data_3AM7
# 
_entry.id   3AM7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3AM7         
RCSB  RCSB029422   
WWPDB D_1000029422 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1WKW 
_pdbx_database_related.details        'The same protein complexed with 4EBP subtype' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3AM7 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-17 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tomoo, K.'  1 
'Fukuyo, A.' 2 
'In, Y.'     3 
'Ishida, T.' 4 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the ternary complex of eIF4E-M7GTP-4EBP2 peptide' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tomoo, K.'  1 
primary 'Fukuyo, A.' 2 
primary 'In, Y.'     3 
primary 'Ishida, T.' 4 
# 
_cell.entry_id           3AM7 
_cell.length_a           87.84 
_cell.length_b           87.84 
_cell.length_c           37.75 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3AM7 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Eukaryotic translation initiation factor 4E'                   22288.252 1  ? ? 'UNP RESIDUES 27-217' ? 
2 polymer     man 'Eukaryotic translation initiation factor 4E-binding protein 2' 2282.627  1  ? ? 'UNP RESIDUES 47-65'  ? 
3 non-polymer syn "7-METHYL-GUANOSINE-5'-TRIPHOSPHATE"                            538.215   1  ? ? ?                     ? 
4 water       nat water                                                           18.015    93 ? ? ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'eIF-4E, eIF4E, mRNA cap-binding protein, eIF-4F 25 kDa subunit' 
2 'eIF4E-binding protein 2, 4E-BP2'                                
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEK
NKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKER
LGLPPKIVIGYQSHADTATKSGSTTKNRFVV
;
;EVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEK
NKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKER
LGLPPKIVIGYQSHADTATKSGSTTKNRFVV
;
A ? 
2 'polypeptide(L)' no no PGGTRIIYDRKFLLDRRNS PGGTRIIYDRKFLLDRRNS B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   VAL n 
1 3   ALA n 
1 4   ASN n 
1 5   PRO n 
1 6   GLU n 
1 7   HIS n 
1 8   TYR n 
1 9   ILE n 
1 10  LYS n 
1 11  HIS n 
1 12  PRO n 
1 13  LEU n 
1 14  GLN n 
1 15  ASN n 
1 16  ARG n 
1 17  TRP n 
1 18  ALA n 
1 19  LEU n 
1 20  TRP n 
1 21  PHE n 
1 22  PHE n 
1 23  LYS n 
1 24  ASN n 
1 25  ASP n 
1 26  LYS n 
1 27  SER n 
1 28  LYS n 
1 29  THR n 
1 30  TRP n 
1 31  GLN n 
1 32  ALA n 
1 33  ASN n 
1 34  LEU n 
1 35  ARG n 
1 36  LEU n 
1 37  ILE n 
1 38  SER n 
1 39  LYS n 
1 40  PHE n 
1 41  ASP n 
1 42  THR n 
1 43  VAL n 
1 44  GLU n 
1 45  ASP n 
1 46  PHE n 
1 47  TRP n 
1 48  ALA n 
1 49  LEU n 
1 50  TYR n 
1 51  ASN n 
1 52  HIS n 
1 53  ILE n 
1 54  GLN n 
1 55  LEU n 
1 56  SER n 
1 57  SER n 
1 58  ASN n 
1 59  LEU n 
1 60  MET n 
1 61  PRO n 
1 62  GLY n 
1 63  CYS n 
1 64  ASP n 
1 65  TYR n 
1 66  SER n 
1 67  LEU n 
1 68  PHE n 
1 69  LYS n 
1 70  ASP n 
1 71  GLY n 
1 72  ILE n 
1 73  GLU n 
1 74  PRO n 
1 75  MET n 
1 76  TRP n 
1 77  GLU n 
1 78  ASP n 
1 79  GLU n 
1 80  LYS n 
1 81  ASN n 
1 82  LYS n 
1 83  ARG n 
1 84  GLY n 
1 85  GLY n 
1 86  ARG n 
1 87  TRP n 
1 88  LEU n 
1 89  ILE n 
1 90  THR n 
1 91  LEU n 
1 92  ASN n 
1 93  LYS n 
1 94  GLN n 
1 95  GLN n 
1 96  ARG n 
1 97  ARG n 
1 98  SER n 
1 99  ASP n 
1 100 LEU n 
1 101 ASP n 
1 102 ARG n 
1 103 PHE n 
1 104 TRP n 
1 105 LEU n 
1 106 GLU n 
1 107 THR n 
1 108 LEU n 
1 109 LEU n 
1 110 CYS n 
1 111 LEU n 
1 112 ILE n 
1 113 GLY n 
1 114 GLU n 
1 115 SER n 
1 116 PHE n 
1 117 ASP n 
1 118 ASP n 
1 119 TYR n 
1 120 SER n 
1 121 ASP n 
1 122 ASP n 
1 123 VAL n 
1 124 CYS n 
1 125 GLY n 
1 126 ALA n 
1 127 VAL n 
1 128 VAL n 
1 129 ASN n 
1 130 VAL n 
1 131 ARG n 
1 132 ALA n 
1 133 LYS n 
1 134 GLY n 
1 135 ASP n 
1 136 LYS n 
1 137 ILE n 
1 138 ALA n 
1 139 ILE n 
1 140 TRP n 
1 141 THR n 
1 142 THR n 
1 143 GLU n 
1 144 CYS n 
1 145 GLU n 
1 146 ASN n 
1 147 ARG n 
1 148 GLU n 
1 149 ALA n 
1 150 VAL n 
1 151 THR n 
1 152 HIS n 
1 153 ILE n 
1 154 GLY n 
1 155 ARG n 
1 156 VAL n 
1 157 TYR n 
1 158 LYS n 
1 159 GLU n 
1 160 ARG n 
1 161 LEU n 
1 162 GLY n 
1 163 LEU n 
1 164 PRO n 
1 165 PRO n 
1 166 LYS n 
1 167 ILE n 
1 168 VAL n 
1 169 ILE n 
1 170 GLY n 
1 171 TYR n 
1 172 GLN n 
1 173 SER n 
1 174 HIS n 
1 175 ALA n 
1 176 ASP n 
1 177 THR n 
1 178 ALA n 
1 179 THR n 
1 180 LYS n 
1 181 SER n 
1 182 GLY n 
1 183 SER n 
1 184 THR n 
1 185 THR n 
1 186 LYS n 
1 187 ASN n 
1 188 ARG n 
1 189 PHE n 
1 190 VAL n 
1 191 VAL n 
2 1   PRO n 
2 2   GLY n 
2 3   GLY n 
2 4   THR n 
2 5   ARG n 
2 6   ILE n 
2 7   ILE n 
2 8   TYR n 
2 9   ASP n 
2 10  ARG n 
2 11  LYS n 
2 12  PHE n 
2 13  LEU n 
2 14  LEU n 
2 15  ASP n 
2 16  ARG n 
2 17  ARG n 
2 18  ASN n 
2 19  SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'EIF4E, EIF4EL1, EIF4F' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? EIF4EBP2                ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP IF4E_HUMAN  P06730 1 
;EVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEK
NKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKER
LGLPPKIVIGYQSHADTATKSGSTTKNRFVV
;
27 ? 
2 UNP 4EBP2_HUMAN Q13542 2 PGGTRIIYDRKFLLDRRNS 47 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3AM7 A 1 ? 191 ? P06730 27 ? 217 ? 27 217 
2 2 3AM7 B 1 ? 19  ? Q13542 47 ? 65  ? 47 65  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                                ? 'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'       149.211 
MGP non-polymer         . "7-METHYL-GUANOSINE-5'-TRIPHOSPHATE" ? 'C11 H19 N5 O14 P3 1' 538.215 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'         117.146 
# 
_exptl.entry_id          3AM7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.96 
_exptl_crystal.density_percent_sol   58.50 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
'20% PEG-MME 2000, 0.1M MES, 0.2M ammonium sulfate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 291.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS VII' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3AM7 
_reflns.observed_criterion_sigma_I   3 
_reflns.observed_criterion_sigma_F   3 
_reflns.d_resolution_low             43.9 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   16434 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.4 
_reflns.pdbx_Rmerge_I_obs            0.101 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.81 
_reflns.pdbx_netI_over_sigmaI        8.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              43.9 
_reflns_shell.percent_possible_all   95.4 
_reflns_shell.Rmerge_I_obs           0.101 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    8.0 
_reflns_shell.pdbx_redundancy        3.81 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      16434 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3AM7 
_refine.ls_number_reflns_obs                     14502 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.3 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    97.1 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.23 
_refine.ls_R_factor_R_free                       0.268 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  734 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3AM7 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.19 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1725 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             93 
_refine_hist.number_atoms_total               1851 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        29.3 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.685 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        2.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.8  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.31  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  3AM7 
_struct.title                     'Crystal structure of the ternary complex of eIF4E-M7GTP-4EBP2 peptide' 
_struct.pdbx_descriptor           
'Eukaryotic translation initiation factor 4E, Eukaryotic translation initiation factor 4E-binding protein 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3AM7 
_struct_keywords.pdbx_keywords   'TRANSLATION/PROTEIN BINDING' 
_struct_keywords.text            'Cap, TRANSLATION, PROTEIN-PROTEIN COMPLEX, TRANSLATION-PROTEIN BINDING complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 4   ? TYR A 8   ? ASN A 30  TYR A 34  5 ? 5  
HELX_P HELX_P2 2 VAL A 43  ? ILE A 53  ? VAL A 69  ILE A 79  1 ? 11 
HELX_P HELX_P3 3 LEU A 55  ? LEU A 59  ? LEU A 81  LEU A 85  5 ? 5  
HELX_P HELX_P4 4 GLN A 94  ? ASP A 99  ? GLN A 120 ASP A 125 1 ? 6  
HELX_P HELX_P5 5 ASP A 99  ? GLY A 113 ? ASP A 125 GLY A 139 1 ? 15 
HELX_P HELX_P6 6 PHE A 116 ? ASP A 121 ? PHE A 142 ASP A 147 5 ? 6  
HELX_P HELX_P7 7 ASN A 146 ? GLY A 162 ? ASN A 172 GLY A 188 1 ? 17 
HELX_P HELX_P8 8 ALA A 175 ? THR A 177 ? ALA A 201 THR A 203 5 ? 3  
HELX_P HELX_P9 9 ASP B 9   ? ASP B 15  ? ASP B 55  ASP B 61  1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 36  ? THR A 42  ? LEU A 62  THR A 68  
A 2 PRO A 12  ? LYS A 23  ? PRO A 38  LYS A 49  
A 3 CYS A 63  ? LYS A 69  ? CYS A 89  LYS A 95  
A 4 VAL A 123 ? ASN A 129 ? VAL A 149 ASN A 155 
A 5 LYS A 136 ? THR A 141 ? LYS A 162 THR A 167 
A 6 GLY A 85  ? THR A 90  ? GLY A 111 THR A 116 
A 7 GLY A 170 ? SER A 173 ? GLY A 196 SER A 199 
A 8 PHE A 189 ? VAL A 190 ? PHE A 215 VAL A 216 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 37  ? O ILE A 63  N LEU A 19  ? N LEU A 45  
A 2 3 N TRP A 20  ? N TRP A 46  O SER A 66  ? O SER A 92  
A 3 4 N TYR A 65  ? N TYR A 91  O VAL A 128 ? O VAL A 154 
A 4 5 N ASN A 129 ? N ASN A 155 O LYS A 136 ? O LYS A 162 
A 5 6 O ILE A 137 ? O ILE A 163 N ILE A 89  ? N ILE A 115 
A 6 7 N ARG A 86  ? N ARG A 112 O GLN A 172 ? O GLN A 198 
A 7 8 N TYR A 171 ? N TYR A 197 O PHE A 189 ? O PHE A 215 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    16 
_struct_site.details              'BINDING SITE FOR RESIDUE MGP A 1000' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 HOH D .   ? HOH A 18  . ? 1_555 ? 
2  AC1 16 HOH D .   ? HOH A 21  . ? 1_555 ? 
3  AC1 16 TRP A 30  ? TRP A 56  . ? 1_555 ? 
4  AC1 16 MET A 75  ? MET A 101 . ? 1_555 ? 
5  AC1 16 TRP A 76  ? TRP A 102 . ? 1_555 ? 
6  AC1 16 GLU A 77  ? GLU A 103 . ? 1_555 ? 
7  AC1 16 ARG A 131 ? ARG A 157 . ? 1_555 ? 
8  AC1 16 LYS A 133 ? LYS A 159 . ? 1_555 ? 
9  AC1 16 LYS A 136 ? LYS A 162 . ? 1_555 ? 
10 AC1 16 PRO A 165 ? PRO A 191 . ? 3_554 ? 
11 AC1 16 LYS A 166 ? LYS A 192 . ? 3_554 ? 
12 AC1 16 VAL A 168 ? VAL A 194 . ? 3_554 ? 
13 AC1 16 VAL A 191 ? VAL A 217 . ? 3_554 ? 
14 AC1 16 HOH D .   ? HOH A 234 . ? 1_555 ? 
15 AC1 16 HOH D .   ? HOH A 241 . ? 1_555 ? 
16 AC1 16 HOH D .   ? HOH A 271 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3AM7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3AM7 
_atom_sites.fract_transf_matrix[1][1]   0.011384 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011384 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026490 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLU A 1 1   ? 16.544  55.195 -27.842 1.00 80.23 ? 27   GLU A N     1 
ATOM   2    C CA    . GLU A 1 1   ? 15.394  55.250 -26.893 1.00 80.43 ? 27   GLU A CA    1 
ATOM   3    C C     . GLU A 1 1   ? 15.105  53.880 -26.296 1.00 80.25 ? 27   GLU A C     1 
ATOM   4    O O     . GLU A 1 1   ? 14.251  53.139 -26.784 1.00 80.27 ? 27   GLU A O     1 
ATOM   5    C CB    . GLU A 1 1   ? 14.146  55.779 -27.607 1.00 81.10 ? 27   GLU A CB    1 
ATOM   6    C CG    . GLU A 1 1   ? 14.258  57.232 -28.032 1.00 82.14 ? 27   GLU A CG    1 
ATOM   7    C CD    . GLU A 1 1   ? 14.431  58.163 -26.848 1.00 82.23 ? 27   GLU A CD    1 
ATOM   8    O OE1   . GLU A 1 1   ? 14.735  59.357 -27.062 1.00 82.52 ? 27   GLU A OE1   1 
ATOM   9    O OE2   . GLU A 1 1   ? 14.257  57.699 -25.702 1.00 82.23 ? 27   GLU A OE2   1 
ATOM   10   N N     . VAL A 1 2   ? 15.828  53.549 -25.233 1.00 79.78 ? 28   VAL A N     1 
ATOM   11   C CA    . VAL A 1 2   ? 15.652  52.271 -24.567 1.00 79.37 ? 28   VAL A CA    1 
ATOM   12   C C     . VAL A 1 2   ? 15.719  52.436 -23.051 1.00 78.22 ? 28   VAL A C     1 
ATOM   13   O O     . VAL A 1 2   ? 16.799  52.473 -22.458 1.00 78.30 ? 28   VAL A O     1 
ATOM   14   C CB    . VAL A 1 2   ? 16.724  51.257 -25.033 1.00 80.45 ? 28   VAL A CB    1 
ATOM   15   C CG1   . VAL A 1 2   ? 16.510  50.927 -26.503 1.00 80.87 ? 28   VAL A CG1   1 
ATOM   16   C CG2   . VAL A 1 2   ? 18.121  51.832 -24.830 1.00 80.63 ? 28   VAL A CG2   1 
ATOM   17   N N     . ALA A 1 3   ? 14.551  52.538 -22.427 1.00 76.29 ? 29   ALA A N     1 
ATOM   18   C CA    . ALA A 1 3   ? 14.476  52.703 -20.982 1.00 74.42 ? 29   ALA A CA    1 
ATOM   19   C C     . ALA A 1 3   ? 15.108  51.514 -20.269 1.00 72.60 ? 29   ALA A C     1 
ATOM   20   O O     . ALA A 1 3   ? 15.086  50.395 -20.782 1.00 72.40 ? 29   ALA A O     1 
ATOM   21   C CB    . ALA A 1 3   ? 13.022  52.862 -20.555 1.00 75.19 ? 29   ALA A CB    1 
ATOM   22   N N     . ASN A 1 4   ? 15.671  51.765 -19.089 1.00 70.32 ? 30   ASN A N     1 
ATOM   23   C CA    . ASN A 1 4   ? 16.310  50.716 -18.299 1.00 68.14 ? 30   ASN A CA    1 
ATOM   24   C C     . ASN A 1 4   ? 15.294  49.946 -17.452 1.00 66.94 ? 30   ASN A C     1 
ATOM   25   O O     . ASN A 1 4   ? 14.880  50.410 -16.388 1.00 66.83 ? 30   ASN A O     1 
ATOM   26   C CB    . ASN A 1 4   ? 17.382  51.319 -17.391 1.00 67.91 ? 30   ASN A CB    1 
ATOM   27   C CG    . ASN A 1 4   ? 17.994  50.296 -16.462 1.00 67.78 ? 30   ASN A CG    1 
ATOM   28   O OD1   . ASN A 1 4   ? 18.407  49.224 -16.896 1.00 67.89 ? 30   ASN A OD1   1 
ATOM   29   N ND2   . ASN A 1 4   ? 18.060  50.623 -15.175 1.00 68.21 ? 30   ASN A ND2   1 
ATOM   30   N N     . PRO A 1 5   ? 14.898  48.744 -17.912 1.00 65.25 ? 31   PRO A N     1 
ATOM   31   C CA    . PRO A 1 5   ? 13.934  47.841 -17.272 1.00 62.53 ? 31   PRO A CA    1 
ATOM   32   C C     . PRO A 1 5   ? 13.949  47.815 -15.746 1.00 60.32 ? 31   PRO A C     1 
ATOM   33   O O     . PRO A 1 5   ? 12.901  47.915 -15.106 1.00 60.10 ? 31   PRO A O     1 
ATOM   34   C CB    . PRO A 1 5   ? 14.292  46.490 -17.876 1.00 63.65 ? 31   PRO A CB    1 
ATOM   35   C CG    . PRO A 1 5   ? 14.647  46.866 -19.275 1.00 64.20 ? 31   PRO A CG    1 
ATOM   36   C CD    . PRO A 1 5   ? 15.532  48.079 -19.067 1.00 64.68 ? 31   PRO A CD    1 
ATOM   37   N N     . GLU A 1 6   ? 15.133  47.673 -15.163 1.00 57.64 ? 32   GLU A N     1 
ATOM   38   C CA    . GLU A 1 6   ? 15.261  47.631 -13.710 1.00 54.80 ? 32   GLU A CA    1 
ATOM   39   C C     . GLU A 1 6   ? 14.612  48.832 -13.032 1.00 51.16 ? 32   GLU A C     1 
ATOM   40   O O     . GLU A 1 6   ? 14.265  48.775 -11.857 1.00 50.74 ? 32   GLU A O     1 
ATOM   41   C CB    . GLU A 1 6   ? 16.742  47.557 -13.318 1.00 57.57 ? 32   GLU A CB    1 
ATOM   42   C CG    . GLU A 1 6   ? 17.018  47.728 -11.827 1.00 60.32 ? 32   GLU A CG    1 
ATOM   43   C CD    . GLU A 1 6   ? 16.239  46.752 -10.959 1.00 62.77 ? 32   GLU A CD    1 
ATOM   44   O OE1   . GLU A 1 6   ? 16.407  45.523 -11.131 1.00 63.68 ? 32   GLU A OE1   1 
ATOM   45   O OE2   . GLU A 1 6   ? 15.462  47.218 -10.099 1.00 63.69 ? 32   GLU A OE2   1 
ATOM   46   N N     . HIS A 1 7   ? 14.437  49.914 -13.780 1.00 48.23 ? 33   HIS A N     1 
ATOM   47   C CA    . HIS A 1 7   ? 13.853  51.135 -13.234 1.00 45.01 ? 33   HIS A CA    1 
ATOM   48   C C     . HIS A 1 7   ? 12.326  51.205 -13.217 1.00 41.68 ? 33   HIS A C     1 
ATOM   49   O O     . HIS A 1 7   ? 11.756  51.904 -12.385 1.00 41.26 ? 33   HIS A O     1 
ATOM   50   C CB    . HIS A 1 7   ? 14.385  52.348 -14.007 1.00 47.42 ? 33   HIS A CB    1 
ATOM   51   C CG    . HIS A 1 7   ? 15.851  52.599 -13.825 1.00 49.42 ? 33   HIS A CG    1 
ATOM   52   N ND1   . HIS A 1 7   ? 16.562  53.463 -14.630 1.00 50.71 ? 33   HIS A ND1   1 
ATOM   53   C CD2   . HIS A 1 7   ? 16.735  52.117 -12.919 1.00 50.55 ? 33   HIS A CD2   1 
ATOM   54   C CE1   . HIS A 1 7   ? 17.820  53.503 -14.229 1.00 51.21 ? 33   HIS A CE1   1 
ATOM   55   N NE2   . HIS A 1 7   ? 17.951  52.695 -13.192 1.00 50.38 ? 33   HIS A NE2   1 
ATOM   56   N N     . TYR A 1 8   ? 11.656  50.485 -14.113 1.00 37.59 ? 34   TYR A N     1 
ATOM   57   C CA    . TYR A 1 8   ? 10.199  50.572 -14.176 1.00 35.76 ? 34   TYR A CA    1 
ATOM   58   C C     . TYR A 1 8   ? 9.453   49.262 -14.422 1.00 34.90 ? 34   TYR A C     1 
ATOM   59   O O     . TYR A 1 8   ? 8.226   49.251 -14.488 1.00 34.70 ? 34   TYR A O     1 
ATOM   60   C CB    . TYR A 1 8   ? 9.816   51.561 -15.276 1.00 35.04 ? 34   TYR A CB    1 
ATOM   61   C CG    . TYR A 1 8   ? 10.163  51.048 -16.659 1.00 35.70 ? 34   TYR A CG    1 
ATOM   62   C CD1   . TYR A 1 8   ? 9.227   50.344 -17.420 1.00 36.58 ? 34   TYR A CD1   1 
ATOM   63   C CD2   . TYR A 1 8   ? 11.448  51.195 -17.174 1.00 35.15 ? 34   TYR A CD2   1 
ATOM   64   C CE1   . TYR A 1 8   ? 9.568   49.796 -18.659 1.00 36.78 ? 34   TYR A CE1   1 
ATOM   65   C CE2   . TYR A 1 8   ? 11.799  50.650 -18.408 1.00 36.11 ? 34   TYR A CE2   1 
ATOM   66   C CZ    . TYR A 1 8   ? 10.857  49.951 -19.145 1.00 36.73 ? 34   TYR A CZ    1 
ATOM   67   O OH    . TYR A 1 8   ? 11.210  49.391 -20.358 1.00 40.12 ? 34   TYR A OH    1 
ATOM   68   N N     . ILE A 1 9   ? 10.181  48.164 -14.572 1.00 33.69 ? 35   ILE A N     1 
ATOM   69   C CA    . ILE A 1 9   ? 9.544   46.880 -14.821 1.00 32.49 ? 35   ILE A CA    1 
ATOM   70   C C     . ILE A 1 9   ? 9.407   46.068 -13.542 1.00 31.31 ? 35   ILE A C     1 
ATOM   71   O O     . ILE A 1 9   ? 10.306  46.066 -12.703 1.00 31.98 ? 35   ILE A O     1 
ATOM   72   C CB    . ILE A 1 9   ? 10.343  46.086 -15.875 1.00 34.28 ? 35   ILE A CB    1 
ATOM   73   C CG1   . ILE A 1 9   ? 10.167  46.757 -17.238 1.00 34.43 ? 35   ILE A CG1   1 
ATOM   74   C CG2   . ILE A 1 9   ? 9.898   44.629 -15.905 1.00 34.01 ? 35   ILE A CG2   1 
ATOM   75   C CD1   . ILE A 1 9   ? 8.737   46.751 -17.853 1.00 35.61 ? 35   ILE A CD1   1 
ATOM   76   N N     . LYS A 1 10  ? 8.270   45.395 -13.388 1.00 30.23 ? 36   LYS A N     1 
ATOM   77   C CA    . LYS A 1 10  ? 8.022   44.569 -12.207 1.00 29.72 ? 36   LYS A CA    1 
ATOM   78   C C     . LYS A 1 10  ? 8.834   43.285 -12.286 1.00 29.32 ? 36   LYS A C     1 
ATOM   79   O O     . LYS A 1 10  ? 9.125   42.801 -13.380 1.00 29.77 ? 36   LYS A O     1 
ATOM   80   C CB    . LYS A 1 10  ? 6.527   44.242 -12.086 1.00 28.00 ? 36   LYS A CB    1 
ATOM   81   C CG    . LYS A 1 10  ? 5.676   45.458 -11.734 1.00 29.50 ? 36   LYS A CG    1 
ATOM   82   C CD    . LYS A 1 10  ? 4.246   45.107 -11.342 1.00 30.18 ? 36   LYS A CD    1 
ATOM   83   C CE    . LYS A 1 10  ? 3.417   44.708 -12.540 1.00 32.11 ? 36   LYS A CE    1 
ATOM   84   N NZ    . LYS A 1 10  ? 1.967   44.649 -12.203 1.00 32.86 ? 36   LYS A NZ    1 
ATOM   85   N N     . HIS A 1 11  ? 9.208   42.744 -11.126 1.00 30.14 ? 37   HIS A N     1 
ATOM   86   C CA    . HIS A 1 11  ? 9.994   41.511 -11.068 1.00 28.39 ? 37   HIS A CA    1 
ATOM   87   C C     . HIS A 1 11  ? 9.090   40.313 -11.290 1.00 27.48 ? 37   HIS A C     1 
ATOM   88   O O     . HIS A 1 11  ? 8.315   39.943 -10.407 1.00 28.62 ? 37   HIS A O     1 
ATOM   89   C CB    . HIS A 1 11  ? 10.696  41.382 -9.719  1.00 29.53 ? 37   HIS A CB    1 
ATOM   90   C CG    . HIS A 1 11  ? 11.670  42.482 -9.444  1.00 32.59 ? 37   HIS A CG    1 
ATOM   91   N ND1   . HIS A 1 11  ? 11.295  43.688 -8.891  1.00 34.26 ? 37   HIS A ND1   1 
ATOM   92   C CD2   . HIS A 1 11  ? 12.998  42.579 -9.692  1.00 33.96 ? 37   HIS A CD2   1 
ATOM   93   C CE1   . HIS A 1 11  ? 12.350  44.479 -8.809  1.00 34.13 ? 37   HIS A CE1   1 
ATOM   94   N NE2   . HIS A 1 11  ? 13.396  43.831 -9.289  1.00 32.84 ? 37   HIS A NE2   1 
ATOM   95   N N     . PRO A 1 12  ? 9.202   39.674 -12.468 1.00 25.05 ? 38   PRO A N     1 
ATOM   96   C CA    . PRO A 1 12  ? 8.397   38.512 -12.840 1.00 25.47 ? 38   PRO A CA    1 
ATOM   97   C C     . PRO A 1 12  ? 8.749   37.243 -12.096 1.00 25.69 ? 38   PRO A C     1 
ATOM   98   O O     . PRO A 1 12  ? 9.904   37.009 -11.760 1.00 27.41 ? 38   PRO A O     1 
ATOM   99   C CB    . PRO A 1 12  ? 8.647   38.389 -14.337 1.00 26.63 ? 38   PRO A CB    1 
ATOM   100  C CG    . PRO A 1 12  ? 10.085  38.785 -14.450 1.00 27.22 ? 38   PRO A CG    1 
ATOM   101  C CD    . PRO A 1 12  ? 10.206  39.971 -13.505 1.00 25.06 ? 38   PRO A CD    1 
ATOM   102  N N     . LEU A 1 13  ? 7.734   36.430 -11.832 1.00 26.02 ? 39   LEU A N     1 
ATOM   103  C CA    . LEU A 1 13  ? 7.926   35.163 -11.145 1.00 26.48 ? 39   LEU A CA    1 
ATOM   104  C C     . LEU A 1 13  ? 7.989   34.092 -12.227 1.00 26.50 ? 39   LEU A C     1 
ATOM   105  O O     . LEU A 1 13  ? 7.500   34.297 -13.340 1.00 27.62 ? 39   LEU A O     1 
ATOM   106  C CB    . LEU A 1 13  ? 6.749   34.878 -10.203 1.00 22.69 ? 39   LEU A CB    1 
ATOM   107  C CG    . LEU A 1 13  ? 6.444   35.936 -9.137  1.00 23.58 ? 39   LEU A CG    1 
ATOM   108  C CD1   . LEU A 1 13  ? 5.125   35.599 -8.454  1.00 23.00 ? 39   LEU A CD1   1 
ATOM   109  C CD2   . LEU A 1 13  ? 7.589   36.017 -8.131  1.00 21.89 ? 39   LEU A CD2   1 
ATOM   110  N N     . GLN A 1 14  ? 8.597   32.959 -11.906 1.00 26.06 ? 40   GLN A N     1 
ATOM   111  C CA    . GLN A 1 14  ? 8.688   31.863 -12.855 1.00 26.96 ? 40   GLN A CA    1 
ATOM   112  C C     . GLN A 1 14  ? 7.262   31.438 -13.204 1.00 27.00 ? 40   GLN A C     1 
ATOM   113  O O     . GLN A 1 14  ? 6.961   31.137 -14.356 1.00 27.41 ? 40   GLN A O     1 
ATOM   114  C CB    . GLN A 1 14  ? 9.459   30.696 -12.226 1.00 27.75 ? 40   GLN A CB    1 
ATOM   115  C CG    . GLN A 1 14  ? 9.531   29.420 -13.064 1.00 29.93 ? 40   GLN A CG    1 
ATOM   116  C CD    . GLN A 1 14  ? 10.434  29.531 -14.281 1.00 31.35 ? 40   GLN A CD    1 
ATOM   117  O OE1   . GLN A 1 14  ? 10.274  28.603 -15.217 1.00 37.34 ? 40   GLN A OE1   1 
ATOM   118  N NE2   . GLN A 1 14  ? 11.275  30.420 -14.373 1.00 32.64 ? 40   GLN A NE2   1 
ATOM   119  N N     . ASN A 1 15  ? 6.381   31.435 -12.205 1.00 26.28 ? 41   ASN A N     1 
ATOM   120  C CA    . ASN A 1 15  ? 4.992   31.046 -12.415 1.00 25.83 ? 41   ASN A CA    1 
ATOM   121  C C     . ASN A 1 15  ? 3.964   32.080 -11.968 1.00 25.72 ? 41   ASN A C     1 
ATOM   122  O O     . ASN A 1 15  ? 4.240   32.938 -11.127 1.00 24.90 ? 41   ASN A O     1 
ATOM   123  C CB    . ASN A 1 15  ? 4.666   29.746 -11.669 1.00 26.63 ? 41   ASN A CB    1 
ATOM   124  C CG    . ASN A 1 15  ? 5.370   28.537 -12.242 1.00 29.51 ? 41   ASN A CG    1 
ATOM   125  O OD1   . ASN A 1 15  ? 6.442   28.140 -11.776 1.00 29.80 ? 41   ASN A OD1   1 
ATOM   126  N ND2   . ASN A 1 15  ? 4.768   27.940 -13.260 1.00 29.99 ? 41   ASN A ND2   1 
ATOM   127  N N     . ARG A 1 16  ? 2.773   31.993 -12.549 1.00 23.26 ? 42   ARG A N     1 
ATOM   128  C CA    . ARG A 1 16  ? 1.681   32.850 -12.131 1.00 24.86 ? 42   ARG A CA    1 
ATOM   129  C C     . ARG A 1 16  ? 0.993   31.976 -11.085 1.00 23.36 ? 42   ARG A C     1 
ATOM   130  O O     . ARG A 1 16  ? 0.815   30.774 -11.298 1.00 24.53 ? 42   ARG A O     1 
ATOM   131  C CB    . ARG A 1 16  ? 0.728   33.155 -13.293 1.00 25.57 ? 42   ARG A CB    1 
ATOM   132  C CG    . ARG A 1 16  ? -0.578  33.809 -12.851 1.00 30.24 ? 42   ARG A CG    1 
ATOM   133  C CD    . ARG A 1 16  ? -1.179  34.696 -13.944 1.00 35.29 ? 42   ARG A CD    1 
ATOM   134  N NE    . ARG A 1 16  ? -1.483  33.954 -15.161 1.00 44.51 ? 42   ARG A NE    1 
ATOM   135  C CZ    . ARG A 1 16  ? -1.605  34.507 -16.365 1.00 46.92 ? 42   ARG A CZ    1 
ATOM   136  N NH1   . ARG A 1 16  ? -1.887  33.748 -17.418 1.00 48.05 ? 42   ARG A NH1   1 
ATOM   137  N NH2   . ARG A 1 16  ? -1.431  35.816 -16.518 1.00 49.07 ? 42   ARG A NH2   1 
ATOM   138  N N     . TRP A 1 17  ? 0.633   32.567 -9.953  1.00 22.66 ? 43   TRP A N     1 
ATOM   139  C CA    . TRP A 1 17  ? -0.014  31.830 -8.879  1.00 22.65 ? 43   TRP A CA    1 
ATOM   140  C C     . TRP A 1 17  ? -1.410  32.355 -8.616  1.00 24.06 ? 43   TRP A C     1 
ATOM   141  O O     . TRP A 1 17  ? -1.739  33.475 -8.997  1.00 26.92 ? 43   TRP A O     1 
ATOM   142  C CB    . TRP A 1 17  ? 0.808   31.952 -7.592  1.00 22.44 ? 43   TRP A CB    1 
ATOM   143  C CG    . TRP A 1 17  ? 2.206   31.471 -7.745  1.00 22.32 ? 43   TRP A CG    1 
