data_3ANX
# 
_entry.id   3ANX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ANX         
RCSB  RCSB029481   
WWPDB D_1000029481 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ANX 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-14 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ganbe, T.'    1 
'Ohnuma, M.'   2 
'Sato, T.'     3 
'Tanaka, N.'   4 
'Oshima, T.'   5 
'Kumasaka, T.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures and enzymatic properties of a triamine/agmatine aminopropyltransferase from Thermus thermophilus' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            408 
_citation.page_first                971 
_citation.page_last                 986 
_citation.year                      2011 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21458463 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2011.03.025 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ohnuma, M.'    1  
primary 'Ganbe, T.'     2  
primary 'Terui, Y.'     3  
primary 'Niitsu, M.'    4  
primary 'Sato, T.'      5  
primary 'Tanaka, N.'    6  
primary 'Tamakoshi, M.' 7  
primary 'Samejima, K.'  8  
primary 'Kumasaka, T.'  9  
primary 'Oshima, T.'    10 
# 
_cell.entry_id           3ANX 
_cell.length_a           88.040 
_cell.length_b           88.040 
_cell.length_c           191.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3ANX 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'spermidine synthase'             36056.238 2   2.5.1.16 ? ? ? 
2 non-polymer syn "5'-DEOXY-5'-METHYLTHIOADENOSINE" 297.334   2   ?        ? ? ? 
3 water       nat water                             18.015    183 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'polyamine aminopropyltransferase, triamine/agmatine aminopropyltransferase, agmatine/spermidine aminopropyltransferase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKR
VLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLT
DPVGEDNPARLLYTVEFYRLVKAHLNPGGVMGMQAGMILLTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLAS
DAFDPAAFSEGVIEARIRERNLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEARQAPYKG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKR
VLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLT
DPVGEDNPARLLYTVEFYRLVKAHLNPGGVMGMQAGMILLTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLAS
DAFDPAAFSEGVIEARIRERNLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEARQAPYKG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   TYR n 
1 4   GLY n 
1 5   MET n 
1 6   TYR n 
1 7   PHE n 
1 8   PHE n 
1 9   GLU n 
1 10  HIS n 
1 11  VAL n 
1 12  THR n 
1 13  PRO n 
1 14  TYR n 
1 15  GLU n 
1 16  THR n 
1 17  LEU n 
1 18  VAL n 
1 19  ARG n 
1 20  ARG n 
1 21  MET n 
1 22  GLU n 
1 23  ARG n 
1 24  VAL n 
1 25  ILE n 
1 26  ALA n 
1 27  SER n 
1 28  GLY n 
1 29  LYS n 
1 30  THR n 
1 31  PRO n 
1 32  PHE n 
1 33  GLN n 
1 34  ASP n 
1 35  TYR n 
1 36  PHE n 
1 37  LEU n 
1 38  PHE n 
1 39  GLU n 
1 40  SER n 
1 41  LYS n 
1 42  GLY n 
1 43  PHE n 
1 44  GLY n 
1 45  LYS n 
1 46  VAL n 
1 47  LEU n 
1 48  ILE n 
1 49  LEU n 
1 50  ASP n 
1 51  LYS n 
1 52  ASP n 
1 53  VAL n 
1 54  GLN n 
1 55  SER n 
1 56  THR n 
1 57  GLU n 
1 58  ARG n 
1 59  ASP n 
1 60  GLU n 
1 61  TYR n 
1 62  ILE n 
1 63  TYR n 
1 64  HIS n 
1 65  GLU n 
1 66  THR n 
1 67  LEU n 
1 68  VAL n 
1 69  HIS n 
1 70  PRO n 
1 71  ALA n 
1 72  MET n 
1 73  LEU n 
1 74  THR n 
1 75  HIS n 
1 76  PRO n 
1 77  GLU n 
1 78  PRO n 
1 79  LYS n 
1 80  ARG n 
1 81  VAL n 
1 82  LEU n 
1 83  ILE n 
1 84  VAL n 
1 85  GLY n 
1 86  GLY n 
1 87  GLY n 
1 88  GLU n 
1 89  GLY n 
1 90  ALA n 
1 91  THR n 
1 92  LEU n 
1 93  ARG n 
1 94  GLU n 
1 95  VAL n 
1 96  LEU n 
1 97  LYS n 
1 98  HIS n 
1 99  PRO n 
1 100 THR n 
1 101 VAL n 
1 102 GLU n 
1 103 LYS n 
1 104 ALA n 
1 105 VAL n 
1 106 MET n 
1 107 VAL n 
1 108 ASP n 
1 109 ILE n 
1 110 ASP n 
1 111 GLY n 
1 112 GLU n 
1 113 LEU n 
1 114 VAL n 
1 115 GLU n 
1 116 VAL n 
1 117 ALA n 
1 118 LYS n 
1 119 ARG n 
1 120 HIS n 
1 121 MET n 
1 122 PRO n 
1 123 GLU n 
1 124 TRP n 
1 125 HIS n 
1 126 GLN n 
1 127 GLY n 
1 128 ALA n 
1 129 PHE n 
1 130 ASP n 
1 131 ASP n 
1 132 PRO n 
1 133 ARG n 
1 134 ALA n 
1 135 VAL n 
1 136 LEU n 
1 137 VAL n 
1 138 ILE n 
1 139 ASP n 
1 140 ASP n 
1 141 ALA n 
1 142 ARG n 
1 143 ALA n 
1 144 TYR n 
1 145 LEU n 
1 146 GLU n 
1 147 ARG n 
1 148 THR n 
1 149 GLU n 
1 150 GLU n 
1 151 ARG n 
1 152 TYR n 
1 153 ASP n 
1 154 VAL n 
1 155 VAL n 
1 156 ILE n 
1 157 ILE n 
1 158 ASP n 
1 159 LEU n 
1 160 THR n 
1 161 ASP n 
1 162 PRO n 
1 163 VAL n 
1 164 GLY n 
1 165 GLU n 
1 166 ASP n 
1 167 ASN n 
1 168 PRO n 
1 169 ALA n 
1 170 ARG n 
1 171 LEU n 
1 172 LEU n 
1 173 TYR n 
1 174 THR n 
1 175 VAL n 
1 176 GLU n 
1 177 PHE n 
1 178 TYR n 
1 179 ARG n 
1 180 LEU n 
1 181 VAL n 
1 182 LYS n 
1 183 ALA n 
1 184 HIS n 
1 185 LEU n 
1 186 ASN n 
1 187 PRO n 
1 188 GLY n 
1 189 GLY n 
1 190 VAL n 
1 191 MET n 
1 192 GLY n 
1 193 MET n 
1 194 GLN n 
1 195 ALA n 
1 196 GLY n 
1 197 MET n 
1 198 ILE n 
1 199 LEU n 
1 200 LEU n 
1 201 THR n 
1 202 HIS n 
1 203 HIS n 
1 204 ARG n 
1 205 VAL n 
1 206 HIS n 
1 207 PRO n 
1 208 VAL n 
1 209 VAL n 
1 210 HIS n 
1 211 ARG n 
1 212 THR n 
1 213 VAL n 
1 214 ARG n 
1 215 GLU n 
1 216 ALA n 
1 217 PHE n 
1 218 ARG n 
1 219 TYR n 
1 220 VAL n 
1 221 ARG n 
1 222 SER n 
1 223 TYR n 
1 224 LYS n 
1 225 ASN n 
1 226 HIS n 
1 227 ILE n 
1 228 PRO n 
1 229 GLY n 
1 230 PHE n 
1 231 PHE n 
1 232 LEU n 
1 233 ASN n 
1 234 PHE n 
1 235 GLY n 
1 236 PHE n 
1 237 LEU n 
1 238 LEU n 
1 239 ALA n 
1 240 SER n 
1 241 ASP n 
1 242 ALA n 
1 243 PHE n 
1 244 ASP n 
1 245 PRO n 
1 246 ALA n 
1 247 ALA n 
1 248 PHE n 
1 249 SER n 
1 250 GLU n 
1 251 GLY n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ALA n 
1 256 ARG n 
1 257 ILE n 
1 258 ARG n 
1 259 GLU n 
1 260 ARG n 
1 261 ASN n 
1 262 LEU n 
1 263 ALA n 
1 264 LEU n 
1 265 ARG n 
1 266 HIS n 
1 267 LEU n 
1 268 THR n 
1 269 ALA n 
1 270 PRO n 
1 271 TYR n 
1 272 LEU n 
1 273 GLU n 
1 274 ALA n 
1 275 MET n 
1 276 PHE n 
1 277 VAL n 
1 278 LEU n 
1 279 PRO n 
1 280 LYS n 
1 281 ASP n 
1 282 LEU n 
1 283 LEU n 
1 284 GLU n 
1 285 ALA n 
1 286 LEU n 
1 287 GLU n 
1 288 LYS n 
1 289 GLU n 
1 290 THR n 
1 291 MET n 
1 292 VAL n 
1 293 SER n 
1 294 THR n 
1 295 ASP n 
1 296 GLN n 
1 297 ASN n 
1 298 PRO n 
1 299 PHE n 
1 300 TYR n 
1 301 VAL n 
1 302 THR n 
1 303 PRO n 
1 304 GLU n 
1 305 GLY n 
1 306 GLU n 
1 307 ALA n 
1 308 ARG n 
1 309 GLN n 
1 310 ALA n 
1 311 PRO n 
1 312 TYR n 
1 313 LYS n 
1 314 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    HB8 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21C 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    P83816_THETH 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKR
VLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLT
DPVGEDNPARLLYTVEFYRLVKAHLNPGGVMGMQAGMILLTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLAS
DAFDPAAFSEGVIEARIRERNLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEARQAPYKG
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P83816 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ANX A 1 ? 314 ? P83816 1 ? 314 ? 1 314 
2 1 3ANX B 1 ? 314 ? P83816 1 ? 314 ? 1 314 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'      133.103 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                             ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'   149.211 
MTA non-polymer         . "5'-DEOXY-5'-METHYLTHIOADENOSINE" ? 'C11 H15 N5 O3 S' 297.334 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3ANX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.density_percent_sol   52.03 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.50 
_exptl_crystal_grow.pdbx_details    
'1.8M AMMONIUM SULFATE, 0.1M MES, 1MM SAM, pH 5.50, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3ANX 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   25838 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.11900 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3ANX 
_refine.ls_number_reflns_obs                     22098 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    91.7 
_refine.ls_R_factor_obs                          0.188 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.180 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.900 
_refine.ls_number_reflns_R_free                  2419 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.895 
_refine.B_iso_mean                               40.93 
_refine.aniso_B[1][1]                            -0.98000 
_refine.aniso_B[2][2]                            -0.98000 
_refine.aniso_B[3][3]                            1.97000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1UIR 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.343 
_refine.overall_SU_ML                            0.227 
_refine.overall_SU_B                             10.416 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5065 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             183 
_refine_hist.number_atoms_total               5288 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.030  0.022  ? 5239 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.686  1.973  ? 7115 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       9.019  5.000  ? 623  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       31.833 22.846 ? 260  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       22.876 15.000 ? 866  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.528 15.000 ? 46   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.162  0.200  ? 775  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.010  0.020  ? 4050 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.292  0.200  ? 2884 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.348  0.200  ? 3470 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.224  0.200  ? 295  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.276  0.200  ? 63   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.488  0.200  ? 11   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.290  1.500  ? 3245 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.204  2.000  ? 5070 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.359  3.000  ? 2299 'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.005  4.500  ? 2045 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.56 
_refine_ls_shell.number_reflns_R_work             1220 
_refine_ls_shell.R_factor_R_work                  0.2680 
_refine_ls_shell.percent_reflns_obs               72.15 
_refine_ls_shell.R_factor_R_free                  0.3340 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             145 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3ANX 
_struct.title                     
'Crystal structure of triamine/agmatine aminopropyltransferase (SPEE) from thermus thermophilus, complexed with MTA' 
_struct.pdbx_descriptor           'spermidine synthase (E.C.2.5.1.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ANX 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            
'SPEE, spermine synthase, spermidine synthase, polyamine, spermidine biosynthesis, TRANSFERASE-TRANSFERASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 59  ? HIS A 75  ? ASP A 59  HIS A 75  1 ? 17 
HELX_P HELX_P2  2  GLY A 89  ? LYS A 97  ? GLY A 89  LYS A 97  1 ? 9  
HELX_P HELX_P3  3  ASP A 110 ? MET A 121 ? ASP A 110 MET A 121 1 ? 12 
HELX_P HELX_P4  4  MET A 121 ? GLN A 126 ? MET A 121 GLN A 126 1 ? 6  
HELX_P HELX_P5  5  GLY A 127 ? ASP A 131 ? GLY A 127 ASP A 131 5 ? 5  
HELX_P HELX_P6  6  ASP A 140 ? THR A 148 ? ASP A 140 THR A 148 1 ? 9  
HELX_P HELX_P7  7  PRO A 168 ? TYR A 173 ? PRO A 168 TYR A 173 5 ? 6  
HELX_P HELX_P8  8  THR A 174 ? HIS A 184 ? THR A 174 HIS A 184 1 ? 11 
HELX_P HELX_P9  9  ARG A 204 ? PHE A 217 ? ARG A 204 PHE A 217 1 ? 14 
HELX_P HELX_P10 10 PRO A 228 ? PHE A 231 ? PRO A 228 PHE A 231 5 ? 4  
HELX_P HELX_P11 11 GLY A 251 ? ARG A 260 ? GLY A 251 ARG A 260 1 ? 10 
HELX_P HELX_P12 12 THR A 268 ? MET A 275 ? THR A 268 MET A 275 1 ? 8  
HELX_P HELX_P13 13 PRO A 279 ? GLU A 289 ? PRO A 279 GLU A 289 1 ? 11 
HELX_P HELX_P14 14 GLU B 57  ? THR B 74  ? GLU B 57  THR B 74  1 ? 18 
HELX_P HELX_P15 15 GLY B 89  ? LEU B 96  ? GLY B 89  LEU B 96  1 ? 8  
HELX_P HELX_P16 16 ASP B 110 ? MET B 121 ? ASP B 110 MET B 121 1 ? 12 
HELX_P HELX_P17 17 MET B 121 ? GLN B 126 ? MET B 121 GLN B 126 1 ? 6  
HELX_P HELX_P18 18 GLY B 127 ? ASP B 131 ? GLY B 127 ASP B 131 5 ? 5  
HELX_P HELX_P19 19 ASP B 140 ? THR B 148 ? ASP B 140 THR B 148 1 ? 9  
HELX_P HELX_P20 20 ALA B 169 ? TYR B 173 ? ALA B 169 TYR B 173 5 ? 5  
HELX_P HELX_P21 21 THR B 174 ? HIS B 184 ? THR B 174 HIS B 184 1 ? 11 
HELX_P HELX_P22 22 ARG B 204 ? GLU B 215 ? ARG B 204 GLU B 215 1 ? 12 
HELX_P HELX_P23 23 PRO B 228 ? PHE B 231 ? PRO B 228 PHE B 231 5 ? 4  
HELX_P HELX_P24 24 SER B 249 ? ARG B 260 ? SER B 249 ARG B 260 1 ? 12 
HELX_P HELX_P25 25 THR B 268 ? MET B 275 ? THR B 268 MET B 275 1 ? 8  
HELX_P HELX_P26 26 PRO B 279 ? GLU B 289 ? PRO B 279 GLU B 289 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 7 ? 
D ? 2 ? 
E ? 4 ? 
F ? 7 ? 
G ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 6   ? THR A 12  ? TYR A 6   THR A 12  
A 2 GLU A 15  ? ARG A 20  ? GLU A 15  ARG A 20  
A 3 GLU B 15  ? MET B 21  ? GLU B 15  MET B 21  
A 4 MET B 5   ? HIS B 10  ? MET B 5   HIS B 10  
B 1 ALA A 26  ? LYS A 29  ? ALA A 26  LYS A 29  
B 2 ASP A 34  ? GLU A 39  ? ASP A 34  GLU A 39  
B 3 LYS A 45  ? LEU A 49  ? LYS A 45  LEU A 49  
B 4 ASP A 52  ? THR A 56  ? ASP A 52  THR A 56  
C 1 ALA A 134 ? VAL A 137 ? ALA A 134 VAL A 137 
C 2 LYS A 103 ? VAL A 107 ? LYS A 103 VAL A 107 
C 3 ARG A 80  ? GLY A 85  ? ARG A 80  GLY A 85  
C 4 TYR A 152 ? ASP A 158 ? TYR A 152 ASP A 158 
C 5 LEU A 185 ? ILE A 198 ? LEU A 185 ILE A 198 
C 6 LEU A 232 ? SER A 240 ? LEU A 232 SER A 240 
C 7 TYR A 219 ? ILE A 227 ? TYR A 219 ILE A 227 
D 1 PHE A 299 ? VAL A 301 ? PHE A 299 VAL A 301 
D 2 ALA A 307 ? GLN A 309 ? ALA A 307 GLN A 309 
E 1 ARG B 23  ? GLY B 28  ? ARG B 23  GLY B 28  
E 2 TYR B 35  ? SER B 40  ? TYR B 35  SER B 40  
E 3 GLY B 44  ? LEU B 49  ? GLY B 44  LEU B 49  
E 4 ASP B 52  ? THR B 56  ? ASP B 52  THR B 56  
F 1 ALA B 134 ? VAL B 137 ? ALA B 134 VAL B 137 
F 2 LYS B 103 ? VAL B 107 ? LYS B 103 VAL B 107 
F 3 ARG B 80  ? GLY B 85  ? ARG B 80  GLY B 85  
F 4 TYR B 152 ? ASP B 158 ? TYR B 152 ASP B 158 
F 5 LEU B 185 ? MET B 197 ? LEU B 185 MET B 197 
F 6 ASN B 233 ? SER B 240 ? ASN B 233 SER B 240 
F 7 TYR B 219 ? HIS B 226 ? TYR B 219 HIS B 226 
G 1 PHE B 299 ? VAL B 301 ? PHE B 299 VAL B 301 
G 2 ALA B 307 ? GLN B 309 ? ALA B 307 GLN B 309 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 9   ? N GLU A 9   O LEU A 17  ? O LEU A 17  
A 2 3 N VAL A 18  ? N VAL A 18  O THR B 16  ? O THR B 16  
A 3 4 O LEU B 17  ? O LEU B 17  N GLU B 9   ? N GLU B 9   
B 1 2 N ALA A 26  ? N ALA A 26  O LEU A 37  ? O LEU A 37  
B 2 3 N PHE A 36  ? N PHE A 36  O ILE A 48  ? O ILE A 48  
B 3 4 N LEU A 47  ? N LEU A 47  O GLN A 54  ? O GLN A 54  
C 1 2 O VAL A 137 ? O VAL A 137 N MET A 106 ? N MET A 106 
C 2 3 O LYS A 103 ? O LYS A 103 N VAL A 81  ? N VAL A 81  
C 3 4 N ARG A 80  ? N ARG A 80  O ASP A 153 ? O ASP A 153 
C 4 5 N TYR A 152 ? N TYR A 152 O ASN A 186 ? O ASN A 186 
C 5 6 N ALA A 195 ? N ALA A 195 O GLY A 235 ? O GLY A 235 
C 6 7 O LEU A 238 ? O LEU A 238 N ARG A 221 ? N ARG A 221 
D 1 2 N TYR A 300 ? N TYR A 300 O ARG A 308 ? O ARG A 308 
E 1 2 N ALA B 26  ? N ALA B 26  O LEU B 37  ? O LEU B 37  
E 2 3 N PHE B 36  ? N PHE B 36  O ILE B 48  ? O ILE B 48  
E 3 4 N LEU B 49  ? N LEU B 49  O ASP B 52  ? O ASP B 52  
F 1 2 O VAL B 137 ? O VAL B 137 N MET B 106 ? N MET B 106 
F 2 3 O VAL B 107 ? O VAL B 107 N ILE B 83  ? N ILE B 83  
F 3 4 N VAL B 84  ? N VAL B 84  O ASP B 158 ? O ASP B 158 
F 4 5 N TYR B 152 ? N TYR B 152 O ASN B 186 ? O ASN B 186 
F 5 6 N GLY B 196 ? N GLY B 196 O GLY B 235 ? O GLY B 235 
F 6 7 O PHE B 236 ? O PHE B 236 N TYR B 223 ? N TYR B 223 
G 1 2 N TYR B 300 ? N TYR B 300 O ARG B 308 ? O ARG B 308 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE MTA A 315' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE MTA B 315' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 GLN A 33  ? GLN A 33  . ? 1_555 ? 
2  AC1 13 GLN A 54  ? GLN A 54  . ? 1_555 ? 
3  AC1 13 GLY A 85  ? GLY A 85  . ? 1_555 ? 
4  AC1 13 GLY A 86  ? GLY A 86  . ? 1_555 ? 
5  AC1 13 GLY A 87  ? GLY A 87  . ? 1_555 ? 
6  AC1 13 ASP A 108 ? ASP A 108 . ? 1_555 ? 
7  AC1 13 ILE A 109 ? ILE A 109 . ? 1_555 ? 
8  AC1 13 LEU A 113 ? LEU A 113 . ? 1_555 ? 
9  AC1 13 ASP A 140 ? ASP A 140 . ? 1_555 ? 
10 AC1 13 ALA A 141 ? ALA A 141 . ? 1_555 ? 
11 AC1 13 ASP A 158 ? ASP A 158 . ? 1_555 ? 
12 AC1 13 THR A 160 ? THR A 160 . ? 1_555 ? 
13 AC1 13 LEU A 172 ? LEU A 172 . ? 1_555 ? 
14 AC2 12 GLN B 33  ? GLN B 33  . ? 1_555 ? 
15 AC2 12 GLY B 85  ? GLY B 85  . ? 1_555 ? 
16 AC2 12 GLY B 86  ? GLY B 86  . ? 1_555 ? 
17 AC2 12 GLY B 87  ? GLY B 87  . ? 1_555 ? 
18 AC2 12 VAL B 107 ? VAL B 107 . ? 1_555 ? 
19 AC2 12 ASP B 108 ? ASP B 108 . ? 1_555 ? 
20 AC2 12 ILE B 109 ? ILE B 109 . ? 1_555 ? 
21 AC2 12 LEU B 113 ? LEU B 113 . ? 1_555 ? 
22 AC2 12 ALA B 141 ? ALA B 141 . ? 1_555 ? 
23 AC2 12 ASP B 158 ? ASP B 158 . ? 1_555 ? 
24 AC2 12 LEU B 159 ? LEU B 159 . ? 1_555 ? 
25 AC2 12 LEU B 172 ? LEU B 172 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3ANX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ANX 
_atom_sites.fract_transf_matrix[1][1]   0.011358 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011358 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005236 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . MET A 1 1   ? 44.594 42.961 141.698 1.00 46.35 ? 1   MET A N     1 
ATOM   2    C CA    . MET A 1 1   ? 45.877 43.386 141.077 1.00 46.15 ? 1   MET A CA    1 
ATOM   3    C C     . MET A 1 1   ? 46.852 44.009 142.008 1.00 46.58 ? 1   MET A C     1 
ATOM   4    O O     . MET A 1 1   ? 46.588 44.258 143.196 1.00 46.87 ? 1   MET A O     1 
ATOM   5    C CB    . MET A 1 1   ? 45.571 44.406 140.016 1.00 46.41 ? 1   MET A CB    1 
ATOM   6    C CG    . MET A 1 1   ? 44.834 45.649 140.517 1.00 46.36 ? 1   MET A CG    1 
ATOM   7    S SD    . MET A 1 1   ? 43.188 45.449 141.210 1.00 41.94 ? 1   MET A SD    1 
ATOM   8    C CE    . MET A 1 1   ? 42.684 47.113 141.203 1.00 40.58 ? 1   MET A CE    1 
ATOM   9    N N     . ASP A 1 2   ? 47.992 44.341 141.465 1.00 47.34 ? 2   ASP A N     1 
ATOM   10   C CA    . ASP A 1 2   ? 49.036 44.955 142.326 1.00 48.96 ? 2   ASP A CA    1 
ATOM   11   C C     . ASP A 1 2   ? 48.454 46.098 143.213 1.00 47.90 ? 2   ASP A C     1 
ATOM   12   O O     . ASP A 1 2   ? 47.385 46.617 142.924 1.00 49.10 ? 2   ASP A O     1 
ATOM   13   C CB    . ASP A 1 2   ? 50.257 45.350 141.464 1.00 49.22 ? 2   ASP A CB    1 
ATOM   14   C CG    . ASP A 1 2   ? 50.264 44.569 140.119 1.00 52.83 ? 2   ASP A CG    1 
ATOM   15   O OD1   . ASP A 1 2   ? 49.330 44.890 139.333 1.00 55.56 ? 2   ASP A OD1   1 
ATOM   16   O OD2   . ASP A 1 2   ? 51.097 43.616 139.885 1.00 53.52 ? 2   ASP A OD2   1 
ATOM   17   N N     . TYR A 1 3   ? 49.090 46.442 144.325 1.00 45.55 ? 3   TYR A N     1 
ATOM   18   C CA    . TYR A 1 3   ? 48.646 47.603 145.082 1.00 42.85 ? 3   TYR A CA    1 
ATOM   19   C C     . TYR A 1 3   ? 49.436 48.896 144.661 1.00 41.48 ? 3   TYR A C     1 
ATOM   20   O O     . TYR A 1 3   ? 50.648 48.833 144.338 1.00 41.06 ? 3   TYR A O     1 
ATOM   21   C CB    . TYR A 1 3   ? 48.925 47.333 146.573 1.00 44.16 ? 3   TYR A CB    1 
ATOM   22   C CG    . TYR A 1 3   ? 48.078 46.287 147.279 1.00 43.64 ? 3   TYR A CG    1 
ATOM   23   C CD1   . TYR A 1 3   ? 46.778 46.566 147.665 1.00 43.25 ? 3   TYR A CD1   1 
ATOM   24   C CD2   . TYR A 1 3   ? 48.605 45.026 147.604 1.00 44.31 ? 3   TYR A CD2   1 
ATOM   25   C CE1   . TYR A 1 3   ? 46.021 45.621 148.348 1.00 46.34 ? 3   TYR A CE1   1 
ATOM   26   C CE2   . TYR A 1 3   ? 47.829 44.062 148.268 1.00 44.65 ? 3   TYR A CE2   1 
ATOM   27   C CZ    . TYR A 1 3   ? 46.555 44.384 148.641 1.00 44.64 ? 3   TYR A CZ    1 
ATOM   28   O OH    . TYR A 1 3   ? 45.796 43.488 149.319 1.00 45.97 ? 3   TYR A OH    1 
ATOM   29   N N     . GLY A 1 4   ? 48.812 50.066 144.707 1.00 38.18 ? 4   GLY A N     1 
ATOM   30   C CA    . GLY A 1 4   ? 49.570 51.268 144.490 1.00 33.54 ? 4   GLY A CA    1 
ATOM   31   C C     . GLY A 1 4   ? 48.650 52.321 143.997 1.00 32.25 ? 4   GLY A C     1 
ATOM   32   O O     . GLY A 1 4   ? 47.478 52.320 144.361 1.00 32.18 ? 4   GLY A O     1 
ATOM   33   N N     . MET A 1 5   ? 49.178 53.243 143.182 1.00 30.64 ? 5   MET A N     1 
ATOM   34   C CA    . MET A 1 5   ? 48.382 54.298 142.546 1.00 28.87 ? 5   MET A CA    1 
ATOM   35   C C     . MET A 1 5   ? 47.553 53.887 141.334 1.00 27.07 ? 5   MET A C     1 
ATOM   36   O O     . MET A 1 5   ? 48.000 53.129 140.461 1.00 28.65 ? 5   MET A O     1 
ATOM   37   C CB    . MET A 1 5   ? 49.311 55.380 142.126 1.00 28.86 ? 5   MET A CB    1 
ATOM   38   C CG    . MET A 1 5   ? 49.988 56.033 143.294 1.00 27.58 ? 5   MET A CG    1 
ATOM   39   S SD    . MET A 1 5   ? 50.911 57.404 142.608 1.00 32.02 ? 5   MET A SD    1 
ATOM   40   C CE    . MET A 1 5   ? 51.817 56.536 141.310 1.00 30.45 ? 5   MET A CE    1 
ATOM   41   N N     . TYR A 1 6   ? 46.339 54.375 141.269 1.00 24.54 ? 6   TYR A N     1 
ATOM   42   C CA    . TYR A 1 6   ? 45.421 53.989 140.231 1.00 22.27 ? 6   TYR A CA    1 
ATOM   43   C C     . TYR A 1 6   ? 44.516 55.125 139.846 1.00 20.95 ? 6   TYR A C     1 
ATOM   44   O O     . TYR A 1 6   ? 44.318 56.062 140.670 1.00 19.52 ? 6   TYR A O     1 
ATOM   45   C CB    . TYR A 1 6   ? 44.535 52.913 140.762 1.00 21.11 ? 6   TYR A CB    1 
ATOM   46   C CG    . TYR A 1 6   ? 45.204 51.607 140.830 1.00 25.25 ? 6   TYR A CG    1 
ATOM   47   C CD1   . TYR A 1 6   ? 45.831 51.166 142.037 1.00 27.26 ? 6   TYR A CD1   1 
ATOM   48   C CD2   . TYR A 1 6   ? 45.187 50.727 139.701 1.00 26.83 ? 6   TYR A CD2   1 
ATOM   49   C CE1   . TYR A 1 6   ? 46.454 49.922 142.086 1.00 26.96 ? 6   TYR A CE1   1 
ATOM   50   C CE2   . TYR A 1 6   ? 45.718 49.489 139.741 1.00 18.58 ? 6   TYR A CE2   1 
ATOM   51   C CZ    . TYR A 1 6   ? 46.371 49.084 140.909 1.00 24.95 ? 6   TYR A CZ    1 
ATOM   52   O OH    . TYR A 1 6   ? 46.940 47.844 140.948 1.00 22.59 ? 6   TYR A OH    1 
ATOM   53   N N     . PHE A 1 7   ? 43.858 54.980 138.683 1.00 19.23 ? 7   PHE A N     1 
ATOM   54   C CA    . PHE A 1 7   ? 42.936 55.973 138.281 1.00 21.43 ? 7   PHE A CA    1 
ATOM   55   C C     . PHE A 1 7   ? 41.604 55.383 137.958 1.00 24.44 ? 7   PHE A C     1 
ATOM   56   O O     . PHE A 1 7   ? 41.460 54.472 137.098 1.00 23.86 ? 7   PHE A O     1 
ATOM   57   C CB    . PHE A 1 7   ? 43.401 56.724 137.038 1.00 21.92 ? 7   PHE A CB    1 
ATOM   58   C CG    . PHE A 1 7   ? 42.434 57.812 136.676 1.00 23.92 ? 7   PHE A CG    1 
ATOM   59   C CD1   . PHE A 1 7   ? 41.271 57.506 135.898 1.00 20.64 ? 7   PHE A CD1   1 
ATOM   60   C CD2   . PHE A 1 7   ? 42.628 59.128 137.163 1.00 14.25 ? 7   PHE A CD2   1 
ATOM   61   C CE1   . PHE A 1 7   ? 40.328 58.469 135.650 1.00 22.09 ? 7   PHE A CE1   1 
ATOM   62   C CE2   . PHE A 1 7   ? 41.679 60.064 136.927 1.00 20.74 ? 7   PHE A CE2   1 
ATOM   63   C CZ    . PHE A 1 7   ? 40.512 59.769 136.181 1.00 21.87 ? 7   PHE A CZ    1 
ATOM   64   N N     . PHE A 1 8   ? 40.568 55.923 138.595 1.00 27.67 ? 8   PHE A N     1 
ATOM   65   C CA    . PHE A 1 8   ? 39.248 55.297 138.408 1.00 29.70 ? 8   PHE A CA    1 
ATOM   66   C C     . PHE A 1 8   ? 38.565 55.986 137.292 1.00 30.23 ? 8   PHE A C     1 
ATOM   67   O O     . PHE A 1 8   ? 38.003 57.024 137.509 1.00 30.92 ? 8   PHE A O     1 
ATOM   68   C CB    . PHE A 1 8   ? 38.389 55.481 139.670 1.00 30.60 ? 8   PHE A CB    1 
ATOM   69   C CG    . PHE A 1 8   ? 38.453 54.367 140.579 1.00 29.36 ? 8   PHE A CG    1 
ATOM   70   C CD1   . PHE A 1 8   ? 39.604 54.124 141.301 1.00 33.61 ? 8   PHE A CD1   1 
ATOM   71   C CD2   . PHE A 1 8   ? 37.367 53.521 140.729 1.00 35.09 ? 8   PHE A CD2   1 
ATOM   72   C CE1   . PHE A 1 8   ? 39.701 53.031 142.235 1.00 33.58 ? 8   PHE A CE1   1 
ATOM   73   C CE2   . PHE A 1 8   ? 37.426 52.409 141.606 1.00 35.27 ? 8   PHE A CE2   1 
ATOM   74   C CZ    . PHE A 1 8   ? 38.632 52.161 142.365 1.00 35.41 ? 8   PHE A CZ    1 
ATOM   75   N N     . GLU A 1 9   ? 38.628 55.436 136.094 1.00 32.33 ? 9   GLU A N     1 
ATOM   76   C CA    . GLU A 1 9   ? 38.036 56.063 134.899 1.00 32.61 ? 9   GLU A CA    1 
ATOM   77   C C     . GLU A 1 9   ? 36.625 55.670 134.850 1.00 32.82 ? 9   GLU A C     1 
ATOM   78   O O     . GLU A 1 9   ? 36.312 54.496 134.944 1.00 31.28 ? 9   GLU A O     1 
ATOM   79   C CB    . GLU A 1 9   ? 38.654 55.506 133.649 1.00 32.12 ? 9   GLU A CB    1 
ATOM   80   C CG    . GLU A 1 9   ? 38.429 56.390 132.427 1.00 36.02 ? 9   GLU A CG    1 
ATOM   81   C CD    . GLU A 1 9   ? 38.473 55.638 131.060 1.00 36.46 ? 9   GLU A CD    1 
ATOM   82   O OE1   . GLU A 1 9   ? 39.219 54.655 130.881 1.00 34.50 ? 9   GLU A OE1   1 
ATOM   83   O OE2   . GLU A 1 9   ? 37.737 56.053 130.160 1.00 40.31 ? 9   GLU A OE2   1 
ATOM   84   N N     . HIS A 1 10  ? 35.738 56.633 134.657 1.00 34.54 ? 10  HIS A N     1 
ATOM   85   C CA    . HIS A 1 10  ? 34.350 56.225 134.407 1.00 36.27 ? 10  HIS A CA    1 
ATOM   86   C C     . HIS A 1 10  ? 34.325 55.678 133.002 1.00 36.25 ? 10  HIS A C     1 
ATOM   87   O O     . HIS A 1 10  ? 35.255 55.959 132.207 1.00 37.26 ? 10  HIS A O     1 
ATOM   88   C CB    . HIS A 1 10  ? 33.429 57.380 134.481 1.00 36.76 ? 10  HIS A CB    1 
ATOM   89   C CG    . HIS A 1 10  ? 32.468 57.416 133.337 1.00 43.06 ? 10  HIS A CG    1 
ATOM   90   N ND1   . HIS A 1 10  ? 32.861 57.760 132.052 1.00 45.01 ? 10  HIS A ND1   1 
ATOM   91   C CD2   . HIS A 1 10  ? 31.136 57.140 133.276 1.00 44.07 ? 10  HIS A CD2   1 
ATOM   92   C CE1   . HIS A 1 10  ? 31.811 57.692 131.255 1.00 48.75 ? 10  HIS A CE1   1 
ATOM   93   N NE2   . HIS A 1 10  ? 30.758 57.306 131.970 1.00 49.32 ? 10  HIS A NE2   1 
ATOM   94   N N     . VAL A 1 11  ? 33.312 54.897 132.666 1.00 35.57 ? 11  VAL A N     1 
ATOM   95   C CA    . VAL A 1 11  ? 33.211 54.384 131.302 1.00 35.43 ? 11  VAL A CA    1 
ATOM   96   C C     . VAL A 1 11  ? 31.763 54.281 130.961 1.00 35.77 ? 11  VAL A C     1 
ATOM   97   O O     . VAL A 1 11  ? 31.338 54.705 129.883 1.00 37.98 ? 11  VAL A O     1 
ATOM   98   C CB    . VAL A 1 11  ? 33.772 52.968 131.194 1.00 34.64 ? 11  VAL A CB    1 
ATOM   99   C CG1   . VAL A 1 11  ? 33.215 52.281 129.994 1.00 35.65 ? 11  VAL A CG1   1 
ATOM   100  C CG2   . VAL A 1 11  ? 35.189 52.985 131.059 1.00 35.43 ? 11  VAL A CG2   1 
ATOM   101  N N     . THR A 1 12  ? 31.035 53.629 131.856 1.00 34.05 ? 12  THR A N     1 
ATOM   102  C CA    . THR A 1 12  ? 29.626 53.462 131.802 1.00 34.17 ? 12  THR A CA    1 
ATOM   103  C C     . THR A 1 12  ? 29.245 53.475 133.242 1.00 34.46 ? 12  THR A C     1 
ATOM   104  O O     . THR A 1 12  ? 30.094 53.295 134.122 1.00 33.79 ? 12  THR A O     1 
ATOM   105  C CB    . THR A 1 12  ? 29.095 52.106 131.198 1.00 33.29 ? 12  THR A CB    1 
ATOM   106  O OG1   . THR A 1 12  ? 29.385 50.980 132.027 1.00 33.94 ? 12  THR A OG1   1 
ATOM   107  C CG2   . THR A 1 12  ? 29.586 51.831 129.829 1.00 35.85 ? 12  THR A CG2   1 
ATOM   108  N N     . PRO A 1 13  ? 27.950 53.595 133.503 1.00 35.31 ? 13  PRO A N     1 
ATOM   109  C CA    . PRO A 1 13  ? 27.580 53.687 134.936 1.00 35.53 ? 13  PRO A CA    1 
ATOM   110  C C     . PRO A 1 13  ? 27.795 52.320 135.582 1.00 35.67 ? 13  PRO A C     1 
ATOM   111  O O     . PRO A 1 13  ? 27.805 52.217 136.763 1.00 36.08 ? 13  PRO A O     1 
ATOM   112  C CB    . PRO A 1 13  ? 26.068 54.032 134.934 1.00 36.37 ? 13  PRO A CB    1 
ATOM   113  C CG    . PRO A 1 13  ? 25.561 53.844 133.354 1.00 37.52 ? 13  PRO A CG    1 
ATOM   114  C CD    . PRO A 1 13  ? 26.812 53.513 132.536 1.00 35.46 ? 13  PRO A CD    1 
ATOM   115  N N     . TYR A 1 14  ? 27.955 51.251 134.811 1.00 35.96 ? 14  TYR A N     1 
ATOM   116  C CA    . TYR A 1 14  ? 28.112 49.923 135.431 1.00 34.97 ? 14  TYR A CA    1 
ATOM   117  C C     . TYR A 1 14  ? 29.476 49.332 135.246 1.00 33.02 ? 14  TYR A C     1 
ATOM   118  O O     . TYR A 1 14  ? 29.657 48.168 135.518 1.00 34.35 ? 14  TYR A O     1 
ATOM   119  C CB    . TYR A 1 14  ? 27.078 48.952 134.833 1.00 34.95 ? 14  TYR A CB    1 
ATOM   120  C CG    . TYR A 1 14  ? 25.777 49.616 134.776 1.00 36.55 ? 14  TYR A CG    1 
ATOM   121  C CD1   . TYR A 1 14  ? 25.282 50.134 133.578 1.00 39.94 ? 14  TYR A CD1   1 
ATOM   122  C CD2   . TYR A 1 14  ? 25.057 49.827 135.942 1.00 37.39 ? 14  TYR A CD2   1 
ATOM   123  C CE1   . TYR A 1 14  ? 24.053 50.783 133.539 1.00 40.79 ? 14  TYR A CE1   1 
ATOM   124  C CE2   . TYR A 1 14  ? 23.830 50.475 135.927 1.00 38.27 ? 14  TYR A CE2   1 
ATOM   125  C CZ    . TYR A 1 14  ? 23.338 50.949 134.739 1.00 40.17 ? 14  TYR A CZ    1 
ATOM   126  O OH    . TYR A 1 14  ? 22.126 51.613 134.776 1.00 42.42 ? 14  TYR A OH    1 
ATOM   127  N N     . GLU A 1 15  ? 30.394 50.071 134.667 1.00 30.41 ? 15  GLU A N     1 
ATOM   128  C CA    . GLU A 1 15  ? 31.608 49.445 134.287 1.00 29.32 ? 15  GLU A CA    1 
ATOM   129  C C     . GLU A 1 15  ? 32.512 50.611 134.443 1.00 28.71 ? 15  GLU A C     1 
ATOM   130  O O     . GLU A 1 15  ? 32.215 51.643 133.905 1.00 27.43 ? 15  GLU A O     1 
ATOM   131  C CB    . GLU A 1 15  ? 31.545 48.971 132.845 1.00 29.61 ? 15  GLU A CB    1 
ATOM   132  C CG    . GLU A 1 15  ? 30.878 47.629 132.623 1.00 27.63 ? 15  GLU A CG    1 
ATOM   133  C CD    . GLU A 1 15  ? 29.384 47.640 132.346 1.00 29.06 ? 15  GLU A CD    1 
ATOM   134  O OE1   . GLU A 1 15  ? 28.780 48.694 131.920 1.00 24.52 ? 15  GLU A OE1   1 
ATOM   135  O OE2   . GLU A 1 15  ? 28.808 46.514 132.540 1.00 27.25 ? 15  GLU A OE2   1 
ATOM   136  N N     . THR A 1 16  ? 33.554 50.445 135.274 1.00 26.90 ? 16  THR A N     1 
ATOM   137  C CA    . THR A 1 16  ? 34.573 51.454 135.538 1.00 25.23 ? 16  THR A CA    1 
ATOM   138  C C     . THR A 1 16  ? 35.900 50.841 135.201 1.00 23.60 ? 16  THR A C     1 
ATOM   139  O O     . THR A 1 16  ? 36.119 49.722 135.630 1.00 25.26 ? 16  THR A O     1 
ATOM   140  C CB    . THR A 1 16  ? 34.513 51.858 137.050 1.00 24.75 ? 16  THR A CB    1 
ATOM   141  O OG1   . THR A 1 16  ? 33.282 52.547 137.254 1.00 30.00 ? 16  THR A OG1   1 
ATOM   142  C CG2   . THR A 1 16  ? 35.614 52.714 137.469 1.00 19.20 ? 16  THR A CG2   1 
ATOM   143  N N     . LEU A 1 17  ? 36.752 51.552 134.472 1.00 21.83 ? 17  LEU A N     1 
ATOM   144  C CA    . LEU A 1 17  ? 38.146 51.125 134.272 1.00 24.01 ? 17  LEU A CA    1 
ATOM   145  C C     . LEU A 1 17  ? 39.099 51.694 135.310 1.00 23.82 ? 17  LEU A C     1 
ATOM   146  O O     . LEU A 1 17  ? 39.279 52.948 135.384 1.00 21.35 ? 17  LEU A O     1 
ATOM   147  C CB    . LEU A 1 17  ? 38.743 51.418 132.852 1.00 23.13 ? 17  LEU A CB    1 
ATOM   148  C CG    . LEU A 1 17  ? 38.552 50.380 131.749 1.00 25.74 ? 17  LEU A CG    1 
ATOM   149  C CD1   . LEU A 1 17  ? 38.984 51.013 130.346 1.00 28.92 ? 17  LEU A CD1   1 
ATOM   150  C CD2   . LEU A 1 17  ? 39.307 49.135 132.041 1.00 20.87 ? 17  LEU A CD2   1 
ATOM   151  N N     . VAL A 1 18  ? 39.731 50.761 136.049 1.00 23.13 ? 18  VAL A N     1 
ATOM   152  C CA    . VAL A 1 18  ? 40.614 51.142 137.109 1.00 24.62 ? 18  VAL A CA    1 
ATOM   153  C C     . VAL A 1 18  ? 41.992 50.985 136.498 1.00 25.79 ? 18  VAL A C     1 
ATOM   154  O O     . VAL A 1 18  ? 42.360 49.891 136.053 1.00 28.03 ? 18  VAL A O     1 
ATOM   155  C CB    . VAL A 1 18  ? 40.348 50.208 138.362 1.00 24.39 ? 18  VAL A CB    1 
ATOM   156  C CG1   . VAL A 1 18  ? 41.575 50.090 139.148 1.00 20.49 ? 18  VAL A CG1   1 
ATOM   157  C CG2   . VAL A 1 18  ? 39.188 50.772 139.218 1.00 21.51 ? 18  VAL A CG2   1 
ATOM   158  N N     . ARG A 1 19  ? 42.736 52.051 136.324 1.00 26.94 ? 19  ARG A N     1 
ATOM   159  C CA    . ARG A 1 19  ? 43.956 51.876 135.506 1.00 27.96 ? 19  ARG A CA    1 
ATOM   160  C C     . ARG A 1 19  ? 45.212 52.316 136.186 1.00 28.28 ? 19  ARG A C     1 
ATOM   161  O O     . ARG A 1 19  ? 45.279 53.428 136.735 1.00 26.98 ? 19  ARG A O     1 
ATOM   162  C CB    . ARG A 1 19  ? 43.817 52.465 134.069 1.00 29.96 ? 19  ARG A CB    1 
ATOM   163  C CG    . ARG A 1 19  ? 43.092 53.800 133.934 1.00 32.25 ? 19  ARG A CG    1 
ATOM   164  C CD    . ARG A 1 19  ? 42.150 53.858 132.734 1.00 34.64 ? 19  ARG A CD    1 
ATOM   165  N NE    . ARG A 1 19  ? 42.900 53.944 131.505 1.00 37.97 ? 19  ARG A NE    1 
ATOM   166  C CZ    . ARG A 1 19  ? 42.453 53.736 130.256 1.00 37.68 ? 19  ARG A CZ    1 
ATOM   167  N NH1   . ARG A 1 19  ? 41.181 53.402 129.989 1.00 34.38 ? 19  ARG A NH1   1 
ATOM   168  N NH2   . ARG A 1 19  ? 43.333 53.878 129.256 1.00 33.61 ? 19  ARG A NH2   1 
ATOM   169  N N     . ARG A 1 20  ? 46.207 51.429 136.165 1.00 28.96 ? 20  ARG A N     1 
ATOM   170  C CA    . ARG A 1 20  ? 47.413 51.641 136.961 1.00 30.89 ? 20  ARG A CA    1 
ATOM   171  C C     . ARG A 1 20  ? 48.287 52.839 136.647 1.00 30.88 ? 20  ARG A C     1 
ATOM   172  O O     . ARG A 1 20  ? 48.661 53.015 135.533 1.00 31.68 ? 20  ARG A O     1 
ATOM   173  C CB    . ARG A 1 20  ? 48.322 50.492 136.886 1.00 31.21 ? 20  ARG A CB    1 
ATOM   174  C CG    . ARG A 1 20  ? 49.065 50.461 138.195 1.00 33.94 ? 20  ARG A CG    1 
ATOM   175  C CD    . ARG A 1 20  ? 49.599 49.107 138.372 1.00 43.60 ? 20  ARG A CD    1 
ATOM   176  N NE    . ARG A 1 20  ? 50.921 49.236 138.924 1.00 51.33 ? 20  ARG A NE    1 
ATOM   177  C CZ    . ARG A 1 20  ? 51.196 48.994 140.196 1.00 54.84 ? 20  ARG A CZ    1 
ATOM   178  N NH1   . ARG A 1 20  ? 50.214 48.576 140.995 1.00 56.86 ? 20  ARG A NH1   1 
ATOM   179  N NH2   . ARG A 1 20  ? 52.442 49.158 140.655 1.00 56.52 ? 20  ARG A NH2   1 
ATOM   180  N N     . MET A 1 21  ? 48.607 53.670 137.620 1.00 31.10 ? 21  MET A N     1 
ATOM   181  C CA    . MET A 1 21  ? 49.541 54.751 137.318 1.00 32.49 ? 21  MET A CA    1 
ATOM   182  C C     . MET A 1 21  ? 50.925 54.439 137.860 1.00 33.26 ? 21  MET A C     1 
ATOM   183  O O     . MET A 1 21  ? 51.094 54.109 139.074 1.00 32.91 ? 21  MET A O     1 
ATOM   184  C CB    . MET A 1 21  ? 49.013 56.036 137.934 1.00 31.81 ? 21  MET A CB    1 
ATOM   185  C CG    . MET A 1 21  ? 47.532 56.165 137.785 1.00 32.04 ? 21  MET A CG    1 
ATOM   186  S SD    . MET A 1 21  ? 47.098 57.864 138.105 1.00 33.39 ? 21  MET A SD    1 
ATOM   187  C CE    . MET A 1 21  ? 47.503 57.782 139.833 1.00 35.56 ? 21  MET A CE    1 
ATOM   188  N N     . GLU A 1 22  ? 51.914 54.525 136.987 1.00 33.46 ? 22  GLU A N     1 
ATOM   189  C CA    . GLU A 1 22  ? 53.319 54.376 137.455 1.00 35.24 ? 22  GLU A CA    1 
ATOM   190  C C     . GLU A 1 22  ? 53.847 55.715 137.954 1.00 35.25 ? 22  GLU A C     1 
ATOM   191  O O     . GLU A 1 22  ? 54.799 55.734 138.673 1.00 34.55 ? 22  GLU A O     1 
ATOM   192  C CB    . GLU A 1 22  ? 54.311 53.802 136.404 1.00 34.16 ? 22  GLU A CB    1 
ATOM   193  C CG    . GLU A 1 22  ? 54.116 52.321 135.886 1.00 41.55 ? 22  GLU A CG    1 
ATOM   194  C CD    . GLU A 1 22  ? 53.977 51.192 136.973 1.00 49.95 ? 22  GLU A CD    1 
ATOM   195  O OE1   . GLU A 1 22  ? 54.915 51.073 137.834 1.00 50.68 ? 22  GLU A OE1   1 
ATOM   196  O OE2   . GLU A 1 22  ? 52.938 50.425 136.932 1.00 51.15 ? 22  GLU A OE2   1 
ATOM   197  N N     . ARG A 1 23  ? 53.243 56.829 137.533 1.00 36.39 ? 23  ARG A N     1 
ATOM   198  C CA    . ARG A 1 23  ? 53.747 58.148 137.898 1.00 37.80 ? 23  ARG A CA    1 
ATOM   199  C C     . ARG A 1 23  ? 52.846 59.319 137.428 1.00 37.20 ? 23  ARG A C     1 
ATOM   200  O O     . ARG A 1 23  ? 52.379 59.330 136.284 1.00 36.18 ? 23  ARG A O     1 
ATOM   201  C CB    . ARG A 1 23  ? 55.176 58.337 137.382 1.00 38.60 ? 23  ARG A CB    1 
