . ASP E  5  25  ? 60.641  285.759 245.876 1.00 40.08  ? 25   ASP E CA  1 
ATOM   9337  C  C   . ASP E  5  25  ? 59.544  285.973 244.778 1.00 38.31  ? 25   ASP E C   1 
ATOM   9338  O  O   . ASP E  5  25  ? 59.506  285.247 243.768 1.00 40.09  ? 25   ASP E O   1 
ATOM   9339  C  CB  . ASP E  5  25  ? 61.335  287.044 246.293 1.00 38.29  ? 25   ASP E CB  1 
ATOM   9340  C  CG  . ASP E  5  25  ? 62.135  287.668 245.108 1.00 42.58  ? 25   ASP E CG  1 
ATOM   9341  O  OD1 . ASP E  5  25  ? 61.869  287.334 243.915 1.00 41.99  ? 25   ASP E OD1 1 
ATOM   9342  O  OD2 . ASP E  5  25  ? 63.063  288.428 245.409 1.00 35.57  ? 25   ASP E OD2 1 
ATOM   9343  N  N   . ALA E  5  26  ? 58.645  286.950 244.992 1.00 36.48  ? 26   ALA E N   1 
ATOM   9344  C  CA  . ALA E  5  26  ? 57.415  287.086 244.166 1.00 35.81  ? 26   ALA E CA  1 
ATOM   9345  C  C   . ALA E  5  26  ? 57.929  287.587 242.754 1.00 35.90  ? 26   ALA E C   1 
ATOM   9346  O  O   . ALA E  5  26  ? 57.542  287.065 241.693 1.00 36.42  ? 26   ALA E O   1 
ATOM   9347  C  CB  . ALA E  5  26  ? 56.443  288.158 244.815 1.00 34.55  ? 26   ALA E CB  1 
ATOM   9348  N  N   . TRP E  5  27  ? 58.868  288.542 242.790 1.00 34.56  ? 27   TRP E N   1 
ATOM   9349  C  CA  . TRP E  5  27  ? 59.563  288.994 241.584 1.00 36.28  ? 27   TRP E CA  1 
ATOM   9350  C  C   . TRP E  5  27  ? 60.095  287.839 240.737 1.00 35.99  ? 27   TRP E C   1 
ATOM   9351  O  O   . TRP E  5  27  ? 59.892  287.818 239.506 1.00 36.85  ? 27   TRP E O   1 
ATOM   9352  C  CB  . TRP E  5  27  ? 60.683  290.035 241.921 1.00 36.49  ? 27   TRP E CB  1 
ATOM   9353  C  CG  . TRP E  5  27  ? 61.249  290.739 240.619 1.00 34.33  ? 27   TRP E CG  1 
ATOM   9354  C  CD1 . TRP E  5  27  ? 60.808  291.946 240.111 1.00 37.52  ? 27   TRP E CD1 1 
ATOM   9355  C  CD2 . TRP E  5  27  ? 62.265  290.241 239.701 1.00 37.75  ? 27   TRP E CD2 1 
ATOM   9356  N  NE1 . TRP E  5  27  ? 61.553  292.264 238.928 1.00 38.69  ? 27   TRP E NE1 1 
ATOM   9357  C  CE2 . TRP E  5  27  ? 62.419  291.231 238.651 1.00 36.86  ? 27   TRP E CE2 1 
ATOM   9358  C  CE3 . TRP E  5  27  ? 63.115  289.102 239.682 1.00 35.31  ? 27   TRP E CE3 1 
ATOM   9359  C  CZ2 . TRP E  5  27  ? 63.325  291.078 237.595 1.00 35.19  ? 27   TRP E CZ2 1 
ATOM   9360  C  CZ3 . TRP E  5  27  ? 64.052  288.952 238.592 1.00 36.51  ? 27   TRP E CZ3 1 
ATOM   9361  C  CH2 . TRP E  5  27  ? 64.124  289.959 237.562 1.00 38.60  ? 27   TRP E CH2 1 
ATOM   9362  N  N   . GLU E  5  28  ? 60.833  286.909 241.359 1.00 34.33  ? 28   GLU E N   1 
ATOM   9363  C  CA  . GLU E  5  28  ? 61.397  285.743 240.619 1.00 34.27  ? 28   GLU E CA  1 
ATOM   9364  C  C   . GLU E  5  28  ? 60.348  284.836 240.103 1.00 34.77  ? 28   GLU E C   1 
ATOM   9365  O  O   . GLU E  5  28  ? 60.489  284.221 239.007 1.00 34.89  ? 28   GLU E O   1 
ATOM   9366  C  CB  . GLU E  5  28  ? 62.407  284.976 241.487 1.00 35.62  ? 28   GLU E CB  1 
ATOM   9367  C  CG  . GLU E  5  28  ? 63.670  285.819 241.702 1.00 36.25  ? 28   GLU E CG  1 
ATOM   9368  C  CD  . GLU E  5  28  ? 64.538  285.424 242.942 1.00 41.83  ? 28   GLU E CD  1 
ATOM   9369  O  OE1 . GLU E  5  28  ? 65.784  285.692 242.928 1.00 38.45  ? 28   GLU E OE1 1 
ATOM   9370  O  OE2 . GLU E  5  28  ? 63.991  284.818 243.885 1.00 37.34  ? 28   GLU E OE2 1 
ATOM   9371  N  N   . LEU E  5  29  ? 59.286  284.676 240.885 1.00 32.99  ? 29   LEU E N   1 
ATOM   9372  C  CA  . LEU E  5  29  ? 58.230  283.798 240.411 1.00 33.08  ? 29   LEU E CA  1 
ATOM   9373  C  C   . LEU E  5  29  ? 57.698  284.432 239.060 1.00 32.18  ? 29   LEU E C   1 
ATOM   9374  O  O   . LEU E  5  29  ? 57.484  283.781 238.112 1.00 29.59  ? 29   LEU E O   1 
ATOM   9375  C  CB  . LEU E  5  29  ? 57.157  283.707 241.498 1.00 32.60  ? 29   LEU E CB  1 
ATOM   9376  C  CG  . LEU E  5  29  ? 55.861  283.051 241.041 1.00 34.64  ? 29   LEU E CG  1 
ATOM   9377  C  CD1 . LEU E  5  29  ? 56.029  281.582 240.801 1.00 33.86  ? 29   LEU E CD1 1 
ATOM   9378  C  CD2 . LEU E  5  29  ? 54.619  283.422 241.972 1.00 36.11  ? 29   LEU E CD2 1 
ATOM   9379  N  N   . ARG E  5  30  ? 57.383  285.712 239.069 1.00 33.48  ? 30   ARG E N   1 
ATOM   9380  C  CA  . ARG E  5  30  ? 56.797  286.379 237.882 1.00 34.64  ? 30   ARG E CA  1 
ATOM   9381  C  C   . ARG E  5  30  ? 57.780  286.383 236.693 1.00 35.17  ? 30   ARG E C   1 
ATOM   9382  O  O   . ARG E  5  30  ? 57.363  286.078 235.565 1.00 36.55  ? 30   ARG E O   1 
ATOM   9383  C  CB  . ARG E  5  30  ? 56.443  287.838 238.275 1.00 36.41  ? 30   ARG E CB  1 
ATOM   9384  C  CG  . ARG E  5  30  ? 55.315  287.857 239.322 1.00 34.04  ? 30   ARG E CG  1 
ATOM   9385  C  CD  . ARG E  5  30  ? 54.630  289.273 239.406 1.00 33.96  ? 30   ARG E CD  1 
ATOM   9386  N  NE  . ARG E  5  30  ? 55.615  290.387 239.546 1.00 32.49  ? 30   ARG E NE  1 
ATOM   9387  C  CZ  . ARG E  5  30  ? 56.110  290.817 240.709 1.00 34.68  ? 30   ARG E CZ  1 
ATOM   9388  N  NH1 . ARG E  5  30  ? 55.782  290.183 241.881 1.00 36.47  ? 30   ARG E NH1 1 
ATOM   9389  N  NH2 . ARG E  5  30  ? 57.000  291.814 240.715 1.00 31.65  ? 30   ARG E NH2 1 
ATOM   9390  N  N   . LYS E  5  31  ? 59.043  286.788 236.955 1.00 34.42  ? 31   LYS E N   1 
ATOM   9391  C  CA  . LYS E  5  31  ? 60.112  286.794 235.934 1.00 33.31  ? 31   LYS E CA  1 
ATOM   9392  C  C   . LYS E  5  31  ? 60.213  285.429 235.346 1.00 33.27  ? 31   LYS E C   1 
ATOM   9393  O  O   . LYS E  5  31  ? 60.290  285.282 234.120 1.00 32.23  ? 31   LYS E O   1 
ATOM   9394  C  CB  . LYS E  5  31  ? 61.480  287.111 236.586 1.00 34.37  ? 31   LYS E CB  1 
ATOM   9395  C  CG  . LYS E  5  31  ? 62.688  287.130 235.576 1.00 38.92  ? 31   LYS E CG  1 
ATOM   9396  C  CD  . LYS E  5  31  ? 62.560  288.290 234.545 1.00 38.69  ? 31   LYS E CD  1 
ATOM   9397  C  CE  . LYS E  5  31  ? 63.777  288.328 233.611 1.00 49.91  ? 31   LYS E CE  1 