ATOM   144  C CD1   . TRP A 1 17  ? 3.250   32.137 -8.333  1.00 21.19 ? 43   TRP A CD1   1 
ATOM   145  C CD2   . TRP A 1 17  ? 2.712   30.189 -7.359  1.00 20.34 ? 43   TRP A CD2   1 
ATOM   146  N NE1   . TRP A 1 17  ? 4.375   31.341 -8.335  1.00 22.06 ? 43   TRP A NE1   1 
ATOM   147  C CE2   . TRP A 1 17  ? 4.072   30.141 -7.744  1.00 21.44 ? 43   TRP A CE2   1 
ATOM   148  C CE3   . TRP A 1 17  ? 2.146   29.072 -6.725  1.00 22.25 ? 43   TRP A CE3   1 
ATOM   149  C CZ2   . TRP A 1 17  ? 4.883   29.012 -7.515  1.00 20.73 ? 43   TRP A CZ2   1 
ATOM   150  C CZ3   . TRP A 1 17  ? 2.953   27.945 -6.495  1.00 21.77 ? 43   TRP A CZ3   1 
ATOM   151  C CH2   . TRP A 1 17  ? 4.307   27.930 -6.892  1.00 21.67 ? 43   TRP A CH2   1 
ATOM   152  N N     . ALA A 1 18  ? -2.222  31.543 -7.947  1.00 23.74 ? 44   ALA A N     1 
ATOM   153  C CA    . ALA A 1 18  ? -3.583  31.920 -7.605  1.00 23.94 ? 44   ALA A CA    1 
ATOM   154  C C     . ALA A 1 18  ? -3.797  31.635 -6.129  1.00 25.17 ? 44   ALA A C     1 
ATOM   155  O O     . ALA A 1 18  ? -3.407  30.571 -5.629  1.00 24.10 ? 44   ALA A O     1 
ATOM   156  C CB    . ALA A 1 18  ? -4.576  31.122 -8.433  1.00 24.44 ? 44   ALA A CB    1 
ATOM   157  N N     . LEU A 1 19  ? -4.399  32.592 -5.428  1.00 24.46 ? 45   LEU A N     1 
ATOM   158  C CA    . LEU A 1 19  ? -4.667  32.429 -4.010  1.00 25.14 ? 45   LEU A CA    1 
ATOM   159  C C     . LEU A 1 19  ? -6.133  32.072 -3.823  1.00 24.53 ? 45   LEU A C     1 
ATOM   160  O O     . LEU A 1 19  ? -7.016  32.727 -4.381  1.00 24.03 ? 45   LEU A O     1 
ATOM   161  C CB    . LEU A 1 19  ? -4.348  33.717 -3.238  1.00 25.68 ? 45   LEU A CB    1 
ATOM   162  C CG    . LEU A 1 19  ? -4.603  33.619 -1.727  1.00 26.87 ? 45   LEU A CG    1 
ATOM   163  C CD1   . LEU A 1 19  ? -3.643  32.598 -1.117  1.00 27.54 ? 45   LEU A CD1   1 
ATOM   164  C CD2   . LEU A 1 19  ? -4.409  34.974 -1.074  1.00 27.10 ? 45   LEU A CD2   1 
ATOM   165  N N     . TRP A 1 20  ? -6.380  31.038 -3.030  1.00 23.72 ? 46   TRP A N     1 
ATOM   166  C CA    . TRP A 1 20  ? -7.730  30.567 -2.761  1.00 23.59 ? 46   TRP A CA    1 
ATOM   167  C C     . TRP A 1 20  ? -8.060  30.658 -1.279  1.00 25.64 ? 46   TRP A C     1 
ATOM   168  O O     . TRP A 1 20  ? -7.174  30.615 -0.423  1.00 28.46 ? 46   TRP A O     1 
ATOM   169  C CB    . TRP A 1 20  ? -7.888  29.111 -3.201  1.00 24.84 ? 46   TRP A CB    1 
ATOM   170  C CG    . TRP A 1 20  ? -7.586  28.852 -4.647  1.00 27.57 ? 46   TRP A CG    1 
ATOM   171  C CD1   . TRP A 1 20  ? -6.357  28.874 -5.254  1.00 26.93 ? 46   TRP A CD1   1 
ATOM   172  C CD2   . TRP A 1 20  ? -8.531  28.511 -5.666  1.00 27.07 ? 46   TRP A CD2   1 
ATOM   173  N NE1   . TRP A 1 20  ? -6.483  28.563 -6.591  1.00 26.46 ? 46   TRP A NE1   1 
ATOM   174  C CE2   . TRP A 1 20  ? -7.807  28.336 -6.869  1.00 27.04 ? 46   TRP A CE2   1 
ATOM   175  C CE3   . TRP A 1 20  ? -9.920  28.336 -5.679  1.00 27.18 ? 46   TRP A CE3   1 
ATOM   176  C CZ2   . TRP A 1 20  ? -8.428  27.992 -8.073  1.00 27.73 ? 46   TRP A CZ2   1 
ATOM   177  C CZ3   . TRP A 1 20  ? -10.540 27.993 -6.877  1.00 29.82 ? 46   TRP A CZ3   1 
ATOM   178  C CH2   . TRP A 1 20  ? -9.789  27.824 -8.059  1.00 29.02 ? 46   TRP A CH2   1 
ATOM   179  N N     . PHE A 1 21  ? -9.345  30.784 -0.981  1.00 25.13 ? 47   PHE A N     1 
ATOM   180  C CA    . PHE A 1 21  ? -9.808  30.860 0.395   1.00 27.02 ? 47   PHE A CA    1 
ATOM   181  C C     . PHE A 1 21  ? -10.901 29.817 0.604   1.00 27.04 ? 47   PHE A C     1 
ATOM   182  O O     . PHE A 1 21  ? -11.710 29.584 -0.284  1.00 26.41 ? 47   PHE A O     1 
ATOM   183  C CB    . PHE A 1 21  ? -10.384 32.250 0.685   1.00 28.08 ? 47   PHE A CB    1 
ATOM   184  C CG    . PHE A 1 21  ? -10.878 32.421 2.094   1.00 28.80 ? 47   PHE A CG    1 
ATOM   185  C CD1   . PHE A 1 21  ? -9.982  32.532 3.151   1.00 29.84 ? 47   PHE A CD1   1 
ATOM   186  C CD2   . PHE A 1 21  ? -12.242 32.476 2.363   1.00 31.47 ? 47   PHE A CD2   1 
ATOM   187  C CE1   . PHE A 1 21  ? -10.432 32.696 4.457   1.00 28.93 ? 47   PHE A CE1   1 
ATOM   188  C CE2   . PHE A 1 21  ? -12.705 32.640 3.672   1.00 30.47 ? 47   PHE A CE2   1 
ATOM   189  C CZ    . PHE A 1 21  ? -11.794 32.750 4.718   1.00 30.36 ? 47   PHE A CZ    1 
ATOM   190  N N     . PHE A 1 22  ? -10.920 29.193 1.774   1.00 27.59 ? 48   PHE A N     1 
ATOM   191  C CA    . PHE A 1 22  ? -11.938 28.198 2.087   1.00 30.02 ? 48   PHE A CA    1 
ATOM   192  C C     . PHE A 1 22  ? -12.665 28.571 3.383   1.00 33.23 ? 48   PHE A C     1 
ATOM   193  O O     . PHE A 1 22  ? -12.038 28.782 4.421   1.00 32.94 ? 48   PHE A O     1 
ATOM   194  C CB    . PHE A 1 22  ? -11.305 26.813 2.238   1.00 29.35 ? 48   PHE A CB    1 
ATOM   195  C CG    . PHE A 1 22  ? -12.276 25.756 2.655   1.00 29.92 ? 48   PHE A CG    1 
ATOM   196  C CD1   . PHE A 1 22  ? -12.995 25.042 1.708   1.00 31.53 ? 48   PHE A CD1   1 
ATOM   197  C CD2   . PHE A 1 22  ? -12.506 25.501 4.000   1.00 30.77 ? 48   PHE A CD2   1 
ATOM   198  C CE1   . PHE A 1 22  ? -13.929 24.089 2.094   1.00 29.39 ? 48   PHE A CE1   1 
ATOM   199  C CE2   . PHE A 1 22  ? -13.439 24.551 4.395   1.00 30.83 ? 48   PHE A CE2   1 
ATOM   200  C CZ    . PHE A 1 22  ? -14.152 23.845 3.438   1.00 28.95 ? 48   PHE A CZ    1 
ATOM   201  N N     . LYS A 1 23  ? -13.988 28.656 3.310   1.00 37.20 ? 49   LYS A N     1 
ATOM   202  C CA    . LYS A 1 23  ? -14.815 29.001 4.465   1.00 42.66 ? 49   LYS A CA    1 
ATOM   203  C C     . LYS A 1 23  ? -15.721 27.819 4.779   1.00 44.98 ? 49   LYS A C     1 
ATOM   204  O O     . LYS A 1 23  ? -16.614 27.504 3.998   1.00 45.20 ? 49   LYS A O     1 
ATOM   205  C CB    . LYS A 1 23  ? -15.680 30.219 4.144   1.00 45.44 ? 49   LYS A CB    1 
ATOM   206  C CG    . LYS A 1 23  ? -16.507 30.739 5.313   1.00 48.47 ? 49   LYS A CG    1 
ATOM   207  C CD    . LYS A 1 23  ? -15.631 31.449 6.334   1.00 50.90 ? 49   LYS A CD    1 
ATOM   208  C CE    . LYS A 1 23  ? -16.469 32.240 7.334   1.00 51.44 ? 49   LYS A CE    1 
ATOM   209  N NZ    . LYS A 1 23  ? -17.388 31.372 8.131   1.00 52.54 ? 49   LYS A NZ    1 
ATOM   210  N N     . ASN A 1 24  ? -15.506 27.173 5.920   1.00 47.98 ? 50   ASN A N     1 
ATOM   211  C CA    . ASN A 1 24  ? -16.317 26.016 6.290   1.00 52.24 ? 50   ASN A CA    1 
ATOM   212  C C     . ASN A 1 24  ? -17.771 26.389 6.565   1.00 53.47 ? 50   ASN A C     1 
ATOM   213  O O     . ASN A 1 24  ? -18.059 27.264 7.382   1.00 52.25 ? 50   ASN A O     1 
ATOM   214  C CB    . ASN A 1 24  ? -15.720 25.317 7.515   1.00 54.20 ? 50   ASN A CB    1 
ATOM   215  C CG    . ASN A 1 24  ? -16.203 23.886 7.659   1.00 55.99 ? 50   ASN A CG    1 
ATOM   216  O OD1   . ASN A 1 24  ? -16.047 23.072 6.747   1.00 56.46 ? 50   ASN A OD1   1 
ATOM   217  N ND2   . ASN A 1 24  ? -16.790 23.570 8.809   1.00 58.57 ? 50   ASN A ND2   1 
ATOM   218  N N     . ASP A 1 25  ? -18.682 25.716 5.871   1.00 56.49 ? 51   ASP A N     1 
ATOM   219  C CA    . ASP A 1 25  ? -20.110 25.967 6.023   1.00 58.61 ? 51   ASP A CA    1 
ATOM   220  C C     . ASP A 1 25  ? -20.782 24.742 6.638   1.00 60.49 ? 51   ASP A C     1 
ATOM   221  O O     . ASP A 1 25  ? -21.976 24.757 6.946   1.00 62.09 ? 51   ASP A O     1 
ATOM   222  C CB    . ASP A 1 25  ? -20.725 26.285 4.661   1.00 59.33 ? 51   ASP A CB    1 
ATOM   223  C CG    . ASP A 1 25  ? -22.120 26.864 4.771   1.00 61.08 ? 51   ASP A CG    1 
ATOM   224  O OD1   . ASP A 1 25  ? -23.028 26.146 5.241   1.00 61.57 ? 51   ASP A OD1   1 
ATOM   225  O OD2   . ASP A 1 25  ? -22.306 28.041 4.390   1.00 61.63 ? 51   ASP A OD2   1 
ATOM   226  N N     . LYS A 1 26  ? -19.995 23.684 6.811   1.00 61.47 ? 52   LYS A N     1 
ATOM   227  C CA    . LYS A 1 26  ? -20.460 22.431 7.401   1.00 62.11 ? 52   LYS A CA    1 
ATOM   228  C C     . LYS A 1 26  ? -21.540 21.737 6.573   1.00 61.45 ? 52   LYS A C     1 
ATOM   229  O O     . LYS A 1 26  ? -21.557 20.509 6.467   1.00 60.30 ? 52   LYS A O     1 
ATOM   230  C CB    . LYS A 1 26  ? -20.978 22.682 8.822   1.00 64.36 ? 52   LYS A CB    1 
ATOM   231  C CG    . LYS A 1 26  ? -20.923 21.460 9.733   1.00 65.89 ? 52   LYS A CG    1 
ATOM   232  C CD    . LYS A 1 26  ? -19.486 20.981 9.942   1.00 66.57 ? 52   LYS A CD    1 
ATOM   233  C CE    . LYS A 1 26  ? -18.639 22.027 10.654  1.00 67.70 ? 52   LYS A CE    1 
ATOM   234  N NZ    . LYS A 1 26  ? -17.222 21.590 10.823  1.00 67.82 ? 52   LYS A NZ    1 
ATOM   235  N N     . SER A 1 27  ? -22.438 22.523 5.987   1.00 60.61 ? 53   SER A N     1 
ATOM   236  C CA    . SER A 1 27  ? -23.517 21.977 5.172   1.00 59.77 ? 53   SER A CA    1 
ATOM   237  C C     . SER A 1 27  ? -23.111 21.826 3.707   1.00 58.66 ? 53   SER A C     1 
ATOM   238  O O     . SER A 1 27  ? -23.095 20.716 3.173   1.00 59.76 ? 53   SER A O     1 
ATOM   239  C CB    . SER A 1 27  ? -24.751 22.875 5.268   1.00 59.88 ? 53   SER A CB    1 
ATOM   240  O OG    . SER A 1 27  ? -24.447 24.195 4.855   1.00 60.50 ? 53   SER A OG    1 
ATOM   241  N N     . LYS A 1 28  ? -22.786 22.945 3.062   1.00 55.59 ? 54   LYS A N     1 
ATOM   242  C CA    . LYS A 1 28  ? -22.390 22.936 1.659   1.00 52.59 ? 54   LYS A CA    1 
ATOM   243  C C     . LYS A 1 28  ? -21.306 21.903 1.352   1.00 50.26 ? 54   LYS A C     1 
ATOM   244  O O     . LYS A 1 28  ? -20.621 21.411 2.249   1.00 48.27 ? 54   LYS A O     1 
ATOM   245  C CB    . LYS A 1 28  ? -21.875 24.314 1.239   1.00 54.22 ? 54   LYS A CB    1 
ATOM   246  C CG    . LYS A 1 28  ? -22.873 25.451 1.345   1.00 54.60 ? 54   LYS A CG    1 
ATOM   247  C CD    . LYS A 1 28  ? -22.308 26.685 0.644   1.00 58.50 ? 54   LYS A CD    1 
ATOM   248  C CE    . LYS A 1 28  ? -23.235 27.895 0.738   1.00 60.13 ? 54   LYS A CE    1 
ATOM   249  N NZ    . LYS A 1 28  ? -23.356 28.408 2.133   1.00 61.84 ? 54   LYS A NZ    1 
ATOM   250  N N     . THR A 1 29  ? -21.163 21.578 0.071   1.00 47.92 ? 55   THR A N     1 
ATOM   251  C CA    . THR A 1 29  ? -20.150 20.632 -0.375  1.00 45.98 ? 55   THR A CA    1 
ATOM   252  C C     . THR A 1 29  ? -18.801 21.307 -0.155  1.00 43.52 ? 55   THR A C     1 
ATOM   253  O O     . THR A 1 29  ? -18.708 22.533 -0.174  1.00 43.86 ? 55   THR A O     1 
ATOM   254  C CB    . THR A 1 29  ? -20.305 20.312 -1.880  1.00 46.09 ? 55   THR A CB    1 
ATOM   255  O OG1   . THR A 1 29  ? -21.530 19.608 -2.095  1.00 46.17 ? 55   THR A OG1   1 
ATOM   256  C CG2   . THR A 1 29  ? -19.153 19.454 -2.373  1.00 48.34 ? 55   THR A CG2   1 
ATOM   257  N N     . TRP A 1 30  ? -17.759 20.515 0.055   1.00 40.78 ? 56   TRP A N     1 
ATOM   258  C CA    . TRP A 1 30  ? -16.435 21.079 0.275   1.00 38.38 ? 56   TRP A CA    1 
ATOM   259  C C     . TRP A 1 30  ? -16.057 22.053 -0.846  1.00 38.56 ? 56   TRP A C     1 
ATOM   260  O O     . TRP A 1 30  ? -15.619 23.169 -0.584  1.00 38.60 ? 56   TRP A O     1 
ATOM   261  C CB    . TRP A 1 30  ? -15.391 19.964 0.366   1.00 34.49 ? 56   TRP A CB    1 
ATOM   262  C CG    . TRP A 1 30  ? -14.005 20.486 0.614   1.00 32.72 ? 56   TRP A CG    1 
ATOM   263  C CD1   . TRP A 1 30  ? -13.451 20.800 1.820   1.00 30.45 ? 56   TRP A CD1   1 
ATOM   264  C CD2   . TRP A 1 30  ? -13.023 20.813 -0.376  1.00 29.61 ? 56   TRP A CD2   1 
ATOM   265  N NE1   . TRP A 1 30  ? -12.188 21.304 1.644   1.00 28.30 ? 56   TRP A NE1   1 
ATOM   266  C CE2   . TRP A 1 30  ? -11.900 21.325 0.305   1.00 30.44 ? 56   TRP A CE2   1 
ATOM   267  C CE3   . TRP A 1 30  ? -12.987 20.725 -1.774  1.00 30.29 ? 56   TRP A CE3   1 
ATOM   268  C CZ2   . TRP A 1 30  ? -10.746 21.751 -0.365  1.00 30.06 ? 56   TRP A CZ2   1 
ATOM   269  C CZ3   . TRP A 1 30  ? -11.844 21.148 -2.440  1.00 30.32 ? 56   TRP A CZ3   1 
ATOM   270  C CH2   . TRP A 1 30  ? -10.738 21.656 -1.734  1.00 31.56 ? 56   TRP A CH2   1 
ATOM   271  N N     . GLN A 1 31  ? -16.231 21.627 -2.094  1.00 39.24 ? 57   GLN A N     1 
ATOM   272  C CA    . GLN A 1 31  ? -15.899 22.461 -3.249  1.00 39.93 ? 57   GLN A CA    1 
ATOM   273  C C     . GLN A 1 31  ? -16.662 23.787 -3.303  1.00 38.86 ? 57   GLN A C     1 
ATOM   274  O O     . GLN A 1 31  ? -16.115 24.803 -3.741  1.00 38.42 ? 57   GLN A O     1 
ATOM   275  C CB    . GLN A 1 31  ? -16.143 21.684 -4.550  1.00 42.29 ? 57   GLN A CB    1 
ATOM   276  C CG    . GLN A 1 31  ? -15.645 22.408 -5.799  1.00 48.03 ? 57   GLN A CG    1 
ATOM   277  C CD    . GLN A 1 31  ? -15.777 21.579 -7.070  1.00 50.02 ? 57   GLN A CD    1 
ATOM   278  O OE1   . GLN A 1 31  ? -16.882 21.220 -7.481  1.00 53.69 ? 57   GLN A OE1   1 
ATOM   279  N NE2   . GLN A 1 31  ? -14.645 21.274 -7.698  1.00 51.23 ? 57   GLN A NE2   1 
ATOM   280  N N     . ALA A 1 32  ? -17.918 23.778 -2.860  1.00 37.53 ? 58   ALA A N     1 
ATOM   281  C CA    . ALA A 1 32  ? -18.749 24.985 -2.869  1.00 35.65 ? 58   ALA A CA    1 
ATOM   282  C C     . ALA A 1 32  ? -18.279 26.033 -1.859  1.00 35.18 ? 58   ALA A C     1 
ATOM   283  O O     . ALA A 1 32  ? -18.678 27.196 -1.932  1.00 33.98 ? 58   ALA A O     1 
ATOM   284  C CB    . ALA A 1 32  ? -20.210 24.621 -2.599  1.00 34.52 ? 58   ALA A CB    1 
ATOM   285  N N     . ASN A 1 33  ? -17.443 25.618 -0.913  1.00 33.98 ? 59   ASN A N     1 
ATOM   286  C CA    . ASN A 1 33  ? -16.910 26.534 0.100   1.00 33.20 ? 59   ASN A CA    1 
ATOM   287  C C     . ASN A 1 33  ? -15.557 27.078 -0.339  1.00 32.94 ? 59   ASN A C     1 
ATOM   288  O O     . ASN A 1 33  ? -14.960 27.905 0.346   1.00 33.14 ? 59   ASN A O     1 
ATOM   289  C CB    . ASN A 1 33  ? -16.723 25.819 1.441   1.00 32.09 ? 59   ASN A CB    1 
ATOM   290  C CG    . ASN A 1 33  ? -18.026 25.565 2.156   1.00 33.32 ? 59   ASN A CG    1 
ATOM   291  O OD1   . ASN A 1 33  ? -18.894 26.438 2.222   1.00 33.02 ? 59   ASN A OD1   1 
ATOM   292  N ND2   . ASN A 1 33  ? -18.166 24.374 2.717   1.00 33.23 ? 59   ASN A ND2   1 
ATOM   293  N N     . ARG A 1 35  ? -13.243 29.248 -2.825  1.00 37.06 ? 61   ARG A N     1 
ATOM   294  C CA    . ARG A 1 35  ? -13.341 30.363 -3.757  1.00 37.11 ? 61   ARG A CA    1 
ATOM   295  C C     . ARG A 1 35  ? -12.006 31.049 -4.037  1.00 36.06 ? 61   ARG A C     1 
ATOM   296  O O     . ARG A 1 35  ? -11.166 31.204 -3.146  1.00 35.46 ? 61   ARG A O     1 
ATOM   297  C CB    . ARG A 1 35  ? -14.360 31.385 -3.238  1.00 41.27 ? 61   ARG A CB    1 
ATOM   298  C CG    . ARG A 1 35  ? -15.813 30.888 -3.247  1.00 47.10 ? 61   ARG A CG    1 
ATOM   299  C CD    . ARG A 1 35  ? -16.327 30.700 -4.671  1.00 52.56 ? 61   ARG A CD    1 
ATOM   300  N NE    . ARG A 1 35  ? -17.730 30.281 -4.734  1.00 57.36 ? 61   ARG A NE    1 
ATOM   301  C CZ    . ARG A 1 35  ? -18.156 29.027 -4.596  1.00 58.85 ? 61   ARG A CZ    1 
ATOM   302  N NH1   . ARG A 1 35  ? -17.291 28.043 -4.384  1.00 59.92 ? 61   ARG A NH1   1 
ATOM   303  N NH2   . ARG A 1 35  ? -19.452 28.753 -4.672  1.00 59.24 ? 61   ARG A NH2   1 
ATOM   304  N N     . LEU A 1 36  ? -11.823 31.459 -5.289  1.00 34.31 ? 62   LEU A N     1 
ATOM   305  C CA    . LEU A 1 36  ? -10.608 32.138 -5.727  1.00 34.05 ? 62   LEU A CA    1 
ATOM   306  C C     . LEU A 1 36  ? -10.588 33.582 -5.242  1.00 33.94 ? 62   LEU A C     1 
ATOM   307  O O     . LEU A 1 36  ? -11.608 34.266 -5.273  1.00 34.66 ? 62   LEU A O     1 
ATOM   308  C CB    . LEU A 1 36  ? -10.525 32.128 -7.253  1.00 34.78 ? 62   LEU A CB    1 
ATOM   309  C CG    . LEU A 1 36  ? -9.386  32.923 -7.897  1.00 37.74 ? 62   LEU A CG    1 
ATOM   310  C CD1   . LEU A 1 36  ? -8.052  32.283 -7.554  1.00 34.67 ? 62   LEU A CD1   1 
ATOM   311  C CD2   . LEU A 1 36  ? -9.579  32.967 -9.412  1.00 38.81 ? 62   LEU A CD2   1 
ATOM   312  N N     . ILE A 1 37  ? -9.431  34.041 -4.779  1.00 33.25 ? 63   ILE A N     1 
ATOM   313  C CA    . ILE A 1 37  ? -9.297  35.416 -4.322  1.00 32.62 ? 63   ILE A CA    1 
ATOM   314  C C     . ILE A 1 37  ? -8.776  36.213 -5.513  1.00 33.72 ? 63   ILE A C     1 
ATOM   315  O O     . ILE A 1 37  ? -9.493  37.041 -6.072  1.00 34.96 ? 63   ILE A O     1 
ATOM   316  C CB    . ILE A 1 37  ? -8.328  35.517 -3.129  1.00 32.35 ? 63   ILE A CB    1 
ATOM   317  C CG1   . ILE A 1 37  ? -8.932  34.794 -1.920  1.00 33.41 ? 63   ILE A CG1   1 
ATOM   318  C CG2   . ILE A 1 37  ? -8.071  36.970 -2.783  1.00 32.18 ? 63   ILE A CG2   1 
ATOM   319  C CD1   . ILE A 1 37  ? -10.297 35.308 -1.375  1.00 35.61 ? 63   ILE A CD1   1 
ATOM   320  N N     . SER A 1 38  ? -7.534  35.950 -5.910  1.00 30.77 ? 64   SER A N     1 
ATOM   321  C CA    . SER A 1 38  ? -6.948  36.620 -7.057  1.00 28.81 ? 64   SER A CA    1 
ATOM   322  C C     . SER A 1 38  ? -5.687  35.892 -7.488  1.00 28.16 ? 64   SER A C     1 
ATOM   323  O O     . SER A 1 38  ? -5.295  34.904 -6.866  1.00 27.54 ? 64   SER A O     1 
ATOM   324  C CB    . SER A 1 38  ? -6.622  38.077 -6.727  1.00 30.80 ? 64   SER A CB    1 
ATOM   325  O OG    . SER A 1 38  ? -5.712  38.161 -5.652  1.00 32.81 ? 64   SER A OG    1 
ATOM   326  N N     . LYS A 1 39  ? -5.061  36.387 -8.551  1.00 26.41 ? 65   LYS A N     1 
ATOM   327  C CA    . LYS A 1 39  ? -3.840  35.802 -9.100  1.00 27.37 ? 65   LYS A CA    1 
ATOM   328  C C     . LYS A 1 39  ? -2.759  36.870 -9.256  1.00 27.62 ? 65   LYS A C     1 
ATOM   329  O O     . LYS A 1 39  ? -3.053  38.066 -9.241  1.00 28.08 ? 65   LYS A O     1 
ATOM   330  C CB    . LYS A 1 39  ? -4.130  35.183 -10.465 1.00 27.28 ? 65   LYS A CB    1 
ATOM   331  C CG    . LYS A 1 39  ? -5.299  34.218 -10.452 1.00 31.07 ? 65   LYS A CG    1 
ATOM   332  C CD    . LYS A 1 39  ? -5.463  33.538 -11.797 1.00 30.91 ? 65   LYS A CD    1 
ATOM   333  C CE    . LYS A 1 39  ? -6.588  32.522 -11.749 1.00 33.31 ? 65   LYS A CE    1 
ATOM   334  N NZ    . LYS A 1 39  ? -6.668  31.740 -13.003 1.00 35.85 ? 65   LYS A NZ    1 
ATOM   335  N N     . PHE A 1 40  ? -1.512  36.439 -9.419  1.00 26.15 ? 66   PHE A N     1 
ATOM   336  C CA    . PHE A 1 40  ? -0.401  37.369 -9.573  1.00 25.89 ? 66   PHE A CA    1 
ATOM   337  C C     . PHE A 1 40  ? 0.790   36.637 -10.174 1.00 26.97 ? 66   PHE A C     1 
ATOM   338  O O     . PHE A 1 40  ? 0.877   35.416 -10.082 1.00 29.27 ? 66   PHE A O     1 
ATOM   339  C CB    . PHE A 1 40  ? -0.022  37.944 -8.207  1.00 27.07 ? 66   PHE A CB    1 
ATOM   340  C CG    . PHE A 1 40  ? 0.464   36.906 -7.223  1.00 26.42 ? 66   PHE A CG    1 
ATOM   341  C CD1   . PHE A 1 40  ? 1.781   36.450 -7.258  1.00 25.68 ? 66   PHE A CD1   1 
ATOM   342  C CD2   . PHE A 1 40  ? -0.396  36.385 -6.262  1.00 24.61 ? 66   PHE A CD2   1 
ATOM   343  C CE1   . PHE A 1 40  ? 2.235   35.492 -6.345  1.00 23.05 ? 66   PHE A CE1   1 
ATOM   344  C CE2   . PHE A 1 40  ? 0.050   35.426 -5.346  1.00 23.22 ? 66   PHE A CE2   1 
ATOM   345  C CZ    . PHE A 1 40  ? 1.368   34.983 -5.390  1.00 21.55 ? 66   PHE A CZ    1 
ATOM   346  N N     . ASP A 1 41  ? 1.707   37.374 -10.791 1.00 27.12 ? 67   ASP A N     1 
ATOM   347  C CA    . ASP A 1 41  ? 2.883   36.753 -11.383 1.00 28.23 ? 67   ASP A CA    1 
ATOM   348  C C     . ASP A 1 41  ? 4.126   37.635 -11.318 1.00 27.44 ? 67   ASP A C     1 
ATOM   349  O O     . ASP A 1 41  ? 5.008   37.538 -12.166 1.00 27.91 ? 67   ASP A O     1 
ATOM   350  C CB    . ASP A 1 41  ? 2.614   36.360 -12.835 1.00 29.31 ? 67   ASP A CB    1 
ATOM   351  C CG    . ASP A 1 41  ? 2.294   37.551 -13.707 1.00 31.77 ? 67   ASP A CG    1 
ATOM   352  O OD1   . ASP A 1 41  ? 2.452   38.695 -13.232 1.00 32.22 ? 67   ASP A OD1   1 
ATOM   353  O OD2   . ASP A 1 41  ? 1.890   37.340 -14.869 1.00 33.62 ? 67   ASP A OD2   1 
ATOM   354  N N     . THR A 1 42  ? 4.178   38.506 -10.317 1.00 26.14 ? 68   THR A N     1 
ATOM   355  C CA    . THR A 1 42  ? 5.331   39.377 -10.108 1.00 25.04 ? 68   THR A CA    1 
ATOM   356  C C     . THR A 1 42  ? 5.515   39.498 -8.605  1.00 24.34 ? 68   THR A C     1 
ATOM   357  O O     . THR A 1 42  ? 4.580   39.259 -7.840  1.00 21.62 ? 68   THR A O     1 
ATOM   358  C CB    . THR A 1 42  ? 5.116   40.801 -10.667 1.00 23.26 ? 68   THR A CB    1 
ATOM   359  O OG1   . THR A 1 42  ? 4.056   41.438 -9.944  1.00 24.39 ? 68   THR A OG1   1 
ATOM   360  C CG2   . THR A 1 42  ? 4.779   40.753 -12.150 1.00 23.01 ? 68   THR A CG2   1 
ATOM   361  N N     . VAL A 1 43  ? 6.722   39.863 -8.186  1.00 23.71 ? 69   VAL A N     1 
ATOM   362  C CA    . VAL A 1 43  ? 7.022   40.024 -6.771  1.00 25.05 ? 69   VAL A CA    1 
ATOM   363  C C     . VAL A 1 43  ? 6.172   41.140 -6.161  1.00 25.44 ? 69   VAL A C     1 
ATOM   364  O O     . VAL A 1 43  ? 5.582   40.972 -5.097  1.00 26.19 ? 69   VAL A O     1 
ATOM   365  C CB    . VAL A 1 43  ? 8.524   40.342 -6.572  1.00 25.74 ? 69   VAL A CB    1 
ATOM   366  C CG1   . VAL A 1 43  ? 8.802   40.741 -5.134  1.00 24.18 ? 69   VAL A CG1   1 
ATOM   367  C CG2   . VAL A 1 43  ? 9.356   39.125 -6.954  1.00 23.50 ? 69   VAL A CG2   1 
ATOM   368  N N     . GLU A 1 44  ? 6.103   42.275 -6.847  1.00 26.63 ? 70   GLU A N     1 
ATOM   369  C CA    . GLU A 1 44  ? 5.339   43.412 -6.354  1.00 26.15 ? 70   GLU A CA    1 
ATOM   370  C C     . GLU A 1 44  ? 3.875   43.059 -6.143  1.00 26.28 ? 70   GLU A C     1 
ATOM   371  O O     . GLU A 1 44  ? 3.268   43.464 -5.148  1.00 26.69 ? 70   GLU A O     1 
ATOM   372  C CB    . GLU A 1 44  ? 5.450   44.598 -7.325  1.00 28.51 ? 70   GLU A CB    1 
ATOM   373  C CG    . GLU A 1 44  ? 6.830   45.280 -7.389  1.00 27.58 ? 70   GLU A CG    1 
ATOM   374  C CD    . GLU A 1 44  ? 7.905   44.438 -8.071  1.00 30.90 ? 70   GLU A CD    1 
ATOM   375  O OE1   . GLU A 1 44  ? 7.580   43.366 -8.627  1.00 30.36 ? 70   GLU A OE1   1 
ATOM   376  O OE2   . GLU A 1 44  ? 9.085   44.861 -8.062  1.00 33.88 ? 70   GLU A OE2   1 
ATOM   377  N N     . ASP A 1 45  ? 3.300   42.304 -7.074  1.00 26.84 ? 71   ASP A N     1 
ATOM   378  C CA    . ASP A 1 45  ? 1.899   41.932 -6.955  1.00 26.74 ? 71   ASP A CA    1 
ATOM   379  C C     . ASP A 1 45  ? 1.671   40.910 -5.840  1.00 27.01 ? 71   ASP A C     1 
ATOM   380  O O     . ASP A 1 45  ? 0.605   40.878 -5.216  1.00 27.11 ? 71   ASP A O     1 
ATOM   381  C CB    . ASP A 1 45  ? 1.368   41.455 -8.312  1.00 26.40 ? 71   ASP A CB    1 
ATOM   382  C CG    . ASP A 1 45  ? 1.284   42.602 -9.327  1.00 29.61 ? 71   ASP A CG    1 
ATOM   383  O OD1   . ASP A 1 45  ? 0.737   43.664 -8.965  1.00 29.93 ? 71   ASP A OD1   1 
ATOM   384  O OD2   . ASP A 1 45  ? 1.764   42.462 -10.472 1.00 30.66 ? 71   ASP A OD2   1 
ATOM   385  N N     . PHE A 1 46  ? 2.676   40.090 -5.562  1.00 25.13 ? 72   PHE A N     1 
ATOM   386  C CA    . PHE A 1 46  ? 2.534   39.137 -4.479  1.00 24.13 ? 72   PHE A CA    1 
ATOM   387  C C     . PHE A 1 46  ? 2.340   39.904 -3.169  1.00 23.91 ? 72   PHE A C     1 
ATOM   388  O O     . PHE A 1 46  ? 1.386   39.660 -2.431  1.00 23.59 ? 72   PHE A O     1 
ATOM   389  C CB    . PHE A 1 46  ? 3.770   38.247 -4.358  1.00 24.11 ? 72   PHE A CB    1 
ATOM   390  C CG    . PHE A 1 46  ? 3.852   37.518 -3.046  1.00 22.79 ? 72   PHE A CG    1 
ATOM   391  C CD1   . PHE A 1 46  ? 2.981   36.472 -2.760  1.00 23.37 ? 72   PHE A CD1   1 
ATOM   392  C CD2   . PHE A 1 46  ? 4.768   37.913 -2.074  1.00 22.82 ? 72   PHE A CD2   1 
ATOM   393  C CE1   . PHE A 1 46  ? 3.016   35.827 -1.526  1.00 24.66 ? 72   PHE A CE1   1 
ATOM   394  C CE2   . PHE A 1 46  ? 4.816   37.278 -0.832  1.00 22.53 ? 72   PHE A CE2   1 
ATOM   395  C CZ    . PHE A 1 46  ? 3.938   36.231 -0.556  1.00 23.25 ? 72   PHE A CZ    1 
ATOM   396  N N     . TRP A 1 47  ? 3.235   40.849 -2.891  1.00 24.53 ? 73   TRP A N     1 
ATOM   397  C CA    . TRP A 1 47  ? 3.154   41.617 -1.650  1.00 22.69 ? 73   TRP A CA    1 
ATOM   398  C C     . TRP A 1 47  ? 1.896   42.462 -1.515  1.00 23.86 ? 73   TRP A C     1 
ATOM   399  O O     . TRP A 1 47  ? 1.344   42.583 -0.419  1.00 23.08 ? 73   TRP A O     1 
ATOM   400  C CB    . TRP A 1 47  ? 4.392   42.498 -1.491  1.00 21.08 ? 73   TRP A CB    1 
ATOM   401  C CG    . TRP A 1 47  ? 5.635   41.716 -1.177  1.00 21.12 ? 73   TRP A CG    1 
ATOM   402  C CD1   . TRP A 1 47  ? 6.768   41.635 -1.932  1.00 18.69 ? 73   TRP A CD1   1 
ATOM   403  C CD2   . TRP A 1 47  ? 5.868   40.914 -0.016  1.00 23.06 ? 73   TRP A CD2   1 
ATOM   404  N NE1   . TRP A 1 47  ? 7.694   40.835 -1.314  1.00 21.89 ? 73   TRP A NE1   1 
ATOM   405  C CE2   . TRP A 1 47  ? 7.168   40.377 -0.135  1.00 21.21 ? 73   TRP A CE2   1 
ATOM   406  C CE3   . TRP A 1 47  ? 5.101   40.594 1.117   1.00 24.21 ? 73   TRP A CE3   1 
ATOM   407  C CZ2   . TRP A 1 47  ? 7.724   39.538 0.837   1.00 22.85 ? 73   TRP A CZ2   1 