ATOM   202  C CG    . ARG A 1 23  ? 56.050 59.204 138.324 1.00 43.87 ? 23  ARG A CG    1 
ATOM   203  C CD    . ARG A 1 23  ? 56.656 60.454 137.635 1.00 48.78 ? 23  ARG A CD    1 
ATOM   204  N NE    . ARG A 1 23  ? 56.948 60.272 136.217 1.00 51.80 ? 23  ARG A NE    1 
ATOM   205  C CZ    . ARG A 1 23  ? 57.417 61.238 135.402 1.00 54.48 ? 23  ARG A CZ    1 
ATOM   206  N NH1   . ARG A 1 23  ? 57.665 62.480 135.876 1.00 50.18 ? 23  ARG A NH1   1 
ATOM   207  N NH2   . ARG A 1 23  ? 57.620 60.952 134.089 1.00 54.00 ? 23  ARG A NH2   1 
ATOM   208  N N     . VAL A 1 24  ? 52.639 60.310 138.299 1.00 36.17 ? 24  VAL A N     1 
ATOM   209  C CA    . VAL A 1 24  ? 51.765 61.352 137.896 1.00 35.97 ? 24  VAL A CA    1 
ATOM   210  C C     . VAL A 1 24  ? 52.488 62.518 137.296 1.00 35.04 ? 24  VAL A C     1 
ATOM   211  O O     . VAL A 1 24  ? 52.541 63.538 137.935 1.00 35.87 ? 24  VAL A O     1 
ATOM   212  C CB    . VAL A 1 24  ? 50.808 61.885 139.081 1.00 37.42 ? 24  VAL A CB    1 
ATOM   213  C CG1   . VAL A 1 24  ? 49.882 63.052 138.606 1.00 34.34 ? 24  VAL A CG1   1 
ATOM   214  C CG2   . VAL A 1 24  ? 49.956 60.775 139.670 1.00 36.27 ? 24  VAL A CG2   1 
ATOM   215  N N     . ILE A 1 25  ? 52.924 62.433 136.043 1.00 34.52 ? 25  ILE A N     1 
ATOM   216  C CA    . ILE A 1 25  ? 53.490 63.632 135.318 1.00 33.83 ? 25  ILE A CA    1 
ATOM   217  C C     . ILE A 1 25  ? 52.836 64.884 135.700 1.00 35.10 ? 25  ILE A C     1 
ATOM   218  O O     . ILE A 1 25  ? 53.512 65.754 136.086 1.00 36.76 ? 25  ILE A O     1 
ATOM   219  C CB    . ILE A 1 25  ? 53.310 63.777 133.708 1.00 33.79 ? 25  ILE A CB    1 
ATOM   220  C CG1   . ILE A 1 25  ? 53.651 62.558 132.858 1.00 28.55 ? 25  ILE A CG1   1 
ATOM   221  C CG2   . ILE A 1 25  ? 53.964 65.086 133.213 1.00 33.02 ? 25  ILE A CG2   1 
ATOM   222  C CD1   . ILE A 1 25  ? 54.460 61.563 133.592 1.00 24.23 ? 25  ILE A CD1   1 
ATOM   223  N N     . ALA A 1 26  ? 51.542 65.046 135.452 1.00 37.29 ? 26  ALA A N     1 
ATOM   224  C CA    . ALA A 1 26  ? 50.855 66.352 135.761 1.00 39.94 ? 26  ALA A CA    1 
ATOM   225  C C     . ALA A 1 26  ? 49.402 66.140 135.983 1.00 41.30 ? 26  ALA A C     1 
ATOM   226  O O     . ALA A 1 26  ? 48.777 65.243 135.332 1.00 42.38 ? 26  ALA A O     1 
ATOM   227  C CB    . ALA A 1 26  ? 50.999 67.399 134.658 1.00 38.34 ? 26  ALA A CB    1 
ATOM   228  N N     . SER A 1 27  ? 48.868 66.955 136.889 1.00 41.89 ? 27  SER A N     1 
ATOM   229  C CA    . SER A 1 27  ? 47.449 66.983 137.151 1.00 43.03 ? 27  SER A CA    1 
ATOM   230  C C     . SER A 1 27  ? 47.092 68.314 137.766 1.00 43.08 ? 27  SER A C     1 
ATOM   231  O O     . SER A 1 27  ? 47.818 68.791 138.619 1.00 41.20 ? 27  SER A O     1 
ATOM   232  C CB    . SER A 1 27  ? 47.052 65.892 138.133 1.00 42.50 ? 27  SER A CB    1 
ATOM   233  O OG    . SER A 1 27  ? 47.058 66.423 139.455 1.00 46.07 ? 27  SER A OG    1 
ATOM   234  N N     . GLY A 1 28  ? 45.939 68.853 137.367 1.00 44.00 ? 28  GLY A N     1 
ATOM   235  C CA    . GLY A 1 28  ? 45.358 70.047 137.993 1.00 45.88 ? 28  GLY A CA    1 
ATOM   236  C C     . GLY A 1 28  ? 43.975 70.410 137.506 1.00 47.04 ? 28  GLY A C     1 
ATOM   237  O O     . GLY A 1 28  ? 43.207 69.501 137.093 1.00 47.75 ? 28  GLY A O     1 
ATOM   238  N N     . LYS A 1 29  ? 43.686 71.723 137.529 1.00 47.25 ? 29  LYS A N     1 
ATOM   239  C CA    . LYS A 1 29  ? 42.335 72.320 137.287 1.00 48.44 ? 29  LYS A CA    1 
ATOM   240  C C     . LYS A 1 29  ? 42.457 73.489 136.271 1.00 47.94 ? 29  LYS A C     1 
ATOM   241  O O     . LYS A 1 29  ? 43.334 74.309 136.400 1.00 46.85 ? 29  LYS A O     1 
ATOM   242  C CB    . LYS A 1 29  ? 41.784 72.868 138.648 1.00 49.47 ? 29  LYS A CB    1 
ATOM   243  C CG    . LYS A 1 29  ? 40.344 72.406 139.131 1.00 51.74 ? 29  LYS A CG    1 
ATOM   244  C CD    . LYS A 1 29  ? 39.277 73.567 139.027 1.00 53.98 ? 29  LYS A CD    1 
ATOM   245  C CE    . LYS A 1 29  ? 37.829 73.027 139.006 1.00 54.17 ? 29  LYS A CE    1 
ATOM   246  N NZ    . LYS A 1 29  ? 37.450 71.941 137.944 1.00 50.77 ? 29  LYS A NZ    1 
ATOM   247  N N     . THR A 1 30  ? 41.614 73.595 135.251 1.00 48.62 ? 30  THR A N     1 
ATOM   248  C CA    . THR A 1 30  ? 41.611 74.878 134.421 1.00 47.68 ? 30  THR A CA    1 
ATOM   249  C C     . THR A 1 30  ? 40.291 75.554 134.699 1.00 47.44 ? 30  THR A C     1 
ATOM   250  O O     . THR A 1 30  ? 39.475 75.009 135.436 1.00 48.96 ? 30  THR A O     1 
ATOM   251  C CB    . THR A 1 30  ? 41.816 74.658 132.868 1.00 46.94 ? 30  THR A CB    1 
ATOM   252  O OG1   . THR A 1 30  ? 40.581 74.221 132.267 1.00 47.15 ? 30  THR A OG1   1 
ATOM   253  C CG2   . THR A 1 30  ? 42.891 73.607 132.608 1.00 44.81 ? 30  THR A CG2   1 
ATOM   254  N N     . PRO A 1 31  ? 40.046 76.725 134.129 1.00 47.16 ? 31  PRO A N     1 
ATOM   255  C CA    . PRO A 1 31  ? 38.719 77.187 134.405 1.00 47.42 ? 31  PRO A CA    1 
ATOM   256  C C     . PRO A 1 31  ? 37.651 76.516 133.544 1.00 48.39 ? 31  PRO A C     1 
ATOM   257  O O     . PRO A 1 31  ? 36.736 77.220 133.085 1.00 50.49 ? 31  PRO A O     1 
ATOM   258  C CB    . PRO A 1 31  ? 38.815 78.663 134.026 1.00 47.41 ? 31  PRO A CB    1 
ATOM   259  C CG    . PRO A 1 31  ? 39.708 78.693 132.893 1.00 46.57 ? 31  PRO A CG    1 
ATOM   260  C CD    . PRO A 1 31  ? 40.788 77.690 133.300 1.00 47.99 ? 31  PRO A CD    1 
ATOM   261  N N     . PHE A 1 32  ? 37.762 75.216 133.251 1.00 47.81 ? 32  PHE A N     1 
ATOM   262  C CA    . PHE A 1 32  ? 36.811 74.575 132.300 1.00 46.61 ? 32  PHE A CA    1 
ATOM   263  C C     . PHE A 1 32  ? 36.842 73.102 132.447 1.00 45.48 ? 32  PHE A C     1 
ATOM   264  O O     . PHE A 1 32  ? 35.959 72.453 131.932 1.00 45.44 ? 32  PHE A O     1 
ATOM   265  C CB    . PHE A 1 32  ? 37.177 74.698 130.836 1.00 46.39 ? 32  PHE A CB    1 
ATOM   266  C CG    . PHE A 1 32  ? 37.016 76.017 130.251 1.00 47.65 ? 32  PHE A CG    1 
ATOM   267  C CD1   . PHE A 1 32  ? 35.761 76.456 129.827 1.00 47.74 ? 32  PHE A CD1   1 
ATOM   268  C CD2   . PHE A 1 32  ? 38.145 76.791 129.971 1.00 49.20 ? 32  PHE A CD2   1 
ATOM   269  C CE1   . PHE A 1 32  ? 35.612 77.687 129.228 1.00 43.97 ? 32  PHE A CE1   1 
ATOM   270  C CE2   . PHE A 1 32  ? 38.011 78.022 129.357 1.00 47.49 ? 32  PHE A CE2   1 
ATOM   271  C CZ    . PHE A 1 32  ? 36.723 78.470 128.985 1.00 45.63 ? 32  PHE A CZ    1 
ATOM   272  N N     . GLN A 1 33  ? 37.905 72.552 133.015 1.00 44.40 ? 33  GLN A N     1 
ATOM   273  C CA    . GLN A 1 33  ? 37.911 71.106 133.261 1.00 43.13 ? 33  GLN A CA    1 
ATOM   274  C C     . GLN A 1 33  ? 39.070 70.614 134.057 1.00 42.58 ? 33  GLN A C     1 
ATOM   275  O O     . GLN A 1 33  ? 40.032 71.324 134.300 1.00 43.83 ? 33  GLN A O     1 
ATOM   276  C CB    . GLN A 1 33  ? 37.826 70.342 131.938 1.00 42.77 ? 33  GLN A CB    1 
ATOM   277  C CG    . GLN A 1 33  ? 39.089 70.367 131.154 1.00 41.46 ? 33  GLN A CG    1 
ATOM   278  C CD    . GLN A 1 33  ? 38.830 70.293 129.719 1.00 36.58 ? 33  GLN A CD    1 
ATOM   279  O OE1   . GLN A 1 33  ? 39.234 71.181 128.965 1.00 37.54 ? 33  GLN A OE1   1 
ATOM   280  N NE2   . GLN A 1 33  ? 38.116 69.261 129.306 1.00 36.51 ? 33  GLN A NE2   1 
ATOM   281  N N     . ASP A 1 34  ? 38.992 69.379 134.466 1.00 42.79 ? 34  ASP A N     1 
ATOM   282  C CA    . ASP A 1 34  ? 40.071 68.790 135.216 1.00 43.31 ? 34  ASP A CA    1 
ATOM   283  C C     . ASP A 1 34  ? 40.975 68.011 134.306 1.00 43.38 ? 34  ASP A C     1 
ATOM   284  O O     . ASP A 1 34  ? 40.488 67.434 133.333 1.00 44.45 ? 34  ASP A O     1 
ATOM   285  C CB    . ASP A 1 34  ? 39.506 67.895 136.291 1.00 43.99 ? 34  ASP A CB    1 
ATOM   286  C CG    . ASP A 1 34  ? 39.032 68.690 137.509 1.00 46.62 ? 34  ASP A CG    1 
ATOM   287  O OD1   . ASP A 1 34  ? 39.268 69.945 137.489 1.00 49.50 ? 34  ASP A OD1   1 
ATOM   288  O OD2   . ASP A 1 34  ? 38.484 68.060 138.470 1.00 45.77 ? 34  ASP A OD2   1 
ATOM   289  N N     . TYR A 1 35  ? 42.301 68.038 134.569 1.00 43.11 ? 35  TYR A N     1 
ATOM   290  C CA    . TYR A 1 35  ? 43.232 67.141 133.872 1.00 40.51 ? 35  TYR A CA    1 
ATOM   291  C C     . TYR A 1 35  ? 44.050 66.196 134.775 1.00 39.94 ? 35  TYR A C     1 
ATOM   292  O O     . TYR A 1 35  ? 44.239 66.423 135.984 1.00 41.35 ? 35  TYR A O     1 
ATOM   293  C CB    . TYR A 1 35  ? 44.098 67.920 132.917 1.00 40.45 ? 35  TYR A CB    1 
ATOM   294  C CG    . TYR A 1 35  ? 45.051 68.883 133.527 1.00 39.56 ? 35  TYR A CG    1 
ATOM   295  C CD1   . TYR A 1 35  ? 46.349 68.472 133.937 1.00 40.16 ? 35  TYR A CD1   1 
ATOM   296  C CD2   . TYR A 1 35  ? 44.711 70.207 133.669 1.00 40.26 ? 35  TYR A CD2   1 
ATOM   297  C CE1   . TYR A 1 35  ? 47.246 69.381 134.534 1.00 36.96 ? 35  TYR A CE1   1 
ATOM   298  C CE2   . TYR A 1 35  ? 45.623 71.127 134.252 1.00 37.16 ? 35  TYR A CE2   1 
ATOM   299  C CZ    . TYR A 1 35  ? 46.862 70.693 134.676 1.00 37.75 ? 35  TYR A CZ    1 
ATOM   300  O OH    . TYR A 1 35  ? 47.719 71.616 135.217 1.00 39.73 ? 35  TYR A OH    1 
ATOM   301  N N     . PHE A 1 36  ? 44.467 65.082 134.216 1.00 38.15 ? 36  PHE A N     1 
ATOM   302  C CA    . PHE A 1 36  ? 45.439 64.233 134.877 1.00 36.68 ? 36  PHE A CA    1 
ATOM   303  C C     . PHE A 1 36  ? 46.176 63.654 133.729 1.00 34.18 ? 36  PHE A C     1 
ATOM   304  O O     . PHE A 1 36  ? 45.550 63.340 132.717 1.00 31.52 ? 36  PHE A O     1 
ATOM   305  C CB    . PHE A 1 36  ? 44.819 63.116 135.696 1.00 37.24 ? 36  PHE A CB    1 
ATOM   306  C CG    . PHE A 1 36  ? 43.787 63.583 136.685 1.00 41.62 ? 36  PHE A CG    1 
ATOM   307  C CD1   . PHE A 1 36  ? 44.142 63.880 138.011 1.00 43.08 ? 36  PHE A CD1   1 
ATOM   308  C CD2   . PHE A 1 36  ? 42.408 63.675 136.308 1.00 43.51 ? 36  PHE A CD2   1 
ATOM   309  C CE1   . PHE A 1 36  ? 43.088 64.268 138.980 1.00 45.13 ? 36  PHE A CE1   1 
ATOM   310  C CE2   . PHE A 1 36  ? 41.399 64.077 137.240 1.00 42.74 ? 36  PHE A CE2   1 
ATOM   311  C CZ    . PHE A 1 36  ? 41.754 64.373 138.585 1.00 41.10 ? 36  PHE A CZ    1 
ATOM   312  N N     . LEU A 1 37  ? 47.499 63.609 133.885 1.00 31.65 ? 37  LEU A N     1 
ATOM   313  C CA    . LEU A 1 37  ? 48.352 63.107 132.888 1.00 30.75 ? 37  LEU A CA    1 
ATOM   314  C C     . LEU A 1 37  ? 49.239 62.200 133.623 1.00 30.41 ? 37  LEU A C     1 
ATOM   315  O O     . LEU A 1 37  ? 50.010 62.650 134.475 1.00 31.83 ? 37  LEU A O     1 
ATOM   316  C CB    . LEU A 1 37  ? 49.179 64.218 132.258 1.00 29.46 ? 37  LEU A CB    1 
ATOM   317  C CG    . LEU A 1 37  ? 50.020 63.580 131.153 1.00 29.71 ? 37  LEU A CG    1 
ATOM   318  C CD1   . LEU A 1 37  ? 49.102 63.420 129.971 1.00 28.37 ? 37  LEU A CD1   1 
ATOM   319  C CD2   . LEU A 1 37  ? 51.209 64.466 130.726 1.00 35.62 ? 37  LEU A CD2   1 
ATOM   320  N N     . PHE A 1 38  ? 49.192 60.934 133.303 1.00 28.51 ? 38  PHE A N     1 
ATOM   321  C CA    . PHE A 1 38  ? 49.979 60.054 134.078 1.00 28.31 ? 38  PHE A CA    1 
ATOM   322  C C     . PHE A 1 38  ? 50.652 59.076 133.236 1.00 29.57 ? 38  PHE A C     1 
ATOM   323  O O     . PHE A 1 38  ? 50.310 58.949 132.063 1.00 28.20 ? 38  PHE A O     1 
ATOM   324  C CB    . PHE A 1 38  ? 49.168 59.331 135.163 1.00 27.77 ? 38  PHE A CB    1 
ATOM   325  C CG    . PHE A 1 38  ? 48.024 58.515 134.670 1.00 27.98 ? 38  PHE A CG    1 
ATOM   326  C CD1   . PHE A 1 38  ? 46.701 59.053 134.669 1.00 28.01 ? 38  PHE A CD1   1 
ATOM   327  C CD2   . PHE A 1 38  ? 48.211 57.213 134.285 1.00 27.53 ? 38  PHE A CD2   1 
ATOM   328  C CE1   . PHE A 1 38  ? 45.640 58.346 134.278 1.00 19.58 ? 38  PHE A CE1   1 
ATOM   329  C CE2   . PHE A 1 38  ? 47.142 56.469 133.896 1.00 20.78 ? 38  PHE A CE2   1 
ATOM   330  C CZ    . PHE A 1 38  ? 45.857 57.047 133.915 1.00 24.62 ? 38  PHE A CZ    1 
ATOM   331  N N     . GLU A 1 39  ? 51.564 58.323 133.861 1.00 30.93 ? 39  GLU A N     1 
ATOM   332  C CA    . GLU A 1 39  ? 52.329 57.332 133.154 1.00 32.14 ? 39  GLU A CA    1 
ATOM   333  C C     . GLU A 1 39  ? 51.780 55.915 133.171 1.00 31.68 ? 39  GLU A C     1 
ATOM   334  O O     . GLU A 1 39  ? 52.094 55.099 133.985 1.00 30.99 ? 39  GLU A O     1 
ATOM   335  C CB    . GLU A 1 39  ? 53.732 57.385 133.699 1.00 33.21 ? 39  GLU A CB    1 
ATOM   336  C CG    . GLU A 1 39  ? 54.648 58.152 132.843 1.00 38.71 ? 39  GLU A CG    1 
ATOM   337  C CD    . GLU A 1 39  ? 55.143 57.341 131.636 1.00 46.14 ? 39  GLU A CD    1 
ATOM   338  O OE1   . GLU A 1 39  ? 55.667 57.966 130.650 1.00 44.49 ? 39  GLU A OE1   1 
ATOM   339  O OE2   . GLU A 1 39  ? 55.014 56.076 131.719 1.00 48.19 ? 39  GLU A OE2   1 
ATOM   340  N N     . SER A 1 40  ? 50.974 55.570 132.211 1.00 33.44 ? 40  SER A N     1 
ATOM   341  C CA    . SER A 1 40  ? 50.665 54.132 132.007 1.00 34.16 ? 40  SER A CA    1 
ATOM   342  C C     . SER A 1 40  ? 51.901 53.333 131.521 1.00 33.88 ? 40  SER A C     1 
ATOM   343  O O     . SER A 1 40  ? 52.696 53.840 130.747 1.00 31.41 ? 40  SER A O     1 
ATOM   344  C CB    . SER A 1 40  ? 49.545 53.990 130.975 1.00 34.01 ? 40  SER A CB    1 
ATOM   345  O OG    . SER A 1 40  ? 49.315 52.614 130.722 1.00 38.31 ? 40  SER A OG    1 
ATOM   346  N N     . LYS A 1 41  ? 52.029 52.090 131.978 1.00 34.69 ? 41  LYS A N     1 
ATOM   347  C CA    . LYS A 1 41  ? 53.124 51.198 131.597 1.00 34.85 ? 41  LYS A CA    1 
ATOM   348  C C     . LYS A 1 41  ? 52.707 50.587 130.260 1.00 34.23 ? 41  LYS A C     1 
ATOM   349  O O     . LYS A 1 41  ? 53.504 50.544 129.331 1.00 34.01 ? 41  LYS A O     1 
ATOM   350  C CB    . LYS A 1 41  ? 53.304 50.077 132.657 1.00 35.38 ? 41  LYS A CB    1 
ATOM   351  C CG    . LYS A 1 41  ? 54.604 49.192 132.616 1.00 36.33 ? 41  LYS A CG    1 
ATOM   352  C CD    . LYS A 1 41  ? 54.988 48.491 133.984 1.00 36.75 ? 41  LYS A CD    1 
ATOM   353  C CE    . LYS A 1 41  ? 56.518 47.967 133.979 1.00 41.18 ? 41  LYS A CE    1 
ATOM   354  N NZ    . LYS A 1 41  ? 57.206 47.531 135.359 1.00 39.97 ? 41  LYS A NZ    1 
ATOM   355  N N     . GLY A 1 42  ? 51.459 50.087 130.226 1.00 32.91 ? 42  GLY A N     1 
ATOM   356  C CA    . GLY A 1 42  ? 50.702 49.670 129.043 1.00 31.01 ? 42  GLY A CA    1 
ATOM   357  C C     . GLY A 1 42  ? 50.765 50.634 127.850 1.00 31.12 ? 42  GLY A C     1 
ATOM   358  O O     . GLY A 1 42  ? 51.401 50.235 126.824 1.00 28.77 ? 42  GLY A O     1 
ATOM   359  N N     . PHE A 1 43  ? 50.202 51.879 128.009 1.00 30.21 ? 43  PHE A N     1 
ATOM   360  C CA    . PHE A 1 43  ? 50.017 52.907 126.922 1.00 30.23 ? 43  PHE A CA    1 
ATOM   361  C C     . PHE A 1 43  ? 50.866 54.151 127.108 1.00 31.24 ? 43  PHE A C     1 
ATOM   362  O O     . PHE A 1 43  ? 50.580 55.230 126.486 1.00 33.11 ? 43  PHE A O     1 
ATOM   363  C CB    . PHE A 1 43  ? 48.544 53.389 126.756 1.00 28.67 ? 43  PHE A CB    1 
ATOM   364  C CG    . PHE A 1 43  ? 47.528 52.276 126.606 1.00 26.81 ? 43  PHE A CG    1 
ATOM   365  C CD1   . PHE A 1 43  ? 47.218 51.768 125.354 1.00 26.84 ? 43  PHE A CD1   1 
ATOM   366  C CD2   . PHE A 1 43  ? 46.866 51.772 127.708 1.00 23.97 ? 43  PHE A CD2   1 
ATOM   367  C CE1   . PHE A 1 43  ? 46.293 50.745 125.171 1.00 24.11 ? 43  PHE A CE1   1 
ATOM   368  C CE2   . PHE A 1 43  ? 45.967 50.706 127.586 1.00 25.91 ? 43  PHE A CE2   1 
ATOM   369  C CZ    . PHE A 1 43  ? 45.659 50.199 126.295 1.00 28.66 ? 43  PHE A CZ    1 
ATOM   370  N N     . GLY A 1 44  ? 51.870 54.095 127.989 1.00 30.15 ? 44  GLY A N     1 
ATOM   371  C CA    . GLY A 1 44  ? 52.630 55.321 128.241 1.00 26.44 ? 44  GLY A CA    1 
ATOM   372  C C     . GLY A 1 44  ? 51.767 56.408 128.852 1.00 26.03 ? 44  GLY A C     1 
ATOM   373  O O     . GLY A 1 44  ? 50.861 56.152 129.577 1.00 25.16 ? 44  GLY A O     1 
ATOM   374  N N     . LYS A 1 45  ? 52.049 57.654 128.535 1.00 25.14 ? 45  LYS A N     1 
ATOM   375  C CA    . LYS A 1 45  ? 51.376 58.671 129.151 1.00 23.86 ? 45  LYS A CA    1 
ATOM   376  C C     . LYS A 1 45  ? 49.925 58.516 128.775 1.00 24.87 ? 45  LYS A C     1 
ATOM   377  O O     . LYS A 1 45  ? 49.647 58.097 127.646 1.00 26.25 ? 45  LYS A O     1 
ATOM   378  C CB    . LYS A 1 45  ? 51.893 60.010 128.637 1.00 23.67 ? 45  LYS A CB    1 
ATOM   379  C CG    . LYS A 1 45  ? 53.401 60.202 128.696 1.00 19.79 ? 45  LYS A CG    1 
ATOM   380  C CD    . LYS A 1 45  ? 53.728 61.681 128.524 1.00 17.24 ? 45  LYS A CD    1 
ATOM   381  C CE    . LYS A 1 45  ? 55.208 62.005 128.349 1.00 19.98 ? 45  LYS A CE    1 
ATOM   382  N NZ    . LYS A 1 45  ? 55.385 63.509 127.976 1.00 19.99 ? 45  LYS A NZ    1 
ATOM   383  N N     . VAL A 1 46  ? 49.027 58.875 129.714 1.00 24.12 ? 46  VAL A N     1 
ATOM   384  C CA    . VAL A 1 46  ? 47.577 58.991 129.538 1.00 23.75 ? 46  VAL A CA    1 
ATOM   385  C C     . VAL A 1 46  ? 47.089 60.380 129.975 1.00 26.42 ? 46  VAL A C     1 
ATOM   386  O O     . VAL A 1 46  ? 47.701 60.981 130.827 1.00 29.23 ? 46  VAL A O     1 
ATOM   387  C CB    . VAL A 1 46  ? 46.843 57.939 130.384 1.00 22.19 ? 46  VAL A CB    1 
ATOM   388  C CG1   . VAL A 1 46  ? 45.267 58.017 130.167 1.00 21.27 ? 46  VAL A CG1   1 
ATOM   389  C CG2   . VAL A 1 46  ? 47.447 56.500 130.092 1.00 12.82 ? 46  VAL A CG2   1 
ATOM   390  N N     . LEU A 1 47  ? 46.022 60.891 129.390 1.00 27.01 ? 47  LEU A N     1 
ATOM   391  C CA    . LEU A 1 47  ? 45.516 62.206 129.687 1.00 28.26 ? 47  LEU A CA    1 
ATOM   392  C C     . LEU A 1 47  ? 44.078 61.977 129.977 1.00 30.16 ? 47  LEU A C     1 
ATOM   393  O O     . LEU A 1 47  ? 43.314 61.646 129.052 1.00 32.31 ? 47  LEU A O     1 
ATOM   394  C CB    . LEU A 1 47  ? 45.575 63.133 128.480 1.00 26.53 ? 47  LEU A CB    1 
ATOM   395  C CG    . LEU A 1 47  ? 45.482 64.671 128.506 1.00 26.23 ? 47  LEU A CG    1 
ATOM   396  C CD1   . LEU A 1 47  ? 44.414 65.386 127.586 1.00 23.41 ? 47  LEU A CD1   1 
ATOM   397  C CD2   . LEU A 1 47  ? 45.659 65.391 129.930 1.00 26.47 ? 47  LEU A CD2   1 
ATOM   398  N N     . ILE A 1 48  ? 43.674 62.122 131.243 1.00 30.85 ? 48  ILE A N     1 
ATOM   399  C CA    . ILE A 1 48  ? 42.252 62.276 131.531 1.00 29.36 ? 48  ILE A CA    1 
ATOM   400  C C     . ILE A 1 48  ? 41.766 63.731 131.422 1.00 29.33 ? 48  ILE A C     1 
ATOM   401  O O     . ILE A 1 48  ? 42.358 64.626 132.031 1.00 28.67 ? 48  ILE A O     1 
ATOM   402  C CB    . ILE A 1 48  ? 41.871 61.799 132.925 1.00 28.74 ? 48  ILE A CB    1 
ATOM   403  C CG1   . ILE A 1 48  ? 42.597 60.477 133.291 1.00 29.93 ? 48  ILE A CG1   1 
ATOM   404  C CG2   . ILE A 1 48  ? 40.344 61.753 133.017 1.00 25.95 ? 48  ILE A CG2   1 
ATOM   405  C CD1   . ILE A 1 48  ? 42.319 59.279 132.453 1.00 31.79 ? 48  ILE A CD1   1 
ATOM   406  N N     . LEU A 1 49  ? 40.672 63.966 130.684 1.00 28.68 ? 49  LEU A N     1 
ATOM   407  C CA    . LEU A 1 49  ? 39.877 65.142 131.002 1.00 29.22 ? 49  LEU A CA    1 
ATOM   408  C C     . LEU A 1 49  ? 38.621 64.804 131.780 1.00 31.03 ? 49  LEU A C     1 
ATOM   409  O O     . LEU A 1 49  ? 37.893 63.839 131.462 1.00 31.76 ? 49  LEU A O     1 
ATOM   410  C CB    . LEU A 1 49  ? 39.541 65.933 129.786 1.00 28.97 ? 49  LEU A CB    1 
ATOM   411  C CG    . LEU A 1 49  ? 40.743 66.465 129.031 1.00 28.55 ? 49  LEU A CG    1 
ATOM   412  C CD1   . LEU A 1 49  ? 39.996 67.074 127.872 1.00 30.91 ? 49  LEU A CD1   1 
ATOM   413  C CD2   . LEU A 1 49  ? 41.484 67.563 129.815 1.00 20.71 ? 49  LEU A CD2   1 
ATOM   414  N N     . ASP A 1 50  ? 38.402 65.593 132.838 1.00 32.58 ? 50  ASP A N     1 
ATOM   415  C CA    . ASP A 1 50  ? 37.412 65.324 133.911 1.00 34.09 ? 50  ASP A CA    1 
ATOM   416  C C     . ASP A 1 50  ? 37.382 63.946 134.500 1.00 33.47 ? 50  ASP A C     1 
ATOM   417  O O     . ASP A 1 50  ? 38.110 63.628 135.404 1.00 34.15 ? 50  ASP A O     1 
ATOM   418  C CB    . ASP A 1 50  ? 36.009 65.782 133.520 1.00 34.59 ? 50  ASP A CB    1 
ATOM   419  C CG    . ASP A 1 50  ? 35.961 67.279 133.267 1.00 39.32 ? 50  ASP A CG    1 
ATOM   420  O OD1   . ASP A 1 50  ? 36.866 67.967 133.764 1.00 41.03 ? 50  ASP A OD1   1 
ATOM   421  O OD2   . ASP A 1 50  ? 35.068 67.808 132.530 1.00 51.24 ? 50  ASP A OD2   1 
ATOM   422  N N     . LYS A 1 51  ? 36.505 63.114 134.027 1.00 33.90 ? 51  LYS A N     1 
ATOM   423  C CA    . LYS A 1 51  ? 36.539 61.735 134.511 1.00 34.03 ? 51  LYS A CA    1 
ATOM   424  C C     . LYS A 1 51  ? 36.706 60.723 133.350 1.00 31.60 ? 51  LYS A C     1 
ATOM   425  O O     . LYS A 1 51  ? 36.194 59.625 133.431 1.00 32.75 ? 51  LYS A O     1 
ATOM   426  C CB    . LYS A 1 51  ? 35.220 61.449 135.214 1.00 34.25 ? 51  LYS A CB    1 
ATOM   427  C CG    . LYS A 1 51  ? 34.067 61.280 134.150 1.00 36.56 ? 51  LYS A CG    1 
ATOM   428  C CD    . LYS A 1 51  ? 32.731 60.837 134.690 1.00 38.07 ? 51  LYS A CD    1 
ATOM   429  C CE    . LYS A 1 51  ? 32.183 61.705 135.867 1.00 40.71 ? 51  LYS A CE    1 
ATOM   430  N NZ    . LYS A 1 51  ? 31.850 63.130 135.545 1.00 44.07 ? 51  LYS A NZ    1 
ATOM   431  N N     . ASP A 1 52  ? 37.328 61.103 132.240 1.00 30.39 ? 52  ASP A N     1 
ATOM   432  C CA    . ASP A 1 52  ? 37.274 60.245 131.007 1.00 29.22 ? 52  ASP A CA    1 
ATOM   433  C C     . ASP A 1 52  ? 38.634 60.279 130.317 1.00 27.64 ? 52  ASP A C     1 
ATOM   434  O O     . ASP A 1 52  ? 39.200 61.335 130.109 1.00 28.86 ? 52  ASP A O     1 
ATOM   435  C CB    . ASP A 1 52  ? 36.165 60.739 130.041 1.00 28.03 ? 52  ASP A CB    1 
ATOM   436  C CG    . ASP A 1 52  ? 34.730 60.409 130.536 1.00 30.05 ? 52  ASP A CG    1 
ATOM   437  O OD1   . ASP A 1 52  ? 34.274 59.238 130.376 1.00 34.00 ? 52  ASP A OD1   1 
ATOM   438  O OD2   . ASP A 1 52  ? 34.016 61.309 131.085 1.00 27.83 ? 52  ASP A OD2   1 
ATOM   439  N N     . VAL A 1 53  ? 39.176 59.147 129.947 1.00 26.42 ? 53  VAL A N     1 
ATOM   440  C CA    . VAL A 1 53  ? 40.350 59.240 129.153 1.00 26.20 ? 53  VAL A CA    1 
ATOM   441  C C     . VAL A 1 53  ? 40.091 59.951 127.849 1.00 25.15 ? 53  VAL A C     1 
ATOM   442  O O     . VAL A 1 53  ? 39.063 59.733 127.203 1.00 23.27 ? 53  VAL A O     1 
ATOM   443  C CB    . VAL A 1 53  ? 40.843 57.976 128.709 1.00 27.17 ? 53  VAL A CB    1 
ATOM   444  C CG1   . VAL A 1 53  ? 42.183 58.257 128.075 1.00 27.44 ? 53  VAL A CG1   1 
ATOM   445  C CG2   . VAL A 1 53  ? 40.998 57.047 129.897 1.00 32.68 ? 53  VAL A CG2   1 
ATOM   446  N N     . GLN A 1 54  ? 41.096 60.737 127.507 1.00 23.06 ? 54  GLN A N     1 
ATOM   447  C CA    . GLN A 1 54  ? 41.194 61.574 126.370 1.00 23.28 ? 54  GLN A CA    1 
ATOM   448  C C     . GLN A 1 54  ? 42.154 60.929 125.314 1.00 22.79 ? 54  GLN A C     1 
ATOM   449  O O     . GLN A 1 54  ? 41.780 60.732 124.217 1.00 21.73 ? 54  GLN A O     1 
ATOM   450  C CB    . GLN A 1 54  ? 41.735 62.875 126.890 1.00 23.15 ? 54  GLN A CB    1 
ATOM   451  C CG    . GLN A 1 54  ? 41.579 63.972 126.026 1.00 30.06 ? 54  GLN A CG    1 
ATOM   452  C CD    . GLN A 1 54  ? 40.168 64.257 125.595 1.00 36.38 ? 54  GLN A CD    1 
ATOM   453  O OE1   . GLN A 1 54  ? 39.988 64.626 124.455 1.00 44.66 ? 54  GLN A OE1   1 
ATOM   454  N NE2   . GLN A 1 54  ? 39.180 64.162 126.494 1.00 37.77 ? 54  GLN A NE2   1 
ATOM   455  N N     . SER A 1 55  ? 43.395 60.590 125.668 1.00 24.33 ? 55  SER A N     1 
ATOM   456  C CA    . SER A 1 55  ? 44.275 59.837 124.798 1.00 24.10 ? 55  SER A CA    1 
ATOM   457  C C     . SER A 1 55  ? 45.229 59.089 125.596 1.00 25.37 ? 55  SER A C     1 
ATOM   458  O O     . SER A 1 55  ? 45.354 59.304 126.803 1.00 26.88 ? 55  SER A O     1 
ATOM   459  C CB    . SER A 1 55  ? 45.079 60.744 123.863 1.00 24.29 ? 55  SER A CB    1 
ATOM   460  O OG    . SER A 1 55  ? 44.572 60.624 122.579 1.00 21.39 ? 55  SER A OG    1 
ATOM   461  N N     . THR A 1 56  ? 45.938 58.203 124.908 1.00 27.07 ? 56  THR A N     1 
ATOM   462  C CA    . THR A 1 56  ? 47.045 57.470 125.493 1.00 28.46 ? 56  THR A CA    1 
ATOM   463  C C     . THR A 1 56  ? 48.094 57.603 124.421 1.00 30.16 ? 56  THR A C     1 
ATOM   464  O O     . THR A 1 56  ? 47.761 57.689 123.245 1.00 32.49 ? 56  THR A O     1 
ATOM   465  C CB    . THR A 1 56  ? 46.854 55.981 125.595 1.00 28.48 ? 56  THR A CB    1 
ATOM   466  O OG1   . THR A 1 56  ? 47.265 55.398 124.365 1.00 27.33 ? 56  THR A OG1   1 
ATOM   467  C CG2   . THR A 1 56  ? 45.424 55.562 125.969 1.00 25.08 ? 56  THR A CG2   1 
ATOM   468  N N     . GLU A 1 57  ? 49.350 57.553 124.822 1.00 29.71 ? 57  GLU A N     1 
ATOM   469  C CA    . GLU A 1 57  ? 50.382 57.891 123.934 1.00 29.54 ? 57  GLU A CA    1 
ATOM   470  C C     . GLU A 1 57  ? 50.623 56.824 122.974 1.00 28.81 ? 57  GLU A C     1 
ATOM   471  O O     . GLU A 1 57  ? 50.789 57.163 121.845 1.00 28.90 ? 57  GLU A O     1 
ATOM   472  C CB    . GLU A 1 57  ? 51.694 58.304 124.661 1.00 30.54 ? 57  GLU A CB    1 
ATOM   473  C CG    . GLU A 1 57  ? 52.997 57.704 124.102 1.00 29.58 ? 57  GLU A CG    1 
ATOM   474  C CD    . GLU A 1 57  ? 54.176 57.763 125.072 1.00 30.72 ? 57  GLU A CD    1 
ATOM   475  O OE1   . GLU A 1 57  ? 53.919 57.701 126.337 1.00 25.04 ? 57  GLU A OE1   1 
ATOM   476  O OE2   . GLU A 1 57  ? 55.323 57.860 124.522 1.00 27.46 ? 57  GLU A OE2   1 
ATOM   477  N N     . ARG A 1 58  ? 50.690 55.554 123.369 1.00 28.52 ? 58  ARG A N     1 
ATOM   478  C CA    . ARG A 1 58  ? 50.979 54.554 122.343 1.00 30.33 ? 58  ARG A CA    1 
ATOM   479  C C     . ARG A 1 58  ? 49.769 54.191 121.364 1.00 29.74 ? 58  ARG A C     1 
ATOM   480  O O     . ARG A 1 58  ? 49.881 53.322 120.534 1.00 30.39 ? 58  ARG A O     1 
ATOM   481  C CB    . ARG A 1 58  ? 51.761 53.362 122.914 1.00 31.39 ? 58  ARG A CB    1 
ATOM   482  C CG    . ARG A 1 58  ? 52.668 53.717 124.168 1.00 32.54 ? 58  ARG A CG    1 
ATOM   483  C CD    . ARG A 1 58  ? 54.028 52.868 124.360 1.00 31.95 ? 58  ARG A CD    1 
ATOM   484  N NE    . ARG A 1 58  ? 54.841 53.352 125.537 1.00 37.94 ? 58  ARG A NE    1 
ATOM   485  C CZ    . ARG A 1 58  ? 54.975 52.776 126.770 1.00 38.76 ? 58  ARG A CZ    1 
ATOM   486  N NH1   . ARG A 1 58  ? 54.437 51.588 127.043 1.00 42.06 ? 58  ARG A NH1   1 
ATOM   487  N NH2   . ARG A 1 58  ? 55.695 53.360 127.748 1.00 38.11 ? 58  ARG A NH2   1 
ATOM   488  N N     . ASP A 1 59  ? 48.643 54.892 121.418 1.00 28.62 ? 59  ASP A N     1 
ATOM   489  C CA    . ASP A 1 59  ? 47.498 54.422 120.654 1.00 27.80 ? 59  ASP A CA    1 
ATOM   490  C C     . ASP A 1 59  ? 46.784 55.539 119.983 1.00 26.03 ? 59  ASP A C     1 
ATOM   491  O O     . ASP A 1 59  ? 45.888 55.277 119.177 1.00 23.95 ? 59  ASP A O     1 
ATOM   492  C CB    . ASP A 1 59  ? 46.497 53.589 121.509 1.00 28.83 ? 59  ASP A CB    1 
ATOM   493  C CG    . ASP A 1 59  ? 45.205 54.325 121.832 1.00 31.95 ? 59  ASP A CG    1 
ATOM   494  O OD1   . ASP A 1 59  ? 44.141 53.668 121.714 1.00 30.67 ? 59  ASP A OD1   1 
ATOM   495  O OD2   . ASP A 1 59  ? 45.251 55.529 122.207 1.00 33.63 ? 59  ASP A OD2   1 
ATOM   496  N N     . GLU A 1 60  ? 47.184 56.767 120.358 1.00 23.56 ? 60  GLU A N     1 
ATOM   497  C CA    . GLU A 1 60  ? 46.569 57.954 119.851 1.00 20.60 ? 60  GLU A CA    1 
ATOM   498  C C     . GLU A 1 60  ? 46.670 57.961 118.293 1.00 19.23 ? 60  GLU A C     1 
ATOM   499  O O     . GLU A 1 60  ? 45.846 58.496 117.595 1.00 18.05 ? 60  GLU A O     1 
ATOM   500  C CB    . GLU A 1 60  ? 47.245 59.126 120.482 1.00 20.01 ? 60  GLU A CB    1 
ATOM   501  C CG    . GLU A 1 60  ? 48.699 59.066 120.178 1.00 21.81 ? 60  GLU A CG    1 
ATOM   502  C CD    . GLU A 1 60  ? 49.172 60.081 119.068 1.00 25.84 ? 60  GLU A CD    1 
ATOM   503  O OE1   . GLU A 1 60  ? 48.376 60.757 118.339 1.00 21.09 ? 60  GLU A OE1   1 
ATOM   504  O OE2   . GLU A 1 60  ? 50.400 60.260 119.009 1.00 27.52 ? 60  GLU A OE2   1 
ATOM   505  N N     . TYR A 1 61  ? 47.690 57.348 117.757 1.00 18.68 ? 61  TYR A N     1 
ATOM   506  C CA    . TYR A 1 61  ? 47.931 57.390 116.311 1.00 17.57 ? 61  TYR A CA    1 
ATOM   507  C C     . TYR A 1 61  ? 46.632 56.786 115.635 1.00 19.41 ? 61  TYR A C     1 
ATOM   508  O O     . TYR A 1 61  ? 46.049 57.372 114.573 1.00 17.28 ? 61  TYR A O     1 
ATOM   509  C CB    . TYR A 1 61  ? 49.260 56.665 115.933 1.00 15.06 ? 61  TYR A CB    1 
ATOM   510  C CG    . TYR A 1 61  ? 49.206 55.092 115.949 1.00 13.36 ? 61  TYR A CG    1 
ATOM   511  C CD1   . TYR A 1 61  ? 49.544 54.362 117.114 1.00 13.38 ? 61  TYR A CD1   1 
ATOM   512  C CD2   . TYR A 1 61  ? 48.892 54.368 114.815 1.00 14.13 ? 61  TYR A CD2   1 
ATOM   513  C CE1   . TYR A 1 61  ? 49.559 52.955 117.178 1.00 11.98 ? 61  TYR A CE1   1 
ATOM   514  C CE2   . TYR A 1 61  ? 48.866 52.881 114.812 1.00 14.45 ? 61  TYR A CE2   1 
ATOM   515  C CZ    . TYR A 1 61  ? 49.166 52.200 116.014 1.00 16.35 ? 61  TYR A CZ    1 
ATOM   516  O OH    . TYR A 1 61  ? 49.132 50.800 116.076 1.00 13.77 ? 61  TYR A OH    1 
ATOM   517  N N     . ILE A 1 62  ? 46.147 55.681 116.263 1.00 18.45 ? 62  ILE A N     1 
ATOM   518  C CA    . ILE A 1 62  ? 44.953 54.996 115.735 1.00 19.24 ? 62  ILE A CA    1 
ATOM   519  C C     . ILE A 1 62  ? 43.758 55.982 115.750 1.00 22.27 ? 62  ILE A C     1 
ATOM   520  O O     . ILE A 1 62  ? 43.109 56.264 114.677 1.00 25.03 ? 62  ILE A O     1 
ATOM   521  C CB    . ILE A 1 62  ? 44.586 53.670 116.451 1.00 18.43 ? 62  ILE A CB    1 
ATOM   522  C CG1   . ILE A 1 62  ? 45.677 52.606 116.305 1.00 16.34 ? 62  ILE A CG1   1 
ATOM   523  C CG2   . ILE A 1 62  ? 43.279 53.231 115.921 1.00 16.74 ? 62  ILE A CG2   1 
ATOM   524  C CD1   . ILE A 1 62  ? 45.742 51.531 117.510 1.00 17.13 ? 62  ILE A CD1   1 
ATOM   525  N N     . TYR A 1 63  ? 43.509 56.609 116.901 1.00 21.07 ? 63  TYR A N     1 
ATOM   526  C CA    . TYR A 1 63  ? 42.430 57.559 116.912 1.00 21.71 ? 63  TYR A CA    1 
ATOM   527  C C     . TYR A 1 63  ? 42.659 58.715 116.047 1.00 22.59 ? 63  TYR A C     1 
ATOM   528  O O     . TYR A 1 63  ? 41.733 59.101 115.323 1.00 26.04 ? 63  TYR A O     1 
ATOM   529  C CB    . TYR A 1 63  ? 42.167 58.094 118.303 1.00 22.35 ? 63  TYR A CB    1 
ATOM   530  C CG    . TYR A 1 63  ? 41.125 59.145 118.435 1.00 16.18 ? 63  TYR A CG    1 
ATOM   531  C CD1   . TYR A 1 63  ? 41.425 60.434 118.318 1.00 11.91 ? 63  TYR A CD1   1 
ATOM   532  C CD2   . TYR A 1 63  ? 39.882 58.834 118.848 1.00 22.02 ? 63  TYR A CD2   1 
ATOM   533  C CE1   . TYR A 1 63  ? 40.506 61.430 118.477 1.00 13.41 ? 63  TYR A CE1   1 
ATOM   534  C CE2   . TYR A 1 63  ? 38.923 59.833 119.060 1.00 22.82 ? 63  TYR A CE2   1 
ATOM   535  C CZ    . TYR A 1 63  ? 39.234 61.150 118.864 1.00 22.30 ? 63  TYR A CZ    1 
ATOM   536  O OH    . TYR A 1 63  ? 38.229 62.183 119.101 1.00 25.20 ? 63  TYR A OH    1 
ATOM   537  N N     . HIS A 1 64  ? 43.816 59.353 116.128 1.00 22.34 ? 64  HIS A N     1 
ATOM   538  C CA    . HIS A 1 64  ? 43.986 60.528 115.227 1.00 21.94 ? 64  HIS A CA    1 
ATOM   539  C C     . HIS A 1 64  ? 43.967 60.310 113.716 1.00 19.79 ? 64  HIS A C     1 
ATOM   540  O O     . HIS A 1 64  ? 43.627 61.177 112.996 1.00 19.93 ? 64  HIS A O     1 
ATOM   541  C CB    . HIS A 1 64  ? 45.141 61.386 115.637 1.00 22.58 ? 64  HIS A CB    1 
ATOM   542  C CG    . HIS A 1 64  ? 44.997 61.878 117.026 1.00 18.49 ? 64  HIS A CG    1 
ATOM   543  N ND1   . HIS A 1 64  ? 45.673 61.306 118.062 1.00 18.23 ? 64  HIS A ND1   1 
ATOM   544  C CD2   . HIS A 1 64  ? 44.253 62.887 117.537 1.00 18.85 ? 64  HIS A CD2   1 
ATOM   545  C CE1   . HIS A 1 64  ? 45.351 61.945 119.172 1.00 29.84 ? 64  HIS A CE1   1 
ATOM   546  N NE2   . HIS A 1 64  ? 44.490 62.913 118.877 1.00 28.47 ? 64  HIS A NE2   1 
ATOM   547  N N     . GLU A 1 65  ? 44.284 59.113 113.299 1.00 19.06 ? 65  GLU A N     1 
ATOM   548  C CA    . GLU A 1 65  ? 44.356 58.753 111.900 1.00 18.06 ? 65  GLU A CA    1 
ATOM   549  C C     . GLU A 1 65  ? 42.942 58.571 111.497 1.00 19.94 ? 65  GLU A C     1 
ATOM   550  O O     . GLU A 1 65  ? 42.496 59.226 110.508 1.00 22.21 ? 65  GLU A O     1 
ATOM   551  C CB    . GLU A 1 65  ? 45.156 57.476 111.690 1.00 12.83 ? 65  GLU A CB    1 
ATOM   552  C CG    . GLU A 1 65  ? 46.598 57.849 111.277 1.00 14.24 ? 65  GLU A CG    1 
ATOM   553  C CD    . GLU A 1 65  ? 47.478 56.617 111.076 1.00 21.88 ? 65  GLU A CD    1 
ATOM   554  O OE1   . GLU A 1 65  ? 46.906 55.579 110.544 1.00 13.28 ? 65  GLU A OE1   1 
ATOM   555  O OE2   . GLU A 1 65  ? 48.682 56.683 111.557 1.00 18.66 ? 65  GLU A OE2   1 
ATOM   556  N N     . THR A 1 66  ? 42.224 57.749 112.293 1.00 19.14 ? 66  THR A N     1 
ATOM   557  C CA    . THR A 1 66  ? 40.824 57.443 112.042 1.00 17.97 ? 66  THR A CA    1 
ATOM   558  C C     . THR A 1 66  ? 39.984 58.728 112.059 1.00 19.32 ? 66  THR A C     1 
ATOM   559  O O     . THR A 1 66  ? 38.956 58.782 111.402 1.00 22.32 ? 66  THR A O     1 
ATOM   560  C CB    . THR A 1 66  ? 40.258 56.493 113.098 1.00 17.75 ? 66  THR A CB    1 
ATOM   561  O OG1   . THR A 1 66  ? 41.070 55.321 113.256 1.00 14.58 ? 66  THR A OG1   1 
ATOM   562  C CG2   . THR A 1 66  ? 38.875 56.125 112.777 1.00 16.37 ? 66  THR A CG2   1 
ATOM   563  N N     . LEU A 1 67  ? 40.369 59.774 112.768 1.00 18.87 ? 67  LEU A N     1 
ATOM   564  C CA    . LEU A 1 67  ? 39.516 60.989 112.740 1.00 21.76 ? 67  LEU A CA    1 
ATOM   565  C C     . LEU A 1 67  ? 39.752 61.961 111.539 1.00 24.19 ? 67  LEU A C     1 
ATOM   566  O O     . LEU A 1 67  ? 38.864 62.764 111.149 1.00 22.48 ? 67  LEU A O     1 
ATOM   567  C CB    . LEU A 1 67  ? 39.712 61.785 114.057 1.00 21.80 ? 67  LEU A CB    1 
ATOM   568  C CG    . LEU A 1 67  ? 39.297 63.232 114.282 1.00 17.60 ? 67  LEU A CG    1 
ATOM   569  C CD1   . LEU A 1 67  ? 37.855 63.326 114.444 1.00 16.96 ? 67  LEU A CD1   1 
ATOM   570  C CD2   . LEU A 1 67  ? 39.956 63.755 115.515 1.00 22.55 ? 67  LEU A CD2   1 
ATOM   571  N N     . VAL A 1 68  ? 40.983 61.934 111.011 1.00 26.29 ? 68  VAL A N     1 
ATOM   572  C CA    . VAL A 1 68  ? 41.366 62.989 110.145 1.00 28.69 ? 68  VAL A CA    1 
ATOM   573  C C     . VAL A 1 68  ? 41.276 62.496 108.750 1.00 29.53 ? 68  VAL A C     1 
ATOM   574  O O     . VAL A 1 68  ? 40.509 63.033 107.953 1.00 28.69 ? 68  VAL A O     1 
ATOM   575  C CB    . VAL A 1 68  ? 42.770 63.343 110.412 1.00 29.76 ? 68  VAL A CB    1 
ATOM   576  C CG1   . VAL A 1 68  ? 43.121 64.633 109.682 1.00 29.68 ? 68  VAL A CG1   1 
ATOM   577  C CG2   . VAL A 1 68  ? 42.884 63.562 111.887 1.00 31.97 ? 68  VAL A CG2   1 
ATOM   578  N N     . HIS A 1 69  ? 42.067 61.451 108.489 1.00 29.09 ? 69  HIS A N     1 
ATOM   579  C CA    . HIS A 1 69  ? 42.360 61.064 107.154 1.00 29.04 ? 69  HIS A CA    1 
ATOM   580  C C     . HIS A 1 69  ? 41.151 60.614 106.358 1.00 30.59 ? 69  HIS A C     1 
ATOM   581  O O     . HIS A 1 69  ? 41.225 60.623 105.141 1.00 30.57 ? 69  HIS A O     1 
ATOM   582  C CB    . HIS A 1 69  ? 43.390 59.984 107.173 1.00 26.54 ? 69  HIS A CB    1 
ATOM   583  C CG    . HIS A 1 69  ? 44.685 60.445 107.768 1.00 30.96 ? 69  HIS A CG    1 
ATOM   584  N ND1   . HIS A 1 69  ? 45.480 61.422 107.174 1.00 27.52 ? 69  HIS A ND1   1 
ATOM   585  C CD2   . HIS A 1 69  ? 45.322 60.080 108.917 1.00 24.68 ? 69  HIS A CD2   1 
ATOM   586  C CE1   . HIS A 1 69  ? 46.548 61.619 107.927 1.00 25.93 ? 69  HIS A CE1   1 
ATOM   587  N NE2   . HIS A 1 69  ? 46.486 60.805 108.977 1.00 19.14 ? 69  HIS A NE2   1 
ATOM   588  N N     . PRO A 1 70  ? 40.083 60.098 107.030 1.00 30.74 ? 70  PRO A N     1 
ATOM   589  C CA    . PRO A 1 70  ? 39.052 59.721 106.146 1.00 29.17 ? 70  PRO A CA    1 
ATOM   590  C C     . PRO A 1 70  ? 38.453 61.008 105.599 1.00 29.61 ? 70  PRO A C     1 
ATOM   591  O O     . PRO A 1 70  ? 38.007 61.071 104.424 1.00 31.45 ? 70  PRO A O     1 
ATOM   592  C CB    . PRO A 1 70  ? 38.127 58.934 107.053 1.00 29.86 ? 70  PRO A CB    1 
ATOM   593  C CG    . PRO A 1 70  ? 38.981 58.504 108.261 1.00 29.47 ? 70  PRO A CG    1 
ATOM   594  C CD    . PRO A 1 70  ? 39.800 59.689 108.435 1.00 30.12 ? 70  PRO A CD    1 
ATOM   595  N N     . ALA A 1 71  ? 38.446 62.076 106.370 1.00 28.43 ? 71  ALA A N     1 
ATOM   596  C CA    . ALA A 1 71  ? 37.901 63.306 105.766 1.00 27.81 ? 71  ALA A CA    1 
ATOM   597  C C     . ALA A 1 71  ? 38.826 63.952 104.730 1.00 26.76 ? 71  ALA A C     1 
ATOM   598  O O     . ALA A 1 71  ? 38.360 64.324 103.679 1.00 26.56 ? 71  ALA A O     1 