ATOM   9398  N  NZ  . LYS E  5  31  ? 63.968  287.068 232.842 1.00 48.97  ? 31   LYS E NZ  1 
ATOM   9399  N  N   . GLY E  5  32  ? 60.178  284.367 236.172 1.00 32.55  ? 32   GLY E N   1 
ATOM   9400  C  CA  . GLY E  5  32  ? 60.388  283.044 235.581 1.00 32.05  ? 32   GLY E CA  1 
ATOM   9401  C  C   . GLY E  5  32  ? 59.180  282.659 234.708 1.00 33.21  ? 32   GLY E C   1 
ATOM   9402  O  O   . GLY E  5  32  ? 59.328  282.147 233.575 1.00 33.89  ? 32   GLY E O   1 
ATOM   9403  N  N   . MET E  5  33  ? 57.943  282.879 235.194 1.00 32.44  ? 33   MET E N   1 
ATOM   9404  C  CA  . MET E  5  33  ? 56.789  282.483 234.359 1.00 31.97  ? 33   MET E CA  1 
ATOM   9405  C  C   . MET E  5  33  ? 56.669  283.325 233.055 1.00 32.42  ? 33   MET E C   1 
ATOM   9406  O  O   . MET E  5  33  ? 56.267  282.820 231.991 1.00 32.28  ? 33   MET E O   1 
ATOM   9407  C  CB  . MET E  5  33  ? 55.452  282.564 235.154 1.00 33.06  ? 33   MET E CB  1 
ATOM   9408  C  CG  . MET E  5  33  ? 55.283  281.340 236.176 1.00 35.07  ? 33   MET E CG  1 
ATOM   9409  S  SD  . MET E  5  33  ? 55.330  279.759 235.288 1.00 39.63  ? 33   MET E SD  1 
ATOM   9410  C  CE  . MET E  5  33  ? 54.083  280.011 233.951 1.00 36.90  ? 33   MET E CE  1 
ATOM   9411  N  N   . ASN E  5  34  ? 56.935  284.609 233.202 1.00 32.14  ? 34   ASN E N   1 
ATOM   9412  C  CA  . ASN E  5  34  ? 56.774  285.557 232.079 1.00 33.31  ? 34   ASN E CA  1 
ATOM   9413  C  C   . ASN E  5  34  ? 57.901  285.277 231.067 1.00 34.06  ? 34   ASN E C   1 
ATOM   9414  O  O   . ASN E  5  34  ? 57.688  285.479 229.928 1.00 34.58  ? 34   ASN E O   1 
ATOM   9415  C  CB  . ASN E  5  34  ? 56.860  287.024 232.560 1.00 30.02  ? 34   ASN E CB  1 
ATOM   9416  C  CG  . ASN E  5  34  ? 55.642  287.477 233.378 1.00 30.84  ? 34   ASN E CG  1 
ATOM   9417  O  OD1 . ASN E  5  34  ? 54.550  287.035 233.155 1.00 32.60  ? 34   ASN E OD1 1 
ATOM   9418  N  ND2 . ASN E  5  34  ? 55.844  288.461 234.266 1.00 33.24  ? 34   ASN E ND2 1 
ATOM   9419  N  N   . THR E  5  35  ? 59.110  284.852 231.489 1.00 35.56  ? 35   THR E N   1 
ATOM   9420  C  CA  . THR E  5  35  ? 60.169  284.451 230.543 1.00 34.53  ? 35   THR E CA  1 
ATOM   9421  C  C   . THR E  5  35  ? 59.875  283.112 229.892 1.00 35.49  ? 35   THR E C   1 
ATOM   9422  O  O   . THR E  5  35  ? 60.039  282.873 228.659 1.00 35.32  ? 35   THR E O   1 
ATOM   9423  C  CB  . THR E  5  35  ? 61.482  284.274 231.261 1.00 33.92  ? 35   THR E CB  1 
ATOM   9424  O  OG1 . THR E  5  35  ? 61.808  285.496 231.884 1.00 34.67  ? 35   THR E OG1 1 
ATOM   9425  C  CG2 . THR E  5  35  ? 62.605  283.908 230.272 1.00 39.08  ? 35   THR E CG2 1 
ATOM   9426  N  N   . LEU E  5  36  ? 59.466  282.159 230.724 1.00 34.41  ? 36   LEU E N   1 
ATOM   9427  C  CA  . LEU E  5  36  ? 59.175  280.839 230.229 1.00 33.55  ? 36   LEU E CA  1 
ATOM   9428  C  C   . LEU E  5  36  ? 58.082  280.809 229.126 1.00 33.77  ? 36   LEU E C   1 
ATOM   9429  O  O   . LEU E  5  36  ? 58.129  279.991 228.241 1.00 33.54  ? 36   LEU E O   1 
ATOM   9430  C  CB  . LEU E  5  36  ? 58.805  279.956 231.447 1.00 36.61  ? 36   LEU E CB  1 
ATOM   9431  C  CG  . LEU E  5  36  ? 58.394  278.490 231.246 1.00 35.94  ? 36   LEU E CG  1 
ATOM   9432  C  CD1 . LEU E  5  36  ? 59.577  277.627 230.651 1.00 35.83  ? 36   LEU E CD1 1 
ATOM   9433  C  CD2 . LEU E  5  36  ? 57.823  277.920 232.542 1.00 36.59  ? 36   LEU E CD2 1 
ATOM   9434  N  N   . VAL E  5  37  ? 57.041  281.623 229.211 1.00 33.92  ? 37   VAL E N   1 
ATOM   9435  C  CA  . VAL E  5  37  ? 55.947  281.473 228.240 1.00 34.89  ? 37   VAL E CA  1 
ATOM   9436  C  C   . VAL E  5  37  ? 56.389  282.145 226.911 1.00 35.95  ? 37   VAL E C   1 
ATOM   9437  O  O   . VAL E  5  37  ? 55.704  282.004 225.886 1.00 36.69  ? 37   VAL E O   1 
ATOM   9438  C  CB  . VAL E  5  37  ? 54.593  282.068 228.713 1.00 35.48  ? 37   VAL E CB  1 
ATOM   9439  C  CG1 . VAL E  5  37  ? 54.108  281.334 230.014 1.00 39.14  ? 37   VAL E CG1 1 
ATOM   9440  C  CG2 . VAL E  5  37  ? 54.762  283.579 228.919 1.00 36.88  ? 37   VAL E CG2 1 
ATOM   9441  N  N   . GLY E  5  38  ? 57.588  282.730 226.895 1.00 36.58  ? 38   GLY E N   1 
ATOM   9442  C  CA  . GLY E  5  38  ? 58.153  283.199 225.606 1.00 38.34  ? 38   GLY E CA  1 
ATOM   9443  C  C   . GLY E  5  38  ? 58.666  282.145 224.660 1.00 39.89  ? 38   GLY E C   1 
ATOM   9444  O  O   . GLY E  5  38  ? 58.932  282.445 223.451 1.00 38.15  ? 38   GLY E O   1 
ATOM   9445  N  N   . TYR E  5  39  ? 58.853  280.904 225.164 1.00 39.09  ? 39   TYR E N   1 
ATOM   9446  C  CA  . TYR E  5  39  ? 59.495  279.815 224.366 1.00 36.83  ? 39   TYR E CA  1 
ATOM   9447  C  C   . TYR E  5  39  ? 58.471  279.095 223.592 1.00 37.64  ? 39   TYR E C   1 
ATOM   9448  O  O   . TYR E  5  39  ? 57.317  279.112 223.966 1.00 33.88  ? 39   TYR E O   1 
ATOM   9449  C  CB  . TYR E  5  39  ? 60.163  278.735 225.240 1.00 40.44  ? 39   TYR E CB  1 
ATOM   9450  C  CG  . TYR E  5  39  ? 61.262  279.255 226.008 1.00 44.58  ? 39   TYR E CG  1 
ATOM   9451  C  CD1 . TYR E  5  39  ? 62.494  279.511 225.408 1.00 56.15  ? 39   TYR E CD1 1 
ATOM   9452  C  CD2 . TYR E  5  39  ? 61.082  279.583 227.315 1.00 51.11  ? 39   TYR E CD2 1 
ATOM   9453  C  CE1 . TYR E  5  39  ? 63.536  280.073 226.157 1.00 61.43  ? 39   TYR E CE1 1 
ATOM   9454  C  CE2 . TYR E  5  39  ? 62.086  280.128 228.067 1.00 54.91  ? 39   TYR E CE2 1 
ATOM   9455  C  CZ  . TYR E  5  39  ? 63.286  280.393 227.513 1.00 59.35  ? 39   TYR E CZ  1 
ATOM   9456  O  OH  . TYR E  5  39  ? 64.220  280.956 228.359 1.00 59.70  ? 39   TYR E OH  1 
ATOM   9457  N  N   . ASP E  5  40  ? 58.935  278.389 222.543 1.00 35.38  ? 40   ASP E N   1 
ATOM   9458  C  CA  . ASP E  5  40  ? 58.086  277.604 221.735 1.00 37.96  ? 40   ASP E CA  1 