ATOM   408  C CZ3   . TRP A 1 47  ? 5.656   39.757 2.085   1.00 23.25 ? 73   TRP A CZ3   1 
ATOM   409  C CH2   . TRP A 1 47  ? 6.953   39.242 1.937   1.00 22.15 ? 73   TRP A CH2   1 
ATOM   410  N N     . ALA A 1 48  ? 1.453   43.051 -2.622  1.00 24.85 ? 74   ALA A N     1 
ATOM   411  C CA    . ALA A 1 48  ? 0.248   43.877 -2.629  1.00 26.39 ? 74   ALA A CA    1 
ATOM   412  C C     . ALA A 1 48  ? -0.937  43.041 -2.159  1.00 27.45 ? 74   ALA A C     1 
ATOM   413  O O     . ALA A 1 48  ? -1.790  43.518 -1.415  1.00 28.87 ? 74   ALA A O     1 
ATOM   414  C CB    . ALA A 1 48  ? -0.017  44.411 -4.031  1.00 25.28 ? 74   ALA A CB    1 
ATOM   415  N N     . LEU A 1 49  ? -0.989  41.787 -2.599  1.00 27.89 ? 75   LEU A N     1 
ATOM   416  C CA    . LEU A 1 49  ? -2.069  40.895 -2.193  1.00 27.91 ? 75   LEU A CA    1 
ATOM   417  C C     . LEU A 1 49  ? -1.842  40.476 -0.744  1.00 27.22 ? 75   LEU A C     1 
ATOM   418  O O     . LEU A 1 49  ? -2.714  40.629 0.112   1.00 26.76 ? 75   LEU A O     1 
ATOM   419  C CB    . LEU A 1 49  ? -2.092  39.658 -3.091  1.00 27.64 ? 75   LEU A CB    1 
ATOM   420  C CG    . LEU A 1 49  ? -3.023  38.503 -2.712  1.00 26.50 ? 75   LEU A CG    1 
ATOM   421  C CD1   . LEU A 1 49  ? -4.459  38.964 -2.706  1.00 26.09 ? 75   LEU A CD1   1 
ATOM   422  C CD2   . LEU A 1 49  ? -2.838  37.370 -3.714  1.00 26.90 ? 75   LEU A CD2   1 
ATOM   423  N N     . TYR A 1 50  ? -0.649  39.962 -0.476  1.00 27.27 ? 76   TYR A N     1 
ATOM   424  C CA    . TYR A 1 50  ? -0.301  39.518 0.859   1.00 28.20 ? 76   TYR A CA    1 
ATOM   425  C C     . TYR A 1 50  ? -0.537  40.573 1.939   1.00 28.70 ? 76   TYR A C     1 
ATOM   426  O O     . TYR A 1 50  ? -1.112  40.277 2.985   1.00 28.22 ? 76   TYR A O     1 
ATOM   427  C CB    . TYR A 1 50  ? 1.163   39.096 0.918   1.00 27.90 ? 76   TYR A CB    1 
ATOM   428  C CG    . TYR A 1 50  ? 1.546   38.545 2.272   1.00 27.71 ? 76   TYR A CG    1 
ATOM   429  C CD1   . TYR A 1 50  ? 1.216   37.236 2.632   1.00 29.35 ? 76   TYR A CD1   1 
ATOM   430  C CD2   . TYR A 1 50  ? 2.183   39.348 3.219   1.00 30.99 ? 76   TYR A CD2   1 
ATOM   431  C CE1   . TYR A 1 50  ? 1.509   36.737 3.904   1.00 28.87 ? 76   TYR A CE1   1 
ATOM   432  C CE2   . TYR A 1 50  ? 2.480   38.863 4.497   1.00 28.87 ? 76   TYR A CE2   1 
ATOM   433  C CZ    . TYR A 1 50  ? 2.138   37.555 4.831   1.00 29.23 ? 76   TYR A CZ    1 
ATOM   434  O OH    . TYR A 1 50  ? 2.412   37.076 6.094   1.00 24.90 ? 76   TYR A OH    1 
ATOM   435  N N     . ASN A 1 51  ? -0.093  41.799 1.686   1.00 28.88 ? 77   ASN A N     1 
ATOM   436  C CA    . ASN A 1 51  ? -0.226  42.873 2.672   1.00 31.16 ? 77   ASN A CA    1 
ATOM   437  C C     . ASN A 1 51  ? -1.636  43.292 3.037   1.00 32.14 ? 77   ASN A C     1 
ATOM   438  O O     . ASN A 1 51  ? -1.826  43.917 4.076   1.00 32.67 ? 77   ASN A O     1 
ATOM   439  C CB    . ASN A 1 51  ? 0.552   44.119 2.229   1.00 29.91 ? 77   ASN A CB    1 
ATOM   440  C CG    . ASN A 1 51  ? 2.053   43.945 2.348   1.00 30.21 ? 77   ASN A CG    1 
ATOM   441  O OD1   . ASN A 1 51  ? 2.815   44.700 1.753   1.00 34.91 ? 77   ASN A OD1   1 
ATOM   442  N ND2   . ASN A 1 51  ? 2.485   42.957 3.124   1.00 29.98 ? 77   ASN A ND2   1 
ATOM   443  N N     . HIS A 1 52  ? -2.628  42.965 2.212   1.00 33.36 ? 78   HIS A N     1 
ATOM   444  C CA    . HIS A 1 52  ? -3.982  43.372 2.555   1.00 33.57 ? 78   HIS A CA    1 
ATOM   445  C C     . HIS A 1 52  ? -4.942  42.254 2.950   1.00 32.18 ? 78   HIS A C     1 
ATOM   446  O O     . HIS A 1 52  ? -6.133  42.491 3.129   1.00 30.59 ? 78   HIS A O     1 
ATOM   447  C CB    . HIS A 1 52  ? -4.593  44.223 1.435   1.00 39.55 ? 78   HIS A CB    1 
ATOM   448  C CG    . HIS A 1 52  ? -5.299  43.435 0.378   1.00 43.92 ? 78   HIS A CG    1 
ATOM   449  N ND1   . HIS A 1 52  ? -4.634  42.783 -0.637  1.00 46.78 ? 78   HIS A ND1   1 
ATOM   450  C CD2   . HIS A 1 52  ? -6.618  43.209 0.172   1.00 46.50 ? 78   HIS A CD2   1 
ATOM   451  C CE1   . HIS A 1 52  ? -5.514  42.192 -1.426  1.00 47.88 ? 78   HIS A CE1   1 
ATOM   452  N NE2   . HIS A 1 52  ? -6.725  42.435 -0.957  1.00 47.83 ? 78   HIS A NE2   1 
ATOM   453  N N     . ILE A 1 53  ? -4.439  41.034 3.092   1.00 31.36 ? 79   ILE A N     1 
ATOM   454  C CA    . ILE A 1 53  ? -5.310  39.944 3.514   1.00 29.31 ? 79   ILE A CA    1 
ATOM   455  C C     . ILE A 1 53  ? -4.971  39.565 4.951   1.00 26.54 ? 79   ILE A C     1 
ATOM   456  O O     . ILE A 1 53  ? -3.870  39.835 5.429   1.00 25.79 ? 79   ILE A O     1 
ATOM   457  C CB    . ILE A 1 53  ? -5.193  38.691 2.586   1.00 29.07 ? 79   ILE A CB    1 
ATOM   458  C CG1   . ILE A 1 53  ? -3.755  38.177 2.547   1.00 29.57 ? 79   ILE A CG1   1 
ATOM   459  C CG2   . ILE A 1 53  ? -5.677  39.041 1.192   1.00 27.68 ? 79   ILE A CG2   1 
ATOM   460  C CD1   . ILE A 1 53  ? -3.589  36.770 1.976   1.00 35.61 ? 79   ILE A CD1   1 
ATOM   461  N N     . GLN A 1 54  ? -5.925  38.950 5.637   1.00 25.74 ? 80   GLN A N     1 
ATOM   462  C CA    . GLN A 1 54  ? -5.737  38.534 7.024   1.00 25.58 ? 80   GLN A CA    1 
ATOM   463  C C     . GLN A 1 54  ? -4.616  37.518 7.192   1.00 26.47 ? 80   GLN A C     1 
ATOM   464  O O     . GLN A 1 54  ? -4.439  36.635 6.348   1.00 25.83 ? 80   GLN A O     1 
ATOM   465  C CB    . GLN A 1 54  ? -7.026  37.906 7.560   1.00 25.81 ? 80   GLN A CB    1 
ATOM   466  C CG    . GLN A 1 54  ? -8.198  38.859 7.670   1.00 28.17 ? 80   GLN A CG    1 
ATOM   467  C CD    . GLN A 1 54  ? -8.040  39.833 8.817   1.00 28.92 ? 80   GLN A CD    1 
ATOM   468  O OE1   . GLN A 1 54  ? -6.981  39.904 9.450   1.00 29.39 ? 80   GLN A OE1   1 
ATOM   469  N NE2   . GLN A 1 54  ? -9.089  40.598 9.087   1.00 29.50 ? 80   GLN A NE2   1 
ATOM   470  N N     . LEU A 1 55  ? -3.854  37.642 8.275   1.00 25.65 ? 81   LEU A N     1 
ATOM   471  C CA    . LEU A 1 55  ? -2.806  36.664 8.551   1.00 27.13 ? 81   LEU A CA    1 
ATOM   472  C C     . LEU A 1 55  ? -3.563  35.392 8.925   1.00 27.84 ? 81   LEU A C     1 
ATOM   473  O O     . LEU A 1 55  ? -4.650  35.461 9.499   1.00 27.55 ? 81   LEU A O     1 
ATOM   474  C CB    . LEU A 1 55  ? -1.948  37.090 9.733   1.00 26.40 ? 81   LEU A CB    1 
ATOM   475  C CG    . LEU A 1 55  ? -0.945  38.216 9.529   1.00 26.96 ? 81   LEU A CG    1 
ATOM   476  C CD1   . LEU A 1 55  ? -0.540  38.784 10.893  1.00 27.73 ? 81   LEU A CD1   1 
ATOM   477  C CD2   . LEU A 1 55  ? 0.262   37.687 8.763   1.00 26.35 ? 81   LEU A CD2   1 
ATOM   478  N N     . SER A 1 56  ? -2.986  34.240 8.611   1.00 26.96 ? 82   SER A N     1 
ATOM   479  C CA    . SER A 1 56  ? -3.616  32.962 8.902   1.00 26.76 ? 82   SER A CA    1 
ATOM   480  C C     . SER A 1 56  ? -4.096  32.861 10.334  1.00 27.61 ? 82   SER A C     1 
ATOM   481  O O     . SER A 1 56  ? -5.181  32.341 10.591  1.00 26.38 ? 82   SER A O     1 
ATOM   482  C CB    . SER A 1 56  ? -2.643  31.817 8.601   1.00 26.21 ? 82   SER A CB    1 
ATOM   483  O OG    . SER A 1 56  ? -2.289  31.818 7.231   1.00 27.04 ? 82   SER A OG    1 
ATOM   484  N N     . SER A 1 57  ? -3.291  33.371 11.262  1.00 29.34 ? 83   SER A N     1 
ATOM   485  C CA    . SER A 1 57  ? -3.630  33.330 12.678  1.00 31.72 ? 83   SER A CA    1 
ATOM   486  C C     . SER A 1 57  ? -4.817  34.214 13.054  1.00 33.51 ? 83   SER A C     1 
ATOM   487  O O     . SER A 1 57  ? -5.301  34.153 14.183  1.00 36.17 ? 83   SER A O     1 
ATOM   488  C CB    . SER A 1 57  ? -2.416  33.736 13.516  1.00 32.60 ? 83   SER A CB    1 
ATOM   489  O OG    . SER A 1 57  ? -2.000  35.048 13.190  1.00 35.26 ? 83   SER A OG    1 
ATOM   490  N N     . ASN A 1 58  ? -5.275  35.040 12.120  1.00 33.55 ? 84   ASN A N     1 
ATOM   491  C CA    . ASN A 1 58  ? -6.411  35.922 12.371  1.00 34.50 ? 84   ASN A CA    1 
ATOM   492  C C     . ASN A 1 58  ? -7.686  35.393 11.733  1.00 33.64 ? 84   ASN A C     1 
ATOM   493  O O     . ASN A 1 58  ? -8.739  36.016 11.835  1.00 32.71 ? 84   ASN A O     1 
ATOM   494  C CB    . ASN A 1 58  ? -6.119  37.327 11.836  1.00 34.48 ? 84   ASN A CB    1 
ATOM   495  C CG    . ASN A 1 58  ? -5.268  38.132 12.780  1.00 38.13 ? 84   ASN A CG    1 
ATOM   496  O OD1   . ASN A 1 58  ? -4.416  38.925 12.358  1.00 40.36 ? 84   ASN A OD1   1 
ATOM   497  N ND2   . ASN A 1 58  ? -5.497  37.946 14.075  1.00 36.56 ? 84   ASN A ND2   1 
ATOM   498  N N     . LEU A 1 59  ? -7.584  34.245 11.073  1.00 35.02 ? 85   LEU A N     1 
ATOM   499  C CA    . LEU A 1 59  ? -8.736  33.630 10.416  1.00 34.66 ? 85   LEU A CA    1 
ATOM   500  C C     . LEU A 1 59  ? -9.542  32.777 11.392  1.00 35.94 ? 85   LEU A C     1 
ATOM   501  O O     . LEU A 1 59  ? -9.005  32.252 12.363  1.00 36.23 ? 85   LEU A O     1 
ATOM   502  C CB    . LEU A 1 59  ? -8.272  32.744 9.262   1.00 34.39 ? 85   LEU A CB    1 
ATOM   503  C CG    . LEU A 1 59  ? -7.527  33.364 8.077   1.00 34.61 ? 85   LEU A CG    1 
ATOM   504  C CD1   . LEU A 1 59  ? -7.086  32.247 7.140   1.00 33.26 ? 85   LEU A CD1   1 
ATOM   505  C CD2   . LEU A 1 59  ? -8.422  34.349 7.342   1.00 31.79 ? 85   LEU A CD2   1 
ATOM   506  N N     . MET A 1 60  ? -10.833 32.634 11.129  1.00 37.69 ? 86   MET A N     1 
ATOM   507  C CA    . MET A 1 60  ? -11.678 31.813 11.982  1.00 38.80 ? 86   MET A CA    1 
ATOM   508  C C     . MET A 1 60  ? -11.247 30.364 11.819  1.00 38.17 ? 86   MET A C     1 
ATOM   509  O O     . MET A 1 60  ? -10.801 29.958 10.749  1.00 37.01 ? 86   MET A O     1 
ATOM   510  C CB    . MET A 1 60  ? -13.148 31.935 11.572  1.00 41.79 ? 86   MET A CB    1 
ATOM   511  C CG    . MET A 1 60  ? -13.821 33.223 11.993  1.00 47.36 ? 86   MET A CG    1 
ATOM   512  S SD    . MET A 1 60  ? -13.765 33.434 13.784  1.00 55.73 ? 86   MET A SD    1 
ATOM   513  C CE    . MET A 1 60  ? -12.686 34.910 13.902  1.00 52.70 ? 86   MET A CE    1 
ATOM   514  N N     . PRO A 1 61  ? -11.367 29.561 12.882  1.00 38.23 ? 87   PRO A N     1 
ATOM   515  C CA    . PRO A 1 61  ? -10.969 28.157 12.756  1.00 37.24 ? 87   PRO A CA    1 
ATOM   516  C C     . PRO A 1 61  ? -11.856 27.489 11.698  1.00 36.52 ? 87   PRO A C     1 
ATOM   517  O O     . PRO A 1 61  ? -13.048 27.783 11.609  1.00 35.16 ? 87   PRO A O     1 
ATOM   518  C CB    . PRO A 1 61  ? -11.208 27.611 14.157  1.00 37.61 ? 87   PRO A CB    1 
ATOM   519  C CG    . PRO A 1 61  ? -12.382 28.437 14.634  1.00 38.72 ? 87   PRO A CG    1 
ATOM   520  C CD    . PRO A 1 61  ? -11.974 29.824 14.197  1.00 38.79 ? 87   PRO A CD    1 
ATOM   521  N N     . GLY A 1 62  ? -11.273 26.610 10.888  1.00 34.77 ? 88   GLY A N     1 
ATOM   522  C CA    . GLY A 1 62  ? -12.045 25.947 9.854   1.00 33.91 ? 88   GLY A CA    1 
ATOM   523  C C     . GLY A 1 62  ? -11.842 26.552 8.474   1.00 34.55 ? 88   GLY A C     1 
ATOM   524  O O     . GLY A 1 62  ? -12.448 26.100 7.504   1.00 36.32 ? 88   GLY A O     1 
ATOM   525  N N     . CYS A 1 63  ? -10.999 27.577 8.377   1.00 32.36 ? 89   CYS A N     1 
ATOM   526  C CA    . CYS A 1 63  ? -10.733 28.215 7.093   1.00 30.59 ? 89   CYS A CA    1 
ATOM   527  C C     . CYS A 1 63  ? -9.368  27.781 6.544   1.00 30.67 ? 89   CYS A C     1 
ATOM   528  O O     . CYS A 1 63  ? -8.513  27.293 7.291   1.00 28.60 ? 89   CYS A O     1 
ATOM   529  C CB    . CYS A 1 63  ? -10.767 29.744 7.244   1.00 34.24 ? 89   CYS A CB    1 
ATOM   530  S SG    . CYS A 1 63  ? -12.405 30.474 7.651   1.00 37.30 ? 89   CYS A SG    1 
ATOM   531  N N     . ASP A 1 64  ? -9.174  27.934 5.234   1.00 28.54 ? 90   ASP A N     1 
ATOM   532  C CA    . ASP A 1 64  ? -7.898  27.589 4.613   1.00 27.96 ? 90   ASP A CA    1 
ATOM   533  C C     . ASP A 1 64  ? -7.486  28.663 3.616   1.00 27.07 ? 90   ASP A C     1 
ATOM   534  O O     . ASP A 1 64  ? -8.323  29.380 3.071   1.00 26.20 ? 90   ASP A O     1 
ATOM   535  C CB    . ASP A 1 64  ? -7.950  26.279 3.808   1.00 28.86 ? 90   ASP A CB    1 
ATOM   536  C CG    . ASP A 1 64  ? -8.495  25.103 4.582   1.00 30.58 ? 90   ASP A CG    1 
ATOM   537  O OD1   . ASP A 1 64  ? -8.229  24.981 5.794   1.00 33.67 ? 90   ASP A OD1   1 
ATOM   538  O OD2   . ASP A 1 64  ? -9.181  24.271 3.946   1.00 32.68 ? 90   ASP A OD2   1 
ATOM   539  N N     . TYR A 1 65  ? -6.181  28.750 3.391   1.00 25.09 ? 91   TYR A N     1 
ATOM   540  C CA    . TYR A 1 65  ? -5.589  29.638 2.406   1.00 22.92 ? 91   TYR A CA    1 
ATOM   541  C C     . TYR A 1 65  ? -4.839  28.619 1.558   1.00 22.30 ? 91   TYR A C     1 
ATOM   542  O O     . TYR A 1 65  ? -4.222  27.710 2.103   1.00 20.21 ? 91   TYR A O     1 
ATOM   543  C CB    . TYR A 1 65  ? -4.560  30.581 3.037   1.00 24.08 ? 91   TYR A CB    1 
ATOM   544  C CG    . TYR A 1 65  ? -5.046  31.965 3.413   1.00 24.89 ? 91   TYR A CG    1 
ATOM   545  C CD1   . TYR A 1 65  ? -4.509  32.619 4.525   1.00 23.48 ? 91   TYR A CD1   1 
ATOM   546  C CD2   . TYR A 1 65  ? -5.999  32.646 2.640   1.00 22.28 ? 91   TYR A CD2   1 
ATOM   547  C CE1   . TYR A 1 65  ? -4.901  33.905 4.863   1.00 24.21 ? 91   TYR A CE1   1 
ATOM   548  C CE2   . TYR A 1 65  ? -6.394  33.944 2.972   1.00 22.88 ? 91   TYR A CE2   1 
ATOM   549  C CZ    . TYR A 1 65  ? -5.838  34.563 4.089   1.00 24.49 ? 91   TYR A CZ    1 
ATOM   550  O OH    . TYR A 1 65  ? -6.214  35.836 4.450   1.00 26.68 ? 91   TYR A OH    1 
ATOM   551  N N     . SER A 1 66  ? -4.907  28.750 0.239   1.00 21.96 ? 92   SER A N     1 
ATOM   552  C CA    . SER A 1 66  ? -4.191  27.845 -0.654  1.00 22.35 ? 92   SER A CA    1 
ATOM   553  C C     . SER A 1 66  ? -3.552  28.674 -1.739  1.00 22.06 ? 92   SER A C     1 
ATOM   554  O O     . SER A 1 66  ? -4.205  29.542 -2.307  1.00 25.68 ? 92   SER A O     1 
ATOM   555  C CB    . SER A 1 66  ? -5.146  26.853 -1.314  1.00 22.28 ? 92   SER A CB    1 
ATOM   556  O OG    . SER A 1 66  ? -5.686  25.977 -0.367  1.00 24.84 ? 92   SER A OG    1 
ATOM   557  N N     . LEU A 1 67  ? -2.282  28.432 -2.024  1.00 20.71 ? 93   LEU A N     1 
ATOM   558  C CA    . LEU A 1 67  ? -1.615  29.161 -3.091  1.00 22.05 ? 93   LEU A CA    1 
ATOM   559  C C     . LEU A 1 67  ? -1.169  28.103 -4.090  1.00 23.91 ? 93   LEU A C     1 
ATOM   560  O O     . LEU A 1 67  ? -0.279  27.310 -3.801  1.00 24.38 ? 93   LEU A O     1 
ATOM   561  C CB    . LEU A 1 67  ? -0.392  29.935 -2.582  1.00 22.10 ? 93   LEU A CB    1 
ATOM   562  C CG    . LEU A 1 67  ? 0.208   30.858 -3.659  1.00 22.65 ? 93   LEU A CG    1 
ATOM   563  C CD1   . LEU A 1 67  ? -0.680  32.094 -3.814  1.00 21.59 ? 93   LEU A CD1   1 
ATOM   564  C CD2   . LEU A 1 67  ? 1.627   31.283 -3.295  1.00 22.74 ? 93   LEU A CD2   1 
ATOM   565  N N     . PHE A 1 68  ? -1.795  28.085 -5.260  1.00 24.14 ? 94   PHE A N     1 
ATOM   566  C CA    . PHE A 1 68  ? -1.443  27.103 -6.270  1.00 24.44 ? 94   PHE A CA    1 
ATOM   567  C C     . PHE A 1 68  ? -1.105  27.734 -7.604  1.00 24.41 ? 94   PHE A C     1 
ATOM   568  O O     . PHE A 1 68  ? -1.587  28.814 -7.938  1.00 25.14 ? 94   PHE A O     1 
ATOM   569  C CB    . PHE A 1 68  ? -2.587  26.099 -6.452  1.00 24.90 ? 94   PHE A CB    1 
ATOM   570  C CG    . PHE A 1 68  ? -2.612  25.011 -5.412  1.00 23.71 ? 94   PHE A CG    1 
ATOM   571  C CD1   . PHE A 1 68  ? -2.854  25.311 -4.076  1.00 24.36 ? 94   PHE A CD1   1 
ATOM   572  C CD2   . PHE A 1 68  ? -2.362  23.689 -5.766  1.00 22.24 ? 94   PHE A CD2   1 
ATOM   573  C CE1   . PHE A 1 68  ? -2.842  24.310 -3.106  1.00 21.66 ? 94   PHE A CE1   1 
ATOM   574  C CE2   . PHE A 1 68  ? -2.349  22.684 -4.808  1.00 21.81 ? 94   PHE A CE2   1 
ATOM   575  C CZ    . PHE A 1 68  ? -2.589  22.995 -3.472  1.00 20.79 ? 94   PHE A CZ    1 
ATOM   576  N N     . LYS A 1 69  ? -0.255  27.057 -8.362  1.00 25.05 ? 95   LYS A N     1 
ATOM   577  C CA    . LYS A 1 69  ? 0.125   27.535 -9.676  1.00 25.65 ? 95   LYS A CA    1 
ATOM   578  C C     . LYS A 1 69  ? -1.152  27.703 -10.491 1.00 26.21 ? 95   LYS A C     1 
ATOM   579  O O     . LYS A 1 69  ? -2.073  26.898 -10.391 1.00 27.83 ? 95   LYS A O     1 
ATOM   580  C CB    . LYS A 1 69  ? 1.068   26.529 -10.338 1.00 26.51 ? 95   LYS A CB    1 
ATOM   581  C CG    . LYS A 1 69  ? 2.424   26.429 -9.633  1.00 26.53 ? 95   LYS A CG    1 
ATOM   582  C CD    . LYS A 1 69  ? 3.316   25.360 -10.261 1.00 29.74 ? 95   LYS A CD    1 
ATOM   583  C CE    . LYS A 1 69  ? 4.738   25.435 -9.709  1.00 30.97 ? 95   LYS A CE    1 
ATOM   584  N NZ    . LYS A 1 69  ? 5.562   24.275 -10.157 1.00 29.95 ? 95   LYS A NZ    1 
ATOM   585  N N     . ASP A 1 70  ? -1.210  28.772 -11.272 1.00 28.48 ? 96   ASP A N     1 
ATOM   586  C CA    . ASP A 1 70  ? -2.371  29.073 -12.104 1.00 28.76 ? 96   ASP A CA    1 
ATOM   587  C C     . ASP A 1 70  ? -2.777  27.838 -12.903 1.00 28.69 ? 96   ASP A C     1 
ATOM   588  O O     . ASP A 1 70  ? -1.938  27.197 -13.540 1.00 28.02 ? 96   ASP A O     1 
ATOM   589  C CB    . ASP A 1 70  ? -2.017  30.218 -13.060 1.00 33.78 ? 96   ASP A CB    1 
ATOM   590  C CG    . ASP A 1 70  ? -3.217  30.741 -13.829 1.00 36.97 ? 96   ASP A CG    1 
ATOM   591  O OD1   . ASP A 1 70  ? -3.002  31.366 -14.889 1.00 40.03 ? 96   ASP A OD1   1 
ATOM   592  O OD2   . ASP A 1 70  ? -4.365  30.548 -13.373 1.00 37.35 ? 96   ASP A OD2   1 
ATOM   593  N N     . GLY A 1 71  ? -4.059  27.492 -12.866 1.00 29.30 ? 97   GLY A N     1 
ATOM   594  C CA    . GLY A 1 71  ? -4.519  26.334 -13.616 1.00 28.93 ? 97   GLY A CA    1 
ATOM   595  C C     . GLY A 1 71  ? -4.655  25.057 -12.804 1.00 29.81 ? 97   GLY A C     1 
ATOM   596  O O     . GLY A 1 71  ? -5.237  24.077 -13.271 1.00 29.65 ? 97   GLY A O     1 
ATOM   597  N N     . ILE A 1 72  ? -4.113  25.054 -11.593 1.00 28.58 ? 98   ILE A N     1 
ATOM   598  C CA    . ILE A 1 72  ? -4.209  23.880 -10.734 1.00 26.59 ? 98   ILE A CA    1 
ATOM   599  C C     . ILE A 1 72  ? -5.137  24.167 -9.556  1.00 26.96 ? 98   ILE A C     1 
ATOM   600  O O     . ILE A 1 72  ? -4.810  24.964 -8.678  1.00 27.35 ? 98   ILE A O     1 
ATOM   601  C CB    . ILE A 1 72  ? -2.835  23.481 -10.180 1.00 24.33 ? 98   ILE A CB    1 
ATOM   602  C CG1   . ILE A 1 72  ? -1.866  23.214 -11.331 1.00 23.56 ? 98   ILE A CG1   1 
ATOM   603  C CG2   . ILE A 1 72  ? -2.980  22.255 -9.298  1.00 25.04 ? 98   ILE A CG2   1 
ATOM   604  C CD1   . ILE A 1 72  ? -0.393  23.150 -10.931 1.00 35.61 ? 98   ILE A CD1   1 
ATOM   605  N N     . GLU A 1 73  ? -6.297  23.522 -9.533  1.00 27.28 ? 99   GLU A N     1 
ATOM   606  C CA    . GLU A 1 73  ? -7.228  23.737 -8.437  1.00 28.19 ? 99   GLU A CA    1 
ATOM   607  C C     . GLU A 1 73  ? -6.694  23.073 -7.167  1.00 26.99 ? 99   GLU A C     1 
ATOM   608  O O     . GLU A 1 73  ? -6.153  21.972 -7.214  1.00 26.35 ? 99   GLU A O     1 
ATOM   609  C CB    . GLU A 1 73  ? -8.609  23.203 -8.822  1.00 31.37 ? 99   GLU A CB    1 
ATOM   610  C CG    . GLU A 1 73  ? -9.251  24.011 -9.956  1.00 36.58 ? 99   GLU A CG    1 
ATOM   611  C CD    . GLU A 1 73  ? -10.652 23.540 -10.325 1.00 41.82 ? 99   GLU A CD    1 
ATOM   612  O OE1   . GLU A 1 73  ? -11.305 24.224 -11.143 1.00 44.76 ? 99   GLU A OE1   1 
ATOM   613  O OE2   . GLU A 1 73  ? -11.104 22.491 -9.806  1.00 43.95 ? 99   GLU A OE2   1 
ATOM   614  N N     . PRO A 1 74  ? -6.834  23.741 -6.013  1.00 24.62 ? 100  PRO A N     1 
ATOM   615  C CA    . PRO A 1 74  ? -6.338  23.181 -4.750  1.00 24.66 ? 100  PRO A CA    1 
ATOM   616  C C     . PRO A 1 74  ? -7.146  22.002 -4.200  1.00 23.43 ? 100  PRO A C     1 
ATOM   617  O O     . PRO A 1 74  ? -7.613  22.028 -3.058  1.00 24.65 ? 100  PRO A O     1 
ATOM   618  C CB    . PRO A 1 74  ? -6.334  24.399 -3.818  1.00 23.08 ? 100  PRO A CB    1 
ATOM   619  C CG    . PRO A 1 74  ? -7.545  25.152 -4.268  1.00 26.12 ? 100  PRO A CG    1 
ATOM   620  C CD    . PRO A 1 74  ? -7.495  25.040 -5.798  1.00 26.06 ? 100  PRO A CD    1 
ATOM   621  N N     . MET A 1 75  ? -7.288  20.958 -5.011  1.00 24.66 ? 101  MET A N     1 
ATOM   622  C CA    . MET A 1 75  ? -8.036  19.772 -4.606  1.00 25.59 ? 101  MET A CA    1 
ATOM   623  C C     . MET A 1 75  ? -7.379  18.496 -5.127  1.00 24.99 ? 101  MET A C     1 
ATOM   624  O O     . MET A 1 75  ? -6.631  18.534 -6.102  1.00 23.44 ? 101  MET A O     1 
ATOM   625  C CB    . MET A 1 75  ? -9.482  19.871 -5.101  1.00 27.86 ? 101  MET A CB    1 
ATOM   626  C CG    . MET A 1 75  ? -9.627  19.886 -6.610  1.00 30.27 ? 101  MET A CG    1 
ATOM   627  S SD    . MET A 1 75  ? -11.324 20.223 -7.146  1.00 38.00 ? 101  MET A SD    1 
ATOM   628  C CE    . MET A 1 75  ? -11.473 21.943 -6.680  1.00 34.49 ? 101  MET A CE    1 
ATOM   629  N N     . TRP A 1 76  ? -7.663  17.376 -4.462  1.00 25.98 ? 102  TRP A N     1 
ATOM   630  C CA    . TRP A 1 76  ? -7.094  16.073 -4.808  1.00 25.82 ? 102  TRP A CA    1 
ATOM   631  C C     . TRP A 1 76  ? -7.396  15.638 -6.225  1.00 27.25 ? 102  TRP A C     1 
ATOM   632  O O     . TRP A 1 76  ? -6.556  15.059 -6.902  1.00 27.50 ? 102  TRP A O     1 
ATOM   633  C CB    . TRP A 1 76  ? -7.634  14.969 -3.889  1.00 26.55 ? 102  TRP A CB    1 
ATOM   634  C CG    . TRP A 1 76  ? -7.455  15.166 -2.424  1.00 25.51 ? 102  TRP A CG    1 
ATOM   635  C CD1   . TRP A 1 76  ? -6.338  15.614 -1.784  1.00 25.50 ? 102  TRP A CD1   1 
ATOM   636  C CD2   . TRP A 1 76  ? -8.387  14.798 -1.399  1.00 26.57 ? 102  TRP A CD2   1 
ATOM   637  N NE1   . TRP A 1 76  ? -6.512  15.539 -0.420  1.00 27.42 ? 102  TRP A NE1   1 
ATOM   638  C CE2   . TRP A 1 76  ? -7.760  15.042 -0.156  1.00 27.12 ? 102  TRP A CE2   1 
ATOM   639  C CE3   . TRP A 1 76  ? -9.689  14.280 -1.410  1.00 27.04 ? 102  TRP A CE3   1 
ATOM   640  C CZ2   . TRP A 1 76  ? -8.390  14.784 1.070   1.00 28.83 ? 102  TRP A CZ2   1 
ATOM   641  C CZ3   . TRP A 1 76  ? -10.323 14.021 -0.185  1.00 29.36 ? 102  TRP A CZ3   1 
ATOM   642  C CH2   . TRP A 1 76  ? -9.667  14.275 1.036   1.00 30.56 ? 102  TRP A CH2   1 
ATOM   643  N N     . GLU A 1 77  ? -8.621  15.910 -6.650  1.00 27.45 ? 103  GLU A N     1 
ATOM   644  C CA    . GLU A 1 77  ? -9.115  15.516 -7.955  1.00 27.57 ? 103  GLU A CA    1 
ATOM   645  C C     . GLU A 1 77  ? -8.442  16.141 -9.162  1.00 28.87 ? 103  GLU A C     1 
ATOM   646  O O     . GLU A 1 77  ? -8.560  15.611 -10.266 1.00 28.44 ? 103  GLU A O     1 
ATOM   647  C CB    . GLU A 1 77  ? -10.621 15.794 -8.027  1.00 30.94 ? 103  GLU A CB    1 
ATOM   648  C CG    . GLU A 1 77  ? -11.424 15.187 -6.886  1.00 31.42 ? 103  GLU A CG    1 
ATOM   649  C CD    . GLU A 1 77  ? -11.707 16.177 -5.771  1.00 34.76 ? 103  GLU A CD    1 
ATOM   650  O OE1   . GLU A 1 77  ? -10.752 16.632 -5.109  1.00 33.58 ? 103  GLU A OE1   1 
ATOM   651  O OE2   . GLU A 1 77  ? -12.897 16.503 -5.556  1.00 36.08 ? 103  GLU A OE2   1 
ATOM   652  N N     . ASP A 1 78  ? -7.738  17.254 -8.968  1.00 26.73 ? 104  ASP A N     1 
ATOM   653  C CA    . ASP A 1 78  ? -7.094  17.922 -10.090 1.00 27.63 ? 104  ASP A CA    1 
ATOM   654  C C     . ASP A 1 78  ? -6.076  17.031 -10.800 1.00 29.30 ? 104  ASP A C     1 
ATOM   655  O O     . ASP A 1 78  ? -5.415  16.201 -10.178 1.00 28.88 ? 104  ASP A O     1 
ATOM   656  C CB    . ASP A 1 78  ? -6.398  19.206 -9.631  1.00 26.93 ? 104  ASP A CB    1 
ATOM   657  C CG    . ASP A 1 78  ? -6.002  20.101 -10.796 1.00 30.10 ? 104  ASP A CG    1 
ATOM   658  O OD1   . ASP A 1 78  ? -6.773  21.033 -11.128 1.00 32.09 ? 104  ASP A OD1   1 
ATOM   659  O OD2   . ASP A 1 78  ? -4.927  19.868 -11.394 1.00 27.90 ? 104  ASP A OD2   1 
ATOM   660  N N     . GLU A 1 79  ? -5.955  17.219 -12.109 1.00 28.48 ? 105  GLU A N     1 
ATOM   661  C CA    . GLU A 1 79  ? -5.010  16.464 -12.918 1.00 31.08 ? 105  GLU A CA    1 
ATOM   662  C C     . GLU A 1 79  ? -3.589  16.463 -12.345 1.00 31.55 ? 105  GLU A C     1 
ATOM   663  O O     . GLU A 1 79  ? -2.876  15.464 -12.447 1.00 32.63 ? 105  GLU A O     1 
ATOM   664  C CB    . GLU A 1 79  ? -4.992  17.038 -14.340 1.00 34.46 ? 105  GLU A CB    1 
ATOM   665  C CG    . GLU A 1 79  ? -3.884  16.498 -15.238 1.00 41.77 ? 105  GLU A CG    1 
ATOM   666  C CD    . GLU A 1 79  ? -4.005  15.008 -15.506 1.00 45.32 ? 105  GLU A CD    1 
ATOM   667  O OE1   . GLU A 1 79  ? -3.070  14.433 -16.102 1.00 49.68 ? 105  GLU A OE1   1 
ATOM   668  O OE2   . GLU A 1 79  ? -5.032  14.407 -15.126 1.00 48.57 ? 105  GLU A OE2   1 
ATOM   669  N N     . LYS A 1 80  ? -3.174  17.568 -11.731 1.00 30.52 ? 106  LYS A N     1 
ATOM   670  C CA    . LYS A 1 80  ? -1.813  17.654 -11.195 1.00 30.18 ? 106  LYS A CA    1 
ATOM   671  C C     . LYS A 1 80  ? -1.633  17.245 -9.735  1.00 29.27 ? 106  LYS A C     1 