ATOM   599  C CB    . ALA A 1 71  ? 37.511 64.290 106.778 1.00 27.91 ? 71  ALA A CB    1 
ATOM   600  N N     . MET A 1 72  ? 40.112 64.082 105.034 1.00 25.62 ? 72  MET A N     1 
ATOM   601  C CA    . MET A 1 72  ? 41.062 64.614 104.121 1.00 25.35 ? 72  MET A CA    1 
ATOM   602  C C     . MET A 1 72  ? 41.197 63.684 102.946 1.00 27.19 ? 72  MET A C     1 
ATOM   603  O O     . MET A 1 72  ? 41.227 64.115 101.796 1.00 29.86 ? 72  MET A O     1 
ATOM   604  C CB    . MET A 1 72  ? 42.379 64.695 104.779 1.00 25.86 ? 72  MET A CB    1 
ATOM   605  C CG    . MET A 1 72  ? 42.450 65.542 106.057 1.00 28.54 ? 72  MET A CG    1 
ATOM   606  S SD    . MET A 1 72  ? 42.185 67.272 105.671 1.00 34.31 ? 72  MET A SD    1 
ATOM   607  C CE    . MET A 1 72  ? 43.837 67.708 105.141 1.00 25.61 ? 72  MET A CE    1 
ATOM   608  N N     . LEU A 1 73  ? 41.295 62.398 103.150 1.00 26.46 ? 73  LEU A N     1 
ATOM   609  C CA    . LEU A 1 73  ? 41.408 61.589 101.986 1.00 26.73 ? 73  LEU A CA    1 
ATOM   610  C C     . LEU A 1 73  ? 40.206 61.732 101.045 1.00 28.62 ? 73  LEU A C     1 
ATOM   611  O O     . LEU A 1 73  ? 40.325 61.546 99.854  1.00 28.82 ? 73  LEU A O     1 
ATOM   612  C CB    . LEU A 1 73  ? 41.567 60.133 102.373 1.00 24.96 ? 73  LEU A CB    1 
ATOM   613  C CG    . LEU A 1 73  ? 43.052 60.021 102.685 1.00 25.07 ? 73  LEU A CG    1 
ATOM   614  C CD1   . LEU A 1 73  ? 43.453 58.652 103.369 1.00 15.82 ? 73  LEU A CD1   1 
ATOM   615  C CD2   . LEU A 1 73  ? 43.869 60.380 101.336 1.00 18.49 ? 73  LEU A CD2   1 
ATOM   616  N N     . THR A 1 74  ? 39.039 62.037 101.575 1.00 30.78 ? 74  THR A N     1 
ATOM   617  C CA    . THR A 1 74  ? 37.822 61.965 100.786 1.00 31.98 ? 74  THR A CA    1 
ATOM   618  C C     . THR A 1 74  ? 37.569 63.308 100.079 1.00 33.94 ? 74  THR A C     1 
ATOM   619  O O     . THR A 1 74  ? 36.738 63.378 99.191  1.00 34.72 ? 74  THR A O     1 
ATOM   620  C CB    . THR A 1 74  ? 36.646 61.440 101.645 1.00 31.32 ? 74  THR A CB    1 
ATOM   621  O OG1   . THR A 1 74  ? 35.953 60.404 100.944 1.00 36.09 ? 74  THR A OG1   1 
ATOM   622  C CG2   . THR A 1 74  ? 35.662 62.517 102.085 1.00 30.56 ? 74  THR A CG2   1 
ATOM   623  N N     . HIS A 1 75  ? 38.348 64.344 100.416 1.00 35.20 ? 75  HIS A N     1 
ATOM   624  C CA    . HIS A 1 75  ? 38.391 65.605 99.633  1.00 37.51 ? 75  HIS A CA    1 
ATOM   625  C C     . HIS A 1 75  ? 39.456 65.609 98.517  1.00 38.44 ? 75  HIS A C     1 
ATOM   626  O O     . HIS A 1 75  ? 40.639 65.334 98.812  1.00 38.11 ? 75  HIS A O     1 
ATOM   627  C CB    . HIS A 1 75  ? 38.770 66.700 100.572 1.00 37.07 ? 75  HIS A CB    1 
ATOM   628  C CG    . HIS A 1 75  ? 38.503 68.059 100.062 1.00 38.65 ? 75  HIS A CG    1 
ATOM   629  N ND1   . HIS A 1 75  ? 39.359 68.704 99.192  1.00 40.62 ? 75  HIS A ND1   1 
ATOM   630  C CD2   . HIS A 1 75  ? 37.494 68.927 100.325 1.00 40.67 ? 75  HIS A CD2   1 
ATOM   631  C CE1   . HIS A 1 75  ? 38.879 69.909 98.934  1.00 41.08 ? 75  HIS A CE1   1 
ATOM   632  N NE2   . HIS A 1 75  ? 37.744 70.065 99.595  1.00 41.24 ? 75  HIS A NE2   1 
ATOM   633  N N     . PRO A 1 76  ? 39.087 66.035 97.263  1.00 39.48 ? 76  PRO A N     1 
ATOM   634  C CA    . PRO A 1 76  ? 40.074 65.923 96.117  1.00 39.81 ? 76  PRO A CA    1 
ATOM   635  C C     . PRO A 1 76  ? 41.363 66.788 96.400  1.00 41.73 ? 76  PRO A C     1 
ATOM   636  O O     . PRO A 1 76  ? 42.501 66.294 96.268  1.00 40.96 ? 76  PRO A O     1 
ATOM   637  C CB    . PRO A 1 76  ? 39.273 66.399 94.892  1.00 38.80 ? 76  PRO A CB    1 
ATOM   638  C CG    . PRO A 1 76  ? 38.176 67.277 95.491  1.00 38.12 ? 76  PRO A CG    1 
ATOM   639  C CD    . PRO A 1 76  ? 37.859 66.766 96.861  1.00 39.30 ? 76  PRO A CD    1 
ATOM   640  N N     . GLU A 1 77  ? 41.187 68.015 96.919  1.00 43.06 ? 77  GLU A N     1 
ATOM   641  C CA    . GLU A 1 77  ? 42.344 68.846 97.171  1.00 43.72 ? 77  GLU A CA    1 
ATOM   642  C C     . GLU A 1 77  ? 42.160 69.792 98.366  1.00 42.88 ? 77  GLU A C     1 
ATOM   643  O O     . GLU A 1 77  ? 41.935 71.017 98.207  1.00 42.97 ? 77  GLU A O     1 
ATOM   644  C CB    . GLU A 1 77  ? 42.633 69.605 95.892  1.00 45.17 ? 77  GLU A CB    1 
ATOM   645  C CG    . GLU A 1 77  ? 44.071 70.144 95.746  1.00 49.13 ? 77  GLU A CG    1 
ATOM   646  C CD    . GLU A 1 77  ? 44.051 71.308 94.846  1.00 52.63 ? 77  GLU A CD    1 
ATOM   647  O OE1   . GLU A 1 77  ? 44.732 72.323 95.170  1.00 55.00 ? 77  GLU A OE1   1 
ATOM   648  O OE2   . GLU A 1 77  ? 43.263 71.198 93.858  1.00 53.16 ? 77  GLU A OE2   1 
ATOM   649  N N     . PRO A 1 78  ? 42.219 69.230 99.594  1.00 41.86 ? 78  PRO A N     1 
ATOM   650  C CA    . PRO A 1 78  ? 42.126 70.033 100.862 1.00 39.30 ? 78  PRO A CA    1 
ATOM   651  C C     . PRO A 1 78  ? 43.153 71.136 101.093 1.00 38.02 ? 78  PRO A C     1 
ATOM   652  O O     . PRO A 1 78  ? 44.264 70.783 101.484 1.00 37.57 ? 78  PRO A O     1 
ATOM   653  C CB    . PRO A 1 78  ? 42.417 68.998 101.913 1.00 39.27 ? 78  PRO A CB    1 
ATOM   654  C CG    . PRO A 1 78  ? 42.990 67.772 101.182 1.00 39.51 ? 78  PRO A CG    1 
ATOM   655  C CD    . PRO A 1 78  ? 42.312 67.783 99.877  1.00 41.07 ? 78  PRO A CD    1 
ATOM   656  N N     . LYS A 1 79  ? 42.797 72.428 100.939 1.00 36.81 ? 79  LYS A N     1 
ATOM   657  C CA    . LYS A 1 79  ? 43.760 73.540 101.164 1.00 37.34 ? 79  LYS A CA    1 
ATOM   658  C C     . LYS A 1 79  ? 43.710 74.266 102.523 1.00 36.81 ? 79  LYS A C     1 
ATOM   659  O O     . LYS A 1 79  ? 44.795 74.587 103.095 1.00 36.07 ? 79  LYS A O     1 
ATOM   660  C CB    . LYS A 1 79  ? 43.716 74.651 100.030 1.00 37.21 ? 79  LYS A CB    1 
ATOM   661  C CG    . LYS A 1 79  ? 43.903 74.219 98.524  1.00 38.26 ? 79  LYS A CG    1 
ATOM   662  C CD    . LYS A 1 79  ? 44.474 75.402 97.541  1.00 40.42 ? 79  LYS A CD    1 
ATOM   663  C CE    . LYS A 1 79  ? 43.822 75.385 96.070  1.00 40.91 ? 79  LYS A CE    1 
ATOM   664  N NZ    . LYS A 1 79  ? 42.352 75.104 96.236  1.00 42.53 ? 79  LYS A NZ    1 
ATOM   665  N N     . ARG A 1 80  ? 42.487 74.646 102.939 1.00 35.88 ? 80  ARG A N     1 
ATOM   666  C CA    . ARG A 1 80  ? 42.217 75.304 104.236 1.00 37.32 ? 80  ARG A CA    1 
ATOM   667  C C     . ARG A 1 80  ? 41.397 74.350 105.162 1.00 36.52 ? 80  ARG A C     1 
ATOM   668  O O     . ARG A 1 80  ? 40.303 73.777 104.806 1.00 35.51 ? 80  ARG A O     1 
ATOM   669  C CB    . ARG A 1 80  ? 41.408 76.646 104.135 1.00 38.98 ? 80  ARG A CB    1 
ATOM   670  C CG    . ARG A 1 80  ? 41.764 77.797 103.114 1.00 39.74 ? 80  ARG A CG    1 
ATOM   671  C CD    . ARG A 1 80  ? 41.000 79.158 103.427 1.00 41.56 ? 80  ARG A CD    1 
ATOM   672  N NE    . ARG A 1 80  ? 41.801 80.142 104.244 1.00 56.42 ? 80  ARG A NE    1 
ATOM   673  C CZ    . ARG A 1 80  ? 42.894 80.846 103.825 1.00 59.51 ? 80  ARG A CZ    1 
ATOM   674  N NH1   . ARG A 1 80  ? 43.380 80.727 102.569 1.00 60.64 ? 80  ARG A NH1   1 
ATOM   675  N NH2   . ARG A 1 80  ? 43.534 81.682 104.667 1.00 61.68 ? 80  ARG A NH2   1 
ATOM   676  N N     . VAL A 1 81  ? 41.909 74.178 106.371 1.00 35.28 ? 81  VAL A N     1 
ATOM   677  C CA    . VAL A 1 81  ? 41.277 73.247 107.249 1.00 32.54 ? 81  VAL A CA    1 
ATOM   678  C C     . VAL A 1 81  ? 41.006 73.859 108.598 1.00 31.61 ? 81  VAL A C     1 
ATOM   679  O O     . VAL A 1 81  ? 41.869 74.540 109.133 1.00 32.95 ? 81  VAL A O     1 
ATOM   680  C CB    . VAL A 1 81  ? 42.149 72.040 107.415 1.00 32.30 ? 81  VAL A CB    1 
ATOM   681  C CG1   . VAL A 1 81  ? 41.821 71.366 108.797 1.00 35.42 ? 81  VAL A CG1   1 
ATOM   682  C CG2   . VAL A 1 81  ? 41.917 71.095 106.306 1.00 28.99 ? 81  VAL A CG2   1 
ATOM   683  N N     . LEU A 1 82  ? 39.844 73.574 109.178 1.00 30.26 ? 82  LEU A N     1 
ATOM   684  C CA    . LEU A 1 82  ? 39.553 73.994 110.536 1.00 30.65 ? 82  LEU A CA    1 
ATOM   685  C C     . LEU A 1 82  ? 39.404 72.781 111.443 1.00 31.04 ? 82  LEU A C     1 
ATOM   686  O O     . LEU A 1 82  ? 38.832 71.787 111.060 1.00 31.40 ? 82  LEU A O     1 
ATOM   687  C CB    . LEU A 1 82  ? 38.293 74.850 110.564 1.00 30.52 ? 82  LEU A CB    1 
ATOM   688  C CG    . LEU A 1 82  ? 37.706 75.183 111.925 1.00 32.77 ? 82  LEU A CG    1 
ATOM   689  C CD1   . LEU A 1 82  ? 38.570 76.149 112.771 1.00 33.72 ? 82  LEU A CD1   1 
ATOM   690  C CD2   . LEU A 1 82  ? 36.315 75.675 111.730 1.00 30.33 ? 82  LEU A CD2   1 
ATOM   691  N N     . ILE A 1 83  ? 39.996 72.866 112.618 1.00 30.74 ? 83  ILE A N     1 
ATOM   692  C CA    . ILE A 1 83  ? 39.969 71.823 113.558 1.00 30.88 ? 83  ILE A CA    1 
ATOM   693  C C     . ILE A 1 83  ? 39.331 72.394 114.799 1.00 33.29 ? 83  ILE A C     1 
ATOM   694  O O     . ILE A 1 83  ? 39.897 73.226 115.493 1.00 34.62 ? 83  ILE A O     1 
ATOM   695  C CB    . ILE A 1 83  ? 41.353 71.421 113.925 1.00 30.32 ? 83  ILE A CB    1 
ATOM   696  C CG1   . ILE A 1 83  ? 42.012 70.730 112.775 1.00 27.78 ? 83  ILE A CG1   1 
ATOM   697  C CG2   . ILE A 1 83  ? 41.308 70.475 115.033 1.00 30.55 ? 83  ILE A CG2   1 
ATOM   698  C CD1   . ILE A 1 83  ? 43.401 70.444 112.991 1.00 24.89 ? 83  ILE A CD1   1 
ATOM   699  N N     . VAL A 1 84  ? 38.128 71.934 115.093 1.00 35.21 ? 84  VAL A N     1 
ATOM   700  C CA    . VAL A 1 84  ? 37.379 72.419 116.236 1.00 34.39 ? 84  VAL A CA    1 
ATOM   701  C C     . VAL A 1 84  ? 37.635 71.496 117.377 1.00 34.92 ? 84  VAL A C     1 
ATOM   702  O O     . VAL A 1 84  ? 37.322 70.292 117.295 1.00 35.37 ? 84  VAL A O     1 
ATOM   703  C CB    . VAL A 1 84  ? 35.925 72.303 115.969 1.00 33.77 ? 84  VAL A CB    1 
ATOM   704  C CG1   . VAL A 1 84  ? 35.172 72.389 117.336 1.00 35.22 ? 84  VAL A CG1   1 
ATOM   705  C CG2   . VAL A 1 84  ? 35.489 73.375 114.974 1.00 30.66 ? 84  VAL A CG2   1 
ATOM   706  N N     . GLY A 1 85  ? 38.193 72.029 118.440 1.00 34.81 ? 85  GLY A N     1 
ATOM   707  C CA    . GLY A 1 85  ? 38.500 71.172 119.564 1.00 36.23 ? 85  GLY A CA    1 
ATOM   708  C C     . GLY A 1 85  ? 39.810 70.528 119.269 1.00 38.17 ? 85  GLY A C     1 
ATOM   709  O O     . GLY A 1 85  ? 40.595 71.050 118.468 1.00 40.93 ? 85  GLY A O     1 
ATOM   710  N N     . GLY A 1 86  ? 40.099 69.407 119.892 1.00 39.28 ? 86  GLY A N     1 
ATOM   711  C CA    . GLY A 1 86  ? 41.356 68.731 119.568 1.00 40.49 ? 86  GLY A CA    1 
ATOM   712  C C     . GLY A 1 86  ? 42.681 69.278 120.111 1.00 41.07 ? 86  GLY A C     1 
ATOM   713  O O     . GLY A 1 86  ? 43.732 69.147 119.455 1.00 42.71 ? 86  GLY A O     1 
ATOM   714  N N     . GLY A 1 87  ? 42.684 69.786 121.340 1.00 40.62 ? 87  GLY A N     1 
ATOM   715  C CA    . GLY A 1 87  ? 43.880 70.428 121.932 1.00 38.53 ? 87  GLY A CA    1 
ATOM   716  C C     . GLY A 1 87  ? 45.253 69.779 122.113 1.00 38.60 ? 87  GLY A C     1 
ATOM   717  O O     . GLY A 1 87  ? 46.235 70.448 122.602 1.00 39.37 ? 87  GLY A O     1 
ATOM   718  N N     . GLU A 1 88  ? 45.390 68.494 121.824 1.00 36.62 ? 88  GLU A N     1 
ATOM   719  C CA    . GLU A 1 88  ? 46.677 67.885 122.105 1.00 35.64 ? 88  GLU A CA    1 
ATOM   720  C C     . GLU A 1 88  ? 47.645 68.232 120.982 1.00 34.86 ? 88  GLU A C     1 
ATOM   721  O O     . GLU A 1 88  ? 48.821 67.987 121.088 1.00 36.85 ? 88  GLU A O     1 
ATOM   722  C CB    . GLU A 1 88  ? 46.547 66.381 122.242 1.00 35.30 ? 88  GLU A CB    1 
ATOM   723  C CG    . GLU A 1 88  ? 45.542 65.963 123.273 1.00 38.03 ? 88  GLU A CG    1 
ATOM   724  C CD    . GLU A 1 88  ? 44.166 65.845 122.658 1.00 42.98 ? 88  GLU A CD    1 
ATOM   725  O OE1   . GLU A 1 88  ? 43.549 66.877 122.320 1.00 44.58 ? 88  GLU A OE1   1 
ATOM   726  O OE2   . GLU A 1 88  ? 43.682 64.712 122.505 1.00 43.41 ? 88  GLU A OE2   1 
ATOM   727  N N     . GLY A 1 89  ? 47.132 68.748 119.884 1.00 33.25 ? 89  GLY A N     1 
ATOM   728  C CA    . GLY A 1 89  ? 47.919 68.952 118.715 1.00 32.01 ? 89  GLY A CA    1 
ATOM   729  C C     . GLY A 1 89  ? 48.084 67.741 117.822 1.00 31.25 ? 89  GLY A C     1 
ATOM   730  O O     . GLY A 1 89  ? 48.770 67.845 116.798 1.00 29.71 ? 89  GLY A O     1 
ATOM   731  N N     . ALA A 1 90  ? 47.512 66.580 118.166 1.00 30.34 ? 90  ALA A N     1 
ATOM   732  C CA    . ALA A 1 90  ? 47.541 65.445 117.173 1.00 30.79 ? 90  ALA A CA    1 
ATOM   733  C C     . ALA A 1 90  ? 46.631 65.558 115.880 1.00 29.93 ? 90  ALA A C     1 
ATOM   734  O O     . ALA A 1 90  ? 47.045 65.222 114.784 1.00 29.59 ? 90  ALA A O     1 
ATOM   735  C CB    . ALA A 1 90  ? 47.281 64.177 117.851 1.00 31.37 ? 90  ALA A CB    1 
ATOM   736  N N     . THR A 1 91  ? 45.395 66.016 116.026 1.00 29.93 ? 91  THR A N     1 
ATOM   737  C CA    . THR A 1 91  ? 44.559 66.246 114.867 1.00 30.38 ? 91  THR A CA    1 
ATOM   738  C C     . THR A 1 91  ? 45.379 67.170 113.934 1.00 30.85 ? 91  THR A C     1 
ATOM   739  O O     . THR A 1 91  ? 45.658 66.841 112.768 1.00 30.66 ? 91  THR A O     1 
ATOM   740  C CB    . THR A 1 91  ? 43.249 66.879 115.257 1.00 29.91 ? 91  THR A CB    1 
ATOM   741  O OG1   . THR A 1 91  ? 42.748 66.297 116.487 1.00 30.78 ? 91  THR A OG1   1 
ATOM   742  C CG2   . THR A 1 91  ? 42.263 66.709 114.135 1.00 30.39 ? 91  THR A CG2   1 
ATOM   743  N N     . LEU A 1 92  ? 45.837 68.295 114.483 1.00 31.40 ? 92  LEU A N     1 
ATOM   744  C CA    . LEU A 1 92  ? 46.837 69.109 113.795 1.00 30.73 ? 92  LEU A CA    1 
ATOM   745  C C     . LEU A 1 92  ? 47.894 68.256 113.152 1.00 29.42 ? 92  LEU A C     1 
ATOM   746  O O     . LEU A 1 92  ? 48.103 68.305 111.950 1.00 31.75 ? 92  LEU A O     1 
ATOM   747  C CB    . LEU A 1 92  ? 47.521 70.072 114.744 1.00 31.77 ? 92  LEU A CB    1 
ATOM   748  C CG    . LEU A 1 92  ? 48.155 71.302 114.109 1.00 31.85 ? 92  LEU A CG    1 
ATOM   749  C CD1   . LEU A 1 92  ? 47.483 71.676 112.758 1.00 36.54 ? 92  LEU A CD1   1 
ATOM   750  C CD2   . LEU A 1 92  ? 47.954 72.389 115.068 1.00 31.30 ? 92  LEU A CD2   1 
ATOM   751  N N     . ARG A 1 93  ? 48.534 67.422 113.916 1.00 27.42 ? 93  ARG A N     1 
ATOM   752  C CA    . ARG A 1 93  ? 49.631 66.702 113.340 1.00 25.62 ? 93  ARG A CA    1 
ATOM   753  C C     . ARG A 1 93  ? 49.191 66.006 112.075 1.00 26.74 ? 93  ARG A C     1 
ATOM   754  O O     . ARG A 1 93  ? 49.761 66.229 111.003 1.00 24.34 ? 93  ARG A O     1 
ATOM   755  C CB    . ARG A 1 93  ? 50.158 65.688 114.277 1.00 23.67 ? 93  ARG A CB    1 
ATOM   756  C CG    . ARG A 1 93  ? 51.516 65.272 114.017 1.00 19.88 ? 93  ARG A CG    1 
ATOM   757  C CD    . ARG A 1 93  ? 51.787 64.224 115.158 1.00 22.63 ? 93  ARG A CD    1 
ATOM   758  N NE    . ARG A 1 93  ? 50.899 63.031 115.118 1.00 19.65 ? 93  ARG A NE    1 
ATOM   759  C CZ    . ARG A 1 93  ? 50.408 62.389 116.188 1.00 22.79 ? 93  ARG A CZ    1 
ATOM   760  N NH1   . ARG A 1 93  ? 49.682 61.265 115.961 1.00 17.77 ? 93  ARG A NH1   1 
ATOM   761  N NH2   . ARG A 1 93  ? 50.595 62.875 117.476 1.00 16.98 ? 93  ARG A NH2   1 
ATOM   762  N N     . GLU A 1 94  ? 48.173 65.149 112.192 1.00 28.16 ? 94  GLU A N     1 
ATOM   763  C CA    . GLU A 1 94  ? 47.784 64.475 110.973 1.00 28.39 ? 94  GLU A CA    1 
ATOM   764  C C     . GLU A 1 94  ? 47.191 65.479 109.964 1.00 28.60 ? 94  GLU A C     1 
ATOM   765  O O     . GLU A 1 94  ? 47.321 65.264 108.774 1.00 27.19 ? 94  GLU A O     1 
ATOM   766  C CB    . GLU A 1 94  ? 46.892 63.274 111.250 1.00 29.17 ? 94  GLU A CB    1 
ATOM   767  C CG    . GLU A 1 94  ? 47.250 62.569 112.508 1.00 28.41 ? 94  GLU A CG    1 
ATOM   768  C CD    . GLU A 1 94  ? 48.359 61.626 112.282 1.00 30.61 ? 94  GLU A CD    1 
ATOM   769  O OE1   . GLU A 1 94  ? 48.373 61.094 111.153 1.00 27.79 ? 94  GLU A OE1   1 
ATOM   770  O OE2   . GLU A 1 94  ? 49.242 61.463 113.213 1.00 31.71 ? 94  GLU A OE2   1 
ATOM   771  N N     . VAL A 1 95  ? 46.571 66.591 110.378 1.00 29.06 ? 95  VAL A N     1 
ATOM   772  C CA    . VAL A 1 95  ? 46.095 67.392 109.267 1.00 30.24 ? 95  VAL A CA    1 
ATOM   773  C C     . VAL A 1 95  ? 47.314 67.935 108.452 1.00 30.08 ? 95  VAL A C     1 
ATOM   774  O O     . VAL A 1 95  ? 47.321 67.853 107.210 1.00 28.60 ? 95  VAL A O     1 
ATOM   775  C CB    . VAL A 1 95  ? 45.082 68.490 109.601 1.00 31.40 ? 95  VAL A CB    1 
ATOM   776  C CG1   . VAL A 1 95  ? 44.774 69.253 108.326 1.00 30.40 ? 95  VAL A CG1   1 
ATOM   777  C CG2   . VAL A 1 95  ? 43.800 67.932 110.186 1.00 33.13 ? 95  VAL A CG2   1 
ATOM   778  N N     . LEU A 1 96  ? 48.321 68.481 109.166 1.00 28.62 ? 96  LEU A N     1 
ATOM   779  C CA    . LEU A 1 96  ? 49.507 68.964 108.537 1.00 27.51 ? 96  LEU A CA    1 
ATOM   780  C C     . LEU A 1 96  ? 50.180 67.960 107.611 1.00 27.86 ? 96  LEU A C     1 
ATOM   781  O O     . LEU A 1 96  ? 50.754 68.365 106.691 1.00 28.63 ? 96  LEU A O     1 
ATOM   782  C CB    . LEU A 1 96  ? 50.492 69.542 109.549 1.00 27.85 ? 96  LEU A CB    1 
ATOM   783  C CG    . LEU A 1 96  ? 49.815 70.859 110.061 1.00 28.16 ? 96  LEU A CG    1 
ATOM   784  C CD1   . LEU A 1 96  ? 50.693 71.635 110.910 1.00 30.58 ? 96  LEU A CD1   1 
ATOM   785  C CD2   . LEU A 1 96  ? 49.326 71.785 109.027 1.00 20.80 ? 96  LEU A CD2   1 
ATOM   786  N N     . LYS A 1 97  ? 50.101 66.667 107.859 1.00 28.43 ? 97  LYS A N     1 
ATOM   787  C CA    . LYS A 1 97  ? 50.629 65.641 106.999 1.00 30.10 ? 97  LYS A CA    1 
ATOM   788  C C     . LYS A 1 97  ? 50.128 65.690 105.518 1.00 31.80 ? 97  LYS A C     1 
ATOM   789  O O     . LYS A 1 97  ? 50.730 65.068 104.684 1.00 32.36 ? 97  LYS A O     1 
ATOM   790  C CB    . LYS A 1 97  ? 50.266 64.253 107.561 1.00 30.01 ? 97  LYS A CB    1 
ATOM   791  C CG    . LYS A 1 97  ? 50.957 63.799 108.853 1.00 30.06 ? 97  LYS A CG    1 
ATOM   792  C CD    . LYS A 1 97  ? 50.581 62.314 109.122 1.00 29.18 ? 97  LYS A CD    1 
ATOM   793  C CE    . LYS A 1 97  ? 51.356 61.731 110.277 1.00 30.52 ? 97  LYS A CE    1 
ATOM   794  N NZ    . LYS A 1 97  ? 51.009 60.316 110.685 1.00 31.07 ? 97  LYS A NZ    1 
ATOM   795  N N     . HIS A 1 98  ? 49.064 66.416 105.175 1.00 33.61 ? 98  HIS A N     1 
ATOM   796  C CA    . HIS A 1 98  ? 48.666 66.482 103.762 1.00 35.70 ? 98  HIS A CA    1 
ATOM   797  C C     . HIS A 1 98  ? 49.178 67.738 103.126 1.00 36.64 ? 98  HIS A C     1 
ATOM   798  O O     . HIS A 1 98  ? 48.756 68.826 103.549 1.00 35.49 ? 98  HIS A O     1 
ATOM   799  C CB    . HIS A 1 98  ? 47.140 66.485 103.566 1.00 35.59 ? 98  HIS A CB    1 
ATOM   800  C CG    . HIS A 1 98  ? 46.445 65.255 104.056 1.00 35.57 ? 98  HIS A CG    1 
ATOM   801  N ND1   . HIS A 1 98  ? 45.608 64.496 103.251 1.00 37.87 ? 98  HIS A ND1   1 
ATOM   802  C CD2   . HIS A 1 98  ? 46.386 64.701 105.283 1.00 31.29 ? 98  HIS A CD2   1 
ATOM   803  C CE1   . HIS A 1 98  ? 45.110 63.494 103.955 1.00 34.63 ? 98  HIS A CE1   1 
ATOM   804  N NE2   . HIS A 1 98  ? 45.562 63.601 105.192 1.00 33.40 ? 98  HIS A NE2   1 
ATOM   805  N N     . PRO A 1 99  ? 49.944 67.598 102.003 1.00 38.32 ? 99  PRO A N     1 
ATOM   806  C CA    . PRO A 1 99  ? 50.807 68.691 101.503 1.00 38.82 ? 99  PRO A CA    1 
ATOM   807  C C     . PRO A 1 99  ? 49.995 69.702 100.752 1.00 39.54 ? 99  PRO A C     1 
ATOM   808  O O     . PRO A 1 99  ? 50.423 70.874 100.629 1.00 40.00 ? 99  PRO A O     1 
ATOM   809  C CB    . PRO A 1 99  ? 51.816 67.982 100.584 1.00 38.75 ? 99  PRO A CB    1 
ATOM   810  C CG    . PRO A 1 99  ? 51.246 66.592 100.322 1.00 38.20 ? 99  PRO A CG    1 
ATOM   811  C CD    . PRO A 1 99  ? 49.940 66.446 101.068 1.00 38.71 ? 99  PRO A CD    1 
ATOM   812  N N     . THR A 1 100 ? 48.810 69.292 100.295 1.00 40.00 ? 100 THR A N     1 
ATOM   813  C CA    . THR A 1 100 ? 47.922 70.247 99.647  1.00 40.57 ? 100 THR A CA    1 
ATOM   814  C C     . THR A 1 100 ? 47.402 71.281 100.676 1.00 39.81 ? 100 THR A C     1 
ATOM   815  O O     . THR A 1 100 ? 46.634 72.181 100.343 1.00 40.20 ? 100 THR A O     1 
ATOM   816  C CB    . THR A 1 100 ? 46.720 69.579 98.930  1.00 41.11 ? 100 THR A CB    1 
ATOM   817  O OG1   . THR A 1 100 ? 45.626 69.530 99.835  1.00 46.89 ? 100 THR A OG1   1 
ATOM   818  C CG2   . THR A 1 100 ? 46.968 68.125 98.431  1.00 40.89 ? 100 THR A CG2   1 
ATOM   819  N N     . VAL A 1 101 ? 47.839 71.165 101.921 1.00 39.07 ? 101 VAL A N     1 
ATOM   820  C CA    . VAL A 1 101 ? 47.411 72.085 102.967 1.00 38.26 ? 101 VAL A CA    1 
ATOM   821  C C     . VAL A 1 101 ? 48.299 73.329 103.125 1.00 39.14 ? 101 VAL A C     1 
ATOM   822  O O     . VAL A 1 101 ? 49.513 73.273 103.507 1.00 37.81 ? 101 VAL A O     1 
ATOM   823  C CB    . VAL A 1 101 ? 47.259 71.388 104.351 1.00 37.18 ? 101 VAL A CB    1 
ATOM   824  C CG1   . VAL A 1 101 ? 46.649 72.326 105.288 1.00 36.96 ? 101 VAL A CG1   1 
ATOM   825  C CG2   . VAL A 1 101 ? 46.365 70.168 104.257 1.00 36.49 ? 101 VAL A CG2   1 
ATOM   826  N N     . GLU A 1 102 ? 47.666 74.478 102.929 1.00 40.40 ? 102 GLU A N     1 
ATOM   827  C CA    . GLU A 1 102 ? 48.378 75.750 103.152 1.00 41.15 ? 102 GLU A CA    1 
ATOM   828  C C     . GLU A 1 102 ? 48.073 76.412 104.477 1.00 39.58 ? 102 GLU A C     1 
ATOM   829  O O     . GLU A 1 102 ? 48.999 76.981 105.116 1.00 38.39 ? 102 GLU A O     1 
ATOM   830  C CB    . GLU A 1 102 ? 48.111 76.723 102.018 1.00 42.86 ? 102 GLU A CB    1 
ATOM   831  C CG    . GLU A 1 102 ? 48.347 76.071 100.642 1.00 47.15 ? 102 GLU A CG    1 
ATOM   832  C CD    . GLU A 1 102 ? 47.635 76.818 99.550  1.00 49.11 ? 102 GLU A CD    1 
ATOM   833  O OE1   . GLU A 1 102 ? 46.932 77.790 99.835  1.00 49.06 ? 102 GLU A OE1   1 
ATOM   834  O OE2   . GLU A 1 102 ? 47.782 76.420 98.394  1.00 56.68 ? 102 GLU A OE2   1 
ATOM   835  N N     . LYS A 1 103 ? 46.798 76.303 104.881 1.00 37.78 ? 103 LYS A N     1 
ATOM   836  C CA    . LYS A 1 103 ? 46.363 76.725 106.221 1.00 35.07 ? 103 LYS A CA    1 
ATOM   837  C C     . LYS A 1 103 ? 45.425 75.733 106.975 1.00 36.07 ? 103 LYS A C     1 
ATOM   838  O O     . LYS A 1 103 ? 44.567 75.051 106.399 1.00 35.55 ? 103 LYS A O     1 
ATOM   839  C CB    . LYS A 1 103 ? 45.809 78.176 106.163 1.00 36.07 ? 103 LYS A CB    1 
ATOM   840  C CG    . LYS A 1 103 ? 45.926 79.047 107.470 1.00 31.00 ? 103 LYS A CG    1 
ATOM   841  C CD    . LYS A 1 103 ? 44.943 80.197 107.375 1.00 30.12 ? 103 LYS A CD    1 
ATOM   842  C CE    . LYS A 1 103 ? 45.323 81.325 108.340 1.00 26.76 ? 103 LYS A CE    1 
ATOM   843  N NZ    . LYS A 1 103 ? 44.211 82.332 108.515 1.00 21.91 ? 103 LYS A NZ    1 
ATOM   844  N N     . ALA A 1 104 ? 45.629 75.703 108.288 1.00 37.26 ? 104 ALA A N     1 
ATOM   845  C CA    . ALA A 1 104 ? 45.070 74.799 109.280 1.00 37.94 ? 104 ALA A CA    1 
ATOM   846  C C     . ALA A 1 104 ? 44.997 75.638 110.546 1.00 39.68 ? 104 ALA A C     1 
ATOM   847  O O     . ALA A 1 104 ? 46.038 76.111 111.085 1.00 39.93 ? 104 ALA A O     1 
ATOM   848  C CB    . ALA A 1 104 ? 46.012 73.674 109.517 1.00 37.47 ? 104 ALA A CB    1 
ATOM   849  N N     . VAL A 1 105 ? 43.760 75.832 111.004 1.00 41.06 ? 105 VAL A N     1 
ATOM   850  C CA    . VAL A 1 105 ? 43.424 76.785 112.029 1.00 40.91 ? 105 VAL A CA    1 
ATOM   851  C C     . VAL A 1 105 ? 42.853 75.802 112.983 1.00 41.53 ? 105 VAL A C     1 
ATOM   852  O O     . VAL A 1 105 ? 42.073 74.889 112.604 1.00 41.46 ? 105 VAL A O     1 
ATOM   853  C CB    . VAL A 1 105 ? 42.299 77.769 111.564 1.00 41.84 ? 105 VAL A CB    1 
ATOM   854  C CG1   . VAL A 1 105 ? 41.919 78.806 112.686 1.00 40.89 ? 105 VAL A CG1   1 
ATOM   855  C CG2   . VAL A 1 105 ? 42.616 78.445 110.224 1.00 40.85 ? 105 VAL A CG2   1 
ATOM   856  N N     . MET A 1 106 ? 43.255 75.978 114.229 1.00 42.15 ? 106 MET A N     1 
ATOM   857  C CA    . MET A 1 106 ? 42.780 75.112 115.296 1.00 42.51 ? 106 MET A CA    1 
ATOM   858  C C     . MET A 1 106 ? 42.269 76.006 116.386 1.00 43.41 ? 106 MET A C     1 
ATOM   859  O O     . MET A 1 106 ? 42.986 76.970 116.784 1.00 44.77 ? 106 MET A O     1 
ATOM   860  C CB    . MET A 1 106 ? 43.898 74.260 115.834 1.00 41.70 ? 106 MET A CB    1 
ATOM   861  C CG    . MET A 1 106 ? 43.409 73.299 116.801 1.00 42.41 ? 106 MET A CG    1 
ATOM   862  S SD    . MET A 1 106 ? 44.832 72.538 117.481 1.00 41.37 ? 106 MET A SD    1 
ATOM   863  C CE    . MET A 1 106 ? 44.431 72.729 119.195 1.00 45.45 ? 106 MET A CE    1 
ATOM   864  N N     . VAL A 1 107 ? 41.040 75.693 116.837 1.00 42.83 ? 107 VAL A N     1 
ATOM   865  C CA    . VAL A 1 107 ? 40.281 76.460 117.872 1.00 42.22 ? 107 VAL A CA    1 
ATOM   866  C C     . VAL A 1 107 ? 40.077 75.653 119.126 1.00 40.20 ? 107 VAL A C     1 
ATOM   867  O O     . VAL A 1 107 ? 39.733 74.511 119.061 1.00 40.97 ? 107 VAL A O     1 
ATOM   868  C CB    . VAL A 1 107 ? 38.851 76.763 117.412 1.00 42.60 ? 107 VAL A CB    1 
ATOM   869  C CG1   . VAL A 1 107 ? 38.170 77.745 118.393 1.00 41.19 ? 107 VAL A CG1   1 
ATOM   870  C CG2   . VAL A 1 107 ? 38.892 77.314 115.999 1.00 43.82 ? 107 VAL A CG2   1 
ATOM   871  N N     . ASP A 1 108 ? 40.242 76.232 120.276 1.00 38.03 ? 108 ASP A N     1 
ATOM   872  C CA    . ASP A 1 108 ? 40.007 75.416 121.392 1.00 37.20 ? 108 ASP A CA    1 
ATOM   873  C C     . ASP A 1 108 ? 39.934 76.234 122.640 1.00 37.39 ? 108 ASP A C     1 
ATOM   874  O O     . ASP A 1 108 ? 40.883 76.784 123.054 1.00 37.13 ? 108 ASP A O     1 
ATOM   875  C CB    . ASP A 1 108 ? 41.045 74.311 121.437 1.00 35.35 ? 108 ASP A CB    1 
ATOM   876  C CG    . ASP A 1 108 ? 40.870 73.384 122.606 1.00 33.89 ? 108 ASP A CG    1 
ATOM   877  O OD1   . ASP A 1 108 ? 40.716 73.854 123.759 1.00 34.98 ? 108 ASP A OD1   1 
ATOM   878  O OD2   . ASP A 1 108 ? 40.904 72.160 122.402 1.00 27.16 ? 108 ASP A OD2   1 
ATOM   879  N N     . ILE A 1 109 ? 38.737 76.352 123.179 1.00 39.63 ? 109 ILE A N     1 
ATOM   880  C CA    . ILE A 1 109 ? 38.397 77.068 124.445 1.00 40.13 ? 109 ILE A CA    1 
ATOM   881  C C     . ILE A 1 109 ? 39.413 77.078 125.622 1.00 40.99 ? 109 ILE A C     1 
ATOM   882  O O     . ILE A 1 109 ? 39.470 77.997 126.395 1.00 41.76 ? 109 ILE A O     1 
ATOM   883  C CB    . ILE A 1 109 ? 37.046 76.437 124.962 1.00 40.50 ? 109 ILE A CB    1 
ATOM   884  C CG1   . ILE A 1 109 ? 36.298 77.344 125.962 1.00 38.91 ? 109 ILE A CG1   1 
ATOM   885  C CG2   . ILE A 1 109 ? 37.291 74.936 125.497 1.00 39.68 ? 109 ILE A CG2   1 
ATOM   886  C CD1   . ILE A 1 109 ? 34.779 77.106 125.996 1.00 39.40 ? 109 ILE A CD1   1 
ATOM   887  N N     . ASP A 1 110 ? 40.174 76.030 125.827 1.00 42.36 ? 110 ASP A N     1 
ATOM   888  C CA    . ASP A 1 110 ? 40.997 75.970 127.008 1.00 43.26 ? 110 ASP A CA    1 
ATOM   889  C C     . ASP A 1 110 ? 42.519 76.130 126.746 1.00 43.54 ? 110 ASP A C     1 
ATOM   890  O O     . ASP A 1 110 ? 43.232 75.185 126.352 1.00 42.82 ? 110 ASP A O     1 
ATOM   891  C CB    . ASP A 1 110 ? 40.629 74.687 127.758 1.00 44.41 ? 110 ASP A CB    1 
ATOM   892  C CG    . ASP A 1 110 ? 41.408 74.515 129.035 1.00 47.61 ? 110 ASP A CG    1 
ATOM   893  O OD1   . ASP A 1 110 ? 41.077 73.528 129.711 1.00 51.79 ? 110 ASP A OD1   1 
ATOM   894  O OD2   . ASP A 1 110 ? 42.338 75.329 129.352 1.00 52.77 ? 110 ASP A OD2   1 
ATOM   895  N N     . GLY A 1 111 ? 42.997 77.353 126.976 1.00 43.98 ? 111 GLY A N     1 
ATOM   896  C CA    . GLY A 1 111 ? 44.413 77.676 126.827 1.00 44.24 ? 111 GLY A CA    1 
ATOM   897  C C     . GLY A 1 111 ? 45.262 76.783 127.701 1.00 44.64 ? 111 GLY A C     1 
ATOM   898  O O     . GLY A 1 111 ? 46.025 75.951 127.194 1.00 46.10 ? 111 GLY A O     1 
ATOM   899  N N     . GLU A 1 112 ? 45.116 76.884 129.014 1.00 43.29 ? 112 GLU A N     1 
ATOM   900  C CA    . GLU A 1 112 ? 46.043 76.155 129.882 1.00 42.46 ? 112 GLU A CA    1 
ATOM   901  C C     . GLU A 1 112 ? 46.199 74.657 129.588 1.00 41.60 ? 112 GLU A C     1 
ATOM   902  O O     . GLU A 1 112 ? 47.250 74.028 129.865 1.00 41.69 ? 112 GLU A O     1 
ATOM   903  C CB    . GLU A 1 112 ? 45.619 76.283 131.297 1.00 43.07 ? 112 GLU A CB    1 
ATOM   904  C CG    . GLU A 1 112 ? 45.242 77.676 131.797 1.00 43.09 ? 112 GLU A CG    1 
ATOM   905  C CD    . GLU A 1 112 ? 45.046 77.540 133.277 1.00 41.97 ? 112 GLU A CD    1 
ATOM   906  O OE1   . GLU A 1 112 ? 45.389 76.409 133.773 1.00 38.58 ? 112 GLU A OE1   1 
ATOM   907  O OE2   . GLU A 1 112 ? 44.572 78.497 133.908 1.00 39.86 ? 112 GLU A OE2   1 
ATOM   908  N N     . LEU A 1 113 ? 45.161 74.062 129.034 1.00 40.40 ? 113 LEU A N     1 
ATOM   909  C CA    . LEU A 1 113 ? 45.294 72.677 128.651 1.00 39.25 ? 113 LEU A CA    1 
ATOM   910  C C     . LEU A 1 113 ? 46.147 72.567 127.380 1.00 38.38 ? 113 LEU A C     1 
ATOM   911  O O     . LEU A 1 113 ? 46.985 71.686 127.233 1.00 36.80 ? 113 LEU A O     1 
ATOM   912  C CB    . LEU A 1 113 ? 43.921 72.069 128.463 1.00 40.08 ? 113 LEU A CB    1 
ATOM   913  C CG    . LEU A 1 113 ? 43.883 70.656 127.885 1.00 41.34 ? 113 LEU A CG    1 
ATOM   914  C CD1   . LEU A 1 113 ? 43.947 69.698 129.053 1.00 42.75 ? 113 LEU A CD1   1 
ATOM   915  C CD2   . LEU A 1 113 ? 42.660 70.428 127.015 1.00 38.10 ? 113 LEU A CD2   1 
ATOM   916  N N     . VAL A 1 114 ? 45.970 73.481 126.448 1.00 37.69 ? 114 VAL A N     1 
ATOM   917  C CA    . VAL A 1 114 ? 46.933 73.445 125.398 1.00 37.53 ? 114 VAL A CA    1 
ATOM   918  C C     . VAL A 1 114 ? 48.298 73.630 126.070 1.00 38.38 ? 114 VAL A C     1 
ATOM   919  O O     . VAL A 1 114 ? 49.214 72.852 125.797 1.00 38.36 ? 114 VAL A O     1 
ATOM   920  C CB    . VAL A 1 114 ? 46.798 74.547 124.383 1.00 37.10 ? 114 VAL A CB    1 
ATOM   921  C CG1   . VAL A 1 114 ? 47.855 74.303 123.342 1.00 38.56 ? 114 VAL A CG1   1 
ATOM   922  C CG2   . VAL A 1 114 ? 45.433 74.600 123.772 1.00 34.54 ? 114 VAL A CG2   1 
ATOM   923  N N     . GLU A 1 115 ? 48.443 74.666 126.931 1.00 38.77 ? 115 GLU A N     1 
ATOM   924  C CA    . GLU A 1 115 ? 49.757 74.964 127.485 1.00 39.15 ? 115 GLU A CA    1 
ATOM   925  C C     . GLU A 1 115 ? 50.319 73.679 128.141 1.00 39.68 ? 115 GLU A C     1 
ATOM   926  O O     . GLU A 1 115 ? 51.547 73.418 128.028 1.00 40.16 ? 115 GLU A O     1 
ATOM   927  C CB    . GLU A 1 115 ? 49.729 76.123 128.478 1.00 39.47 ? 115 GLU A CB    1 
ATOM   928  C CG    . GLU A 1 115 ? 49.851 77.475 127.919 1.00 41.41 ? 115 GLU A CG    1 
ATOM   929  C CD    . GLU A 1 115 ? 50.965 77.562 126.895 1.00 45.50 ? 115 GLU A CD    1 
ATOM   930  O OE1   . GLU A 1 115 ? 52.152 77.479 127.349 1.00 45.40 ? 115 GLU A OE1   1 
ATOM   931  O OE2   . GLU A 1 115 ? 50.639 77.692 125.655 1.00 43.76 ? 115 GLU A OE2   1 
ATOM   932  N N     . VAL A 1 116 ? 49.433 72.898 128.804 1.00 38.41 ? 116 VAL A N     1 
ATOM   933  C CA    . VAL A 1 116 ? 49.776 71.562 129.297 1.00 37.90 ? 116 VAL A CA    1 
ATOM   934  C C     . VAL A 1 116 ? 50.152 70.540 128.190 1.00 37.64 ? 116 VAL A C     1 
ATOM   935  O O     . VAL A 1 116 ? 51.117 69.751 128.384 1.00 38.65 ? 116 VAL A O     1 
ATOM   936  C CB    . VAL A 1 116 ? 48.663 70.970 130.256 1.00 37.91 ? 116 VAL A CB    1 
ATOM   937  C CG1   . VAL A 1 116 ? 48.783 69.438 130.415 1.00 36.22 ? 116 VAL A CG1   1 
ATOM   938  C CG2   . VAL A 1 116 ? 48.769 71.542 131.604 1.00 37.80 ? 116 VAL A CG2   1 
ATOM   939  N N     . ALA A 1 117 ? 49.417 70.516 127.063 1.00 36.61 ? 117 ALA A N     1 
ATOM   940  C CA    . ALA A 1 117 ? 49.756 69.561 125.975 1.00 35.92 ? 117 ALA A CA    1 
ATOM   941  C C     . ALA A 1 117 ? 51.185 69.838 125.503 1.00 35.36 ? 117 ALA A C     1 
ATOM   942  O O     . ALA A 1 117 ? 51.992 68.905 125.236 1.00 35.86 ? 117 ALA A O     1 
ATOM   943  C CB    . ALA A 1 117 ? 48.815 69.676 124.829 1.00 35.92 ? 117 ALA A CB    1 
ATOM   944  N N     . LYS A 1 118 ? 51.484 71.129 125.394 1.00 34.18 ? 118 LYS A N     1 
ATOM   945  C CA    . LYS A 1 118 ? 52.811 71.590 124.963 1.00 32.69 ? 118 LYS A CA    1 
ATOM   946  C C     . LYS A 1 118 ? 53.910 71.310 125.955 1.00 32.66 ? 118 LYS A C     1 
ATOM   947  O O     . LYS A 1 118 ? 54.903 70.701 125.581 1.00 32.95 ? 118 LYS A O     1 
ATOM   948  C CB    . LYS A 1 118 ? 52.804 73.046 124.590 1.00 30.64 ? 118 LYS A CB    1 
ATOM   949  C CG    . LYS A 1 118 ? 52.021 73.383 123.366 1.00 26.64 ? 118 LYS A CG    1 
ATOM   950  C CD    . LYS A 1 118 ? 51.897 74.865 123.321 1.00 17.56 ? 118 LYS A CD    1 
ATOM   951  C CE    . LYS A 1 118 ? 51.414 75.246 122.053 1.00 17.18 ? 118 LYS A CE    1 
ATOM   952  N NZ    . LYS A 1 118 ? 50.925 76.603 122.221 1.00 16.80 ? 118 LYS A NZ    1 
ATOM   953  N N     . ARG A 1 119 ? 53.774 71.739 127.195 1.00 32.49 ? 119 ARG A N     1 
ATOM   954  C CA    . ARG A 1 119 ? 54.809 71.376 128.143 1.00 34.17 ? 119 ARG A CA    1 
ATOM   955  C C     . ARG A 1 119 ? 55.003 69.870 128.232 1.00 33.10 ? 119 ARG A C     1 
ATOM   956  O O     . ARG A 1 119 ? 56.137 69.480 128.269 1.00 33.31 ? 119 ARG A O     1 
ATOM   957  C CB    . ARG A 1 119 ? 54.552 71.949 129.544 1.00 36.14 ? 119 ARG A CB    1 
ATOM   958  C CG    . ARG A 1 119 ? 54.830 73.506 129.675 1.00 44.72 ? 119 ARG A CG    1 
ATOM   959  C CD    . ARG A 1 119 ? 56.154 73.835 130.529 1.00 55.78 ? 119 ARG A CD    1 
ATOM   960  N NE    . ARG A 1 119 ? 55.831 74.025 131.969 1.00 64.22 ? 119 ARG A NE    1 
ATOM   961  C CZ    . ARG A 1 119 ? 55.906 73.096 132.941 1.00 68.78 ? 119 ARG A CZ    1 
ATOM   962  N NH1   . ARG A 1 119 ? 56.353 71.858 132.700 1.00 70.10 ? 119 ARG A NH1   1 
ATOM   963  N NH2   . ARG A 1 119 ? 55.546 73.421 134.189 1.00 71.42 ? 119 ARG A NH2   1 
ATOM   964  N N     . HIS A 1 120 ? 53.936 69.038 128.229 1.00 31.22 ? 120 HIS A N     1 
ATOM   965  C CA    . HIS A 1 120 ? 54.022 67.637 128.704 1.00 30.36 ? 120 HIS A CA    1 
ATOM   966  C C     . HIS A 1 120 ? 53.614 66.510 127.720 1.00 30.75 ? 120 HIS A C     1 
ATOM   967  O O     . HIS A 1 120 ? 53.698 65.334 128.031 1.00 31.28 ? 120 HIS A O     1 
ATOM   968  C CB    . HIS A 1 120 ? 53.150 67.475 129.966 1.00 31.00 ? 120 HIS A CB    1 
ATOM   969  C CG    . HIS A 1 120 ? 53.559 68.362 131.124 1.00 28.60 ? 120 HIS A CG    1 
ATOM   970  N ND1   . HIS A 1 120 ? 54.622 68.064 131.964 1.00 18.42 ? 120 HIS A ND1   1 
ATOM   971  C CD2   . HIS A 1 120 ? 53.086 69.565 131.528 1.00 25.83 ? 120 HIS A CD2   1 
ATOM   972  C CE1   . HIS A 1 120 ? 54.737 69.015 132.870 1.00 22.40 ? 120 HIS A CE1   1 
ATOM   973  N NE2   . HIS A 1 120 ? 53.840 69.951 132.611 1.00 25.72 ? 120 HIS A NE2   1 
ATOM   974  N N     . MET A 1 121 ? 53.129 66.852 126.547 1.00 29.56 ? 121 MET A N     1 
ATOM   975  C CA    . MET A 1 121 ? 52.786 65.816 125.593 1.00 28.75 ? 121 MET A CA    1 
ATOM   976  C C     . MET A 1 121 ? 53.438 66.052 124.216 1.00 27.26 ? 121 MET A C     1 
ATOM   977  O O     . MET A 1 121 ? 52.791 65.986 123.182 1.00 25.15 ? 121 MET A O     1 
ATOM   978  C CB    . MET A 1 121 ? 51.273 65.658 125.477 1.00 29.01 ? 121 MET A CB    1 
ATOM   979  C CG    . MET A 1 121 ? 50.627 65.499 126.779 1.00 29.65 ? 121 MET A CG    1 
ATOM   980  S SD    . MET A 1 121 ? 48.892 65.978 126.810 1.00 25.57 ? 121 MET A SD    1 
ATOM   981  C CE    . MET A 1 121 ? 48.133 64.525 126.094 1.00 14.99 ? 121 MET A CE    1 
ATOM   982  N N     . PRO A 1 122 ? 54.750 66.260 124.225 1.00 26.65 ? 122 PRO A N     1 
ATOM   983  C CA    . PRO A 1 122 ? 55.556 66.389 123.020 1.00 26.55 ? 122 PRO A CA    1 
ATOM   984  C C     . PRO A 1 122 ? 55.266 65.257 121.978 1.00 27.06 ? 122 PRO A C     1 
ATOM   985  O O     . PRO A 1 122 ? 55.377 65.474 120.730 1.00 26.64 ? 122 PRO A O     1 
ATOM   986  C CB    . PRO A 1 122 ? 56.939 66.163 123.533 1.00 26.53 ? 122 PRO A CB    1 
ATOM   987  C CG    . PRO A 1 122 ? 56.726 65.724 125.085 1.00 28.90 ? 122 PRO A CG    1 
ATOM   988  C CD    . PRO A 1 122 ? 55.542 66.362 125.461 1.00 26.48 ? 122 PRO A CD    1 
ATOM   989  N N     . GLU A 1 123 ? 54.915 64.076 122.502 1.00 26.08 ? 123 GLU A N     1 
ATOM   990  C CA    . GLU A 1 123 ? 54.653 62.900 121.744 1.00 25.33 ? 123 GLU A CA    1 
ATOM   991  C C     . GLU A 1 123 ? 53.438 63.129 120.917 1.00 25.49 ? 123 GLU A C     1 
ATOM   992  O O     . GLU A 1 123 ? 53.243 62.497 119.878 1.00 26.58 ? 123 GLU A O     1 
ATOM   993  C CB    . GLU A 1 123 ? 54.358 61.789 122.662 1.00 24.54 ? 123 GLU A CB    1 
ATOM   994  C CG    . GLU A 1 123 ? 55.476 61.382 123.535 1.00 29.37 ? 123 GLU A CG    1 
ATOM   995  C CD    . GLU A 1 123 ? 55.578 62.169 124.874 1.00 32.99 ? 123 GLU A CD    1 