ATOM   9459  C  C   . ASP E  5  40  ? 57.943  276.200 222.393 1.00 38.41  ? 40   ASP E C   1 
ATOM   9460  O  O   . ASP E  5  40  ? 58.476  275.192 221.898 1.00 38.13  ? 40   ASP E O   1 
ATOM   9461  C  CB  . ASP E  5  40  ? 58.681  277.447 220.335 1.00 34.95  ? 40   ASP E CB  1 
ATOM   9462  C  CG  . ASP E  5  40  ? 57.800  276.621 219.400 1.00 37.66  ? 40   ASP E CG  1 
ATOM   9463  O  OD1 . ASP E  5  40  ? 58.364  276.224 218.373 1.00 42.67  ? 40   ASP E OD1 1 
ATOM   9464  O  OD2 . ASP E  5  40  ? 56.553  276.443 219.566 1.00 40.33  ? 40   ASP E OD2 1 
ATOM   9465  N  N   . LEU E  5  41  ? 57.094  276.152 223.423 1.00 38.83  ? 41   LEU E N   1 
ATOM   9466  C  CA  . LEU E  5  41  ? 56.748  274.925 224.108 1.00 37.75  ? 41   LEU E CA  1 
ATOM   9467  C  C   . LEU E  5  41  ? 55.703  275.248 225.149 1.00 37.83  ? 41   LEU E C   1 
ATOM   9468  O  O   . LEU E  5  41  ? 55.605  276.405 225.657 1.00 37.16  ? 41   LEU E O   1 
ATOM   9469  C  CB  . LEU E  5  41  ? 58.013  274.369 224.828 1.00 38.59  ? 41   LEU E CB  1 
ATOM   9470  C  CG  . LEU E  5  41  ? 58.790  275.284 225.755 1.00 39.26  ? 41   LEU E CG  1 
ATOM   9471  C  CD1 . LEU E  5  41  ? 58.352  275.143 227.236 1.00 33.50  ? 41   LEU E CD1 1 
ATOM   9472  C  CD2 . LEU E  5  41  ? 60.323  274.936 225.621 1.00 42.46  ? 41   LEU E CD2 1 
ATOM   9473  N  N   . VAL E  5  42  ? 54.939  274.228 225.495 1.00 35.91  ? 42   VAL E N   1 
ATOM   9474  C  CA  . VAL E  5  42  ? 54.126  274.214 226.725 1.00 35.15  ? 42   VAL E CA  1 
ATOM   9475  C  C   . VAL E  5  42  ? 54.979  273.522 227.854 1.00 36.09  ? 42   VAL E C   1 
ATOM   9476  O  O   . VAL E  5  42  ? 55.480  272.444 227.619 1.00 36.17  ? 42   VAL E O   1 
ATOM   9477  C  CB  . VAL E  5  42  ? 52.833  273.484 226.470 1.00 33.82  ? 42   VAL E CB  1 
ATOM   9478  C  CG1 . VAL E  5  42  ? 51.920  273.503 227.744 1.00 34.15  ? 42   VAL E CG1 1 
ATOM   9479  C  CG2 . VAL E  5  42  ? 52.153  274.076 225.225 1.00 35.18  ? 42   VAL E CG2 1 
ATOM   9480  N  N   . PRO E  5  43  ? 55.164  274.172 229.025 1.00 35.00  ? 43   PRO E N   1 
ATOM   9481  C  CA  . PRO E  5  43  ? 56.089  273.623 230.012 1.00 35.90  ? 43   PRO E CA  1 
ATOM   9482  C  C   . PRO E  5  43  ? 55.645  272.213 230.478 1.00 35.62  ? 43   PRO E C   1 
ATOM   9483  O  O   . PRO E  5  43  ? 54.424  271.918 230.607 1.00 33.40  ? 43   PRO E O   1 
ATOM   9484  C  CB  . PRO E  5  43  ? 56.061  274.684 231.143 1.00 34.41  ? 43   PRO E CB  1 
ATOM   9485  C  CG  . PRO E  5  43  ? 55.606  275.974 230.380 1.00 36.28  ? 43   PRO E CG  1 
ATOM   9486  C  CD  . PRO E  5  43  ? 54.524  275.408 229.539 1.00 34.91  ? 43   PRO E CD  1 
ATOM   9487  N  N   . GLU E  5  44  ? 56.602  271.305 230.506 1.00 36.72  ? 44   GLU E N   1 
ATOM   9488  C  CA  . GLU E  5  44  ? 56.374  269.986 231.174 1.00 39.00  ? 44   GLU E CA  1 
ATOM   9489  C  C   . GLU E  5  44  ? 55.650  270.090 232.491 1.00 38.27  ? 44   GLU E C   1 
ATOM   9490  O  O   . GLU E  5  44  ? 55.928  270.991 233.291 1.00 38.55  ? 44   GLU E O   1 
ATOM   9491  C  CB  . GLU E  5  44  ? 57.719  269.318 231.434 1.00 39.99  ? 44   GLU E CB  1 
ATOM   9492  C  CG  . GLU E  5  44  ? 58.380  268.685 230.153 1.00 43.64  ? 44   GLU E CG  1 
ATOM   9493  C  CD  . GLU E  5  44  ? 57.901  267.263 229.921 1.00 47.76  ? 44   GLU E CD  1 
ATOM   9494  O  OE1 . GLU E  5  44  ? 57.989  266.807 228.765 1.00 48.90  ? 44   GLU E OE1 1 
ATOM   9495  O  OE2 . GLU E  5  44  ? 57.392  266.597 230.875 1.00 50.95  ? 44   GLU E OE2 1 
ATOM   9496  N  N   . PRO E  5  45  ? 54.794  269.115 232.794 1.00 38.62  ? 45   PRO E N   1 
ATOM   9497  C  CA  . PRO E  5  45  ? 54.209  269.078 234.194 1.00 38.32  ? 45   PRO E CA  1 
ATOM   9498  C  C   . PRO E  5  45  ? 55.175  269.247 235.362 1.00 38.20  ? 45   PRO E C   1 
ATOM   9499  O  O   . PRO E  5  45  ? 54.806  269.899 236.344 1.00 38.42  ? 45   PRO E O   1 
ATOM   9500  C  CB  . PRO E  5  45  ? 53.534  267.707 234.268 1.00 37.80  ? 45   PRO E CB  1 
ATOM   9501  C  CG  . PRO E  5  45  ? 53.060  267.512 232.722 1.00 35.66  ? 45   PRO E CG  1 
ATOM   9502  C  CD  . PRO E  5  45  ? 54.330  267.952 231.974 1.00 39.35  ? 45   PRO E CD  1 
ATOM   9503  N  N   . LYS E  5  46  ? 56.409  268.762 235.275 1.00 37.66  ? 46   LYS E N   1 
ATOM   9504  C  CA  . LYS E  5  46  ? 57.285  268.918 236.426 1.00 39.22  ? 46   LYS E CA  1 
ATOM   9505  C  C   . LYS E  5  46  ? 57.736  270.368 236.602 1.00 36.43  ? 46   LYS E C   1 
ATOM   9506  O  O   . LYS E  5  46  ? 58.117  270.792 237.706 1.00 34.45  ? 46   LYS E O   1 
ATOM   9507  C  CB  . LYS E  5  46  ? 58.508  267.975 236.348 1.00 41.22  ? 46   LYS E CB  1 
ATOM   9508  C  CG  . LYS E  5  46  ? 59.359  268.181 235.093 1.00 47.51  ? 46   LYS E CG  1 
ATOM   9509  C  CD  . LYS E  5  46  ? 60.522  267.125 234.940 1.00 55.66  ? 46   LYS E CD  1 
ATOM   9510  C  CE  . LYS E  5  46  ? 60.810  266.977 233.420 1.00 64.04  ? 46   LYS E CE  1 
ATOM   9511  N  NZ  . LYS E  5  46  ? 61.946  266.043 233.008 1.00 69.08  ? 46   LYS E NZ  1 
ATOM   9512  N  N   . ILE E  5  47  ? 57.721  271.161 235.524 1.00 36.06  ? 47   ILE E N   1 
ATOM   9513  C  CA  . ILE E  5  47  ? 58.103  272.540 235.691 1.00 33.68  ? 47   ILE E CA  1 
ATOM   9514  C  C   . ILE E  5  47  ? 56.932  273.260 236.363 1.00 33.34  ? 47   ILE E C   1 
ATOM   9515  O  O   . ILE E  5  47  ? 57.149  274.009 237.324 1.00 34.00  ? 47   ILE E O   1 
ATOM   9516  C  CB  . ILE E  5  47  ? 58.453  273.253 234.298 1.00 36.42  ? 47   ILE E CB  1 
ATOM   9517  C  CG1 . ILE E  5  47  ? 59.663  272.557 233.640 1.00 36.39  ? 47   ILE E CG1 1 
ATOM   9518  C  CG2 . ILE E  5  47  ? 58.654  274.759 234.541 1.00 33.78  ? 47   ILE E CG2 1 
ATOM   9519  C  CD1 . ILE E  5  47  ? 60.077  273.024 232.280 1.00 38.27  ? 47   ILE E CD1 1 
ATOM   9520  N  N   . ILE E  5  48  ? 55.692  273.030 235.889 1.00 33.60  ? 48   ILE E N   1 