ATOM   672  O O     . LYS A 1 80  ? -0.517  17.286 -9.211  1.00 30.75 ? 106  LYS A O     1 
ATOM   673  C CB    . LYS A 1 80  ? -1.270  19.071 -11.389 1.00 31.81 ? 106  LYS A CB    1 
ATOM   674  C CG    . LYS A 1 80  ? -1.351  19.583 -12.827 1.00 34.88 ? 106  LYS A CG    1 
ATOM   675  C CD    . LYS A 1 80  ? -0.445  18.797 -13.774 1.00 37.34 ? 106  LYS A CD    1 
ATOM   676  C CE    . LYS A 1 80  ? 1.026   19.084 -13.505 1.00 40.46 ? 106  LYS A CE    1 
ATOM   677  N NZ    . LYS A 1 80  ? 1.926   18.370 -14.456 1.00 42.77 ? 106  LYS A NZ    1 
ATOM   678  N N     . ASN A 1 81  ? -2.721  16.851 -9.083  1.00 27.17 ? 107  ASN A N     1 
ATOM   679  C CA    . ASN A 1 81  ? -2.668  16.438 -7.690  1.00 25.26 ? 107  ASN A CA    1 
ATOM   680  C C     . ASN A 1 81  ? -3.110  14.995 -7.422  1.00 24.65 ? 107  ASN A C     1 
ATOM   681  O O     . ASN A 1 81  ? -2.672  14.391 -6.443  1.00 25.54 ? 107  ASN A O     1 
ATOM   682  C CB    . ASN A 1 81  ? -3.535  17.367 -6.825  1.00 25.43 ? 107  ASN A CB    1 
ATOM   683  C CG    . ASN A 1 81  ? -3.095  18.826 -6.894  1.00 27.59 ? 107  ASN A CG    1 
ATOM   684  O OD1   . ASN A 1 81  ? -1.905  19.124 -6.965  1.00 29.23 ? 107  ASN A OD1   1 
ATOM   685  N ND2   . ASN A 1 81  ? -4.062  19.740 -6.852  1.00 23.40 ? 107  ASN A ND2   1 
ATOM   686  N N     . LYS A 1 82  ? -3.965  14.439 -8.278  1.00 24.03 ? 108  LYS A N     1 
ATOM   687  C CA    . LYS A 1 82  ? -4.483  13.093 -8.051  1.00 25.51 ? 108  LYS A CA    1 
ATOM   688  C C     . LYS A 1 82  ? -3.428  11.996 -7.885  1.00 26.68 ? 108  LYS A C     1 
ATOM   689  O O     . LYS A 1 82  ? -3.646  11.027 -7.158  1.00 26.30 ? 108  LYS A O     1 
ATOM   690  C CB    . LYS A 1 82  ? -5.504  12.708 -9.146  1.00 24.86 ? 108  LYS A CB    1 
ATOM   691  C CG    . LYS A 1 82  ? -4.980  11.882 -10.314 1.00 23.13 ? 108  LYS A CG    1 
ATOM   692  C CD    . LYS A 1 82  ? -4.334  12.745 -11.378 1.00 28.03 ? 108  LYS A CD    1 
ATOM   693  C CE    . LYS A 1 82  ? -4.051  11.889 -12.631 1.00 37.61 ? 108  LYS A CE    1 
ATOM   694  N NZ    . LYS A 1 82  ? -3.427  12.612 -13.795 1.00 34.48 ? 108  LYS A NZ    1 
ATOM   695  N N     . ARG A 1 83  ? -2.286  12.137 -8.546  1.00 27.23 ? 109  ARG A N     1 
ATOM   696  C CA    . ARG A 1 83  ? -1.235  11.137 -8.407  1.00 29.56 ? 109  ARG A CA    1 
ATOM   697  C C     . ARG A 1 83  ? -0.163  11.622 -7.437  1.00 28.66 ? 109  ARG A C     1 
ATOM   698  O O     . ARG A 1 83  ? 0.850   10.948 -7.232  1.00 26.25 ? 109  ARG A O     1 
ATOM   699  C CB    . ARG A 1 83  ? -0.617  10.831 -9.774  1.00 33.38 ? 109  ARG A CB    1 
ATOM   700  C CG    . ARG A 1 83  ? -1.525  9.983  -10.665 1.00 39.29 ? 109  ARG A CG    1 
ATOM   701  C CD    . ARG A 1 83  ? -1.097  9.991  -12.121 1.00 44.97 ? 109  ARG A CD    1 
ATOM   702  N NE    . ARG A 1 83  ? -1.171  11.330 -12.702 1.00 51.73 ? 109  ARG A NE    1 
ATOM   703  C CZ    . ARG A 1 83  ? -0.148  12.179 -12.769 1.00 55.11 ? 109  ARG A CZ    1 
ATOM   704  N NH1   . ARG A 1 83  ? -0.313  13.384 -13.311 1.00 54.30 ? 109  ARG A NH1   1 
ATOM   705  N NH2   . ARG A 1 83  ? 1.047   11.819 -12.311 1.00 56.18 ? 109  ARG A NH2   1 
ATOM   706  N N     . GLY A 1 84  ? -0.420  12.777 -6.819  1.00 27.22 ? 110  GLY A N     1 
ATOM   707  C CA    . GLY A 1 84  ? 0.537   13.379 -5.905  1.00 25.63 ? 110  GLY A CA    1 
ATOM   708  C C     . GLY A 1 84  ? 0.355   13.195 -4.409  1.00 25.90 ? 110  GLY A C     1 
ATOM   709  O O     . GLY A 1 84  ? -0.306  12.269 -3.951  1.00 25.53 ? 110  GLY A O     1 
ATOM   710  N N     . GLY A 1 85  ? 0.965   14.098 -3.647  1.00 25.36 ? 111  GLY A N     1 
ATOM   711  C CA    . GLY A 1 85  ? 0.897   14.032 -2.202  1.00 24.66 ? 111  GLY A CA    1 
ATOM   712  C C     . GLY A 1 85  ? 1.363   15.332 -1.576  1.00 25.46 ? 111  GLY A C     1 
ATOM   713  O O     . GLY A 1 85  ? 1.537   16.334 -2.267  1.00 24.15 ? 111  GLY A O     1 
ATOM   714  N N     . ARG A 1 86  ? 1.596   15.321 -0.270  1.00 25.03 ? 112  ARG A N     1 
ATOM   715  C CA    . ARG A 1 86  ? 2.005   16.545 0.413   1.00 23.52 ? 112  ARG A CA    1 
ATOM   716  C C     . ARG A 1 86  ? 2.943   16.287 1.570   1.00 23.84 ? 112  ARG A C     1 
ATOM   717  O O     . ARG A 1 86  ? 2.908   15.223 2.174   1.00 24.99 ? 112  ARG A O     1 
ATOM   718  C CB    . ARG A 1 86  ? 0.768   17.245 0.972   1.00 22.51 ? 112  ARG A CB    1 
ATOM   719  C CG    . ARG A 1 86  ? 0.044   16.370 2.006   1.00 23.85 ? 112  ARG A CG    1 
ATOM   720  C CD    . ARG A 1 86  ? -1.214  17.008 2.575   1.00 26.68 ? 112  ARG A CD    1 
ATOM   721  N NE    . ARG A 1 86  ? -1.775  16.170 3.630   1.00 27.11 ? 112  ARG A NE    1 
ATOM   722  C CZ    . ARG A 1 86  ? -2.732  16.539 4.480   1.00 30.78 ? 112  ARG A CZ    1 
ATOM   723  N NH1   . ARG A 1 86  ? -3.161  15.678 5.398   1.00 29.65 ? 112  ARG A NH1   1 
ATOM   724  N NH2   . ARG A 1 86  ? -3.256  17.760 4.428   1.00 27.18 ? 112  ARG A NH2   1 
ATOM   725  N N     . TRP A 1 87  ? 3.775   17.281 1.863   1.00 24.19 ? 113  TRP A N     1 
ATOM   726  C CA    . TRP A 1 87  ? 4.681   17.256 3.000   1.00 24.49 ? 113  TRP A CA    1 
ATOM   727  C C     . TRP A 1 87  ? 3.854   17.980 4.053   1.00 25.84 ? 113  TRP A C     1 
ATOM   728  O O     . TRP A 1 87  ? 3.492   19.145 3.869   1.00 26.51 ? 113  TRP A O     1 
ATOM   729  C CB    . TRP A 1 87  ? 5.948   18.058 2.702   1.00 23.03 ? 113  TRP A CB    1 
ATOM   730  C CG    . TRP A 1 87  ? 6.988   17.259 1.999   1.00 23.06 ? 113  TRP A CG    1 
ATOM   731  C CD1   . TRP A 1 87  ? 7.406   17.404 0.713   1.00 22.50 ? 113  TRP A CD1   1 
ATOM   732  C CD2   . TRP A 1 87  ? 7.726   16.155 2.543   1.00 23.94 ? 113  TRP A CD2   1 
ATOM   733  N NE1   . TRP A 1 87  ? 8.358   16.459 0.414   1.00 21.42 ? 113  TRP A NE1   1 
ATOM   734  C CE2   . TRP A 1 87  ? 8.574   15.679 1.520   1.00 23.44 ? 113  TRP A CE2   1 
ATOM   735  C CE3   . TRP A 1 87  ? 7.751   15.522 3.797   1.00 24.76 ? 113  TRP A CE3   1 
ATOM   736  C CZ2   . TRP A 1 87  ? 9.442   14.594 1.707   1.00 26.03 ? 113  TRP A CZ2   1 
ATOM   737  C CZ3   . TRP A 1 87  ? 8.618   14.436 3.983   1.00 25.72 ? 113  TRP A CZ3   1 
ATOM   738  C CH2   . TRP A 1 87  ? 9.449   13.988 2.939   1.00 24.71 ? 113  TRP A CH2   1 
ATOM   739  N N     . LEU A 1 88  ? 3.542   17.302 5.149   1.00 26.59 ? 114  LEU A N     1 
ATOM   740  C CA    . LEU A 1 88  ? 2.708   17.903 6.177   1.00 26.25 ? 114  LEU A CA    1 
ATOM   741  C C     . LEU A 1 88  ? 3.419   18.422 7.421   1.00 28.06 ? 114  LEU A C     1 
ATOM   742  O O     . LEU A 1 88  ? 4.214   17.720 8.050   1.00 28.03 ? 114  LEU A O     1 
ATOM   743  C CB    . LEU A 1 88  ? 1.632   16.901 6.593   1.00 26.63 ? 114  LEU A CB    1 
ATOM   744  C CG    . LEU A 1 88  ? 0.570   17.365 7.587   1.00 24.77 ? 114  LEU A CG    1 
ATOM   745  C CD1   . LEU A 1 88  ? -0.277  18.459 6.966   1.00 24.19 ? 114  LEU A CD1   1 
ATOM   746  C CD2   . LEU A 1 88  ? -0.297  16.173 7.979   1.00 26.55 ? 114  LEU A CD2   1 
ATOM   747  N N     . ILE A 1 89  ? 3.108   19.666 7.770   1.00 29.46 ? 115  ILE A N     1 
ATOM   748  C CA    . ILE A 1 89  ? 3.660   20.304 8.955   1.00 28.29 ? 115  ILE A CA    1 
ATOM   749  C C     . ILE A 1 89  ? 2.509   20.393 9.950   1.00 30.95 ? 115  ILE A C     1 
ATOM   750  O O     . ILE A 1 89  ? 1.522   21.086 9.694   1.00 30.34 ? 115  ILE A O     1 
ATOM   751  C CB    . ILE A 1 89  ? 4.129   21.744 8.676   1.00 29.80 ? 115  ILE A CB    1 
ATOM   752  C CG1   . ILE A 1 89  ? 5.089   21.784 7.482   1.00 29.47 ? 115  ILE A CG1   1 
ATOM   753  C CG2   . ILE A 1 89  ? 4.799   22.308 9.923   1.00 28.65 ? 115  ILE A CG2   1 
ATOM   754  C CD1   . ILE A 1 89  ? 6.402   20.962 7.592   1.00 35.61 ? 115  ILE A CD1   1 
ATOM   755  N N     . THR A 1 90  ? 2.618   19.682 11.067  1.00 31.57 ? 116  THR A N     1 
ATOM   756  C CA    . THR A 1 90  ? 1.581   19.720 12.088  1.00 32.86 ? 116  THR A CA    1 
ATOM   757  C C     . THR A 1 90  ? 2.039   20.638 13.211  1.00 33.47 ? 116  THR A C     1 
ATOM   758  O O     . THR A 1 90  ? 3.093   20.420 13.809  1.00 34.29 ? 116  THR A O     1 
ATOM   759  C CB    . THR A 1 90  ? 1.302   18.326 12.676  1.00 33.03 ? 116  THR A CB    1 
ATOM   760  O OG1   . THR A 1 90  ? 2.525   17.755 13.153  1.00 38.22 ? 116  THR A OG1   1 
ATOM   761  C CG2   . THR A 1 90  ? 0.708   17.414 11.630  1.00 33.34 ? 116  THR A CG2   1 
ATOM   762  N N     . LEU A 1 91  ? 1.248   21.671 13.485  1.00 33.40 ? 117  LEU A N     1 
ATOM   763  C CA    . LEU A 1 91  ? 1.563   22.627 14.541  1.00 33.32 ? 117  LEU A CA    1 
ATOM   764  C C     . LEU A 1 91  ? 0.698   22.400 15.770  1.00 32.28 ? 117  LEU A C     1 
ATOM   765  O O     . LEU A 1 91  ? -0.442  21.947 15.660  1.00 31.86 ? 117  LEU A O     1 
ATOM   766  C CB    . LEU A 1 91  ? 1.342   24.060 14.049  1.00 32.70 ? 117  LEU A CB    1 
ATOM   767  C CG    . LEU A 1 91  ? 2.387   24.693 13.131  1.00 35.40 ? 117  LEU A CG    1 
ATOM   768  C CD1   . LEU A 1 91  ? 2.610   23.829 11.912  1.00 38.39 ? 117  LEU A CD1   1 
ATOM   769  C CD2   . LEU A 1 91  ? 1.904   26.073 12.712  1.00 36.40 ? 117  LEU A CD2   1 
ATOM   770  N N     . ASN A 1 92  ? 1.240   22.703 16.944  1.00 33.73 ? 118  ASN A N     1 
ATOM   771  C CA    . ASN A 1 92  ? 0.462   22.557 18.167  1.00 35.00 ? 118  ASN A CA    1 
ATOM   772  C C     . ASN A 1 92  ? -0.284  23.872 18.352  1.00 35.15 ? 118  ASN A C     1 
ATOM   773  O O     . ASN A 1 92  ? -0.097  24.805 17.571  1.00 34.10 ? 118  ASN A O     1 
ATOM   774  C CB    . ASN A 1 92  ? 1.358   22.256 19.384  1.00 34.66 ? 118  ASN A CB    1 
ATOM   775  C CG    . ASN A 1 92  ? 2.413   23.323 19.629  1.00 36.87 ? 118  ASN A CG    1 
ATOM   776  O OD1   . ASN A 1 92  ? 2.114   24.517 19.678  1.00 36.57 ? 118  ASN A OD1   1 
ATOM   777  N ND2   . ASN A 1 92  ? 3.661   22.889 19.801  1.00 35.44 ? 118  ASN A ND2   1 
ATOM   778  N N     . LYS A 1 93  ? -1.131  23.945 19.371  1.00 36.23 ? 119  LYS A N     1 
ATOM   779  C CA    . LYS A 1 93  ? -1.909  25.148 19.625  1.00 37.57 ? 119  LYS A CA    1 
ATOM   780  C C     . LYS A 1 93  ? -1.056  26.362 19.985  1.00 38.02 ? 119  LYS A C     1 
ATOM   781  O O     . LYS A 1 93  ? -1.397  27.486 19.620  1.00 39.21 ? 119  LYS A O     1 
ATOM   782  C CB    . LYS A 1 93  ? -2.954  24.861 20.709  1.00 38.17 ? 119  LYS A CB    1 
ATOM   783  C CG    . LYS A 1 93  ? -3.990  23.827 20.257  1.00 39.30 ? 119  LYS A CG    1 
ATOM   784  C CD    . LYS A 1 93  ? -4.854  23.310 21.396  1.00 41.75 ? 119  LYS A CD    1 
ATOM   785  C CE    . LYS A 1 93  ? -6.262  23.891 21.384  1.00 44.38 ? 119  LYS A CE    1 
ATOM   786  N NZ    . LYS A 1 93  ? -6.305  25.355 21.681  1.00 45.81 ? 119  LYS A NZ    1 
ATOM   787  N N     . GLN A 1 94  ? 0.056   26.140 20.679  1.00 38.16 ? 120  GLN A N     1 
ATOM   788  C CA    . GLN A 1 94  ? 0.942   27.240 21.060  1.00 39.61 ? 120  GLN A CA    1 
ATOM   789  C C     . GLN A 1 94  ? 1.615   27.887 19.844  1.00 40.24 ? 120  GLN A C     1 
ATOM   790  O O     . GLN A 1 94  ? 1.857   29.096 19.822  1.00 41.12 ? 120  GLN A O     1 
ATOM   791  C CB    . GLN A 1 94  ? 2.034   26.753 22.021  1.00 39.32 ? 120  GLN A CB    1 
ATOM   792  C CG    . GLN A 1 94  ? 1.547   26.246 23.370  1.00 40.95 ? 120  GLN A CG    1 
ATOM   793  C CD    . GLN A 1 94  ? 0.864   24.899 23.290  1.00 41.90 ? 120  GLN A CD    1 
ATOM   794  O OE1   . GLN A 1 94  ? -0.361  24.800 23.377  1.00 45.37 ? 120  GLN A OE1   1 
ATOM   795  N NE2   . GLN A 1 94  ? 1.654   23.848 23.115  1.00 43.46 ? 120  GLN A NE2   1 
ATOM   796  N N     . GLN A 1 95  ? 1.916   27.077 18.835  1.00 40.07 ? 121  GLN A N     1 
ATOM   797  C CA    . GLN A 1 95  ? 2.577   27.565 17.630  1.00 38.96 ? 121  GLN A CA    1 
ATOM   798  C C     . GLN A 1 95  ? 1.740   28.514 16.783  1.00 39.18 ? 121  GLN A C     1 
ATOM   799  O O     . GLN A 1 95  ? 2.254   29.132 15.849  1.00 38.01 ? 121  GLN A O     1 
ATOM   800  C CB    . GLN A 1 95  ? 3.040   26.391 16.774  1.00 36.91 ? 121  GLN A CB    1 
ATOM   801  C CG    . GLN A 1 95  ? 4.327   25.762 17.253  1.00 35.82 ? 121  GLN A CG    1 
ATOM   802  C CD    . GLN A 1 95  ? 4.571   24.424 16.606  1.00 35.11 ? 121  GLN A CD    1 
ATOM   803  O OE1   . GLN A 1 95  ? 3.848   23.466 16.861  1.00 35.07 ? 121  GLN A OE1   1 
ATOM   804  N NE2   . GLN A 1 95  ? 5.587   24.348 15.757  1.00 32.91 ? 121  GLN A NE2   1 
ATOM   805  N N     . ARG A 1 96  ? 0.453   28.634 17.087  1.00 38.95 ? 122  ARG A N     1 
ATOM   806  C CA    . ARG A 1 96  ? -0.370  29.553 16.317  1.00 38.89 ? 122  ARG A CA    1 
ATOM   807  C C     . ARG A 1 96  ? 0.207   30.955 16.487  1.00 38.58 ? 122  ARG A C     1 
ATOM   808  O O     . ARG A 1 96  ? 0.280   31.736 15.535  1.00 38.63 ? 122  ARG A O     1 
ATOM   809  C CB    . ARG A 1 96  ? -1.815  29.540 16.797  1.00 39.10 ? 122  ARG A CB    1 
ATOM   810  C CG    . ARG A 1 96  ? -2.612  30.681 16.200  1.00 42.62 ? 122  ARG A CG    1 
ATOM   811  C CD    . ARG A 1 96  ? -4.093  30.474 16.323  1.00 45.49 ? 122  ARG A CD    1 
ATOM   812  N NE    . ARG A 1 96  ? -4.542  29.289 15.600  1.00 46.69 ? 122  ARG A NE    1 
ATOM   813  C CZ    . ARG A 1 96  ? -5.818  28.939 15.493  1.00 46.74 ? 122  ARG A CZ    1 
ATOM   814  N NH1   . ARG A 1 96  ? -6.751  29.691 16.061  1.00 48.52 ? 122  ARG A NH1   1 
ATOM   815  N NH2   . ARG A 1 96  ? -6.165  27.846 14.828  1.00 45.34 ? 122  ARG A NH2   1 
ATOM   816  N N     . ARG A 1 97  ? 0.623   31.259 17.711  1.00 38.07 ? 123  ARG A N     1 
ATOM   817  C CA    . ARG A 1 97  ? 1.202   32.556 18.025  1.00 37.34 ? 123  ARG A CA    1 
ATOM   818  C C     . ARG A 1 97  ? 2.632   32.683 17.547  1.00 38.55 ? 123  ARG A C     1 
ATOM   819  O O     . ARG A 1 97  ? 2.993   33.657 16.894  1.00 41.76 ? 123  ARG A O     1 
ATOM   820  C CB    . ARG A 1 97  ? 1.185   32.802 19.537  1.00 37.13 ? 123  ARG A CB    1 
ATOM   821  C CG    . ARG A 1 97  ? 2.257   33.788 20.012  1.00 36.04 ? 123  ARG A CG    1 
ATOM   822  C CD    . ARG A 1 97  ? 2.160   34.051 21.500  1.00 38.98 ? 123  ARG A CD    1 
ATOM   823  N NE    . ARG A 1 97  ? 3.166   34.999 21.975  1.00 37.76 ? 123  ARG A NE    1 
ATOM   824  C CZ    . ARG A 1 97  ? 4.417   34.673 22.286  1.00 38.36 ? 123  ARG A CZ    1 
ATOM   825  N NH1   . ARG A 1 97  ? 4.826   33.414 22.175  1.00 40.56 ? 123  ARG A NH1   1 
ATOM   826  N NH2   . ARG A 1 97  ? 5.260   35.605 22.713  1.00 35.94 ? 123  ARG A NH2   1 
ATOM   827  N N     . SER A 1 98  ? 3.448   31.692 17.874  1.00 39.11 ? 124  SER A N     1 
ATOM   828  C CA    . SER A 1 98  ? 4.858   31.737 17.529  1.00 40.32 ? 124  SER A CA    1 
ATOM   829  C C     . SER A 1 98  ? 5.325   31.332 16.132  1.00 39.43 ? 124  SER A C     1 
ATOM   830  O O     . SER A 1 98  ? 6.252   31.943 15.611  1.00 40.36 ? 124  SER A O     1 
ATOM   831  C CB    . SER A 1 98  ? 5.652   30.937 18.568  1.00 41.08 ? 124  SER A CB    1 
ATOM   832  O OG    . SER A 1 98  ? 5.135   29.626 18.704  1.00 41.98 ? 124  SER A OG    1 
ATOM   833  N N     . ASP A 1 99  ? 4.700   30.335 15.511  1.00 37.74 ? 125  ASP A N     1 
ATOM   834  C CA    . ASP A 1 99  ? 5.191   29.892 14.207  1.00 36.14 ? 125  ASP A CA    1 
ATOM   835  C C     . ASP A 1 99  ? 4.267   29.867 12.990  1.00 33.07 ? 125  ASP A C     1 
ATOM   836  O O     . ASP A 1 99  ? 4.750   29.902 11.865  1.00 31.75 ? 125  ASP A O     1 
ATOM   837  C CB    . ASP A 1 99  ? 5.819   28.497 14.347  1.00 37.58 ? 125  ASP A CB    1 
ATOM   838  C CG    . ASP A 1 99  ? 6.982   28.463 15.335  1.00 42.29 ? 125  ASP A CG    1 
ATOM   839  O OD1   . ASP A 1 99  ? 7.642   29.509 15.529  1.00 43.36 ? 125  ASP A OD1   1 
ATOM   840  O OD2   . ASP A 1 99  ? 7.250   27.380 15.904  1.00 41.89 ? 125  ASP A OD2   1 
ATOM   841  N N     . LEU A 1 100 ? 2.960   29.804 13.199  1.00 31.31 ? 126  LEU A N     1 
ATOM   842  C CA    . LEU A 1 100 ? 2.021   29.724 12.083  1.00 31.24 ? 126  LEU A CA    1 
ATOM   843  C C     . LEU A 1 100 ? 2.228   30.737 10.958  1.00 31.62 ? 126  LEU A C     1 
ATOM   844  O O     . LEU A 1 100 ? 2.412   30.358 9.795   1.00 29.90 ? 126  LEU A O     1 
ATOM   845  C CB    . LEU A 1 100 ? 0.576   29.834 12.587  1.00 30.54 ? 126  LEU A CB    1 
ATOM   846  C CG    . LEU A 1 100 ? -0.478  29.842 11.466  1.00 31.21 ? 126  LEU A CG    1 
ATOM   847  C CD1   . LEU A 1 100 ? -0.426  28.532 10.696  1.00 30.14 ? 126  LEU A CD1   1 
ATOM   848  C CD2   . LEU A 1 100 ? -1.864  30.059 12.047  1.00 30.83 ? 126  LEU A CD2   1 
ATOM   849  N N     . ASP A 1 101 ? 2.196   32.018 11.301  1.00 29.00 ? 127  ASP A N     1 
ATOM   850  C CA    . ASP A 1 101 ? 2.340   33.069 10.301  1.00 30.30 ? 127  ASP A CA    1 
ATOM   851  C C     . ASP A 1 101 ? 3.685   33.148 9.597   1.00 28.36 ? 127  ASP A C     1 
ATOM   852  O O     . ASP A 1 101 ? 3.730   33.336 8.380   1.00 28.13 ? 127  ASP A O     1 
ATOM   853  C CB    . ASP A 1 101 ? 2.002   34.421 10.922  1.00 30.96 ? 127  ASP A CB    1 
ATOM   854  C CG    . ASP A 1 101 ? 0.566   34.495 11.368  1.00 33.94 ? 127  ASP A CG    1 
ATOM   855  O OD1   . ASP A 1 101 ? 0.297   35.166 12.386  1.00 37.73 ? 127  ASP A OD1   1 
ATOM   856  O OD2   . ASP A 1 101 ? -0.296  33.881 10.699  1.00 33.71 ? 127  ASP A OD2   1 
ATOM   857  N N     . ARG A 1 102 ? 4.783   33.020 10.332  1.00 28.45 ? 128  ARG A N     1 
ATOM   858  C CA    . ARG A 1 102 ? 6.073   33.093 9.667   1.00 30.18 ? 128  ARG A CA    1 
ATOM   859  C C     . ARG A 1 102 ? 6.325   31.820 8.863   1.00 29.73 ? 128  ARG A C     1 
ATOM   860  O O     . ARG A 1 102 ? 6.963   31.859 7.815   1.00 29.40 ? 128  ARG A O     1 
ATOM   861  C CB    . ARG A 1 102 ? 7.201   33.354 10.673  1.00 33.91 ? 128  ARG A CB    1 
ATOM   862  C CG    . ARG A 1 102 ? 7.468   32.260 11.675  1.00 36.96 ? 128  ARG A CG    1 
ATOM   863  C CD    . ARG A 1 102 ? 8.389   32.793 12.773  1.00 38.72 ? 128  ARG A CD    1 
ATOM   864  N NE    . ARG A 1 102 ? 8.803   31.748 13.703  1.00 38.27 ? 128  ARG A NE    1 
ATOM   865  C CZ    . ARG A 1 102 ? 9.722   30.833 13.419  1.00 39.98 ? 128  ARG A CZ    1 
ATOM   866  N NH1   . ARG A 1 102 ? 10.042  29.909 14.316  1.00 39.56 ? 128  ARG A NH1   1 
ATOM   867  N NH2   . ARG A 1 102 ? 10.329  30.853 12.237  1.00 40.40 ? 128  ARG A NH2   1 
ATOM   868  N N     . PHE A 1 103 ? 5.811   30.694 9.342   1.00 29.61 ? 129  PHE A N     1 
ATOM   869  C CA    . PHE A 1 103 ? 5.972   29.442 8.606   1.00 29.55 ? 129  PHE A CA    1 
ATOM   870  C C     . PHE A 1 103 ? 5.199   29.542 7.286   1.00 28.74 ? 129  PHE A C     1 
ATOM   871  O O     . PHE A 1 103 ? 5.681   29.095 6.244   1.00 28.74 ? 129  PHE A O     1 
ATOM   872  C CB    . PHE A 1 103 ? 5.433   28.246 9.412   1.00 30.38 ? 129  PHE A CB    1 
ATOM   873  C CG    . PHE A 1 103 ? 6.434   27.633 10.373  1.00 29.45 ? 129  PHE A CG    1 
ATOM   874  C CD1   . PHE A 1 103 ? 6.103   26.487 11.094  1.00 29.09 ? 129  PHE A CD1   1 
ATOM   875  C CD2   . PHE A 1 103 ? 7.694   28.198 10.563  1.00 27.77 ? 129  PHE A CD2   1 
ATOM   876  C CE1   . PHE A 1 103 ? 7.011   25.911 11.992  1.00 28.04 ? 129  PHE A CE1   1 
ATOM   877  C CE2   . PHE A 1 103 ? 8.608   27.631 11.459  1.00 28.20 ? 129  PHE A CE2   1 
ATOM   878  C CZ    . PHE A 1 103 ? 8.263   26.483 12.175  1.00 27.59 ? 129  PHE A CZ    1 
ATOM   879  N N     . TRP A 1 104 ? 4.007   30.133 7.325   1.00 25.44 ? 130  TRP A N     1 
ATOM   880  C CA    . TRP A 1 104 ? 3.215   30.252 6.108   1.00 26.35 ? 130  TRP A CA    1 
ATOM   881  C C     . TRP A 1 104 ? 3.895   31.207 5.133   1.00 24.31 ? 130  TRP A C     1 
ATOM   882  O O     . TRP A 1 104 ? 3.938   30.939 3.940   1.00 26.25 ? 130  TRP A O     1 
ATOM   883  C CB    . TRP A 1 104 ? 1.782   30.712 6.426   1.00 25.31 ? 130  TRP A CB    1 
ATOM   884  C CG    . TRP A 1 104 ? 0.894   30.898 5.210   1.00 25.67 ? 130  TRP A CG    1 
ATOM   885  C CD1   . TRP A 1 104 ? 0.239   32.033 4.852   1.00 24.81 ? 130  TRP A CD1   1 
ATOM   886  C CD2   . TRP A 1 104 ? 0.573   29.918 4.203   1.00 26.73 ? 130  TRP A CD2   1 
ATOM   887  N NE1   . TRP A 1 104 ? -0.469  31.833 3.689   1.00 24.86 ? 130  TRP A NE1   1 
ATOM   888  C CE2   . TRP A 1 104 ? -0.284  30.544 3.270   1.00 25.48 ? 130  TRP A CE2   1 
ATOM   889  C CE3   . TRP A 1 104 ? 0.924   28.574 4.001   1.00 25.55 ? 130  TRP A CE3   1 
ATOM   890  C CZ2   . TRP A 1 104 ? -0.798  29.875 2.149   1.00 26.95 ? 130  TRP A CZ2   1 
ATOM   891  C CZ3   . TRP A 1 104 ? 0.412   27.907 2.884   1.00 26.92 ? 130  TRP A CZ3   1 
ATOM   892  C CH2   . TRP A 1 104 ? -0.440  28.562 1.973   1.00 26.54 ? 130  TRP A CH2   1 
ATOM   893  N N     . LEU A 1 105 ? 4.452   32.307 5.630   1.00 25.19 ? 131  LEU A N     1 
ATOM   894  C CA    . LEU A 1 105 ? 5.128   33.245 4.730   1.00 25.93 ? 131  LEU A CA    1 
ATOM   895  C C     . LEU A 1 105 ? 6.355   32.601 4.086   1.00 26.06 ? 131  LEU A C     1 
ATOM   896  O O     . LEU A 1 105 ? 6.594   32.779 2.895   1.00 27.83 ? 131  LEU A O     1 
ATOM   897  C CB    . LEU A 1 105 ? 5.546   34.523 5.467   1.00 24.44 ? 131  LEU A CB    1 
ATOM   898  C CG    . LEU A 1 105 ? 6.232   35.611 4.619   1.00 26.13 ? 131  LEU A CG    1 
ATOM   899  C CD1   . LEU A 1 105 ? 5.405   35.922 3.370   1.00 24.20 ? 131  LEU A CD1   1 
ATOM   900  C CD2   . LEU A 1 105 ? 6.406   36.883 5.460   1.00 28.05 ? 131  LEU A CD2   1 
ATOM   901  N N     . GLU A 1 106 ? 7.130   31.851 4.868   1.00 26.19 ? 132  GLU A N     1 
ATOM   902  C CA    . GLU A 1 106 ? 8.321   31.192 4.334   1.00 25.98 ? 132  GLU A CA    1 
ATOM   903  C C     . GLU A 1 106 ? 7.899   30.210 3.249   1.00 24.33 ? 132  GLU A C     1 
ATOM   904  O O     . GLU A 1 106 ? 8.571   30.062 2.233   1.00 24.69 ? 132  GLU A O     1 
ATOM   905  C CB    . GLU A 1 106 ? 9.070   30.444 5.442   1.00 27.30 ? 132  GLU A CB    1 
ATOM   906  C CG    . GLU A 1 106 ? 10.542  30.213 5.130   1.00 31.18 ? 132  GLU A CG    1 
ATOM   907  C CD    . GLU A 1 106 ? 11.293  31.521 4.852   1.00 33.14 ? 132  GLU A CD    1 
ATOM   908  O OE1   . GLU A 1 106 ? 11.086  32.503 5.594   1.00 32.59 ? 132  GLU A OE1   1 
ATOM   909  O OE2   . GLU A 1 106 ? 12.094  31.567 3.899   1.00 35.47 ? 132  GLU A OE2   1 
ATOM   910  N N     . THR A 1 107 ? 6.784   29.530 3.483   1.00 24.76 ? 133  THR A N     1 
ATOM   911  C CA    . THR A 1 107 ? 6.246   28.584 2.514   1.00 25.41 ? 133  THR A CA    1 
ATOM   912  C C     . THR A 1 107 ? 5.949   29.334 1.218   1.00 24.46 ? 133  THR A C     1 
ATOM   913  O O     . THR A 1 107 ? 6.281   28.866 0.129   1.00 23.82 ? 133  THR A O     1 
ATOM   914  C CB    . THR A 1 107 ? 4.934   27.935 3.019   1.00 26.04 ? 133  THR A CB    1 
ATOM   915  O OG1   . THR A 1 107 ? 5.201   27.189 4.208   1.00 27.57 ? 133  THR A OG1   1 
ATOM   916  C CG2   . THR A 1 107 ? 4.364   26.988 1.974   1.00 26.43 ? 133  THR A CG2   1 
ATOM   917  N N     . LEU A 1 108 ? 5.338   30.509 1.342   1.00 24.51 ? 134  LEU A N     1 
ATOM   918  C CA    . LEU A 1 108 ? 5.007   31.304 0.170   1.00 24.18 ? 134  LEU A CA    1 
ATOM   919  C C     . LEU A 1 108 ? 6.248   31.731 -0.601  1.00 25.09 ? 134  LEU A C     1 
ATOM   920  O O     . LEU A 1 108 ? 6.258   31.709 -1.835  1.00 22.85 ? 134  LEU A O     1 
ATOM   921  C CB    . LEU A 1 108 ? 4.209   32.543 0.575   1.00 23.33 ? 134  LEU A CB    1 
ATOM   922  C CG    . LEU A 1 108 ? 2.830   32.301 1.193   1.00 25.37 ? 134  LEU A CG    1 
ATOM   923  C CD1   . LEU A 1 108 ? 2.207   33.639 1.565   1.00 24.58 ? 134  LEU A CD1   1 
ATOM   924  C CD2   . LEU A 1 108 ? 1.936   31.553 0.209   1.00 23.24 ? 134  LEU A CD2   1 
ATOM   925  N N     . LEU A 1 109 ? 7.283   32.136 0.130   1.00 24.66 ? 135  LEU A N     1 
ATOM   926  C CA    . LEU A 1 109 ? 8.529   32.580 -0.484  1.00 25.85 ? 135  LEU A CA    1 
ATOM   927  C C     . LEU A 1 109 ? 9.228   31.420 -1.181  1.00 26.75 ? 135  LEU A C     1 
ATOM   928  O O     . LEU A 1 109 ? 9.887   31.609 -2.204  1.00 26.88 ? 135  LEU A O     1 
ATOM   929  C CB    . LEU A 1 109 ? 9.451   33.189 0.578   1.00 25.61 ? 135  LEU A CB    1 
ATOM   930  C CG    . LEU A 1 109 ? 8.842   34.338 1.384   1.00 25.93 ? 135  LEU A CG    1 
ATOM   931  C CD1   . LEU A 1 109 ? 9.892   34.908 2.329   1.00 26.51 ? 135  LEU A CD1   1 
ATOM   932  C CD2   . LEU A 1 109 ? 8.320   35.416 0.445   1.00 24.26 ? 135  LEU A CD2   1 
ATOM   933  N N     . CYS A 1 110 ? 9.085   30.221 -0.622  1.00 27.67 ? 136  CYS A N     1 
ATOM   934  C CA    . CYS A 1 110 ? 9.688   29.031 -1.217  1.00 28.76 ? 136  CYS A CA    1 