ATOM   996  O OE1   . GLU A 1 123 ? 56.518 61.827 125.649 1.00 30.95 ? 123 GLU A OE1   1 
ATOM   997  O OE2   . GLU A 1 123 ? 54.761 63.113 125.109 1.00 29.06 ? 123 GLU A OE2   1 
ATOM   998  N N     . TRP A 1 124 ? 52.598 64.041 121.356 1.00 24.22 ? 124 TRP A N     1 
ATOM   999  C CA    . TRP A 1 124 ? 51.383 64.235 120.649 1.00 24.34 ? 124 TRP A CA    1 
ATOM   1000 C C     . TRP A 1 124 ? 51.603 65.247 119.533 1.00 26.21 ? 124 TRP A C     1 
ATOM   1001 O O     . TRP A 1 124 ? 51.691 64.878 118.351 1.00 26.66 ? 124 TRP A O     1 
ATOM   1002 C CB    . TRP A 1 124 ? 50.324 64.775 121.589 1.00 23.89 ? 124 TRP A CB    1 
ATOM   1003 C CG    . TRP A 1 124 ? 49.480 63.725 122.263 1.00 23.15 ? 124 TRP A CG    1 
ATOM   1004 C CD1   . TRP A 1 124 ? 48.184 63.443 121.982 1.00 23.88 ? 124 TRP A CD1   1 
ATOM   1005 C CD2   . TRP A 1 124 ? 49.856 62.871 123.374 1.00 21.97 ? 124 TRP A CD2   1 
ATOM   1006 N NE1   . TRP A 1 124 ? 47.721 62.451 122.835 1.00 25.13 ? 124 TRP A NE1   1 
ATOM   1007 C CE2   . TRP A 1 124 ? 48.729 62.091 123.695 1.00 21.96 ? 124 TRP A CE2   1 
ATOM   1008 C CE3   . TRP A 1 124 ? 51.008 62.764 124.186 1.00 21.17 ? 124 TRP A CE3   1 
ATOM   1009 C CZ2   . TRP A 1 124 ? 48.735 61.154 124.738 1.00 24.01 ? 124 TRP A CZ2   1 
ATOM   1010 C CZ3   . TRP A 1 124 ? 51.011 61.813 125.193 1.00 22.00 ? 124 TRP A CZ3   1 
ATOM   1011 C CH2   . TRP A 1 124 ? 49.883 61.029 125.461 1.00 22.52 ? 124 TRP A CH2   1 
ATOM   1012 N N     . HIS A 1 125 ? 51.628 66.528 119.935 1.00 26.45 ? 125 HIS A N     1 
ATOM   1013 C CA    . HIS A 1 125 ? 51.803 67.633 119.045 1.00 27.04 ? 125 HIS A CA    1 
ATOM   1014 C C     . HIS A 1 125 ? 52.975 67.468 118.040 1.00 25.37 ? 125 HIS A C     1 
ATOM   1015 O O     . HIS A 1 125 ? 52.886 67.847 116.879 1.00 24.79 ? 125 HIS A O     1 
ATOM   1016 C CB    . HIS A 1 125 ? 51.835 68.951 119.865 1.00 28.70 ? 125 HIS A CB    1 
ATOM   1017 C CG    . HIS A 1 125 ? 53.004 69.112 120.819 1.00 36.36 ? 125 HIS A CG    1 
ATOM   1018 N ND1   . HIS A 1 125 ? 54.243 69.585 120.416 1.00 39.12 ? 125 HIS A ND1   1 
ATOM   1019 C CD2   . HIS A 1 125 ? 53.073 69.007 122.177 1.00 40.90 ? 125 HIS A CD2   1 
ATOM   1020 C CE1   . HIS A 1 125 ? 55.040 69.688 121.473 1.00 41.43 ? 125 HIS A CE1   1 
ATOM   1021 N NE2   . HIS A 1 125 ? 54.345 69.384 122.553 1.00 42.00 ? 125 HIS A NE2   1 
ATOM   1022 N N     . GLN A 1 126 ? 54.057 66.905 118.526 1.00 24.65 ? 126 GLN A N     1 
ATOM   1023 C CA    . GLN A 1 126 ? 55.221 66.559 117.756 1.00 24.87 ? 126 GLN A CA    1 
ATOM   1024 C C     . GLN A 1 126 ? 55.821 67.677 117.025 1.00 24.91 ? 126 GLN A C     1 
ATOM   1025 O O     . GLN A 1 126 ? 56.385 67.454 115.995 1.00 23.55 ? 126 GLN A O     1 
ATOM   1026 C CB    . GLN A 1 126 ? 54.904 65.417 116.800 1.00 24.11 ? 126 GLN A CB    1 
ATOM   1027 C CG    . GLN A 1 126 ? 55.427 64.090 117.310 1.00 25.42 ? 126 GLN A CG    1 
ATOM   1028 C CD    . GLN A 1 126 ? 55.088 62.927 116.383 1.00 28.91 ? 126 GLN A CD    1 
ATOM   1029 O OE1   . GLN A 1 126 ? 54.546 61.937 116.802 1.00 22.88 ? 126 GLN A OE1   1 
ATOM   1030 N NE2   . GLN A 1 126 ? 55.400 63.065 115.110 1.00 36.98 ? 126 GLN A NE2   1 
ATOM   1031 N N     . GLY A 1 127 ? 55.662 68.891 117.541 1.00 26.24 ? 127 GLY A N     1 
ATOM   1032 C CA    . GLY A 1 127 ? 55.995 70.049 116.737 1.00 26.93 ? 127 GLY A CA    1 
ATOM   1033 C C     . GLY A 1 127 ? 54.887 70.679 115.903 1.00 29.02 ? 127 GLY A C     1 
ATOM   1034 O O     . GLY A 1 127 ? 54.865 71.838 115.781 1.00 29.08 ? 127 GLY A O     1 
ATOM   1035 N N     . ALA A 1 128 ? 54.007 69.958 115.219 1.00 32.54 ? 128 ALA A N     1 
ATOM   1036 C CA    . ALA A 1 128 ? 52.696 70.577 114.858 1.00 35.01 ? 128 ALA A CA    1 
ATOM   1037 C C     . ALA A 1 128 ? 52.557 72.144 114.975 1.00 35.83 ? 128 ALA A C     1 
ATOM   1038 O O     . ALA A 1 128 ? 52.586 72.829 113.978 1.00 36.78 ? 128 ALA A O     1 
ATOM   1039 C CB    . ALA A 1 128 ? 51.605 69.949 115.731 1.00 34.67 ? 128 ALA A CB    1 
ATOM   1040 N N     . PHE A 1 129 ? 52.361 72.672 116.197 1.00 37.41 ? 129 PHE A N     1 
ATOM   1041 C CA    . PHE A 1 129 ? 52.094 74.123 116.490 1.00 36.45 ? 129 PHE A CA    1 
ATOM   1042 C C     . PHE A 1 129 ? 53.019 75.082 115.814 1.00 37.49 ? 129 PHE A C     1 
ATOM   1043 O O     . PHE A 1 129 ? 52.598 76.128 115.287 1.00 39.21 ? 129 PHE A O     1 
ATOM   1044 C CB    . PHE A 1 129 ? 52.192 74.412 117.989 1.00 36.98 ? 129 PHE A CB    1 
ATOM   1045 C CG    . PHE A 1 129 ? 51.108 73.769 118.782 1.00 37.13 ? 129 PHE A CG    1 
ATOM   1046 C CD1   . PHE A 1 129 ? 51.415 72.727 119.679 1.00 40.73 ? 129 PHE A CD1   1 
ATOM   1047 C CD2   . PHE A 1 129 ? 49.755 74.125 118.545 1.00 38.45 ? 129 PHE A CD2   1 
ATOM   1048 C CE1   . PHE A 1 129 ? 50.366 72.036 120.417 1.00 42.72 ? 129 PHE A CE1   1 
ATOM   1049 C CE2   . PHE A 1 129 ? 48.678 73.459 119.202 1.00 42.11 ? 129 PHE A CE2   1 
ATOM   1050 C CZ    . PHE A 1 129 ? 48.981 72.381 120.173 1.00 41.83 ? 129 PHE A CZ    1 
ATOM   1051 N N     . ASP A 1 130 ? 54.293 74.743 115.862 1.00 36.59 ? 130 ASP A N     1 
ATOM   1052 C CA    . ASP A 1 130 ? 55.350 75.558 115.383 1.00 35.71 ? 130 ASP A CA    1 
ATOM   1053 C C     . ASP A 1 130 ? 55.528 75.436 113.883 1.00 34.03 ? 130 ASP A C     1 
ATOM   1054 O O     . ASP A 1 130 ? 56.451 75.966 113.371 1.00 31.27 ? 130 ASP A O     1 
ATOM   1055 C CB    . ASP A 1 130 ? 56.668 75.079 115.990 1.00 37.47 ? 130 ASP A CB    1 
ATOM   1056 C CG    . ASP A 1 130 ? 56.710 75.169 117.454 1.00 43.00 ? 130 ASP A CG    1 
ATOM   1057 O OD1   . ASP A 1 130 ? 56.341 76.204 118.074 1.00 49.65 ? 130 ASP A OD1   1 
ATOM   1058 O OD2   . ASP A 1 130 ? 57.167 74.153 118.012 1.00 53.22 ? 130 ASP A OD2   1 
ATOM   1059 N N     . ASP A 1 131 ? 54.688 74.671 113.203 1.00 35.15 ? 131 ASP A N     1 
ATOM   1060 C CA    . ASP A 1 131 ? 54.672 74.637 111.756 1.00 34.93 ? 131 ASP A CA    1 
ATOM   1061 C C     . ASP A 1 131 ? 54.089 75.952 111.366 1.00 35.32 ? 131 ASP A C     1 
ATOM   1062 O O     . ASP A 1 131 ? 53.119 76.363 111.951 1.00 35.36 ? 131 ASP A O     1 
ATOM   1063 C CB    . ASP A 1 131 ? 53.757 73.523 111.260 1.00 34.83 ? 131 ASP A CB    1 
ATOM   1064 C CG    . ASP A 1 131 ? 53.423 73.655 109.735 1.00 36.43 ? 131 ASP A CG    1 
ATOM   1065 O OD1   . ASP A 1 131 ? 52.914 74.710 109.351 1.00 40.14 ? 131 ASP A OD1   1 
ATOM   1066 O OD2   . ASP A 1 131 ? 53.626 72.722 108.929 1.00 29.96 ? 131 ASP A OD2   1 
ATOM   1067 N N     . PRO A 1 132 ? 54.662 76.605 110.348 1.00 36.22 ? 132 PRO A N     1 
ATOM   1068 C CA    . PRO A 1 132 ? 54.192 77.867 109.734 1.00 35.36 ? 132 PRO A CA    1 
ATOM   1069 C C     . PRO A 1 132 ? 52.740 77.867 109.331 1.00 34.91 ? 132 PRO A C     1 
ATOM   1070 O O     . PRO A 1 132 ? 52.086 78.858 109.539 1.00 36.47 ? 132 PRO A O     1 
ATOM   1071 C CB    . PRO A 1 132 ? 55.054 77.993 108.454 1.00 35.08 ? 132 PRO A CB    1 
ATOM   1072 C CG    . PRO A 1 132 ? 55.567 76.612 108.214 1.00 35.51 ? 132 PRO A CG    1 
ATOM   1073 C CD    . PRO A 1 132 ? 55.847 76.089 109.644 1.00 36.36 ? 132 PRO A CD    1 
ATOM   1074 N N     . ARG A 1 133 ? 52.242 76.806 108.718 1.00 34.51 ? 133 ARG A N     1 
ATOM   1075 C CA    . ARG A 1 133 ? 50.824 76.740 108.241 1.00 33.93 ? 133 ARG A CA    1 
ATOM   1076 C C     . ARG A 1 133 ? 49.691 76.718 109.320 1.00 33.98 ? 133 ARG A C     1 
ATOM   1077 O O     . ARG A 1 133 ? 48.479 76.724 108.974 1.00 32.87 ? 133 ARG A O     1 
ATOM   1078 C CB    . ARG A 1 133 ? 50.643 75.492 107.338 1.00 34.86 ? 133 ARG A CB    1 
ATOM   1079 C CG    . ARG A 1 133 ? 51.807 75.219 106.343 1.00 32.05 ? 133 ARG A CG    1 
ATOM   1080 C CD    . ARG A 1 133 ? 51.557 73.899 105.663 1.00 33.37 ? 133 ARG A CD    1 
ATOM   1081 N NE    . ARG A 1 133 ? 52.050 72.849 106.547 1.00 34.18 ? 133 ARG A NE    1 
ATOM   1082 C CZ    . ARG A 1 133 ? 51.856 71.538 106.377 1.00 38.55 ? 133 ARG A CZ    1 
ATOM   1083 N NH1   . ARG A 1 133 ? 51.192 71.018 105.335 1.00 39.19 ? 133 ARG A NH1   1 
ATOM   1084 N NH2   . ARG A 1 133 ? 52.352 70.723 107.274 1.00 41.63 ? 133 ARG A NH2   1 
ATOM   1085 N N     . ALA A 1 134 ? 50.084 76.702 110.591 1.00 33.22 ? 134 ALA A N     1 
ATOM   1086 C CA    . ALA A 1 134 ? 49.150 76.456 111.681 1.00 34.96 ? 134 ALA A CA    1 
ATOM   1087 C C     . ALA A 1 134 ? 48.666 77.767 112.330 1.00 35.70 ? 134 ALA A C     1 
ATOM   1088 O O     . ALA A 1 134 ? 49.341 78.751 112.307 1.00 37.33 ? 134 ALA A O     1 
ATOM   1089 C CB    . ALA A 1 134 ? 49.818 75.518 112.737 1.00 34.35 ? 134 ALA A CB    1 
ATOM   1090 N N     . VAL A 1 135 ? 47.512 77.811 112.928 1.00 36.51 ? 135 VAL A N     1 
ATOM   1091 C CA    . VAL A 1 135 ? 47.178 79.040 113.573 1.00 38.34 ? 135 VAL A CA    1 
ATOM   1092 C C     . VAL A 1 135 ? 46.347 78.722 114.836 1.00 38.58 ? 135 VAL A C     1 
ATOM   1093 O O     . VAL A 1 135 ? 45.118 78.645 114.768 1.00 39.52 ? 135 VAL A O     1 
ATOM   1094 C CB    . VAL A 1 135 ? 46.382 80.007 112.536 1.00 39.14 ? 135 VAL A CB    1 
ATOM   1095 C CG1   . VAL A 1 135 ? 46.012 81.409 113.097 1.00 36.18 ? 135 VAL A CG1   1 
ATOM   1096 C CG2   . VAL A 1 135 ? 47.033 80.038 111.109 1.00 39.34 ? 135 VAL A CG2   1 
ATOM   1097 N N     . LEU A 1 136 ? 46.995 78.588 115.994 1.00 38.73 ? 136 LEU A N     1 
ATOM   1098 C CA    . LEU A 1 136 ? 46.263 78.373 117.275 1.00 38.89 ? 136 LEU A CA    1 
ATOM   1099 C C     . LEU A 1 136 ? 45.331 79.518 117.609 1.00 40.75 ? 136 LEU A C     1 
ATOM   1100 O O     . LEU A 1 136 ? 45.701 80.689 117.529 1.00 42.21 ? 136 LEU A O     1 
ATOM   1101 C CB    . LEU A 1 136 ? 47.180 78.180 118.476 1.00 37.67 ? 136 LEU A CB    1 
ATOM   1102 C CG    . LEU A 1 136 ? 46.493 77.730 119.798 1.00 37.54 ? 136 LEU A CG    1 
ATOM   1103 C CD1   . LEU A 1 136 ? 45.448 76.614 119.628 1.00 30.60 ? 136 LEU A CD1   1 
ATOM   1104 C CD2   . LEU A 1 136 ? 47.525 77.302 120.864 1.00 38.06 ? 136 LEU A CD2   1 
ATOM   1105 N N     . VAL A 1 137 ? 44.096 79.195 117.963 1.00 41.85 ? 137 VAL A N     1 
ATOM   1106 C CA    . VAL A 1 137 ? 43.133 80.223 118.350 1.00 41.78 ? 137 VAL A CA    1 
ATOM   1107 C C     . VAL A 1 137 ? 42.436 79.725 119.600 1.00 41.83 ? 137 VAL A C     1 
ATOM   1108 O O     . VAL A 1 137 ? 41.953 78.593 119.650 1.00 42.13 ? 137 VAL A O     1 
ATOM   1109 C CB    . VAL A 1 137 ? 42.146 80.528 117.228 1.00 41.22 ? 137 VAL A CB    1 
ATOM   1110 C CG1   . VAL A 1 137 ? 41.107 81.548 117.672 1.00 42.30 ? 137 VAL A CG1   1 
ATOM   1111 C CG2   . VAL A 1 137 ? 42.875 80.987 116.011 1.00 41.91 ? 137 VAL A CG2   1 
ATOM   1112 N N     . ILE A 1 138 ? 42.439 80.525 120.644 1.00 41.33 ? 138 ILE A N     1 
ATOM   1113 C CA    . ILE A 1 138 ? 41.819 80.005 121.822 1.00 40.96 ? 138 ILE A CA    1 
ATOM   1114 C C     . ILE A 1 138 ? 40.507 80.639 122.126 1.00 41.33 ? 138 ILE A C     1 
ATOM   1115 O O     . ILE A 1 138 ? 40.488 81.595 122.846 1.00 42.67 ? 138 ILE A O     1 
ATOM   1116 C CB    . ILE A 1 138 ? 42.718 80.096 122.986 1.00 40.23 ? 138 ILE A CB    1 
ATOM   1117 C CG1   . ILE A 1 138 ? 43.871 79.173 122.686 1.00 36.62 ? 138 ILE A CG1   1 
ATOM   1118 C CG2   . ILE A 1 138 ? 41.960 79.614 124.268 1.00 40.36 ? 138 ILE A CG2   1 
ATOM   1119 C CD1   . ILE A 1 138 ? 44.197 78.334 123.834 1.00 33.74 ? 138 ILE A CD1   1 
ATOM   1120 N N     . ASP A 1 139 ? 39.419 80.115 121.574 1.00 41.22 ? 139 ASP A N     1 
ATOM   1121 C CA    . ASP A 1 139 ? 38.079 80.725 121.725 1.00 41.75 ? 139 ASP A CA    1 
ATOM   1122 C C     . ASP A 1 139 ? 37.045 79.595 121.934 1.00 42.16 ? 139 ASP A C     1 
ATOM   1123 O O     . ASP A 1 139 ? 37.444 78.438 122.099 1.00 44.39 ? 139 ASP A O     1 
ATOM   1124 C CB    . ASP A 1 139 ? 37.781 81.498 120.448 1.00 41.38 ? 139 ASP A CB    1 
ATOM   1125 C CG    . ASP A 1 139 ? 36.711 82.569 120.625 1.00 43.88 ? 139 ASP A CG    1 
ATOM   1126 O OD1   . ASP A 1 139 ? 36.593 83.372 119.657 1.00 44.72 ? 139 ASP A OD1   1 
ATOM   1127 O OD2   . ASP A 1 139 ? 36.003 82.640 121.683 1.00 45.83 ? 139 ASP A OD2   1 
ATOM   1128 N N     . ASP A 1 140 ? 35.741 79.855 121.905 1.00 42.35 ? 140 ASP A N     1 
ATOM   1129 C CA    . ASP A 1 140 ? 34.750 78.744 121.932 1.00 41.69 ? 140 ASP A CA    1 
ATOM   1130 C C     . ASP A 1 140 ? 34.402 78.717 120.484 1.00 41.46 ? 140 ASP A C     1 
ATOM   1131 O O     . ASP A 1 140 ? 34.270 79.784 119.902 1.00 40.11 ? 140 ASP A O     1 
ATOM   1132 C CB    . ASP A 1 140 ? 33.523 79.084 122.809 1.00 42.20 ? 140 ASP A CB    1 
ATOM   1133 C CG    . ASP A 1 140 ? 32.134 78.781 122.124 1.00 41.74 ? 140 ASP A CG    1 
ATOM   1134 O OD1   . ASP A 1 140 ? 31.388 79.709 121.723 1.00 38.89 ? 140 ASP A OD1   1 
ATOM   1135 O OD2   . ASP A 1 140 ? 31.779 77.599 122.013 1.00 41.54 ? 140 ASP A OD2   1 
ATOM   1136 N N     . ALA A 1 141 ? 34.282 77.508 119.924 1.00 41.41 ? 141 ALA A N     1 
ATOM   1137 C CA    . ALA A 1 141 ? 34.070 77.295 118.514 1.00 41.28 ? 141 ALA A CA    1 
ATOM   1138 C C     . ALA A 1 141 ? 32.842 77.998 118.049 1.00 42.05 ? 141 ALA A C     1 
ATOM   1139 O O     . ALA A 1 141 ? 32.763 78.463 116.910 1.00 43.53 ? 141 ALA A O     1 
ATOM   1140 C CB    . ALA A 1 141 ? 33.945 75.842 118.210 1.00 41.82 ? 141 ALA A CB    1 
ATOM   1141 N N     . ARG A 1 142 ? 31.855 78.075 118.895 1.00 42.15 ? 142 ARG A N     1 
ATOM   1142 C CA    . ARG A 1 142 ? 30.593 78.498 118.395 1.00 43.37 ? 142 ARG A CA    1 
ATOM   1143 C C     . ARG A 1 142 ? 30.798 79.961 118.264 1.00 44.24 ? 142 ARG A C     1 
ATOM   1144 O O     . ARG A 1 142 ? 30.537 80.500 117.192 1.00 44.48 ? 142 ARG A O     1 
ATOM   1145 C CB    . ARG A 1 142 ? 29.463 78.149 119.360 1.00 43.99 ? 142 ARG A CB    1 
ATOM   1146 C CG    . ARG A 1 142 ? 28.152 77.796 118.662 1.00 47.17 ? 142 ARG A CG    1 
ATOM   1147 C CD    . ARG A 1 142 ? 26.911 78.493 119.304 1.00 52.46 ? 142 ARG A CD    1 
ATOM   1148 N NE    . ARG A 1 142 ? 25.711 77.668 119.178 1.00 53.23 ? 142 ARG A NE    1 
ATOM   1149 C CZ    . ARG A 1 142 ? 24.913 77.646 118.123 1.00 54.60 ? 142 ARG A CZ    1 
ATOM   1150 N NH1   . ARG A 1 142 ? 25.141 78.433 117.088 1.00 53.11 ? 142 ARG A NH1   1 
ATOM   1151 N NH2   . ARG A 1 142 ? 23.868 76.837 118.105 1.00 57.62 ? 142 ARG A NH2   1 
ATOM   1152 N N     . ALA A 1 143 ? 31.302 80.601 119.337 1.00 44.39 ? 143 ALA A N     1 
ATOM   1153 C CA    . ALA A 1 143 ? 31.817 81.954 119.255 1.00 44.88 ? 143 ALA A CA    1 
ATOM   1154 C C     . ALA A 1 143 ? 32.787 82.186 118.062 1.00 46.41 ? 143 ALA A C     1 
ATOM   1155 O O     . ALA A 1 143 ? 32.623 83.165 117.312 1.00 47.01 ? 143 ALA A O     1 
ATOM   1156 C CB    . ALA A 1 143 ? 32.488 82.303 120.512 1.00 44.83 ? 143 ALA A CB    1 
ATOM   1157 N N     . TYR A 1 144 ? 33.796 81.334 117.865 1.00 46.91 ? 144 TYR A N     1 
ATOM   1158 C CA    . TYR A 1 144 ? 34.684 81.592 116.769 1.00 48.52 ? 144 TYR A CA    1 
ATOM   1159 C C     . TYR A 1 144 ? 33.897 81.646 115.444 1.00 49.56 ? 144 TYR A C     1 
ATOM   1160 O O     . TYR A 1 144 ? 34.059 82.574 114.660 1.00 48.25 ? 144 TYR A O     1 
ATOM   1161 C CB    . TYR A 1 144 ? 35.820 80.561 116.654 1.00 49.36 ? 144 TYR A CB    1 
ATOM   1162 C CG    . TYR A 1 144 ? 36.708 80.754 115.353 1.00 49.72 ? 144 TYR A CG    1 
ATOM   1163 C CD1   . TYR A 1 144 ? 36.598 79.893 114.279 1.00 48.55 ? 144 TYR A CD1   1 
ATOM   1164 C CD2   . TYR A 1 144 ? 37.620 81.810 115.223 1.00 48.58 ? 144 TYR A CD2   1 
ATOM   1165 C CE1   . TYR A 1 144 ? 37.348 80.060 113.123 1.00 49.81 ? 144 TYR A CE1   1 
ATOM   1166 C CE2   . TYR A 1 144 ? 38.385 81.970 114.057 1.00 49.01 ? 144 TYR A CE2   1 
ATOM   1167 C CZ    . TYR A 1 144 ? 38.244 81.091 113.013 1.00 49.72 ? 144 TYR A CZ    1 
ATOM   1168 O OH    . TYR A 1 144 ? 38.974 81.213 111.826 1.00 50.73 ? 144 TYR A OH    1 
ATOM   1169 N N     . LEU A 1 145 ? 33.030 80.657 115.234 1.00 51.01 ? 145 LEU A N     1 
ATOM   1170 C CA    . LEU A 1 145 ? 32.338 80.437 113.951 1.00 52.52 ? 145 LEU A CA    1 
ATOM   1171 C C     . LEU A 1 145 ? 31.295 81.488 113.622 1.00 54.23 ? 145 LEU A C     1 
ATOM   1172 O O     . LEU A 1 145 ? 30.917 81.696 112.444 1.00 54.23 ? 145 LEU A O     1 
ATOM   1173 C CB    . LEU A 1 145 ? 31.693 79.050 113.926 1.00 51.99 ? 145 LEU A CB    1 
ATOM   1174 C CG    . LEU A 1 145 ? 32.767 77.979 113.706 1.00 52.29 ? 145 LEU A CG    1 
ATOM   1175 C CD1   . LEU A 1 145 ? 32.494 76.759 114.544 1.00 53.57 ? 145 LEU A CD1   1 
ATOM   1176 C CD2   . LEU A 1 145 ? 33.069 77.595 112.238 1.00 48.95 ? 145 LEU A CD2   1 
ATOM   1177 N N     . GLU A 1 146 ? 30.840 82.152 114.682 1.00 56.02 ? 146 GLU A N     1 
ATOM   1178 C CA    . GLU A 1 146 ? 29.848 83.197 114.569 1.00 57.47 ? 146 GLU A CA    1 
ATOM   1179 C C     . GLU A 1 146 ? 30.531 84.513 114.233 1.00 57.90 ? 146 GLU A C     1 
ATOM   1180 O O     . GLU A 1 146 ? 30.106 85.190 113.304 1.00 58.32 ? 146 GLU A O     1 
ATOM   1181 C CB    . GLU A 1 146 ? 29.058 83.307 115.855 1.00 57.69 ? 146 GLU A CB    1 
ATOM   1182 C CG    . GLU A 1 146 ? 28.150 82.131 116.182 1.00 63.18 ? 146 GLU A CG    1 
ATOM   1183 C CD    . GLU A 1 146 ? 26.778 82.179 115.468 1.00 70.60 ? 146 GLU A CD    1 
ATOM   1184 O OE1   . GLU A 1 146 ? 26.759 82.348 114.225 1.00 75.41 ? 146 GLU A OE1   1 
ATOM   1185 O OE2   . GLU A 1 146 ? 25.705 82.029 116.124 1.00 72.12 ? 146 GLU A OE2   1 
ATOM   1186 N N     . ARG A 1 147 ? 31.593 84.869 114.970 1.00 58.98 ? 147 ARG A N     1 
ATOM   1187 C CA    . ARG A 1 147 ? 32.410 86.062 114.646 1.00 59.89 ? 147 ARG A CA    1 
ATOM   1188 C C     . ARG A 1 147 ? 33.135 86.037 113.260 1.00 59.76 ? 147 ARG A C     1 
ATOM   1189 O O     . ARG A 1 147 ? 32.745 86.802 112.382 1.00 60.63 ? 147 ARG A O     1 
ATOM   1190 C CB    . ARG A 1 147 ? 33.351 86.458 115.783 1.00 59.36 ? 147 ARG A CB    1 
ATOM   1191 C CG    . ARG A 1 147 ? 34.189 87.682 115.384 1.00 64.39 ? 147 ARG A CG    1 
ATOM   1192 C CD    . ARG A 1 147 ? 35.575 87.790 116.077 1.00 69.13 ? 147 ARG A CD    1 
ATOM   1193 N NE    . ARG A 1 147 ? 36.231 86.496 116.323 1.00 70.88 ? 147 ARG A NE    1 
ATOM   1194 C CZ    . ARG A 1 147 ? 36.180 85.817 117.482 1.00 73.14 ? 147 ARG A CZ    1 
ATOM   1195 N NH1   . ARG A 1 147 ? 36.826 84.658 117.585 1.00 72.04 ? 147 ARG A NH1   1 
ATOM   1196 N NH2   . ARG A 1 147 ? 35.497 86.286 118.547 1.00 73.11 ? 147 ARG A NH2   1 
ATOM   1197 N N     . THR A 1 148 ? 34.149 85.196 113.039 1.00 59.05 ? 148 THR A N     1 
ATOM   1198 C CA    . THR A 1 148 ? 34.818 85.193 111.723 1.00 59.38 ? 148 THR A CA    1 
ATOM   1199 C C     . THR A 1 148 ? 33.903 84.795 110.584 1.00 58.71 ? 148 THR A C     1 
ATOM   1200 O O     . THR A 1 148 ? 32.935 84.092 110.805 1.00 58.67 ? 148 THR A O     1 
ATOM   1201 C CB    . THR A 1 148 ? 35.954 84.167 111.646 1.00 59.39 ? 148 THR A CB    1 
ATOM   1202 O OG1   . THR A 1 148 ? 36.501 84.169 110.315 1.00 63.81 ? 148 THR A OG1   1 
ATOM   1203 C CG2   . THR A 1 148 ? 35.429 82.795 111.867 1.00 59.50 ? 148 THR A CG2   1 
ATOM   1204 N N     . GLU A 1 149 ? 34.225 85.196 109.353 1.00 58.74 ? 149 GLU A N     1 
ATOM   1205 C CA    . GLU A 1 149 ? 33.696 84.410 108.233 1.00 58.80 ? 149 GLU A CA    1 
ATOM   1206 C C     . GLU A 1 149 ? 34.656 83.797 107.187 1.00 57.49 ? 149 GLU A C     1 
ATOM   1207 O O     . GLU A 1 149 ? 34.217 83.531 106.056 1.00 56.65 ? 149 GLU A O     1 
ATOM   1208 C CB    . GLU A 1 149 ? 32.268 84.832 107.647 1.00 59.72 ? 149 GLU A CB    1 
ATOM   1209 C CG    . GLU A 1 149 ? 31.612 86.186 108.048 1.00 62.09 ? 149 GLU A CG    1 
ATOM   1210 C CD    . GLU A 1 149 ? 32.243 87.400 107.291 1.00 68.01 ? 149 GLU A CD    1 
ATOM   1211 O OE1   . GLU A 1 149 ? 33.469 87.376 106.980 1.00 67.98 ? 149 GLU A OE1   1 
ATOM   1212 O OE2   . GLU A 1 149 ? 31.518 88.392 106.992 1.00 71.86 ? 149 GLU A OE2   1 
ATOM   1213 N N     . GLU A 1 150 ? 35.917 83.523 107.559 1.00 56.82 ? 150 GLU A N     1 
ATOM   1214 C CA    . GLU A 1 150 ? 36.794 82.623 106.698 1.00 56.75 ? 150 GLU A CA    1 
ATOM   1215 C C     . GLU A 1 150 ? 36.045 81.315 106.291 1.00 53.96 ? 150 GLU A C     1 
ATOM   1216 O O     . GLU A 1 150 ? 35.124 80.864 106.975 1.00 53.45 ? 150 GLU A O     1 
ATOM   1217 C CB    . GLU A 1 150 ? 38.155 82.249 107.371 1.00 57.29 ? 150 GLU A CB    1 
ATOM   1218 C CG    . GLU A 1 150 ? 39.234 83.414 107.523 1.00 59.90 ? 150 GLU A CG    1 
ATOM   1219 C CD    . GLU A 1 150 ? 40.692 83.090 106.930 1.00 59.62 ? 150 GLU A CD    1 
ATOM   1220 O OE1   . GLU A 1 150 ? 41.367 82.093 107.383 1.00 61.68 ? 150 GLU A OE1   1 
ATOM   1221 O OE2   . GLU A 1 150 ? 41.163 83.880 106.037 1.00 56.92 ? 150 GLU A OE2   1 
ATOM   1222 N N     . ARG A 1 151 ? 36.406 80.718 105.169 1.00 51.71 ? 151 ARG A N     1 
ATOM   1223 C CA    . ARG A 1 151 ? 35.858 79.391 104.822 1.00 49.02 ? 151 ARG A CA    1 
ATOM   1224 C C     . ARG A 1 151 ? 36.962 78.274 104.697 1.00 48.18 ? 151 ARG A C     1 
ATOM   1225 O O     . ARG A 1 151 ? 38.204 78.585 104.735 1.00 47.55 ? 151 ARG A O     1 
ATOM   1226 C CB    . ARG A 1 151 ? 34.913 79.486 103.618 1.00 49.27 ? 151 ARG A CB    1 
ATOM   1227 C CG    . ARG A 1 151 ? 33.535 80.217 103.934 1.00 52.57 ? 151 ARG A CG    1 
ATOM   1228 C CD    . ARG A 1 151 ? 32.587 80.342 102.715 1.00 52.57 ? 151 ARG A CD    1 
ATOM   1229 N NE    . ARG A 1 151 ? 33.350 80.886 101.583 1.00 60.58 ? 151 ARG A NE    1 
ATOM   1230 C CZ    . ARG A 1 151 ? 33.097 80.693 100.282 1.00 63.14 ? 151 ARG A CZ    1 
ATOM   1231 N NH1   . ARG A 1 151 ? 33.905 81.260 99.375  1.00 61.99 ? 151 ARG A NH1   1 
ATOM   1232 N NH2   . ARG A 1 151 ? 32.047 79.955 99.880  1.00 65.27 ? 151 ARG A NH2   1 
ATOM   1233 N N     . TYR A 1 152 ? 36.523 76.991 104.616 1.00 46.15 ? 152 TYR A N     1 
ATOM   1234 C CA    . TYR A 1 152 ? 37.398 75.796 104.806 1.00 43.74 ? 152 TYR A CA    1 
ATOM   1235 C C     . TYR A 1 152 ? 37.029 74.728 103.868 1.00 42.00 ? 152 TYR A C     1 
ATOM   1236 O O     . TYR A 1 152 ? 35.873 74.671 103.412 1.00 41.72 ? 152 TYR A O     1 
ATOM   1237 C CB    . TYR A 1 152 ? 37.277 75.264 106.230 1.00 42.23 ? 152 TYR A CB    1 
ATOM   1238 C CG    . TYR A 1 152 ? 37.756 76.305 107.197 1.00 41.66 ? 152 TYR A CG    1 
ATOM   1239 C CD1   . TYR A 1 152 ? 36.838 77.007 108.003 1.00 41.51 ? 152 TYR A CD1   1 
ATOM   1240 C CD2   . TYR A 1 152 ? 39.136 76.673 107.249 1.00 39.39 ? 152 TYR A CD2   1 
ATOM   1241 C CE1   . TYR A 1 152 ? 37.271 78.013 108.880 1.00 41.29 ? 152 TYR A CE1   1 
ATOM   1242 C CE2   . TYR A 1 152 ? 39.580 77.651 108.137 1.00 40.89 ? 152 TYR A CE2   1 
ATOM   1243 C CZ    . TYR A 1 152 ? 38.640 78.327 108.938 1.00 42.00 ? 152 TYR A CZ    1 
ATOM   1244 O OH    . TYR A 1 152 ? 39.044 79.339 109.781 1.00 44.98 ? 152 TYR A OH    1 
ATOM   1245 N N     . ASP A 1 153 ? 38.006 73.885 103.537 1.00 40.80 ? 153 ASP A N     1 
ATOM   1246 C CA    . ASP A 1 153 ? 37.722 72.678 102.701 1.00 39.69 ? 153 ASP A CA    1 
ATOM   1247 C C     . ASP A 1 153 ? 37.315 71.432 103.484 1.00 37.62 ? 153 ASP A C     1 
ATOM   1248 O O     . ASP A 1 153 ? 36.448 70.694 103.037 1.00 36.25 ? 153 ASP A O     1 
ATOM   1249 C CB    . ASP A 1 153 ? 38.911 72.323 101.838 1.00 39.40 ? 153 ASP A CB    1 
ATOM   1250 C CG    . ASP A 1 153 ? 39.224 73.400 100.856 1.00 44.04 ? 153 ASP A CG    1 
ATOM   1251 O OD1   . ASP A 1 153 ? 40.371 73.986 101.010 1.00 43.08 ? 153 ASP A OD1   1 
ATOM   1252 O OD2   . ASP A 1 153 ? 38.311 73.648 99.968  1.00 44.21 ? 153 ASP A OD2   1 
ATOM   1253 N N     . VAL A 1 154 ? 38.023 71.170 104.593 1.00 35.85 ? 154 VAL A N     1 
ATOM   1254 C CA    . VAL A 1 154 ? 37.545 70.247 105.595 1.00 34.61 ? 154 VAL A CA    1 
ATOM   1255 C C     . VAL A 1 154 ? 37.470 71.006 106.958 1.00 33.63 ? 154 VAL A C     1 
ATOM   1256 O O     . VAL A 1 154 ? 38.275 71.890 107.213 1.00 32.43 ? 154 VAL A O     1 
ATOM   1257 C CB    . VAL A 1 154 ? 38.402 68.920 105.626 1.00 34.30 ? 154 VAL A CB    1 
ATOM   1258 C CG1   . VAL A 1 154 ? 37.907 67.999 106.633 1.00 34.48 ? 154 VAL A CG1   1 
ATOM   1259 C CG2   . VAL A 1 154 ? 38.356 68.230 104.320 1.00 35.19 ? 154 VAL A CG2   1 
ATOM   1260 N N     . VAL A 1 155 ? 36.437 70.687 107.763 1.00 33.01 ? 155 VAL A N     1 
ATOM   1261 C CA    . VAL A 1 155 ? 36.344 70.980 109.192 1.00 30.99 ? 155 VAL A CA    1 
ATOM   1262 C C     . VAL A 1 155 ? 36.448 69.639 109.889 1.00 31.59 ? 155 VAL A C     1 
ATOM   1263 O O     . VAL A 1 155 ? 35.805 68.649 109.480 1.00 33.81 ? 155 VAL A O     1 
ATOM   1264 C CB    . VAL A 1 155 ? 34.990 71.569 109.557 1.00 30.75 ? 155 VAL A CB    1 
ATOM   1265 C CG1   . VAL A 1 155 ? 34.989 72.074 111.005 1.00 31.62 ? 155 VAL A CG1   1 
ATOM   1266 C CG2   . VAL A 1 155 ? 34.614 72.704 108.619 1.00 28.14 ? 155 VAL A CG2   1 
ATOM   1267 N N     . ILE A 1 156 ? 37.289 69.553 110.913 1.00 31.06 ? 156 ILE A N     1 
ATOM   1268 C CA    . ILE A 1 156 ? 37.309 68.366 111.715 1.00 28.80 ? 156 ILE A CA    1 
ATOM   1269 C C     . ILE A 1 156 ? 36.768 68.852 113.041 1.00 29.57 ? 156 ILE A C     1 
ATOM   1270 O O     . ILE A 1 156 ? 37.151 69.959 113.516 1.00 29.22 ? 156 ILE A O     1 
ATOM   1271 C CB    . ILE A 1 156 ? 38.684 67.831 111.880 1.00 27.08 ? 156 ILE A CB    1 
ATOM   1272 C CG1   . ILE A 1 156 ? 39.378 67.475 110.543 1.00 29.37 ? 156 ILE A CG1   1 
ATOM   1273 C CG2   . ILE A 1 156 ? 38.650 66.633 112.678 1.00 29.19 ? 156 ILE A CG2   1 
ATOM   1274 C CD1   . ILE A 1 156 ? 38.807 66.306 109.498 1.00 13.12 ? 156 ILE A CD1   1 
ATOM   1275 N N     . ILE A 1 157 ? 35.862 68.050 113.614 1.00 29.07 ? 157 ILE A N     1 
ATOM   1276 C CA    . ILE A 1 157 ? 35.306 68.291 114.897 1.00 28.61 ? 157 ILE A CA    1 
ATOM   1277 C C     . ILE A 1 157 ? 35.679 67.171 115.843 1.00 29.10 ? 157 ILE A C     1 
ATOM   1278 O O     . ILE A 1 157 ? 35.249 65.948 115.631 1.00 27.23 ? 157 ILE A O     1 
ATOM   1279 C CB    . ILE A 1 157 ? 33.841 68.358 114.849 1.00 28.35 ? 157 ILE A CB    1 
ATOM   1280 C CG1   . ILE A 1 157 ? 33.445 69.510 113.999 1.00 31.30 ? 157 ILE A CG1   1 
ATOM   1281 C CG2   . ILE A 1 157 ? 33.311 68.624 116.280 1.00 28.43 ? 157 ILE A CG2   1 
ATOM   1282 C CD1   . ILE A 1 157 ? 32.444 70.362 114.753 1.00 37.34 ? 157 ILE A CD1   1 
ATOM   1283 N N     . ASP A 1 158 ? 36.437 67.591 116.880 1.00 28.60 ? 158 ASP A N     1 
ATOM   1284 C CA    . ASP A 1 158 ? 37.018 66.700 117.847 1.00 29.51 ? 158 ASP A CA    1 
ATOM   1285 C C     . ASP A 1 158 ? 36.706 67.255 119.246 1.00 32.04 ? 158 ASP A C     1 
ATOM   1286 O O     . ASP A 1 158 ? 37.529 67.938 119.965 1.00 33.89 ? 158 ASP A O     1 
ATOM   1287 C CB    . ASP A 1 158 ? 38.505 66.553 117.570 1.00 29.20 ? 158 ASP A CB    1 
ATOM   1288 C CG    . ASP A 1 158 ? 39.190 65.466 118.480 1.00 30.86 ? 158 ASP A CG    1 
ATOM   1289 O OD1   . ASP A 1 158 ? 40.403 65.667 118.897 1.00 29.49 ? 158 ASP A OD1   1 
ATOM   1290 O OD2   . ASP A 1 158 ? 38.523 64.411 118.765 1.00 25.24 ? 158 ASP A OD2   1 
ATOM   1291 N N     . LEU A 1 159 ? 35.466 66.993 119.629 1.00 32.89 ? 159 LEU A N     1 
ATOM   1292 C CA    . LEU A 1 159 ? 34.895 67.537 120.838 1.00 32.96 ? 159 LEU A CA    1 
ATOM   1293 C C     . LEU A 1 159 ? 34.513 66.386 121.748 1.00 35.26 ? 159 LEU A C     1 
ATOM   1294 O O     . LEU A 1 159 ? 34.700 65.224 121.398 1.00 35.80 ? 159 LEU A O     1 
ATOM   1295 C CB    . LEU A 1 159 ? 33.641 68.321 120.509 1.00 31.30 ? 159 LEU A CB    1 
ATOM   1296 C CG    . LEU A 1 159 ? 33.830 69.585 119.752 1.00 23.53 ? 159 LEU A CG    1 
ATOM   1297 C CD1   . LEU A 1 159 ? 32.483 70.054 119.633 1.00 13.74 ? 159 LEU A CD1   1 
ATOM   1298 C CD2   . LEU A 1 159 ? 34.723 70.619 120.484 1.00 20.10 ? 159 LEU A CD2   1 
ATOM   1299 N N     . THR A 1 160 ? 33.921 66.714 122.897 1.00 37.40 ? 160 THR A N     1 
ATOM   1300 C CA    . THR A 1 160 ? 33.848 65.791 124.040 1.00 38.02 ? 160 THR A CA    1 
ATOM   1301 C C     . THR A 1 160 ? 32.374 65.502 124.283 1.00 38.74 ? 160 THR A C     1 
ATOM   1302 O O     . THR A 1 160 ? 31.586 66.416 124.278 1.00 37.94 ? 160 THR A O     1 
ATOM   1303 C CB    . THR A 1 160 ? 34.527 66.491 125.277 1.00 38.80 ? 160 THR A CB    1 
ATOM   1304 O OG1   . THR A 1 160 ? 33.693 67.566 125.760 1.00 36.16 ? 160 THR A OG1   1 
ATOM   1305 C CG2   . THR A 1 160 ? 35.962 67.051 124.915 1.00 36.94 ? 160 THR A CG2   1 
ATOM   1306 N N     . ASP A 1 161 ? 31.956 64.248 124.434 1.00 41.11 ? 161 ASP A N     1 
ATOM   1307 C CA    . ASP A 1 161 ? 30.478 63.995 124.374 1.00 43.03 ? 161 ASP A CA    1 
ATOM   1308 C C     . ASP A 1 161 ? 29.651 65.050 125.091 1.00 42.99 ? 161 ASP A C     1 
ATOM   1309 O O     . ASP A 1 161 ? 30.115 65.677 126.004 1.00 43.55 ? 161 ASP A O     1 
ATOM   1310 C CB    . ASP A 1 161 ? 30.082 62.562 124.786 1.00 43.89 ? 161 ASP A CB    1 
ATOM   1311 C CG    . ASP A 1 161 ? 30.681 61.494 123.832 1.00 47.27 ? 161 ASP A CG    1 
ATOM   1312 O OD1   . ASP A 1 161 ? 31.570 61.934 123.027 1.00 48.04 ? 161 ASP A OD1   1 
ATOM   1313 O OD2   . ASP A 1 161 ? 30.289 60.254 123.911 1.00 47.25 ? 161 ASP A OD2   1 
ATOM   1314 N N     . PRO A 1 162 ? 28.419 65.298 124.662 1.00 43.97 ? 162 PRO A N     1 
ATOM   1315 C CA    . PRO A 1 162 ? 27.792 66.283 125.562 1.00 44.62 ? 162 PRO A CA    1 
ATOM   1316 C C     . PRO A 1 162 ? 27.094 65.559 126.690 1.00 46.03 ? 162 PRO A C     1 
ATOM   1317 O O     . PRO A 1 162 ? 25.959 65.109 126.535 1.00 45.81 ? 162 PRO A O     1 
ATOM   1318 C CB    . PRO A 1 162 ? 26.811 67.023 124.668 1.00 44.64 ? 162 PRO A CB    1 
ATOM   1319 C CG    . PRO A 1 162 ? 26.545 65.990 123.484 1.00 43.86 ? 162 PRO A CG    1 
ATOM   1320 C CD    . PRO A 1 162 ? 27.560 64.891 123.536 1.00 42.91 ? 162 PRO A CD    1 
ATOM   1321 N N     . VAL A 1 163 ? 27.797 65.413 127.825 1.00 48.18 ? 163 VAL A N     1 
ATOM   1322 C CA    . VAL A 1 163 ? 27.316 64.487 128.909 1.00 49.12 ? 163 VAL A CA    1 
ATOM   1323 C C     . VAL A 1 163 ? 26.834 65.177 130.157 1.00 49.64 ? 163 VAL A C     1 
ATOM   1324 O O     . VAL A 1 163 ? 27.544 65.953 130.792 1.00 50.05 ? 163 VAL A O     1 
ATOM   1325 C CB    . VAL A 1 163 ? 28.355 63.362 129.332 1.00 49.41 ? 163 VAL A CB    1 
ATOM   1326 C CG1   . VAL A 1 163 ? 27.794 62.492 130.471 1.00 48.51 ? 163 VAL A CG1   1 
ATOM   1327 C CG2   . VAL A 1 163 ? 28.807 62.465 128.128 1.00 50.31 ? 163 VAL A CG2   1 
ATOM   1328 N N     . GLY A 1 164 ? 25.602 64.848 130.514 1.00 51.32 ? 164 GLY A N     1 
ATOM   1329 C CA    . GLY A 1 164 ? 24.856 65.505 131.613 1.00 50.81 ? 164 GLY A CA    1 
ATOM   1330 C C     . GLY A 1 164 ? 24.209 66.814 131.184 1.00 50.17 ? 164 GLY A C     1 
ATOM   1331 O O     . GLY A 1 164 ? 24.745 67.537 130.330 1.00 49.12 ? 164 GLY A O     1 
ATOM   1332 N N     . GLU A 1 165 ? 23.084 67.111 131.845 1.00 51.40 ? 165 GLU A N     1 
ATOM   1333 C CA    . GLU A 1 165 ? 22.254 68.335 131.687 1.00 52.21 ? 165 GLU A CA    1 
ATOM   1334 C C     . GLU A 1 165 ? 22.925 69.733 131.760 1.00 52.21 ? 165 GLU A C     1 
ATOM   1335 O O     . GLU A 1 165 ? 22.762 70.533 130.839 1.00 51.90 ? 165 GLU A O     1 
ATOM   1336 C CB    . GLU A 1 165 ? 21.135 68.289 132.699 1.00 52.41 ? 165 GLU A CB    1 
ATOM   1337 C CG    . GLU A 1 165 ? 20.284 69.533 132.665 1.00 54.35 ? 165 GLU A CG    1 
ATOM   1338 C CD    . GLU A 1 165 ? 18.844 69.166 132.753 1.00 55.10 ? 165 GLU A CD    1 
ATOM   1339 O OE1   . GLU A 1 165 ? 18.540 68.136 133.409 1.00 55.65 ? 165 GLU A OE1   1 
ATOM   1340 O OE2   . GLU A 1 165 ? 18.036 69.903 132.165 1.00 56.23 ? 165 GLU A OE2   1 
ATOM   1341 N N     . ASP A 1 166 ? 23.651 70.014 132.841 1.00 52.46 ? 166 ASP A N     1 
ATOM   1342 C CA    . ASP A 1 166 ? 24.363 71.270 132.948 1.00 53.77 ? 166 ASP A CA    1 
ATOM   1343 C C     . ASP A 1 166 ? 25.460 71.555 131.880 1.00 53.45 ? 166 ASP A C     1 
ATOM   1344 O O     . ASP A 1 166 ? 25.710 72.719 131.584 1.00 54.51 ? 166 ASP A O     1 
ATOM   1345 C CB    . ASP A 1 166 ? 24.805 71.607 134.409 1.00 54.54 ? 166 ASP A CB    1 
ATOM   1346 C CG    . ASP A 1 166 ? 25.634 70.443 135.125 1.00 58.18 ? 166 ASP A CG    1 
ATOM   1347 O OD1   . ASP A 1 166 ? 25.610 69.236 134.647 1.00 59.00 ? 166 ASP A OD1   1 
ATOM   1348 O OD2   . ASP A 1 166 ? 26.275 70.764 136.193 1.00 55.17 ? 166 ASP A OD2   1 
ATOM   1349 N N     . ASN A 1 167 ? 26.074 70.538 131.289 1.00 53.41 ? 167 ASN A N     1 
ATOM   1350 C CA    . ASN A 1 167 ? 27.188 70.711 130.315 1.00 53.84 ? 167 ASN A CA    1 
ATOM   1351 C C     . ASN A 1 167 ? 26.960 71.791 129.217 1.00 53.54 ? 167 ASN A C     1 
ATOM   1352 O O     . ASN A 1 167 ? 25.897 71.880 128.644 1.00 53.02 ? 167 ASN A O     1 
ATOM   1353 C CB    . ASN A 1 167 ? 27.476 69.357 129.668 1.00 54.52 ? 167 ASN A CB    1 
ATOM   1354 C CG    . ASN A 1 167 ? 28.894 69.215 129.130 1.00 56.39 ? 167 ASN A CG    1 
ATOM   1355 O OD1   . ASN A 1 167 ? 29.539 70.165 128.627 1.00 55.61 ? 167 ASN A OD1   1 
ATOM   1356 N ND2   . ASN A 1 167 ? 29.367 67.967 129.177 1.00 58.39 ? 167 ASN A ND2   1 
ATOM   1357 N N     . PRO A 1 168 ? 27.935 72.680 128.990 1.00 53.87 ? 168 PRO A N     1 
ATOM   1358 C CA    . PRO A 1 168 ? 27.743 73.640 127.893 1.00 53.75 ? 168 PRO A CA    1 
ATOM   1359 C C     . PRO A 1 168 ? 28.304 73.180 126.567 1.00 52.59 ? 168 PRO A C     1 
ATOM   1360 O O     . PRO A 1 168 ? 28.306 73.980 125.626 1.00 51.90 ? 168 PRO A O     1 
ATOM   1361 C CB    . PRO A 1 168 ? 28.600 74.809 128.333 1.00 54.22 ? 168 PRO A CB    1 
ATOM   1362 C CG    . PRO A 1 168 ? 29.832 74.039 128.892 1.00 55.23 ? 168 PRO A CG    1 
ATOM   1363 C CD    . PRO A 1 168 ? 29.196 72.935 129.718 1.00 53.52 ? 168 PRO A CD    1 
ATOM   1364 N N     . ALA A 1 169 ? 28.803 71.937 126.493 1.00 52.74 ? 169 ALA A N     1 
ATOM   1365 C CA    . ALA A 1 169 ? 29.319 71.393 125.187 1.00 52.50 ? 169 ALA A CA    1 
ATOM   1366 C C     . ALA A 1 169 ? 28.113 71.042 124.359 1.00 51.70 ? 169 ALA A C     1 
ATOM   1367 O O     . ALA A 1 169 ? 28.201 70.887 123.150 1.00 52.25 ? 169 ALA A O     1 
ATOM   1368 C CB    . ALA A 1 169 ? 30.281 70.208 125.337 1.00 51.42 ? 169 ALA A CB    1 
ATOM   1369 N N     . ARG A 1 170 ? 26.968 71.018 125.036 1.00 50.32 ? 170 ARG A N     1 
ATOM   1370 C CA    . ARG A 1 170 ? 25.705 70.748 124.395 1.00 49.12 ? 170 ARG A CA    1 
ATOM   1371 C C     . ARG A 1 170 ? 25.368 71.658 123.226 1.00 47.72 ? 170 ARG A C     1 
ATOM   1372 O O     . ARG A 1 170 ? 24.888 71.177 122.213 1.00 48.25 ? 170 ARG A O     1 
ATOM   1373 C CB    . ARG A 1 170 ? 24.556 70.861 125.386 1.00 49.20 ? 170 ARG A CB    1 
ATOM   1374 C CG    . ARG A 1 170 ? 24.459 69.785 126.370 1.00 47.13 ? 170 ARG A CG    1 
ATOM   1375 C CD    . ARG A 1 170 ? 23.528 70.299 127.451 1.00 46.75 ? 170 ARG A CD    1 
ATOM   1376 N NE    . ARG A 1 170 ? 22.155 70.126 127.026 1.00 47.54 ? 170 ARG A NE    1 
ATOM   1377 C CZ    . ARG A 1 170 ? 21.099 70.540 127.701 1.00 41.51 ? 170 ARG A CZ    1 
ATOM   1378 N NH1   . ARG A 1 170 ? 19.882 70.308 127.215 1.00 33.87 ? 170 ARG A NH1   1 
ATOM   1379 N NH2   . ARG A 1 170 ? 21.294 71.156 128.853 1.00 38.98 ? 170 ARG A NH2   1 
ATOM   1380 N N     . LEU A 1 171 ? 25.559 72.964 123.375 1.00 45.61 ? 171 LEU A N     1 
ATOM   1381 C CA    . LEU A 1 171 ? 25.212 73.874 122.298 1.00 42.80 ? 171 LEU A CA    1 
ATOM   1382 C C     . LEU A 1 171 ? 26.178 73.671 121.126 1.00 42.14 ? 171 LEU A C     1 
ATOM   1383 O O     . LEU A 1 171 ? 26.180 74.442 120.151 1.00 41.81 ? 171 LEU A O     1 
ATOM   1384 C CB    . LEU A 1 171 ? 25.189 75.334 122.759 1.00 42.29 ? 171 LEU A CB    1 
ATOM   1385 C CG    . LEU A 1 171 ? 24.475 75.818 124.005 1.00 41.85 ? 171 LEU A CG    1 
ATOM   1386 C CD1   . LEU A 1 171 ? 24.678 77.325 124.156 1.00 41.63 ? 171 LEU A CD1   1 
ATOM   1387 C CD2   . LEU A 1 171 ? 23.017 75.495 123.884 1.00 40.45 ? 171 LEU A CD2   1 
ATOM   1388 N N     . LEU A 1 172 ? 26.970 72.616 121.192 1.00 41.81 ? 172 LEU A N     1 
ATOM   1389 C CA    . LEU A 1 172 ? 27.876 72.308 120.084 1.00 42.48 ? 172 LEU A CA    1 
ATOM   1390 C C     . LEU A 1 172 ? 27.482 71.081 119.286 1.00 41.59 ? 172 LEU A C     1 
ATOM   1391 O O     . LEU A 1 172 ? 28.082 70.757 118.230 1.00 41.84 ? 172 LEU A O     1 
ATOM   1392 C CB    . LEU A 1 172 ? 29.322 72.226 120.579 1.00 43.41 ? 172 LEU A CB    1 