ATOM   9521  C  CA  . ILE E  5  48  ? 54.526  273.680 236.420 1.00 33.45  ? 48   ILE E CA  1 
ATOM   9522  C  C   . ILE E  5  48  ? 54.317  273.307 237.913 1.00 36.68  ? 48   ILE E C   1 
ATOM   9523  O  O   . ILE E  5  48  ? 53.906  274.143 238.803 1.00 37.20  ? 48   ILE E O   1 
ATOM   9524  C  CB  . ILE E  5  48  ? 53.275  273.223 235.625 1.00 33.42  ? 48   ILE E CB  1 
ATOM   9525  C  CG1 . ILE E  5  48  ? 53.327  273.631 234.101 1.00 35.57  ? 48   ILE E CG1 1 
ATOM   9526  C  CG2 . ILE E  5  48  ? 51.925  273.796 236.195 1.00 31.67  ? 48   ILE E CG2 1 
ATOM   9527  C  CD1 . ILE E  5  48  ? 53.749  275.180 233.891 1.00 41.99  ? 48   ILE E CD1 1 
ATOM   9528  N  N   . ASP E  5  49  ? 54.498  272.025 238.191 1.00 35.85  ? 49   ASP E N   1 
ATOM   9529  C  CA  . ASP E  5  49  ? 54.455  271.531 239.598 1.00 35.40  ? 49   ASP E CA  1 
ATOM   9530  C  C   . ASP E  5  49  ? 55.430  272.326 240.493 1.00 33.93  ? 49   ASP E C   1 
ATOM   9531  O  O   . ASP E  5  49  ? 54.966  272.937 241.477 1.00 34.62  ? 49   ASP E O   1 
ATOM   9532  C  CB  . ASP E  5  49  ? 54.722  270.018 239.598 1.00 35.70  ? 49   ASP E CB  1 
ATOM   9533  C  CG  . ASP E  5  49  ? 54.912  269.435 241.085 1.00 42.14  ? 49   ASP E CG  1 
ATOM   9534  O  OD1 . ASP E  5  49  ? 55.993  268.955 241.431 1.00 47.71  ? 49   ASP E OD1 1 
ATOM   9535  O  OD2 . ASP E  5  49  ? 54.000  269.587 241.882 1.00 41.89  ? 49   ASP E OD2 1 
ATOM   9536  N  N   . ALA E  5  50  ? 56.735  272.438 240.158 1.00 34.65  ? 50   ALA E N   1 
ATOM   9537  C  CA  . ALA E  5  50  ? 57.634  273.373 240.897 1.00 32.88  ? 50   ALA E CA  1 
ATOM   9538  C  C   . ALA E  5  50  ? 57.116  274.852 241.011 1.00 34.93  ? 50   ALA E C   1 
ATOM   9539  O  O   . ALA E  5  50  ? 57.266  275.514 242.048 1.00 36.17  ? 50   ALA E O   1 
ATOM   9540  C  CB  . ALA E  5  50  ? 58.985  273.425 240.208 1.00 33.14  ? 50   ALA E CB  1 
ATOM   9541  N  N   . ALA E  5  51  ? 56.605  275.417 239.898 1.00 34.03  ? 51   ALA E N   1 
ATOM   9542  C  CA  . ALA E  5  51  ? 56.042  276.801 239.949 1.00 33.13  ? 51   ALA E CA  1 
ATOM   9543  C  C   . ALA E  5  51  ? 54.874  276.849 240.888 1.00 33.70  ? 51   ALA E C   1 
ATOM   9544  O  O   . ALA E  5  51  ? 54.718  277.836 241.643 1.00 34.85  ? 51   ALA E O   1 
ATOM   9545  C  CB  . ALA E  5  51  ? 55.582  277.273 238.533 1.00 30.32  ? 51   ALA E CB  1 
ATOM   9546  N  N   . LEU E  5  52  ? 53.965  275.880 240.784 1.00 31.85  ? 52   LEU E N   1 
ATOM   9547  C  CA  . LEU E  5  52  ? 52.838  275.903 241.713 1.00 34.98  ? 52   LEU E CA  1 
ATOM   9548  C  C   . LEU E  5  52  ? 53.248  275.859 243.216 1.00 34.89  ? 52   LEU E C   1 
ATOM   9549  O  O   . LEU E  5  52  ? 52.613  276.495 244.089 1.00 34.25  ? 52   LEU E O   1 
ATOM   9550  C  CB  . LEU E  5  52  ? 51.865  274.792 241.412 1.00 35.07  ? 52   LEU E CB  1 
ATOM   9551  C  CG  . LEU E  5  52  ? 51.248  274.727 240.011 1.00 36.63  ? 52   LEU E CG  1 
ATOM   9552  C  CD1 . LEU E  5  52  ? 50.264  273.526 240.016 1.00 36.72  ? 52   LEU E CD1 1 
ATOM   9553  C  CD2 . LEU E  5  52  ? 50.479  275.985 239.745 1.00 34.67  ? 52   LEU E CD2 1 
ATOM   9554  N  N   . ARG E  5  53  ? 54.299  275.107 243.510 1.00 36.28  ? 53   ARG E N   1 
ATOM   9555  C  CA  . ARG E  5  53  ? 54.726  274.944 244.941 1.00 36.22  ? 53   ARG E CA  1 
ATOM   9556  C  C   . ARG E  5  53  ? 55.382  276.216 245.390 1.00 35.95  ? 53   ARG E C   1 
ATOM   9557  O  O   . ARG E  5  53  ? 55.280  276.612 246.564 1.00 35.24  ? 53   ARG E O   1 
ATOM   9558  C  CB  . ARG E  5  53  ? 55.629  273.711 245.113 1.00 37.56  ? 53   ARG E CB  1 
ATOM   9559  C  CG  . ARG E  5  53  ? 54.753  272.432 244.815 1.00 36.10  ? 53   ARG E CG  1 
ATOM   9560  C  CD  . ARG E  5  53  ? 55.596  271.165 244.893 1.00 39.00  ? 53   ARG E CD  1 
ATOM   9561  N  NE  . ARG E  5  53  ? 54.700  270.044 244.736 1.00 39.52  ? 53   ARG E NE  1 
ATOM   9562  C  CZ  . ARG E  5  53  ? 54.090  269.423 245.753 1.00 41.29  ? 53   ARG E CZ  1 
ATOM   9563  N  NH1 . ARG E  5  53  ? 54.291  269.850 247.014 1.00 39.22  ? 53   ARG E NH1 1 
ATOM   9564  N  NH2 . ARG E  5  53  ? 53.260  268.414 245.499 1.00 39.77  ? 53   ARG E NH2 1 
ATOM   9565  N  N   . ALA E  5  54  ? 55.998  276.907 244.398 1.00 35.73  ? 54   ALA E N   1 
ATOM   9566  C  CA  . ALA E  5  54  ? 56.577  278.244 244.678 1.00 34.40  ? 54   ALA E CA  1 
ATOM   9567  C  C   . ALA E  5  54  ? 55.397  279.186 244.978 1.00 34.31  ? 54   ALA E C   1 
ATOM   9568  O  O   . ALA E  5  54  ? 55.472  279.978 245.917 1.00 35.18  ? 54   ALA E O   1 
ATOM   9569  C  CB  . ALA E  5  54  ? 57.472  278.733 243.476 1.00 32.59  ? 54   ALA E CB  1 
ATOM   9570  N  N   . CYS E  5  55  ? 54.283  279.066 244.237 1.00 35.06  ? 55   CYS E N   1 
ATOM   9571  C  CA  . CYS E  5  55  ? 53.077  279.893 244.609 1.00 35.44  ? 55   CYS E CA  1 
ATOM   9572  C  C   . CYS E  5  55  ? 52.664  279.689 246.110 1.00 36.80  ? 55   CYS E C   1 
ATOM   9573  O  O   . CYS E  5  55  ? 52.309  280.641 246.854 1.00 36.52  ? 55   CYS E O   1 
ATOM   9574  C  CB  . CYS E  5  55  ? 51.858  279.579 243.740 1.00 32.68  ? 55   CYS E CB  1 
ATOM   9575  S  SG  . CYS E  5  55  ? 52.158  280.256 241.990 1.00 35.37  ? 55   CYS E SG  1 
ATOM   9576  N  N   . ARG E  5  56  ? 52.592  278.405 246.484 1.00 37.46  ? 56   ARG E N   1 
ATOM   9577  C  CA  . ARG E  5  56  ? 52.334  278.001 247.919 1.00 36.44  ? 56   ARG E CA  1 
ATOM   9578  C  C   . ARG E  5  56  ? 53.283  278.679 248.905 1.00 36.53  ? 56   ARG E C   1 
ATOM   9579  O  O   . ARG E  5  56  ? 52.832  279.310 249.843 1.00 37.66  ? 56   ARG E O   1 
ATOM   9580  C  CB  . ARG E  5  56  ? 52.436  276.475 248.065 1.00 34.89  ? 56   ARG E CB  1 
ATOM   9581  C  CG  . ARG E  5  56  ? 52.073  275.954 249.562 1.00 33.85  ? 56   ARG E CG  1 
ATOM   9582  C  CD  . ARG E  5  56  ? 50.608  276.279 250.001 1.00 28.09  ? 56   ARG E CD  1 