ATOM   935  C C     . CYS A 1 110 ? 9.009   28.743 -2.544  1.00 27.47 ? 136  CYS A C     1 
ATOM   936  O O     . CYS A 1 110 ? 9.666   28.398 -3.526  1.00 29.15 ? 136  CYS A O     1 
ATOM   937  C CB    . CYS A 1 110 ? 9.530   27.810 -0.305  1.00 29.50 ? 136  CYS A CB    1 
ATOM   938  S SG    . CYS A 1 110 ? 10.658  27.749 1.103   1.00 34.41 ? 136  CYS A SG    1 
ATOM   939  N N     . LEU A 1 111 ? 7.689   28.888 -2.566  1.00 27.62 ? 137  LEU A N     1 
ATOM   940  C CA    . LEU A 1 111 ? 6.912   28.643 -3.778  1.00 26.62 ? 137  LEU A CA    1 
ATOM   941  C C     . LEU A 1 111 ? 7.203   29.629 -4.901  1.00 26.46 ? 137  LEU A C     1 
ATOM   942  O O     . LEU A 1 111 ? 7.690   29.242 -5.957  1.00 27.71 ? 137  LEU A O     1 
ATOM   943  C CB    . LEU A 1 111 ? 5.411   28.688 -3.483  1.00 25.89 ? 137  LEU A CB    1 
ATOM   944  C CG    . LEU A 1 111 ? 4.798   27.659 -2.534  1.00 30.45 ? 137  LEU A CG    1 
ATOM   945  C CD1   . LEU A 1 111 ? 3.291   27.656 -2.725  1.00 27.04 ? 137  LEU A CD1   1 
ATOM   946  C CD2   . LEU A 1 111 ? 5.353   26.275 -2.822  1.00 30.38 ? 137  LEU A CD2   1 
ATOM   947  N N     . ILE A 1 112 ? 6.910   30.906 -4.668  1.00 25.92 ? 138  ILE A N     1 
ATOM   948  C CA    . ILE A 1 112 ? 7.099   31.909 -5.700  1.00 24.58 ? 138  ILE A CA    1 
ATOM   949  C C     . ILE A 1 112 ? 8.555   32.145 -6.060  1.00 25.98 ? 138  ILE A C     1 
ATOM   950  O O     . ILE A 1 112 ? 8.863   32.531 -7.185  1.00 26.81 ? 138  ILE A O     1 
ATOM   951  C CB    . ILE A 1 112 ? 6.410   33.245 -5.315  1.00 22.44 ? 138  ILE A CB    1 
ATOM   952  C CG1   . ILE A 1 112 ? 7.161   33.945 -4.183  1.00 24.18 ? 138  ILE A CG1   1 
ATOM   953  C CG2   . ILE A 1 112 ? 4.978   32.962 -4.881  1.00 23.56 ? 138  ILE A CG2   1 
ATOM   954  C CD1   . ILE A 1 112 ? 6.797   35.415 -3.981  1.00 35.61 ? 138  ILE A CD1   1 
ATOM   955  N N     . GLY A 1 113 ? 9.451   31.887 -5.115  1.00 25.76 ? 139  GLY A N     1 
ATOM   956  C CA    . GLY A 1 113 ? 10.865  32.078 -5.377  1.00 25.87 ? 139  GLY A CA    1 
ATOM   957  C C     . GLY A 1 113 ? 11.545  30.896 -6.043  1.00 27.18 ? 139  GLY A C     1 
ATOM   958  O O     . GLY A 1 113 ? 12.731  30.976 -6.359  1.00 27.33 ? 139  GLY A O     1 
ATOM   959  N N     . GLU A 1 114 ? 10.802  29.809 -6.266  1.00 27.85 ? 140  GLU A N     1 
ATOM   960  C CA    . GLU A 1 114 ? 11.338  28.600 -6.903  1.00 29.26 ? 140  GLU A CA    1 
ATOM   961  C C     . GLU A 1 114 ? 12.560  28.104 -6.136  1.00 29.79 ? 140  GLU A C     1 
ATOM   962  O O     . GLU A 1 114 ? 13.594  27.824 -6.722  1.00 30.28 ? 140  GLU A O     1 
ATOM   963  C CB    . GLU A 1 114 ? 11.739  28.899 -8.343  1.00 29.93 ? 140  GLU A CB    1 
ATOM   964  C CG    . GLU A 1 114 ? 10.624  29.462 -9.210  1.00 35.36 ? 140  GLU A CG    1 
ATOM   965  C CD    . GLU A 1 114 ? 9.565   28.429 -9.574  1.00 39.13 ? 140  GLU A CD    1 
ATOM   966  O OE1   . GLU A 1 114 ? 9.945   27.350 -10.083 1.00 41.39 ? 140  GLU A OE1   1 
ATOM   967  O OE2   . GLU A 1 114 ? 8.357   28.702 -9.370  1.00 38.48 ? 140  GLU A OE2   1 
ATOM   968  N N     . SER A 1 115 ? 12.426  27.982 -4.822  1.00 29.59 ? 141  SER A N     1 
ATOM   969  C CA    . SER A 1 115 ? 13.534  27.574 -3.966  1.00 29.70 ? 141  SER A CA    1 
ATOM   970  C C     . SER A 1 115 ? 13.980  26.116 -4.022  1.00 30.44 ? 141  SER A C     1 
ATOM   971  O O     . SER A 1 115 ? 14.941  25.748 -3.353  1.00 30.39 ? 141  SER A O     1 
ATOM   972  C CB    . SER A 1 115 ? 13.206  27.930 -2.515  1.00 28.30 ? 141  SER A CB    1 
ATOM   973  O OG    . SER A 1 115 ? 12.812  29.285 -2.416  1.00 30.91 ? 141  SER A OG    1 
ATOM   974  N N     . PHE A 1 116 ? 13.299  25.279 -4.797  1.00 30.36 ? 142  PHE A N     1 
ATOM   975  C CA    . PHE A 1 116 ? 13.692  23.876 -4.871  1.00 29.07 ? 142  PHE A CA    1 
ATOM   976  C C     . PHE A 1 116 ? 14.399  23.546 -6.177  1.00 30.75 ? 142  PHE A C     1 
ATOM   977  O O     . PHE A 1 116 ? 14.418  22.395 -6.607  1.00 30.01 ? 142  PHE A O     1 
ATOM   978  C CB    . PHE A 1 116 ? 12.469  22.974 -4.699  1.00 26.65 ? 142  PHE A CB    1 
ATOM   979  C CG    . PHE A 1 116 ? 11.611  23.344 -3.519  1.00 27.34 ? 142  PHE A CG    1 
ATOM   980  C CD1   . PHE A 1 116 ? 10.353  23.904 -3.709  1.00 23.19 ? 142  PHE A CD1   1 
ATOM   981  C CD2   . PHE A 1 116 ? 12.082  23.172 -2.216  1.00 26.21 ? 142  PHE A CD2   1 
ATOM   982  C CE1   . PHE A 1 116 ? 9.575   24.293 -2.624  1.00 27.78 ? 142  PHE A CE1   1 
ATOM   983  C CE2   . PHE A 1 116 ? 11.312  23.557 -1.122  1.00 29.07 ? 142  PHE A CE2   1 
ATOM   984  C CZ    . PHE A 1 116 ? 10.055  24.121 -1.322  1.00 26.59 ? 142  PHE A CZ    1 
ATOM   985  N N     . ASP A 1 117 ? 14.987  24.560 -6.801  1.00 32.07 ? 143  ASP A N     1 
ATOM   986  C CA    . ASP A 1 117 ? 15.695  24.369 -8.062  1.00 34.76 ? 143  ASP A CA    1 
ATOM   987  C C     . ASP A 1 117 ? 14.805  23.712 -9.116  1.00 34.55 ? 143  ASP A C     1 
ATOM   988  O O     . ASP A 1 117 ? 13.628  24.055 -9.252  1.00 33.56 ? 143  ASP A O     1 
ATOM   989  C CB    . ASP A 1 117 ? 16.942  23.510 -7.839  1.00 38.83 ? 143  ASP A CB    1 
ATOM   990  C CG    . ASP A 1 117 ? 17.993  24.216 -7.010  1.00 44.34 ? 143  ASP A CG    1 
ATOM   991  O OD1   . ASP A 1 117 ? 18.348  25.365 -7.356  1.00 48.20 ? 143  ASP A OD1   1 
ATOM   992  O OD2   . ASP A 1 117 ? 18.470  23.625 -6.017  1.00 47.62 ? 143  ASP A OD2   1 
ATOM   993  N N     . ASP A 1 118 ? 15.368  22.766 -9.860  1.00 33.28 ? 144  ASP A N     1 
ATOM   994  C CA    . ASP A 1 118 ? 14.604  22.084 -10.890 1.00 35.62 ? 144  ASP A CA    1 
ATOM   995  C C     . ASP A 1 118 ? 13.417  21.326 -10.325 1.00 35.02 ? 144  ASP A C     1 
ATOM   996  O O     . ASP A 1 118 ? 12.383  21.209 -10.987 1.00 34.16 ? 144  ASP A O     1 
ATOM   997  C CB    . ASP A 1 118 ? 15.492  21.120 -11.675 1.00 39.79 ? 144  ASP A CB    1 
ATOM   998  C CG    . ASP A 1 118 ? 16.267  21.816 -12.777 1.00 43.88 ? 144  ASP A CG    1 
ATOM   999  O OD1   . ASP A 1 118 ? 15.868  22.937 -13.164 1.00 46.34 ? 144  ASP A OD1   1 
ATOM   1000 O OD2   . ASP A 1 118 ? 17.262  21.238 -13.264 1.00 47.73 ? 144  ASP A OD2   1 
ATOM   1001 N N     . TYR A 1 119 ? 13.564  20.823 -9.102  1.00 32.57 ? 145  TYR A N     1 
ATOM   1002 C CA    . TYR A 1 119 ? 12.496  20.068 -8.455  1.00 31.93 ? 145  TYR A CA    1 
ATOM   1003 C C     . TYR A 1 119 ? 11.262  20.931 -8.206  1.00 30.86 ? 145  TYR A C     1 
ATOM   1004 O O     . TYR A 1 119 ? 10.211  20.426 -7.801  1.00 27.38 ? 145  TYR A O     1 
ATOM   1005 C CB    . TYR A 1 119 ? 13.005  19.472 -7.141  1.00 31.74 ? 145  TYR A CB    1 
ATOM   1006 C CG    . TYR A 1 119 ? 14.245  18.620 -7.320  1.00 31.71 ? 145  TYR A CG    1 
ATOM   1007 C CD1   . TYR A 1 119 ? 15.443  18.952 -6.685  1.00 34.65 ? 145  TYR A CD1   1 
ATOM   1008 C CD2   . TYR A 1 119 ? 14.220  17.486 -8.125  1.00 32.30 ? 145  TYR A CD2   1 
ATOM   1009 C CE1   . TYR A 1 119 ? 16.591  18.166 -6.846  1.00 34.29 ? 145  TYR A CE1   1 
ATOM   1010 C CE2   . TYR A 1 119 ? 15.356  16.696 -8.294  1.00 35.29 ? 145  TYR A CE2   1 
ATOM   1011 C CZ    . TYR A 1 119 ? 16.538  17.041 -7.648  1.00 35.82 ? 145  TYR A CZ    1 
ATOM   1012 O OH    . TYR A 1 119 ? 17.656  16.245 -7.789  1.00 38.59 ? 145  TYR A OH    1 
ATOM   1013 N N     . SER A 1 120 ? 11.392  22.232 -8.452  1.00 31.14 ? 146  SER A N     1 
ATOM   1014 C CA    . SER A 1 120 ? 10.275  23.152 -8.271  1.00 32.50 ? 146  SER A CA    1 
ATOM   1015 C C     . SER A 1 120 ? 9.153   22.887 -9.263  1.00 31.61 ? 146  SER A C     1 
ATOM   1016 O O     . SER A 1 120 ? 8.024   23.309 -9.047  1.00 32.49 ? 146  SER A O     1 
ATOM   1017 C CB    . SER A 1 120 ? 10.741  24.605 -8.393  1.00 32.27 ? 146  SER A CB    1 
ATOM   1018 O OG    . SER A 1 120 ? 11.122  25.110 -7.122  1.00 35.71 ? 146  SER A OG    1 
ATOM   1019 N N     . ASP A 1 121 ? 9.457   22.190 -10.352 1.00 31.90 ? 147  ASP A N     1 
ATOM   1020 C CA    . ASP A 1 121 ? 8.429   21.877 -11.341 1.00 33.67 ? 147  ASP A CA    1 
ATOM   1021 C C     . ASP A 1 121 ? 7.428   20.859 -10.802 1.00 32.66 ? 147  ASP A C     1 
ATOM   1022 O O     . ASP A 1 121 ? 6.312   20.763 -11.305 1.00 32.07 ? 147  ASP A O     1 
ATOM   1023 C CB    . ASP A 1 121 ? 9.055   21.349 -12.637 1.00 34.54 ? 147  ASP A CB    1 
ATOM   1024 C CG    . ASP A 1 121 ? 9.676   22.456 -13.476 1.00 40.12 ? 147  ASP A CG    1 
ATOM   1025 O OD1   . ASP A 1 121 ? 9.533   23.641 -13.093 1.00 41.72 ? 147  ASP A OD1   1 
ATOM   1026 O OD2   . ASP A 1 121 ? 10.296  22.148 -14.517 1.00 40.50 ? 147  ASP A OD2   1 
ATOM   1027 N N     . ASP A 1 122 ? 7.835   20.101 -9.784  1.00 30.85 ? 148  ASP A N     1 
ATOM   1028 C CA    . ASP A 1 122 ? 6.963   19.105 -9.163  1.00 29.33 ? 148  ASP A CA    1 
ATOM   1029 C C     . ASP A 1 122 ? 6.014   19.740 -8.144  1.00 28.26 ? 148  ASP A C     1 
ATOM   1030 O O     . ASP A 1 122 ? 5.031   19.119 -7.735  1.00 28.40 ? 148  ASP A O     1 
ATOM   1031 C CB    . ASP A 1 122 ? 7.786   18.017 -8.466  1.00 31.18 ? 148  ASP A CB    1 
ATOM   1032 C CG    . ASP A 1 122 ? 8.183   16.885 -9.404  1.00 35.61 ? 148  ASP A CG    1 
ATOM   1033 O OD1   . ASP A 1 122 ? 8.959   17.141 -10.351 1.00 38.43 ? 148  ASP A OD1   1 
ATOM   1034 O OD2   . ASP A 1 122 ? 7.716   15.737 -9.197  1.00 34.87 ? 148  ASP A OD2   1 
ATOM   1035 N N     . VAL A 1 123 ? 6.309   20.969 -7.732  1.00 24.97 ? 149  VAL A N     1 
ATOM   1036 C CA    . VAL A 1 123 ? 5.468   21.664 -6.763  1.00 24.83 ? 149  VAL A CA    1 
ATOM   1037 C C     . VAL A 1 123 ? 4.168   22.183 -7.376  1.00 26.26 ? 149  VAL A C     1 
ATOM   1038 O O     . VAL A 1 123 ? 4.176   22.888 -8.385  1.00 26.00 ? 149  VAL A O     1 
ATOM   1039 C CB    . VAL A 1 123 ? 6.217   22.860 -6.117  1.00 24.92 ? 149  VAL A CB    1 
ATOM   1040 C CG1   . VAL A 1 123 ? 5.268   23.645 -5.206  1.00 19.97 ? 149  VAL A CG1   1 
ATOM   1041 C CG2   . VAL A 1 123 ? 7.416   22.352 -5.303  1.00 19.97 ? 149  VAL A CG2   1 
ATOM   1042 N N     . CYS A 1 124 ? 3.048   21.840 -6.752  1.00 25.67 ? 150  CYS A N     1 
ATOM   1043 C CA    . CYS A 1 124 ? 1.748   22.290 -7.228  1.00 25.03 ? 150  CYS A CA    1 
ATOM   1044 C C     . CYS A 1 124 ? 1.302   23.519 -6.448  1.00 24.83 ? 150  CYS A C     1 
ATOM   1045 O O     . CYS A 1 124 ? 0.824   24.499 -7.030  1.00 25.76 ? 150  CYS A O     1 
ATOM   1046 C CB    . CYS A 1 124 ? 0.717   21.179 -7.064  1.00 25.03 ? 150  CYS A CB    1 
ATOM   1047 S SG    . CYS A 1 124 ? 1.115   19.697 -8.006  1.00 29.70 ? 150  CYS A SG    1 
ATOM   1048 N N     . GLY A 1 125 ? 1.460   23.455 -5.130  1.00 21.17 ? 151  GLY A N     1 
ATOM   1049 C CA    . GLY A 1 125 ? 1.074   24.561 -4.276  1.00 21.01 ? 151  GLY A CA    1 
ATOM   1050 C C     . GLY A 1 125 ? 1.211   24.205 -2.812  1.00 22.44 ? 151  GLY A C     1 
ATOM   1051 O O     . GLY A 1 125 ? 1.837   23.205 -2.468  1.00 21.96 ? 151  GLY A O     1 
ATOM   1052 N N     . ALA A 1 126 ? 0.638   25.029 -1.945  1.00 22.49 ? 152  ALA A N     1 
ATOM   1053 C CA    . ALA A 1 126 ? 0.687   24.770 -0.518  1.00 23.13 ? 152  ALA A CA    1 
ATOM   1054 C C     . ALA A 1 126 ? -0.628  25.201 0.104   1.00 23.41 ? 152  ALA A C     1 
ATOM   1055 O O     . ALA A 1 126 ? -1.325  26.065 -0.426  1.00 22.28 ? 152  ALA A O     1 
ATOM   1056 C CB    . ALA A 1 126 ? 1.834   25.535 0.118   1.00 22.80 ? 152  ALA A CB    1 
ATOM   1057 N N     . VAL A 1 127 ? -0.983  24.593 1.223   1.00 23.11 ? 153  VAL A N     1 
ATOM   1058 C CA    . VAL A 1 127 ? -2.217  24.975 1.884   1.00 24.07 ? 153  VAL A CA    1 
ATOM   1059 C C     . VAL A 1 127 ? -2.020  25.082 3.378   1.00 23.68 ? 153  VAL A C     1 
ATOM   1060 O O     . VAL A 1 127 ? -1.264  24.312 3.972   1.00 24.42 ? 153  VAL A O     1 
ATOM   1061 C CB    . VAL A 1 127 ? -3.381  23.978 1.578   1.00 24.26 ? 153  VAL A CB    1 
ATOM   1062 C CG1   . VAL A 1 127 ? -2.840  22.647 1.184   1.00 27.59 ? 153  VAL A CG1   1 
ATOM   1063 C CG2   . VAL A 1 127 ? -4.287  23.828 2.802   1.00 22.13 ? 153  VAL A CG2   1 
ATOM   1064 N N     . VAL A 1 128 ? -2.671  26.069 3.980   1.00 21.68 ? 154  VAL A N     1 
ATOM   1065 C CA    . VAL A 1 128 ? -2.595  26.229 5.419   1.00 21.50 ? 154  VAL A CA    1 
ATOM   1066 C C     . VAL A 1 128 ? -4.004  26.072 5.959   1.00 21.83 ? 154  VAL A C     1 
ATOM   1067 O O     . VAL A 1 128 ? -4.932  26.744 5.500   1.00 21.91 ? 154  VAL A O     1 
ATOM   1068 C CB    . VAL A 1 128 ? -2.019  27.610 5.842   1.00 21.60 ? 154  VAL A CB    1 
ATOM   1069 C CG1   . VAL A 1 128 ? -2.809  28.752 5.212   1.00 21.09 ? 154  VAL A CG1   1 
ATOM   1070 C CG2   . VAL A 1 128 ? -2.040  27.725 7.355   1.00 20.75 ? 154  VAL A CG2   1 
ATOM   1071 N N     . ASN A 1 129 ? -4.167  25.145 6.899   1.00 22.47 ? 155  ASN A N     1 
ATOM   1072 C CA    . ASN A 1 129 ? -5.463  24.905 7.525   1.00 24.65 ? 155  ASN A CA    1 
ATOM   1073 C C     . ASN A 1 129 ? -5.455  25.526 8.924   1.00 24.39 ? 155  ASN A C     1 
ATOM   1074 O O     . ASN A 1 129 ? -4.601  25.210 9.748   1.00 26.00 ? 155  ASN A O     1 
ATOM   1075 C CB    . ASN A 1 129 ? -5.738  23.405 7.667   1.00 23.95 ? 155  ASN A CB    1 
ATOM   1076 C CG    . ASN A 1 129 ? -5.612  22.652 6.353   1.00 25.09 ? 155  ASN A CG    1 
ATOM   1077 O OD1   . ASN A 1 129 ? -4.772  21.767 6.219   1.00 28.62 ? 155  ASN A OD1   1 
ATOM   1078 N ND2   . ASN A 1 129 ? -6.453  22.994 5.383   1.00 24.91 ? 155  ASN A ND2   1 
ATOM   1079 N N     . VAL A 1 130 ? -6.391  26.423 9.191   1.00 26.16 ? 156  VAL A N     1 
ATOM   1080 C CA    . VAL A 1 130 ? -6.473  27.020 10.516  1.00 26.39 ? 156  VAL A CA    1 
ATOM   1081 C C     . VAL A 1 130 ? -7.505  26.159 11.243  1.00 25.97 ? 156  VAL A C     1 
ATOM   1082 O O     . VAL A 1 130 ? -8.664  26.093 10.841  1.00 23.59 ? 156  VAL A O     1 
ATOM   1083 C CB    . VAL A 1 130 ? -6.931  28.483 10.430  1.00 27.78 ? 156  VAL A CB    1 
ATOM   1084 C CG1   . VAL A 1 130 ? -6.987  29.101 11.824  1.00 26.78 ? 156  VAL A CG1   1 
ATOM   1085 C CG2   . VAL A 1 130 ? -5.963  29.261 9.550   1.00 27.63 ? 156  VAL A CG2   1 
ATOM   1086 N N     . ARG A 1 131 ? -7.071  25.471 12.294  1.00 27.88 ? 157  ARG A N     1 
ATOM   1087 C CA    . ARG A 1 131 ? -7.958  24.574 13.036  1.00 28.82 ? 157  ARG A CA    1 
ATOM   1088 C C     . ARG A 1 131 ? -7.822  24.735 14.541  1.00 30.49 ? 157  ARG A C     1 
ATOM   1089 O O     . ARG A 1 131 ? -6.731  24.996 15.047  1.00 32.64 ? 157  ARG A O     1 
ATOM   1090 C CB    . ARG A 1 131 ? -7.655  23.125 12.643  1.00 24.64 ? 157  ARG A CB    1 
ATOM   1091 C CG    . ARG A 1 131 ? -7.865  22.824 11.162  1.00 25.16 ? 157  ARG A CG    1 
ATOM   1092 C CD    . ARG A 1 131 ? -9.351  22.692 10.820  1.00 24.59 ? 157  ARG A CD    1 
ATOM   1093 N NE    . ARG A 1 131 ? -9.562  22.319 9.422   1.00 26.52 ? 157  ARG A NE    1 
ATOM   1094 C CZ    . ARG A 1 131 ? -9.450  23.155 8.392   1.00 28.95 ? 157  ARG A CZ    1 
ATOM   1095 N NH1   . ARG A 1 131 ? -9.138  24.427 8.598   1.00 28.18 ? 157  ARG A NH1   1 
ATOM   1096 N NH2   . ARG A 1 131 ? -9.621  22.713 7.151   1.00 27.38 ? 157  ARG A NH2   1 
ATOM   1097 N N     . ALA A 1 132 ? -8.930  24.567 15.255  1.00 31.95 ? 158  ALA A N     1 
ATOM   1098 C CA    . ALA A 1 132 ? -8.927  24.698 16.706  1.00 33.86 ? 158  ALA A CA    1 
ATOM   1099 C C     . ALA A 1 132 ? -8.106  23.603 17.382  1.00 35.60 ? 158  ALA A C     1 
ATOM   1100 O O     . ALA A 1 132 ? -7.532  23.830 18.442  1.00 37.95 ? 158  ALA A O     1 
ATOM   1101 C CB    . ALA A 1 132 ? -10.351 24.680 17.234  1.00 31.97 ? 158  ALA A CB    1 
ATOM   1102 N N     . LYS A 1 133 ? -8.041  22.423 16.772  1.00 35.19 ? 159  LYS A N     1 
ATOM   1103 C CA    . LYS A 1 133 ? -7.285  21.319 17.353  1.00 37.55 ? 159  LYS A CA    1 
ATOM   1104 C C     . LYS A 1 133 ? -5.805  21.397 16.988  1.00 37.66 ? 159  LYS A C     1 
ATOM   1105 O O     . LYS A 1 133 ? -4.976  20.703 17.575  1.00 38.09 ? 159  LYS A O     1 
ATOM   1106 C CB    . LYS A 1 133 ? -7.853  19.974 16.880  1.00 40.35 ? 159  LYS A CB    1 
ATOM   1107 C CG    . LYS A 1 133 ? -7.502  19.633 15.443  1.00 44.93 ? 159  LYS A CG    1 
ATOM   1108 C CD    . LYS A 1 133 ? -8.201  18.369 14.957  1.00 47.05 ? 159  LYS A CD    1 
ATOM   1109 C CE    . LYS A 1 133 ? -7.796  18.019 13.516  1.00 49.44 ? 159  LYS A CE    1 
ATOM   1110 N NZ    . LYS A 1 133 ? -7.958  19.162 12.549  1.00 47.00 ? 159  LYS A NZ    1 
ATOM   1111 N N     . GLY A 1 134 ? -5.471  22.246 16.021  1.00 37.77 ? 160  GLY A N     1 
ATOM   1112 C CA    . GLY A 1 134 ? -4.085  22.374 15.610  1.00 34.80 ? 160  GLY A CA    1 
ATOM   1113 C C     . GLY A 1 134 ? -3.965  22.717 14.140  1.00 33.01 ? 160  GLY A C     1 
ATOM   1114 O O     . GLY A 1 134 ? -4.528  22.042 13.281  1.00 33.78 ? 160  GLY A O     1 
ATOM   1115 N N     . ASP A 1 135 ? -3.212  23.768 13.853  1.00 31.14 ? 161  ASP A N     1 
ATOM   1116 C CA    . ASP A 1 135 ? -3.022  24.232 12.487  1.00 30.06 ? 161  ASP A CA    1 
ATOM   1117 C C     . ASP A 1 135 ? -2.086  23.325 11.694  1.00 28.44 ? 161  ASP A C     1 
ATOM   1118 O O     . ASP A 1 135 ? -1.244  22.632 12.265  1.00 26.31 ? 161  ASP A O     1 
ATOM   1119 C CB    . ASP A 1 135 ? -2.482  25.660 12.520  1.00 30.49 ? 161  ASP A CB    1 
ATOM   1120 C CG    . ASP A 1 135 ? -3.352  26.586 13.363  1.00 34.51 ? 161  ASP A CG    1 
ATOM   1121 O OD1   . ASP A 1 135 ? -2.803  27.336 14.206  1.00 36.14 ? 161  ASP A OD1   1 
ATOM   1122 O OD2   . ASP A 1 135 ? -4.590  26.561 13.184  1.00 35.96 ? 161  ASP A OD2   1 
ATOM   1123 N N     . LYS A 1 136 ? -2.247  23.340 10.376  1.00 26.16 ? 162  LYS A N     1 
ATOM   1124 C CA    . LYS A 1 136 ? -1.441  22.524 9.482   1.00 26.81 ? 162  LYS A CA    1 
ATOM   1125 C C     . LYS A 1 136 ? -1.031  23.288 8.227   1.00 25.96 ? 162  LYS A C     1 
ATOM   1126 O O     . LYS A 1 136 ? -1.788  24.111 7.702   1.00 24.63 ? 162  LYS A O     1 
ATOM   1127 C CB    . LYS A 1 136 ? -2.221  21.276 9.058   1.00 27.64 ? 162  LYS A CB    1 
ATOM   1128 C CG    . LYS A 1 136 ? -2.112  20.083 10.002  1.00 29.92 ? 162  LYS A CG    1 
ATOM   1129 C CD    . LYS A 1 136 ? -3.477  19.480 10.312  1.00 30.37 ? 162  LYS A CD    1 
ATOM   1130 C CE    . LYS A 1 136 ? -4.293  19.223 9.063   1.00 32.09 ? 162  LYS A CE    1 
ATOM   1131 N NZ    . LYS A 1 136 ? -5.679  18.772 9.385   1.00 31.25 ? 162  LYS A NZ    1 
ATOM   1132 N N     . ILE A 1 137 ? 0.181   23.020 7.763   1.00 24.89 ? 163  ILE A N     1 
ATOM   1133 C CA    . ILE A 1 137 ? 0.680   23.632 6.544   1.00 24.52 ? 163  ILE A CA    1 
ATOM   1134 C C     . ILE A 1 137 ? 1.230   22.484 5.716   1.00 26.13 ? 163  ILE A C     1 
ATOM   1135 O O     . ILE A 1 137 ? 1.820   21.530 6.242   1.00 25.93 ? 163  ILE A O     1 
ATOM   1136 C CB    . ILE A 1 137 ? 1.779   24.665 6.820   1.00 26.31 ? 163  ILE A CB    1 
ATOM   1137 C CG1   . ILE A 1 137 ? 1.233   25.757 7.755   1.00 25.46 ? 163  ILE A CG1   1 
ATOM   1138 C CG2   . ILE A 1 137 ? 2.245   25.297 5.498   1.00 24.89 ? 163  ILE A CG2   1 
ATOM   1139 C CD1   . ILE A 1 137 ? 1.164   25.366 9.226   1.00 35.61 ? 163  ILE A CD1   1 
ATOM   1140 N N     . ALA A 1 138 ? 1.020   22.560 4.416   1.00 25.73 ? 164  ALA A N     1 
ATOM   1141 C CA    . ALA A 1 138 ? 1.475   21.497 3.557   1.00 25.07 ? 164  ALA A CA    1 
ATOM   1142 C C     . ALA A 1 138 ? 1.841   21.985 2.172   1.00 25.87 ? 164  ALA A C     1 
ATOM   1143 O O     . ALA A 1 138 ? 1.210   22.893 1.633   1.00 26.55 ? 164  ALA A O     1 
ATOM   1144 C CB    . ALA A 1 138 ? 0.385   20.439 3.460   1.00 21.95 ? 164  ALA A CB    1 
ATOM   1145 N N     . ILE A 1 139 ? 2.884   21.391 1.609   1.00 25.55 ? 165  ILE A N     1 
ATOM   1146 C CA    . ILE A 1 139 ? 3.282   21.707 0.250   1.00 24.35 ? 165  ILE A CA    1 
ATOM   1147 C C     . ILE A 1 139 ? 2.872   20.478 -0.552  1.00 23.54 ? 165  ILE A C     1 
ATOM   1148 O O     . ILE A 1 139 ? 3.275   19.357 -0.245  1.00 21.79 ? 165  ILE A O     1 
ATOM   1149 C CB    . ILE A 1 139 ? 4.806   21.957 0.127   1.00 24.37 ? 165  ILE A CB    1 
ATOM   1150 C CG1   . ILE A 1 139 ? 5.134   23.359 0.652   1.00 24.41 ? 165  ILE A CG1   1 
ATOM   1151 C CG2   . ILE A 1 139 ? 5.255   21.829 -1.331  1.00 24.49 ? 165  ILE A CG2   1 
ATOM   1152 C CD1   . ILE A 1 139 ? 4.412   23.804 1.920   1.00 35.61 ? 165  ILE A CD1   1 
ATOM   1153 N N     . TRP A 1 140 ? 2.034   20.696 -1.558  1.00 23.25 ? 166  TRP A N     1 
ATOM   1154 C CA    . TRP A 1 140 ? 1.548   19.623 -2.417  1.00 23.22 ? 166  TRP A CA    1 
ATOM   1155 C C     . TRP A 1 140 ? 2.447   19.438 -3.644  1.00 23.23 ? 166  TRP A C     1 
ATOM   1156 O O     . TRP A 1 140 ? 2.851   20.421 -4.264  1.00 21.39 ? 166  TRP A O     1 
ATOM   1157 C CB    . TRP A 1 140 ? 0.140   19.960 -2.904  1.00 22.70 ? 166  TRP A CB    1 
ATOM   1158 C CG    . TRP A 1 140 ? -0.939  19.837 -1.880  1.00 20.63 ? 166  TRP A CG    1 
ATOM   1159 C CD1   . TRP A 1 140 ? -0.825  20.023 -0.536  1.00 20.14 ? 166  TRP A CD1   1 
ATOM   1160 C CD2   . TRP A 1 140 ? -2.311  19.533 -2.129  1.00 21.53 ? 166  TRP A CD2   1 
ATOM   1161 N NE1   . TRP A 1 140 ? -2.040  19.852 0.069   1.00 21.61 ? 166  TRP A NE1   1 
ATOM   1162 C CE2   . TRP A 1 140 ? -2.973  19.550 -0.886  1.00 20.34 ? 166  TRP A CE2   1 
ATOM   1163 C CE3   . TRP A 1 140 ? -3.051  19.252 -3.290  1.00 23.46 ? 166  TRP A CE3   1 
ATOM   1164 C CZ2   . TRP A 1 140 ? -4.339  19.296 -0.762  1.00 21.33 ? 166  TRP A CZ2   1 
ATOM   1165 C CZ3   . TRP A 1 140 ? -4.409  19.001 -3.167  1.00 21.57 ? 166  TRP A CZ3   1 
ATOM   1166 C CH2   . TRP A 1 140 ? -5.038  19.024 -1.910  1.00 21.42 ? 166  TRP A CH2   1 
ATOM   1167 N N     . THR A 1 141 ? 2.758   18.190 -3.990  1.00 21.96 ? 167  THR A N     1 
ATOM   1168 C CA    . THR A 1 141 ? 3.563   17.916 -5.180  1.00 24.17 ? 167  THR A CA    1 
ATOM   1169 C C     . THR A 1 141 ? 2.741   17.038 -6.123  1.00 24.78 ? 167  THR A C     1 
ATOM   1170 O O     . THR A 1 141 ? 1.787   16.380 -5.697  1.00 25.59 ? 167  THR A O     1 
ATOM   1171 C CB    . THR A 1 141 ? 4.920   17.232 -4.848  1.00 23.82 ? 167  THR A CB    1 
ATOM   1172 O OG1   . THR A 1 141 ? 4.708   15.880 -4.437  1.00 22.85 ? 167  THR A OG1   1 
ATOM   1173 C CG2   . THR A 1 141 ? 5.621   17.997 -3.736  1.00 25.94 ? 167  THR A CG2   1 
ATOM   1174 N N     . THR A 1 142 ? 3.126   17.034 -7.395  1.00 25.23 ? 168  THR A N     1 
ATOM   1175 C CA    . THR A 1 142 ? 2.402   16.323 -8.447  1.00 26.70 ? 168  THR A CA    1 
ATOM   1176 C C     . THR A 1 142 ? 2.466   14.794 -8.567  1.00 26.96 ? 168  THR A C     1 
ATOM   1177 O O     . THR A 1 142 ? 1.483   14.175 -8.975  1.00 22.99 ? 168  THR A O     1 
ATOM   1178 C CB    . THR A 1 142 ? 2.768   16.941 -9.821  1.00 27.74 ? 168  THR A CB    1 
ATOM   1179 O OG1   . THR A 1 142 ? 1.787   16.575 -10.796 1.00 31.17 ? 168  THR A OG1   1 
ATOM   1180 C CG2   . THR A 1 142 ? 4.138   16.460 -10.283 1.00 28.40 ? 168  THR A CG2   1 
ATOM   1181 N N     . GLU A 1 143 ? 3.589   14.180 -8.202  1.00 27.69 ? 169  GLU A N     1 
ATOM   1182 C CA    . GLU A 1 143 ? 3.728   12.731 -8.338  1.00 28.99 ? 169  GLU A CA    1 
ATOM   1183 C C     . GLU A 1 143 ? 4.388   12.108 -7.112  1.00 30.57 ? 169  GLU A C     1 
ATOM   1184 O O     . GLU A 1 143 ? 5.559   12.358 -6.836  1.00 29.32 ? 169  GLU A O     1 
ATOM   1185 C CB    . GLU A 1 143 ? 4.544   12.435 -9.605  1.00 29.39 ? 169  GLU A CB    1 
ATOM   1186 C CG    . GLU A 1 143 ? 4.985   10.988 -9.795  1.00 35.21 ? 169  GLU A CG    1 
ATOM   1187 C CD    . GLU A 1 143 ? 3.820   10.020 -9.911  1.00 37.97 ? 169  GLU A CD    1 
ATOM   1188 O OE1   . GLU A 1 143 ? 3.633   9.203  -8.981  1.00 38.31 ? 169  GLU A OE1   1 
ATOM   1189 O OE2   . GLU A 1 143 ? 3.090   10.081 -10.927 1.00 39.89 ? 169  GLU A OE2   1 
ATOM   1190 N N     . CYS A 1 144 ? 3.635   11.290 -6.380  1.00 30.68 ? 170  CYS A N     1 
ATOM   1191 C CA    . CYS A 1 144 ? 4.164   10.674 -5.173  1.00 33.84 ? 170  CYS A CA    1 
ATOM   1192 C C     . CYS A 1 144 ? 5.259   9.641  -5.440  1.00 34.51 ? 170  CYS A C     1 
ATOM   1193 O O     . CYS A 1 144 ? 5.949   9.217  -4.522  1.00 35.72 ? 170  CYS A O     1 
ATOM   1194 C CB    . CYS A 1 144 ? 3.029   10.063 -4.342  1.00 34.42 ? 170  CYS A CB    1 
ATOM   1195 S SG    . CYS A 1 144 ? 2.085   8.750  -5.139  1.00 44.24 ? 170  CYS A SG    1 
ATOM   1196 N N     . GLU A 1 145 ? 5.441   9.258  -6.699  1.00 36.00 ? 171  GLU A N     1 
ATOM   1197 C CA    . GLU A 1 145 ? 6.473   8.284  -7.034  1.00 36.74 ? 171  GLU A CA    1 
ATOM   1198 C C     . GLU A 1 145 ? 7.804   8.918  -7.417  1.00 34.98 ? 171  GLU A C     1 