ATOM   1393 C CG    . LEU A 1 172 ? 29.918 73.585 121.031 1.00 44.82 ? 172 LEU A CG    1 
ATOM   1394 C CD1   . LEU A 1 172 ? 30.870 73.426 122.225 1.00 41.20 ? 172 LEU A CD1   1 
ATOM   1395 C CD2   . LEU A 1 172 ? 30.560 74.303 119.850 1.00 45.59 ? 172 LEU A CD2   1 
ATOM   1396 N N     . TYR A 1 173 ? 26.430 70.429 119.759 1.00 39.57 ? 173 TYR A N     1 
ATOM   1397 C CA    . TYR A 1 173 ? 25.945 69.248 119.097 1.00 37.53 ? 173 TYR A CA    1 
ATOM   1398 C C     . TYR A 1 173 ? 24.514 69.401 118.577 1.00 37.30 ? 173 TYR A C     1 
ATOM   1399 O O     . TYR A 1 173 ? 23.824 68.418 118.378 1.00 38.05 ? 173 TYR A O     1 
ATOM   1400 C CB    . TYR A 1 173 ? 25.984 68.139 120.083 1.00 36.72 ? 173 TYR A CB    1 
ATOM   1401 C CG    . TYR A 1 173 ? 27.323 67.537 120.289 1.00 35.11 ? 173 TYR A CG    1 
ATOM   1402 C CD1   . TYR A 1 173 ? 28.248 68.090 121.148 1.00 34.85 ? 173 TYR A CD1   1 
ATOM   1403 C CD2   . TYR A 1 173 ? 27.649 66.399 119.643 1.00 32.95 ? 173 TYR A CD2   1 
ATOM   1404 C CE1   . TYR A 1 173 ? 29.504 67.519 121.313 1.00 33.90 ? 173 TYR A CE1   1 
ATOM   1405 C CE2   . TYR A 1 173 ? 28.843 65.815 119.805 1.00 34.82 ? 173 TYR A CE2   1 
ATOM   1406 C CZ    . TYR A 1 173 ? 29.809 66.346 120.636 1.00 36.31 ? 173 TYR A CZ    1 
ATOM   1407 O OH    . TYR A 1 173 ? 31.053 65.632 120.747 1.00 37.50 ? 173 TYR A OH    1 
ATOM   1408 N N     . THR A 1 174 ? 24.067 70.631 118.388 1.00 36.04 ? 174 THR A N     1 
ATOM   1409 C CA    . THR A 1 174 ? 22.814 70.958 117.705 1.00 34.57 ? 174 THR A CA    1 
ATOM   1410 C C     . THR A 1 174 ? 22.934 71.120 116.174 1.00 34.31 ? 174 THR A C     1 
ATOM   1411 O O     . THR A 1 174 ? 24.010 71.297 115.582 1.00 33.42 ? 174 THR A O     1 
ATOM   1412 C CB    . THR A 1 174 ? 22.335 72.312 118.160 1.00 35.09 ? 174 THR A CB    1 
ATOM   1413 O OG1   . THR A 1 174 ? 23.253 73.306 117.643 1.00 36.40 ? 174 THR A OG1   1 
ATOM   1414 C CG2   . THR A 1 174 ? 22.266 72.397 119.687 1.00 32.16 ? 174 THR A CG2   1 
ATOM   1415 N N     . VAL A 1 175 ? 21.788 71.103 115.532 1.00 34.07 ? 175 VAL A N     1 
ATOM   1416 C CA    . VAL A 1 175 ? 21.761 71.204 114.118 1.00 34.06 ? 175 VAL A CA    1 
ATOM   1417 C C     . VAL A 1 175 ? 22.137 72.618 113.800 1.00 34.35 ? 175 VAL A C     1 
ATOM   1418 O O     . VAL A 1 175 ? 22.943 72.865 112.908 1.00 35.04 ? 175 VAL A O     1 
ATOM   1419 C CB    . VAL A 1 175 ? 20.399 70.751 113.536 1.00 34.33 ? 175 VAL A CB    1 
ATOM   1420 C CG1   . VAL A 1 175 ? 19.243 71.456 114.222 1.00 33.68 ? 175 VAL A CG1   1 
ATOM   1421 C CG2   . VAL A 1 175 ? 20.362 71.023 112.079 1.00 35.89 ? 175 VAL A CG2   1 
ATOM   1422 N N     . GLU A 1 176 ? 21.604 73.576 114.548 1.00 34.41 ? 176 GLU A N     1 
ATOM   1423 C CA    . GLU A 1 176 ? 22.103 74.907 114.321 1.00 34.16 ? 176 GLU A CA    1 
ATOM   1424 C C     . GLU A 1 176 ? 23.656 74.977 114.280 1.00 32.86 ? 176 GLU A C     1 
ATOM   1425 O O     . GLU A 1 176 ? 24.210 75.742 113.451 1.00 31.77 ? 176 GLU A O     1 
ATOM   1426 C CB    . GLU A 1 176 ? 21.548 75.836 115.345 1.00 35.12 ? 176 GLU A CB    1 
ATOM   1427 C CG    . GLU A 1 176 ? 20.176 76.259 115.032 1.00 39.27 ? 176 GLU A CG    1 
ATOM   1428 C CD    . GLU A 1 176 ? 19.124 75.270 115.577 1.00 46.73 ? 176 GLU A CD    1 
ATOM   1429 O OE1   . GLU A 1 176 ? 18.021 75.252 114.947 1.00 51.52 ? 176 GLU A OE1   1 
ATOM   1430 O OE2   . GLU A 1 176 ? 19.372 74.546 116.596 1.00 43.41 ? 176 GLU A OE2   1 
ATOM   1431 N N     . PHE A 1 177 ? 24.348 74.207 115.151 1.00 31.27 ? 177 PHE A N     1 
ATOM   1432 C CA    . PHE A 1 177 ? 25.824 74.191 115.131 1.00 30.19 ? 177 PHE A CA    1 
ATOM   1433 C C     . PHE A 1 177 ? 26.435 73.668 113.813 1.00 29.51 ? 177 PHE A C     1 
ATOM   1434 O O     . PHE A 1 177 ? 27.616 73.941 113.499 1.00 30.02 ? 177 PHE A O     1 
ATOM   1435 C CB    . PHE A 1 177 ? 26.488 73.446 116.310 1.00 29.82 ? 177 PHE A CB    1 
ATOM   1436 C CG    . PHE A 1 177 ? 28.038 73.557 116.305 1.00 31.15 ? 177 PHE A CG    1 
ATOM   1437 C CD1   . PHE A 1 177 ? 28.843 72.466 116.075 1.00 27.91 ? 177 PHE A CD1   1 
ATOM   1438 C CD2   . PHE A 1 177 ? 28.670 74.787 116.510 1.00 34.15 ? 177 PHE A CD2   1 
ATOM   1439 C CE1   . PHE A 1 177 ? 30.211 72.599 116.039 1.00 25.81 ? 177 PHE A CE1   1 
ATOM   1440 C CE2   . PHE A 1 177 ? 30.059 74.916 116.475 1.00 31.73 ? 177 PHE A CE2   1 
ATOM   1441 C CZ    . PHE A 1 177 ? 30.826 73.798 116.251 1.00 27.90 ? 177 PHE A CZ    1 
ATOM   1442 N N     . TYR A 1 178 ? 25.673 72.888 113.082 1.00 26.94 ? 178 TYR A N     1 
ATOM   1443 C CA    . TYR A 1 178 ? 26.257 72.120 112.077 1.00 26.05 ? 178 TYR A CA    1 
ATOM   1444 C C     . TYR A 1 178 ? 25.948 72.859 110.841 1.00 28.67 ? 178 TYR A C     1 
ATOM   1445 O O     . TYR A 1 178 ? 26.785 72.894 109.950 1.00 29.70 ? 178 TYR A O     1 
ATOM   1446 C CB    . TYR A 1 178 ? 25.635 70.754 112.031 1.00 24.23 ? 178 TYR A CB    1 
ATOM   1447 C CG    . TYR A 1 178 ? 26.035 69.824 113.164 1.00 26.49 ? 178 TYR A CG    1 
ATOM   1448 C CD1   . TYR A 1 178 ? 25.077 69.057 113.825 1.00 25.53 ? 178 TYR A CD1   1 
ATOM   1449 C CD2   . TYR A 1 178 ? 27.365 69.716 113.617 1.00 22.61 ? 178 TYR A CD2   1 
ATOM   1450 C CE1   . TYR A 1 178 ? 25.461 68.181 114.882 1.00 26.27 ? 178 TYR A CE1   1 
ATOM   1451 C CE2   . TYR A 1 178 ? 27.723 68.878 114.646 1.00 19.18 ? 178 TYR A CE2   1 
ATOM   1452 C CZ    . TYR A 1 178 ? 26.780 68.115 115.274 1.00 22.54 ? 178 TYR A CZ    1 
ATOM   1453 O OH    . TYR A 1 178 ? 27.086 67.259 116.297 1.00 25.76 ? 178 TYR A OH    1 
ATOM   1454 N N     . ARG A 1 179 ? 24.749 73.447 110.747 1.00 28.94 ? 179 ARG A N     1 
ATOM   1455 C CA    . ARG A 1 179 ? 24.505 74.425 109.705 1.00 29.61 ? 179 ARG A CA    1 
ATOM   1456 C C     . ARG A 1 179 ? 25.560 75.514 109.837 1.00 29.79 ? 179 ARG A C     1 
ATOM   1457 O O     . ARG A 1 179 ? 25.805 76.270 108.901 1.00 29.60 ? 179 ARG A O     1 
ATOM   1458 C CB    . ARG A 1 179 ? 23.135 75.057 109.869 1.00 29.14 ? 179 ARG A CB    1 
ATOM   1459 C CG    . ARG A 1 179 ? 22.082 74.091 109.990 1.00 31.03 ? 179 ARG A CG    1 
ATOM   1460 C CD    . ARG A 1 179 ? 21.001 74.347 108.960 1.00 31.77 ? 179 ARG A CD    1 
ATOM   1461 N NE    . ARG A 1 179 ? 20.012 73.242 108.968 1.00 28.60 ? 179 ARG A NE    1 
ATOM   1462 C CZ    . ARG A 1 179 ? 18.860 73.255 109.624 1.00 24.86 ? 179 ARG A CZ    1 
ATOM   1463 N NH1   . ARG A 1 179 ? 18.073 72.180 109.572 1.00 22.58 ? 179 ARG A NH1   1 
ATOM   1464 N NH2   . ARG A 1 179 ? 18.504 74.328 110.353 1.00 24.58 ? 179 ARG A NH2   1 
ATOM   1465 N N     . LEU A 1 180 ? 26.117 75.649 111.027 1.00 29.71 ? 180 LEU A N     1 
ATOM   1466 C CA    . LEU A 1 180 ? 27.044 76.749 111.274 1.00 30.96 ? 180 LEU A CA    1 
ATOM   1467 C C     . LEU A 1 180 ? 28.417 76.337 110.869 1.00 31.25 ? 180 LEU A C     1 
ATOM   1468 O O     . LEU A 1 180 ? 29.142 77.146 110.292 1.00 32.75 ? 180 LEU A O     1 
ATOM   1469 C CB    . LEU A 1 180 ? 27.064 77.184 112.722 1.00 30.01 ? 180 LEU A CB    1 
ATOM   1470 C CG    . LEU A 1 180 ? 27.920 78.409 112.958 1.00 33.25 ? 180 LEU A CG    1 
ATOM   1471 C CD1   . LEU A 1 180 ? 27.501 79.720 112.147 1.00 32.73 ? 180 LEU A CD1   1 
ATOM   1472 C CD2   . LEU A 1 180 ? 27.904 78.649 114.454 1.00 34.92 ? 180 LEU A CD2   1 
ATOM   1473 N N     . VAL A 1 181 ? 28.782 75.083 111.156 1.00 31.42 ? 181 VAL A N     1 
ATOM   1474 C CA    . VAL A 1 181 ? 29.904 74.443 110.472 1.00 31.42 ? 181 VAL A CA    1 
ATOM   1475 C C     . VAL A 1 181 ? 29.690 74.553 108.876 1.00 33.37 ? 181 VAL A C     1 
ATOM   1476 O O     . VAL A 1 181 ? 30.482 75.215 108.174 1.00 32.65 ? 181 VAL A O     1 
ATOM   1477 C CB    . VAL A 1 181 ? 30.179 73.003 111.033 1.00 30.39 ? 181 VAL A CB    1 
ATOM   1478 C CG1   . VAL A 1 181 ? 31.107 72.201 110.074 1.00 22.23 ? 181 VAL A CG1   1 
ATOM   1479 C CG2   . VAL A 1 181 ? 30.663 73.026 112.677 1.00 25.14 ? 181 VAL A CG2   1 
ATOM   1480 N N     . LYS A 1 182 ? 28.613 73.975 108.348 1.00 33.87 ? 182 LYS A N     1 
ATOM   1481 C CA    . LYS A 1 182 ? 28.235 74.096 106.947 1.00 35.63 ? 182 LYS A CA    1 
ATOM   1482 C C     . LYS A 1 182 ? 28.356 75.500 106.357 1.00 38.26 ? 182 LYS A C     1 
ATOM   1483 O O     . LYS A 1 182 ? 28.943 75.705 105.228 1.00 40.41 ? 182 LYS A O     1 
ATOM   1484 C CB    . LYS A 1 182 ? 26.779 73.689 106.743 1.00 36.29 ? 182 LYS A CB    1 
ATOM   1485 C CG    . LYS A 1 182 ? 26.678 72.577 105.727 1.00 36.84 ? 182 LYS A CG    1 
ATOM   1486 C CD    . LYS A 1 182 ? 25.797 72.875 104.524 1.00 38.54 ? 182 LYS A CD    1 
ATOM   1487 C CE    . LYS A 1 182 ? 24.373 73.320 104.856 1.00 41.21 ? 182 LYS A CE    1 
ATOM   1488 N NZ    . LYS A 1 182 ? 23.429 72.750 103.809 1.00 41.25 ? 182 LYS A NZ    1 
ATOM   1489 N N     . ALA A 1 183 ? 27.803 76.460 107.081 1.00 38.57 ? 183 ALA A N     1 
ATOM   1490 C CA    . ALA A 1 183 ? 27.834 77.845 106.644 1.00 40.07 ? 183 ALA A CA    1 
ATOM   1491 C C     . ALA A 1 183 ? 29.269 78.205 106.347 1.00 41.90 ? 183 ALA A C     1 
ATOM   1492 O O     . ALA A 1 183 ? 29.502 78.939 105.404 1.00 44.38 ? 183 ALA A O     1 
ATOM   1493 C CB    . ALA A 1 183 ? 27.243 78.785 107.681 1.00 38.17 ? 183 ALA A CB    1 
ATOM   1494 N N     . HIS A 1 184 ? 30.239 77.698 107.108 1.00 43.15 ? 184 HIS A N     1 
ATOM   1495 C CA    . HIS A 1 184 ? 31.612 78.007 106.811 1.00 44.17 ? 184 HIS A CA    1 
ATOM   1496 C C     . HIS A 1 184 ? 32.387 77.093 105.888 1.00 45.13 ? 184 HIS A C     1 
ATOM   1497 O O     . HIS A 1 184 ? 33.610 76.974 106.097 1.00 46.06 ? 184 HIS A O     1 
ATOM   1498 C CB    . HIS A 1 184 ? 32.391 78.142 108.081 1.00 44.07 ? 184 HIS A CB    1 
ATOM   1499 C CG    . HIS A 1 184 ? 32.000 79.324 108.886 1.00 51.13 ? 184 HIS A CG    1 
ATOM   1500 N ND1   . HIS A 1 184 ? 30.731 79.860 108.843 1.00 58.29 ? 184 HIS A ND1   1 
ATOM   1501 C CD2   . HIS A 1 184 ? 32.696 80.068 109.788 1.00 58.09 ? 184 HIS A CD2   1 
ATOM   1502 C CE1   . HIS A 1 184 ? 30.665 80.898 109.668 1.00 62.72 ? 184 HIS A CE1   1 
ATOM   1503 N NE2   . HIS A 1 184 ? 31.840 81.036 110.266 1.00 61.69 ? 184 HIS A NE2   1 
ATOM   1504 N N     . LEU A 1 185 ? 31.762 76.473 104.874 1.00 45.79 ? 185 LEU A N     1 
ATOM   1505 C CA    . LEU A 1 185 ? 32.512 75.536 103.991 1.00 46.80 ? 185 LEU A CA    1 
ATOM   1506 C C     . LEU A 1 185 ? 32.515 75.836 102.483 1.00 48.01 ? 185 LEU A C     1 
ATOM   1507 O O     . LEU A 1 185 ? 31.477 76.170 101.894 1.00 47.71 ? 185 LEU A O     1 
ATOM   1508 C CB    . LEU A 1 185 ? 31.989 74.128 104.145 1.00 47.10 ? 185 LEU A CB    1 
ATOM   1509 C CG    . LEU A 1 185 ? 32.394 73.125 105.235 1.00 47.42 ? 185 LEU A CG    1 
ATOM   1510 C CD1   . LEU A 1 185 ? 31.675 71.797 104.932 1.00 43.73 ? 185 LEU A CD1   1 
ATOM   1511 C CD2   . LEU A 1 185 ? 33.908 72.927 105.399 1.00 43.94 ? 185 LEU A CD2   1 
ATOM   1512 N N     . ASN A 1 186 ? 33.671 75.705 101.843 1.00 49.20 ? 186 ASN A N     1 
ATOM   1513 C CA    . ASN A 1 186 ? 33.737 75.973 100.390 1.00 50.98 ? 186 ASN A CA    1 
ATOM   1514 C C     . ASN A 1 186 ? 32.878 74.964 99.642  1.00 51.62 ? 186 ASN A C     1 
ATOM   1515 O O     . ASN A 1 186 ? 32.393 73.999 100.246 1.00 51.80 ? 186 ASN A O     1 
ATOM   1516 C CB    . ASN A 1 186 ? 35.188 75.974 99.916  1.00 51.14 ? 186 ASN A CB    1 
ATOM   1517 C CG    . ASN A 1 186 ? 36.063 76.940 100.741 1.00 51.62 ? 186 ASN A CG    1 
ATOM   1518 O OD1   . ASN A 1 186 ? 37.262 76.761 100.876 1.00 50.93 ? 186 ASN A OD1   1 
ATOM   1519 N ND2   . ASN A 1 186 ? 35.439 77.947 101.332 1.00 54.81 ? 186 ASN A ND2   1 
ATOM   1520 N N     . PRO A 1 187 ? 32.590 75.204 98.359  1.00 52.27 ? 187 PRO A N     1 
ATOM   1521 C CA    . PRO A 1 187 ? 31.884 74.012 97.830  1.00 52.14 ? 187 PRO A CA    1 
ATOM   1522 C C     . PRO A 1 187 ? 32.921 72.935 97.508  1.00 51.38 ? 187 PRO A C     1 
ATOM   1523 O O     . PRO A 1 187 ? 34.095 73.234 97.248  1.00 52.12 ? 187 PRO A O     1 
ATOM   1524 C CB    . PRO A 1 187 ? 31.105 74.523 96.598  1.00 51.91 ? 187 PRO A CB    1 
ATOM   1525 C CG    . PRO A 1 187 ? 31.627 75.989 96.358  1.00 52.99 ? 187 PRO A CG    1 
ATOM   1526 C CD    . PRO A 1 187 ? 32.750 76.282 97.361  1.00 52.27 ? 187 PRO A CD    1 
ATOM   1527 N N     . GLY A 1 188 ? 32.477 71.692 97.591  1.00 50.62 ? 188 GLY A N     1 
ATOM   1528 C CA    . GLY A 1 188 ? 33.367 70.544 97.676  1.00 48.60 ? 188 GLY A CA    1 
ATOM   1529 C C     . GLY A 1 188 ? 33.884 70.204 99.080  1.00 47.26 ? 188 GLY A C     1 
ATOM   1530 O O     . GLY A 1 188 ? 34.668 69.251 99.211  1.00 48.17 ? 188 GLY A O     1 
ATOM   1531 N N     . GLY A 1 189 ? 33.472 70.950 100.118 1.00 45.05 ? 189 GLY A N     1 
ATOM   1532 C CA    . GLY A 1 189 ? 33.989 70.773 101.484 1.00 42.99 ? 189 GLY A CA    1 
ATOM   1533 C C     . GLY A 1 189 ? 33.303 69.665 102.289 1.00 42.09 ? 189 GLY A C     1 
ATOM   1534 O O     . GLY A 1 189 ? 32.145 69.392 102.059 1.00 42.06 ? 189 GLY A O     1 
ATOM   1535 N N     . VAL A 1 190 ? 34.037 69.023 103.206 1.00 41.35 ? 190 VAL A N     1 
ATOM   1536 C CA    . VAL A 1 190 ? 33.545 67.884 104.067 1.00 40.97 ? 190 VAL A CA    1 
ATOM   1537 C C     . VAL A 1 190 ? 33.817 68.054 105.517 1.00 38.13 ? 190 VAL A C     1 
ATOM   1538 O O     . VAL A 1 190 ? 34.806 68.641 105.921 1.00 38.12 ? 190 VAL A O     1 
ATOM   1539 C CB    . VAL A 1 190 ? 34.108 66.468 103.718 1.00 41.47 ? 190 VAL A CB    1 
ATOM   1540 C CG1   . VAL A 1 190 ? 33.879 66.136 102.199 1.00 43.33 ? 190 VAL A CG1   1 
ATOM   1541 C CG2   . VAL A 1 190 ? 35.561 66.321 104.078 1.00 40.04 ? 190 VAL A CG2   1 
ATOM   1542 N N     . MET A 1 191 ? 32.917 67.540 106.305 1.00 36.32 ? 191 MET A N     1 
ATOM   1543 C CA    . MET A 1 191 ? 33.081 67.667 107.731 1.00 36.20 ? 191 MET A CA    1 
ATOM   1544 C C     . MET A 1 191 ? 33.499 66.305 108.194 1.00 34.84 ? 191 MET A C     1 
ATOM   1545 O O     . MET A 1 191 ? 33.080 65.307 107.547 1.00 34.68 ? 191 MET A O     1 
ATOM   1546 C CB    . MET A 1 191 ? 31.757 68.026 108.341 1.00 36.73 ? 191 MET A CB    1 
ATOM   1547 C CG    . MET A 1 191 ? 31.859 68.739 109.565 1.00 37.56 ? 191 MET A CG    1 
ATOM   1548 S SD    . MET A 1 191 ? 31.219 67.683 110.850 1.00 41.58 ? 191 MET A SD    1 
ATOM   1549 C CE    . MET A 1 191 ? 29.490 67.636 110.523 1.00 37.42 ? 191 MET A CE    1 
ATOM   1550 N N     . GLY A 1 192 ? 34.329 66.248 109.242 1.00 32.66 ? 192 GLY A N     1 
ATOM   1551 C CA    . GLY A 1 192 ? 34.723 64.955 109.816 1.00 31.10 ? 192 GLY A CA    1 
ATOM   1552 C C     . GLY A 1 192 ? 34.551 65.055 111.312 1.00 30.76 ? 192 GLY A C     1 
ATOM   1553 O O     . GLY A 1 192 ? 34.773 66.125 111.839 1.00 31.83 ? 192 GLY A O     1 
ATOM   1554 N N     . MET A 1 193 ? 34.186 63.985 112.028 1.00 29.58 ? 193 MET A N     1 
ATOM   1555 C CA    . MET A 1 193 ? 34.013 64.109 113.492 1.00 28.29 ? 193 MET A CA    1 
ATOM   1556 C C     . MET A 1 193 ? 34.031 62.850 114.303 1.00 29.42 ? 193 MET A C     1 
ATOM   1557 O O     . MET A 1 193 ? 33.573 61.793 113.856 1.00 29.20 ? 193 MET A O     1 
ATOM   1558 C CB    . MET A 1 193 ? 32.734 64.837 113.844 1.00 28.95 ? 193 MET A CB    1 
ATOM   1559 C CG    . MET A 1 193 ? 31.547 64.149 113.346 1.00 22.32 ? 193 MET A CG    1 
ATOM   1560 S SD    . MET A 1 193 ? 30.170 65.204 113.709 1.00 24.58 ? 193 MET A SD    1 
ATOM   1561 C CE    . MET A 1 193 ? 30.070 64.989 115.534 1.00 18.24 ? 193 MET A CE    1 
ATOM   1562 N N     . GLN A 1 194 ? 34.531 62.959 115.532 1.00 29.82 ? 194 GLN A N     1 
ATOM   1563 C CA    . GLN A 1 194 ? 34.271 61.883 116.486 1.00 29.56 ? 194 GLN A CA    1 
ATOM   1564 C C     . GLN A 1 194 ? 32.797 62.125 116.859 1.00 28.94 ? 194 GLN A C     1 
ATOM   1565 O O     . GLN A 1 194 ? 32.503 63.257 117.046 1.00 28.44 ? 194 GLN A O     1 
ATOM   1566 C CB    . GLN A 1 194 ? 35.284 61.939 117.653 1.00 29.10 ? 194 GLN A CB    1 
ATOM   1567 C CG    . GLN A 1 194 ? 34.921 62.716 118.905 1.00 28.81 ? 194 GLN A CG    1 
ATOM   1568 C CD    . GLN A 1 194 ? 34.184 61.844 119.827 1.00 30.57 ? 194 GLN A CD    1 
ATOM   1569 O OE1   . GLN A 1 194 ? 34.259 60.593 119.698 1.00 28.89 ? 194 GLN A OE1   1 
ATOM   1570 N NE2   . GLN A 1 194 ? 33.378 62.450 120.717 1.00 27.29 ? 194 GLN A NE2   1 
ATOM   1571 N N     . ALA A 1 195 ? 31.894 61.107 116.786 1.00 29.66 ? 195 ALA A N     1 
ATOM   1572 C CA    . ALA A 1 195 ? 30.528 61.063 117.458 1.00 30.91 ? 195 ALA A CA    1 
ATOM   1573 C C     . ALA A 1 195 ? 30.333 60.001 118.491 1.00 32.29 ? 195 ALA A C     1 
ATOM   1574 O O     . ALA A 1 195 ? 29.468 59.207 118.287 1.00 33.41 ? 195 ALA A O     1 
ATOM   1575 C CB    . ALA A 1 195 ? 29.468 60.800 116.509 1.00 31.13 ? 195 ALA A CB    1 
ATOM   1576 N N     . GLY A 1 196 ? 31.096 59.988 119.574 1.00 33.69 ? 196 GLY A N     1 
ATOM   1577 C CA    . GLY A 1 196 ? 30.801 59.163 120.757 1.00 35.62 ? 196 GLY A CA    1 
ATOM   1578 C C     . GLY A 1 196 ? 30.847 57.664 120.600 1.00 37.28 ? 196 GLY A C     1 
ATOM   1579 O O     . GLY A 1 196 ? 30.861 57.145 119.448 1.00 37.27 ? 196 GLY A O     1 
ATOM   1580 N N     . MET A 1 197 ? 30.901 56.965 121.744 1.00 36.87 ? 197 MET A N     1 
ATOM   1581 C CA    . MET A 1 197 ? 31.105 55.503 121.716 1.00 37.39 ? 197 MET A CA    1 
ATOM   1582 C C     . MET A 1 197 ? 29.844 54.776 121.236 1.00 36.41 ? 197 MET A C     1 
ATOM   1583 O O     . MET A 1 197 ? 28.719 55.325 121.262 1.00 36.24 ? 197 MET A O     1 
ATOM   1584 C CB    . MET A 1 197 ? 31.434 54.976 123.102 1.00 35.94 ? 197 MET A CB    1 
ATOM   1585 C CG    . MET A 1 197 ? 30.248 55.076 124.000 1.00 38.52 ? 197 MET A CG    1 
ATOM   1586 S SD    . MET A 1 197 ? 30.539 54.587 125.764 1.00 41.04 ? 197 MET A SD    1 
ATOM   1587 C CE    . MET A 1 197 ? 30.897 56.218 126.422 1.00 38.81 ? 197 MET A CE    1 
ATOM   1588 N N     . ILE A 1 198 ? 30.030 53.514 120.884 1.00 33.67 ? 198 ILE A N     1 
ATOM   1589 C CA    . ILE A 1 198 ? 28.974 52.752 120.409 1.00 31.29 ? 198 ILE A CA    1 
ATOM   1590 C C     . ILE A 1 198 ? 29.079 51.644 121.334 1.00 32.98 ? 198 ILE A C     1 
ATOM   1591 O O     . ILE A 1 198 ? 30.149 51.000 121.494 1.00 30.91 ? 198 ILE A O     1 
ATOM   1592 C CB    . ILE A 1 198 ? 29.246 52.244 119.021 1.00 29.46 ? 198 ILE A CB    1 
ATOM   1593 C CG1   . ILE A 1 198 ? 29.246 53.423 118.049 1.00 29.64 ? 198 ILE A CG1   1 
ATOM   1594 C CG2   . ILE A 1 198 ? 28.167 51.317 118.639 1.00 27.53 ? 198 ILE A CG2   1 
ATOM   1595 C CD1   . ILE A 1 198 ? 29.640 53.132 116.630 1.00 24.28 ? 198 ILE A CD1   1 
ATOM   1596 N N     . LEU A 1 199 ? 27.914 51.369 121.880 1.00 36.03 ? 199 LEU A N     1 
ATOM   1597 C CA    . LEU A 1 199 ? 27.746 50.334 122.886 1.00 39.69 ? 199 LEU A CA    1 
ATOM   1598 C C     . LEU A 1 199 ? 26.274 50.255 122.907 1.00 43.16 ? 199 LEU A C     1 
ATOM   1599 O O     . LEU A 1 199 ? 25.657 50.827 123.813 1.00 44.08 ? 199 LEU A O     1 
ATOM   1600 C CB    . LEU A 1 199 ? 28.126 50.932 124.234 1.00 38.23 ? 199 LEU A CB    1 
ATOM   1601 C CG    . LEU A 1 199 ? 28.726 49.861 125.098 1.00 35.01 ? 199 LEU A CG    1 
ATOM   1602 C CD1   . LEU A 1 199 ? 30.227 49.949 124.987 1.00 30.66 ? 199 LEU A CD1   1 
ATOM   1603 C CD2   . LEU A 1 199 ? 28.299 50.197 126.392 1.00 32.64 ? 199 LEU A CD2   1 
ATOM   1604 N N     . LEU A 1 200 ? 25.669 49.690 121.872 1.00 46.60 ? 200 LEU A N     1 
ATOM   1605 C CA    . LEU A 1 200 ? 24.368 50.336 121.451 1.00 48.71 ? 200 LEU A CA    1 
ATOM   1606 C C     . LEU A 1 200 ? 23.449 49.597 122.281 1.00 49.99 ? 200 LEU A C     1 
ATOM   1607 O O     . LEU A 1 200 ? 22.209 49.882 122.383 1.00 50.33 ? 200 LEU A O     1 
ATOM   1608 C CB    . LEU A 1 200 ? 24.004 50.156 119.968 1.00 48.53 ? 200 LEU A CB    1 
ATOM   1609 C CG    . LEU A 1 200 ? 24.832 49.450 118.879 1.00 47.61 ? 200 LEU A CG    1 
ATOM   1610 C CD1   . LEU A 1 200 ? 25.482 47.925 119.128 1.00 46.45 ? 200 LEU A CD1   1 
ATOM   1611 C CD2   . LEU A 1 200 ? 23.773 49.411 117.895 1.00 45.41 ? 200 LEU A CD2   1 
ATOM   1612 N N     . THR A 1 201 ? 24.143 48.620 122.873 1.00 52.23 ? 201 THR A N     1 
ATOM   1613 C CA    . THR A 1 201 ? 23.600 47.759 123.929 1.00 55.27 ? 201 THR A CA    1 
ATOM   1614 C C     . THR A 1 201 ? 23.275 48.512 125.304 1.00 56.48 ? 201 THR A C     1 
ATOM   1615 O O     . THR A 1 201 ? 22.190 48.368 125.878 1.00 57.11 ? 201 THR A O     1 
ATOM   1616 C CB    . THR A 1 201 ? 24.338 46.336 124.024 1.00 54.62 ? 201 THR A CB    1 
ATOM   1617 O OG1   . THR A 1 201 ? 24.857 46.136 125.336 1.00 56.89 ? 201 THR A OG1   1 
ATOM   1618 C CG2   . THR A 1 201 ? 25.421 46.095 122.911 1.00 53.65 ? 201 THR A CG2   1 
ATOM   1619 N N     . HIS A 1 202 ? 24.116 49.386 125.793 1.00 57.12 ? 202 HIS A N     1 
ATOM   1620 C CA    . HIS A 1 202 ? 23.474 50.361 126.596 1.00 59.24 ? 202 HIS A CA    1 
ATOM   1621 C C     . HIS A 1 202 ? 22.708 51.289 125.567 1.00 60.35 ? 202 HIS A C     1 
ATOM   1622 O O     . HIS A 1 202 ? 21.442 51.135 125.378 1.00 60.95 ? 202 HIS A O     1 
ATOM   1623 C CB    . HIS A 1 202 ? 24.483 51.084 127.509 1.00 60.59 ? 202 HIS A CB    1 
ATOM   1624 C CG    . HIS A 1 202 ? 25.229 50.186 128.503 1.00 66.94 ? 202 HIS A CG    1 
ATOM   1625 N ND1   . HIS A 1 202 ? 25.621 48.879 128.229 1.00 69.44 ? 202 HIS A ND1   1 
ATOM   1626 C CD2   . HIS A 1 202 ? 25.709 50.450 129.755 1.00 69.57 ? 202 HIS A CD2   1 
ATOM   1627 C CE1   . HIS A 1 202 ? 26.297 48.388 129.260 1.00 68.30 ? 202 HIS A CE1   1 
ATOM   1628 N NE2   . HIS A 1 202 ? 26.365 49.318 130.200 1.00 68.29 ? 202 HIS A NE2   1 
ATOM   1629 N N     . HIS A 1 203 ? 23.461 52.132 124.801 1.00 59.67 ? 203 HIS A N     1 
ATOM   1630 C CA    . HIS A 1 203 ? 22.970 53.501 124.404 1.00 58.10 ? 203 HIS A CA    1 
ATOM   1631 C C     . HIS A 1 203 ? 23.472 54.312 123.129 1.00 55.08 ? 203 HIS A C     1 
ATOM   1632 O O     . HIS A 1 203 ? 24.303 53.845 122.295 1.00 54.84 ? 203 HIS A O     1 
ATOM   1633 C CB    . HIS A 1 203 ? 23.205 54.383 125.623 1.00 59.56 ? 203 HIS A CB    1 
ATOM   1634 C CG    . HIS A 1 203 ? 24.614 54.274 126.166 1.00 65.29 ? 203 HIS A CG    1 
ATOM   1635 N ND1   . HIS A 1 203 ? 25.675 55.015 125.663 1.00 68.61 ? 203 HIS A ND1   1 
ATOM   1636 C CD2   . HIS A 1 203 ? 25.131 53.500 127.165 1.00 67.11 ? 203 HIS A CD2   1 
ATOM   1637 C CE1   . HIS A 1 203 ? 26.773 54.708 126.339 1.00 70.06 ? 203 HIS A CE1   1 
ATOM   1638 N NE2   . HIS A 1 203 ? 26.472 53.789 127.249 1.00 69.22 ? 203 HIS A NE2   1 
ATOM   1639 N N     . ARG A 1 204 ? 23.028 55.581 123.111 1.00 49.96 ? 204 ARG A N     1 
ATOM   1640 C CA    . ARG A 1 204 ? 22.517 56.257 121.929 1.00 45.13 ? 204 ARG A CA    1 
ATOM   1641 C C     . ARG A 1 204 ? 23.254 57.527 121.446 1.00 42.30 ? 204 ARG A C     1 
ATOM   1642 O O     . ARG A 1 204 ? 22.890 58.092 120.405 1.00 41.42 ? 204 ARG A O     1 
ATOM   1643 C CB    . ARG A 1 204 ? 20.986 56.568 122.155 1.00 46.12 ? 204 ARG A CB    1 
ATOM   1644 C CG    . ARG A 1 204 ? 19.927 55.806 121.180 1.00 42.51 ? 204 ARG A CG    1 
ATOM   1645 C CD    . ARG A 1 204 ? 18.422 55.975 121.636 1.00 44.04 ? 204 ARG A CD    1 
ATOM   1646 N NE    . ARG A 1 204 ? 17.866 57.328 121.316 1.00 42.44 ? 204 ARG A NE    1 
ATOM   1647 C CZ    . ARG A 1 204 ? 16.835 57.961 121.903 1.00 39.10 ? 204 ARG A CZ    1 
ATOM   1648 N NH1   . ARG A 1 204 ? 16.140 57.417 122.882 1.00 41.70 ? 204 ARG A NH1   1 
ATOM   1649 N NH2   . ARG A 1 204 ? 16.470 59.165 121.495 1.00 39.36 ? 204 ARG A NH2   1 
ATOM   1650 N N     . VAL A 1 205 ? 24.258 58.008 122.167 1.00 37.85 ? 205 VAL A N     1 
ATOM   1651 C CA    . VAL A 1 205 ? 25.004 59.120 121.626 1.00 34.55 ? 205 VAL A CA    1 
ATOM   1652 C C     . VAL A 1 205 ? 25.348 58.902 120.170 1.00 33.29 ? 205 VAL A C     1 
ATOM   1653 O O     . VAL A 1 205 ? 24.993 59.709 119.339 1.00 34.85 ? 205 VAL A O     1 
ATOM   1654 C CB    . VAL A 1 205 ? 26.326 59.419 122.386 1.00 36.14 ? 205 VAL A CB    1 
ATOM   1655 C CG1   . VAL A 1 205 ? 26.599 60.939 122.399 1.00 30.37 ? 205 VAL A CG1   1 
ATOM   1656 C CG2   . VAL A 1 205 ? 26.296 58.804 123.883 1.00 38.11 ? 205 VAL A CG2   1 
ATOM   1657 N N     . HIS A 1 206 ? 26.028 57.845 119.781 1.00 30.92 ? 206 HIS A N     1 
ATOM   1658 C CA    . HIS A 1 206 ? 26.302 57.818 118.353 1.00 29.75 ? 206 HIS A CA    1 
ATOM   1659 C C     . HIS A 1 206 ? 25.098 58.035 117.395 1.00 29.38 ? 206 HIS A C     1 
ATOM   1660 O O     . HIS A 1 206 ? 25.217 58.812 116.503 1.00 31.37 ? 206 HIS A O     1 
ATOM   1661 C CB    . HIS A 1 206 ? 27.158 56.678 117.845 1.00 29.68 ? 206 HIS A CB    1 
ATOM   1662 C CG    . HIS A 1 206 ? 27.420 56.800 116.369 1.00 30.69 ? 206 HIS A CG    1 
ATOM   1663 N ND1   . HIS A 1 206 ? 27.936 57.942 115.802 1.00 30.75 ? 206 HIS A ND1   1 
ATOM   1664 C CD2   . HIS A 1 206 ? 27.206 55.941 115.341 1.00 26.24 ? 206 HIS A CD2   1 
ATOM   1665 C CE1   . HIS A 1 206 ? 28.006 57.786 114.482 1.00 30.52 ? 206 HIS A CE1   1 
ATOM   1666 N NE2   . HIS A 1 206 ? 27.566 56.575 114.182 1.00 23.28 ? 206 HIS A NE2   1 
ATOM   1667 N N     . PRO A 1 207 ? 24.013 57.250 117.450 1.00 27.76 ? 207 PRO A N     1 
ATOM   1668 C CA    . PRO A 1 207 ? 22.923 57.484 116.466 1.00 27.39 ? 207 PRO A CA    1 
ATOM   1669 C C     . PRO A 1 207 ? 22.145 58.835 116.415 1.00 28.43 ? 207 PRO A C     1 
ATOM   1670 O O     . PRO A 1 207 ? 21.597 59.231 115.319 1.00 31.81 ? 207 PRO A O     1 
ATOM   1671 C CB    . PRO A 1 207 ? 21.965 56.338 116.751 1.00 26.95 ? 207 PRO A CB    1 
ATOM   1672 C CG    . PRO A 1 207 ? 22.792 55.324 117.406 1.00 24.11 ? 207 PRO A CG    1 
ATOM   1673 C CD    . PRO A 1 207 ? 23.801 56.004 118.198 1.00 26.39 ? 207 PRO A CD    1 
ATOM   1674 N N     . VAL A 1 208 ? 22.059 59.531 117.544 1.00 28.09 ? 208 VAL A N     1 
ATOM   1675 C CA    . VAL A 1 208 ? 21.448 60.862 117.593 1.00 26.28 ? 208 VAL A CA    1 
ATOM   1676 C C     . VAL A 1 208 ? 22.400 61.819 116.970 1.00 27.34 ? 208 VAL A C     1 
ATOM   1677 O O     . VAL A 1 208 ? 21.979 62.699 116.164 1.00 28.49 ? 208 VAL A O     1 
ATOM   1678 C CB    . VAL A 1 208 ? 21.257 61.307 119.016 1.00 27.08 ? 208 VAL A CB    1 
ATOM   1679 C CG1   . VAL A 1 208 ? 20.709 62.669 119.087 1.00 22.92 ? 208 VAL A CG1   1 
ATOM   1680 C CG2   . VAL A 1 208 ? 20.374 60.306 119.780 1.00 27.91 ? 208 VAL A CG2   1 
ATOM   1681 N N     . VAL A 1 209 ? 23.701 61.665 117.280 1.00 26.48 ? 209 VAL A N     1 
ATOM   1682 C CA    . VAL A 1 209 ? 24.628 62.530 116.624 1.00 25.59 ? 209 VAL A CA    1 
ATOM   1683 C C     . VAL A 1 209 ? 24.369 62.398 115.110 1.00 26.17 ? 209 VAL A C     1 
ATOM   1684 O O     . VAL A 1 209 ? 24.204 63.430 114.426 1.00 22.78 ? 209 VAL A O     1 
ATOM   1685 C CB    . VAL A 1 209 ? 26.079 62.304 117.055 1.00 25.04 ? 209 VAL A CB    1 
ATOM   1686 C CG1   . VAL A 1 209 ? 26.943 63.089 116.262 1.00 24.50 ? 209 VAL A CG1   1 
ATOM   1687 C CG2   . VAL A 1 209 ? 26.335 62.921 118.435 1.00 27.57 ? 209 VAL A CG2   1 
ATOM   1688 N N     . HIS A 1 210 ? 24.289 61.138 114.625 1.00 25.65 ? 210 HIS A N     1 
ATOM   1689 C CA    . HIS A 1 210 ? 24.248 60.890 113.200 1.00 26.72 ? 210 HIS A CA    1 
ATOM   1690 C C     . HIS A 1 210 ? 23.012 61.495 112.651 1.00 27.82 ? 210 HIS A C     1 
ATOM   1691 O O     . HIS A 1 210 ? 23.027 61.989 111.541 1.00 26.95 ? 210 HIS A O     1 
ATOM   1692 C CB    . HIS A 1 210 ? 24.142 59.399 112.894 1.00 27.09 ? 210 HIS A CB    1 
ATOM   1693 C CG    . HIS A 1 210 ? 24.037 59.091 111.432 1.00 28.51 ? 210 HIS A CG    1 
ATOM   1694 N ND1   . HIS A 1 210 ? 25.086 58.576 110.699 1.00 30.01 ? 210 HIS A ND1   1 
ATOM   1695 C CD2   . HIS A 1 210 ? 22.991 59.198 110.572 1.00 29.74 ? 210 HIS A CD2   1 
ATOM   1696 C CE1   . HIS A 1 210 ? 24.687 58.389 109.446 1.00 31.19 ? 210 HIS A CE1   1 
ATOM   1697 N NE2   . HIS A 1 210 ? 23.424 58.772 109.342 1.00 25.74 ? 210 HIS A NE2   1 
ATOM   1698 N N     . ARG A 1 211 ? 21.915 61.388 113.413 1.00 28.67 ? 211 ARG A N     1 
ATOM   1699 C CA    . ARG A 1 211 ? 20.629 61.820 112.941 1.00 29.21 ? 211 ARG A CA    1 
ATOM   1700 C C     . ARG A 1 211 ? 20.567 63.317 112.844 1.00 30.08 ? 211 ARG A C     1 
ATOM   1701 O O     . ARG A 1 211 ? 19.841 63.823 112.043 1.00 31.12 ? 211 ARG A O     1 
ATOM   1702 C CB    . ARG A 1 211 ? 19.514 61.309 113.871 1.00 29.96 ? 211 ARG A CB    1 
ATOM   1703 C CG    . ARG A 1 211 ? 18.095 61.989 113.698 1.00 28.27 ? 211 ARG A CG    1 
ATOM   1704 C CD    . ARG A 1 211 ? 17.366 61.451 112.466 1.00 28.49 ? 211 ARG A CD    1 
ATOM   1705 N NE    . ARG A 1 211 ? 16.107 62.150 112.051 1.00 31.36 ? 211 ARG A NE    1 
ATOM   1706 C CZ    . ARG A 1 211 ? 15.983 63.343 111.395 1.00 29.53 ? 211 ARG A CZ    1 
ATOM   1707 N NH1   . ARG A 1 211 ? 14.730 63.794 111.115 1.00 23.18 ? 211 ARG A NH1   1 
ATOM   1708 N NH2   . ARG A 1 211 ? 17.058 64.114 111.082 1.00 16.22 ? 211 ARG A NH2   1 
ATOM   1709 N N     . THR A 1 212 ? 21.286 64.016 113.698 1.00 31.85 ? 212 THR A N     1 
ATOM   1710 C CA    . THR A 1 212 ? 21.189 65.462 113.887 1.00 32.62 ? 212 THR A CA    1 
ATOM   1711 C C     . THR A 1 212 ? 22.035 66.105 112.835 1.00 33.93 ? 212 THR A C     1 
ATOM   1712 O O     . THR A 1 212 ? 21.571 66.921 112.010 1.00 36.38 ? 212 THR A O     1 
ATOM   1713 C CB    . THR A 1 212 ? 21.756 65.808 115.277 1.00 32.75 ? 212 THR A CB    1 
ATOM   1714 O OG1   . THR A 1 212 ? 20.984 65.121 116.293 1.00 35.41 ? 212 THR A OG1   1 
ATOM   1715 C CG2   . THR A 1 212 ? 21.804 67.300 115.560 1.00 31.64 ? 212 THR A CG2   1 
ATOM   1716 N N     . VAL A 1 213 ? 23.291 65.748 112.823 1.00 34.28 ? 213 VAL A N     1 
ATOM   1717 C CA    . VAL A 1 213 ? 24.088 66.077 111.673 1.00 35.73 ? 213 VAL A CA    1 
ATOM   1718 C C     . VAL A 1 213 ? 23.339 65.844 110.350 1.00 36.65 ? 213 VAL A C     1 
ATOM   1719 O O     . VAL A 1 213 ? 23.512 66.631 109.425 1.00 37.66 ? 213 VAL A O     1 
ATOM   1720 C CB    . VAL A 1 213 ? 25.322 65.268 111.613 1.00 34.35 ? 213 VAL A CB    1 
ATOM   1721 C CG1   . VAL A 1 213 ? 25.992 65.500 110.250 1.00 37.07 ? 213 VAL A CG1   1 
ATOM   1722 C CG2   . VAL A 1 213 ? 26.244 65.661 112.706 1.00 32.49 ? 213 VAL A CG2   1 
ATOM   1723 N N     . ARG A 1 214 ? 22.507 64.790 110.258 1.00 37.70 ? 214 ARG A N     1 
ATOM   1724 C CA    . ARG A 1 214 ? 21.745 64.466 109.002 1.00 37.24 ? 214 ARG A CA    1 
ATOM   1725 C C     . ARG A 1 214 ? 20.817 65.619 108.581 1.00 38.56 ? 214 ARG A C     1 
ATOM   1726 O O     . ARG A 1 214 ? 20.734 65.957 107.396 1.00 38.24 ? 214 ARG A O     1 
ATOM   1727 C CB    . ARG A 1 214 ? 20.978 63.148 109.130 1.00 37.17 ? 214 ARG A CB    1 
ATOM   1728 C CG    . ARG A 1 214 ? 20.416 62.544 107.845 1.00 38.78 ? 214 ARG A CG    1 
ATOM   1729 C CD    . ARG A 1 214 ? 21.381 62.651 106.663 1.00 46.19 ? 214 ARG A CD    1 
ATOM   1730 N NE    . ARG A 1 214 ? 20.733 62.376 105.384 1.00 47.80 ? 214 ARG A NE    1 
ATOM   1731 C CZ    . ARG A 1 214 ? 20.096 63.283 104.646 1.00 47.21 ? 214 ARG A CZ    1 
ATOM   1732 N NH1   . ARG A 1 214 ? 20.068 64.541 105.087 1.00 44.05 ? 214 ARG A NH1   1 
ATOM   1733 N NH2   . ARG A 1 214 ? 19.504 62.925 103.478 1.00 42.73 ? 214 ARG A NH2   1 
ATOM   1734 N N     . GLU A 1 215 ? 20.170 66.243 109.568 1.00 38.45 ? 215 GLU A N     1 
ATOM   1735 C CA    . GLU A 1 215 ? 19.352 67.420 109.365 1.00 38.46 ? 215 GLU A CA    1 
ATOM   1736 C C     . GLU A 1 215 ? 20.096 68.703 108.868 1.00 39.03 ? 215 GLU A C     1 
ATOM   1737 O O     . GLU A 1 215 ? 19.433 69.654 108.486 1.00 39.27 ? 215 GLU A O     1 
ATOM   1738 C CB    . GLU A 1 215 ? 18.650 67.701 110.680 1.00 38.66 ? 215 GLU A CB    1 
ATOM   1739 C CG    . GLU A 1 215 ? 17.409 68.534 110.554 1.00 40.25 ? 215 GLU A CG    1 
ATOM   1740 C CD    . GLU A 1 215 ? 16.192 67.775 110.079 1.00 42.71 ? 215 GLU A CD    1 
ATOM   1741 O OE1   . GLU A 1 215 ? 15.098 68.347 110.223 1.00 47.69 ? 215 GLU A OE1   1 
ATOM   1742 O OE2   . GLU A 1 215 ? 16.265 66.625 109.582 1.00 38.73 ? 215 GLU A OE2   1 
ATOM   1743 N N     . ALA A 1 216 ? 21.442 68.766 108.900 1.00 38.29 ? 216 ALA A N     1 
ATOM   1744 C CA    . ALA A 1 216 ? 22.182 69.970 108.359 1.00 37.99 ? 216 ALA A CA    1 
ATOM   1745 C C     . ALA A 1 216 ? 22.934 69.634 107.083 1.00 37.39 ? 216 ALA A C     1 
ATOM   1746 O O     . ALA A 1 216 ? 23.335 70.538 106.294 1.00 37.32 ? 216 ALA A O     1 
ATOM   1747 C CB    . ALA A 1 216 ? 23.160 70.628 109.364 1.00 37.08 ? 216 ALA A CB    1 
ATOM   1748 N N     . PHE A 1 217 ? 23.124 68.325 106.889 1.00 35.54 ? 217 PHE A N     1 
ATOM   1749 C CA    . PHE A 1 217 ? 23.913 67.826 105.759 1.00 32.79 ? 217 PHE A CA    1 
ATOM   1750 C C     . PHE A 1 217 ? 23.126 66.854 104.824 1.00 31.48 ? 217 PHE A C     1 
ATOM   1751 O O     . PHE A 1 217 ? 22.518 65.887 105.275 1.00 29.39 ? 217 PHE A O     1 
ATOM   1752 C CB    . PHE A 1 217 ? 25.284 67.228 106.297 1.00 29.91 ? 217 PHE A CB    1 
ATOM   1753 C CG    . PHE A 1 217 ? 26.349 68.284 106.670 1.00 24.93 ? 217 PHE A CG    1 
ATOM   1754 C CD1   . PHE A 1 217 ? 27.106 68.899 105.661 1.00 16.56 ? 217 PHE A CD1   1 
ATOM   1755 C CD2   . PHE A 1 217 ? 26.631 68.613 108.030 1.00 20.58 ? 217 PHE A CD2   1 
ATOM   1756 C CE1   . PHE A 1 217 ? 28.138 69.856 105.920 1.00 11.55 ? 217 PHE A CE1   1 
ATOM   1757 C CE2   . PHE A 1 217 ? 27.646 69.585 108.382 1.00 22.73 ? 217 PHE A CE2   1 
ATOM   1758 C CZ    . PHE A 1 217 ? 28.445 70.220 107.317 1.00 25.12 ? 217 PHE A CZ    1 
ATOM   1759 N N     . ARG A 1 218 ? 23.184 67.076 103.521 1.00 33.11 ? 218 ARG A N     1 
ATOM   1760 C CA    . ARG A 1 218 ? 22.619 66.054 102.616 1.00 34.41 ? 218 ARG A CA    1 
ATOM   1761 C C     . ARG A 1 218 ? 23.239 64.662 102.822 1.00 34.14 ? 218 ARG A C     1 
ATOM   1762 O O     . ARG A 1 218 ? 22.533 63.636 102.917 1.00 34.59 ? 218 ARG A O     1 
ATOM   1763 C CB    . ARG A 1 218 ? 22.777 66.408 101.115 1.00 36.38 ? 218 ARG A CB    1 
ATOM   1764 C CG    . ARG A 1 218 ? 22.162 65.309 100.153 1.00 35.56 ? 218 ARG A CG    1 
ATOM   1765 C CD    . ARG A 1 218 ? 20.782 64.717 100.776 1.00 44.36 ? 218 ARG A CD    1 
ATOM   1766 N NE    . ARG A 1 218 ? 20.046 63.826 99.856  1.00 43.92 ? 218 ARG A NE    1 
ATOM   1767 C CZ    . ARG A 1 218 ? 20.296 62.532 99.736  1.00 45.04 ? 218 ARG A CZ    1 
ATOM   1768 N NH1   . ARG A 1 218 ? 21.248 61.954 100.500 1.00 45.32 ? 218 ARG A NH1   1 
ATOM   1769 N NH2   . ARG A 1 218 ? 19.609 61.833 98.848  1.00 45.78 ? 218 ARG A NH2   1 
ATOM   1770 N N     . TYR A 1 219 ? 24.547 64.596 102.840 1.00 33.24 ? 219 TYR A N     1 
ATOM   1771 C CA    . TYR A 1 219 ? 25.149 63.253 102.853 1.00 34.67 ? 219 TYR A CA    1 
ATOM   1772 C C     . TYR A 1 219 ? 25.897 62.923 104.143 1.00 33.60 ? 219 TYR A C     1 
ATOM   1773 O O     . TYR A 1 219 ? 27.061 63.386 104.270 1.00 34.99 ? 219 TYR A O     1 
ATOM   1774 C CB    . TYR A 1 219 ? 26.149 63.155 101.700 1.00 35.54 ? 219 TYR A CB    1 
ATOM   1775 C CG    . TYR A 1 219 ? 25.510 63.087 100.408 1.00 36.17 ? 219 TYR A CG    1 
ATOM   1776 C CD1   . TYR A 1 219 ? 25.532 64.189 99.530  1.00 42.43 ? 219 TYR A CD1   1 
ATOM   1777 C CD2   . TYR A 1 219 ? 24.817 61.961 100.054 1.00 38.10 ? 219 TYR A CD2   1 
ATOM   1778 C CE1   . TYR A 1 219 ? 24.892 64.146 98.256  1.00 43.39 ? 219 TYR A CE1   1 
ATOM   1779 C CE2   . TYR A 1 219 ? 24.168 61.889 98.835  1.00 40.21 ? 219 TYR A CE2   1 
ATOM   1780 C CZ    . TYR A 1 219 ? 24.219 62.958 97.925  1.00 41.19 ? 219 TYR A CZ    1 
ATOM   1781 O OH    . TYR A 1 219 ? 23.590 62.784 96.704  1.00 41.21 ? 219 TYR A OH    1 
ATOM   1782 N N     . VAL A 1 220 ? 25.302 62.133 105.049 1.00 31.44 ? 220 VAL A N     1 
ATOM   1783 C CA    . VAL A 1 220 ? 25.981 61.794 106.314 1.00 29.61 ? 220 VAL A CA    1 
ATOM   1784 C C     . VAL A 1 220 ? 26.254 60.328 106.379 1.00 29.20 ? 220 VAL A C     1 
ATOM   1785 O O     . VAL A 1 220 ? 25.341 59.506 106.421 1.00 28.71 ? 220 VAL A O     1 
ATOM   1786 C CB    . VAL A 1 220 ? 25.183 62.152 107.654 1.00 30.47 ? 220 VAL A CB    1 
ATOM   1787 C CG1   . VAL A 1 220 ? 25.991 61.770 108.899 1.00 27.00 ? 220 VAL A CG1   1 
ATOM   1788 C CG2   . VAL A 1 220 ? 24.661 63.611 107.688 1.00 27.14 ? 220 VAL A CG2   1 
ATOM   1789 N N     . ARG A 1 221 ? 27.540 60.018 106.454 1.00 28.61 ? 221 ARG A N     1 
ATOM   1790 C CA    . ARG A 1 221 ? 27.979 58.654 106.382 1.00 27.07 ? 221 ARG A CA    1 