ATOM   9583  N  NE  . ARG E  5  56  ? 50.638  277.653 250.633 1.00 34.56  ? 56   ARG E NE  1 
ATOM   9584  C  CZ  . ARG E  5  56  ? 49.567  278.234 251.177 1.00 33.61  ? 56   ARG E CZ  1 
ATOM   9585  N  NH1 . ARG E  5  56  ? 48.411  277.584 251.140 1.00 31.55  ? 56   ARG E NH1 1 
ATOM   9586  N  NH2 . ARG E  5  56  ? 49.623  279.478 251.746 1.00 36.84  ? 56   ARG E NH2 1 
ATOM   9587  N  N   . ARG E  5  57  ? 54.589  278.552 248.706 1.00 38.16  ? 57   ARG E N   1 
ATOM   9588  C  CA  . ARG E  5  57  ? 55.558  279.186 249.604 1.00 37.92  ? 57   ARG E CA  1 
ATOM   9589  C  C   . ARG E  5  57  ? 55.395  280.697 249.648 1.00 39.25  ? 57   ARG E C   1 
ATOM   9590  O  O   . ARG E  5  57  ? 55.743  281.344 250.648 1.00 38.50  ? 57   ARG E O   1 
ATOM   9591  C  CB  . ARG E  5  57  ? 56.954  278.797 249.182 1.00 39.29  ? 57   ARG E CB  1 
ATOM   9592  C  CG  . ARG E  5  57  ? 57.172  277.288 249.279 1.00 38.43  ? 57   ARG E CG  1 
ATOM   9593  C  CD  . ARG E  5  57  ? 58.666  276.939 249.315 1.00 41.13  ? 57   ARG E CD  1 
ATOM   9594  N  NE  . ARG E  5  57  ? 59.435  277.329 248.117 1.00 42.35  ? 57   ARG E NE  1 
ATOM   9595  C  CZ  . ARG E  5  57  ? 59.314  276.768 246.911 1.00 41.97  ? 57   ARG E CZ  1 
ATOM   9596  N  NH1 . ARG E  5  57  ? 58.437  275.815 246.704 1.00 40.39  ? 57   ARG E NH1 1 
ATOM   9597  N  NH2 . ARG E  5  57  ? 60.078  277.157 245.885 1.00 39.59  ? 57   ARG E NH2 1 
ATOM   9598  N  N   . LEU E  5  58  ? 54.879  281.300 248.536 1.00 39.21  ? 58   LEU E N   1 
ATOM   9599  C  CA  . LEU E  5  58  ? 54.672  282.770 248.500 1.00 36.42  ? 58   LEU E CA  1 
ATOM   9600  C  C   . LEU E  5  58  ? 53.214  283.078 248.873 1.00 36.89  ? 58   LEU E C   1 
ATOM   9601  O  O   . LEU E  5  58  ? 52.753  284.214 248.730 1.00 34.63  ? 58   LEU E O   1 
ATOM   9602  C  CB  . LEU E  5  58  ? 55.053  283.325 247.076 1.00 36.71  ? 58   LEU E CB  1 
ATOM   9603  C  CG  . LEU E  5  58  ? 56.530  283.232 246.698 1.00 32.02  ? 58   LEU E CG  1 
ATOM   9604  C  CD1 . LEU E  5  58  ? 56.753  283.375 245.167 1.00 33.55  ? 58   LEU E CD1 1 
ATOM   9605  C  CD2 . LEU E  5  58  ? 57.265  284.305 247.404 1.00 36.90  ? 58   LEU E CD2 1 
ATOM   9606  N  N   . ASN E  5  59  ? 52.446  282.070 249.335 1.00 37.59  ? 59   ASN E N   1 
ATOM   9607  C  CA  . ASN E  5  59  ? 51.068  282.343 249.787 1.00 36.83  ? 59   ASN E CA  1 
ATOM   9608  C  C   . ASN E  5  59  ? 50.257  283.090 248.723 1.00 35.72  ? 59   ASN E C   1 
ATOM   9609  O  O   . ASN E  5  59  ? 49.462  284.010 249.024 1.00 37.68  ? 59   ASN E O   1 
ATOM   9610  C  CB  . ASN E  5  59  ? 51.055  283.147 251.118 1.00 35.55  ? 59   ASN E CB  1 
ATOM   9611  C  CG  . ASN E  5  59  ? 51.671  282.322 252.245 1.00 37.55  ? 59   ASN E CG  1 
ATOM   9612  O  OD1 . ASN E  5  59  ? 51.558  281.098 252.250 1.00 35.73  ? 59   ASN E OD1 1 
ATOM   9613  N  ND2 . ASN E  5  59  ? 52.415  282.957 253.065 1.00 35.22  ? 59   ASN E ND2 1 
ATOM   9614  N  N   . ASP E  5  60  ? 50.397  282.626 247.498 1.00 35.13  ? 60   ASP E N   1 
ATOM   9615  C  CA  . ASP E  5  60  ? 49.704  283.280 246.357 1.00 34.50  ? 60   ASP E CA  1 
ATOM   9616  C  C   . ASP E  5  60  ? 48.848  282.288 245.557 1.00 34.36  ? 60   ASP E C   1 
ATOM   9617  O  O   . ASP E  5  60  ? 49.306  281.651 244.582 1.00 35.47  ? 60   ASP E O   1 
ATOM   9618  C  CB  . ASP E  5  60  ? 50.749  283.973 245.496 1.00 32.31  ? 60   ASP E CB  1 
ATOM   9619  C  CG  . ASP E  5  60  ? 50.142  284.847 244.405 1.00 35.38  ? 60   ASP E CG  1 
ATOM   9620  O  OD1 . ASP E  5  60  ? 50.946  285.586 243.777 1.00 38.40  ? 60   ASP E OD1 1 
ATOM   9621  O  OD2 . ASP E  5  60  ? 48.892  284.863 244.166 1.00 31.73  ? 60   ASP E OD2 1 
ATOM   9622  N  N   . PHE E  5  61  ? 47.628  282.126 246.005 1.00 33.25  ? 61   PHE E N   1 
ATOM   9623  C  CA  . PHE E  5  61  ? 46.707  281.265 245.343 1.00 33.43  ? 61   PHE E CA  1 
ATOM   9624  C  C   . PHE E  5  61  ? 46.402  281.737 243.921 1.00 33.43  ? 61   PHE E C   1 
ATOM   9625  O  O   . PHE E  5  61  ? 46.223  280.900 243.023 1.00 31.18  ? 61   PHE E O   1 
ATOM   9626  C  CB  . PHE E  5  61  ? 45.390  281.157 246.120 1.00 32.19  ? 61   PHE E CB  1 
ATOM   9627  C  CG  . PHE E  5  61  ? 44.343  280.376 245.412 1.00 36.28  ? 61   PHE E CG  1 
ATOM   9628  C  CD1 . PHE E  5  61  ? 44.351  278.967 245.432 1.00 36.94  ? 61   PHE E CD1 1 
ATOM   9629  C  CD2 . PHE E  5  61  ? 43.338  281.015 244.692 1.00 29.70  ? 61   PHE E CD2 1 
ATOM   9630  C  CE1 . PHE E  5  61  ? 43.381  278.203 244.774 1.00 32.61  ? 61   PHE E CE1 1 
ATOM   9631  C  CE2 . PHE E  5  61  ? 42.347  280.220 243.952 1.00 35.33  ? 61   PHE E CE2 1 
ATOM   9632  C  CZ  . PHE E  5  61  ? 42.417  278.798 243.981 1.00 30.03  ? 61   PHE E CZ  1 
ATOM   9633  N  N   . ALA E  5  62  ? 46.150  283.035 243.752 1.00 33.11  ? 62   ALA E N   1 
ATOM   9634  C  CA  . ALA E  5  62  ? 45.667  283.521 242.435 1.00 33.36  ? 62   ALA E CA  1 
ATOM   9635  C  C   . ALA E  5  62  ? 46.699  283.198 241.308 1.00 33.14  ? 62   ALA E C   1 
ATOM   9636  O  O   . ALA E  5  62  ? 46.310  282.815 240.216 1.00 34.87  ? 62   ALA E O   1 
ATOM   9637  C  CB  . ALA E  5  62  ? 45.487  285.032 242.535 1.00 32.74  ? 62   ALA E CB  1 
ATOM   9638  N  N   . SER E  5  63  ? 47.999  283.427 241.582 1.00 33.74  ? 63   SER E N   1 
ATOM   9639  C  CA  . SER E  5  63  ? 49.062  283.145 240.591 1.00 33.60  ? 63   SER E CA  1 
ATOM   9640  C  C   . SER E  5  63  ? 49.088  281.651 240.183 1.00 33.85  ? 63   SER E C   1 
ATOM   9641  O  O   . SER E  5  63  ? 49.386  281.358 239.062 1.00 33.56  ? 63   SER E O   1 
ATOM   9642  C  CB  . SER E  5  63  ? 50.454  283.542 241.074 1.00 32.36  ? 63   SER E CB  1 
ATOM   9643  O  OG  . SER E  5  63  ? 50.480  284.950 241.187 1.00 37.13  ? 63   SER E OG  1 