ATOM   1199 O O     . GLU A 1 145 ? 8.775   8.213  -7.668  1.00 35.18 ? 171  GLU A O     1 
ATOM   1200 C CB    . GLU A 1 145 ? 6.003   7.368  -8.162  1.00 37.80 ? 171  GLU A CB    1 
ATOM   1201 C CG    . GLU A 1 145 ? 4.997   6.337  -7.709  1.00 45.75 ? 171  GLU A CG    1 
ATOM   1202 C CD    . GLU A 1 145 ? 4.716   5.299  -8.777  1.00 51.45 ? 171  GLU A CD    1 
ATOM   1203 O OE1   . GLU A 1 145 ? 5.679   4.641  -9.234  1.00 54.14 ? 171  GLU A OE1   1 
ATOM   1204 O OE2   . GLU A 1 145 ? 3.535   5.139  -9.159  1.00 54.61 ? 171  GLU A OE2   1 
ATOM   1205 N N     . ASN A 1 146 ? 7.849   10.245 -7.472  1.00 33.04 ? 172  ASN A N     1 
ATOM   1206 C CA    . ASN A 1 146 ? 9.087   10.941 -7.807  1.00 32.51 ? 172  ASN A CA    1 
ATOM   1207 C C     . ASN A 1 146 ? 9.884   11.167 -6.529  1.00 30.95 ? 172  ASN A C     1 
ATOM   1208 O O     . ASN A 1 146 ? 9.899   12.275 -5.984  1.00 28.81 ? 172  ASN A O     1 
ATOM   1209 C CB    . ASN A 1 146 ? 8.784   12.283 -8.475  1.00 34.37 ? 172  ASN A CB    1 
ATOM   1210 C CG    . ASN A 1 146 ? 8.240   12.127 -9.878  1.00 36.60 ? 172  ASN A CG    1 
ATOM   1211 O OD1   . ASN A 1 146 ? 7.798   13.100 -10.497 1.00 39.78 ? 172  ASN A OD1   1 
ATOM   1212 N ND2   . ASN A 1 146 ? 8.278   10.904 -10.396 1.00 35.32 ? 172  ASN A ND2   1 
ATOM   1213 N N     . ARG A 1 147 ? 10.537  10.106 -6.057  1.00 29.72 ? 173  ARG A N     1 
ATOM   1214 C CA    . ARG A 1 147 ? 11.334  10.152 -4.830  1.00 29.31 ? 173  ARG A CA    1 
ATOM   1215 C C     . ARG A 1 147 ? 12.389  11.257 -4.812  1.00 27.91 ? 173  ARG A C     1 
ATOM   1216 O O     . ARG A 1 147 ? 12.449  12.045 -3.870  1.00 27.97 ? 173  ARG A O     1 
ATOM   1217 C CB    . ARG A 1 147 ? 12.018  8.798  -4.583  1.00 26.70 ? 173  ARG A CB    1 
ATOM   1218 C CG    . ARG A 1 147 ? 12.851  8.744  -3.290  1.00 27.95 ? 173  ARG A CG    1 
ATOM   1219 C CD    . ARG A 1 147 ? 13.858  7.577  -3.305  1.00 27.22 ? 173  ARG A CD    1 
ATOM   1220 N NE    . ARG A 1 147 ? 14.777  7.719  -4.430  1.00 27.49 ? 173  ARG A NE    1 
ATOM   1221 C CZ    . ARG A 1 147 ? 15.725  8.648  -4.514  1.00 25.76 ? 173  ARG A CZ    1 
ATOM   1222 N NH1   . ARG A 1 147 ? 15.903  9.518  -3.527  1.00 26.72 ? 173  ARG A NH1   1 
ATOM   1223 N NH2   . ARG A 1 147 ? 16.466  8.736  -5.604  1.00 23.65 ? 173  ARG A NH2   1 
ATOM   1224 N N     . GLU A 1 148 ? 13.221  11.315 -5.844  1.00 27.71 ? 174  GLU A N     1 
ATOM   1225 C CA    . GLU A 1 148 ? 14.269  12.329 -5.895  1.00 29.01 ? 174  GLU A CA    1 
ATOM   1226 C C     . GLU A 1 148 ? 13.700  13.730 -5.685  1.00 29.50 ? 174  GLU A C     1 
ATOM   1227 O O     . GLU A 1 148 ? 14.175  14.477 -4.831  1.00 30.06 ? 174  GLU A O     1 
ATOM   1228 C CB    . GLU A 1 148 ? 15.008  12.273 -7.232  1.00 31.09 ? 174  GLU A CB    1 
ATOM   1229 C CG    . GLU A 1 148 ? 16.222  13.180 -7.290  1.00 36.82 ? 174  GLU A CG    1 
ATOM   1230 C CD    . GLU A 1 148 ? 16.828  13.258 -8.682  1.00 42.91 ? 174  GLU A CD    1 
ATOM   1231 O OE1   . GLU A 1 148 ? 17.145  12.195 -9.254  1.00 46.73 ? 174  GLU A OE1   1 
ATOM   1232 O OE2   . GLU A 1 148 ? 16.992  14.381 -9.207  1.00 45.04 ? 174  GLU A OE2   1 
ATOM   1233 N N     . ALA A 1 149 ? 12.679  14.081 -6.462  1.00 27.15 ? 175  ALA A N     1 
ATOM   1234 C CA    . ALA A 1 149 ? 12.063  15.394 -6.343  1.00 27.44 ? 175  ALA A CA    1 
ATOM   1235 C C     . ALA A 1 149 ? 11.414  15.590 -4.978  1.00 27.46 ? 175  ALA A C     1 
ATOM   1236 O O     . ALA A 1 149 ? 11.677  16.577 -4.291  1.00 28.67 ? 175  ALA A O     1 
ATOM   1237 C CB    . ALA A 1 149 ? 11.028  15.588 -7.443  1.00 26.27 ? 175  ALA A CB    1 
ATOM   1238 N N     . VAL A 1 150 ? 10.566  14.645 -4.585  1.00 25.92 ? 176  VAL A N     1 
ATOM   1239 C CA    . VAL A 1 150 ? 9.879   14.735 -3.308  1.00 25.25 ? 176  VAL A CA    1 
ATOM   1240 C C     . VAL A 1 150 ? 10.824  14.853 -2.111  1.00 25.38 ? 176  VAL A C     1 
ATOM   1241 O O     . VAL A 1 150 ? 10.645  15.737 -1.264  1.00 24.55 ? 176  VAL A O     1 
ATOM   1242 C CB    . VAL A 1 150 ? 8.936   13.530 -3.104  1.00 24.79 ? 176  VAL A CB    1 
ATOM   1243 C CG1   . VAL A 1 150 ? 8.281   13.602 -1.746  1.00 23.89 ? 176  VAL A CG1   1 
ATOM   1244 C CG2   . VAL A 1 150 ? 7.865   13.523 -4.186  1.00 24.01 ? 176  VAL A CG2   1 
ATOM   1245 N N     . THR A 1 151 ? 11.834  13.991 -2.029  1.00 24.89 ? 177  THR A N     1 
ATOM   1246 C CA    . THR A 1 151 ? 12.746  14.056 -0.884  1.00 26.83 ? 177  THR A CA    1 
ATOM   1247 C C     . THR A 1 151 ? 13.574  15.337 -0.808  1.00 27.35 ? 177  THR A C     1 
ATOM   1248 O O     . THR A 1 151 ? 13.794  15.861 0.284   1.00 29.16 ? 177  THR A O     1 
ATOM   1249 C CB    . THR A 1 151 ? 13.700  12.835 -0.821  1.00 26.62 ? 177  THR A CB    1 
ATOM   1250 O OG1   . THR A 1 151 ? 14.499  12.777 -2.004  1.00 23.73 ? 177  THR A OG1   1 
ATOM   1251 C CG2   . THR A 1 151 ? 12.900  11.545 -0.675  1.00 26.67 ? 177  THR A CG2   1 
ATOM   1252 N N     . HIS A 1 152 ? 14.031  15.846 -1.951  1.00 28.41 ? 178  HIS A N     1 
ATOM   1253 C CA    . HIS A 1 152 ? 14.816  17.081 -1.953  1.00 31.02 ? 178  HIS A CA    1 
ATOM   1254 C C     . HIS A 1 152 ? 13.969  18.284 -1.545  1.00 30.11 ? 178  HIS A C     1 
ATOM   1255 O O     . HIS A 1 152 ? 14.440  19.181 -0.834  1.00 29.43 ? 178  HIS A O     1 
ATOM   1256 C CB    . HIS A 1 152 ? 15.434  17.333 -3.328  1.00 32.37 ? 178  HIS A CB    1 
ATOM   1257 C CG    . HIS A 1 152 ? 16.669  16.529 -3.589  1.00 36.78 ? 178  HIS A CG    1 
ATOM   1258 N ND1   . HIS A 1 152 ? 16.638  15.178 -3.866  1.00 38.87 ? 178  HIS A ND1   1 
ATOM   1259 C CD2   . HIS A 1 152 ? 17.975  16.888 -3.616  1.00 37.73 ? 178  HIS A CD2   1 
ATOM   1260 C CE1   . HIS A 1 152 ? 17.871  14.741 -4.054  1.00 39.86 ? 178  HIS A CE1   1 
ATOM   1261 N NE2   . HIS A 1 152 ? 18.701  15.759 -3.908  1.00 39.68 ? 178  HIS A NE2   1 
ATOM   1262 N N     . ILE A 1 153 ? 12.719  18.295 -1.997  1.00 28.29 ? 179  ILE A N     1 
ATOM   1263 C CA    . ILE A 1 153 ? 11.783  19.370 -1.672  1.00 27.20 ? 179  ILE A CA    1 
ATOM   1264 C C     . ILE A 1 153 ? 11.516  19.367 -0.166  1.00 26.44 ? 179  ILE A C     1 
ATOM   1265 O O     . ILE A 1 153 ? 11.545  20.412 0.483   1.00 24.50 ? 179  ILE A O     1 
ATOM   1266 C CB    . ILE A 1 153 ? 10.441  19.181 -2.433  1.00 27.15 ? 179  ILE A CB    1 
ATOM   1267 C CG1   . ILE A 1 153 ? 10.639  19.494 -3.916  1.00 26.93 ? 179  ILE A CG1   1 
ATOM   1268 C CG2   . ILE A 1 153 ? 9.352   20.070 -1.834  1.00 25.29 ? 179  ILE A CG2   1 
ATOM   1269 C CD1   . ILE A 1 153 ? 12.036  19.847 -4.365  1.00 35.61 ? 179  ILE A CD1   1 
ATOM   1270 N N     . GLY A 1 154 ? 11.266  18.181 0.381   1.00 25.71 ? 180  GLY A N     1 
ATOM   1271 C CA    . GLY A 1 154 ? 11.000  18.064 1.800   1.00 25.28 ? 180  GLY A CA    1 
ATOM   1272 C C     . GLY A 1 154 ? 12.180  18.531 2.629   1.00 26.65 ? 180  GLY A C     1 
ATOM   1273 O O     . GLY A 1 154 ? 12.022  19.222 3.631   1.00 25.47 ? 180  GLY A O     1 
ATOM   1274 N N     . ARG A 1 155 ? 13.375  18.157 2.198   1.00 28.89 ? 181  ARG A N     1 
ATOM   1275 C CA    . ARG A 1 155 ? 14.598  18.527 2.899   1.00 30.55 ? 181  ARG A CA    1 
ATOM   1276 C C     . ARG A 1 155 ? 14.795  20.043 2.900   1.00 30.16 ? 181  ARG A C     1 
ATOM   1277 O O     . ARG A 1 155 ? 14.982  20.659 3.951   1.00 30.09 ? 181  ARG A O     1 
ATOM   1278 C CB    . ARG A 1 155 ? 15.783  17.836 2.228   1.00 31.31 ? 181  ARG A CB    1 
ATOM   1279 C CG    . ARG A 1 155 ? 17.019  17.703 3.086   1.00 38.50 ? 181  ARG A CG    1 
ATOM   1280 C CD    . ARG A 1 155 ? 18.013  16.792 2.395   1.00 39.40 ? 181  ARG A CD    1 
ATOM   1281 N NE    . ARG A 1 155 ? 17.368  15.540 2.013   1.00 42.09 ? 181  ARG A NE    1 
ATOM   1282 C CZ    . ARG A 1 155 ? 17.522  14.945 0.837   1.00 40.80 ? 181  ARG A CZ    1 
ATOM   1283 N NH1   . ARG A 1 155 ? 18.303  15.484 -0.087  1.00 40.62 ? 181  ARG A NH1   1 
ATOM   1284 N NH2   . ARG A 1 155 ? 16.886  13.810 0.584   1.00 44.73 ? 181  ARG A NH2   1 
ATOM   1285 N N     . VAL A 1 156 ? 14.753  20.651 1.720   1.00 31.56 ? 182  VAL A N     1 
ATOM   1286 C CA    . VAL A 1 156 ? 14.936  22.093 1.626   1.00 28.47 ? 182  VAL A CA    1 
ATOM   1287 C C     . VAL A 1 156 ? 13.828  22.809 2.390   1.00 28.89 ? 182  VAL A C     1 
ATOM   1288 O O     . VAL A 1 156 ? 14.080  23.781 3.105   1.00 28.76 ? 182  VAL A O     1 
ATOM   1289 C CB    . VAL A 1 156 ? 14.940  22.570 0.157   1.00 29.74 ? 182  VAL A CB    1 
ATOM   1290 C CG1   . VAL A 1 156 ? 15.134  24.081 0.098   1.00 29.65 ? 182  VAL A CG1   1 
ATOM   1291 C CG2   . VAL A 1 156 ? 16.061  21.868 -0.619  1.00 27.85 ? 182  VAL A CG2   1 
ATOM   1292 N N     . TYR A 1 157 ? 12.603  22.311 2.259   1.00 28.33 ? 183  TYR A N     1 
ATOM   1293 C CA    . TYR A 1 157 ? 11.465  22.922 2.932   1.00 28.46 ? 183  TYR A CA    1 
ATOM   1294 C C     . TYR A 1 157 ? 11.646  22.953 4.449   1.00 29.15 ? 183  TYR A C     1 
ATOM   1295 O O     . TYR A 1 157 ? 11.435  23.980 5.090   1.00 30.18 ? 183  TYR A O     1 
ATOM   1296 C CB    . TYR A 1 157 ? 10.188  22.177 2.562   1.00 26.77 ? 183  TYR A CB    1 
ATOM   1297 C CG    . TYR A 1 157 ? 8.929   22.778 3.136   1.00 28.34 ? 183  TYR A CG    1 
ATOM   1298 C CD1   . TYR A 1 157 ? 8.707   24.157 3.097   1.00 29.14 ? 183  TYR A CD1   1 
ATOM   1299 C CD2   . TYR A 1 157 ? 7.933   21.963 3.680   1.00 26.78 ? 183  TYR A CD2   1 
ATOM   1300 C CE1   . TYR A 1 157 ? 7.522   24.710 3.585   1.00 27.52 ? 183  TYR A CE1   1 
ATOM   1301 C CE2   . TYR A 1 157 ? 6.746   22.504 4.168   1.00 28.19 ? 183  TYR A CE2   1 
ATOM   1302 C CZ    . TYR A 1 157 ? 6.547   23.875 4.116   1.00 28.82 ? 183  TYR A CZ    1 
ATOM   1303 O OH    . TYR A 1 157 ? 5.369   24.405 4.584   1.00 27.36 ? 183  TYR A OH    1 
ATOM   1304 N N     . LYS A 1 158 ? 12.029  21.820 5.019   1.00 28.67 ? 184  LYS A N     1 
ATOM   1305 C CA    . LYS A 1 158 ? 12.253  21.730 6.454   1.00 28.52 ? 184  LYS A CA    1 
ATOM   1306 C C     . LYS A 1 158 ? 13.395  22.676 6.861   1.00 28.65 ? 184  LYS A C     1 
ATOM   1307 O O     . LYS A 1 158 ? 13.331  23.343 7.891   1.00 28.69 ? 184  LYS A O     1 
ATOM   1308 C CB    . LYS A 1 158 ? 12.592  20.282 6.825   1.00 27.35 ? 184  LYS A CB    1 
ATOM   1309 C CG    . LYS A 1 158 ? 12.936  20.072 8.281   1.00 26.64 ? 184  LYS A CG    1 
ATOM   1310 C CD    . LYS A 1 158 ? 13.103  18.602 8.583   1.00 26.99 ? 184  LYS A CD    1 
ATOM   1311 C CE    . LYS A 1 158 ? 13.735  18.394 9.948   1.00 28.11 ? 184  LYS A CE    1 
ATOM   1312 N NZ    . LYS A 1 158 ? 13.936  16.942 10.214  1.00 30.99 ? 184  LYS A NZ    1 
ATOM   1313 N N     . GLU A 1 159 ? 14.437  22.737 6.043   1.00 28.65 ? 185  GLU A N     1 
ATOM   1314 C CA    . GLU A 1 159 ? 15.561  23.614 6.334   1.00 30.69 ? 185  GLU A CA    1 
ATOM   1315 C C     . GLU A 1 159 ? 15.097  25.069 6.351   1.00 30.66 ? 185  GLU A C     1 
ATOM   1316 O O     . GLU A 1 159 ? 15.386  25.809 7.285   1.00 32.20 ? 185  GLU A O     1 
ATOM   1317 C CB    . GLU A 1 159 ? 16.656  23.442 5.279   1.00 32.87 ? 185  GLU A CB    1 
ATOM   1318 C CG    . GLU A 1 159 ? 17.845  24.362 5.477   1.00 37.60 ? 185  GLU A CG    1 
ATOM   1319 C CD    . GLU A 1 159 ? 18.910  24.190 4.409   1.00 42.57 ? 185  GLU A CD    1 
ATOM   1320 O OE1   . GLU A 1 159 ? 19.916  24.937 4.455   1.00 43.69 ? 185  GLU A OE1   1 
ATOM   1321 O OE2   . GLU A 1 159 ? 18.747  23.315 3.525   1.00 43.81 ? 185  GLU A OE2   1 
ATOM   1322 N N     . ARG A 1 160 ? 14.378  25.470 5.309   1.00 30.24 ? 186  ARG A N     1 
ATOM   1323 C CA    . ARG A 1 160 ? 13.878  26.834 5.201   1.00 29.79 ? 186  ARG A CA    1 
ATOM   1324 C C     . ARG A 1 160 ? 13.018  27.253 6.379   1.00 28.47 ? 186  ARG A C     1 
ATOM   1325 O O     . ARG A 1 160 ? 13.116  28.384 6.849   1.00 28.18 ? 186  ARG A O     1 
ATOM   1326 C CB    . ARG A 1 160 ? 13.069  27.003 3.915   1.00 30.49 ? 186  ARG A CB    1 
ATOM   1327 C CG    . ARG A 1 160 ? 13.906  27.310 2.689   1.00 32.81 ? 186  ARG A CG    1 
ATOM   1328 C CD    . ARG A 1 160 ? 14.577  28.682 2.801   1.00 34.11 ? 186  ARG A CD    1 
ATOM   1329 N NE    . ARG A 1 160 ? 14.722  29.292 1.483   1.00 37.98 ? 186  ARG A NE    1 
ATOM   1330 C CZ    . ARG A 1 160 ? 13.816  30.082 0.918   1.00 37.12 ? 186  ARG A CZ    1 
ATOM   1331 N NH1   . ARG A 1 160 ? 12.696  30.379 1.557   1.00 39.73 ? 186  ARG A NH1   1 
ATOM   1332 N NH2   . ARG A 1 160 ? 14.020  30.554 -0.301  1.00 40.12 ? 186  ARG A NH2   1 
ATOM   1333 N N     . LEU A 1 161 ? 12.161  26.353 6.844   1.00 27.57 ? 187  LEU A N     1 
ATOM   1334 C CA    . LEU A 1 161 ? 11.290  26.671 7.961   1.00 27.96 ? 187  LEU A CA    1 
ATOM   1335 C C     . LEU A 1 161 ? 12.124  26.903 9.217   1.00 29.63 ? 187  LEU A C     1 
ATOM   1336 O O     . LEU A 1 161 ? 11.710  27.624 10.124  1.00 30.02 ? 187  LEU A O     1 
ATOM   1337 C CB    . LEU A 1 161 ? 10.264  25.545 8.165   1.00 27.03 ? 187  LEU A CB    1 
ATOM   1338 C CG    . LEU A 1 161 ? 9.285   25.383 6.989   1.00 26.98 ? 187  LEU A CG    1 
ATOM   1339 C CD1   . LEU A 1 161 ? 8.331   24.224 7.238   1.00 26.74 ? 187  LEU A CD1   1 
ATOM   1340 C CD2   . LEU A 1 161 ? 8.513   26.665 6.797   1.00 22.46 ? 187  LEU A CD2   1 
ATOM   1341 N N     . GLY A 1 162 ? 13.303  26.288 9.255   1.00 31.79 ? 188  GLY A N     1 
ATOM   1342 C CA    . GLY A 1 162 ? 14.208  26.458 10.378  1.00 31.11 ? 188  GLY A CA    1 
ATOM   1343 C C     . GLY A 1 162 ? 13.839  25.794 11.693  1.00 32.53 ? 188  GLY A C     1 
ATOM   1344 O O     . GLY A 1 162 ? 14.450  26.096 12.714  1.00 32.58 ? 188  GLY A O     1 
ATOM   1345 N N     . LEU A 1 163 ? 12.857  24.899 11.686  1.00 32.21 ? 189  LEU A N     1 
ATOM   1346 C CA    . LEU A 1 163 ? 12.445  24.215 12.913  1.00 34.67 ? 189  LEU A CA    1 
ATOM   1347 C C     . LEU A 1 163 ? 13.548  23.226 13.328  1.00 34.22 ? 189  LEU A C     1 
ATOM   1348 O O     . LEU A 1 163 ? 14.396  22.862 12.516  1.00 31.76 ? 189  LEU A O     1 
ATOM   1349 C CB    . LEU A 1 163 ? 11.109  23.482 12.677  1.00 36.05 ? 189  LEU A CB    1 
ATOM   1350 C CG    . LEU A 1 163 ? 11.105  22.384 11.603  1.00 38.00 ? 189  LEU A CG    1 
ATOM   1351 C CD1   . LEU A 1 163 ? 11.389  21.050 12.263  1.00 34.54 ? 189  LEU A CD1   1 
ATOM   1352 C CD2   . LEU A 1 163 ? 9.758   22.334 10.878  1.00 37.32 ? 189  LEU A CD2   1 
ATOM   1353 N N     . PRO A 1 164 ? 13.556  22.791 14.600  1.00 33.58 ? 190  PRO A N     1 
ATOM   1354 C CA    . PRO A 1 164 ? 14.571  21.848 15.092  1.00 34.52 ? 190  PRO A CA    1 
ATOM   1355 C C     . PRO A 1 164 ? 14.775  20.647 14.164  1.00 33.97 ? 190  PRO A C     1 
ATOM   1356 O O     . PRO A 1 164 ? 13.864  19.853 13.948  1.00 37.19 ? 190  PRO A O     1 
ATOM   1357 C CB    . PRO A 1 164 ? 14.027  21.447 16.459  1.00 33.84 ? 190  PRO A CB    1 
ATOM   1358 C CG    . PRO A 1 164 ? 13.343  22.703 16.906  1.00 33.57 ? 190  PRO A CG    1 
ATOM   1359 C CD    . PRO A 1 164 ? 12.596  23.124 15.665  1.00 33.24 ? 190  PRO A CD    1 
ATOM   1360 N N     . PRO A 1 165 ? 15.988  20.501 13.615  1.00 34.27 ? 191  PRO A N     1 
ATOM   1361 C CA    . PRO A 1 165 ? 16.388  19.427 12.698  1.00 34.07 ? 191  PRO A CA    1 
ATOM   1362 C C     . PRO A 1 165 ? 15.995  18.015 13.130  1.00 34.88 ? 191  PRO A C     1 
ATOM   1363 O O     . PRO A 1 165 ? 15.781  17.139 12.287  1.00 34.84 ? 191  PRO A O     1 
ATOM   1364 C CB    . PRO A 1 165 ? 17.906  19.587 12.626  1.00 35.75 ? 191  PRO A CB    1 
ATOM   1365 C CG    . PRO A 1 165 ? 18.096  21.053 12.834  1.00 35.70 ? 191  PRO A CG    1 
ATOM   1366 C CD    . PRO A 1 165 ? 17.146  21.342 13.962  1.00 33.01 ? 191  PRO A CD    1 
ATOM   1367 N N     . LYS A 1 166 ? 15.910  17.787 14.438  1.00 33.04 ? 192  LYS A N     1 
ATOM   1368 C CA    . LYS A 1 166 ? 15.557  16.466 14.939  1.00 33.43 ? 192  LYS A CA    1 
ATOM   1369 C C     . LYS A 1 166 ? 14.093  16.097 14.709  1.00 31.88 ? 192  LYS A C     1 
ATOM   1370 O O     . LYS A 1 166 ? 13.736  14.921 14.740  1.00 32.23 ? 192  LYS A O     1 
ATOM   1371 C CB    . LYS A 1 166 ? 15.907  16.359 16.433  1.00 35.52 ? 192  LYS A CB    1 
ATOM   1372 C CG    . LYS A 1 166 ? 15.169  17.340 17.339  1.00 39.16 ? 192  LYS A CG    1 
ATOM   1373 C CD    . LYS A 1 166 ? 13.956  16.699 18.009  1.00 43.07 ? 192  LYS A CD    1 
ATOM   1374 C CE    . LYS A 1 166 ? 14.370  15.602 18.994  1.00 46.05 ? 192  LYS A CE    1 
ATOM   1375 N NZ    . LYS A 1 166 ? 13.200  14.970 19.685  1.00 47.77 ? 192  LYS A NZ    1 
ATOM   1376 N N     . ILE A 1 167 ? 13.249  17.102 14.486  1.00 32.39 ? 193  ILE A N     1 
ATOM   1377 C CA    . ILE A 1 167 ? 11.821  16.877 14.244  1.00 32.48 ? 193  ILE A CA    1 
ATOM   1378 C C     . ILE A 1 167 ? 11.625  16.259 12.859  1.00 31.16 ? 193  ILE A C     1 
ATOM   1379 O O     . ILE A 1 167 ? 12.144  16.765 11.875  1.00 32.53 ? 193  ILE A O     1 
ATOM   1380 C CB    . ILE A 1 167 ? 11.030  18.205 14.327  1.00 32.18 ? 193  ILE A CB    1 
ATOM   1381 C CG1   . ILE A 1 167 ? 11.128  18.772 15.742  1.00 31.67 ? 193  ILE A CG1   1 
ATOM   1382 C CG2   . ILE A 1 167 ? 9.568   17.979 13.961  1.00 31.05 ? 193  ILE A CG2   1 
ATOM   1383 C CD1   . ILE A 1 167 ? 10.576  17.903 16.910  1.00 35.61 ? 193  ILE A CD1   1 
ATOM   1384 N N     . VAL A 1 168 ? 10.885  15.161 12.785  1.00 30.66 ? 194  VAL A N     1 
ATOM   1385 C CA    . VAL A 1 168 ? 10.664  14.500 11.503  1.00 29.11 ? 194  VAL A CA    1 
ATOM   1386 C C     . VAL A 1 168 ? 9.298   14.809 10.912  1.00 28.76 ? 194  VAL A C     1 
ATOM   1387 O O     . VAL A 1 168 ? 8.299   14.846 11.624  1.00 29.23 ? 194  VAL A O     1 
ATOM   1388 C CB    . VAL A 1 168 ? 10.803  12.967 11.628  1.00 28.37 ? 194  VAL A CB    1 
ATOM   1389 C CG1   . VAL A 1 168 ? 10.503  12.295 10.297  1.00 27.87 ? 194  VAL A CG1   1 
ATOM   1390 C CG2   . VAL A 1 168 ? 12.195  12.618 12.081  1.00 27.44 ? 194  VAL A CG2   1 
ATOM   1391 N N     . ILE A 1 169 ? 9.268   15.048 9.606   1.00 28.07 ? 195  ILE A N     1 
ATOM   1392 C CA    . ILE A 1 169 ? 8.019   15.317 8.906   1.00 28.30 ? 195  ILE A CA    1 
ATOM   1393 C C     . ILE A 1 169 ? 7.798   14.227 7.871   1.00 28.24 ? 195  ILE A C     1 
ATOM   1394 O O     . ILE A 1 169 ? 8.757   13.621 7.373   1.00 27.44 ? 195  ILE A O     1 
ATOM   1395 C CB    . ILE A 1 169 ? 8.031   16.684 8.204   1.00 27.84 ? 195  ILE A CB    1 
ATOM   1396 C CG1   . ILE A 1 169 ? 9.186   16.755 7.205   1.00 28.69 ? 195  ILE A CG1   1 
ATOM   1397 C CG2   . ILE A 1 169 ? 8.155   17.791 9.246   1.00 30.13 ? 195  ILE A CG2   1 
ATOM   1398 C CD1   . ILE A 1 169 ? 9.102   17.906 6.205   1.00 35.61 ? 195  ILE A CD1   1 
ATOM   1399 N N     . GLY A 1 170 ? 6.533   13.971 7.557   1.00 27.43 ? 196  GLY A N     1 
ATOM   1400 C CA    . GLY A 1 170 ? 6.215   12.932 6.600   1.00 26.90 ? 196  GLY A CA    1 
ATOM   1401 C C     . GLY A 1 170 ? 5.457   13.405 5.377   1.00 27.49 ? 196  GLY A C     1 
ATOM   1402 O O     . GLY A 1 170 ? 4.791   14.452 5.380   1.00 25.90 ? 196  GLY A O     1 
ATOM   1403 N N     . TYR A 1 171 ? 5.557   12.612 4.319   1.00 26.20 ? 197  TYR A N     1 
ATOM   1404 C CA    . TYR A 1 171 ? 4.889   12.914 3.065   1.00 26.10 ? 197  TYR A CA    1 
ATOM   1405 C C     . TYR A 1 171 ? 3.844   11.840 2.833   1.00 26.87 ? 197  TYR A C     1 
ATOM   1406 O O     . TYR A 1 171 ? 4.172   10.652 2.846   1.00 26.61 ? 197  TYR A O     1 
ATOM   1407 C CB    . TYR A 1 171 ? 5.909   12.890 1.926   1.00 25.83 ? 197  TYR A CB    1 
ATOM   1408 C CG    . TYR A 1 171 ? 5.330   13.126 0.549   1.00 24.65 ? 197  TYR A CG    1 
ATOM   1409 C CD1   . TYR A 1 171 ? 5.243   14.413 0.019   1.00 23.58 ? 197  TYR A CD1   1 
ATOM   1410 C CD2   . TYR A 1 171 ? 4.902   12.058 -0.241  1.00 25.69 ? 197  TYR A CD2   1 
ATOM   1411 C CE1   . TYR A 1 171 ? 4.751   14.632 -1.265  1.00 22.75 ? 197  TYR A CE1   1 
ATOM   1412 C CE2   . TYR A 1 171 ? 4.404   12.268 -1.527  1.00 24.30 ? 197  TYR A CE2   1 
ATOM   1413 C CZ    . TYR A 1 171 ? 4.334   13.556 -2.031  1.00 23.50 ? 197  TYR A CZ    1 
ATOM   1414 O OH    . TYR A 1 171 ? 3.851   13.766 -3.302  1.00 23.62 ? 197  TYR A OH    1 
ATOM   1415 N N     . GLN A 1 172 ? 2.593   12.248 2.637   1.00 26.49 ? 198  GLN A N     1 
ATOM   1416 C CA    . GLN A 1 172 ? 1.516   11.295 2.380   1.00 29.07 ? 198  GLN A CA    1 
ATOM   1417 C C     . GLN A 1 172 ? 0.950   11.532 0.984   1.00 28.96 ? 198  GLN A C     1 
ATOM   1418 O O     . GLN A 1 172 ? 0.792   12.675 0.569   1.00 30.84 ? 198  GLN A O     1 
ATOM   1419 C CB    . GLN A 1 172 ? 0.355   11.470 3.365   1.00 31.00 ? 198  GLN A CB    1 
ATOM   1420 C CG    . GLN A 1 172 ? 0.686   12.033 4.732   1.00 37.18 ? 198  GLN A CG    1 
ATOM   1421 C CD    . GLN A 1 172 ? -0.579  12.402 5.501   1.00 38.52 ? 198  GLN A CD    1 
ATOM   1422 O OE1   . GLN A 1 172 ? -1.380  13.221 5.046   1.00 40.21 ? 198  GLN A OE1   1 
ATOM   1423 N NE2   . GLN A 1 172 ? -0.767  11.791 6.663   1.00 40.42 ? 198  GLN A NE2   1 
ATOM   1424 N N     . SER A 1 173 ? 0.622   10.464 0.266   1.00 29.88 ? 199  SER A N     1 
ATOM   1425 C CA    . SER A 1 173 ? 0.036   10.621 -1.059  1.00 29.75 ? 199  SER A CA    1 
ATOM   1426 C C     . SER A 1 173 ? -1.449  10.870 -0.836  1.00 30.50 ? 199  SER A C     1 
ATOM   1427 O O     . SER A 1 173 ? -2.017  10.405 0.150   1.00 28.30 ? 199  SER A O     1 
ATOM   1428 C CB    . SER A 1 173 ? 0.213   9.353  -1.899  1.00 31.51 ? 199  SER A CB    1 
ATOM   1429 O OG    . SER A 1 173 ? -0.815  8.417  -1.643  1.00 33.17 ? 199  SER A OG    1 
ATOM   1430 N N     . HIS A 1 174 ? -2.078  11.602 -1.747  1.00 30.41 ? 200  HIS A N     1 
ATOM   1431 C CA    . HIS A 1 174 ? -3.496  11.893 -1.615  1.00 29.96 ? 200  HIS A CA    1 
ATOM   1432 C C     . HIS A 1 174 ? -4.334  10.630 -1.829  1.00 31.12 ? 200  HIS A C     1 
ATOM   1433 O O     . HIS A 1 174 ? -5.305  10.404 -1.131  1.00 30.94 ? 200  HIS A O     1 
ATOM   1434 C CB    . HIS A 1 174 ? -3.909  12.973 -2.617  1.00 25.73 ? 200  HIS A CB    1 
ATOM   1435 C CG    . HIS A 1 174 ? -3.107  14.236 -2.509  1.00 24.98 ? 200  HIS A CG    1 
ATOM   1436 N ND1   . HIS A 1 174 ? -3.036  14.979 -1.352  1.00 20.37 ? 200  HIS A ND1   1 
ATOM   1437 C CD2   . HIS A 1 174 ? -2.349  14.889 -3.420  1.00 23.33 ? 200  HIS A CD2   1 
ATOM   1438 C CE1   . HIS A 1 174 ? -2.270  16.035 -1.553  1.00 21.49 ? 200  HIS A CE1   1 
ATOM   1439 N NE2   . HIS A 1 174 ? -1.841  16.004 -2.802  1.00 25.40 ? 200  HIS A NE2   1 
ATOM   1440 N N     . ALA A 1 175 ? -3.957  9.804  -2.794  1.00 33.52 ? 201  ALA A N     1 
ATOM   1441 C CA    . ALA A 1 175 ? -4.707  8.581  -3.063  1.00 36.71 ? 201  ALA A CA    1 
ATOM   1442 C C     . ALA A 1 175 ? -4.727  7.623  -1.868  1.00 39.22 ? 201  ALA A C     1 
ATOM   1443 O O     . ALA A 1 175 ? -5.434  6.620  -1.893  1.00 39.88 ? 201  ALA A O     1 
ATOM   1444 C CB    . ALA A 1 175 ? -4.127  7.875  -4.284  1.00 35.43 ? 201  ALA A CB    1 
ATOM   1445 N N     . ASP A 1 176 ? -3.957  7.931  -0.825  1.00 42.55 ? 202  ASP A N     1 
ATOM   1446 C CA    . ASP A 1 176 ? -3.900  7.078  0.363   1.00 44.91 ? 202  ASP A CA    1 
ATOM   1447 C C     . ASP A 1 176 ? -4.660  7.606  1.580   1.00 45.99 ? 202  ASP A C     1 
ATOM   1448 O O     . ASP A 1 176 ? -4.624  6.981  2.632   1.00 45.22 ? 202  ASP A O     1 
ATOM   1449 C CB    . ASP A 1 176 ? -2.443  6.832  0.775   1.00 46.71 ? 202  ASP A CB    1 
ATOM   1450 C CG    . ASP A 1 176 ? -1.745  5.792  -0.094  1.00 49.81 ? 202  ASP A CG    1 
ATOM   1451 O OD1   . ASP A 1 176 ? -0.511  5.622  0.049   1.00 48.90 ? 202  ASP A OD1   1 
ATOM   1452 O OD2   . ASP A 1 176 ? -2.425  5.138  -0.914  1.00 52.86 ? 202  ASP A OD2   1 
ATOM   1453 N N     . THR A 1 177 ? -5.348  8.739  1.458   1.00 48.73 ? 203  THR A N     1 
ATOM   1454 C CA    . THR A 1 177 ? -6.070  9.280  2.614   1.00 50.40 ? 203  THR A CA    1 
ATOM   1455 C C     . THR A 1 177 ? -7.127  8.309  3.137   1.00 53.92 ? 203  THR A C     1 
ATOM   1456 O O     . THR A 1 177 ? -7.835  7.656  2.364   1.00 53.47 ? 203  THR A O     1 
ATOM   1457 C CB    . THR A 1 177 ? -6.750  10.643 2.309   1.00 48.44 ? 203  THR A CB    1 
ATOM   1458 O OG1   . THR A 1 177 ? -8.144  10.450 2.044   1.00 46.11 ? 203  THR A OG1   1 
ATOM   1459 C CG2   . THR A 1 177 ? -6.097  11.306 1.115   1.00 45.42 ? 203  THR A CG2   1 
ATOM   1460 N N     . ALA A 1 178 ? -7.223  8.222  4.460   1.00 57.39 ? 204  ALA A N     1 
ATOM   1461 C CA    . ALA A 1 178 ? -8.170  7.329  5.115   1.00 59.94 ? 204  ALA A CA    1 