ATOM   1791 C C     . ARG A 1 221 ? 28.731 58.221 107.604 1.00 26.19 ? 221 ARG A C     1 
ATOM   1792 O O     . ARG A 1 221 ? 29.672 58.843 108.009 1.00 25.61 ? 221 ARG A O     1 
ATOM   1793 C CB    . ARG A 1 221 ? 28.835 58.523 105.172 1.00 26.94 ? 221 ARG A CB    1 
ATOM   1794 C CG    . ARG A 1 221 ? 28.034 57.849 104.254 1.00 28.11 ? 221 ARG A CG    1 
ATOM   1795 C CD    . ARG A 1 221 ? 27.767 58.572 103.062 1.00 34.33 ? 221 ARG A CD    1 
ATOM   1796 N NE    . ARG A 1 221 ? 27.039 57.553 102.353 1.00 41.30 ? 221 ARG A NE    1 
ATOM   1797 C CZ    . ARG A 1 221 ? 25.720 57.435 102.357 1.00 44.91 ? 221 ARG A CZ    1 
ATOM   1798 N NH1   . ARG A 1 221 ? 25.175 56.407 101.704 1.00 47.25 ? 221 ARG A NH1   1 
ATOM   1799 N NH2   . ARG A 1 221 ? 24.960 58.344 102.985 1.00 41.57 ? 221 ARG A NH2   1 
ATOM   1800 N N     . SER A 1 222 ? 28.292 57.160 108.231 1.00 24.75 ? 222 SER A N     1 
ATOM   1801 C CA    . SER A 1 222 ? 28.821 56.967 109.562 1.00 23.30 ? 222 SER A CA    1 
ATOM   1802 C C     . SER A 1 222 ? 29.842 55.794 109.577 1.00 23.31 ? 222 SER A C     1 
ATOM   1803 O O     . SER A 1 222 ? 29.499 54.715 109.123 1.00 25.39 ? 222 SER A O     1 
ATOM   1804 C CB    . SER A 1 222 ? 27.658 56.709 110.472 1.00 22.82 ? 222 SER A CB    1 
ATOM   1805 O OG    . SER A 1 222 ? 28.102 56.033 111.589 1.00 23.58 ? 222 SER A OG    1 
ATOM   1806 N N     . TYR A 1 223 ? 31.094 56.022 109.987 1.00 21.63 ? 223 TYR A N     1 
ATOM   1807 C CA    . TYR A 1 223 ? 32.084 54.946 110.186 1.00 21.00 ? 223 TYR A CA    1 
ATOM   1808 C C     . TYR A 1 223 ? 32.630 54.666 111.621 1.00 20.84 ? 223 TYR A C     1 
ATOM   1809 O O     . TYR A 1 223 ? 32.557 55.504 112.468 1.00 21.79 ? 223 TYR A O     1 
ATOM   1810 C CB    . TYR A 1 223 ? 33.262 55.126 109.278 1.00 18.01 ? 223 TYR A CB    1 
ATOM   1811 C CG    . TYR A 1 223 ? 34.059 56.296 109.636 1.00 16.54 ? 223 TYR A CG    1 
ATOM   1812 C CD1   . TYR A 1 223 ? 33.554 57.551 109.473 1.00 18.46 ? 223 TYR A CD1   1 
ATOM   1813 C CD2   . TYR A 1 223 ? 35.340 56.174 110.137 1.00 14.93 ? 223 TYR A CD2   1 
ATOM   1814 C CE1   . TYR A 1 223 ? 34.279 58.652 109.791 1.00 15.19 ? 223 TYR A CE1   1 
ATOM   1815 C CE2   . TYR A 1 223 ? 36.091 57.288 110.493 1.00 6.33  ? 223 TYR A CE2   1 
ATOM   1816 C CZ    . TYR A 1 223 ? 35.550 58.510 110.296 1.00 16.71 ? 223 TYR A CZ    1 
ATOM   1817 O OH    . TYR A 1 223 ? 36.269 59.656 110.542 1.00 19.87 ? 223 TYR A OH    1 
ATOM   1818 N N     . LYS A 1 224 ? 33.248 53.514 111.846 1.00 21.50 ? 224 LYS A N     1 
ATOM   1819 C CA    . LYS A 1 224 ? 33.633 53.104 113.218 1.00 22.86 ? 224 LYS A CA    1 
ATOM   1820 C C     . LYS A 1 224 ? 34.963 52.364 113.342 1.00 21.44 ? 224 LYS A C     1 
ATOM   1821 O O     . LYS A 1 224 ? 35.479 51.822 112.358 1.00 23.87 ? 224 LYS A O     1 
ATOM   1822 C CB    . LYS A 1 224 ? 32.491 52.292 113.863 1.00 22.38 ? 224 LYS A CB    1 
ATOM   1823 C CG    . LYS A 1 224 ? 32.173 50.988 113.176 1.00 22.60 ? 224 LYS A CG    1 
ATOM   1824 C CD    . LYS A 1 224 ? 31.607 49.878 114.118 1.00 25.30 ? 224 LYS A CD    1 
ATOM   1825 C CE    . LYS A 1 224 ? 32.410 48.520 113.928 1.00 32.04 ? 224 LYS A CE    1 
ATOM   1826 N NZ    . LYS A 1 224 ? 33.036 48.239 112.457 1.00 29.28 ? 224 LYS A NZ    1 
ATOM   1827 N N     . ASN A 1 225 ? 35.538 52.337 114.530 1.00 20.26 ? 225 ASN A N     1 
ATOM   1828 C CA    . ASN A 1 225 ? 36.889 51.764 114.739 1.00 18.82 ? 225 ASN A CA    1 
ATOM   1829 C C     . ASN A 1 225 ? 37.108 51.655 116.261 1.00 20.06 ? 225 ASN A C     1 
ATOM   1830 O O     . ASN A 1 225 ? 36.621 52.531 117.070 1.00 16.54 ? 225 ASN A O     1 
ATOM   1831 C CB    . ASN A 1 225 ? 37.950 52.695 114.132 1.00 18.05 ? 225 ASN A CB    1 
ATOM   1832 C CG    . ASN A 1 225 ? 39.348 52.036 113.948 1.00 19.60 ? 225 ASN A CG    1 
ATOM   1833 O OD1   . ASN A 1 225 ? 39.506 50.816 113.816 1.00 15.96 ? 225 ASN A OD1   1 
ATOM   1834 N ND2   . ASN A 1 225 ? 40.370 52.900 113.854 1.00 18.01 ? 225 ASN A ND2   1 
ATOM   1835 N N     . HIS A 1 226 ? 37.855 50.593 116.643 1.00 21.12 ? 226 HIS A N     1 
ATOM   1836 C CA    . HIS A 1 226 ? 38.158 50.218 118.020 1.00 20.26 ? 226 HIS A CA    1 
ATOM   1837 C C     . HIS A 1 226 ? 39.392 50.971 118.525 1.00 19.85 ? 226 HIS A C     1 
ATOM   1838 O O     . HIS A 1 226 ? 40.526 50.565 118.204 1.00 22.29 ? 226 HIS A O     1 
ATOM   1839 C CB    . HIS A 1 226 ? 38.523 48.722 118.090 1.00 22.06 ? 226 HIS A CB    1 
ATOM   1840 C CG    . HIS A 1 226 ? 38.985 48.308 119.471 1.00 27.52 ? 226 HIS A CG    1 
ATOM   1841 N ND1   . HIS A 1 226 ? 38.092 48.077 120.511 1.00 25.77 ? 226 HIS A ND1   1 
ATOM   1842 C CD2   . HIS A 1 226 ? 40.234 48.246 120.012 1.00 27.11 ? 226 HIS A CD2   1 
ATOM   1843 C CE1   . HIS A 1 226 ? 38.783 47.785 121.601 1.00 32.12 ? 226 HIS A CE1   1 
ATOM   1844 N NE2   . HIS A 1 226 ? 40.079 47.909 121.334 1.00 30.61 ? 226 HIS A NE2   1 
ATOM   1845 N N     . ILE A 1 227 ? 39.249 51.957 119.374 1.00 17.53 ? 227 ILE A N     1 
ATOM   1846 C CA    . ILE A 1 227 ? 40.410 52.576 119.975 1.00 18.63 ? 227 ILE A CA    1 
ATOM   1847 C C     . ILE A 1 227 ? 40.961 51.764 121.244 1.00 17.81 ? 227 ILE A C     1 
ATOM   1848 O O     . ILE A 1 227 ? 40.356 51.806 122.289 1.00 18.21 ? 227 ILE A O     1 
ATOM   1849 C CB    . ILE A 1 227 ? 39.982 53.976 120.353 1.00 19.29 ? 227 ILE A CB    1 
ATOM   1850 C CG1   . ILE A 1 227 ? 39.087 54.524 119.246 1.00 19.80 ? 227 ILE A CG1   1 
ATOM   1851 C CG2   . ILE A 1 227 ? 41.152 54.936 120.811 1.00 18.99 ? 227 ILE A CG2   1 
ATOM   1852 C CD1   . ILE A 1 227 ? 39.632 54.690 117.805 1.00 16.51 ? 227 ILE A CD1   1 
ATOM   1853 N N     . PRO A 1 228 ? 42.135 51.100 121.182 1.00 16.84 ? 228 PRO A N     1 
ATOM   1854 C CA    . PRO A 1 228 ? 42.517 50.098 122.213 1.00 18.43 ? 228 PRO A CA    1 
ATOM   1855 C C     . PRO A 1 228 ? 42.603 50.707 123.619 1.00 20.24 ? 228 PRO A C     1 
ATOM   1856 O O     . PRO A 1 228 ? 42.072 50.126 124.604 1.00 19.33 ? 228 PRO A O     1 
ATOM   1857 C CB    . PRO A 1 228 ? 43.892 49.658 121.768 1.00 18.05 ? 228 PRO A CB    1 
ATOM   1858 C CG    . PRO A 1 228 ? 43.866 49.965 120.170 1.00 19.43 ? 228 PRO A CG    1 
ATOM   1859 C CD    . PRO A 1 228 ? 43.221 51.296 120.242 1.00 17.74 ? 228 PRO A CD    1 
ATOM   1860 N N     . GLY A 1 229 ? 43.344 51.828 123.652 1.00 20.65 ? 229 GLY A N     1 
ATOM   1861 C CA    . GLY A 1 229 ? 43.284 52.898 124.593 1.00 22.57 ? 229 GLY A CA    1 
ATOM   1862 C C     . GLY A 1 229 ? 42.074 53.166 125.434 1.00 24.22 ? 229 GLY A C     1 
ATOM   1863 O O     . GLY A 1 229 ? 42.231 53.497 126.587 1.00 26.19 ? 229 GLY A O     1 
ATOM   1864 N N     . PHE A 1 230 ? 40.891 52.989 124.871 1.00 23.95 ? 230 PHE A N     1 
ATOM   1865 C CA    . PHE A 1 230 ? 39.645 53.390 125.494 1.00 24.15 ? 230 PHE A CA    1 
ATOM   1866 C C     . PHE A 1 230 ? 38.848 52.176 125.854 1.00 24.59 ? 230 PHE A C     1 
ATOM   1867 O O     . PHE A 1 230 ? 37.784 52.283 126.482 1.00 22.07 ? 230 PHE A O     1 
ATOM   1868 C CB    . PHE A 1 230 ? 38.726 54.138 124.498 1.00 23.51 ? 230 PHE A CB    1 
ATOM   1869 C CG    . PHE A 1 230 ? 39.192 55.510 124.076 1.00 23.59 ? 230 PHE A CG    1 
ATOM   1870 C CD1   . PHE A 1 230 ? 40.258 56.163 124.690 1.00 27.04 ? 230 PHE A CD1   1 
ATOM   1871 C CD2   . PHE A 1 230 ? 38.531 56.166 123.008 1.00 26.04 ? 230 PHE A CD2   1 
ATOM   1872 C CE1   . PHE A 1 230 ? 40.661 57.507 124.218 1.00 25.65 ? 230 PHE A CE1   1 
ATOM   1873 C CE2   . PHE A 1 230 ? 38.939 57.450 122.530 1.00 21.89 ? 230 PHE A CE2   1 
ATOM   1874 C CZ    . PHE A 1 230 ? 40.010 58.100 123.125 1.00 20.94 ? 230 PHE A CZ    1 
ATOM   1875 N N     . PHE A 1 231 ? 39.304 51.043 125.303 1.00 26.08 ? 231 PHE A N     1 
ATOM   1876 C CA    . PHE A 1 231 ? 38.700 49.724 125.469 1.00 24.90 ? 231 PHE A CA    1 
ATOM   1877 C C     . PHE A 1 231 ? 37.335 49.876 125.000 1.00 26.95 ? 231 PHE A C     1 
ATOM   1878 O O     . PHE A 1 231 ? 36.433 49.578 125.738 1.00 28.59 ? 231 PHE A O     1 
ATOM   1879 C CB    . PHE A 1 231 ? 38.681 49.376 126.936 1.00 22.78 ? 231 PHE A CB    1 
ATOM   1880 C CG    . PHE A 1 231 ? 40.013 49.217 127.477 1.00 19.29 ? 231 PHE A CG    1 
ATOM   1881 C CD1   . PHE A 1 231 ? 40.847 50.322 127.591 1.00 15.19 ? 231 PHE A CD1   1 
ATOM   1882 C CD2   . PHE A 1 231 ? 40.519 47.954 127.696 1.00 16.58 ? 231 PHE A CD2   1 
ATOM   1883 C CE1   . PHE A 1 231 ? 42.174 50.148 127.986 1.00 15.13 ? 231 PHE A CE1   1 
ATOM   1884 C CE2   . PHE A 1 231 ? 41.846 47.792 128.110 1.00 14.76 ? 231 PHE A CE2   1 
ATOM   1885 C CZ    . PHE A 1 231 ? 42.671 48.861 128.311 1.00 9.23  ? 231 PHE A CZ    1 
ATOM   1886 N N     . LEU A 1 232 ? 37.153 50.440 123.823 1.00 27.89 ? 232 LEU A N     1 
ATOM   1887 C CA    . LEU A 1 232 ? 35.819 50.961 123.518 1.00 29.28 ? 232 LEU A CA    1 
ATOM   1888 C C     . LEU A 1 232 ? 35.645 51.170 122.007 1.00 29.51 ? 232 LEU A C     1 
ATOM   1889 O O     . LEU A 1 232 ? 36.578 51.504 121.306 1.00 31.10 ? 232 LEU A O     1 
ATOM   1890 C CB    . LEU A 1 232 ? 35.710 52.261 124.246 1.00 28.34 ? 232 LEU A CB    1 
ATOM   1891 C CG    . LEU A 1 232 ? 34.430 52.859 124.767 1.00 31.50 ? 232 LEU A CG    1 
ATOM   1892 C CD1   . LEU A 1 232 ? 33.768 51.880 125.627 1.00 37.16 ? 232 LEU A CD1   1 
ATOM   1893 C CD2   . LEU A 1 232 ? 34.707 54.123 125.603 1.00 29.23 ? 232 LEU A CD2   1 
ATOM   1894 N N     . ASN A 1 233 ? 34.475 50.934 121.476 1.00 30.36 ? 233 ASN A N     1 
ATOM   1895 C CA    . ASN A 1 233 ? 34.250 51.059 120.010 1.00 29.06 ? 233 ASN A CA    1 
ATOM   1896 C C     . ASN A 1 233 ? 33.701 52.459 119.752 1.00 28.35 ? 233 ASN A C     1 
ATOM   1897 O O     . ASN A 1 233 ? 32.602 52.818 120.177 1.00 27.64 ? 233 ASN A O     1 
ATOM   1898 C CB    . ASN A 1 233 ? 33.204 50.048 119.607 1.00 30.07 ? 233 ASN A CB    1 
ATOM   1899 C CG    . ASN A 1 233 ? 33.265 49.667 118.157 1.00 31.27 ? 233 ASN A CG    1 
ATOM   1900 O OD1   . ASN A 1 233 ? 34.238 49.909 117.441 1.00 38.45 ? 233 ASN A OD1   1 
ATOM   1901 N ND2   . ASN A 1 233 ? 32.249 48.976 117.731 1.00 35.20 ? 233 ASN A ND2   1 
ATOM   1902 N N     . PHE A 1 234 ? 34.497 53.278 119.099 1.00 27.89 ? 234 PHE A N     1 
ATOM   1903 C CA    . PHE A 1 234 ? 34.148 54.673 118.917 1.00 26.23 ? 234 PHE A CA    1 
ATOM   1904 C C     . PHE A 1 234 ? 33.538 54.974 117.604 1.00 26.17 ? 234 PHE A C     1 
ATOM   1905 O O     . PHE A 1 234 ? 34.044 54.426 116.618 1.00 28.96 ? 234 PHE A O     1 
ATOM   1906 C CB    . PHE A 1 234 ? 35.356 55.527 119.124 1.00 25.32 ? 234 PHE A CB    1 
ATOM   1907 C CG    . PHE A 1 234 ? 35.224 56.354 120.291 1.00 26.68 ? 234 PHE A CG    1 
ATOM   1908 C CD1   . PHE A 1 234 ? 34.817 57.677 120.163 1.00 34.44 ? 234 PHE A CD1   1 
ATOM   1909 C CD2   . PHE A 1 234 ? 35.298 55.797 121.535 1.00 23.31 ? 234 PHE A CD2   1 
ATOM   1910 C CE1   . PHE A 1 234 ? 34.620 58.460 121.328 1.00 36.76 ? 234 PHE A CE1   1 
ATOM   1911 C CE2   . PHE A 1 234 ? 35.140 56.510 122.631 1.00 26.61 ? 234 PHE A CE2   1 
ATOM   1912 C CZ    . PHE A 1 234 ? 34.790 57.863 122.579 1.00 29.41 ? 234 PHE A CZ    1 
ATOM   1913 N N     . GLY A 1 235 ? 32.478 55.819 117.586 1.00 24.76 ? 235 GLY A N     1 
ATOM   1914 C CA    . GLY A 1 235 ? 31.720 56.199 116.362 1.00 22.29 ? 235 GLY A CA    1 
ATOM   1915 C C     . GLY A 1 235 ? 32.160 57.494 115.679 1.00 21.19 ? 235 GLY A C     1 
ATOM   1916 O O     . GLY A 1 235 ? 32.327 58.560 116.307 1.00 22.53 ? 235 GLY A O     1 
ATOM   1917 N N     . PHE A 1 236 ? 32.355 57.478 114.399 1.00 20.07 ? 236 PHE A N     1 
ATOM   1918 C CA    . PHE A 1 236 ? 32.803 58.774 113.766 1.00 20.61 ? 236 PHE A CA    1 
ATOM   1919 C C     . PHE A 1 236 ? 31.921 58.971 112.615 1.00 20.21 ? 236 PHE A C     1 
ATOM   1920 O O     . PHE A 1 236 ? 31.247 57.996 112.214 1.00 20.55 ? 236 PHE A O     1 
ATOM   1921 C CB    . PHE A 1 236 ? 34.188 58.699 113.180 1.00 19.23 ? 236 PHE A CB    1 
ATOM   1922 C CG    . PHE A 1 236 ? 35.207 58.344 114.120 1.00 18.39 ? 236 PHE A CG    1 
ATOM   1923 C CD1   . PHE A 1 236 ? 36.036 59.312 114.668 1.00 19.46 ? 236 PHE A CD1   1 
ATOM   1924 C CD2   . PHE A 1 236 ? 35.379 57.055 114.506 1.00 24.13 ? 236 PHE A CD2   1 
ATOM   1925 C CE1   . PHE A 1 236 ? 37.039 58.969 115.613 1.00 13.49 ? 236 PHE A CE1   1 
ATOM   1926 C CE2   . PHE A 1 236 ? 36.351 56.728 115.518 1.00 19.02 ? 236 PHE A CE2   1 
ATOM   1927 C CZ    . PHE A 1 236 ? 37.199 57.690 115.990 1.00 13.43 ? 236 PHE A CZ    1 
ATOM   1928 N N     . LEU A 1 237 ? 31.891 60.189 112.083 1.00 20.02 ? 237 LEU A N     1 
ATOM   1929 C CA    . LEU A 1 237 ? 31.095 60.387 110.804 1.00 20.69 ? 237 LEU A CA    1 
ATOM   1930 C C     . LEU A 1 237 ? 31.671 61.380 109.763 1.00 21.88 ? 237 LEU A C     1 
ATOM   1931 O O     . LEU A 1 237 ? 32.441 62.260 110.096 1.00 23.13 ? 237 LEU A O     1 
ATOM   1932 C CB    . LEU A 1 237 ? 29.561 60.463 111.011 1.00 16.48 ? 237 LEU A CB    1 
ATOM   1933 C CG    . LEU A 1 237 ? 29.041 61.693 111.677 1.00 16.91 ? 237 LEU A CG    1 
ATOM   1934 C CD1   . LEU A 1 237 ? 29.426 62.987 110.956 1.00 24.34 ? 237 LEU A CD1   1 
ATOM   1935 C CD2   . LEU A 1 237 ? 27.533 61.680 111.963 1.00 18.65 ? 237 LEU A CD2   1 
ATOM   1936 N N     . LEU A 1 238 ? 31.316 61.199 108.519 1.00 23.43 ? 238 LEU A N     1 
ATOM   1937 C CA    . LEU A 1 238 ? 31.653 62.150 107.502 1.00 26.69 ? 238 LEU A CA    1 
ATOM   1938 C C     . LEU A 1 238 ? 30.371 62.784 106.943 1.00 28.06 ? 238 LEU A C     1 
ATOM   1939 O O     . LEU A 1 238 ? 29.406 62.045 106.548 1.00 28.70 ? 238 LEU A O     1 
ATOM   1940 C CB    . LEU A 1 238 ? 32.328 61.390 106.345 1.00 25.92 ? 238 LEU A CB    1 
ATOM   1941 C CG    . LEU A 1 238 ? 33.731 60.845 106.436 1.00 26.90 ? 238 LEU A CG    1 
ATOM   1942 C CD1   . LEU A 1 238 ? 34.068 60.345 105.069 1.00 22.88 ? 238 LEU A CD1   1 
ATOM   1943 C CD2   . LEU A 1 238 ? 34.760 61.906 106.966 1.00 19.20 ? 238 LEU A CD2   1 
ATOM   1944 N N     . ALA A 1 239 ? 30.392 64.113 106.800 1.00 29.76 ? 239 ALA A N     1 
ATOM   1945 C CA    . ALA A 1 239 ? 29.237 64.884 106.223 1.00 31.01 ? 239 ALA A CA    1 
ATOM   1946 C C     . ALA A 1 239 ? 29.548 65.845 105.082 1.00 32.23 ? 239 ALA A C     1 
ATOM   1947 O O     . ALA A 1 239 ? 30.612 66.512 105.083 1.00 32.78 ? 239 ALA A O     1 
ATOM   1948 C CB    . ALA A 1 239 ? 28.575 65.643 107.260 1.00 30.97 ? 239 ALA A CB    1 
ATOM   1949 N N     . SER A 1 240 ? 28.618 65.942 104.127 1.00 33.27 ? 240 SER A N     1 
ATOM   1950 C CA    . SER A 1 240 ? 28.740 66.907 102.988 1.00 35.16 ? 240 SER A CA    1 
ATOM   1951 C C     . SER A 1 240 ? 27.419 67.155 102.310 1.00 36.11 ? 240 SER A C     1 
ATOM   1952 O O     . SER A 1 240 ? 26.658 66.203 102.101 1.00 37.71 ? 240 SER A O     1 
ATOM   1953 C CB    . SER A 1 240 ? 29.710 66.384 101.886 1.00 34.63 ? 240 SER A CB    1 
ATOM   1954 O OG    . SER A 1 240 ? 29.979 67.384 100.901 1.00 34.03 ? 240 SER A OG    1 
ATOM   1955 N N     . ASP A 1 241 ? 27.155 68.405 101.931 1.00 37.28 ? 241 ASP A N     1 
ATOM   1956 C CA    . ASP A 1 241 ? 26.112 68.703 100.881 1.00 37.58 ? 241 ASP A CA    1 
ATOM   1957 C C     . ASP A 1 241 ? 26.581 68.411 99.446  1.00 38.05 ? 241 ASP A C     1 
ATOM   1958 O O     . ASP A 1 241 ? 25.808 68.004 98.606  1.00 38.80 ? 241 ASP A O     1 
ATOM   1959 C CB    . ASP A 1 241 ? 25.497 70.117 101.010 1.00 35.45 ? 241 ASP A CB    1 
ATOM   1960 C CG    . ASP A 1 241 ? 24.405 70.180 102.047 1.00 36.78 ? 241 ASP A CG    1 
ATOM   1961 O OD1   . ASP A 1 241 ? 24.053 71.286 102.464 1.00 38.46 ? 241 ASP A OD1   1 
ATOM   1962 O OD2   . ASP A 1 241 ? 23.881 69.129 102.489 1.00 37.43 ? 241 ASP A OD2   1 
ATOM   1963 N N     . ALA A 1 242 ? 27.865 68.591 99.205  1.00 39.90 ? 242 ALA A N     1 
ATOM   1964 C CA    . ALA A 1 242 ? 28.421 68.563 97.861  1.00 41.72 ? 242 ALA A CA    1 
ATOM   1965 C C     . ALA A 1 242 ? 28.477 67.231 97.149  1.00 41.61 ? 242 ALA A C     1 
ATOM   1966 O O     . ALA A 1 242 ? 28.572 67.251 95.943  1.00 42.89 ? 242 ALA A O     1 
ATOM   1967 C CB    . ALA A 1 242 ? 29.845 69.262 97.833  1.00 41.85 ? 242 ALA A CB    1 
ATOM   1968 N N     . PHE A 1 243 ? 28.464 66.098 97.858  1.00 42.87 ? 243 PHE A N     1 
ATOM   1969 C CA    . PHE A 1 243 ? 28.611 64.692 97.270  1.00 43.70 ? 243 PHE A CA    1 
ATOM   1970 C C     . PHE A 1 243 ? 28.691 63.565 98.388  1.00 43.99 ? 243 PHE A C     1 
ATOM   1971 O O     . PHE A 1 243 ? 29.182 63.842 99.501  1.00 43.36 ? 243 PHE A O     1 
ATOM   1972 C CB    . PHE A 1 243 ? 29.910 64.580 96.413  1.00 43.90 ? 243 PHE A CB    1 
ATOM   1973 C CG    . PHE A 1 243 ? 31.173 64.706 97.258  1.00 47.11 ? 243 PHE A CG    1 
ATOM   1974 C CD1   . PHE A 1 243 ? 31.646 65.959 97.665  1.00 49.69 ? 243 PHE A CD1   1 
ATOM   1975 C CD2   . PHE A 1 243 ? 31.830 63.570 97.738  1.00 50.50 ? 243 PHE A CD2   1 
ATOM   1976 C CE1   . PHE A 1 243 ? 32.793 66.077 98.492  1.00 49.35 ? 243 PHE A CE1   1 
ATOM   1977 C CE2   . PHE A 1 243 ? 32.977 63.679 98.534  1.00 49.31 ? 243 PHE A CE2   1 
ATOM   1978 C CZ    . PHE A 1 243 ? 33.440 64.955 98.923  1.00 47.36 ? 243 PHE A CZ    1 
ATOM   1979 N N     . ASP A 1 244 ? 28.294 62.318 98.070  1.00 43.59 ? 244 ASP A N     1 
ATOM   1980 C CA    . ASP A 1 244 ? 28.454 61.166 99.005  1.00 43.13 ? 244 ASP A CA    1 
ATOM   1981 C C     . ASP A 1 244 ? 29.875 60.813 99.387  1.00 42.47 ? 244 ASP A C     1 
ATOM   1982 O O     . ASP A 1 244 ? 30.573 60.115 98.626  1.00 43.60 ? 244 ASP A O     1 
ATOM   1983 C CB    . ASP A 1 244 ? 27.901 59.858 98.462  1.00 42.74 ? 244 ASP A CB    1 
ATOM   1984 C CG    . ASP A 1 244 ? 27.911 58.755 99.502  1.00 43.35 ? 244 ASP A CG    1 
ATOM   1985 O OD1   . ASP A 1 244 ? 28.789 58.722 100.429 1.00 46.74 ? 244 ASP A OD1   1 
ATOM   1986 O OD2   . ASP A 1 244 ? 27.015 57.917 99.412  1.00 41.70 ? 244 ASP A OD2   1 
ATOM   1987 N N     . PRO A 1 245 ? 30.267 61.161 100.607 1.00 40.49 ? 245 PRO A N     1 
ATOM   1988 C CA    . PRO A 1 245 ? 31.676 61.107 100.911 1.00 39.88 ? 245 PRO A CA    1 
ATOM   1989 C C     . PRO A 1 245 ? 32.186 59.699 101.123 1.00 40.11 ? 245 PRO A C     1 
ATOM   1990 O O     . PRO A 1 245 ? 33.420 59.525 101.362 1.00 39.56 ? 245 PRO A O     1 
ATOM   1991 C CB    . PRO A 1 245 ? 31.778 61.908 102.190 1.00 38.96 ? 245 PRO A CB    1 
ATOM   1992 C CG    . PRO A 1 245 ? 30.514 61.682 102.803 1.00 38.70 ? 245 PRO A CG    1 
ATOM   1993 C CD    . PRO A 1 245 ? 29.488 61.642 101.738 1.00 39.47 ? 245 PRO A CD    1 
ATOM   1994 N N     . ALA A 1 246 ? 31.280 58.715 101.040 1.00 39.42 ? 246 ALA A N     1 
ATOM   1995 C CA    . ALA A 1 246 ? 31.706 57.343 101.153 1.00 39.37 ? 246 ALA A CA    1 
ATOM   1996 C C     . ALA A 1 246 ? 31.417 56.483 99.923  1.00 40.22 ? 246 ALA A C     1 
ATOM   1997 O O     . ALA A 1 246 ? 31.409 55.224 100.039 1.00 39.45 ? 246 ALA A O     1 
ATOM   1998 C CB    . ALA A 1 246 ? 31.062 56.722 102.383 1.00 39.69 ? 246 ALA A CB    1 
ATOM   1999 N N     . ALA A 1 247 ? 31.058 57.110 98.785  1.00 40.56 ? 247 ALA A N     1 
ATOM   2000 C CA    . ALA A 1 247 ? 31.049 56.354 97.527  1.00 41.15 ? 247 ALA A CA    1 
ATOM   2001 C C     . ALA A 1 247 ? 32.516 56.382 97.239  1.00 41.75 ? 247 ALA A C     1 
ATOM   2002 O O     . ALA A 1 247 ? 33.122 57.470 97.090  1.00 43.01 ? 247 ALA A O     1 
ATOM   2003 C CB    . ALA A 1 247 ? 30.318 57.075 96.468  1.00 41.75 ? 247 ALA A CB    1 
ATOM   2004 N N     . PHE A 1 248 ? 33.144 55.230 97.286  1.00 41.08 ? 248 PHE A N     1 
ATOM   2005 C CA    . PHE A 1 248 ? 34.592 55.268 97.221  1.00 41.93 ? 248 PHE A CA    1 
ATOM   2006 C C     . PHE A 1 248 ? 34.910 54.708 95.879  1.00 42.38 ? 248 PHE A C     1 
ATOM   2007 O O     . PHE A 1 248 ? 34.625 53.510 95.672  1.00 43.73 ? 248 PHE A O     1 
ATOM   2008 C CB    . PHE A 1 248 ? 35.198 54.296 98.209  1.00 40.41 ? 248 PHE A CB    1 
ATOM   2009 C CG    . PHE A 1 248 ? 35.097 54.731 99.574  1.00 40.96 ? 248 PHE A CG    1 
ATOM   2010 C CD1   . PHE A 1 248 ? 34.424 53.940 100.501 1.00 40.63 ? 248 PHE A CD1   1 
ATOM   2011 C CD2   . PHE A 1 248 ? 35.666 55.923 99.953  1.00 36.62 ? 248 PHE A CD2   1 
ATOM   2012 C CE1   . PHE A 1 248 ? 34.350 54.331 101.784 1.00 41.39 ? 248 PHE A CE1   1 
ATOM   2013 C CE2   . PHE A 1 248 ? 35.589 56.322 101.211 1.00 38.07 ? 248 PHE A CE2   1 
ATOM   2014 C CZ    . PHE A 1 248 ? 34.928 55.545 102.156 1.00 38.58 ? 248 PHE A CZ    1 
ATOM   2015 N N     . SER A 1 249 ? 35.490 55.467 94.965  1.00 40.82 ? 249 SER A N     1 
ATOM   2016 C CA    . SER A 1 249 ? 35.747 54.778 93.692  1.00 40.56 ? 249 SER A CA    1 
ATOM   2017 C C     . SER A 1 249 ? 36.908 53.828 93.829  1.00 41.00 ? 249 SER A C     1 
ATOM   2018 O O     . SER A 1 249 ? 37.803 54.124 94.670  1.00 40.57 ? 249 SER A O     1 
ATOM   2019 C CB    . SER A 1 249 ? 35.882 55.740 92.523  1.00 39.44 ? 249 SER A CB    1 
ATOM   2020 O OG    . SER A 1 249 ? 34.575 56.153 92.244  1.00 36.28 ? 249 SER A OG    1 
ATOM   2021 N N     . GLU A 1 250 ? 36.860 52.694 93.069  1.00 40.83 ? 250 GLU A N     1 
ATOM   2022 C CA    . GLU A 1 250 ? 37.997 51.705 93.024  1.00 40.92 ? 250 GLU A CA    1 
ATOM   2023 C C     . GLU A 1 250 ? 39.335 52.382 92.819  1.00 39.08 ? 250 GLU A C     1 
ATOM   2024 O O     . GLU A 1 250 ? 39.397 53.306 92.022  1.00 38.92 ? 250 GLU A O     1 
ATOM   2025 C CB    . GLU A 1 250 ? 37.787 50.699 91.934  1.00 41.67 ? 250 GLU A CB    1 
ATOM   2026 C CG    . GLU A 1 250 ? 38.684 49.499 91.990  1.00 47.05 ? 250 GLU A CG    1 
ATOM   2027 C CD    . GLU A 1 250 ? 38.252 48.481 90.939  1.00 56.08 ? 250 GLU A CD    1 
ATOM   2028 O OE1   . GLU A 1 250 ? 37.062 48.593 90.501  1.00 58.89 ? 250 GLU A OE1   1 
ATOM   2029 O OE2   . GLU A 1 250 ? 39.068 47.583 90.549  1.00 57.25 ? 250 GLU A OE2   1 
ATOM   2030 N N     . GLY A 1 251 ? 40.342 52.001 93.614  1.00 37.78 ? 251 GLY A N     1 
ATOM   2031 C CA    . GLY A 1 251 ? 41.745 52.523 93.524  1.00 37.30 ? 251 GLY A CA    1 
ATOM   2032 C C     . GLY A 1 251 ? 42.134 53.947 93.934  1.00 38.02 ? 251 GLY A C     1 
ATOM   2033 O O     . GLY A 1 251 ? 43.345 54.341 93.867  1.00 37.76 ? 251 GLY A O     1 
ATOM   2034 N N     . VAL A 1 252 ? 41.150 54.723 94.417  1.00 37.84 ? 252 VAL A N     1 
ATOM   2035 C CA    . VAL A 1 252 ? 41.268 56.208 94.533  1.00 36.79 ? 252 VAL A CA    1 
ATOM   2036 C C     . VAL A 1 252 ? 41.813 56.709 95.856  1.00 37.29 ? 252 VAL A C     1 
ATOM   2037 O O     . VAL A 1 252 ? 42.736 57.515 95.912  1.00 37.07 ? 252 VAL A O     1 
ATOM   2038 C CB    . VAL A 1 252 ? 39.892 56.832 94.337  1.00 37.11 ? 252 VAL A CB    1 
ATOM   2039 C CG1   . VAL A 1 252 ? 39.991 58.351 94.070  1.00 38.34 ? 252 VAL A CG1   1 
ATOM   2040 C CG2   . VAL A 1 252 ? 39.102 56.110 93.190  1.00 37.33 ? 252 VAL A CG2   1 
ATOM   2041 N N     . ILE A 1 253 ? 41.211 56.244 96.952  1.00 37.88 ? 253 ILE A N     1 
ATOM   2042 C CA    . ILE A 1 253 ? 41.819 56.411 98.264  1.00 36.80 ? 253 ILE A CA    1 
ATOM   2043 C C     . ILE A 1 253 ? 43.316 56.037 98.205  1.00 37.26 ? 253 ILE A C     1 
ATOM   2044 O O     . ILE A 1 253 ? 44.157 56.828 98.630  1.00 36.52 ? 253 ILE A O     1 
ATOM   2045 C CB    . ILE A 1 253 ? 41.065 55.633 99.429  1.00 36.32 ? 253 ILE A CB    1 
ATOM   2046 C CG1   . ILE A 1 253 ? 39.557 56.030 99.557  1.00 35.70 ? 253 ILE A CG1   1 
ATOM   2047 C CG2   . ILE A 1 253 ? 41.756 55.924 100.720 1.00 33.57 ? 253 ILE A CG2   1 
ATOM   2048 C CD1   . ILE A 1 253 ? 39.192 57.588 99.979  1.00 25.88 ? 253 ILE A CD1   1 
ATOM   2049 N N     . GLU A 1 254 ? 43.620 54.833 97.707  1.00 37.45 ? 254 GLU A N     1 
ATOM   2050 C CA    . GLU A 1 254 ? 44.990 54.410 97.487  1.00 38.84 ? 254 GLU A CA    1 
ATOM   2051 C C     . GLU A 1 254 ? 45.738 55.430 96.601  1.00 39.51 ? 254 GLU A C     1 
ATOM   2052 O O     . GLU A 1 254 ? 46.870 55.845 96.963  1.00 39.05 ? 254 GLU A O     1 
ATOM   2053 C CB    . GLU A 1 254 ? 45.006 53.019 96.805  1.00 40.75 ? 254 GLU A CB    1 
ATOM   2054 C CG    . GLU A 1 254 ? 46.362 52.232 96.808  1.00 44.89 ? 254 GLU A CG    1 
ATOM   2055 C CD    . GLU A 1 254 ? 47.056 52.226 98.226  1.00 50.35 ? 254 GLU A CD    1 
ATOM   2056 O OE1   . GLU A 1 254 ? 46.438 51.780 99.232  1.00 47.51 ? 254 GLU A OE1   1 
ATOM   2057 O OE2   . GLU A 1 254 ? 48.226 52.691 98.337  1.00 53.76 ? 254 GLU A OE2   1 
ATOM   2058 N N     . ALA A 1 255 ? 45.153 55.821 95.429  1.00 39.88 ? 255 ALA A N     1 
ATOM   2059 C CA    . ALA A 1 255 ? 45.808 56.826 94.545  1.00 38.38 ? 255 ALA A CA    1 
ATOM   2060 C C     . ALA A 1 255 ? 46.320 57.963 95.441  1.00 38.14 ? 255 ALA A C     1 
ATOM   2061 O O     . ALA A 1 255 ? 47.529 58.265 95.504  1.00 39.44 ? 255 ALA A O     1 
ATOM   2062 C CB    . ALA A 1 255 ? 44.859 57.350 93.472  1.00 37.56 ? 255 ALA A CB    1 
ATOM   2063 N N     . ARG A 1 256 ? 45.388 58.562 96.172  1.00 38.07 ? 256 ARG A N     1 
ATOM   2064 C CA    . ARG A 1 256 ? 45.660 59.752 97.004  1.00 36.95 ? 256 ARG A CA    1 
ATOM   2065 C C     . ARG A 1 256 ? 46.603 59.455 98.112  1.00 36.96 ? 256 ARG A C     1 
ATOM   2066 O O     . ARG A 1 256 ? 47.479 60.240 98.455  1.00 36.94 ? 256 ARG A O     1 
ATOM   2067 C CB    . ARG A 1 256 ? 44.367 60.258 97.595  1.00 36.05 ? 256 ARG A CB    1 
ATOM   2068 C CG    . ARG A 1 256 ? 43.630 61.028 96.648  1.00 32.29 ? 256 ARG A CG    1 
ATOM   2069 C CD    . ARG A 1 256 ? 42.214 60.779 96.862  1.00 32.85 ? 256 ARG A CD    1 
ATOM   2070 N NE    . ARG A 1 256 ? 41.400 61.647 95.997  1.00 33.09 ? 256 ARG A NE    1 
ATOM   2071 C CZ    . ARG A 1 256 ? 40.112 61.970 96.162  1.00 33.33 ? 256 ARG A CZ    1 
ATOM   2072 N NH1   . ARG A 1 256 ? 39.368 61.499 97.172  1.00 30.45 ? 256 ARG A NH1   1 
ATOM   2073 N NH2   . ARG A 1 256 ? 39.545 62.788 95.272  1.00 32.60 ? 256 ARG A NH2   1 
ATOM   2074 N N     . ILE A 1 257 ? 46.459 58.298 98.696  1.00 38.07 ? 257 ILE A N     1 
ATOM   2075 C CA    . ILE A 1 257 ? 47.425 58.010 99.712  1.00 40.65 ? 257 ILE A CA    1 
ATOM   2076 C C     . ILE A 1 257 ? 48.862 58.181 99.186  1.00 42.88 ? 257 ILE A C     1 
ATOM   2077 O O     . ILE A 1 257 ? 49.669 58.844 99.881  1.00 43.54 ? 257 ILE A O     1 
ATOM   2078 C CB    . ILE A 1 257 ? 47.148 56.715 100.481 1.00 40.37 ? 257 ILE A CB    1 
ATOM   2079 C CG1   . ILE A 1 257 ? 45.809 56.886 101.229 1.00 37.79 ? 257 ILE A CG1   1 
ATOM   2080 C CG2   . ILE A 1 257 ? 48.337 56.427 101.398 1.00 40.19 ? 257 ILE A CG2   1 
ATOM   2081 C CD1   . ILE A 1 257 ? 45.398 55.684 101.972 1.00 34.16 ? 257 ILE A CD1   1 
ATOM   2082 N N     . ARG A 1 258 ? 49.146 57.685 97.958  1.00 44.22 ? 258 ARG A N     1 
ATOM   2083 C CA    . ARG A 1 258 ? 50.485 57.809 97.306  1.00 45.84 ? 258 ARG A CA    1 
ATOM   2084 C C     . ARG A 1 258 ? 50.892 59.219 96.983  1.00 45.26 ? 258 ARG A C     1 
ATOM   2085 O O     . ARG A 1 258 ? 51.841 59.750 97.638  1.00 43.68 ? 258 ARG A O     1 
ATOM   2086 C CB    . ARG A 1 258 ? 50.528 57.075 95.987  1.00 47.80 ? 258 ARG A CB    1 
ATOM   2087 C CG    . ARG A 1 258 ? 50.086 55.651 96.054  1.00 53.12 ? 258 ARG A CG    1 
ATOM   2088 C CD    . ARG A 1 258 ? 51.171 54.785 96.715  1.00 60.95 ? 258 ARG A CD    1 
ATOM   2089 N NE    . ARG A 1 258 ? 50.653 53.429 96.887  1.00 67.94 ? 258 ARG A NE    1 
ATOM   2090 C CZ    . ARG A 1 258 ? 50.383 52.578 95.884  1.00 72.21 ? 258 ARG A CZ    1 
ATOM   2091 N NH1   . ARG A 1 258 ? 50.608 52.902 94.598  1.00 71.74 ? 258 ARG A NH1   1 
ATOM   2092 N NH2   . ARG A 1 258 ? 49.887 51.375 96.176  1.00 75.24 ? 258 ARG A NH2   1 
ATOM   2093 N N     . GLU A 1 259 ? 50.195 59.803 95.971  1.00 44.62 ? 259 GLU A N     1 
ATOM   2094 C CA    . GLU A 1 259 ? 50.422 61.216 95.619  1.00 45.33 ? 259 GLU A CA    1 
ATOM   2095 C C     . GLU A 1 259 ? 50.780 61.989 96.900  1.00 44.13 ? 259 GLU A C     1 
ATOM   2096 O O     . GLU A 1 259 ? 51.805 62.643 96.963  1.00 45.63 ? 259 GLU A O     1 
ATOM   2097 C CB    . GLU A 1 259 ? 49.227 61.896 94.977  1.00 45.27 ? 259 GLU A CB    1 
ATOM   2098 C CG    . GLU A 1 259 ? 48.299 61.018 94.185  1.00 50.31 ? 259 GLU A CG    1 
ATOM   2099 C CD    . GLU A 1 259 ? 47.336 61.875 93.339  1.00 55.92 ? 259 GLU A CD    1 
ATOM   2100 O OE1   . GLU A 1 259 ? 46.080 61.735 93.426  1.00 59.19 ? 259 GLU A OE1   1 
ATOM   2101 O OE2   . GLU A 1 259 ? 47.840 62.718 92.578  1.00 57.37 ? 259 GLU A OE2   1 
ATOM   2102 N N     . ARG A 1 260 ? 49.991 61.828 97.945  1.00 42.18 ? 260 ARG A N     1 
ATOM   2103 C CA    . ARG A 1 260 ? 50.109 62.693 99.109  1.00 40.83 ? 260 ARG A CA    1 
ATOM   2104 C C     . ARG A 1 260 ? 51.191 62.303 100.021 1.00 39.29 ? 260 ARG A C     1 
ATOM   2105 O O     . ARG A 1 260 ? 51.500 63.059 100.882 1.00 39.35 ? 260 ARG A O     1 
ATOM   2106 C CB    . ARG A 1 260 ? 48.784 62.802 99.897  1.00 40.22 ? 260 ARG A CB    1 
ATOM   2107 C CG    . ARG A 1 260 ? 48.026 64.133 99.639  1.00 40.05 ? 260 ARG A CG    1 
ATOM   2108 C CD    . ARG A 1 260 ? 46.565 64.148 100.241 1.00 41.70 ? 260 ARG A CD    1 
ATOM   2109 N NE    . ARG A 1 260 ? 45.505 63.994 99.240  1.00 40.00 ? 260 ARG A NE    1 
ATOM   2110 C CZ    . ARG A 1 260 ? 44.211 64.189 99.475  1.00 41.88 ? 260 ARG A CZ    1 
ATOM   2111 N NH1   . ARG A 1 260 ? 43.795 64.513 100.687 1.00 42.48 ? 260 ARG A NH1   1 
ATOM   2112 N NH2   . ARG A 1 260 ? 43.300 64.032 98.507  1.00 43.14 ? 260 ARG A NH2   1 
ATOM   2113 N N     . ASN A 1 261 ? 51.784 61.128 99.824  1.00 39.95 ? 261 ASN A N     1 
ATOM   2114 C CA    . ASN A 1 261 ? 52.786 60.583 100.766 1.00 39.21 ? 261 ASN A CA    1 
ATOM   2115 C C     . ASN A 1 261 ? 52.313 60.562 102.221 1.00 38.69 ? 261 ASN A C     1 
ATOM   2116 O O     . ASN A 1 261 ? 52.818 61.268 103.067 1.00 37.95 ? 261 ASN A O     1 
ATOM   2117 C CB    . ASN A 1 261 ? 54.089 61.349 100.645 1.00 39.20 ? 261 ASN A CB    1 
ATOM   2118 C CG    . ASN A 1 261 ? 54.988 60.790 99.541  1.00 43.73 ? 261 ASN A CG    1 
ATOM   2119 O OD1   . ASN A 1 261 ? 55.334 59.599 99.566  1.00 48.14 ? 261 ASN A OD1   1 
ATOM   2120 N ND2   . ASN A 1 261 ? 55.369 61.637 98.558  1.00 45.27 ? 261 ASN A ND2   1 
ATOM   2121 N N     . LEU A 1 262 ? 51.297 59.778 102.513 1.00 38.28 ? 262 LEU A N     1 
ATOM   2122 C CA    . LEU A 1 262 ? 50.925 59.629 103.906 1.00 37.86 ? 262 LEU A CA    1 
ATOM   2123 C C     . LEU A 1 262 ? 51.770 58.541 104.634 1.00 37.94 ? 262 LEU A C     1 
ATOM   2124 O O     . LEU A 1 262 ? 51.753 57.349 104.279 1.00 38.48 ? 262 LEU A O     1 
ATOM   2125 C CB    . LEU A 1 262 ? 49.441 59.357 104.080 1.00 36.36 ? 262 LEU A CB    1 
ATOM   2126 C CG    . LEU A 1 262 ? 48.572 60.548 103.674 1.00 36.21 ? 262 LEU A CG    1 
ATOM   2127 C CD1   . LEU A 1 262 ? 47.096 60.096 103.638 1.00 32.90 ? 262 LEU A CD1   1 
ATOM   2128 C CD2   . LEU A 1 262 ? 48.766 61.813 104.509 1.00 29.96 ? 262 LEU A CD2   1 
ATOM   2129 N N     . ALA A 1 263 ? 52.540 59.003 105.608 1.00 35.97 ? 263 ALA A N     1 
ATOM   2130 C CA    . ALA A 1 263 ? 53.082 58.160 106.619 1.00 35.95 ? 263 ALA A CA    1 
ATOM   2131 C C     . ALA A 1 263 ? 51.890 57.715 107.498 1.00 34.89 ? 263 ALA A C     1 
ATOM   2132 O O     . ALA A 1 263 ? 51.432 58.491 108.320 1.00 35.58 ? 263 ALA A O     1 
ATOM   2133 C CB    . ALA A 1 263 ? 54.100 58.964 107.453 1.00 34.66 ? 263 ALA A CB    1 
ATOM   2134 N N     . LEU A 1 264 ? 51.390 56.496 107.319 1.00 33.23 ? 264 LEU A N     1 
ATOM   2135 C CA    . LEU A 1 264 ? 50.310 55.984 108.190 1.00 31.64 ? 264 LEU A CA    1 
ATOM   2136 C C     . LEU A 1 264 ? 50.746 54.732 108.889 1.00 29.54 ? 264 LEU A C     1 
ATOM   2137 O O     . LEU A 1 264 ? 51.539 53.978 108.387 1.00 29.63 ? 264 LEU A O     1 
ATOM   2138 C CB    . LEU A 1 264 ? 48.991 55.714 107.430 1.00 31.51 ? 264 LEU A CB    1 
ATOM   2139 C CG    . LEU A 1 264 ? 48.432 56.742 106.464 1.00 31.45 ? 264 LEU A CG    1 
ATOM   2140 C CD1   . LEU A 1 264 ? 47.260 56.249 105.676 1.00 33.49 ? 264 LEU A CD1   1 
ATOM   2141 C CD2   . LEU A 1 264 ? 48.016 57.988 107.110 1.00 34.92 ? 264 LEU A CD2   1 
ATOM   2142 N N     . ARG A 1 265 ? 50.157 54.491 110.045 1.00 28.90 ? 265 ARG A N     1 
ATOM   2143 C CA    . ARG A 1 265 ? 50.625 53.493 111.003 1.00 26.38 ? 265 ARG A CA    1 
ATOM   2144 C C     . ARG A 1 265 ? 49.453 52.604 111.309 1.00 26.62 ? 265 ARG A C     1 
ATOM   2145 O O     . ARG A 1 265 ? 49.601 51.330 111.437 1.00 28.80 ? 265 ARG A O     1 
ATOM   2146 C CB    . ARG A 1 265 ? 51.126 54.177 112.228 1.00 23.86 ? 265 ARG A CB    1 
ATOM   2147 C CG    . ARG A 1 265 ? 52.514 54.480 112.025 1.00 28.38 ? 265 ARG A CG    1 
ATOM   2148 C CD    . ARG A 1 265 ? 53.068 55.357 113.053 1.00 28.78 ? 265 ARG A CD    1 
ATOM   2149 N NE    . ARG A 1 265 ? 53.159 54.587 114.276 1.00 41.44 ? 265 ARG A NE    1 
ATOM   2150 C CZ    . ARG A 1 265 ? 53.055 55.093 115.521 1.00 44.94 ? 265 ARG A CZ    1 
ATOM   2151 N NH1   . ARG A 1 265 ? 52.799 56.407 115.715 1.00 42.35 ? 265 ARG A NH1   1 
ATOM   2152 N NH2   . ARG A 1 265 ? 53.186 54.260 116.570 1.00 43.22 ? 265 ARG A NH2   1 
ATOM   2153 N N     . HIS A 1 266 ? 48.285 53.218 111.364 1.00 23.37 ? 266 HIS A N     1 
ATOM   2154 C CA    . HIS A 1 266 ? 47.069 52.422 111.445 1.00 22.95 ? 266 HIS A CA    1 
ATOM   2155 C C     . HIS A 1 266 ? 46.355 52.179 110.082 1.00 23.98 ? 266 HIS A C     1 
ATOM   2156 O O     . HIS A 1 266 ? 46.113 51.050 109.646 1.00 24.30 ? 266 HIS A O     1 
ATOM   2157 C CB    . HIS A 1 266 ? 46.078 53.091 112.433 1.00 21.37 ? 266 HIS A CB    1 
ATOM   2158 C CG    . HIS A 1 266 ? 44.949 52.214 112.791 1.00 15.65 ? 266 HIS A CG    1 
ATOM   2159 N ND1   . HIS A 1 266 ? 45.134 50.900 113.184 1.00 14.29 ? 266 HIS A ND1   1 
ATOM   2160 C CD2   . HIS A 1 266 ? 43.614 52.413 112.742 1.00 9.28  ? 266 HIS A CD2   1 
ATOM   2161 C CE1   . HIS A 1 266 ? 43.958 50.355 113.447 1.00 10.80 ? 266 HIS A CE1   1 
ATOM   2162 N NE2   . HIS A 1 266 ? 43.016 51.241 113.154 1.00 12.06 ? 266 HIS A NE2   1 
ATOM   2163 N N     . LEU A 1 267 ? 45.972 53.264 109.446 1.00 24.67 ? 267 LEU A N     1 
ATOM   2164 C CA    . LEU A 1 267 ? 45.108 53.149 108.310 1.00 28.22 ? 267 LEU A CA    1 
ATOM   2165 C C     . LEU A 1 267 ? 45.829 52.543 107.044 1.00 29.31 ? 267 LEU A C     1 
ATOM   2166 O O     . LEU A 1 267 ? 47.058 52.625 106.905 1.00 31.97 ? 267 LEU A O     1 
ATOM   2167 C CB    . LEU A 1 267 ? 44.433 54.520 108.024 1.00 26.72 ? 267 LEU A CB    1 
ATOM   2168 C CG    . LEU A 1 267 ? 43.289 54.967 108.929 1.00 28.50 ? 267 LEU A CG    1 
ATOM   2169 C CD1   . LEU A 1 267 ? 43.121 56.466 108.992 1.00 28.87 ? 267 LEU A CD1   1 
ATOM   2170 C CD2   . LEU A 1 267 ? 41.995 54.413 108.373 1.00 29.07 ? 267 LEU A CD2   1 
ATOM   2171 N N     . THR A 1 268 ? 45.075 51.916 106.159 1.00 28.66 ? 268 THR A N     1 
ATOM   2172 C CA    . THR A 1 268 ? 45.532 51.577 104.827 1.00 27.79 ? 268 THR A CA    1 
ATOM   2173 C C     . THR A 1 268 ? 44.269 51.928 104.108 1.00 28.97 ? 268 THR A C     1 
ATOM   2174 O O     . THR A 1 268 ? 43.216 52.157 104.759 1.00 31.70 ? 268 THR A O     1 
ATOM   2175 C CB    . THR A 1 268 ? 45.602 50.061 104.516 1.00 27.56 ? 268 THR A CB    1 
ATOM   2176 O OG1   . THR A 1 268 ? 44.266 49.494 104.566 1.00 24.92 ? 268 THR A OG1   1 
ATOM   2177 C CG2   . THR A 1 268 ? 46.436 49.379 105.443 1.00 25.33 ? 268 THR A CG2   1 
ATOM   2178 N N     . ALA A 1 269 ? 44.324 51.917 102.776 1.00 28.19 ? 269 ALA A N     1 
ATOM   2179 C CA    . ALA A 1 269 ? 43.178 52.239 101.932 1.00 25.42 ? 269 ALA A CA    1 
ATOM   2180 C C     . ALA A 1 269 ? 42.012 51.277 102.215 1.00 22.93 ? 269 ALA A C     1 
ATOM   2181 O O     . ALA A 1 269 ? 40.953 51.666 102.641 1.00 19.80 ? 269 ALA A O     1 
ATOM   2182 C CB    . ALA A 1 269 ? 43.620 52.137 100.500 1.00 25.15 ? 269 ALA A CB    1 
ATOM   2183 N N     . PRO A 1 270 ? 42.237 49.978 102.000 1.00 22.01 ? 270 PRO A N     1 
ATOM   2184 C CA    . PRO A 1 270 ? 41.085 49.101 102.165 1.00 21.85 ? 270 PRO A CA    1 
ATOM   2185 C C     . PRO A 1 270 ? 40.527 49.159 103.679 1.00 23.25 ? 270 PRO A C     1 
ATOM   2186 O O     . PRO A 1 270 ? 39.321 49.379 103.894 1.00 22.70 ? 270 PRO A O     1 
ATOM   2187 C CB    . PRO A 1 270 ? 41.652 47.758 101.745 1.00 23.20 ? 270 PRO A CB    1 