ATOM   9644  N  N   . ALA E  5  64  ? 48.809  280.710 241.117 1.00 33.18  ? 64   ALA E N   1 
ATOM   9645  C  CA  . ALA E  5  64  ? 48.714  279.288 240.757 1.00 32.23  ? 64   ALA E CA  1 
ATOM   9646  C  C   . ALA E  5  64  ? 47.633  279.053 239.744 1.00 32.37  ? 64   ALA E C   1 
ATOM   9647  O  O   . ALA E  5  64  ? 47.834  278.338 238.758 1.00 32.91  ? 64   ALA E O   1 
ATOM   9648  C  CB  . ALA E  5  64  ? 48.486  278.384 242.079 1.00 31.30  ? 64   ALA E CB  1 
ATOM   9649  N  N   . VAL E  5  65  ? 46.461  279.657 239.934 1.00 32.04  ? 65   VAL E N   1 
ATOM   9650  C  CA  . VAL E  5  65  ? 45.419  279.504 238.951 1.00 32.90  ? 65   VAL E CA  1 
ATOM   9651  C  C   . VAL E  5  65  ? 45.856  280.147 237.583 1.00 34.88  ? 65   VAL E C   1 
ATOM   9652  O  O   . VAL E  5  65  ? 45.677  279.539 236.499 1.00 33.92  ? 65   VAL E O   1 
ATOM   9653  C  CB  . VAL E  5  65  ? 44.071  280.132 239.435 1.00 32.12  ? 65   VAL E CB  1 
ATOM   9654  C  CG1 . VAL E  5  65  ? 43.030  280.037 238.409 1.00 31.33  ? 65   VAL E CG1 1 
ATOM   9655  C  CG2 . VAL E  5  65  ? 43.577  279.467 240.827 1.00 29.74  ? 65   VAL E CG2 1 
ATOM   9656  N  N   . ARG E  5  66  ? 46.477  281.332 237.674 1.00 34.66  ? 66   ARG E N   1 
ATOM   9657  C  CA  . ARG E  5  66  ? 46.908  282.066 236.452 1.00 33.75  ? 66   ARG E CA  1 
ATOM   9658  C  C   . ARG E  5  66  ? 47.927  281.187 235.659 1.00 35.31  ? 66   ARG E C   1 
ATOM   9659  O  O   . ARG E  5  66  ? 47.872  281.098 234.397 1.00 35.90  ? 66   ARG E O   1 
ATOM   9660  C  CB  . ARG E  5  66  ? 47.553  283.354 236.846 1.00 31.72  ? 66   ARG E CB  1 
ATOM   9661  C  CG  . ARG E  5  66  ? 47.678  284.366 235.648 1.00 33.84  ? 66   ARG E CG  1 
ATOM   9662  C  CD  . ARG E  5  66  ? 46.319  284.969 235.144 1.00 33.72  ? 66   ARG E CD  1 
ATOM   9663  N  NE  . ARG E  5  66  ? 46.608  286.313 234.474 1.00 36.00  ? 66   ARG E NE  1 
ATOM   9664  C  CZ  . ARG E  5  66  ? 45.694  287.215 234.146 1.00 35.35  ? 66   ARG E CZ  1 
ATOM   9665  N  NH1 . ARG E  5  66  ? 44.374  286.969 234.341 1.00 31.85  ? 66   ARG E NH1 1 
ATOM   9666  N  NH2 . ARG E  5  66  ? 46.112  288.362 233.564 1.00 35.63  ? 66   ARG E NH2 1 
ATOM   9667  N  N   . ILE E  5  67  ? 48.810  280.503 236.415 1.00 35.14  ? 67   ILE E N   1 
ATOM   9668  C  CA  . ILE E  5  67  ? 49.786  279.571 235.815 1.00 34.22  ? 67   ILE E CA  1 
ATOM   9669  C  C   . ILE E  5  67  ? 49.031  278.483 235.072 1.00 34.49  ? 67   ILE E C   1 
ATOM   9670  O  O   . ILE E  5  67  ? 49.365  278.202 233.935 1.00 36.40  ? 67   ILE E O   1 
ATOM   9671  C  CB  . ILE E  5  67  ? 50.749  279.012 236.827 1.00 34.08  ? 67   ILE E CB  1 
ATOM   9672  C  CG1 . ILE E  5  67  ? 51.709  280.171 237.285 1.00 33.60  ? 67   ILE E CG1 1 
ATOM   9673  C  CG2 . ILE E  5  67  ? 51.497  277.770 236.165 1.00 30.73  ? 67   ILE E CG2 1 
ATOM   9674  C  CD1 . ILE E  5  67  ? 52.522  279.885 238.642 1.00 31.09  ? 67   ILE E CD1 1 
ATOM   9675  N  N   . LEU E  5  68  ? 47.956  277.934 235.647 1.00 32.70  ? 68   LEU E N   1 
ATOM   9676  C  CA  . LEU E  5  68  ? 47.215  276.912 234.882 1.00 34.32  ? 68   LEU E CA  1 
ATOM   9677  C  C   . LEU E  5  68  ? 46.607  277.480 233.577 1.00 34.61  ? 68   LEU E C   1 
ATOM   9678  O  O   . LEU E  5  68  ? 46.537  276.798 232.521 1.00 31.20  ? 68   LEU E O   1 
ATOM   9679  C  CB  . LEU E  5  68  ? 46.143  276.263 235.781 1.00 34.44  ? 68   LEU E CB  1 
ATOM   9680  C  CG  . LEU E  5  68  ? 46.694  275.547 237.039 1.00 36.52  ? 68   LEU E CG  1 
ATOM   9681  C  CD1 . LEU E  5  68  ? 45.494  274.878 237.860 1.00 33.97  ? 68   LEU E CD1 1 
ATOM   9682  C  CD2 . LEU E  5  68  ? 47.899  274.546 236.695 1.00 32.44  ? 68   LEU E CD2 1 
ATOM   9683  N  N   . GLU E  5  69  ? 46.057  278.709 233.661 1.00 34.64  ? 69   GLU E N   1 
ATOM   9684  C  CA  . GLU E  5  69  ? 45.477  279.375 232.448 1.00 32.87  ? 69   GLU E CA  1 
ATOM   9685  C  C   . GLU E  5  69  ? 46.531  279.581 231.348 1.00 32.68  ? 69   GLU E C   1 
ATOM   9686  O  O   . GLU E  5  69  ? 46.257  279.393 230.197 1.00 33.86  ? 69   GLU E O   1 
ATOM   9687  C  CB  . GLU E  5  69  ? 44.968  280.764 232.864 1.00 32.38  ? 69   GLU E CB  1 
ATOM   9688  C  CG  . GLU E  5  69  ? 43.578  280.702 233.658 1.00 27.00  ? 69   GLU E CG  1 
ATOM   9689  C  CD  . GLU E  5  69  ? 43.250  282.091 234.033 1.00 32.38  ? 69   GLU E CD  1 
ATOM   9690  O  OE1 . GLU E  5  69  ? 43.944  282.711 234.915 1.00 27.49  ? 69   GLU E OE1 1 
ATOM   9691  O  OE2 . GLU E  5  69  ? 42.356  282.627 233.375 1.00 29.98  ? 69   GLU E OE2 1 
ATOM   9692  N  N   . VAL E  5  70  ? 47.738  279.925 231.715 1.00 32.78  ? 70   VAL E N   1 
ATOM   9693  C  CA  . VAL E  5  70  ? 48.681  280.225 230.681 1.00 35.62  ? 70   VAL E CA  1 
ATOM   9694  C  C   . VAL E  5  70  ? 49.222  278.919 230.051 1.00 34.95  ? 70   VAL E C   1 
ATOM   9695  O  O   . VAL E  5  70  ? 49.487  278.856 228.852 1.00 35.12  ? 70   VAL E O   1 
ATOM   9696  C  CB  . VAL E  5  70  ? 49.829  281.207 231.133 1.00 37.24  ? 70   VAL E CB  1 
ATOM   9697  C  CG1 . VAL E  5  70  ? 50.983  280.423 231.800 1.00 35.00  ? 70   VAL E CG1 1 
ATOM   9698  C  CG2 . VAL E  5  70  ? 50.407  281.988 229.839 1.00 39.01  ? 70   VAL E CG2 1 
ATOM   9699  N  N   . VAL E  5  71  ? 49.281  277.832 230.790 1.00 34.56  ? 71   VAL E N   1 
ATOM   9700  C  CA  . VAL E  5  71  ? 49.584  276.501 230.154 1.00 31.44  ? 71   VAL E CA  1 
ATOM   9701  C  C   . VAL E  5  71  ? 48.572  276.186 229.049 1.00 31.44  ? 71   VAL E C   1 
ATOM   9702  O  O   . VAL E  5  71  ? 48.909  275.724 227.931 1.00 34.77  ? 71   VAL E O   1 
ATOM   9703  C  CB  . VAL E  5  71  ? 49.507  275.325 231.286 1.00 33.74  ? 71   VAL E CB  1 
ATOM   9704  C  CG1 . VAL E  5  71  ? 49.394  273.907 230.620 1.00 30.91  ? 71   VAL E CG1 1 
ATOM   9705  C  CG2 . VAL E  5  71  ? 50.669  275.467 232.180 1.00 30.64  ? 71   VAL E CG2 1 