ATOM   1462 C C     . ALA A 1 178 ? -9.588  7.465  4.579   1.00 61.97 ? 204  ALA A C     1 
ATOM   1463 O O     . ALA A 1 178 ? -10.068 8.570  4.322   1.00 62.29 ? 204  ALA A O     1 
ATOM   1464 C CB    . ALA A 1 178 ? -8.158  7.577  6.617   1.00 60.39 ? 204  ALA A CB    1 
ATOM   1465 N N     . THR A 1 179 ? -10.243 6.321  4.411   1.00 64.92 ? 205  THR A N     1 
ATOM   1466 C CA    . THR A 1 179 ? -11.619 6.248  3.930   1.00 67.81 ? 205  THR A CA    1 
ATOM   1467 C C     . THR A 1 179 ? -12.335 5.207  4.784   1.00 70.02 ? 205  THR A C     1 
ATOM   1468 O O     . THR A 1 179 ? -12.721 4.145  4.296   1.00 70.03 ? 205  THR A O     1 
ATOM   1469 C CB    . THR A 1 179 ? -11.685 5.809  2.446   1.00 67.87 ? 205  THR A CB    1 
ATOM   1470 O OG1   . THR A 1 179 ? -11.079 6.809  1.619   1.00 68.67 ? 205  THR A OG1   1 
ATOM   1471 C CG2   . THR A 1 179 ? -13.128 5.619  2.004   1.00 68.77 ? 205  THR A CG2   1 
ATOM   1472 N N     . LYS A 1 180 ? -12.494 5.510  6.068   1.00 72.79 ? 206  LYS A N     1 
ATOM   1473 C CA    . LYS A 1 180 ? -13.158 4.591  6.985   1.00 75.86 ? 206  LYS A CA    1 
ATOM   1474 C C     . LYS A 1 180 ? -13.468 5.265  8.315   1.00 77.46 ? 206  LYS A C     1 
ATOM   1475 O O     . LYS A 1 180 ? -14.622 5.310  8.746   1.00 77.52 ? 206  LYS A O     1 
ATOM   1476 C CB    . LYS A 1 180 ? -12.276 3.363  7.228   1.00 75.92 ? 206  LYS A CB    1 
ATOM   1477 C CG    . LYS A 1 180 ? -12.882 2.352  8.186   1.00 77.13 ? 206  LYS A CG    1 
ATOM   1478 C CD    . LYS A 1 180 ? -11.957 1.167  8.387   1.00 78.19 ? 206  LYS A CD    1 
ATOM   1479 C CE    . LYS A 1 180 ? -12.574 0.134  9.316   1.00 78.37 ? 206  LYS A CE    1 
ATOM   1480 N NZ    . LYS A 1 180 ? -11.651 -1.012 9.544   1.00 79.24 ? 206  LYS A NZ    1 
ATOM   1481 N N     . SER A 1 181 ? -12.426 5.783  8.957   1.00 79.01 ? 207  SER A N     1 
ATOM   1482 C CA    . SER A 1 181 ? -12.558 6.460  10.243  1.00 81.10 ? 207  SER A CA    1 
ATOM   1483 C C     . SER A 1 181 ? -11.168 6.769  10.800  1.00 81.84 ? 207  SER A C     1 
ATOM   1484 O O     . SER A 1 181 ? -11.024 7.166  11.957  1.00 82.36 ? 207  SER A O     1 
ATOM   1485 C CB    . SER A 1 181 ? -13.327 5.575  11.231  1.00 81.65 ? 207  SER A CB    1 
ATOM   1486 O OG    . SER A 1 181 ? -13.578 6.258  12.447  1.00 81.83 ? 207  SER A OG    1 
ATOM   1487 N N     . GLY A 1 182 ? -10.152 6.586  9.961   1.00 81.98 ? 208  GLY A N     1 
ATOM   1488 C CA    . GLY A 1 182 ? -8.781  6.836  10.371  1.00 81.79 ? 208  GLY A CA    1 
ATOM   1489 C C     . GLY A 1 182 ? -7.846  5.911  9.618   1.00 81.84 ? 208  GLY A C     1 
ATOM   1490 O O     . GLY A 1 182 ? -6.765  6.317  9.190   1.00 81.82 ? 208  GLY A O     1 
ATOM   1491 N N     . SER A 1 183 ? -8.281  4.662  9.466   1.00 81.59 ? 209  SER A N     1 
ATOM   1492 C CA    . SER A 1 183 ? -7.540  3.619  8.758   1.00 81.35 ? 209  SER A CA    1 
ATOM   1493 C C     . SER A 1 183 ? -6.047  3.881  8.545   1.00 81.03 ? 209  SER A C     1 
ATOM   1494 O O     . SER A 1 183 ? -5.538  3.737  7.433   1.00 81.35 ? 209  SER A O     1 
ATOM   1495 C CB    . SER A 1 183 ? -8.207  3.349  7.406   1.00 81.64 ? 209  SER A CB    1 
ATOM   1496 O OG    . SER A 1 183 ? -8.343  4.545  6.657   1.00 81.82 ? 209  SER A OG    1 
ATOM   1497 N N     . THR A 1 184 ? -5.356  4.259  9.618   1.00 79.78 ? 210  THR A N     1 
ATOM   1498 C CA    . THR A 1 184 ? -3.920  4.530  9.580   1.00 78.00 ? 210  THR A CA    1 
ATOM   1499 C C     . THR A 1 184 ? -3.436  5.211  8.297   1.00 75.83 ? 210  THR A C     1 
ATOM   1500 O O     . THR A 1 184 ? -3.127  4.538  7.313   1.00 76.66 ? 210  THR A O     1 
ATOM   1501 C CB    . THR A 1 184 ? -3.111  3.223  9.766   1.00 78.82 ? 210  THR A CB    1 
ATOM   1502 O OG1   . THR A 1 184 ? -3.304  2.368  8.631   1.00 79.32 ? 210  THR A OG1   1 
ATOM   1503 C CG2   . THR A 1 184 ? -3.567  2.489  11.021  1.00 78.45 ? 210  THR A CG2   1 
ATOM   1504 N N     . THR A 1 185 ? -3.368  6.540  8.309   1.00 72.73 ? 211  THR A N     1 
ATOM   1505 C CA    . THR A 1 185 ? -2.900  7.294  7.143   1.00 69.25 ? 211  THR A CA    1 
ATOM   1506 C C     . THR A 1 185 ? -1.368  7.332  7.193   1.00 65.78 ? 211  THR A C     1 
ATOM   1507 O O     . THR A 1 185 ? -0.783  8.118  7.936   1.00 66.51 ? 211  THR A O     1 
ATOM   1508 C CB    . THR A 1 185 ? -3.444  8.736  7.157   1.00 69.74 ? 211  THR A CB    1 
ATOM   1509 O OG1   . THR A 1 185 ? -4.843  8.719  7.472   1.00 69.78 ? 211  THR A OG1   1 
ATOM   1510 C CG2   . THR A 1 185 ? -3.255  9.385  5.789   1.00 70.06 ? 211  THR A CG2   1 
ATOM   1511 N N     . LYS A 1 186 ? -0.727  6.485  6.393   1.00 61.56 ? 212  LYS A N     1 
ATOM   1512 C CA    . LYS A 1 186 ? 0.733   6.377  6.378   1.00 57.04 ? 212  LYS A CA    1 
ATOM   1513 C C     . LYS A 1 186 ? 1.534   7.363  5.523   1.00 52.60 ? 212  LYS A C     1 
ATOM   1514 O O     . LYS A 1 186 ? 0.997   8.042  4.643   1.00 51.64 ? 212  LYS A O     1 
ATOM   1515 C CB    . LYS A 1 186 ? 1.129   4.949  5.980   1.00 59.13 ? 212  LYS A CB    1 
ATOM   1516 C CG    . LYS A 1 186 ? 0.785   3.883  7.017   1.00 61.73 ? 212  LYS A CG    1 
ATOM   1517 C CD    . LYS A 1 186 ? 1.570   4.089  8.310   1.00 63.69 ? 212  LYS A CD    1 
ATOM   1518 C CE    . LYS A 1 186 ? 1.298   2.978  9.318   1.00 64.68 ? 212  LYS A CE    1 
ATOM   1519 N NZ    . LYS A 1 186 ? -0.129  2.945  9.748   1.00 64.79 ? 212  LYS A NZ    1 
ATOM   1520 N N     . ASN A 1 187 ? 2.836   7.419  5.804   1.00 46.12 ? 213  ASN A N     1 
ATOM   1521 C CA    . ASN A 1 187 ? 3.768   8.274  5.080   1.00 41.54 ? 213  ASN A CA    1 
ATOM   1522 C C     . ASN A 1 187 ? 4.580   7.410  4.116   1.00 39.13 ? 213  ASN A C     1 
ATOM   1523 O O     . ASN A 1 187 ? 4.936   6.281  4.446   1.00 38.56 ? 213  ASN A O     1 
ATOM   1524 C CB    . ASN A 1 187 ? 4.750   8.954  6.043   1.00 39.22 ? 213  ASN A CB    1 
ATOM   1525 C CG    . ASN A 1 187 ? 4.067   9.877  7.033   1.00 38.88 ? 213  ASN A CG    1 
ATOM   1526 O OD1   . ASN A 1 187 ? 3.268   10.735 6.659   1.00 35.86 ? 213  ASN A OD1   1 
ATOM   1527 N ND2   . ASN A 1 187 ? 4.395   9.713  8.308   1.00 38.43 ? 213  ASN A ND2   1 
ATOM   1528 N N     . ARG A 1 188 ? 4.869   7.940  2.930   1.00 37.29 ? 214  ARG A N     1 
ATOM   1529 C CA    . ARG A 1 188 ? 5.676   7.224  1.950   1.00 34.83 ? 214  ARG A CA    1 
ATOM   1530 C C     . ARG A 1 188 ? 7.127   7.629  2.158   1.00 31.66 ? 214  ARG A C     1 
ATOM   1531 O O     . ARG A 1 188 ? 8.038   6.840  1.909   1.00 32.87 ? 214  ARG A O     1 
ATOM   1532 C CB    . ARG A 1 188 ? 5.262   7.575  0.515   1.00 35.98 ? 214  ARG A CB    1 
ATOM   1533 C CG    . ARG A 1 188 ? 3.931   7.004  0.088   1.00 42.83 ? 214  ARG A CG    1 
ATOM   1534 C CD    . ARG A 1 188 ? 3.641   7.314  -1.373  1.00 47.59 ? 214  ARG A CD    1 
ATOM   1535 N NE    . ARG A 1 188 ? 2.358   6.763  -1.807  1.00 50.91 ? 214  ARG A NE    1 
ATOM   1536 C CZ    . ARG A 1 188 ? 2.079   5.466  -1.856  1.00 51.87 ? 214  ARG A CZ    1 
ATOM   1537 N NH1   . ARG A 1 188 ? 2.992   4.571  -1.500  1.00 54.63 ? 214  ARG A NH1   1 
ATOM   1538 N NH2   . ARG A 1 188 ? 0.883   5.059  -2.254  1.00 53.30 ? 214  ARG A NH2   1 
ATOM   1539 N N     . PHE A 1 189 ? 7.334   8.867  2.600   1.00 28.19 ? 215  PHE A N     1 
ATOM   1540 C CA    . PHE A 1 189 ? 8.682   9.391  2.846   1.00 27.07 ? 215  PHE A CA    1 
ATOM   1541 C C     . PHE A 1 189 ? 8.731   10.216 4.129   1.00 26.91 ? 215  PHE A C     1 
ATOM   1542 O O     . PHE A 1 189 ? 7.709   10.698 4.615   1.00 26.41 ? 215  PHE A O     1 
ATOM   1543 C CB    . PHE A 1 189 ? 9.155   10.286 1.697   1.00 24.82 ? 215  PHE A CB    1 
ATOM   1544 C CG    . PHE A 1 189 ? 9.029   9.663  0.346   1.00 28.19 ? 215  PHE A CG    1 
ATOM   1545 C CD1   . PHE A 1 189 ? 8.107   10.154 -0.572  1.00 26.26 ? 215  PHE A CD1   1 
ATOM   1546 C CD2   . PHE A 1 189 ? 9.835   8.591  -0.019  1.00 26.20 ? 215  PHE A CD2   1 
ATOM   1547 C CE1   . PHE A 1 189 ? 7.988   9.589  -1.834  1.00 25.79 ? 215  PHE A CE1   1 
ATOM   1548 C CE2   . PHE A 1 189 ? 9.721   8.018  -1.281  1.00 26.70 ? 215  PHE A CE2   1 
ATOM   1549 C CZ    . PHE A 1 189 ? 8.794   8.520  -2.191  1.00 27.11 ? 215  PHE A CZ    1 
ATOM   1550 N N     . VAL A 1 190 ? 9.939   10.380 4.656   1.00 27.28 ? 216  VAL A N     1 
ATOM   1551 C CA    . VAL A 1 190 ? 10.174  11.136 5.873   1.00 28.03 ? 216  VAL A CA    1 
ATOM   1552 C C     . VAL A 1 190 ? 11.531  11.828 5.776   1.00 29.28 ? 216  VAL A C     1 
ATOM   1553 O O     . VAL A 1 190 ? 12.450  11.315 5.134   1.00 27.98 ? 216  VAL A O     1 
ATOM   1554 C CB    . VAL A 1 190 ? 10.183  10.204 7.101   1.00 28.76 ? 216  VAL A CB    1 
ATOM   1555 C CG1   . VAL A 1 190 ? 8.760   9.768  7.446   1.00 28.17 ? 216  VAL A CG1   1 
ATOM   1556 C CG2   . VAL A 1 190 ? 11.031  8.974  6.798   1.00 28.72 ? 216  VAL A CG2   1 
ATOM   1557 N N     . VAL A 1 191 ? 11.641  13.003 6.393   1.00 30.71 ? 217  VAL A N     1 
ATOM   1558 C CA    . VAL A 1 191 ? 12.891  13.765 6.414   1.00 32.49 ? 217  VAL A CA    1 
ATOM   1559 C C     . VAL A 1 191 ? 12.999  14.589 7.692   1.00 33.26 ? 217  VAL A C     1 
ATOM   1560 O O     . VAL A 1 191 ? 14.064  15.131 7.994   1.00 35.85 ? 217  VAL A O     1 
ATOM   1561 C CB    . VAL A 1 191 ? 13.025  14.729 5.198   1.00 32.26 ? 217  VAL A CB    1 
ATOM   1562 C CG1   . VAL A 1 191 ? 13.061  13.936 3.905   1.00 33.97 ? 217  VAL A CG1   1 
ATOM   1563 C CG2   . VAL A 1 191 ? 11.884  15.734 5.183   1.00 31.85 ? 217  VAL A CG2   1 
ATOM   1564 O OXT   . VAL A 1 191 ? 11.964  14.698 8.383   1.00 35.61 ? 217  VAL A OXT   1 
ATOM   1565 N N     . PRO B 2 1   ? 15.753  19.084 -16.626 1.00 78.08 ? 47   PRO B N     1 
ATOM   1566 C CA    . PRO B 2 1   ? 17.079  19.692 -16.789 1.00 77.94 ? 47   PRO B CA    1 
ATOM   1567 C C     . PRO B 2 1   ? 17.157  20.674 -17.965 1.00 77.66 ? 47   PRO B C     1 
ATOM   1568 O O     . PRO B 2 1   ? 16.656  20.397 -19.056 1.00 77.70 ? 47   PRO B O     1 
ATOM   1569 C CB    . PRO B 2 1   ? 17.987  18.478 -16.975 1.00 77.81 ? 47   PRO B CB    1 
ATOM   1570 C CG    . PRO B 2 1   ? 17.337  17.456 -16.095 1.00 77.65 ? 47   PRO B CG    1 
ATOM   1571 C CD    . PRO B 2 1   ? 15.866  17.627 -16.429 1.00 77.84 ? 47   PRO B CD    1 
ATOM   1572 N N     . GLY B 2 2   ? 17.789  21.822 -17.731 1.00 76.85 ? 48   GLY B N     1 
ATOM   1573 C CA    . GLY B 2 2   ? 17.919  22.824 -18.773 1.00 75.28 ? 48   GLY B CA    1 
ATOM   1574 C C     . GLY B 2 2   ? 16.756  23.799 -18.795 1.00 74.04 ? 48   GLY B C     1 
ATOM   1575 O O     . GLY B 2 2   ? 15.627  23.418 -19.094 1.00 74.39 ? 48   GLY B O     1 
ATOM   1576 N N     . GLY B 2 3   ? 17.031  25.061 -18.477 1.00 72.60 ? 49   GLY B N     1 
ATOM   1577 C CA    . GLY B 2 3   ? 15.984  26.069 -18.471 1.00 69.59 ? 49   GLY B CA    1 
ATOM   1578 C C     . GLY B 2 3   ? 16.301  27.215 -17.529 1.00 67.94 ? 49   GLY B C     1 
ATOM   1579 O O     . GLY B 2 3   ? 16.573  26.991 -16.349 1.00 68.32 ? 49   GLY B O     1 
ATOM   1580 N N     . THR B 2 4   ? 16.270  28.442 -18.047 1.00 65.14 ? 50   THR B N     1 
ATOM   1581 C CA    . THR B 2 4   ? 16.556  29.626 -17.240 1.00 61.43 ? 50   THR B CA    1 
ATOM   1582 C C     . THR B 2 4   ? 15.394  29.943 -16.301 1.00 57.91 ? 50   THR B C     1 
ATOM   1583 O O     . THR B 2 4   ? 14.511  30.744 -16.615 1.00 57.63 ? 50   THR B O     1 
ATOM   1584 C CB    . THR B 2 4   ? 16.838  30.853 -18.130 1.00 63.00 ? 50   THR B CB    1 
ATOM   1585 O OG1   . THR B 2 4   ? 15.706  31.111 -18.970 1.00 64.07 ? 50   THR B OG1   1 
ATOM   1586 C CG2   . THR B 2 4   ? 18.060  30.599 -19.002 1.00 64.54 ? 50   THR B CG2   1 
ATOM   1587 N N     . ARG B 2 5   ? 15.405  29.300 -15.142 1.00 52.84 ? 51   ARG B N     1 
ATOM   1588 C CA    . ARG B 2 5   ? 14.363  29.490 -14.153 1.00 48.67 ? 51   ARG B CA    1 
ATOM   1589 C C     . ARG B 2 5   ? 14.576  30.792 -13.383 1.00 45.62 ? 51   ARG B C     1 
ATOM   1590 O O     . ARG B 2 5   ? 15.704  31.172 -13.061 1.00 44.00 ? 51   ARG B O     1 
ATOM   1591 C CB    . ARG B 2 5   ? 14.347  28.295 -13.193 1.00 48.91 ? 51   ARG B CB    1 
ATOM   1592 C CG    . ARG B 2 5   ? 13.325  28.394 -12.072 1.00 51.19 ? 51   ARG B CG    1 
ATOM   1593 C CD    . ARG B 2 5   ? 13.287  27.131 -11.197 1.00 51.41 ? 51   ARG B CD    1 
ATOM   1594 N NE    . ARG B 2 5   ? 12.455  26.067 -11.764 1.00 52.30 ? 51   ARG B NE    1 
ATOM   1595 C CZ    . ARG B 2 5   ? 12.826  25.252 -12.746 1.00 52.25 ? 51   ARG B CZ    1 
ATOM   1596 N NH1   . ARG B 2 5   ? 14.031  25.358 -13.292 1.00 53.88 ? 51   ARG B NH1   1 
ATOM   1597 N NH2   . ARG B 2 5   ? 11.989  24.327 -13.187 1.00 51.52 ? 51   ARG B NH2   1 
ATOM   1598 N N     . ILE B 2 6   ? 13.484  31.490 -13.109 1.00 41.89 ? 52   ILE B N     1 
ATOM   1599 C CA    . ILE B 2 6   ? 13.566  32.729 -12.361 1.00 38.30 ? 52   ILE B CA    1 
ATOM   1600 C C     . ILE B 2 6   ? 13.545  32.344 -10.893 1.00 36.85 ? 52   ILE B C     1 
ATOM   1601 O O     . ILE B 2 6   ? 12.527  31.890 -10.381 1.00 35.42 ? 52   ILE B O     1 
ATOM   1602 C CB    . ILE B 2 6   ? 12.379  33.645 -12.688 1.00 38.35 ? 52   ILE B CB    1 
ATOM   1603 C CG1   . ILE B 2 6   ? 12.435  34.031 -14.170 1.00 37.24 ? 52   ILE B CG1   1 
ATOM   1604 C CG2   . ILE B 2 6   ? 12.402  34.876 -11.787 1.00 37.45 ? 52   ILE B CG2   1 
ATOM   1605 C CD1   . ILE B 2 6   ? 13.669  34.843 -14.654 1.00 35.61 ? 52   ILE B CD1   1 
ATOM   1606 N N     . ILE B 2 7   ? 14.682  32.520 -10.226 1.00 36.44 ? 53   ILE B N     1 
ATOM   1607 C CA    . ILE B 2 7   ? 14.813  32.165 -8.817  1.00 36.55 ? 53   ILE B CA    1 
ATOM   1608 C C     . ILE B 2 7   ? 15.084  33.373 -7.924  1.00 36.80 ? 53   ILE B C     1 
ATOM   1609 O O     . ILE B 2 7   ? 15.954  34.196 -8.224  1.00 38.05 ? 53   ILE B O     1 
ATOM   1610 C CB    . ILE B 2 7   ? 15.956  31.151 -8.625  1.00 35.93 ? 53   ILE B CB    1 
ATOM   1611 C CG1   . ILE B 2 7   ? 15.705  29.925 -9.503  1.00 35.90 ? 53   ILE B CG1   1 
ATOM   1612 C CG2   . ILE B 2 7   ? 16.072  30.758 -7.155  1.00 36.38 ? 53   ILE B CG2   1 
ATOM   1613 C CD1   . ILE B 2 7   ? 16.909  29.003 -9.680  1.00 35.61 ? 53   ILE B CD1   1 
ATOM   1614 N N     . TYR B 2 8   ? 14.345  33.471 -6.822  1.00 34.58 ? 54   TYR B N     1 
ATOM   1615 C CA    . TYR B 2 8   ? 14.523  34.578 -5.887  1.00 33.76 ? 54   TYR B CA    1 
ATOM   1616 C C     . TYR B 2 8   ? 14.839  34.092 -4.472  1.00 34.24 ? 54   TYR B C     1 
ATOM   1617 O O     . TYR B 2 8   ? 14.126  33.248 -3.919  1.00 33.03 ? 54   TYR B O     1 
ATOM   1618 C CB    . TYR B 2 8   ? 13.265  35.453 -5.835  1.00 30.73 ? 54   TYR B CB    1 
ATOM   1619 C CG    . TYR B 2 8   ? 12.925  36.158 -7.125  1.00 29.14 ? 54   TYR B CG    1 
ATOM   1620 C CD1   . TYR B 2 8   ? 11.807  35.789 -7.867  1.00 27.85 ? 54   TYR B CD1   1 
ATOM   1621 C CD2   . TYR B 2 8   ? 13.701  37.223 -7.588  1.00 30.77 ? 54   TYR B CD2   1 
ATOM   1622 C CE1   . TYR B 2 8   ? 11.461  36.465 -9.036  1.00 27.82 ? 54   TYR B CE1   1 
ATOM   1623 C CE2   . TYR B 2 8   ? 13.368  37.905 -8.757  1.00 29.28 ? 54   TYR B CE2   1 
ATOM   1624 C CZ    . TYR B 2 8   ? 12.244  37.520 -9.475  1.00 29.99 ? 54   TYR B CZ    1 
ATOM   1625 O OH    . TYR B 2 8   ? 11.898  38.194 -10.625 1.00 28.22 ? 54   TYR B OH    1 
ATOM   1626 N N     . ASP B 2 9   ? 15.907  34.631 -3.891  1.00 34.92 ? 55   ASP B N     1 
ATOM   1627 C CA    . ASP B 2 9   ? 16.296  34.280 -2.533  1.00 35.85 ? 55   ASP B CA    1 
ATOM   1628 C C     . ASP B 2 9   ? 15.371  35.059 -1.607  1.00 35.61 ? 55   ASP B C     1 
ATOM   1629 O O     . ASP B 2 9   ? 14.949  36.166 -1.937  1.00 34.19 ? 55   ASP B O     1 
ATOM   1630 C CB    . ASP B 2 9   ? 17.761  34.652 -2.282  1.00 40.96 ? 55   ASP B CB    1 
ATOM   1631 C CG    . ASP B 2 9   ? 17.953  35.443 -1.006  1.00 45.79 ? 55   ASP B CG    1 
ATOM   1632 O OD1   . ASP B 2 9   ? 17.572  36.636 -0.991  1.00 48.01 ? 55   ASP B OD1   1 
ATOM   1633 O OD2   . ASP B 2 9   ? 18.477  34.878 -0.017  1.00 48.43 ? 55   ASP B OD2   1 
ATOM   1634 N N     . ARG B 2 10  ? 15.052  34.479 -0.456  1.00 34.96 ? 56   ARG B N     1 
ATOM   1635 C CA    . ARG B 2 10  ? 14.148  35.115 0.492   1.00 35.03 ? 56   ARG B CA    1 
ATOM   1636 C C     . ARG B 2 10  ? 14.492  36.570 0.781   1.00 35.18 ? 56   ARG B C     1 
ATOM   1637 O O     . ARG B 2 10  ? 13.601  37.410 0.885   1.00 33.90 ? 56   ARG B O     1 
ATOM   1638 C CB    . ARG B 2 10  ? 14.117  34.324 1.805   1.00 34.28 ? 56   ARG B CB    1 
ATOM   1639 C CG    . ARG B 2 10  ? 15.419  34.346 2.581   1.00 34.47 ? 56   ARG B CG    1 
ATOM   1640 C CD    . ARG B 2 10  ? 15.416  33.284 3.674   1.00 34.30 ? 56   ARG B CD    1 
ATOM   1641 N NE    . ARG B 2 10  ? 14.259  33.429 4.552   1.00 33.69 ? 56   ARG B NE    1 
ATOM   1642 C CZ    . ARG B 2 10  ? 14.077  34.443 5.388   1.00 33.15 ? 56   ARG B CZ    1 
ATOM   1643 N NH1   . ARG B 2 10  ? 14.979  35.412 5.471   1.00 34.35 ? 56   ARG B NH1   1 
ATOM   1644 N NH2   . ARG B 2 10  ? 12.989  34.490 6.143   1.00 33.58 ? 56   ARG B NH2   1 
ATOM   1645 N N     . LYS B 2 11  ? 15.781  36.868 0.912   1.00 36.48 ? 57   LYS B N     1 
ATOM   1646 C CA    . LYS B 2 11  ? 16.216  38.226 1.208   1.00 36.98 ? 57   LYS B CA    1 
ATOM   1647 C C     . LYS B 2 11  ? 15.773  39.201 0.125   1.00 36.60 ? 57   LYS B C     1 
ATOM   1648 O O     . LYS B 2 11  ? 15.313  40.307 0.415   1.00 36.02 ? 57   LYS B O     1 
ATOM   1649 C CB    . LYS B 2 11  ? 17.735  38.274 1.359   1.00 39.77 ? 57   LYS B CB    1 
ATOM   1650 C CG    . LYS B 2 11  ? 18.253  39.632 1.786   1.00 43.38 ? 57   LYS B CG    1 
ATOM   1651 C CD    . LYS B 2 11  ? 19.749  39.603 2.050   1.00 44.85 ? 57   LYS B CD    1 
ATOM   1652 C CE    . LYS B 2 11  ? 20.250  40.973 2.477   1.00 46.36 ? 57   LYS B CE    1 
ATOM   1653 N NZ    . LYS B 2 11  ? 19.546  41.467 3.699   1.00 47.80 ? 57   LYS B NZ    1 
ATOM   1654 N N     . PHE B 2 12  ? 15.908  38.782 -1.124  1.00 35.11 ? 58   PHE B N     1 
ATOM   1655 C CA    . PHE B 2 12  ? 15.516  39.615 -2.249  1.00 35.17 ? 58   PHE B CA    1 
ATOM   1656 C C     . PHE B 2 12  ? 14.026  39.944 -2.168  1.00 34.30 ? 58   PHE B C     1 
ATOM   1657 O O     . PHE B 2 12  ? 13.624  41.093 -2.341  1.00 33.63 ? 58   PHE B O     1 
ATOM   1658 C CB    . PHE B 2 12  ? 15.811  38.891 -3.567  1.00 36.40 ? 58   PHE B CB    1 
ATOM   1659 C CG    . PHE B 2 12  ? 15.602  39.743 -4.784  1.00 38.11 ? 58   PHE B CG    1 
ATOM   1660 C CD1   . PHE B 2 12  ? 16.649  40.484 -5.318  1.00 38.66 ? 58   PHE B CD1   1 
ATOM   1661 C CD2   . PHE B 2 12  ? 14.345  39.836 -5.375  1.00 38.69 ? 58   PHE B CD2   1 
ATOM   1662 C CE1   . PHE B 2 12  ? 16.446  41.309 -6.425  1.00 40.19 ? 58   PHE B CE1   1 
ATOM   1663 C CE2   . PHE B 2 12  ? 14.130  40.658 -6.480  1.00 39.00 ? 58   PHE B CE2   1 
ATOM   1664 C CZ    . PHE B 2 12  ? 15.180  41.394 -7.005  1.00 39.43 ? 58   PHE B CZ    1 
ATOM   1665 N N     . LEU B 2 13  ? 13.212  38.929 -1.900  1.00 33.76 ? 59   LEU B N     1 
ATOM   1666 C CA    . LEU B 2 13  ? 11.762  39.103 -1.808  1.00 33.35 ? 59   LEU B CA    1 
ATOM   1667 C C     . LEU B 2 13  ? 11.348  39.955 -0.617  1.00 32.29 ? 59   LEU B C     1 
ATOM   1668 O O     . LEU B 2 13  ? 10.482  40.825 -0.729  1.00 33.06 ? 59   LEU B O     1 
ATOM   1669 C CB    . LEU B 2 13  ? 11.081  37.735 -1.718  1.00 32.24 ? 59   LEU B CB    1 
ATOM   1670 C CG    . LEU B 2 13  ? 11.343  36.756 -2.868  1.00 31.38 ? 59   LEU B CG    1 
ATOM   1671 C CD1   . LEU B 2 13  ? 10.776  35.385 -2.515  1.00 26.83 ? 59   LEU B CD1   1 
ATOM   1672 C CD2   . LEU B 2 13  ? 10.712  37.287 -4.149  1.00 28.68 ? 59   LEU B CD2   1 
ATOM   1673 N N     . LEU B 2 14  ? 11.968  39.706 0.527   1.00 32.95 ? 60   LEU B N     1 
ATOM   1674 C CA    . LEU B 2 14  ? 11.644  40.451 1.736   1.00 32.58 ? 60   LEU B CA    1 
ATOM   1675 C C     . LEU B 2 14  ? 12.046  41.918 1.656   1.00 34.16 ? 60   LEU B C     1 
ATOM   1676 O O     . LEU B 2 14  ? 11.379  42.772 2.237   1.00 36.07 ? 60   LEU B O     1 
ATOM   1677 C CB    . LEU B 2 14  ? 12.304  39.797 2.949   1.00 29.89 ? 60   LEU B CB    1 
ATOM   1678 C CG    . LEU B 2 14  ? 11.770  38.420 3.350   1.00 31.36 ? 60   LEU B CG    1 
ATOM   1679 C CD1   . LEU B 2 14  ? 12.707  37.790 4.375   1.00 29.99 ? 60   LEU B CD1   1 
ATOM   1680 C CD2   . LEU B 2 14  ? 10.359  38.554 3.912   1.00 28.75 ? 60   LEU B CD2   1 
ATOM   1681 N N     . ASP B 2 15  ? 13.132  42.212 0.944   1.00 34.01 ? 61   ASP B N     1 
ATOM   1682 C CA    . ASP B 2 15  ? 13.593  43.592 0.797   1.00 35.63 ? 61   ASP B CA    1 
ATOM   1683 C C     . ASP B 2 15  ? 12.628  44.477 0.015   1.00 36.09 ? 61   ASP B C     1 
ATOM   1684 O O     . ASP B 2 15  ? 12.740  45.695 0.045   1.00 36.43 ? 61   ASP B O     1 
ATOM   1685 C CB    . ASP B 2 15  ? 14.952  43.643 0.095   1.00 35.21 ? 61   ASP B CB    1 
ATOM   1686 C CG    . ASP B 2 15  ? 16.107  43.384 1.036   1.00 34.87 ? 61   ASP B CG    1 
ATOM   1687 O OD1   . ASP B 2 15  ? 15.902  43.458 2.262   1.00 35.54 ? 61   ASP B OD1   1 
ATOM   1688 O OD2   . ASP B 2 15  ? 17.225  43.121 0.546   1.00 36.32 ? 61   ASP B OD2   1 
ATOM   1689 N N     . ARG B 2 16  ? 11.689  43.859 -0.690  1.00 38.34 ? 62   ARG B N     1 
ATOM   1690 C CA    . ARG B 2 16  ? 10.725  44.591 -1.498  1.00 38.69 ? 62   ARG B CA    1 
ATOM   1691 C C     . ARG B 2 16  ? 9.308   44.478 -0.959  1.00 38.86 ? 62   ARG B C     1 
ATOM   1692 O O     . ARG B 2 16  ? 8.343   44.827 -1.631  1.00 38.72 ? 62   ARG B O     1 
ATOM   1693 C CB    . ARG B 2 16  ? 10.782  44.088 -2.944  1.00 39.30 ? 62   ARG B CB    1 
ATOM   1694 C CG    . ARG B 2 16  ? 11.760  44.851 -3.830  1.00 41.87 ? 62   ARG B CG    1 
ATOM   1695 C CD    . ARG B 2 16  ? 12.317  43.970 -4.929  1.00 40.23 ? 62   ARG B CD    1 
ATOM   1696 N NE    . ARG B 2 16  ? 13.397  43.144 -4.408  1.00 43.24 ? 62   ARG B NE    1 
ATOM   1697 C CZ    . ARG B 2 16  ? 14.662  43.540 -4.312  1.00 40.16 ? 62   ARG B CZ    1 
ATOM   1698 N NH1   . ARG B 2 16  ? 15.015  44.749 -4.718  1.00 40.95 ? 62   ARG B NH1   1 
ATOM   1699 N NH2   . ARG B 2 16  ? 15.568  42.738 -3.782  1.00 37.61 ? 62   ARG B NH2   1 
ATOM   1700 N N     . ARG B 2 17  ? 9.189   43.990 0.266   1.00 41.68 ? 63   ARG B N     1 
ATOM   1701 C CA    . ARG B 2 17  ? 7.888   43.837 0.897   1.00 43.95 ? 63   ARG B CA    1 
ATOM   1702 C C     . ARG B 2 17  ? 7.109   45.155 0.940   1.00 45.75 ? 63   ARG B C     1 
ATOM   1703 O O     . ARG B 2 17  ? 5.901   45.177 0.721   1.00 44.52 ? 63   ARG B O     1 
ATOM   1704 C CB    . ARG B 2 17  ? 8.074   43.313 2.310   1.00 44.65 ? 63   ARG B CB    1 
ATOM   1705 C CG    . ARG B 2 17  ? 6.792   43.170 3.075   1.00 46.51 ? 63   ARG B CG    1 
ATOM   1706 C CD    . ARG B 2 17  ? 7.070   42.529 4.404   1.00 45.98 ? 63   ARG B CD    1 
ATOM   1707 N NE    . ARG B 2 17  ? 5.837   42.190 5.096   1.00 46.93 ? 63   ARG B NE    1 
ATOM   1708 C CZ    . ARG B 2 17  ? 5.773   41.304 6.081   1.00 45.71 ? 63   ARG B CZ    1 
ATOM   1709 N NH1   . ARG B 2 17  ? 6.875   40.679 6.474   1.00 44.30 ? 63   ARG B NH1   1 
ATOM   1710 N NH2   . ARG B 2 17  ? 4.612   41.045 6.665   1.00 46.36 ? 63   ARG B NH2   1 
ATOM   1711 N N     . ASN B 2 18  ? 7.812   46.246 1.224   1.00 48.64 ? 64   ASN B N     1 
ATOM   1712 C CA    . ASN B 2 18  ? 7.200   47.569 1.306   1.00 51.68 ? 64   ASN B CA    1 
ATOM   1713 C C     . ASN B 2 18  ? 7.711   48.456 0.175   1.00 54.26 ? 64   ASN B C     1 
ATOM   1714 O O     . ASN B 2 18  ? 6.962   49.251 -0.391  1.00 54.99 ? 64   ASN B O     1 
ATOM   1715 C CB    . ASN B 2 18  ? 7.539   48.215 2.650   1.00 51.20 ? 64   ASN B CB    1 
ATOM   1716 C CG    . ASN B 2 18  ? 7.223   47.313 3.825   1.00 52.33 ? 64   ASN B CG    1 
ATOM   1717 O OD1   . ASN B 2 18  ? 8.105   46.970 4.618   1.00 53.54 ? 64   ASN B OD1   1 
ATOM   1718 N ND2   . ASN B 2 18  ? 5.960   46.918 3.944   1.00 51.22 ? 64   ASN B ND2   1 
ATOM   1719 N N     . SER B 2 19  ? 8.996   48.308 -0.138  1.00 57.51 ? 65   SER B N     1 
ATOM   1720 C CA    . SER B 2 19  ? 9.662   49.064 -1.196  1.00 59.68 ? 65   SER B CA    1 
ATOM   1721 C C     . SER B 2 19  ? 8.947   50.359 -1.580  1.00 60.66 ? 65   SER B C     1 
ATOM   1722 O O     . SER B 2 19  ? 9.396   51.090 -2.467  1.00 61.51 ? 65   SER B O     1 
ATOM   1723 C CB    . SER B 2 19  ? 9.828   48.182 -2.437  1.00 60.46 ? 65   SER B CB    1 
ATOM   1724 O OG    . SER B 2 19  ? 10.486  48.886 -3.479  1.00 63.87 ? 65   SER B OG    1 
ATOM   1725 O OXT   . SER B 2 19  ? 7.945   50.730 -0.943  1.00 35.61 ? 65   SER B OXT   1 