ATOM   2188 C CG    . PRO A 1 270 ? 43.069 47.846 102.056 1.00 20.33 ? 270 PRO A CG    1 
ATOM   2189 C CD    . PRO A 1 270 ? 43.464 49.255 101.692 1.00 19.47 ? 270 PRO A CD    1 
ATOM   2190 N N     . TYR A 1 271 ? 41.391 49.083 104.702 1.00 22.58 ? 271 TYR A N     1 
ATOM   2191 C CA    . TYR A 1 271 ? 40.910 49.295 106.078 1.00 22.63 ? 271 TYR A CA    1 
ATOM   2192 C C     . TYR A 1 271 ? 40.076 50.549 106.309 1.00 21.70 ? 271 TYR A C     1 
ATOM   2193 O O     . TYR A 1 271 ? 38.996 50.522 106.885 1.00 21.53 ? 271 TYR A O     1 
ATOM   2194 C CB    . TYR A 1 271 ? 42.072 49.289 107.088 1.00 24.31 ? 271 TYR A CB    1 
ATOM   2195 C CG    . TYR A 1 271 ? 41.531 49.068 108.474 1.00 26.01 ? 271 TYR A CG    1 
ATOM   2196 C CD1   . TYR A 1 271 ? 41.443 50.133 109.358 1.00 24.61 ? 271 TYR A CD1   1 
ATOM   2197 C CD2   . TYR A 1 271 ? 41.003 47.843 108.853 1.00 26.26 ? 271 TYR A CD2   1 
ATOM   2198 C CE1   . TYR A 1 271 ? 40.973 49.990 110.582 1.00 28.51 ? 271 TYR A CE1   1 
ATOM   2199 C CE2   . TYR A 1 271 ? 40.460 47.707 110.138 1.00 31.16 ? 271 TYR A CE2   1 
ATOM   2200 C CZ    . TYR A 1 271 ? 40.464 48.808 110.995 1.00 27.50 ? 271 TYR A CZ    1 
ATOM   2201 O OH    . TYR A 1 271 ? 39.927 48.801 112.246 1.00 25.57 ? 271 TYR A OH    1 
ATOM   2202 N N     . LEU A 1 272 ? 40.600 51.657 105.852 1.00 20.16 ? 272 LEU A N     1 
ATOM   2203 C CA    . LEU A 1 272 ? 39.835 52.869 105.799 1.00 20.29 ? 272 LEU A CA    1 
ATOM   2204 C C     . LEU A 1 272 ? 38.413 52.741 105.183 1.00 22.74 ? 272 LEU A C     1 
ATOM   2205 O O     . LEU A 1 272 ? 37.390 53.180 105.815 1.00 23.34 ? 272 LEU A O     1 
ATOM   2206 C CB    . LEU A 1 272 ? 40.655 53.997 105.116 1.00 18.30 ? 272 LEU A CB    1 
ATOM   2207 C CG    . LEU A 1 272 ? 39.966 55.333 105.068 1.00 11.42 ? 272 LEU A CG    1 
ATOM   2208 C CD1   . LEU A 1 272 ? 40.871 56.410 104.474 1.00 6.09  ? 272 LEU A CD1   1 
ATOM   2209 C CD2   . LEU A 1 272 ? 38.707 55.151 104.153 1.00 12.79 ? 272 LEU A CD2   1 
ATOM   2210 N N     . GLU A 1 273 ? 38.321 52.224 103.947 1.00 24.49 ? 273 GLU A N     1 
ATOM   2211 C CA    . GLU A 1 273 ? 36.983 51.942 103.421 1.00 25.84 ? 273 GLU A CA    1 
ATOM   2212 C C     . GLU A 1 273 ? 36.252 50.885 104.258 1.00 25.34 ? 273 GLU A C     1 
ATOM   2213 O O     . GLU A 1 273 ? 35.030 50.827 104.252 1.00 26.40 ? 273 GLU A O     1 
ATOM   2214 C CB    . GLU A 1 273 ? 37.003 51.469 101.979 1.00 26.89 ? 273 GLU A CB    1 
ATOM   2215 C CG    . GLU A 1 273 ? 38.249 51.842 101.217 1.00 28.07 ? 273 GLU A CG    1 
ATOM   2216 C CD    . GLU A 1 273 ? 37.963 52.229 99.822  1.00 26.41 ? 273 GLU A CD    1 
ATOM   2217 O OE1   . GLU A 1 273 ? 36.994 51.771 99.176  1.00 31.13 ? 273 GLU A OE1   1 
ATOM   2218 O OE2   . GLU A 1 273 ? 38.725 53.038 99.361  1.00 35.14 ? 273 GLU A OE2   1 
ATOM   2219 N N     . ALA A 1 274 ? 36.947 50.028 104.955 1.00 24.50 ? 274 ALA A N     1 
ATOM   2220 C CA    . ALA A 1 274 ? 36.205 49.013 105.764 1.00 24.62 ? 274 ALA A CA    1 
ATOM   2221 C C     . ALA A 1 274 ? 35.428 49.653 106.907 1.00 25.09 ? 274 ALA A C     1 
ATOM   2222 O O     . ALA A 1 274 ? 34.351 49.234 107.261 1.00 24.38 ? 274 ALA A O     1 
ATOM   2223 C CB    . ALA A 1 274 ? 37.183 47.998 106.341 1.00 24.06 ? 274 ALA A CB    1 
ATOM   2224 N N     . MET A 1 275 ? 36.024 50.676 107.516 1.00 26.32 ? 275 MET A N     1 
ATOM   2225 C CA    . MET A 1 275 ? 35.429 51.287 108.704 1.00 27.04 ? 275 MET A CA    1 
ATOM   2226 C C     . MET A 1 275 ? 33.970 51.638 108.455 1.00 26.91 ? 275 MET A C     1 
ATOM   2227 O O     . MET A 1 275 ? 33.130 51.730 109.392 1.00 26.14 ? 275 MET A O     1 
ATOM   2228 C CB    . MET A 1 275 ? 36.211 52.495 109.105 1.00 26.74 ? 275 MET A CB    1 
ATOM   2229 C CG    . MET A 1 275 ? 37.624 52.159 109.367 1.00 25.26 ? 275 MET A CG    1 
ATOM   2230 S SD    . MET A 1 275 ? 38.322 53.513 110.300 1.00 28.94 ? 275 MET A SD    1 
ATOM   2231 C CE    . MET A 1 275 ? 38.531 54.779 108.976 1.00 26.12 ? 275 MET A CE    1 
ATOM   2232 N N     . PHE A 1 276 ? 33.673 51.759 107.172 1.00 25.49 ? 276 PHE A N     1 
ATOM   2233 C CA    . PHE A 1 276 ? 32.343 52.206 106.734 1.00 24.98 ? 276 PHE A CA    1 
ATOM   2234 C C     . PHE A 1 276 ? 31.213 51.196 106.596 1.00 25.25 ? 276 PHE A C     1 
ATOM   2235 O O     . PHE A 1 276 ? 30.060 51.569 106.355 1.00 27.58 ? 276 PHE A O     1 
ATOM   2236 C CB    . PHE A 1 276 ? 32.522 52.989 105.475 1.00 21.53 ? 276 PHE A CB    1 
ATOM   2237 C CG    . PHE A 1 276 ? 33.082 54.293 105.740 1.00 15.58 ? 276 PHE A CG    1 
ATOM   2238 C CD1   . PHE A 1 276 ? 32.259 55.345 105.918 1.00 10.08 ? 276 PHE A CD1   1 
ATOM   2239 C CD2   . PHE A 1 276 ? 34.441 54.496 105.818 1.00 17.55 ? 276 PHE A CD2   1 
ATOM   2240 C CE1   . PHE A 1 276 ? 32.726 56.645 106.147 1.00 6.20  ? 276 PHE A CE1   1 
ATOM   2241 C CE2   . PHE A 1 276 ? 34.920 55.854 106.074 1.00 12.24 ? 276 PHE A CE2   1 
ATOM   2242 C CZ    . PHE A 1 276 ? 34.041 56.879 106.253 1.00 9.23  ? 276 PHE A CZ    1 
ATOM   2243 N N     . VAL A 1 277 ? 31.560 49.936 106.782 1.00 25.24 ? 277 VAL A N     1 
ATOM   2244 C CA    . VAL A 1 277 ? 30.737 48.788 106.558 1.00 22.84 ? 277 VAL A CA    1 
ATOM   2245 C C     . VAL A 1 277 ? 30.325 48.405 107.946 1.00 24.35 ? 277 VAL A C     1 
ATOM   2246 O O     . VAL A 1 277 ? 31.180 47.876 108.709 1.00 22.90 ? 277 VAL A O     1 
ATOM   2247 C CB    . VAL A 1 277 ? 31.607 47.690 105.997 1.00 22.01 ? 277 VAL A CB    1 
ATOM   2248 C CG1   . VAL A 1 277 ? 30.765 46.508 105.635 1.00 22.01 ? 277 VAL A CG1   1 
ATOM   2249 C CG2   . VAL A 1 277 ? 32.326 48.170 104.841 1.00 16.82 ? 277 VAL A CG2   1 
ATOM   2250 N N     . LEU A 1 278 ? 29.038 48.673 108.283 1.00 24.84 ? 278 LEU A N     1 
ATOM   2251 C CA    . LEU A 1 278 ? 28.548 48.412 109.652 1.00 25.22 ? 278 LEU A CA    1 
ATOM   2252 C C     . LEU A 1 278 ? 27.705 47.183 109.837 1.00 25.31 ? 278 LEU A C     1 
ATOM   2253 O O     . LEU A 1 278 ? 26.966 46.839 108.907 1.00 23.09 ? 278 LEU A O     1 
ATOM   2254 C CB    . LEU A 1 278 ? 27.680 49.569 110.162 1.00 25.93 ? 278 LEU A CB    1 
ATOM   2255 C CG    . LEU A 1 278 ? 28.324 50.915 110.331 1.00 22.68 ? 278 LEU A CG    1 
ATOM   2256 C CD1   . LEU A 1 278 ? 29.841 50.778 110.323 1.00 14.81 ? 278 LEU A CD1   1 
ATOM   2257 C CD2   . LEU A 1 278 ? 27.846 51.824 109.319 1.00 21.30 ? 278 LEU A CD2   1 
ATOM   2258 N N     . PRO A 1 279 ? 27.746 46.594 111.099 1.00 25.14 ? 279 PRO A N     1 
ATOM   2259 C CA    . PRO A 1 279 ? 27.015 45.416 111.532 1.00 24.47 ? 279 PRO A CA    1 
ATOM   2260 C C     . PRO A 1 279 ? 25.613 45.780 111.501 1.00 24.58 ? 279 PRO A C     1 
ATOM   2261 O O     . PRO A 1 279 ? 25.319 46.942 111.383 1.00 27.43 ? 279 PRO A O     1 
ATOM   2262 C CB    . PRO A 1 279 ? 27.392 45.302 112.998 1.00 25.02 ? 279 PRO A CB    1 
ATOM   2263 C CG    . PRO A 1 279 ? 27.805 46.592 113.387 1.00 24.79 ? 279 PRO A CG    1 
ATOM   2264 C CD    . PRO A 1 279 ? 28.570 47.084 112.220 1.00 24.10 ? 279 PRO A CD    1 
ATOM   2265 N N     . LYS A 1 280 ? 24.727 44.836 111.644 1.00 23.99 ? 280 LYS A N     1 
ATOM   2266 C CA    . LYS A 1 280 ? 23.340 45.090 111.341 1.00 24.78 ? 280 LYS A CA    1 
ATOM   2267 C C     . LYS A 1 280 ? 22.673 45.872 112.451 1.00 24.73 ? 280 LYS A C     1 
ATOM   2268 O O     . LYS A 1 280 ? 21.782 46.757 112.259 1.00 23.23 ? 280 LYS A O     1 
ATOM   2269 C CB    . LYS A 1 280 ? 22.655 43.734 111.156 1.00 24.86 ? 280 LYS A CB    1 
ATOM   2270 C CG    . LYS A 1 280 ? 21.231 43.668 111.538 1.00 24.29 ? 280 LYS A CG    1 
ATOM   2271 C CD    . LYS A 1 280 ? 20.945 42.242 111.287 1.00 26.32 ? 280 LYS A CD    1 
ATOM   2272 C CE    . LYS A 1 280 ? 19.547 41.871 111.348 1.00 25.29 ? 280 LYS A CE    1 
ATOM   2273 N NZ    . LYS A 1 280 ? 19.596 40.698 110.457 1.00 36.24 ? 280 LYS A NZ    1 
ATOM   2274 N N     . ASP A 1 281 ? 23.064 45.432 113.633 1.00 25.72 ? 281 ASP A N     1 
ATOM   2275 C CA    . ASP A 1 281 ? 22.658 46.083 114.841 1.00 25.08 ? 281 ASP A CA    1 
ATOM   2276 C C     . ASP A 1 281 ? 23.057 47.572 114.802 1.00 24.75 ? 281 ASP A C     1 
ATOM   2277 O O     . ASP A 1 281 ? 22.287 48.392 115.231 1.00 24.41 ? 281 ASP A O     1 
ATOM   2278 C CB    . ASP A 1 281 ? 23.173 45.277 116.051 1.00 25.76 ? 281 ASP A CB    1 
ATOM   2279 C CG    . ASP A 1 281 ? 24.620 44.861 115.926 1.00 25.32 ? 281 ASP A CG    1 
ATOM   2280 O OD1   . ASP A 1 281 ? 25.431 45.567 115.386 1.00 29.49 ? 281 ASP A OD1   1 
ATOM   2281 O OD2   . ASP A 1 281 ? 24.995 43.824 116.435 1.00 28.86 ? 281 ASP A OD2   1 
ATOM   2282 N N     . LEU A 1 282 ? 24.201 47.957 114.213 1.00 25.18 ? 282 LEU A N     1 
ATOM   2283 C CA    . LEU A 1 282 ? 24.554 49.377 114.178 1.00 24.57 ? 282 LEU A CA    1 
ATOM   2284 C C     . LEU A 1 282 ? 23.657 50.013 113.092 1.00 25.17 ? 282 LEU A C     1 
ATOM   2285 O O     . LEU A 1 282 ? 23.014 51.077 113.318 1.00 26.44 ? 282 LEU A O     1 
ATOM   2286 C CB    . LEU A 1 282 ? 26.053 49.585 113.912 1.00 24.02 ? 282 LEU A CB    1 
ATOM   2287 C CG    . LEU A 1 282 ? 26.720 50.858 114.453 1.00 23.24 ? 282 LEU A CG    1 
ATOM   2288 C CD1   . LEU A 1 282 ? 27.763 51.412 113.434 1.00 16.42 ? 282 LEU A CD1   1 
ATOM   2289 C CD2   . LEU A 1 282 ? 25.695 51.963 114.908 1.00 10.54 ? 282 LEU A CD2   1 
ATOM   2290 N N     . LEU A 1 283 ? 23.531 49.358 111.945 1.00 22.44 ? 283 LEU A N     1 
ATOM   2291 C CA    . LEU A 1 283 ? 22.571 49.878 110.968 1.00 21.33 ? 283 LEU A CA    1 
ATOM   2292 C C     . LEU A 1 283 ? 21.147 50.153 111.553 1.00 22.82 ? 283 LEU A C     1 
ATOM   2293 O O     . LEU A 1 283 ? 20.558 51.291 111.385 1.00 22.18 ? 283 LEU A O     1 
ATOM   2294 C CB    . LEU A 1 283 ? 22.548 48.952 109.751 1.00 20.45 ? 283 LEU A CB    1 
ATOM   2295 C CG    . LEU A 1 283 ? 23.895 48.924 109.052 1.00 17.66 ? 283 LEU A CG    1 
ATOM   2296 C CD1   . LEU A 1 283 ? 23.961 48.111 107.726 1.00 14.39 ? 283 LEU A CD1   1 
ATOM   2297 C CD2   . LEU A 1 283 ? 24.192 50.358 108.783 1.00 15.62 ? 283 LEU A CD2   1 
ATOM   2298 N N     . GLU A 1 284 ? 20.599 49.162 112.240 1.00 23.43 ? 284 GLU A N     1 
ATOM   2299 C CA    . GLU A 1 284 ? 19.220 49.281 112.738 1.00 28.43 ? 284 GLU A CA    1 
ATOM   2300 C C     . GLU A 1 284 ? 19.062 50.421 113.663 1.00 28.81 ? 284 GLU A C     1 
ATOM   2301 O O     . GLU A 1 284 ? 18.043 51.088 113.682 1.00 30.04 ? 284 GLU A O     1 
ATOM   2302 C CB    . GLU A 1 284 ? 18.736 48.039 113.498 1.00 27.81 ? 284 GLU A CB    1 
ATOM   2303 C CG    . GLU A 1 284 ? 17.844 47.056 112.709 1.00 29.51 ? 284 GLU A CG    1 
ATOM   2304 C CD    . GLU A 1 284 ? 17.809 45.686 113.377 1.00 34.49 ? 284 GLU A CD    1 
ATOM   2305 O OE1   . GLU A 1 284 ? 17.496 44.668 112.663 1.00 36.82 ? 284 GLU A OE1   1 
ATOM   2306 O OE2   . GLU A 1 284 ? 18.147 45.634 114.647 1.00 43.36 ? 284 GLU A OE2   1 
ATOM   2307 N N     . ALA A 1 285 ? 20.067 50.670 114.474 1.00 31.30 ? 285 ALA A N     1 
ATOM   2308 C CA    . ALA A 1 285 ? 19.875 51.653 115.527 1.00 31.42 ? 285 ALA A CA    1 
ATOM   2309 C C     . ALA A 1 285 ? 19.962 53.092 114.882 1.00 33.47 ? 285 ALA A C     1 
ATOM   2310 O O     . ALA A 1 285 ? 19.107 54.016 115.146 1.00 32.78 ? 285 ALA A O     1 
ATOM   2311 C CB    . ALA A 1 285 ? 20.880 51.428 116.562 1.00 29.42 ? 285 ALA A CB    1 
ATOM   2312 N N     . LEU A 1 286 ? 21.000 53.239 114.031 1.00 34.63 ? 286 LEU A N     1 
ATOM   2313 C CA    . LEU A 1 286 ? 21.215 54.415 113.193 1.00 35.48 ? 286 LEU A CA    1 
ATOM   2314 C C     . LEU A 1 286 ? 19.862 54.718 112.489 1.00 36.13 ? 286 LEU A C     1 
ATOM   2315 O O     . LEU A 1 286 ? 19.350 55.840 112.556 1.00 35.70 ? 286 LEU A O     1 
ATOM   2316 C CB    . LEU A 1 286 ? 22.348 54.159 112.185 1.00 35.17 ? 286 LEU A CB    1 
ATOM   2317 C CG    . LEU A 1 286 ? 23.856 54.215 112.494 1.00 36.03 ? 286 LEU A CG    1 
ATOM   2318 C CD1   . LEU A 1 286 ? 24.748 53.843 111.279 1.00 34.59 ? 286 LEU A CD1   1 
ATOM   2319 C CD2   . LEU A 1 286 ? 24.290 55.559 113.077 1.00 39.16 ? 286 LEU A CD2   1 
ATOM   2320 N N     . GLU A 1 287 ? 19.248 53.703 111.887 1.00 36.42 ? 287 GLU A N     1 
ATOM   2321 C CA    . GLU A 1 287 ? 17.918 53.889 111.331 1.00 36.90 ? 287 GLU A CA    1 
ATOM   2322 C C     . GLU A 1 287 ? 16.750 54.147 112.328 1.00 35.86 ? 287 GLU A C     1 
ATOM   2323 O O     . GLU A 1 287 ? 15.928 55.010 112.098 1.00 37.02 ? 287 GLU A O     1 
ATOM   2324 C CB    . GLU A 1 287 ? 17.581 52.693 110.508 1.00 36.70 ? 287 GLU A CB    1 
ATOM   2325 C CG    . GLU A 1 287 ? 16.975 53.059 109.221 1.00 43.18 ? 287 GLU A CG    1 
ATOM   2326 C CD    . GLU A 1 287 ? 18.010 53.168 108.099 1.00 54.74 ? 287 GLU A CD    1 
ATOM   2327 O OE1   . GLU A 1 287 ? 19.163 52.607 108.211 1.00 58.67 ? 287 GLU A OE1   1 
ATOM   2328 O OE2   . GLU A 1 287 ? 17.644 53.816 107.071 1.00 59.65 ? 287 GLU A OE2   1 
ATOM   2329 N N     . LYS A 1 288 ? 16.600 53.381 113.379 1.00 34.07 ? 288 LYS A N     1 
ATOM   2330 C CA    . LYS A 1 288 ? 15.494 53.672 114.228 1.00 34.67 ? 288 LYS A CA    1 
ATOM   2331 C C     . LYS A 1 288 ? 15.543 55.139 114.799 1.00 32.92 ? 288 LYS A C     1 
ATOM   2332 O O     . LYS A 1 288 ? 14.525 55.728 114.956 1.00 33.51 ? 288 LYS A O     1 
ATOM   2333 C CB    . LYS A 1 288 ? 15.352 52.590 115.346 1.00 35.26 ? 288 LYS A CB    1 
ATOM   2334 C CG    . LYS A 1 288 ? 16.243 52.915 116.613 1.00 39.38 ? 288 LYS A CG    1 
ATOM   2335 C CD    . LYS A 1 288 ? 15.551 52.813 118.081 1.00 38.82 ? 288 LYS A CD    1 
ATOM   2336 C CE    . LYS A 1 288 ? 15.715 51.391 118.775 1.00 43.31 ? 288 LYS A CE    1 
ATOM   2337 N NZ    . LYS A 1 288 ? 14.620 50.334 118.353 1.00 41.91 ? 288 LYS A NZ    1 
ATOM   2338 N N     . GLU A 1 289 ? 16.711 55.730 115.063 1.00 32.02 ? 289 GLU A N     1 
ATOM   2339 C CA    . GLU A 1 289 ? 16.817 57.064 115.694 1.00 32.17 ? 289 GLU A CA    1 
ATOM   2340 C C     . GLU A 1 289 ? 15.993 58.211 115.198 1.00 32.55 ? 289 GLU A C     1 
ATOM   2341 O O     . GLU A 1 289 ? 16.118 58.617 114.079 1.00 34.09 ? 289 GLU A O     1 
ATOM   2342 C CB    . GLU A 1 289 ? 18.228 57.635 115.664 1.00 31.55 ? 289 GLU A CB    1 
ATOM   2343 C CG    . GLU A 1 289 ? 18.395 58.825 116.648 1.00 29.68 ? 289 GLU A CG    1 
ATOM   2344 C CD    . GLU A 1 289 ? 17.979 58.424 118.130 1.00 31.95 ? 289 GLU A CD    1 
ATOM   2345 O OE1   . GLU A 1 289 ? 17.061 59.040 118.702 1.00 27.01 ? 289 GLU A OE1   1 
ATOM   2346 O OE2   . GLU A 1 289 ? 18.539 57.455 118.694 1.00 30.44 ? 289 GLU A OE2   1 
ATOM   2347 N N     . THR A 1 290 ? 15.281 58.854 116.090 1.00 32.33 ? 290 THR A N     1 
ATOM   2348 C CA    . THR A 1 290 ? 14.534 60.019 115.697 1.00 31.03 ? 290 THR A CA    1 
ATOM   2349 C C     . THR A 1 290 ? 14.868 61.346 116.378 1.00 30.77 ? 290 THR A C     1 
ATOM   2350 O O     . THR A 1 290 ? 14.410 62.371 115.890 1.00 30.93 ? 290 THR A O     1 
ATOM   2351 C CB    . THR A 1 290 ? 13.055 59.734 115.961 1.00 32.27 ? 290 THR A CB    1 
ATOM   2352 O OG1   . THR A 1 290 ? 12.901 59.045 117.224 1.00 23.24 ? 290 THR A OG1   1 
ATOM   2353 C CG2   . THR A 1 290 ? 12.585 58.828 114.830 1.00 34.14 ? 290 THR A CG2   1 
ATOM   2354 N N     . MET A 1 291 ? 15.613 61.352 117.494 1.00 29.54 ? 291 MET A N     1 
ATOM   2355 C CA    . MET A 1 291 ? 15.866 62.594 118.206 1.00 28.63 ? 291 MET A CA    1 
ATOM   2356 C C     . MET A 1 291 ? 16.771 63.505 117.362 1.00 28.47 ? 291 MET A C     1 
ATOM   2357 O O     . MET A 1 291 ? 17.781 63.070 116.888 1.00 28.88 ? 291 MET A O     1 
ATOM   2358 C CB    . MET A 1 291 ? 16.455 62.321 119.553 1.00 26.55 ? 291 MET A CB    1 
ATOM   2359 C CG    . MET A 1 291 ? 17.184 63.487 120.108 1.00 28.18 ? 291 MET A CG    1 
ATOM   2360 S SD    . MET A 1 291 ? 17.198 63.541 121.916 1.00 30.44 ? 291 MET A SD    1 
ATOM   2361 C CE    . MET A 1 291 ? 16.498 61.964 122.271 1.00 28.53 ? 291 MET A CE    1 
ATOM   2362 N N     . VAL A 1 292 ? 16.392 64.750 117.142 1.00 27.61 ? 292 VAL A N     1 
ATOM   2363 C CA    . VAL A 1 292 ? 17.297 65.687 116.506 1.00 28.53 ? 292 VAL A CA    1 
ATOM   2364 C C     . VAL A 1 292 ? 17.655 66.776 117.590 1.00 29.26 ? 292 VAL A C     1 
ATOM   2365 O O     . VAL A 1 292 ? 16.738 67.333 118.102 1.00 27.24 ? 292 VAL A O     1 
ATOM   2366 C CB    . VAL A 1 292 ? 16.584 66.392 115.302 1.00 29.22 ? 292 VAL A CB    1 
ATOM   2367 C CG1   . VAL A 1 292 ? 17.169 67.733 115.016 1.00 28.09 ? 292 VAL A CG1   1 
ATOM   2368 C CG2   . VAL A 1 292 ? 16.575 65.487 113.981 1.00 33.05 ? 292 VAL A CG2   1 
ATOM   2369 N N     . SER A 1 293 ? 18.931 67.051 117.977 1.00 29.46 ? 293 SER A N     1 
ATOM   2370 C CA    . SER A 1 293 ? 19.132 68.064 119.059 1.00 30.35 ? 293 SER A CA    1 
ATOM   2371 C C     . SER A 1 293 ? 19.192 69.453 118.392 1.00 32.64 ? 293 SER A C     1 
ATOM   2372 O O     . SER A 1 293 ? 19.669 69.553 117.212 1.00 33.35 ? 293 SER A O     1 
ATOM   2373 C CB    . SER A 1 293 ? 20.317 67.770 119.980 1.00 29.39 ? 293 SER A CB    1 
ATOM   2374 O OG    . SER A 1 293 ? 21.388 68.604 119.731 1.00 25.20 ? 293 SER A OG    1 
ATOM   2375 N N     . THR A 1 294 ? 18.627 70.471 119.080 1.00 32.42 ? 294 THR A N     1 
ATOM   2376 C CA    . THR A 1 294 ? 18.424 71.805 118.508 1.00 33.52 ? 294 THR A CA    1 
ATOM   2377 C C     . THR A 1 294 ? 18.785 72.816 119.535 1.00 34.51 ? 294 THR A C     1 
ATOM   2378 O O     . THR A 1 294 ? 18.549 72.571 120.733 1.00 33.80 ? 294 THR A O     1 
ATOM   2379 C CB    . THR A 1 294 ? 16.966 72.069 118.328 1.00 33.04 ? 294 THR A CB    1 
ATOM   2380 O OG1   . THR A 1 294 ? 16.354 71.866 119.628 1.00 38.67 ? 294 THR A OG1   1 
ATOM   2381 C CG2   . THR A 1 294 ? 16.361 71.161 117.336 1.00 25.75 ? 294 THR A CG2   1 
ATOM   2382 N N     . ASP A 1 295 ? 19.233 73.986 119.087 1.00 36.34 ? 295 ASP A N     1 
ATOM   2383 C CA    . ASP A 1 295 ? 19.362 75.127 120.014 1.00 38.30 ? 295 ASP A CA    1 
ATOM   2384 C C     . ASP A 1 295 ? 18.210 75.310 120.953 1.00 39.21 ? 295 ASP A C     1 
ATOM   2385 O O     . ASP A 1 295 ? 18.408 75.467 122.182 1.00 38.93 ? 295 ASP A O     1 
ATOM   2386 C CB    . ASP A 1 295 ? 19.577 76.414 119.279 1.00 38.20 ? 295 ASP A CB    1 
ATOM   2387 C CG    . ASP A 1 295 ? 20.993 76.562 118.862 1.00 43.69 ? 295 ASP A CG    1 
ATOM   2388 O OD1   . ASP A 1 295 ? 21.354 77.497 118.070 1.00 43.79 ? 295 ASP A OD1   1 
ATOM   2389 O OD2   . ASP A 1 295 ? 21.776 75.707 119.371 1.00 50.61 ? 295 ASP A OD2   1 
ATOM   2390 N N     . GLN A 1 296 ? 17.005 75.286 120.367 1.00 40.58 ? 296 GLN A N     1 
ATOM   2391 C CA    . GLN A 1 296 ? 15.768 75.428 121.127 1.00 41.57 ? 296 GLN A CA    1 
ATOM   2392 C C     . GLN A 1 296 ? 15.725 74.405 122.253 1.00 42.64 ? 296 GLN A C     1 
ATOM   2393 O O     . GLN A 1 296 ? 15.334 74.736 123.399 1.00 42.20 ? 296 GLN A O     1 
ATOM   2394 C CB    . GLN A 1 296 ? 14.570 75.315 120.176 1.00 41.61 ? 296 GLN A CB    1 
ATOM   2395 C CG    . GLN A 1 296 ? 13.167 75.412 120.819 1.00 42.99 ? 296 GLN A CG    1 
ATOM   2396 C CD    . GLN A 1 296 ? 12.878 76.707 121.599 1.00 44.49 ? 296 GLN A CD    1 
ATOM   2397 O OE1   . GLN A 1 296 ? 12.606 76.685 122.845 1.00 42.67 ? 296 GLN A OE1   1 
ATOM   2398 N NE2   . GLN A 1 296 ? 12.905 77.838 120.876 1.00 40.51 ? 296 GLN A NE2   1 
ATOM   2399 N N     . ASN A 1 297 ? 16.156 73.176 121.929 1.00 43.92 ? 297 ASN A N     1 
ATOM   2400 C CA    . ASN A 1 297 ? 16.042 72.046 122.834 1.00 45.62 ? 297 ASN A CA    1 
ATOM   2401 C C     . ASN A 1 297 ? 17.287 71.119 122.797 1.00 46.66 ? 297 ASN A C     1 
ATOM   2402 O O     . ASN A 1 297 ? 17.193 69.941 122.370 1.00 47.90 ? 297 ASN A O     1 
ATOM   2403 C CB    . ASN A 1 297 ? 14.756 71.258 122.490 1.00 45.46 ? 297 ASN A CB    1 
ATOM   2404 C CG    . ASN A 1 297 ? 13.490 71.867 123.110 1.00 48.50 ? 297 ASN A CG    1 
ATOM   2405 O OD1   . ASN A 1 297 ? 12.546 72.296 122.377 1.00 49.53 ? 297 ASN A OD1   1 
ATOM   2406 N ND2   . ASN A 1 297 ? 13.448 71.916 124.469 1.00 46.10 ? 297 ASN A ND2   1 
ATOM   2407 N N     . PRO A 1 298 ? 18.457 71.593 123.280 1.00 46.53 ? 298 PRO A N     1 
ATOM   2408 C CA    . PRO A 1 298 ? 19.708 70.781 123.200 1.00 46.11 ? 298 PRO A CA    1 
ATOM   2409 C C     . PRO A 1 298 ? 19.754 69.381 123.902 1.00 45.59 ? 298 PRO A C     1 
ATOM   2410 O O     . PRO A 1 298 ? 19.397 69.238 125.058 1.00 44.99 ? 298 PRO A O     1 
ATOM   2411 C CB    . PRO A 1 298 ? 20.763 71.716 123.793 1.00 46.33 ? 298 PRO A CB    1 
ATOM   2412 C CG    . PRO A 1 298 ? 20.167 73.082 123.614 1.00 46.91 ? 298 PRO A CG    1 
ATOM   2413 C CD    . PRO A 1 298 ? 18.716 72.883 123.928 1.00 47.21 ? 298 PRO A CD    1 
ATOM   2414 N N     . PHE A 1 299 ? 20.256 68.379 123.189 1.00 45.18 ? 299 PHE A N     1 
ATOM   2415 C CA    . PHE A 1 299 ? 20.347 67.058 123.727 1.00 44.27 ? 299 PHE A CA    1 
ATOM   2416 C C     . PHE A 1 299 ? 21.586 66.839 124.590 1.00 44.12 ? 299 PHE A C     1 
ATOM   2417 O O     . PHE A 1 299 ? 22.626 67.432 124.389 1.00 43.36 ? 299 PHE A O     1 
ATOM   2418 C CB    . PHE A 1 299 ? 20.216 66.010 122.612 1.00 43.96 ? 299 PHE A CB    1 
ATOM   2419 C CG    . PHE A 1 299 ? 21.431 65.109 122.411 1.00 45.20 ? 299 PHE A CG    1 
ATOM   2420 C CD1   . PHE A 1 299 ? 21.471 63.826 122.992 1.00 44.13 ? 299 PHE A CD1   1 
ATOM   2421 C CD2   . PHE A 1 299 ? 22.512 65.503 121.572 1.00 45.76 ? 299 PHE A CD2   1 
ATOM   2422 C CE1   . PHE A 1 299 ? 22.552 62.923 122.736 1.00 44.44 ? 299 PHE A CE1   1 
ATOM   2423 C CE2   . PHE A 1 299 ? 23.604 64.645 121.350 1.00 43.59 ? 299 PHE A CE2   1 
ATOM   2424 C CZ    . PHE A 1 299 ? 23.614 63.320 121.927 1.00 43.30 ? 299 PHE A CZ    1 
ATOM   2425 N N     . TYR A 1 300 ? 21.423 65.957 125.565 1.00 44.61 ? 300 TYR A N     1 
ATOM   2426 C CA    . TYR A 1 300 ? 22.483 65.489 126.403 1.00 44.58 ? 300 TYR A CA    1 
ATOM   2427 C C     . TYR A 1 300 ? 22.256 64.023 126.739 1.00 45.26 ? 300 TYR A C     1 
ATOM   2428 O O     . TYR A 1 300 ? 21.155 63.462 126.574 1.00 44.32 ? 300 TYR A O     1 
ATOM   2429 C CB    . TYR A 1 300 ? 22.507 66.308 127.694 1.00 44.73 ? 300 TYR A CB    1 
ATOM   2430 C CG    . TYR A 1 300 ? 21.298 66.169 128.613 1.00 43.14 ? 300 TYR A CG    1 
ATOM   2431 C CD1   . TYR A 1 300 ? 20.120 66.830 128.337 1.00 45.64 ? 300 TYR A CD1   1 
ATOM   2432 C CD2   . TYR A 1 300 ? 21.353 65.401 129.771 1.00 43.71 ? 300 TYR A CD2   1 
ATOM   2433 C CE1   . TYR A 1 300 ? 19.021 66.722 129.192 1.00 45.01 ? 300 TYR A CE1   1 
ATOM   2434 C CE2   . TYR A 1 300 ? 20.251 65.290 130.621 1.00 41.13 ? 300 TYR A CE2   1 
ATOM   2435 C CZ    . TYR A 1 300 ? 19.098 65.967 130.324 1.00 41.56 ? 300 TYR A CZ    1 
ATOM   2436 O OH    . TYR A 1 300 ? 17.977 65.865 131.108 1.00 38.55 ? 300 TYR A OH    1 
ATOM   2437 N N     . VAL A 1 301 ? 23.299 63.403 127.247 1.00 46.35 ? 301 VAL A N     1 
ATOM   2438 C CA    . VAL A 1 301 ? 23.144 62.048 127.628 1.00 48.15 ? 301 VAL A CA    1 
ATOM   2439 C C     . VAL A 1 301 ? 22.987 62.028 129.124 1.00 49.40 ? 301 VAL A C     1 
ATOM   2440 O O     . VAL A 1 301 ? 23.722 62.726 129.816 1.00 49.02 ? 301 VAL A O     1 
ATOM   2441 C CB    . VAL A 1 301 ? 24.366 61.245 127.307 1.00 48.05 ? 301 VAL A CB    1 
ATOM   2442 C CG1   . VAL A 1 301 ? 24.057 59.799 127.692 1.00 49.78 ? 301 VAL A CG1   1 
ATOM   2443 C CG2   . VAL A 1 301 ? 24.755 61.362 125.812 1.00 48.49 ? 301 VAL A CG2   1 
ATOM   2444 N N     . THR A 1 302 ? 22.072 61.203 129.628 1.00 50.93 ? 302 THR A N     1 
ATOM   2445 C CA    . THR A 1 302 ? 21.992 60.971 131.072 1.00 52.56 ? 302 THR A CA    1 
ATOM   2446 C C     . THR A 1 302 ? 23.228 60.258 131.614 1.00 53.98 ? 302 THR A C     1 
ATOM   2447 O O     . THR A 1 302 ? 24.004 59.674 130.865 1.00 52.94 ? 302 THR A O     1 
ATOM   2448 C CB    . THR A 1 302 ? 20.647 60.316 131.529 1.00 52.53 ? 302 THR A CB    1 
ATOM   2449 O OG1   . THR A 1 302 ? 20.407 59.062 130.869 1.00 49.36 ? 302 THR A OG1   1 
ATOM   2450 C CG2   . THR A 1 302 ? 19.447 61.322 131.278 1.00 55.39 ? 302 THR A CG2   1 
ATOM   2451 N N     . PRO A 1 303 ? 23.425 60.319 132.929 1.00 56.06 ? 303 PRO A N     1 
ATOM   2452 C CA    . PRO A 1 303 ? 24.591 59.633 133.420 1.00 57.24 ? 303 PRO A CA    1 
ATOM   2453 C C     . PRO A 1 303 ? 24.319 58.130 133.393 1.00 58.79 ? 303 PRO A C     1 
ATOM   2454 O O     . PRO A 1 303 ? 25.260 57.352 133.528 1.00 60.71 ? 303 PRO A O     1 
ATOM   2455 C CB    . PRO A 1 303 ? 24.768 60.198 134.832 1.00 57.10 ? 303 PRO A CB    1 
ATOM   2456 C CG    . PRO A 1 303 ? 23.366 60.468 135.288 1.00 57.68 ? 303 PRO A CG    1 
ATOM   2457 C CD    . PRO A 1 303 ? 22.624 60.917 134.014 1.00 56.79 ? 303 PRO A CD    1 
ATOM   2458 N N     . GLU A 1 304 ? 23.074 57.719 133.135 1.00 59.93 ? 304 GLU A N     1 
ATOM   2459 C CA    . GLU A 1 304 ? 22.752 56.320 132.672 1.00 60.88 ? 304 GLU A CA    1 
ATOM   2460 C C     . GLU A 1 304 ? 22.912 56.078 131.157 1.00 59.87 ? 304 GLU A C     1 
ATOM   2461 O O     . GLU A 1 304 ? 22.609 55.000 130.654 1.00 60.28 ? 304 GLU A O     1 
ATOM   2462 C CB    . GLU A 1 304 ? 21.338 55.829 133.110 1.00 61.39 ? 304 GLU A CB    1 
ATOM   2463 C CG    . GLU A 1 304 ? 20.588 56.671 134.182 1.00 66.57 ? 304 GLU A CG    1 
ATOM   2464 C CD    . GLU A 1 304 ? 21.411 56.957 135.452 1.00 74.44 ? 304 GLU A CD    1 
ATOM   2465 O OE1   . GLU A 1 304 ? 22.261 56.104 135.809 1.00 78.40 ? 304 GLU A OE1   1 
ATOM   2466 O OE2   . GLU A 1 304 ? 21.210 58.031 136.103 1.00 78.44 ? 304 GLU A OE2   1 
ATOM   2467 N N     . GLY A 1 305 ? 23.370 57.078 130.425 1.00 59.64 ? 305 GLY A N     1 
ATOM   2468 C CA    . GLY A 1 305 ? 23.622 56.904 128.995 1.00 59.03 ? 305 GLY A CA    1 
ATOM   2469 C C     . GLY A 1 305 ? 22.447 57.216 128.071 1.00 58.81 ? 305 GLY A C     1 
ATOM   2470 O O     . GLY A 1 305 ? 22.626 57.215 126.828 1.00 58.92 ? 305 GLY A O     1 
ATOM   2471 N N     . GLU A 1 306 ? 21.253 57.456 128.648 1.00 57.52 ? 306 GLU A N     1 
ATOM   2472 C CA    . GLU A 1 306 ? 20.058 57.742 127.848 1.00 56.54 ? 306 GLU A CA    1 
ATOM   2473 C C     . GLU A 1 306 ? 20.118 59.136 127.225 1.00 54.71 ? 306 GLU A C     1 
ATOM   2474 O O     . GLU A 1 306 ? 20.662 60.049 127.815 1.00 54.76 ? 306 GLU A O     1 
ATOM   2475 C CB    . GLU A 1 306 ? 18.761 57.554 128.640 1.00 57.13 ? 306 GLU A CB    1 
ATOM   2476 C CG    . GLU A 1 306 ? 18.322 56.088 128.815 1.00 59.98 ? 306 GLU A CG    1 
ATOM   2477 C CD    . GLU A 1 306 ? 18.286 55.695 130.269 1.00 64.00 ? 306 GLU A CD    1 
ATOM   2478 O OE1   . GLU A 1 306 ? 18.201 56.615 131.102 1.00 67.70 ? 306 GLU A OE1   1 
ATOM   2479 O OE2   . GLU A 1 306 ? 18.358 54.493 130.598 1.00 64.00 ? 306 GLU A OE2   1 
ATOM   2480 N N     . ALA A 1 307 ? 19.593 59.266 126.012 1.00 52.89 ? 307 ALA A N     1 
ATOM   2481 C CA    . ALA A 1 307 ? 19.470 60.549 125.299 1.00 50.79 ? 307 ALA A CA    1 
ATOM   2482 C C     . ALA A 1 307 ? 18.282 61.377 125.765 1.00 49.48 ? 307 ALA A C     1 
ATOM   2483 O O     . ALA A 1 307 ? 17.145 61.023 125.488 1.00 49.83 ? 307 ALA A O     1 
ATOM   2484 C CB    . ALA A 1 307 ? 19.319 60.290 123.807 1.00 50.59 ? 307 ALA A CB    1 
ATOM   2485 N N     . ARG A 1 308 ? 18.531 62.496 126.422 1.00 48.03 ? 308 ARG A N     1 
ATOM   2486 C CA    . ARG A 1 308 ? 17.448 63.428 126.750 1.00 47.44 ? 308 ARG A CA    1 
ATOM   2487 C C     . ARG A 1 308 ? 17.496 64.685 125.892 1.00 46.09 ? 308 ARG A C     1 
ATOM   2488 O O     . ARG A 1 308 ? 18.462 64.890 125.178 1.00 45.28 ? 308 ARG A O     1 
ATOM   2489 C CB    . ARG A 1 308 ? 17.522 63.827 128.212 1.00 47.14 ? 308 ARG A CB    1 
ATOM   2490 C CG    . ARG A 1 308 ? 16.474 63.198 129.038 1.00 51.72 ? 308 ARG A CG    1 
ATOM   2491 C CD    . ARG A 1 308 ? 16.536 61.656 129.002 1.00 61.27 ? 308 ARG A CD    1 
ATOM   2492 N NE    . ARG A 1 308 ? 16.367 61.195 130.395 1.00 67.26 ? 308 ARG A NE    1 
ATOM   2493 C CZ    . ARG A 1 308 ? 15.717 60.107 130.814 1.00 67.48 ? 308 ARG A CZ    1 
ATOM   2494 N NH1   . ARG A 1 308 ? 15.668 59.920 132.115 1.00 69.24 ? 308 ARG A NH1   1 
ATOM   2495 N NH2   . ARG A 1 308 ? 15.119 59.231 129.982 1.00 66.47 ? 308 ARG A NH2   1 
ATOM   2496 N N     . GLN A 1 309 ? 16.481 65.548 126.017 1.00 45.64 ? 309 GLN A N     1 
ATOM   2497 C CA    . GLN A 1 309 ? 16.427 66.811 125.315 1.00 45.48 ? 309 GLN A CA    1 
ATOM   2498 C C     . GLN A 1 309 ? 15.538 67.829 126.019 1.00 47.74 ? 309 GLN A C     1 
ATOM   2499 O O     . GLN A 1 309 ? 14.389 67.548 126.309 1.00 48.29 ? 309 GLN A O     1 
ATOM   2500 C CB    . GLN A 1 309 ? 15.915 66.474 123.949 1.00 45.00 ? 309 GLN A CB    1 
ATOM   2501 C CG    . GLN A 1 309 ? 15.467 67.537 123.106 1.00 42.90 ? 309 GLN A CG    1 
ATOM   2502 C CD    . GLN A 1 309 ? 15.439 67.106 121.602 1.00 40.76 ? 309 GLN A CD    1 
ATOM   2503 O OE1   . GLN A 1 309 ? 14.657 66.226 121.150 1.00 35.79 ? 309 GLN A OE1   1 
ATOM   2504 N NE2   . GLN A 1 309 ? 16.295 67.778 120.823 1.00 38.57 ? 309 GLN A NE2   1 
ATOM   2505 N N     . ALA A 1 310 ? 16.096 68.987 126.382 1.00 49.91 ? 310 ALA A N     1 
ATOM   2506 C CA    . ALA A 1 310 ? 15.317 70.142 126.852 1.00 52.66 ? 310 ALA A CA    1 
ATOM   2507 C C     . ALA A 1 310 ? 16.055 71.528 126.657 1.00 53.87 ? 310 ALA A C     1 
ATOM   2508 O O     . ALA A 1 310 ? 17.247 71.537 126.263 1.00 54.11 ? 310 ALA A O     1 
ATOM   2509 C CB    . ALA A 1 310 ? 14.861 69.927 128.314 1.00 53.05 ? 310 ALA A CB    1 
ATOM   2510 N N     . PRO A 1 311 ? 15.354 72.700 126.895 1.00 54.80 ? 311 PRO A N     1 
ATOM   2511 C CA    . PRO A 1 311 ? 16.041 74.027 126.689 1.00 55.17 ? 311 PRO A CA    1 
ATOM   2512 C C     . PRO A 1 311 ? 17.225 74.190 127.651 1.00 56.54 ? 311 PRO A C     1 
ATOM   2513 O O     . PRO A 1 311 ? 17.394 73.312 128.479 1.00 55.68 ? 311 PRO A O     1 
ATOM   2514 C CB    . PRO A 1 311 ? 14.923 75.045 126.927 1.00 55.39 ? 311 PRO A CB    1 
ATOM   2515 C CG    . PRO A 1 311 ? 13.579 74.227 126.827 1.00 54.65 ? 311 PRO A CG    1 
ATOM   2516 C CD    . PRO A 1 311 ? 13.943 72.874 127.331 1.00 54.73 ? 311 PRO A CD    1 
ATOM   2517 N N     . TYR A 1 312 ? 18.061 75.233 127.535 1.00 58.70 ? 312 TYR A N     1 
ATOM   2518 C CA    . TYR A 1 312 ? 19.321 75.285 128.359 1.00 60.20 ? 312 TYR A CA    1 
ATOM   2519 C C     . TYR A 1 312 ? 19.423 76.392 129.520 1.00 61.61 ? 312 TYR A C     1 
ATOM   2520 O O     . TYR A 1 312 ? 19.770 76.185 130.750 1.00 61.21 ? 312 TYR A O     1 
ATOM   2521 C CB    . TYR A 1 312 ? 20.578 75.222 127.425 1.00 60.62 ? 312 TYR A CB    1 
ATOM   2522 C CG    . TYR A 1 312 ? 21.953 75.317 128.104 1.00 60.33 ? 312 TYR A CG    1 
ATOM   2523 C CD1   . TYR A 1 312 ? 23.083 75.803 127.416 1.00 60.07 ? 312 TYR A CD1   1 
ATOM   2524 C CD2   . TYR A 1 312 ? 22.114 74.954 129.460 1.00 64.11 ? 312 TYR A CD2   1 
ATOM   2525 C CE1   . TYR A 1 312 ? 24.346 75.903 128.067 1.00 60.43 ? 312 TYR A CE1   1 
ATOM   2526 C CE2   . TYR A 1 312 ? 23.358 75.071 130.132 1.00 64.13 ? 312 TYR A CE2   1 
ATOM   2527 C CZ    . TYR A 1 312 ? 24.463 75.528 129.431 1.00 62.45 ? 312 TYR A CZ    1 
ATOM   2528 O OH    . TYR A 1 312 ? 25.644 75.584 130.145 1.00 62.72 ? 312 TYR A OH    1 
ATOM   2529 N N     . MET B 1 1   ? 30.478 56.824 140.445 1.00 53.01 ? 1   MET B N     1 
ATOM   2530 C CA    . MET B 1 1   ? 30.763 55.406 140.802 1.00 53.62 ? 1   MET B CA    1 
ATOM   2531 C C     . MET B 1 1   ? 30.213 55.060 142.195 1.00 54.19 ? 1   MET B C     1 
ATOM   2532 O O     . MET B 1 1   ? 30.609 55.649 143.235 1.00 54.60 ? 1   MET B O     1 
ATOM   2533 C CB    . MET B 1 1   ? 32.293 55.138 140.698 1.00 54.03 ? 1   MET B CB    1 
ATOM   2534 C CG    . MET B 1 1   ? 32.909 54.004 141.589 1.00 51.54 ? 1   MET B CG    1 
ATOM   2535 S SD    . MET B 1 1   ? 33.013 52.390 140.760 1.00 43.89 ? 1   MET B SD    1 
ATOM   2536 C CE    . MET B 1 1   ? 34.318 51.624 141.668 1.00 51.76 ? 1   MET B CE    1 
ATOM   2537 N N     . ASP B 1 2   ? 29.277 54.108 142.244 1.00 54.21 ? 2   ASP B N     1 
ATOM   2538 C CA    . ASP B 1 2   ? 28.567 53.887 143.543 1.00 53.27 ? 2   ASP B CA    1 
ATOM   2539 C C     . ASP B 1 2   ? 29.323 53.099 144.617 1.00 50.78 ? 2   ASP B C     1 
ATOM   2540 O O     . ASP B 1 2   ? 30.548 53.089 144.681 1.00 50.34 ? 2   ASP B O     1 
ATOM   2541 C CB    . ASP B 1 2   ? 27.146 53.294 143.332 1.00 54.43 ? 2   ASP B CB    1 
ATOM   2542 C CG    . ASP B 1 2   ? 26.266 54.163 142.412 1.00 56.83 ? 2   ASP B CG    1 
ATOM   2543 O OD1   . ASP B 1 2   ? 26.213 55.422 142.602 1.00 56.71 ? 2   ASP B OD1   1 
ATOM   2544 O OD2   . ASP B 1 2   ? 25.622 53.570 141.494 1.00 60.18 ? 2   ASP B OD2   1 
ATOM   2545 N N     . TYR B 1 3   ? 28.516 52.484 145.472 1.00 48.18 ? 3   TYR B N     1 
ATOM   2546 C CA    . TYR B 1 3   ? 28.866 51.367 146.344 1.00 44.84 ? 3   TYR B CA    1 
ATOM   2547 C C     . TYR B 1 3   ? 27.950 50.180 145.975 1.00 43.70 ? 3   TYR B C     1 
ATOM   2548 O O     . TYR B 1 3   ? 27.062 50.328 145.113 1.00 45.39 ? 3   TYR B O     1 
ATOM   2549 C CB    . TYR B 1 3   ? 28.595 51.778 147.740 1.00 43.15 ? 3   TYR B CB    1 
ATOM   2550 C CG    . TYR B 1 3   ? 29.405 52.988 148.142 1.00 41.23 ? 3   TYR B CG    1 
ATOM   2551 C CD1   . TYR B 1 3   ? 30.786 52.925 148.228 1.00 40.80 ? 3   TYR B CD1   1 
ATOM   2552 C CD2   . TYR B 1 3   ? 28.787 54.177 148.496 1.00 41.29 ? 3   TYR B CD2   1 
ATOM   2553 C CE1   . TYR B 1 3   ? 31.546 54.029 148.627 1.00 38.25 ? 3   TYR B CE1   1 
ATOM   2554 C CE2   . TYR B 1 3   ? 29.527 55.272 148.892 1.00 41.00 ? 3   TYR B CE2   1 
ATOM   2555 C CZ    . TYR B 1 3   ? 30.904 55.172 148.962 1.00 39.14 ? 3   TYR B CZ    1 
ATOM   2556 O OH    . TYR B 1 3   ? 31.625 56.218 149.374 1.00 37.58 ? 3   TYR B OH    1 
ATOM   2557 N N     . GLY B 1 4   ? 28.150 49.013 146.570 1.00 40.39 ? 4   GLY B N     1 
ATOM   2558 C CA    . GLY B 1 4   ? 27.391 47.895 146.148 1.00 36.04 ? 4   GLY B CA    1 
ATOM   2559 C C     . GLY B 1 4   ? 28.348 46.835 145.780 1.00 34.24 ? 4   GLY B C     1 
ATOM   2560 O O     . GLY B 1 4   ? 29.503 46.880 146.105 1.00 34.80 ? 4   GLY B O     1 
ATOM   2561 N N     . MET B 1 5   ? 27.866 45.843 145.090 1.00 34.15 ? 5   MET B N     1 
ATOM   2562 C CA    . MET B 1 5   ? 28.691 44.720 144.845 1.00 34.36 ? 5   MET B CA    1 
ATOM   2563 C C     . MET B 1 5   ? 29.457 44.924 143.578 1.00 33.47 ? 5   MET B C     1 
ATOM   2564 O O     . MET B 1 5   ? 28.915 45.327 142.586 1.00 34.23 ? 5   MET B O     1 
ATOM   2565 C CB    . MET B 1 5   ? 27.779 43.543 144.741 1.00 33.83 ? 5   MET B CB    1 
ATOM   2566 C CG    . MET B 1 5   ? 27.314 43.194 146.124 1.00 35.14 ? 5   MET B CG    1 
ATOM   2567 S SD    . MET B 1 5   ? 26.130 41.801 146.331 1.00 37.40 ? 5   MET B SD    1 
ATOM   2568 C CE    . MET B 1 5   ? 24.916 42.039 145.035 1.00 30.77 ? 5   MET B CE    1 
ATOM   2569 N N     . TYR B 1 6   ? 30.741 44.673 143.584 1.00 32.51 ? 6   TYR B N     1 
ATOM   2570 C CA    . TYR B 1 6   ? 31.397 44.749 142.311 1.00 30.05 ? 6   TYR B CA    1 
ATOM   2571 C C     . TYR B 1 6   ? 32.202 43.546 141.963 1.00 30.69 ? 6   TYR B C     1 
ATOM   2572 O O     . TYR B 1 6   ? 32.682 42.788 142.812 1.00 29.78 ? 6   TYR B O     1 
ATOM   2573 C CB    . TYR B 1 6   ? 32.300 45.938 142.257 1.00 29.55 ? 6   TYR B CB    1 
ATOM   2574 C CG    . TYR B 1 6   ? 31.549 47.223 142.172 1.00 27.46 ? 6   TYR B CG    1 
ATOM   2575 C CD1   . TYR B 1 6   ? 31.145 47.844 143.327 1.00 25.20 ? 6   TYR B CD1   1 
ATOM   2576 C CD2   . TYR B 1 6   ? 31.263 47.819 140.933 1.00 21.86 ? 6   TYR B CD2   1 
ATOM   2577 C CE1   . TYR B 1 6   ? 30.493 49.019 143.315 1.00 27.87 ? 6   TYR B CE1   1 
ATOM   2578 C CE2   . TYR B 1 6   ? 30.574 48.970 140.874 1.00 25.78 ? 6   TYR B CE2   1 
ATOM   2579 C CZ    . TYR B 1 6   ? 30.187 49.614 142.101 1.00 29.64 ? 6   TYR B CZ    1 
ATOM   2580 O OH    . TYR B 1 6   ? 29.490 50.842 142.160 1.00 28.63 ? 6   TYR B OH    1 
ATOM   2581 N N     . PHE B 1 7   ? 32.340 43.325 140.668 1.00 31.61 ? 7   PHE B N     1 
ATOM   2582 C CA    . PHE B 1 7   ? 33.315 42.365 140.291 1.00 31.37 ? 7   PHE B CA    1 
ATOM   2583 C C     . PHE B 1 7   ? 34.648 43.052 140.026 1.00 32.21 ? 7   PHE B C     1 
ATOM   2584 O O     . PHE B 1 7   ? 34.683 44.227 139.708 1.00 31.34 ? 7   PHE B O     1 