ATOM   9706  N  N   . LYS E  5  72  ? 47.291  276.365 229.362 1.00 29.60  ? 72   LYS E N   1 
ATOM   9707  C  CA  . LYS E  5  72  ? 46.287  276.076 228.400 1.00 30.58  ? 72   LYS E CA  1 
ATOM   9708  C  C   . LYS E  5  72  ? 46.521  277.003 227.183 1.00 32.77  ? 72   LYS E C   1 
ATOM   9709  O  O   . LYS E  5  72  ? 46.364  276.599 225.998 1.00 32.71  ? 72   LYS E O   1 
ATOM   9710  C  CB  . LYS E  5  72  ? 44.916  276.360 229.028 1.00 28.15  ? 72   LYS E CB  1 
ATOM   9711  C  CG  . LYS E  5  72  ? 43.819  276.179 228.043 1.00 34.55  ? 72   LYS E CG  1 
ATOM   9712  C  CD  . LYS E  5  72  ? 42.444  276.266 228.699 1.00 44.49  ? 72   LYS E CD  1 
ATOM   9713  C  CE  . LYS E  5  72  ? 41.350  276.064 227.601 1.00 52.19  ? 72   LYS E CE  1 
ATOM   9714  N  NZ  . LYS E  5  72  ? 39.986  276.084 228.275 1.00 60.65  ? 72   LYS E NZ  1 
ATOM   9715  N  N   . ASP E  5  73  ? 46.889  278.259 227.476 1.00 30.86  ? 73   ASP E N   1 
ATOM   9716  C  CA  . ASP E  5  73  ? 46.982  279.251 226.358 1.00 31.59  ? 73   ASP E CA  1 
ATOM   9717  C  C   . ASP E  5  73  ? 48.172  278.931 225.483 1.00 32.54  ? 73   ASP E C   1 
ATOM   9718  O  O   . ASP E  5  73  ? 48.076  279.031 224.260 1.00 33.55  ? 73   ASP E O   1 
ATOM   9719  C  CB  . ASP E  5  73  ? 47.167  280.669 226.955 1.00 32.16  ? 73   ASP E CB  1 
ATOM   9720  C  CG  . ASP E  5  73  ? 46.870  281.804 225.893 1.00 34.80  ? 73   ASP E CG  1 
ATOM   9721  O  OD1 . ASP E  5  73  ? 45.689  282.057 225.590 1.00 31.67  ? 73   ASP E OD1 1 
ATOM   9722  O  OD2 . ASP E  5  73  ? 47.829  282.366 225.381 1.00 33.49  ? 73   ASP E OD2 1 
ATOM   9723  N  N   . LYS E  5  74  ? 49.333  278.610 226.086 1.00 32.59  ? 74   LYS E N   1 
ATOM   9724  C  CA  . LYS E  5  74  ? 50.529  278.205 225.352 1.00 33.67  ? 74   LYS E CA  1 
ATOM   9725  C  C   . LYS E  5  74  ? 50.379  277.017 224.352 1.00 33.69  ? 74   LYS E C   1 
ATOM   9726  O  O   . LYS E  5  74  ? 51.135  276.870 223.334 1.00 32.01  ? 74   LYS E O   1 
ATOM   9727  C  CB  . LYS E  5  74  ? 51.728  277.929 226.312 1.00 34.28  ? 74   LYS E CB  1 
ATOM   9728  C  CG  . LYS E  5  74  ? 52.409  279.168 226.798 1.00 37.22  ? 74   LYS E CG  1 
ATOM   9729  C  CD  . LYS E  5  74  ? 53.069  279.995 225.634 1.00 36.41  ? 74   LYS E CD  1 
ATOM   9730  C  CE  . LYS E  5  74  ? 54.260  279.235 225.046 1.00 36.39  ? 74   LYS E CE  1 
ATOM   9731  N  NZ  . LYS E  5  74  ? 54.973  280.124 223.987 1.00 33.32  ? 74   LYS E NZ  1 
ATOM   9732  N  N   . ALA E  5  75  ? 49.322  276.250 224.530 1.00 34.10  ? 75   ALA E N   1 
ATOM   9733  C  CA  . ALA E  5  75  ? 49.036  275.083 223.636 1.00 35.22  ? 75   ALA E CA  1 
ATOM   9734  C  C   . ALA E  5  75  ? 48.279  275.469 222.364 1.00 37.28  ? 75   ALA E C   1 
ATOM   9735  O  O   . ALA E  5  75  ? 48.134  274.615 221.442 1.00 35.92  ? 75   ALA E O   1 
ATOM   9736  C  CB  . ALA E  5  75  ? 48.132  274.059 224.369 1.00 33.52  ? 75   ALA E CB  1 
ATOM   9737  N  N   . GLY E  5  76  ? 47.684  276.684 222.347 1.00 37.38  ? 76   GLY E N   1 
ATOM   9738  C  CA  . GLY E  5  76  ? 47.090  277.180 221.118 1.00 34.16  ? 76   GLY E CA  1 
ATOM   9739  C  C   . GLY E  5  76  ? 45.954  276.217 220.728 1.00 36.57  ? 76   GLY E C   1 
ATOM   9740  O  O   . GLY E  5  76  ? 45.090  275.874 221.567 1.00 33.67  ? 76   GLY E O   1 
ATOM   9741  N  N   . PRO E  5  77  ? 45.921  275.769 219.445 1.00 35.59  ? 77   PRO E N   1 
ATOM   9742  C  CA  . PRO E  5  77  ? 44.750  274.968 219.071 1.00 36.00  ? 77   PRO E CA  1 
ATOM   9743  C  C   . PRO E  5  77  ? 44.910  273.435 219.460 1.00 38.43  ? 77   PRO E C   1 
ATOM   9744  O  O   . PRO E  5  77  ? 44.039  272.613 219.118 1.00 38.84  ? 77   PRO E O   1 
ATOM   9745  C  CB  . PRO E  5  77  ? 44.730  275.081 217.546 1.00 35.67  ? 77   PRO E CB  1 
ATOM   9746  C  CG  . PRO E  5  77  ? 46.193  275.100 217.202 1.00 33.62  ? 77   PRO E CG  1 
ATOM   9747  C  CD  . PRO E  5  77  ? 46.882  275.939 218.316 1.00 37.52  ? 77   PRO E CD  1 
ATOM   9748  N  N   . HIS E  5  78  ? 46.036  273.077 220.077 1.00 37.25  ? 78   HIS E N   1 
ATOM   9749  C  CA  . HIS E  5  78  ? 46.295  271.675 220.516 1.00 38.25  ? 78   HIS E CA  1 
ATOM   9750  C  C   . HIS E  5  78  ? 45.518  271.399 221.766 1.00 36.16  ? 78   HIS E C   1 
ATOM   9751  O  O   . HIS E  5  78  ? 46.037  271.439 222.836 1.00 37.28  ? 78   HIS E O   1 
ATOM   9752  C  CB  . HIS E  5  78  ? 47.809  271.530 220.661 1.00 36.91  ? 78   HIS E CB  1 
ATOM   9753  C  CG  . HIS E  5  78  ? 48.473  271.605 219.335 1.00 43.56  ? 78   HIS E CG  1 
ATOM   9754  N  ND1 . HIS E  5  78  ? 48.220  270.679 218.345 1.00 46.96  ? 78   HIS E ND1 1 
ATOM   9755  C  CD2 . HIS E  5  78  ? 49.269  272.540 218.773 1.00 46.97  ? 78   HIS E CD2 1 
ATOM   9756  C  CE1 . HIS E  5  78  ? 48.882  271.002 217.252 1.00 46.64  ? 78   HIS E CE1 1 
ATOM   9757  N  NE2 . HIS E  5  78  ? 49.536  272.121 217.485 1.00 46.39  ? 78   HIS E NE2 1 
ATOM   9758  N  N   . LYS E  5  79  ? 44.222  271.162 221.606 1.00 37.71  ? 79   LYS E N   1 
ATOM   9759  C  CA  . LYS E  5  79  ? 43.280  270.996 222.692 1.00 39.85  ? 79   LYS E CA  1 
ATOM   9760  C  C   . LYS E  5  79  ? 43.537  269.745 223.619 1.00 40.69  ? 79   LYS E C   1 
ATOM   9761  O  O   . LYS E  5  79  ? 42.952  269.680 224.703 1.00 39.73  ? 79   LYS E O   1 
ATOM   9762  C  CB  . LYS E  5  79  ? 41.892  270.780 222.087 1.00 41.95  ? 79   LYS E CB  1 
ATOM   9763  C  CG  . LYS E  5  79  ? 41.230  272.027 221.486 1.00 49.08  ? 79   LYS E CG  1 
ATOM   9764  C  CD  . LYS E  5  79  ? 39.665  271.823 221.344 1.00 60.77  ? 79   LYS E CD  1 
ATOM   9765  C  CE  . LYS E  5  79  ? 39.007  272.995 220.502 1.00 66.44  ? 79   LYS E CE  1 
ATOM   9766  N  NZ  . LYS E  5  79  ? 38.193  272.539 219.279 1.00 68.47  ? 79   LYS E NZ  1 