HETATM 1726 P PA    . MGP C 3 .   ? -8.868  18.801 5.908   1.00 39.72 ? 1000 MGP A PA    1 
HETATM 1727 O O1A   . MGP C 3 .   ? -9.390  20.182 5.649   1.00 39.24 ? 1000 MGP A O1A   1 
HETATM 1728 O O2A   . MGP C 3 .   ? -7.677  18.567 5.027   1.00 41.23 ? 1000 MGP A O2A   1 
HETATM 1729 O O3A   . MGP C 3 .   ? -8.437  18.636 7.427   1.00 44.50 ? 1000 MGP A O3A   1 
HETATM 1730 O "O5'" . MGP C 3 .   ? -10.027 17.684 5.479   1.00 39.60 ? 1000 MGP A "O5'" 1 
HETATM 1731 P PB    . MGP C 3 .   ? -9.416  18.821 8.681   1.00 46.74 ? 1000 MGP A PB    1 
HETATM 1732 O O1B   . MGP C 3 .   ? -10.513 19.797 8.406   1.00 46.29 ? 1000 MGP A O1B   1 
HETATM 1733 O O2B   . MGP C 3 .   ? -8.536  19.256 9.770   1.00 47.84 ? 1000 MGP A O2B   1 
HETATM 1734 O O3B   . MGP C 3 .   ? -10.008 17.554 9.071   1.00 54.21 ? 1000 MGP A O3B   1 
HETATM 1735 P PC    . MGP C 3 .   ? -9.483  16.106 9.505   1.00 63.93 ? 1000 MGP A PC    1 
HETATM 1736 O O1C   . MGP C 3 .   ? -9.976  16.190 11.078  1.00 62.02 ? 1000 MGP A O1C   1 
HETATM 1737 O O2C   . MGP C 3 .   ? -7.970  16.083 9.405   1.00 62.29 ? 1000 MGP A O2C   1 
HETATM 1738 O O3C   . MGP C 3 .   ? -10.015 14.830 8.860   1.00 63.90 ? 1000 MGP A O3C   1 
HETATM 1739 C "C5'" . MGP C 3 .   ? -11.407 17.742 5.893   1.00 32.69 ? 1000 MGP A "C5'" 1 
HETATM 1740 C "C4'" . MGP C 3 .   ? -12.366 17.210 4.891   1.00 32.15 ? 1000 MGP A "C4'" 1 
HETATM 1741 O "O4'" . MGP C 3 .   ? -12.383 18.181 3.753   1.00 29.57 ? 1000 MGP A "O4'" 1 
HETATM 1742 C "C3'" . MGP C 3 .   ? -12.029 15.917 4.129   1.00 31.46 ? 1000 MGP A "C3'" 1 
HETATM 1743 O "O3'" . MGP C 3 .   ? -12.246 14.686 4.881   1.00 29.50 ? 1000 MGP A "O3'" 1 
HETATM 1744 C "C2'" . MGP C 3 .   ? -12.891 16.016 2.902   1.00 30.88 ? 1000 MGP A "C2'" 1 
HETATM 1745 O "O2'" . MGP C 3 .   ? -14.259 15.593 3.220   1.00 32.94 ? 1000 MGP A "O2'" 1 
HETATM 1746 C "C1'" . MGP C 3 .   ? -12.705 17.474 2.500   1.00 29.19 ? 1000 MGP A "C1'" 1 
HETATM 1747 N N9    . MGP C 3 .   ? -11.491 17.823 1.620   1.00 28.18 ? 1000 MGP A N9    1 
HETATM 1748 C C8    . MGP C 3 .   ? -10.257 18.357 1.891   1.00 27.64 ? 1000 MGP A C8    1 
HETATM 1749 N N7    . MGP C 3 .   ? -9.553  18.463 0.787   1.00 27.31 ? 1000 MGP A N7    1 
HETATM 1750 C CM7   . MGP C 3 .   ? -8.177  18.998 0.729   1.00 26.19 ? 1000 MGP A CM7   1 
HETATM 1751 C C5    . MGP C 3 .   ? -10.307 17.975 -0.408  1.00 24.71 ? 1000 MGP A C5    1 
HETATM 1752 C C6    . MGP C 3 .   ? -10.146 17.827 -1.734  1.00 24.58 ? 1000 MGP A C6    1 
HETATM 1753 O O6    . MGP C 3 .   ? -9.064  18.153 -2.374  1.00 26.10 ? 1000 MGP A O6    1 
HETATM 1754 N N1    . MGP C 3 .   ? -11.291 17.264 -2.415  1.00 22.59 ? 1000 MGP A N1    1 
HETATM 1755 C C2    . MGP C 3 .   ? -12.512 16.871 -1.831  1.00 24.06 ? 1000 MGP A C2    1 
HETATM 1756 N N2    . MGP C 3 .   ? -13.468 16.373 -2.596  1.00 24.81 ? 1000 MGP A N2    1 
HETATM 1757 N N3    . MGP C 3 .   ? -12.693 17.017 -0.460  1.00 26.39 ? 1000 MGP A N3    1 
HETATM 1758 C C4    . MGP C 3 .   ? -11.564 17.581 0.267   1.00 25.44 ? 1000 MGP A C4    1 
HETATM 1759 O O     . HOH D 4 .   ? -0.626  17.569 -5.069  1.00 18.50 ? 1    HOH A O     1 
HETATM 1760 O O     . HOH D 4 .   ? -2.082  25.621 16.013  1.00 29.75 ? 2    HOH A O     1 
HETATM 1761 O O     . HOH D 4 .   ? 5.945   14.987 -6.813  1.00 25.06 ? 3    HOH A O     1 
HETATM 1762 O O     . HOH D 4 .   ? 4.681   33.212 13.689  1.00 26.27 ? 4    HOH A O     1 
HETATM 1763 O O     . HOH D 4 .   ? 0.990   8.000  1.701   1.00 31.05 ? 5    HOH A O     1 
HETATM 1764 O O     . HOH D 4 .   ? 12.128  12.628 -8.993  1.00 33.07 ? 6    HOH A O     1 
HETATM 1765 O O     . HOH D 4 .   ? 12.086  8.272  3.283   1.00 30.66 ? 7    HOH A O     1 
HETATM 1766 O O     . HOH D 4 .   ? 2.870   30.153 -14.727 1.00 51.53 ? 8    HOH A O     1 
HETATM 1767 O O     . HOH D 4 .   ? -0.871  14.288 -10.142 1.00 25.04 ? 9    HOH A O     1 
HETATM 1768 O O     . HOH D 4 .   ? -0.481  29.975 20.871  1.00 36.21 ? 10   HOH A O     1 
HETATM 1769 O O     . HOH D 4 .   ? -13.111 23.308 7.794   1.00 38.41 ? 11   HOH A O     1 
HETATM 1770 O O     . HOH D 4 .   ? -1.938  45.968 -0.376  1.00 38.16 ? 12   HOH A O     1 
HETATM 1771 O O     . HOH D 4 .   ? 1.787   33.193 13.944  1.00 28.59 ? 13   HOH A O     1 
HETATM 1772 O O     . HOH D 4 .   ? 0.777   40.029 -11.393 1.00 32.57 ? 14   HOH A O     1 
HETATM 1773 O O     . HOH D 4 .   ? 10.127  13.400 15.081  1.00 45.22 ? 15   HOH A O     1 
HETATM 1774 O O     . HOH D 4 .   ? 1.470   7.973  -8.415  1.00 35.44 ? 16   HOH A O     1 
HETATM 1775 O O     . HOH D 4 .   ? -6.103  10.522 -6.364  1.00 37.27 ? 17   HOH A O     1 
HETATM 1776 O O     . HOH D 4 .   ? -5.198  18.918 6.140   1.00 32.28 ? 18   HOH A O     1 
HETATM 1777 O O     . HOH D 4 .   ? 16.315  27.536 -0.458  1.00 55.19 ? 20   HOH A O     1 
HETATM 1778 O O     . HOH D 4 .   ? -15.116 16.554 0.549   1.00 46.49 ? 21   HOH A O     1 
HETATM 1779 O O     . HOH D 4 .   ? -1.846  20.327 13.932  1.00 42.74 ? 22   HOH A O     1 
HETATM 1780 O O     . HOH D 4 .   ? -2.038  41.555 -6.133  1.00 30.88 ? 23   HOH A O     1 
HETATM 1781 O O     . HOH D 4 .   ? 8.093   25.867 -11.535 1.00 35.14 ? 24   HOH A O     1 
HETATM 1782 O O     . HOH D 4 .   ? 9.731   26.248 15.602  1.00 39.72 ? 25   HOH A O     1 
HETATM 1783 O O     . HOH D 4 .   ? -5.594  15.754 7.198   1.00 45.00 ? 26   HOH A O     1 
HETATM 1784 O O     . HOH D 4 .   ? 12.921  6.541  -6.887  1.00 49.13 ? 218  HOH A O     1 
HETATM 1785 O O     . HOH D 4 .   ? -5.579  16.688 11.779  1.00 66.23 ? 219  HOH A O     1 
HETATM 1786 O O     . HOH D 4 .   ? 4.860   21.214 16.637  1.00 37.31 ? 220  HOH A O     1 
HETATM 1787 O O     . HOH D 4 .   ? 13.864  30.683 9.090   1.00 49.87 ? 221  HOH A O     1 
HETATM 1788 O O     . HOH D 4 .   ? -4.997  46.930 2.867   1.00 46.61 ? 222  HOH A O     1 
HETATM 1789 O O     . HOH D 4 .   ? -2.948  20.103 2.858   1.00 26.30 ? 223  HOH A O     1 
HETATM 1790 O O     . HOH D 4 .   ? 4.332   15.293 9.096   1.00 24.28 ? 224  HOH A O     1 
HETATM 1791 O O     . HOH D 4 .   ? 3.318   21.002 -11.327 1.00 49.10 ? 225  HOH A O     1 
HETATM 1792 O O     . HOH D 4 .   ? 18.897  11.275 -4.224  1.00 34.89 ? 226  HOH A O     1 
HETATM 1793 O O     . HOH D 4 .   ? 12.544  32.292 -1.727  1.00 27.14 ? 227  HOH A O     1 
HETATM 1794 O O     . HOH D 4 .   ? 12.085  28.708 12.494  1.00 43.58 ? 228  HOH A O     1 
HETATM 1795 O O     . HOH D 4 .   ? 1.988   34.900 7.234   1.00 22.47 ? 229  HOH A O     1 
HETATM 1796 O O     . HOH D 4 .   ? -11.401 23.838 14.005  1.00 34.74 ? 230  HOH A O     1 
HETATM 1797 O O     . HOH D 4 .   ? 15.997  19.485 6.249   1.00 31.09 ? 231  HOH A O     1 
HETATM 1798 O O     . HOH D 4 .   ? 10.941  30.593 9.220   1.00 53.94 ? 232  HOH A O     1 
HETATM 1799 O O     . HOH D 4 .   ? -1.862  34.028 3.065   1.00 24.86 ? 233  HOH A O     1 
HETATM 1800 O O     . HOH D 4 .   ? -10.344 21.939 3.626   1.00 51.60 ? 234  HOH A O     1 
HETATM 1801 O O     . HOH D 4 .   ? -1.614  35.937 5.091   1.00 29.68 ? 235  HOH A O     1 
HETATM 1802 O O     . HOH D 4 .   ? -5.433  19.578 13.373  1.00 44.03 ? 236  HOH A O     1 
HETATM 1803 O O     . HOH D 4 .   ? 10.327  33.072 -9.377  1.00 22.35 ? 237  HOH A O     1 
HETATM 1804 O O     . HOH D 4 .   ? -16.237 18.853 -3.402  1.00 40.48 ? 238  HOH A O     1 
HETATM 1805 O O     . HOH D 4 .   ? -14.760 19.793 5.387   1.00 49.95 ? 239  HOH A O     1 
HETATM 1806 O O     . HOH D 4 .   ? -1.229  38.747 5.012   1.00 33.82 ? 240  HOH A O     1 
HETATM 1807 O O     . HOH D 4 .   ? -5.811  20.178 3.208   1.00 28.77 ? 241  HOH A O     1 
HETATM 1808 O O     . HOH D 4 .   ? -16.570 16.126 -2.540  1.00 30.50 ? 242  HOH A O     1 
HETATM 1809 O O     . HOH D 4 .   ? 16.294  54.674 -17.440 1.00 47.76 ? 243  HOH A O     1 
HETATM 1810 O O     . HOH D 4 .   ? 17.400  23.713 -3.567  1.00 45.07 ? 244  HOH A O     1 
HETATM 1811 O O     . HOH D 4 .   ? -1.667  46.680 4.628   1.00 37.00 ? 245  HOH A O     1 
HETATM 1812 O O     . HOH D 4 .   ? -2.248  10.386 -5.009  1.00 34.38 ? 246  HOH A O     1 
HETATM 1813 O O     . HOH D 4 .   ? -12.182 34.193 8.420   1.00 47.94 ? 247  HOH A O     1 
HETATM 1814 O O     . HOH D 4 .   ? -13.728 18.766 -4.864  1.00 44.19 ? 248  HOH A O     1 
HETATM 1815 O O     . HOH D 4 .   ? -17.639 17.171 0.165   1.00 49.05 ? 249  HOH A O     1 
HETATM 1816 O O     . HOH D 4 .   ? -4.594  25.410 17.019  1.00 39.82 ? 250  HOH A O     1 
HETATM 1817 O O     . HOH D 4 .   ? -9.820  21.311 14.605  1.00 48.40 ? 251  HOH A O     1 
HETATM 1818 O O     . HOH D 4 .   ? 12.920  9.263  -8.690  1.00 33.43 ? 252  HOH A O     1 
HETATM 1819 O O     . HOH D 4 .   ? -0.188  40.884 6.798   1.00 30.80 ? 253  HOH A O     1 
HETATM 1820 O O     . HOH D 4 .   ? 4.324   47.862 -8.911  1.00 31.60 ? 254  HOH A O     1 
HETATM 1821 O O     . HOH D 4 .   ? -5.742  26.692 18.912  1.00 42.03 ? 255  HOH A O     1 
HETATM 1822 O O     . HOH D 4 .   ? -4.718  27.655 -8.417  1.00 31.56 ? 256  HOH A O     1 
HETATM 1823 O O     . HOH D 4 .   ? -9.055  24.732 0.650   1.00 29.07 ? 257  HOH A O     1 
HETATM 1824 O O     . HOH D 4 .   ? 7.147   31.247 -9.170  1.00 26.79 ? 258  HOH A O     1 
HETATM 1825 O O     . HOH D 4 .   ? 6.101   16.173 11.905  1.00 37.43 ? 259  HOH A O     1 
HETATM 1826 O O     . HOH D 4 .   ? -2.307  21.864 5.083   1.00 19.19 ? 260  HOH A O     1 
HETATM 1827 O O     . HOH D 4 .   ? -0.702  34.270 6.982   1.00 36.50 ? 261  HOH A O     1 
HETATM 1828 O O     . HOH D 4 .   ? 2.229   46.066 -8.384  1.00 45.15 ? 262  HOH A O     1 
HETATM 1829 O O     . HOH D 4 .   ? -3.611  39.676 -7.169  1.00 44.17 ? 263  HOH A O     1 
HETATM 1830 O O     . HOH D 4 .   ? -5.860  28.740 -10.813 1.00 31.55 ? 264  HOH A O     1 
HETATM 1831 O O     . HOH D 4 .   ? 5.426   18.852 11.716  1.00 32.35 ? 265  HOH A O     1 
HETATM 1832 O O     . HOH D 4 .   ? 17.296  12.512 -1.700  1.00 43.54 ? 266  HOH A O     1 
HETATM 1833 O O     . HOH D 4 .   ? 9.107   26.390 -5.583  1.00 37.88 ? 267  HOH A O     1 
HETATM 1834 O O     . HOH D 4 .   ? -0.634  15.429 -15.731 1.00 43.11 ? 268  HOH A O     1 
HETATM 1835 O O     . HOH D 4 .   ? -4.393  21.137 -13.670 1.00 36.67 ? 269  HOH A O     1 
HETATM 1836 O O     . HOH D 4 .   ? 8.480   4.813  0.095   1.00 30.59 ? 270  HOH A O     1 
HETATM 1837 O O     . HOH D 4 .   ? -12.740 16.771 9.122   1.00 49.53 ? 271  HOH A O     1 
HETATM 1838 O O     . HOH D 4 .   ? 7.537   26.507 -7.737  1.00 39.35 ? 272  HOH A O     1 
HETATM 1839 O O     . HOH D 4 .   ? -8.019  27.344 0.161   1.00 32.37 ? 273  HOH A O     1 
HETATM 1840 O O     . HOH D 4 .   ? -7.144  23.458 -0.693  1.00 37.63 ? 274  HOH A O     1 
HETATM 1841 O O     . HOH D 4 .   ? -0.912  7.994  -6.200  1.00 42.89 ? 275  HOH A O     1 
HETATM 1842 O O     . HOH D 4 .   ? 14.947  22.902 9.971   1.00 35.22 ? 276  HOH A O     1 
HETATM 1843 O O     . HOH D 4 .   ? 3.718   16.398 -14.143 1.00 48.25 ? 277  HOH A O     1 
HETATM 1844 O O     . HOH D 4 .   ? -2.808  5.073  4.061   1.00 44.54 ? 278  HOH A O     1 
HETATM 1845 O O     . HOH E 4 .   ? 17.760  42.630 -1.924  1.00 42.26 ? 19   HOH B O     1 
HETATM 1846 O O     . HOH E 4 .   ? 14.947  31.103 -2.960  1.00 40.95 ? 66   HOH B O     1 
HETATM 1847 O O     . HOH E 4 .   ? 13.476  37.370 8.640   1.00 49.01 ? 67   HOH B O     1 
HETATM 1848 O O     . HOH E 4 .   ? 17.795  36.372 -5.806  1.00 44.16 ? 71   HOH B O     1 
HETATM 1849 O O     . HOH E 4 .   ? 9.903   46.785 -5.687  1.00 43.07 ? 86   HOH B O     1 
HETATM 1850 O O     . HOH E 4 .   ? 18.691  34.175 -7.122  1.00 47.11 ? 89   HOH B O     1 
HETATM 1851 O O     . HOH E 4 .   ? 12.013  31.612 -16.758 1.00 48.16 ? 93   HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   27  27  GLU GLU A . n 
A 1 2   VAL 2   28  28  VAL VAL A . n 
A 1 3   ALA 3   29  29  ALA ALA A . n 
A 1 4   ASN 4   30  30  ASN ASN A . n 
A 1 5   PRO 5   31  31  PRO PRO A . n 
A 1 6   GLU 6   32  32  GLU GLU A . n 
A 1 7   HIS 7   33  33  HIS HIS A . n 
A 1 8   TYR 8   34  34  TYR TYR A . n 
A 1 9   ILE 9   35  35  ILE ILE A . n 
A 1 10  LYS 10  36  36  LYS LYS A . n 
A 1 11  HIS 11  37  37  HIS HIS A . n 
A 1 12  PRO 12  38  38  PRO PRO A . n 
A 1 13  LEU 13  39  39  LEU LEU A . n 
A 1 14  GLN 14  40  40  GLN GLN A . n 
A 1 15  ASN 15  41  41  ASN ASN A . n 
A 1 16  ARG 16  42  42  ARG ARG A . n 
A 1 17  TRP 17  43  43  TRP TRP A . n 
A 1 18  ALA 18  44  44  ALA ALA A . n 
A 1 19  LEU 19  45  45  LEU LEU A . n 
A 1 20  TRP 20  46  46  TRP TRP A . n 
A 1 21  PHE 21  47  47  PHE PHE A . n 
A 1 22  PHE 22  48  48  PHE PHE A . n 
A 1 23  LYS 23  49  49  LYS LYS A . n 
A 1 24  ASN 24  50  50  ASN ASN A . n 
A 1 25  ASP 25  51  51  ASP ASP A . n 
A 1 26  LYS 26  52  52  LYS LYS A . n 
A 1 27  SER 27  53  53  SER SER A . n 
A 1 28  LYS 28  54  54  LYS LYS A . n 
A 1 29  THR 29  55  55  THR THR A . n 
A 1 30  TRP 30  56  56  TRP TRP A . n 
A 1 31  GLN 31  57  57  GLN GLN A . n 
A 1 32  ALA 32  58  58  ALA ALA A . n 
A 1 33  ASN 33  59  59  ASN ASN A . n 
A 1 34  LEU 34  60  ?   ?   ?   A . n 
A 1 35  ARG 35  61  61  ARG ARG A . n 
A 1 36  LEU 36  62  62  LEU LEU A . n 
A 1 37  ILE 37  63  63  ILE ILE A . n 
A 1 38  SER 38  64  64  SER SER A . n 
A 1 39  LYS 39  65  65  LYS LYS A . n 
A 1 40  PHE 40  66  66  PHE PHE A . n 
A 1 41  ASP 41  67  67  ASP ASP A . n 
A 1 42  THR 42  68  68  THR THR A . n 
A 1 43  VAL 43  69  69  VAL VAL A . n 
A 1 44  GLU 44  70  70  GLU GLU A . n 
A 1 45  ASP 45  71  71  ASP ASP A . n 
A 1 46  PHE 46  72  72  PHE PHE A . n 
A 1 47  TRP 47  73  73  TRP TRP A . n 
A 1 48  ALA 48  74  74  ALA ALA A . n 
A 1 49  LEU 49  75  75  LEU LEU A . n 
A 1 50  TYR 50  76  76  TYR TYR A . n 
A 1 51  ASN 51  77  77  ASN ASN A . n 
A 1 52  HIS 52  78  78  HIS HIS A . n 
A 1 53  ILE 53  79  79  ILE ILE A . n 
A 1 54  GLN 54  80  80  GLN GLN A . n 
A 1 55  LEU 55  81  81  LEU LEU A . n 
A 1 56  SER 56  82  82  SER SER A . n 
A 1 57  SER 57  83  83  SER SER A . n 
A 1 58  ASN 58  84  84  ASN ASN A . n 
A 1 59  LEU 59  85  85  LEU LEU A . n 
A 1 60  MET 60  86  86  MET MET A . n 
A 1 61  PRO 61  87  87  PRO PRO A . n 
A 1 62  GLY 62  88  88  GLY GLY A . n 
A 1 63  CYS 63  89  89  CYS CYS A . n 
A 1 64  ASP 64  90  90  ASP ASP A . n 
A 1 65  TYR 65  91  91  TYR TYR A . n 
A 1 66  SER 66  92  92  SER SER A . n 
A 1 67  LEU 67  93  93  LEU LEU A . n 
A 1 68  PHE 68  94  94  PHE PHE A . n 
A 1 69  LYS 69  95  95  LYS LYS A . n 
A 1 70  ASP 70  96  96  ASP ASP A . n 
A 1 71  GLY 71  97  97  GLY GLY A . n 
A 1 72  ILE 72  98  98  ILE ILE A . n 
A 1 73  GLU 73  99  99  GLU GLU A . n 
A 1 74  PRO 74  100 100 PRO PRO A . n 
A 1 75  MET 75  101 101 MET MET A . n 
A 1 76  TRP 76  102 102 TRP TRP A . n 
A 1 77  GLU 77  103 103 GLU GLU A . n 
A 1 78  ASP 78  104 104 ASP ASP A . n 
A 1 79  GLU 79  105 105 GLU GLU A . n 
A 1 80  LYS 80  106 106 LYS LYS A . n 
A 1 81  ASN 81  107 107 ASN ASN A . n 
A 1 82  LYS 82  108 108 LYS LYS A . n 
A 1 83  ARG 83  109 109 ARG ARG A . n 
A 1 84  GLY 84  110 110 GLY GLY A . n 
A 1 85  GLY 85  111 111 GLY GLY A . n 
A 1 86  ARG 86  112 112 ARG ARG A . n 
A 1 87  TRP 87  113 113 TRP TRP A . n 
A 1 88  LEU 88  114 114 LEU LEU A . n 
A 1 89  ILE 89  115 115 ILE ILE A . n 
A 1 90  THR 90  116 116 THR THR A . n 
A 1 91  LEU 91  117 117 LEU LEU A . n 
A 1 92  ASN 92  118 118 ASN ASN A . n 
A 1 93  LYS 93  119 119 LYS LYS A . n 
A 1 94  GLN 94  120 120 GLN GLN A . n 
A 1 95  GLN 95  121 121 GLN GLN A . n 
A 1 96  ARG 96  122 122 ARG ARG A . n 
A 1 97  ARG 97  123 123 ARG ARG A . n 
A 1 98  SER 98  124 124 SER SER A . n 
A 1 99  ASP 99  125 125 ASP ASP A . n 
A 1 100 LEU 100 126 126 LEU LEU A . n 
A 1 101 ASP 101 127 127 ASP ASP A . n 
A 1 102 ARG 102 128 128 ARG ARG A . n 
A 1 103 PHE 103 129 129 PHE PHE A . n 
A 1 104 TRP 104 130 130 TRP TRP A . n 
A 1 105 LEU 105 131 131 LEU LEU A . n 
A 1 106 GLU 106 132 132 GLU GLU A . n 
A 1 107 THR 107 133 133 THR THR A . n 
A 1 108 LEU 108 134 134 LEU LEU A . n 
A 1 109 LEU 109 135 135 LEU LEU A . n 
A 1 110 CYS 110 136 136 CYS CYS A . n 
A 1 111 LEU 111 137 137 LEU LEU A . n 
A 1 112 ILE 112 138 138 ILE ILE A . n 
A 1 113 GLY 113 139 139 GLY GLY A . n 
A 1 114 GLU 114 140 140 GLU GLU A . n 
A 1 115 SER 115 141 141 SER SER A . n 
A 1 116 PHE 116 142 142 PHE PHE A . n 
A 1 117 ASP 117 143 143 ASP ASP A . n 
A 1 118 ASP 118 144 144 ASP ASP A . n 
A 1 119 TYR 119 145 145 TYR TYR A . n 
A 1 120 SER 120 146 146 SER SER A . n 
A 1 121 ASP 121 147 147 ASP ASP A . n 
A 1 122 ASP 122 148 148 ASP ASP A . n 
A 1 123 VAL 123 149 149 VAL VAL A . n 
A 1 124 CYS 124 150 150 CYS CYS A . n 
A 1 125 GLY 125 151 151 GLY GLY A . n 
A 1 126 ALA 126 152 152 ALA ALA A . n 
A 1 127 VAL 127 153 153 VAL VAL A . n 
A 1 128 VAL 128 154 154 VAL VAL A . n 
A 1 129 ASN 129 155 155 ASN ASN A . n 
A 1 130 VAL 130 156 156 VAL VAL A . n 
A 1 131 ARG 131 157 157 ARG ARG A . n 
A 1 132 ALA 132 158 158 ALA ALA A . n 
A 1 133 LYS 133 159 159 LYS LYS A . n 
A 1 134 GLY 134 160 160 GLY GLY A . n 
A 1 135 ASP 135 161 161 ASP ASP A . n 
A 1 136 LYS 136 162 162 LYS LYS A . n 
A 1 137 ILE 137 163 163 ILE ILE A . n 
A 1 138 ALA 138 164 164 ALA ALA A . n 
A 1 139 ILE 139 165 165 ILE ILE A . n 
A 1 140 TRP 140 166 166 TRP TRP A . n 
A 1 141 THR 141 167 167 THR THR A . n 
A 1 142 THR 142 168 168 THR THR A . n 
A 1 143 GLU 143 169 169 GLU GLU A . n 
A 1 144 CYS 144 170 170 CYS CYS A . n 
A 1 145 GLU 145 171 171 GLU GLU A . n 
A 1 146 ASN 146 172 172 ASN ASN A . n 
A 1 147 ARG 147 173 173 ARG ARG A . n 
A 1 148 GLU 148 174 174 GLU GLU A . n 
A 1 149 ALA 149 175 175 ALA ALA A . n 
A 1 150 VAL 150 176 176 VAL VAL A . n 
A 1 151 THR 151 177 177 THR THR A . n 
A 1 152 HIS 152 178 178 HIS HIS A . n 
A 1 153 ILE 153 179 179 ILE ILE A . n 
A 1 154 GLY 154 180 180 GLY GLY A . n 
A 1 155 ARG 155 181 181 ARG ARG A . n 
A 1 156 VAL 156 182 182 VAL VAL A . n 
A 1 157 TYR 157 183 183 TYR TYR A . n 
A 1 158 LYS 158 184 184 LYS LYS A . n 
A 1 159 GLU 159 185 185 GLU GLU A . n 
A 1 160 ARG 160 186 186 ARG ARG A . n 
A 1 161 LEU 161 187 187 LEU LEU A . n 
A 1 162 GLY 162 188 188 GLY GLY A . n 
A 1 163 LEU 163 189 189 LEU LEU A . n 
A 1 164 PRO 164 190 190 PRO PRO A . n 
A 1 165 PRO 165 191 191 PRO PRO A . n 
A 1 166 LYS 166 192 192 LYS LYS A . n 
A 1 167 ILE 167 193 193 ILE ILE A . n 
A 1 168 VAL 168 194 194 VAL VAL A . n 
A 1 169 ILE 169 195 195 ILE ILE A . n 
A 1 170 GLY 170 196 196 GLY GLY A . n 
A 1 171 TYR 171 197 197 TYR TYR A . n 
A 1 172 GLN 172 198 198 GLN GLN A . n 
A 1 173 SER 173 199 199 SER SER A . n 
A 1 174 HIS 174 200 200 HIS HIS A . n 
A 1 175 ALA 175 201 201 ALA ALA A . n 
A 1 176 ASP 176 202 202 ASP ASP A . n 
A 1 177 THR 177 203 203 THR THR A . n 
A 1 178 ALA 178 204 204 ALA ALA A . n 
A 1 179 THR 179 205 205 THR THR A . n 
A 1 180 LYS 180 206 206 LYS LYS A . n 
A 1 181 SER 181 207 207 SER SER A . n 
A 1 182 GLY 182 208 208 GLY GLY A . n 
A 1 183 SER 183 209 209 SER SER A . n 
A 1 184 THR 184 210 210 THR THR A . n 
A 1 185 THR 185 211 211 THR THR A . n 
A 1 186 LYS 186 212 212 LYS LYS A . n 
A 1 187 ASN 187 213 213 ASN ASN A . n 
A 1 188 ARG 188 214 214 ARG ARG A . n 
A 1 189 PHE 189 215 215 PHE PHE A . n 
A 1 190 VAL 190 216 216 VAL VAL A . n 
A 1 191 VAL 191 217 217 VAL VAL A . n 
B 2 1   PRO 1   47  47  PRO PRO B . n 
B 2 2   GLY 2   48  48  GLY GLY B . n 
B 2 3   GLY 3   49  49  GLY GLY B . n 
B 2 4   THR 4   50  50  THR THR B . n 
B 2 5   ARG 5   51  51  ARG ARG B . n 
B 2 6   ILE 6   52  52  ILE ILE B . n 
B 2 7   ILE 7   53  53  ILE ILE B . n 
B 2 8   TYR 8   54  54  TYR TYR B . n 
B 2 9   ASP 9   55  55  ASP ASP B . n 
B 2 10  ARG 10  56  56  ARG ARG B . n 
B 2 11  LYS 11  57  57  LYS LYS B . n 
B 2 12  PHE 12  58  58  PHE PHE B . n 
B 2 13  LEU 13  59  59  LEU LEU B . n 
B 2 14  LEU 14  60  60  LEU LEU B . n 
B 2 15  ASP 15  61  61  ASP ASP B . n 
B 2 16  ARG 16  62  62  ARG ARG B . n 
B 2 17  ARG 17  63  63  ARG ARG B . n 
B 2 18  ASN 18  64  64  ASN ASN B . n 
B 2 19  SER 19  65  65  SER SER B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1510  ? 
1 MORE         -4    ? 
1 'SSA (A^2)'  11730 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2011-08-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CrystalClear 'data collection' . ? 1 
CNS          refinement        . ? 2 
CrystalClear 'data reduction'  . ? 3 
SCALA        'data scaling'    . ? 4 
CNS          phasing           . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 34  ? ? -140.27 -0.72   
2  1 LYS A 52  ? ? 63.45   -37.97  
3  1 LYS A 54  ? ? -49.98  161.99  
4  1 ILE A 63  ? ? -94.28  -68.08  
5  1 ASP A 67  ? ? -146.92 27.68   
6  1 ASP A 143 ? ? 54.99   -138.00 
7  1 LYS A 206 ? ? -168.56 -57.03  
8  1 SER A 207 ? ? 172.39  10.58   
9  1 SER A 209 ? ? 17.83   49.37   
10 1 THR A 210 ? ? 37.14   93.34   
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     LEU 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      60 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    LEU 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     34 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 "7-METHYL-GUANOSINE-5'-TRIPHOSPHATE" MGP 
4 water                                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 MGP 1  1000 1000 MGP M7G A . 
D 4 HOH 1  1    1    HOH HOH A . 
D 4 HOH 2  2    2    HOH HOH A . 
D 4 HOH 3  3    3    HOH HOH A . 
D 4 HOH 4  4    4    HOH HOH A . 
D 4 HOH 5  5    5    HOH HOH A . 
D 4 HOH 6  6    6    HOH HOH A . 
D 4 HOH 7  7    7    HOH HOH A . 
D 4 HOH 8  8    8    HOH HOH A . 
D 4 HOH 9  9    9    HOH HOH A . 
D 4 HOH 10 10   10   HOH HOH A . 
D 4 HOH 11 11   11   HOH HOH A . 
D 4 HOH 12 12   12   HOH HOH A . 
D 4 HOH 13 13   13   HOH HOH A . 
D 4 HOH 14 14   14   HOH HOH A . 
D 4 HOH 15 15   15   HOH HOH A . 
D 4 HOH 16 16   16   HOH HOH A . 
D 4 HOH 17 17   17   HOH HOH A . 
D 4 HOH 18 18   18   HOH HOH A . 
D 4 HOH 19 20   20   HOH HOH A . 
D 4 HOH 20 21   21   HOH HOH A . 
D 4 HOH 21 22   22   HOH HOH A . 
D 4 HOH 22 23   23   HOH HOH A . 
D 4 HOH 23 24   24   HOH HOH A . 
D 4 HOH 24 25   25   HOH HOH A . 
D 4 HOH 25 26   26   HOH HOH A . 
D 4 HOH 26 218  27   HOH HOH A . 
D 4 HOH 27 219  28   HOH HOH A . 
D 4 HOH 28 220  29   HOH HOH A . 
D 4 HOH 29 221  30   HOH HOH A . 
D 4 HOH 30 222  31   HOH HOH A . 
D 4 HOH 31 223  32   HOH HOH A . 
D 4 HOH 32 224  33   HOH HOH A . 
D 4 HOH 33 225  34   HOH HOH A . 
D 4 HOH 34 226  35   HOH HOH A . 
D 4 HOH 35 227  36   HOH HOH A . 
D 4 HOH 36 228  37   HOH HOH A . 
D 4 HOH 37 229  38   HOH HOH A . 
D 4 HOH 38 230  39   HOH HOH A . 
D 4 HOH 39 231  40   HOH HOH A . 
D 4 HOH 40 232  41   HOH HOH A . 
D 4 HOH 41 233  42   HOH HOH A . 
D 4 HOH 42 234  43   HOH HOH A . 
D 4 HOH 43 235  44   HOH HOH A . 
D 4 HOH 44 236  45   HOH HOH A . 
D 4 HOH 45 237  46   HOH HOH A . 
D 4 HOH 46 238  47   HOH HOH A . 
D 4 HOH 47 239  48   HOH HOH A . 
D 4 HOH 48 240  50   HOH HOH A . 
D 4 HOH 49 241  51   HOH HOH A . 
D 4 HOH 50 242  52   HOH HOH A . 
D 4 HOH 51 243  54   HOH HOH A . 
D 4 HOH 52 244  55   HOH HOH A . 
D 4 HOH 53 245  56   HOH HOH A . 
D 4 HOH 54 246  57   HOH HOH A . 
D 4 HOH 55 247  58   HOH HOH A . 
D 4 HOH 56 248  59   HOH HOH A . 
D 4 HOH 57 249  60   HOH HOH A . 
D 4 HOH 58 250  61   HOH HOH A . 
D 4 HOH 59 251  62   HOH HOH A . 
D 4 HOH 60 252  63   HOH HOH A . 
D 4 HOH 61 253  64   HOH HOH A . 
D 4 HOH 62 254  65   HOH HOH A . 
D 4 HOH 63 255  66   HOH HOH A . 
D 4 HOH 64 256  67   HOH HOH A . 
D 4 HOH 65 257  68   HOH HOH A . 
D 4 HOH 66 258  69   HOH HOH A . 
D 4 HOH 67 259  70   HOH HOH A . 
D 4 HOH 68 260  72   HOH HOH A . 
D 4 HOH 69 261  73   HOH HOH A . 
D 4 HOH 70 262  74   HOH HOH A . 
D 4 HOH 71 263  75   HOH HOH A . 
D 4 HOH 72 264  77   HOH HOH A . 
D 4 HOH 73 265  78   HOH HOH A . 
D 4 HOH 74 266  79   HOH HOH A . 
D 4 HOH 75 267  80   HOH HOH A . 
D 4 HOH 76 268  81   HOH HOH A . 
D 4 HOH 77 269  82   HOH HOH A . 
D 4 HOH 78 270  83   HOH HOH A . 
D 4 HOH 79 271  84   HOH HOH A . 
D 4 HOH 80 272  85   HOH HOH A . 
D 4 HOH 81 273  87   HOH HOH A . 
D 4 HOH 82 274  88   HOH HOH A . 
D 4 HOH 83 275  90   HOH HOH A . 
D 4 HOH 84 276  91   HOH HOH A . 
D 4 HOH 85 277  92   HOH HOH A . 
D 4 HOH 86 278  94   HOH HOH A . 
E 4 HOH 1  19   19   HOH HOH B . 
E 4 HOH 2  66   49   HOH HOH B . 
E 4 HOH 3  67   53   HOH HOH B . 
E 4 HOH 4  71   71   HOH HOH B . 
E 4 HOH 5  86   86   HOH HOH B . 
E 4 HOH 6  89   89   HOH HOH B . 
E 4 HOH 7  93   93   HOH HOH B . 
#