ATOM   9767  N  N   . GLU E  5  80  ? 44.392  268.801 223.169 1.00 39.07  ? 80   GLU E N   1 
ATOM   9768  C  CA  . GLU E  5  80  ? 44.790  267.609 223.955 1.00 39.73  ? 80   GLU E CA  1 
ATOM   9769  C  C   . GLU E  5  80  ? 45.839  267.916 225.035 1.00 38.38  ? 80   GLU E C   1 
ATOM   9770  O  O   . GLU E  5  80  ? 46.025  267.130 225.979 1.00 40.21  ? 80   GLU E O   1 
ATOM   9771  C  CB  . GLU E  5  80  ? 45.278  266.460 223.006 1.00 38.53  ? 80   GLU E CB  1 
ATOM   9772  C  CG  . GLU E  5  80  ? 46.673  266.662 222.508 1.00 38.94  ? 80   GLU E CG  1 
ATOM   9773  C  CD  . GLU E  5  80  ? 46.800  267.604 221.293 1.00 43.47  ? 80   GLU E CD  1 
ATOM   9774  O  OE1 . GLU E  5  80  ? 47.875  267.652 220.688 1.00 45.92  ? 80   GLU E OE1 1 
ATOM   9775  O  OE2 . GLU E  5  80  ? 45.839  268.296 220.959 1.00 43.60  ? 80   GLU E OE2 1 
ATOM   9776  N  N   . ILE E  5  81  ? 46.549  269.032 224.932 1.00 37.10  ? 81   ILE E N   1 
ATOM   9777  C  CA  . ILE E  5  81  ? 47.673  269.287 225.852 1.00 35.31  ? 81   ILE E CA  1 
ATOM   9778  C  C   . ILE E  5  81  ? 47.254  269.616 227.294 1.00 37.49  ? 81   ILE E C   1 
ATOM   9779  O  O   . ILE E  5  81  ? 47.698  268.936 228.304 1.00 37.31  ? 81   ILE E O   1 
ATOM   9780  C  CB  . ILE E  5  81  ? 48.706  270.319 225.288 1.00 34.98  ? 81   ILE E CB  1 
ATOM   9781  C  CG1 . ILE E  5  81  ? 49.345  269.778 224.010 1.00 35.71  ? 81   ILE E CG1 1 
ATOM   9782  C  CG2 . ILE E  5  81  ? 49.781  270.615 226.310 1.00 31.19  ? 81   ILE E CG2 1 
ATOM   9783  C  CD1 . ILE E  5  81  ? 50.231  270.847 223.241 1.00 36.61  ? 81   ILE E CD1 1 
ATOM   9784  N  N   . TYR E  5  82  ? 46.335  270.584 227.405 1.00 35.50  ? 82   TYR E N   1 
ATOM   9785  C  CA  . TYR E  5  82  ? 45.958  271.090 228.718 1.00 36.47  ? 82   TYR E CA  1 
ATOM   9786  C  C   . TYR E  5  82  ? 45.307  269.908 229.559 1.00 36.17  ? 82   TYR E C   1 
ATOM   9787  O  O   . TYR E  5  82  ? 45.746  269.694 230.680 1.00 35.97  ? 82   TYR E O   1 
ATOM   9788  C  CB  . TYR E  5  82  ? 44.971  272.229 228.595 1.00 34.12  ? 82   TYR E CB  1 
ATOM   9789  C  CG  . TYR E  5  82  ? 44.497  272.785 229.915 1.00 34.54  ? 82   TYR E CG  1 
ATOM   9790  C  CD1 . TYR E  5  82  ? 43.132  272.737 230.266 1.00 30.51  ? 82   TYR E CD1 1 
ATOM   9791  C  CD2 . TYR E  5  82  ? 45.382  273.359 230.800 1.00 29.30  ? 82   TYR E CD2 1 
ATOM   9792  C  CE1 . TYR E  5  82  ? 42.684  273.266 231.492 1.00 29.43  ? 82   TYR E CE1 1 
ATOM   9793  C  CE2 . TYR E  5  82  ? 44.920  273.918 232.048 1.00 30.51  ? 82   TYR E CE2 1 
ATOM   9794  C  CZ  . TYR E  5  82  ? 43.549  273.865 232.346 1.00 32.41  ? 82   TYR E CZ  1 
ATOM   9795  O  OH  . TYR E  5  82  ? 43.024  274.442 233.523 1.00 35.46  ? 82   TYR E OH  1 
ATOM   9796  N  N   . PRO E  5  83  ? 44.313  269.170 229.003 1.00 36.64  ? 83   PRO E N   1 
ATOM   9797  C  CA  . PRO E  5  83  ? 43.774  268.087 229.849 1.00 37.51  ? 83   PRO E CA  1 
ATOM   9798  C  C   . PRO E  5  83  ? 44.832  267.037 230.329 1.00 38.97  ? 83   PRO E C   1 
ATOM   9799  O  O   . PRO E  5  83  ? 44.749  266.505 231.456 1.00 40.20  ? 83   PRO E O   1 
ATOM   9800  C  CB  . PRO E  5  83  ? 42.687  267.463 228.983 1.00 38.55  ? 83   PRO E CB  1 
ATOM   9801  C  CG  . PRO E  5  83  ? 42.411  268.532 227.807 1.00 35.51  ? 83   PRO E CG  1 
ATOM   9802  C  CD  . PRO E  5  83  ? 43.665  269.260 227.668 1.00 35.43  ? 83   PRO E CD  1 
ATOM   9803  N  N   . TYR E  5  84  ? 45.825  266.758 229.504 1.00 39.71  ? 84   TYR E N   1 
ATOM   9804  C  CA  . TYR E  5  84  ? 46.883  265.858 229.881 1.00 39.45  ? 84   TYR E CA  1 
ATOM   9805  C  C   . TYR E  5  84  ? 47.676  266.539 231.020 1.00 39.48  ? 84   TYR E C   1 
ATOM   9806  O  O   . TYR E  5  84  ? 48.036  265.929 232.024 1.00 37.64  ? 84   TYR E O   1 
ATOM   9807  C  CB  . TYR E  5  84  ? 47.800  265.569 228.694 1.00 39.17  ? 84   TYR E CB  1 
ATOM   9808  C  CG  . TYR E  5  84  ? 49.064  264.907 229.188 1.00 40.83  ? 84   TYR E CG  1 
ATOM   9809  C  CD1 . TYR E  5  84  ? 49.098  263.506 229.465 1.00 41.78  ? 84   TYR E CD1 1 
ATOM   9810  C  CD2 . TYR E  5  84  ? 50.196  265.653 229.410 1.00 42.22  ? 84   TYR E CD2 1 
ATOM   9811  C  CE1 . TYR E  5  84  ? 50.259  262.881 229.984 1.00 39.64  ? 84   TYR E CE1 1 
ATOM   9812  C  CE2 . TYR E  5  84  ? 51.368  265.084 229.879 1.00 43.35  ? 84   TYR E CE2 1 
ATOM   9813  C  CZ  . TYR E  5  84  ? 51.384  263.661 230.195 1.00 44.82  ? 84   TYR E CZ  1 
ATOM   9814  O  OH  . TYR E  5  84  ? 52.560  263.139 230.649 1.00 42.87  ? 84   TYR E OH  1 
ATOM   9815  N  N   . VAL E  5  85  ? 47.940  267.822 230.897 1.00 38.49  ? 85   VAL E N   1 
ATOM   9816  C  CA  . VAL E  5  85  ? 48.822  268.438 231.915 1.00 37.83  ? 85   VAL E CA  1 
ATOM   9817  C  C   . VAL E  5  85  ? 48.107  268.436 233.325 1.00 37.30  ? 85   VAL E C   1 
ATOM   9818  O  O   . VAL E  5  85  ? 48.764  268.210 234.355 1.00 34.94  ? 85   VAL E O   1 
ATOM   9819  C  CB  . VAL E  5  85  ? 49.285  269.921 231.504 1.00 37.93  ? 85   VAL E CB  1 
ATOM   9820  C  CG1 . VAL E  5  85  ? 49.867  270.665 232.717 1.00 39.07  ? 85   VAL E CG1 1 
ATOM   9821  C  CG2 . VAL E  5  85  ? 50.309  269.931 230.394 1.00 34.60  ? 85   VAL E CG2 1 
ATOM   9822  N  N   . ILE E  5  86  ? 46.797  268.765 233.315 1.00 36.26  ? 86   ILE E N   1 
ATOM   9823  C  CA  . ILE E  5  86  ? 45.965  268.815 234.499 1.00 37.27  ? 86   ILE E CA  1 
ATOM   9824  C  C   . ILE E  5  86  ? 45.905  267.390 235.159 1.00 38.96  ? 86   ILE E C   1 
ATOM   9825  O  O   . ILE E  5  86  ? 46.136  267.239 236.360 1.00 40.58  ? 86   ILE E O   1 
ATOM   9826  C  CB  . ILE E  5  86  ? 44.539  269.291 234.132 1.00 35.44  ? 86   ILE E CB  1 
ATOM   9827  C  CG1 . ILE E  5  86  ? 44.548  270.810 233.712 1.00 37.27  ? 86   ILE E CG1 1 
ATOM   9828  C  CG2 . ILE E  5  86  ? 43.504  269.028 235.370 1.00 33.05  ? 86