ATOM   2585 C CB    . PHE B 1 7   ? 32.863 41.524 139.132 1.00 30.59 ? 7   PHE B CB    1 
ATOM   2586 C CG    . PHE B 1 7   ? 33.666 40.285 139.018 1.00 29.89 ? 7   PHE B CG    1 
ATOM   2587 C CD1   . PHE B 1 7   ? 34.796 40.257 138.237 1.00 31.94 ? 7   PHE B CD1   1 
ATOM   2588 C CD2   . PHE B 1 7   ? 33.355 39.180 139.778 1.00 21.22 ? 7   PHE B CD2   1 
ATOM   2589 C CE1   . PHE B 1 7   ? 35.607 39.094 138.195 1.00 32.11 ? 7   PHE B CE1   1 
ATOM   2590 C CE2   . PHE B 1 7   ? 34.104 38.052 139.715 1.00 21.35 ? 7   PHE B CE2   1 
ATOM   2591 C CZ    . PHE B 1 7   ? 35.237 38.000 138.964 1.00 28.90 ? 7   PHE B CZ    1 
ATOM   2592 N N     . PHE B 1 8   ? 35.751 42.323 140.174 1.00 32.89 ? 8   PHE B N     1 
ATOM   2593 C CA    . PHE B 1 8   ? 37.011 42.881 139.765 1.00 33.67 ? 8   PHE B CA    1 
ATOM   2594 C C     . PHE B 1 8   ? 37.521 42.027 138.620 1.00 34.21 ? 8   PHE B C     1 
ATOM   2595 O O     . PHE B 1 8   ? 37.919 40.906 138.831 1.00 33.80 ? 8   PHE B O     1 
ATOM   2596 C CB    . PHE B 1 8   ? 37.991 42.956 140.949 1.00 33.71 ? 8   PHE B CB    1 
ATOM   2597 C CG    . PHE B 1 8   ? 38.074 44.314 141.587 1.00 33.21 ? 8   PHE B CG    1 
ATOM   2598 C CD1   . PHE B 1 8   ? 36.944 44.879 142.230 1.00 30.58 ? 8   PHE B CD1   1 
ATOM   2599 C CD2   . PHE B 1 8   ? 39.254 45.020 141.567 1.00 31.85 ? 8   PHE B CD2   1 
ATOM   2600 C CE1   . PHE B 1 8   ? 36.959 46.113 142.835 1.00 31.04 ? 8   PHE B CE1   1 
ATOM   2601 C CE2   . PHE B 1 8   ? 39.296 46.346 142.170 1.00 35.94 ? 8   PHE B CE2   1 
ATOM   2602 C CZ    . PHE B 1 8   ? 38.126 46.868 142.831 1.00 35.91 ? 8   PHE B CZ    1 
ATOM   2603 N N     . GLU B 1 9   ? 37.471 42.547 137.401 1.00 35.81 ? 9   GLU B N     1 
ATOM   2604 C CA    . GLU B 1 9   ? 37.802 41.723 136.212 1.00 36.77 ? 9   GLU B CA    1 
ATOM   2605 C C     . GLU B 1 9   ? 39.121 42.116 135.604 1.00 36.87 ? 9   GLU B C     1 
ATOM   2606 O O     . GLU B 1 9   ? 39.330 43.291 135.210 1.00 37.10 ? 9   GLU B O     1 
ATOM   2607 C CB    . GLU B 1 9   ? 36.735 41.835 135.136 1.00 37.02 ? 9   GLU B CB    1 
ATOM   2608 C CG    . GLU B 1 9   ? 36.962 40.837 133.994 1.00 39.00 ? 9   GLU B CG    1 
ATOM   2609 C CD    . GLU B 1 9   ? 36.699 41.476 132.621 1.00 39.64 ? 9   GLU B CD    1 
ATOM   2610 O OE1   . GLU B 1 9   ? 36.037 42.562 132.577 1.00 38.58 ? 9   GLU B OE1   1 
ATOM   2611 O OE2   . GLU B 1 9   ? 37.150 40.869 131.612 1.00 37.75 ? 9   GLU B OE2   1 
ATOM   2612 N N     . HIS B 1 10  ? 40.019 41.138 135.545 1.00 37.43 ? 10  HIS B N     1 
ATOM   2613 C CA    . HIS B 1 10  ? 41.366 41.320 134.977 1.00 38.43 ? 10  HIS B CA    1 
ATOM   2614 C C     . HIS B 1 10  ? 41.233 41.703 133.474 1.00 37.66 ? 10  HIS B C     1 
ATOM   2615 O O     . HIS B 1 10  ? 40.365 41.154 132.728 1.00 38.82 ? 10  HIS B O     1 
ATOM   2616 C CB    . HIS B 1 10  ? 42.140 40.006 135.176 1.00 38.97 ? 10  HIS B CB    1 
ATOM   2617 C CG    . HIS B 1 10  ? 42.999 39.637 134.014 1.00 42.28 ? 10  HIS B CG    1 
ATOM   2618 N ND1   . HIS B 1 10  ? 44.159 40.314 133.704 1.00 46.02 ? 10  HIS B ND1   1 
ATOM   2619 C CD2   . HIS B 1 10  ? 42.851 38.690 133.062 1.00 44.08 ? 10  HIS B CD2   1 
ATOM   2620 C CE1   . HIS B 1 10  ? 44.687 39.814 132.602 1.00 45.55 ? 10  HIS B CE1   1 
ATOM   2621 N NE2   . HIS B 1 10  ? 43.910 38.828 132.190 1.00 47.31 ? 10  HIS B NE2   1 
ATOM   2622 N N     . VAL B 1 11  ? 41.978 42.666 132.989 1.00 35.94 ? 11  VAL B N     1 
ATOM   2623 C CA    . VAL B 1 11  ? 41.811 42.882 131.516 1.00 34.14 ? 11  VAL B CA    1 
ATOM   2624 C C     . VAL B 1 11  ? 43.194 42.770 130.927 1.00 34.53 ? 11  VAL B C     1 
ATOM   2625 O O     . VAL B 1 11  ? 43.370 42.280 129.818 1.00 35.15 ? 11  VAL B O     1 
ATOM   2626 C CB    . VAL B 1 11  ? 41.082 44.170 131.120 1.00 32.78 ? 11  VAL B CB    1 
ATOM   2627 C CG1   . VAL B 1 11  ? 40.812 44.245 129.592 1.00 32.31 ? 11  VAL B CG1   1 
ATOM   2628 C CG2   . VAL B 1 11  ? 39.811 44.209 131.789 1.00 32.15 ? 11  VAL B CG2   1 
ATOM   2629 N N     . THR B 1 12  ? 44.172 43.223 131.709 1.00 34.55 ? 12  THR B N     1 
ATOM   2630 C CA    . THR B 1 12  ? 45.564 43.156 131.392 1.00 34.24 ? 12  THR B CA    1 
ATOM   2631 C C     . THR B 1 12  ? 46.236 43.429 132.719 1.00 36.63 ? 12  THR B C     1 
ATOM   2632 O O     . THR B 1 12  ? 45.586 43.633 133.740 1.00 37.74 ? 12  THR B O     1 
ATOM   2633 C CB    . THR B 1 12  ? 45.961 44.304 130.544 1.00 33.25 ? 12  THR B CB    1 
ATOM   2634 O OG1   . THR B 1 12  ? 46.223 45.443 131.395 1.00 34.01 ? 12  THR B OG1   1 
ATOM   2635 C CG2   . THR B 1 12  ? 44.897 44.645 129.499 1.00 33.06 ? 12  THR B CG2   1 
ATOM   2636 N N     . PRO B 1 13  ? 47.559 43.484 132.736 1.00 38.17 ? 13  PRO B N     1 
ATOM   2637 C CA    . PRO B 1 13  ? 47.980 43.754 134.066 1.00 38.00 ? 13  PRO B CA    1 
ATOM   2638 C C     . PRO B 1 13  ? 47.816 45.159 134.502 1.00 37.88 ? 13  PRO B C     1 
ATOM   2639 O O     . PRO B 1 13  ? 48.200 45.417 135.610 1.00 38.23 ? 13  PRO B O     1 
ATOM   2640 C CB    . PRO B 1 13  ? 49.474 43.498 133.996 1.00 39.86 ? 13  PRO B CB    1 
ATOM   2641 C CG    . PRO B 1 13  ? 49.801 43.775 132.519 1.00 40.07 ? 13  PRO B CG    1 
ATOM   2642 C CD    . PRO B 1 13  ? 48.684 43.237 131.801 1.00 38.04 ? 13  PRO B CD    1 
ATOM   2643 N N     . TYR B 1 14  ? 47.325 46.089 133.681 1.00 37.58 ? 14  TYR B N     1 
ATOM   2644 C CA    . TYR B 1 14  ? 47.365 47.521 134.102 1.00 35.72 ? 14  TYR B CA    1 
ATOM   2645 C C     . TYR B 1 14  ? 46.097 48.100 133.929 1.00 33.67 ? 14  TYR B C     1 
ATOM   2646 O O     . TYR B 1 14  ? 45.949 49.224 134.307 1.00 35.47 ? 14  TYR B O     1 
ATOM   2647 C CB    . TYR B 1 14  ? 48.287 48.430 133.292 1.00 37.29 ? 14  TYR B CB    1 
ATOM   2648 C CG    . TYR B 1 14  ? 49.616 47.830 133.000 1.00 40.18 ? 14  TYR B CG    1 
ATOM   2649 C CD1   . TYR B 1 14  ? 49.892 47.275 131.760 1.00 43.13 ? 14  TYR B CD1   1 
ATOM   2650 C CD2   . TYR B 1 14  ? 50.598 47.771 133.985 1.00 43.56 ? 14  TYR B CD2   1 
ATOM   2651 C CE1   . TYR B 1 14  ? 51.129 46.659 131.512 1.00 42.71 ? 14  TYR B CE1   1 
ATOM   2652 C CE2   . TYR B 1 14  ? 51.825 47.169 133.754 1.00 43.53 ? 14  TYR B CE2   1 
ATOM   2653 C CZ    . TYR B 1 14  ? 52.085 46.631 132.507 1.00 43.21 ? 14  TYR B CZ    1 
ATOM   2654 O OH    . TYR B 1 14  ? 53.323 46.053 132.273 1.00 47.79 ? 14  TYR B OH    1 
ATOM   2655 N N     . GLU B 1 15  ? 45.185 47.395 133.279 1.00 31.70 ? 15  GLU B N     1 
ATOM   2656 C CA    . GLU B 1 15  ? 43.824 47.868 133.246 1.00 29.49 ? 15  GLU B CA    1 
ATOM   2657 C C     . GLU B 1 15  ? 42.959 46.771 133.850 1.00 28.09 ? 15  GLU B C     1 
ATOM   2658 O O     . GLU B 1 15  ? 43.197 45.622 133.625 1.00 27.40 ? 15  GLU B O     1 
ATOM   2659 C CB    . GLU B 1 15  ? 43.447 48.399 131.860 1.00 28.76 ? 15  GLU B CB    1 
ATOM   2660 C CG    . GLU B 1 15  ? 44.264 49.681 131.424 1.00 28.45 ? 15  GLU B CG    1 
ATOM   2661 C CD    . GLU B 1 15  ? 45.710 49.358 130.867 1.00 30.53 ? 15  GLU B CD    1 
ATOM   2662 O OE1   . GLU B 1 15  ? 45.966 48.222 130.366 1.00 27.52 ? 15  GLU B OE1   1 
ATOM   2663 O OE2   . GLU B 1 15  ? 46.624 50.217 130.963 1.00 29.56 ? 15  GLU B OE2   1 
ATOM   2664 N N     . THR B 1 16  ? 42.068 47.159 134.764 1.00 28.63 ? 16  THR B N     1 
ATOM   2665 C CA    . THR B 1 16  ? 41.095 46.254 135.491 1.00 26.40 ? 16  THR B CA    1 
ATOM   2666 C C     . THR B 1 16  ? 39.725 46.890 135.311 1.00 26.07 ? 16  THR B C     1 
ATOM   2667 O O     . THR B 1 16  ? 39.556 48.156 135.340 1.00 26.96 ? 16  THR B O     1 
ATOM   2668 C CB    . THR B 1 16  ? 41.416 46.109 137.017 1.00 26.64 ? 16  THR B CB    1 
ATOM   2669 O OG1   . THR B 1 16  ? 42.777 45.707 137.222 1.00 24.37 ? 16  THR B OG1   1 
ATOM   2670 C CG2   . THR B 1 16  ? 40.649 45.060 137.642 1.00 24.33 ? 16  THR B CG2   1 
ATOM   2671 N N     . LEU B 1 17  ? 38.751 46.032 135.070 1.00 23.51 ? 17  LEU B N     1 
ATOM   2672 C CA    . LEU B 1 17  ? 37.407 46.482 134.870 1.00 22.03 ? 17  LEU B CA    1 
ATOM   2673 C C     . LEU B 1 17  ? 36.622 46.050 136.114 1.00 20.91 ? 17  LEU B C     1 
ATOM   2674 O O     . LEU B 1 17  ? 36.556 44.860 136.440 1.00 16.99 ? 17  LEU B O     1 
ATOM   2675 C CB    . LEU B 1 17  ? 36.843 45.776 133.656 1.00 21.96 ? 17  LEU B CB    1 
ATOM   2676 C CG    . LEU B 1 17  ? 35.772 46.514 132.885 1.00 23.25 ? 17  LEU B CG    1 
ATOM   2677 C CD1   . LEU B 1 17  ? 36.118 47.939 132.904 1.00 22.34 ? 17  LEU B CD1   1 
ATOM   2678 C CD2   . LEU B 1 17  ? 35.647 46.024 131.372 1.00 24.83 ? 17  LEU B CD2   1 
ATOM   2679 N N     . VAL B 1 18  ? 36.062 47.049 136.790 1.00 21.97 ? 18  VAL B N     1 
ATOM   2680 C CA    . VAL B 1 18  ? 35.301 46.851 138.004 1.00 22.83 ? 18  VAL B CA    1 
ATOM   2681 C C     . VAL B 1 18  ? 33.894 46.888 137.517 1.00 22.14 ? 18  VAL B C     1 
ATOM   2682 O O     . VAL B 1 18  ? 33.490 47.879 137.091 1.00 20.89 ? 18  VAL B O     1 
ATOM   2683 C CB    . VAL B 1 18  ? 35.654 47.970 139.100 1.00 24.62 ? 18  VAL B CB    1 
ATOM   2684 C CG1   . VAL B 1 18  ? 34.677 47.929 140.215 1.00 23.44 ? 18  VAL B CG1   1 
ATOM   2685 C CG2   . VAL B 1 18  ? 37.095 47.820 139.692 1.00 21.36 ? 18  VAL B CG2   1 
ATOM   2686 N N     . ARG B 1 19  ? 33.183 45.765 137.518 1.00 25.75 ? 19  ARG B N     1 
ATOM   2687 C CA    . ARG B 1 19  ? 31.744 45.629 137.111 1.00 28.86 ? 19  ARG B CA    1 
ATOM   2688 C C     . ARG B 1 19  ? 30.644 45.568 138.262 1.00 29.56 ? 19  ARG B C     1 
ATOM   2689 O O     . ARG B 1 19  ? 30.761 44.757 139.169 1.00 29.01 ? 19  ARG B O     1 
ATOM   2690 C CB    . ARG B 1 19  ? 31.620 44.322 136.330 1.00 28.84 ? 19  ARG B CB    1 
ATOM   2691 C CG    . ARG B 1 19  ? 32.089 44.375 134.841 1.00 33.93 ? 19  ARG B CG    1 
ATOM   2692 C CD    . ARG B 1 19  ? 32.758 43.030 134.522 1.00 35.13 ? 19  ARG B CD    1 
ATOM   2693 N NE    . ARG B 1 19  ? 33.432 42.909 133.226 1.00 39.74 ? 19  ARG B NE    1 
ATOM   2694 C CZ    . ARG B 1 19  ? 32.848 42.923 132.014 1.00 36.93 ? 19  ARG B CZ    1 
ATOM   2695 N NH1   . ARG B 1 19  ? 31.531 43.160 131.846 1.00 32.21 ? 19  ARG B NH1   1 
ATOM   2696 N NH2   . ARG B 1 19  ? 33.618 42.706 130.955 1.00 35.74 ? 19  ARG B NH2   1 
ATOM   2697 N N     . ARG B 1 20  ? 29.576 46.365 138.183 1.00 30.20 ? 20  ARG B N     1 
ATOM   2698 C CA    . ARG B 1 20  ? 28.562 46.470 139.260 1.00 31.44 ? 20  ARG B CA    1 
ATOM   2699 C C     . ARG B 1 20  ? 27.643 45.274 139.186 1.00 32.72 ? 20  ARG B C     1 
ATOM   2700 O O     . ARG B 1 20  ? 26.944 45.071 138.202 1.00 33.51 ? 20  ARG B O     1 
ATOM   2701 C CB    . ARG B 1 20  ? 27.733 47.806 139.195 1.00 30.37 ? 20  ARG B CB    1 
ATOM   2702 C CG    . ARG B 1 20  ? 26.931 48.195 140.453 1.00 30.41 ? 20  ARG B CG    1 
ATOM   2703 C CD    . ARG B 1 20  ? 25.706 49.077 140.130 1.00 32.98 ? 20  ARG B CD    1 
ATOM   2704 N NE    . ARG B 1 20  ? 25.106 49.871 141.207 1.00 43.41 ? 20  ARG B NE    1 
ATOM   2705 C CZ    . ARG B 1 20  ? 25.191 49.660 142.559 1.00 47.87 ? 20  ARG B CZ    1 
ATOM   2706 N NH1   . ARG B 1 20  ? 25.890 48.665 143.103 1.00 49.03 ? 20  ARG B NH1   1 
ATOM   2707 N NH2   . ARG B 1 20  ? 24.535 50.462 143.414 1.00 47.72 ? 20  ARG B NH2   1 
ATOM   2708 N N     . MET B 1 21  ? 27.624 44.531 140.292 1.00 34.88 ? 21  MET B N     1 
ATOM   2709 C CA    . MET B 1 21  ? 26.849 43.307 140.500 1.00 35.13 ? 21  MET B CA    1 
ATOM   2710 C C     . MET B 1 21  ? 25.506 43.628 141.127 1.00 35.85 ? 21  MET B C     1 
ATOM   2711 O O     . MET B 1 21  ? 25.438 44.172 142.222 1.00 36.87 ? 21  MET B O     1 
ATOM   2712 C CB    . MET B 1 21  ? 27.648 42.383 141.356 1.00 33.72 ? 21  MET B CB    1 
ATOM   2713 C CG    . MET B 1 21  ? 28.856 41.899 140.625 1.00 32.67 ? 21  MET B CG    1 
ATOM   2714 S SD    . MET B 1 21  ? 29.388 40.280 141.149 1.00 37.72 ? 21  MET B SD    1 
ATOM   2715 C CE    . MET B 1 21  ? 29.645 40.499 142.893 1.00 26.12 ? 21  MET B CE    1 
ATOM   2716 N N     . GLU B 1 22  ? 24.449 43.354 140.381 1.00 36.98 ? 22  GLU B N     1 
ATOM   2717 C CA    . GLU B 1 22  ? 23.095 43.668 140.783 1.00 37.66 ? 22  GLU B CA    1 
ATOM   2718 C C     . GLU B 1 22  ? 22.746 42.510 141.703 1.00 37.30 ? 22  GLU B C     1 
ATOM   2719 O O     . GLU B 1 22  ? 22.201 42.721 142.784 1.00 37.72 ? 22  GLU B O     1 
ATOM   2720 C CB    . GLU B 1 22  ? 22.180 43.752 139.554 1.00 37.82 ? 22  GLU B CB    1 
ATOM   2721 C CG    . GLU B 1 22  ? 21.740 45.182 139.014 1.00 42.32 ? 22  GLU B CG    1 
ATOM   2722 C CD    . GLU B 1 22  ? 22.509 46.469 139.494 1.00 43.66 ? 22  GLU B CD    1 
ATOM   2723 O OE1   . GLU B 1 22  ? 21.833 47.312 140.098 1.00 41.32 ? 22  GLU B OE1   1 
ATOM   2724 O OE2   . GLU B 1 22  ? 23.712 46.708 139.180 1.00 48.22 ? 22  GLU B OE2   1 
ATOM   2725 N N     . ARG B 1 23  ? 23.154 41.301 141.338 1.00 36.25 ? 23  ARG B N     1 
ATOM   2726 C CA    . ARG B 1 23  ? 22.918 40.197 142.193 1.00 37.21 ? 23  ARG B CA    1 
ATOM   2727 C C     . ARG B 1 23  ? 23.647 38.996 141.683 1.00 35.81 ? 23  ARG B C     1 
ATOM   2728 O O     . ARG B 1 23  ? 23.560 38.673 140.498 1.00 37.43 ? 23  ARG B O     1 
ATOM   2729 C CB    . ARG B 1 23  ? 21.426 39.932 142.253 1.00 37.31 ? 23  ARG B CB    1 
ATOM   2730 C CG    . ARG B 1 23  ? 21.052 38.555 142.840 1.00 40.48 ? 23  ARG B CG    1 
ATOM   2731 C CD    . ARG B 1 23  ? 19.564 38.203 142.446 1.00 42.14 ? 23  ARG B CD    1 
ATOM   2732 N NE    . ARG B 1 23  ? 19.359 38.390 140.999 1.00 48.67 ? 23  ARG B NE    1 
ATOM   2733 C CZ    . ARG B 1 23  ? 19.286 37.383 140.129 1.00 51.81 ? 23  ARG B CZ    1 
ATOM   2734 N NH1   . ARG B 1 23  ? 19.364 36.133 140.572 1.00 53.92 ? 23  ARG B NH1   1 
ATOM   2735 N NH2   . ARG B 1 23  ? 19.121 37.614 138.823 1.00 53.32 ? 23  ARG B NH2   1 
ATOM   2736 N N     . VAL B 1 24  ? 24.380 38.335 142.561 1.00 34.76 ? 24  VAL B N     1 
ATOM   2737 C CA    . VAL B 1 24  ? 24.943 37.058 142.246 1.00 34.67 ? 24  VAL B CA    1 
ATOM   2738 C C     . VAL B 1 24  ? 23.813 36.008 142.175 1.00 36.75 ? 24  VAL B C     1 
ATOM   2739 O O     . VAL B 1 24  ? 22.855 36.084 142.897 1.00 37.68 ? 24  VAL B O     1 
ATOM   2740 C CB    . VAL B 1 24  ? 25.993 36.771 143.205 1.00 34.56 ? 24  VAL B CB    1 
ATOM   2741 C CG1   . VAL B 1 24  ? 26.905 35.595 142.755 1.00 33.69 ? 24  VAL B CG1   1 
ATOM   2742 C CG2   . VAL B 1 24  ? 26.791 37.997 143.307 1.00 31.21 ? 24  VAL B CG2   1 
ATOM   2743 N N     . ILE B 1 25  ? 23.919 35.111 141.197 1.00 38.79 ? 25  ILE B N     1 
ATOM   2744 C CA    . ILE B 1 25  ? 22.904 34.238 140.681 1.00 38.60 ? 25  ILE B CA    1 
ATOM   2745 C C     . ILE B 1 25  ? 23.457 32.898 140.989 1.00 39.44 ? 25  ILE B C     1 
ATOM   2746 O O     . ILE B 1 25  ? 22.725 31.901 140.975 1.00 40.72 ? 25  ILE B O     1 
ATOM   2747 C CB    . ILE B 1 25  ? 22.827 34.341 139.135 1.00 39.08 ? 25  ILE B CB    1 
ATOM   2748 C CG1   . ILE B 1 25  ? 21.682 35.252 138.763 1.00 42.53 ? 25  ILE B CG1   1 
ATOM   2749 C CG2   . ILE B 1 25  ? 22.491 32.995 138.478 1.00 37.04 ? 25  ILE B CG2   1 
ATOM   2750 C CD1   . ILE B 1 25  ? 21.841 35.904 137.366 1.00 48.59 ? 25  ILE B CD1   1 
ATOM   2751 N N     . ALA B 1 26  ? 24.763 32.836 141.239 1.00 39.83 ? 26  ALA B N     1 
ATOM   2752 C CA    . ALA B 1 26  ? 25.403 31.550 141.426 1.00 40.55 ? 26  ALA B CA    1 
ATOM   2753 C C     . ALA B 1 26  ? 26.860 31.674 141.125 1.00 41.42 ? 26  ALA B C     1 
ATOM   2754 O O     . ALA B 1 26  ? 27.235 32.038 140.028 1.00 42.42 ? 26  ALA B O     1 
ATOM   2755 C CB    . ALA B 1 26  ? 24.776 30.488 140.507 1.00 39.20 ? 26  ALA B CB    1 
ATOM   2756 N N     . SER B 1 27  ? 27.671 31.338 142.109 1.00 42.07 ? 27  SER B N     1 
ATOM   2757 C CA    . SER B 1 27  ? 29.082 31.184 141.967 1.00 42.21 ? 27  SER B CA    1 
ATOM   2758 C C     . SER B 1 27  ? 29.431 29.799 142.521 1.00 42.68 ? 27  SER B C     1 
ATOM   2759 O O     . SER B 1 27  ? 28.544 29.100 142.989 1.00 41.06 ? 27  SER B O     1 
ATOM   2760 C CB    . SER B 1 27  ? 29.738 32.225 142.837 1.00 42.90 ? 27  SER B CB    1 
ATOM   2761 O OG    . SER B 1 27  ? 29.300 32.144 144.194 1.00 45.04 ? 27  SER B OG    1 
ATOM   2762 N N     . GLY B 1 28  ? 30.709 29.429 142.444 1.00 43.27 ? 28  GLY B N     1 
ATOM   2763 C CA    . GLY B 1 28  ? 31.227 28.209 143.030 1.00 45.67 ? 28  GLY B CA    1 
ATOM   2764 C C     . GLY B 1 28  ? 32.613 27.820 142.483 1.00 47.55 ? 28  GLY B C     1 
ATOM   2765 O O     . GLY B 1 28  ? 33.263 28.645 141.837 1.00 47.73 ? 28  GLY B O     1 
ATOM   2766 N N     . LYS B 1 29  ? 33.070 26.575 142.707 1.00 48.16 ? 29  LYS B N     1 
ATOM   2767 C CA    . LYS B 1 29  ? 34.428 26.257 142.365 1.00 48.62 ? 29  LYS B CA    1 
ATOM   2768 C C     . LYS B 1 29  ? 34.757 24.954 141.678 1.00 48.44 ? 29  LYS B C     1 
ATOM   2769 O O     . LYS B 1 29  ? 35.739 24.363 142.049 1.00 49.30 ? 29  LYS B O     1 
ATOM   2770 C CB    . LYS B 1 29  ? 35.326 26.441 143.612 1.00 49.90 ? 29  LYS B CB    1 
ATOM   2771 C CG    . LYS B 1 29  ? 36.874 26.164 143.443 1.00 49.08 ? 29  LYS B CG    1 
ATOM   2772 C CD    . LYS B 1 29  ? 37.697 27.088 144.334 1.00 50.39 ? 29  LYS B CD    1 
ATOM   2773 C CE    . LYS B 1 29  ? 39.110 26.571 144.647 1.00 52.95 ? 29  LYS B CE    1 
ATOM   2774 N NZ    . LYS B 1 29  ? 39.757 27.571 145.591 1.00 58.00 ? 29  LYS B NZ    1 
ATOM   2775 N N     . THR B 1 30  ? 34.051 24.549 140.626 1.00 48.47 ? 30  THR B N     1 
ATOM   2776 C CA    . THR B 1 30  ? 34.439 23.325 139.832 1.00 47.40 ? 30  THR B CA    1 
ATOM   2777 C C     . THR B 1 30  ? 35.917 22.887 139.866 1.00 47.48 ? 30  THR B C     1 
ATOM   2778 O O     . THR B 1 30  ? 36.824 23.696 140.094 1.00 45.21 ? 30  THR B O     1 
ATOM   2779 C CB    . THR B 1 30  ? 33.965 23.301 138.296 1.00 47.89 ? 30  THR B CB    1 
ATOM   2780 O OG1   . THR B 1 30  ? 35.081 23.348 137.400 1.00 50.57 ? 30  THR B OG1   1 
ATOM   2781 C CG2   . THR B 1 30  ? 32.984 24.360 137.924 1.00 46.46 ? 30  THR B CG2   1 
ATOM   2782 N N     . PRO B 1 31  ? 36.168 21.568 139.626 1.00 48.37 ? 31  PRO B N     1 
ATOM   2783 C CA    . PRO B 1 31  ? 37.511 21.062 139.811 1.00 48.14 ? 31  PRO B CA    1 
ATOM   2784 C C     . PRO B 1 31  ? 38.378 21.559 138.718 1.00 48.71 ? 31  PRO B C     1 
ATOM   2785 O O     . PRO B 1 31  ? 39.567 21.331 138.769 1.00 48.82 ? 31  PRO B O     1 
ATOM   2786 C CB    . PRO B 1 31  ? 37.345 19.590 139.633 1.00 47.45 ? 31  PRO B CB    1 
ATOM   2787 C CG    . PRO B 1 31  ? 36.224 19.480 138.717 1.00 48.66 ? 31  PRO B CG    1 
ATOM   2788 C CD    . PRO B 1 31  ? 35.266 20.489 139.194 1.00 48.33 ? 31  PRO B CD    1 
ATOM   2789 N N     . PHE B 1 32  ? 37.788 22.243 137.734 1.00 49.58 ? 32  PHE B N     1 
ATOM   2790 C CA    . PHE B 1 32  ? 38.549 22.855 136.606 1.00 49.80 ? 32  PHE B CA    1 
ATOM   2791 C C     . PHE B 1 32  ? 38.595 24.396 136.613 1.00 48.80 ? 32  PHE B C     1 
ATOM   2792 O O     . PHE B 1 32  ? 39.548 24.965 136.123 1.00 48.08 ? 32  PHE B O     1 
ATOM   2793 C CB    . PHE B 1 32  ? 38.058 22.370 135.238 1.00 50.32 ? 32  PHE B CB    1 
ATOM   2794 C CG    . PHE B 1 32  ? 38.111 20.876 135.056 1.00 51.79 ? 32  PHE B CG    1 
ATOM   2795 C CD1   . PHE B 1 32  ? 39.216 20.279 134.460 1.00 53.30 ? 32  PHE B CD1   1 
ATOM   2796 C CD2   . PHE B 1 32  ? 37.027 20.066 135.469 1.00 52.84 ? 32  PHE B CD2   1 
ATOM   2797 C CE1   . PHE B 1 32  ? 39.260 18.895 134.266 1.00 55.86 ? 32  PHE B CE1   1 
ATOM   2798 C CE2   . PHE B 1 32  ? 37.049 18.687 135.295 1.00 55.18 ? 32  PHE B CE2   1 
ATOM   2799 C CZ    . PHE B 1 32  ? 38.175 18.081 134.680 1.00 55.72 ? 32  PHE B CZ    1 
ATOM   2800 N N     . GLN B 1 33  ? 37.587 25.066 137.154 1.00 47.43 ? 33  GLN B N     1 
ATOM   2801 C CA    . GLN B 1 33  ? 37.715 26.510 137.339 1.00 47.75 ? 33  GLN B CA    1 
ATOM   2802 C C     . GLN B 1 33  ? 36.818 27.150 138.412 1.00 46.30 ? 33  GLN B C     1 
ATOM   2803 O O     . GLN B 1 33  ? 35.932 26.515 138.976 1.00 46.55 ? 33  GLN B O     1 
ATOM   2804 C CB    . GLN B 1 33  ? 37.584 27.258 135.984 1.00 47.54 ? 33  GLN B CB    1 
ATOM   2805 C CG    . GLN B 1 33  ? 36.427 26.760 135.049 1.00 49.07 ? 33  GLN B CG    1 
ATOM   2806 C CD    . GLN B 1 33  ? 36.719 27.095 133.592 1.00 50.55 ? 33  GLN B CD    1 
ATOM   2807 O OE1   . GLN B 1 33  ? 36.316 26.355 132.647 1.00 52.62 ? 33  GLN B OE1   1 
ATOM   2808 N NE2   . GLN B 1 33  ? 37.481 28.210 133.391 1.00 52.14 ? 33  GLN B NE2   1 
ATOM   2809 N N     . ASP B 1 34  ? 37.095 28.413 138.714 1.00 45.72 ? 34  ASP B N     1 
ATOM   2810 C CA    . ASP B 1 34  ? 36.186 29.251 139.486 1.00 44.65 ? 34  ASP B CA    1 
ATOM   2811 C C     . ASP B 1 34  ? 35.148 29.779 138.498 1.00 42.65 ? 34  ASP B C     1 
ATOM   2812 O O     . ASP B 1 34  ? 35.507 29.902 137.358 1.00 42.56 ? 34  ASP B O     1 
ATOM   2813 C CB    . ASP B 1 34  ? 36.954 30.431 140.088 1.00 45.68 ? 34  ASP B CB    1 
ATOM   2814 C CG    . ASP B 1 34  ? 37.929 30.018 141.175 1.00 46.15 ? 34  ASP B CG    1 
ATOM   2815 O OD1   . ASP B 1 34  ? 37.633 29.095 141.936 1.00 43.67 ? 34  ASP B OD1   1 
ATOM   2816 O OD2   . ASP B 1 34  ? 39.003 30.665 141.246 1.00 50.67 ? 34  ASP B OD2   1 
ATOM   2817 N N     . TYR B 1 35  ? 33.907 30.067 138.904 1.00 40.29 ? 35  TYR B N     1 
ATOM   2818 C CA    . TYR B 1 35  ? 32.931 30.669 138.013 1.00 39.76 ? 35  TYR B CA    1 
ATOM   2819 C C     . TYR B 1 35  ? 32.072 31.583 138.850 1.00 40.52 ? 35  TYR B C     1 
ATOM   2820 O O     . TYR B 1 35  ? 31.886 31.335 140.075 1.00 41.01 ? 35  TYR B O     1 
ATOM   2821 C CB    . TYR B 1 35  ? 32.108 29.604 137.270 1.00 39.65 ? 35  TYR B CB    1 
ATOM   2822 C CG    . TYR B 1 35  ? 31.186 28.841 138.176 1.00 38.76 ? 35  TYR B CG    1 
ATOM   2823 C CD1   . TYR B 1 35  ? 29.945 29.360 138.537 1.00 38.60 ? 35  TYR B CD1   1 
ATOM   2824 C CD2   . TYR B 1 35  ? 31.549 27.591 138.707 1.00 40.82 ? 35  TYR B CD2   1 
ATOM   2825 C CE1   . TYR B 1 35  ? 29.063 28.656 139.427 1.00 38.48 ? 35  TYR B CE1   1 
ATOM   2826 C CE2   . TYR B 1 35  ? 30.667 26.872 139.618 1.00 41.01 ? 35  TYR B CE2   1 
ATOM   2827 C CZ    . TYR B 1 35  ? 29.435 27.440 139.975 1.00 39.63 ? 35  TYR B CZ    1 
ATOM   2828 O OH    . TYR B 1 35  ? 28.556 26.803 140.837 1.00 41.66 ? 35  TYR B OH    1 
ATOM   2829 N N     . PHE B 1 36  ? 31.638 32.687 138.239 1.00 40.43 ? 36  PHE B N     1 
ATOM   2830 C CA    . PHE B 1 36  ? 30.638 33.593 138.841 1.00 39.68 ? 36  PHE B CA    1 
ATOM   2831 C C     . PHE B 1 36  ? 29.693 33.983 137.723 1.00 38.71 ? 36  PHE B C     1 
ATOM   2832 O O     . PHE B 1 36  ? 30.128 34.502 136.662 1.00 38.83 ? 36  PHE B O     1 
ATOM   2833 C CB    . PHE B 1 36  ? 31.274 34.881 139.357 1.00 39.80 ? 36  PHE B CB    1 
ATOM   2834 C CG    . PHE B 1 36  ? 32.465 34.675 140.262 1.00 43.20 ? 36  PHE B CG    1 
ATOM   2835 C CD1   . PHE B 1 36  ? 32.330 34.779 141.663 1.00 45.94 ? 36  PHE B CD1   1 
ATOM   2836 C CD2   . PHE B 1 36  ? 33.748 34.416 139.731 1.00 41.22 ? 36  PHE B CD2   1 
ATOM   2837 C CE1   . PHE B 1 36  ? 33.494 34.571 142.523 1.00 46.72 ? 36  PHE B CE1   1 
ATOM   2838 C CE2   . PHE B 1 36  ? 34.898 34.245 140.557 1.00 42.39 ? 36  PHE B CE2   1 
ATOM   2839 C CZ    . PHE B 1 36  ? 34.780 34.293 141.953 1.00 41.28 ? 36  PHE B CZ    1 
ATOM   2840 N N     . LEU B 1 37  ? 28.407 33.746 137.926 1.00 36.78 ? 37  LEU B N     1 
ATOM   2841 C CA    . LEU B 1 37  ? 27.416 34.271 136.999 1.00 35.58 ? 37  LEU B CA    1 
ATOM   2842 C C     . LEU B 1 37  ? 26.722 35.390 137.754 1.00 35.44 ? 37  LEU B C     1 
ATOM   2843 O O     . LEU B 1 37  ? 26.317 35.202 138.920 1.00 36.57 ? 37  LEU B O     1 
ATOM   2844 C CB    . LEU B 1 37  ? 26.500 33.166 136.563 1.00 32.80 ? 37  LEU B CB    1 
ATOM   2845 C CG    . LEU B 1 37  ? 25.389 33.393 135.536 1.00 36.06 ? 37  LEU B CG    1 
ATOM   2846 C CD1   . LEU B 1 37  ? 25.802 33.647 134.052 1.00 34.60 ? 37  LEU B CD1   1 
ATOM   2847 C CD2   . LEU B 1 37  ? 24.486 32.133 135.570 1.00 37.09 ? 37  LEU B CD2   1 
ATOM   2848 N N     . PHE B 1 38  ? 26.611 36.592 137.191 1.00 34.31 ? 38  PHE B N     1 
ATOM   2849 C CA    . PHE B 1 38  ? 25.862 37.619 138.001 1.00 34.07 ? 38  PHE B CA    1 
ATOM   2850 C C     . PHE B 1 38  ? 25.021 38.536 137.172 1.00 33.40 ? 38  PHE B C     1 
ATOM   2851 O O     . PHE B 1 38  ? 25.024 38.450 136.003 1.00 32.92 ? 38  PHE B O     1 
ATOM   2852 C CB    . PHE B 1 38  ? 26.756 38.485 138.890 1.00 32.53 ? 38  PHE B CB    1 
ATOM   2853 C CG    . PHE B 1 38  ? 27.768 39.281 138.121 1.00 29.25 ? 38  PHE B CG    1 
ATOM   2854 C CD1   . PHE B 1 38  ? 29.060 38.817 137.957 1.00 28.80 ? 38  PHE B CD1   1 
ATOM   2855 C CD2   . PHE B 1 38  ? 27.430 40.473 137.527 1.00 26.70 ? 38  PHE B CD2   1 
ATOM   2856 C CE1   . PHE B 1 38  ? 30.023 39.568 137.197 1.00 29.69 ? 38  PHE B CE1   1 
ATOM   2857 C CE2   . PHE B 1 38  ? 28.368 41.196 136.749 1.00 22.09 ? 38  PHE B CE2   1 
ATOM   2858 C CZ    . PHE B 1 38  ? 29.654 40.756 136.593 1.00 26.04 ? 38  PHE B CZ    1 
ATOM   2859 N N     . GLU B 1 39  ? 24.321 39.437 137.803 1.00 33.80 ? 39  GLU B N     1 
ATOM   2860 C CA    . GLU B 1 39  ? 23.376 40.182 137.050 1.00 34.90 ? 39  GLU B CA    1 
ATOM   2861 C C     . GLU B 1 39  ? 23.814 41.594 137.109 1.00 35.14 ? 39  GLU B C     1 
ATOM   2862 O O     . GLU B 1 39  ? 23.964 42.140 138.196 1.00 33.93 ? 39  GLU B O     1 
ATOM   2863 C CB    . GLU B 1 39  ? 21.956 40.008 137.598 1.00 35.39 ? 39  GLU B CB    1 
ATOM   2864 C CG    . GLU B 1 39  ? 20.915 40.889 136.963 1.00 39.01 ? 39  GLU B CG    1 
ATOM   2865 C CD    . GLU B 1 39  ? 20.525 40.543 135.475 1.00 45.59 ? 39  GLU B CD    1 
ATOM   2866 O OE1   . GLU B 1 39  ? 20.295 39.353 135.090 1.00 47.34 ? 39  GLU B OE1   1 
ATOM   2867 O OE2   . GLU B 1 39  ? 20.403 41.500 134.690 1.00 46.22 ? 39  GLU B OE2   1 
ATOM   2868 N N     . SER B 1 40  ? 24.101 42.153 135.924 1.00 35.51 ? 40  SER B N     1 
ATOM   2869 C CA    . SER B 1 40  ? 24.392 43.553 135.789 1.00 35.10 ? 40  SER B CA    1 
ATOM   2870 C C     . SER B 1 40  ? 23.290 44.246 134.999 1.00 35.84 ? 40  SER B C     1 
ATOM   2871 O O     . SER B 1 40  ? 22.581 43.618 134.189 1.00 34.07 ? 40  SER B O     1 
ATOM   2872 C CB    . SER B 1 40  ? 25.745 43.748 135.106 1.00 35.45 ? 40  SER B CB    1 
ATOM   2873 O OG    . SER B 1 40  ? 25.706 43.204 133.808 1.00 32.37 ? 40  SER B OG    1 
ATOM   2874 N N     . LYS B 1 41  ? 23.180 45.554 135.244 1.00 36.76 ? 41  LYS B N     1 
ATOM   2875 C CA    . LYS B 1 41  ? 22.233 46.420 134.531 1.00 37.56 ? 41  LYS B CA    1 
ATOM   2876 C C     . LYS B 1 41  ? 22.683 46.661 133.090 1.00 36.89 ? 41  LYS B C     1 
ATOM   2877 O O     . LYS B 1 41  ? 21.829 46.922 132.192 1.00 36.12 ? 41  LYS B O     1 
ATOM   2878 C CB    . LYS B 1 41  ? 22.033 47.774 135.278 1.00 37.31 ? 41  LYS B CB    1 
ATOM   2879 C CG    . LYS B 1 41  ? 20.547 48.225 135.378 1.00 39.39 ? 41  LYS B CG    1 
ATOM   2880 C CD    . LYS B 1 41  ? 20.224 49.074 136.673 1.00 41.22 ? 41  LYS B CD    1 
ATOM   2881 C CE    . LYS B 1 41  ? 19.627 48.259 137.884 1.00 44.07 ? 41  LYS B CE    1 
ATOM   2882 N NZ    . LYS B 1 41  ? 18.953 49.157 138.985 1.00 45.46 ? 41  LYS B NZ    1 
ATOM   2883 N N     . GLY B 1 42  ? 24.011 46.577 132.887 1.00 35.83 ? 42  GLY B N     1 
ATOM   2884 C CA    . GLY B 1 42  ? 24.611 46.813 131.606 1.00 34.77 ? 42  GLY B CA    1 
ATOM   2885 C C     . GLY B 1 42  ? 24.296 45.687 130.615 1.00 34.37 ? 42  GLY B C     1 
ATOM   2886 O O     . GLY B 1 42  ? 23.582 45.869 129.651 1.00 34.14 ? 42  GLY B O     1 
ATOM   2887 N N     . PHE B 1 43  ? 24.766 44.486 130.899 1.00 33.69 ? 43  PHE B N     1 
ATOM   2888 C CA    . PHE B 1 43  ? 24.776 43.472 129.899 1.00 31.99 ? 43  PHE B CA    1 
ATOM   2889 C C     . PHE B 1 43  ? 23.939 42.247 130.221 1.00 31.92 ? 43  PHE B C     1 
ATOM   2890 O O     . PHE B 1 43  ? 24.095 41.175 129.605 1.00 31.76 ? 43  PHE B O     1 
ATOM   2891 C CB    . PHE B 1 43  ? 26.208 43.080 129.668 1.00 31.82 ? 43  PHE B CB    1 
ATOM   2892 C CG    . PHE B 1 43  ? 27.043 44.162 129.127 1.00 27.65 ? 43  PHE B CG    1 
ATOM   2893 C CD1   . PHE B 1 43  ? 27.023 44.447 127.764 1.00 29.66 ? 43  PHE B CD1   1 
ATOM   2894 C CD2   . PHE B 1 43  ? 27.874 44.881 129.947 1.00 23.00 ? 43  PHE B CD2   1 
ATOM   2895 C CE1   . PHE B 1 43  ? 27.846 45.452 127.250 1.00 25.33 ? 43  PHE B CE1   1 
ATOM   2896 C CE2   . PHE B 1 43  ? 28.703 45.895 129.450 1.00 27.35 ? 43  PHE B CE2   1 
ATOM   2897 C CZ    . PHE B 1 43  ? 28.688 46.167 128.104 1.00 30.58 ? 43  PHE B CZ    1 
ATOM   2898 N N     . GLY B 1 44  ? 23.028 42.397 131.160 1.00 31.45 ? 44  GLY B N     1 
ATOM   2899 C CA    . GLY B 1 44  ? 22.226 41.252 131.587 1.00 30.81 ? 44  GLY B CA    1 
ATOM   2900 C C     . GLY B 1 44  ? 23.158 40.335 132.325 1.00 30.02 ? 44  GLY B C     1 
ATOM   2901 O O     . GLY B 1 44  ? 24.007 40.793 133.071 1.00 29.70 ? 44  GLY B O     1 
ATOM   2902 N N     . LYS B 1 45  ? 23.020 39.027 132.150 1.00 29.62 ? 45  LYS B N     1 
ATOM   2903 C CA    . LYS B 1 45  ? 23.735 38.162 133.071 1.00 28.03 ? 45  LYS B CA    1 
ATOM   2904 C C     . LYS B 1 45  ? 25.060 38.190 132.488 1.00 28.41 ? 45  LYS B C     1 
ATOM   2905 O O     . LYS B 1 45  ? 25.126 38.183 131.224 1.00 27.77 ? 45  LYS B O     1 
ATOM   2906 C CB    . LYS B 1 45  ? 23.211 36.758 133.058 1.00 27.49 ? 45  LYS B CB    1 
ATOM   2907 C CG    . LYS B 1 45  ? 21.870 36.556 133.736 1.00 27.77 ? 45  LYS B CG    1 
ATOM   2908 C CD    . LYS B 1 45  ? 21.517 35.044 133.695 1.00 26.41 ? 45  LYS B CD    1 
ATOM   2909 C CE    . LYS B 1 45  ? 20.121 34.752 134.056 1.00 23.24 ? 45  LYS B CE    1 
ATOM   2910 N NZ    . LYS B 1 45  ? 19.975 33.477 133.457 1.00 29.42 ? 45  LYS B NZ    1 
ATOM   2911 N N     . VAL B 1 46  ? 26.086 38.256 133.380 1.00 28.74 ? 46  VAL B N     1 
ATOM   2912 C CA    . VAL B 1 46  ? 27.562 38.191 133.057 1.00 28.37 ? 46  VAL B CA    1 
ATOM   2913 C C     . VAL B 1 46  ? 28.277 36.896 133.499 1.00 28.88 ? 46  VAL B C     1 
ATOM   2914 O O     . VAL B 1 46  ? 28.096 36.441 134.605 1.00 29.01 ? 46  VAL B O     1 
ATOM   2915 C CB    . VAL B 1 46  ? 28.239 39.383 133.700 1.00 27.78 ? 46  VAL B CB    1 
ATOM   2916 C CG1   . VAL B 1 46  ? 29.688 39.401 133.372 1.00 28.05 ? 46  VAL B CG1   1 
ATOM   2917 C CG2   . VAL B 1 46  ? 27.632 40.675 133.120 1.00 27.05 ? 46  VAL B CG2   1 
ATOM   2918 N N     . LEU B 1 47  ? 29.117 36.284 132.682 1.00 29.72 ? 47  LEU B N     1 
ATOM   2919 C CA    . LEU B 1 47  ? 29.737 35.069 133.202 1.00 29.97 ? 47  LEU B CA    1 
ATOM   2920 C C     . LEU B 1 47  ? 31.206 35.169 133.230 1.00 31.33 ? 47  LEU B C     1 
ATOM   2921 O O     . LEU B 1 47  ? 31.879 35.403 132.183 1.00 30.92 ? 47  LEU B O     1 
ATOM   2922 C CB    . LEU B 1 47  ? 29.323 33.805 132.446 1.00 30.00 ? 47  LEU B CB    1 
ATOM   2923 C CG    . LEU B 1 47  ? 29.870 32.363 132.668 1.00 29.27 ? 47  LEU B CG    1 
ATOM   2924 C CD1   . LEU B 1 47  ? 31.262 32.241 132.477 1.00 22.92 ? 47  LEU B CD1   1 
ATOM   2925 C CD2   . LEU B 1 47  ? 29.677 31.999 134.014 1.00 29.82 ? 47  LEU B CD2   1 
ATOM   2926 N N     . ILE B 1 48  ? 31.707 34.922 134.439 1.00 31.09 ? 48  ILE B N     1 
ATOM   2927 C CA    . ILE B 1 48  ? 33.150 34.889 134.698 1.00 30.91 ? 48  ILE B CA    1 
ATOM   2928 C C     . ILE B 1 48  ? 33.784 33.474 134.825 1.00 31.74 ? 48  ILE B C     1 
ATOM   2929 O O     . ILE B 1 48  ? 33.166 32.534 135.274 1.00 30.03 ? 48  ILE B O     1 
ATOM   2930 C CB    . ILE B 1 48  ? 33.512 35.979 135.794 1.00 31.11 ? 48  ILE B CB    1 
ATOM   2931 C CG1   . ILE B 1 48  ? 32.988 37.325 135.224 1.00 29.83 ? 48  ILE B CG1   1 
ATOM   2932 C CG2   . ILE B 1 48  ? 35.042 36.033 136.167 1.00 29.74 ? 48  ILE B CG2   1 
ATOM   2933 C CD1   . ILE B 1 48  ? 33.066 38.483 135.999 1.00 27.45 ? 48  ILE B CD1   1 
ATOM   2934 N N     . LEU B 1 49  ? 34.979 33.314 134.288 1.00 32.82 ? 49  LEU B N     1 
ATOM   2935 C CA    . LEU B 1 49  ? 35.781 32.124 134.562 1.00 35.04 ? 49  LEU B CA    1 
ATOM   2936 C C     . LEU B 1 49  ? 37.092 32.635 135.113 1.00 37.42 ? 49  LEU B C     1 
ATOM   2937 O O     . LEU B 1 49  ? 37.718 33.533 134.530 1.00 40.07 ? 49  LEU B O     1 
ATOM   2938 C CB    . LEU B 1 49  ? 35.985 31.228 133.338 1.00 33.96 ? 49  LEU B CB    1 
ATOM   2939 C CG    . LEU B 1 49  ? 34.834 30.222 133.148 1.00 32.28 ? 49  LEU B CG    1 
ATOM   2940 C CD1   . LEU B 1 49  ? 33.564 30.804 133.514 1.00 29.81 ? 49  LEU B CD1   1 
ATOM   2941 C CD2   . LEU B 1 49  ? 34.699 29.792 131.753 1.00 35.69 ? 49  LEU B CD2   1 
ATOM   2942 N N     . ASP B 1 50  ? 37.482 32.140 136.280 1.00 38.67 ? 50  ASP B N     1 
ATOM   2943 C CA    . ASP B 1 50  ? 38.688 32.628 136.955 1.00 38.51 ? 50  ASP B CA    1 
ATOM   2944 C C     . ASP B 1 50  ? 38.727 34.124 136.999 1.00 37.76 ? 50  ASP B C     1 
ATOM   2945 O O     . ASP B 1 50  ? 38.079 34.645 137.821 1.00 36.80 ? 50  ASP B O     1 
ATOM   2946 C CB    . ASP B 1 50  ? 39.944 31.960 136.377 1.00 39.16 ? 50  ASP B CB    1 
ATOM   2947 C CG    . ASP B 1 50  ? 40.006 30.471 136.754 1.00 43.28 ? 50  ASP B CG    1 
ATOM   2948 O OD1   . ASP B 1 50  ? 40.176 29.551 135.893 1.00 38.64 ? 50  ASP B OD1   1 
ATOM   2949 O OD2   . ASP B 1 50  ? 39.783 30.226 137.976 1.00 51.76 ? 50  ASP B OD2   1 
ATOM   2950 N N     . LYS B 1 51  ? 39.456 34.833 136.136 1.00 38.08 ? 51  LYS B N     1 
ATOM   2951 C CA    . LYS B 1 51  ? 39.469 36.271 136.322 1.00 37.71 ? 51  LYS B CA    1 
ATOM   2952 C C     . LYS B 1 51  ? 38.915 37.013 135.215 1.00 37.33 ? 51  LYS B C     1 
ATOM   2953 O O     . LYS B 1 51  ? 39.011 38.233 135.214 1.00 38.03 ? 51  LYS B O     1 
ATOM   2954 C CB    . LYS B 1 51  ? 40.815 36.898 136.665 1.00 38.68 ? 51  LYS B CB    1 
ATOM   2955 C CG    . LYS B 1 51  ? 42.001 36.015 136.632 1.00 40.08 ? 51  LYS B CG    1 
ATOM   2956 C CD    . LYS B 1 51  ? 43.064 36.433 137.690 1.00 34.29 ? 51  LYS B CD    1 
ATOM   2957 C CE    . LYS B 1 51  ? 44.138 35.279 137.763 1.00 34.25 ? 51  LYS B CE    1 
ATOM   2958 N NZ    . LYS B 1 51  ? 43.457 33.983 138.242 1.00 32.98 ? 51  LYS B NZ    1 
ATOM   2959 N N     . ASP B 1 52  ? 38.279 36.307 134.305 1.00 37.25 ? 52  ASP B N     1 
ATOM   2960 C CA    . ASP B 1 52  ? 37.792 36.921 133.061 1.00 37.80 ? 52  ASP B CA    1 
ATOM   2961 C C     . ASP B 1 52  ? 36.381 36.555 132.761 1.00 37.00 ? 52  ASP B C     1 
ATOM   2962 O O     . ASP B 1 52  ? 35.829 35.585 133.353 1.00 37.18 ? 52  ASP B O     1 
ATOM   2963 C CB    . ASP B 1 52  ? 38.666 36.533 131.908 1.00 37.85 ? 52  ASP B CB    1 
ATOM   2964 C CG    . ASP B 1 52  ? 40.070 36.828 132.204 1.00 41.79 ? 52  ASP B CG    1 
ATOM   2965 O OD1   . ASP B 1 52  ? 40.331 37.980 132.671 1.00 43.71 ? 52  ASP B OD1   1 
ATOM   2966 O OD2   . ASP B 1 52  ? 40.898 35.907 132.024 1.00 44.98 ? 52  ASP B OD2   1 
ATOM   2967 N N     . VAL B 1 53  ? 35.790 37.360 131.891 1.00 33.93 ? 53  VAL B N     1 
ATOM   2968 C CA    . VAL B 1 53  ? 34.417 37.201 131.655 1.00 32.32 ? 53  VAL B CA    1 
ATOM   2969 C C     . VAL B 1 53  ? 34.376 36.306 130.435 1.00 31.22 ? 53  VAL B C     1 
ATOM   2970 O O     . VAL B 1 53  ? 35.005 36.635 129.464 1.00 30.03 ? 53  VAL B O     1 
ATOM   2971 C CB    . VAL B 1 53  ? 33.735 38.581 131.495 1.00 32.44 ? 53  VAL B CB    1 
ATOM   2972 C CG1   . VAL B 1 53  ? 34.772 39.607 131.243 1.00 33.23 ? 53  VAL B CG1   1 
ATOM   2973 C CG2   . VAL B 1 53  ? 32.644 38.573 130.365 1.00 29.26 ? 53  VAL B CG2   1 
ATOM   2974 N N     . GLN B 1 54  ? 33.669 35.165 130.509 1.00 30.93 ? 54  GLN B N     1 
ATOM   2975 C CA    . GLN B 1 54  ? 33.505 34.318 129.348 1.00 30.76 ? 54  GLN B CA    1 
ATOM   2976 C C     . GLN B 1 54  ? 32.545 35.042 128.398 1.00 30.77 ? 54  GLN B C     1 
ATOM   2977 O O     . GLN B 1 54  ? 32.781 35.102 127.166 1.00 31.69 ? 54  GLN B O     1 
ATOM   2978 C CB    . GLN B 1 54  ? 32.980 32.915 129.709 1.00 30.92 ? 54  GLN B CB    1 
ATOM   2979 C CG    . GLN B 1 54  ? 33.847 31.843 129.098 1.00 36.78 ? 54  GLN B CG    1 
ATOM   2980 C CD    . GLN B 1 54  ? 35.396 32.203 129.299 1.00 48.24 ? 54  GLN B CD    1 
ATOM   2981 O OE1   . GLN B 1 54  ? 36.238 31.953 128.435 1.00 46.98 ? 54  GLN B OE1   1 
ATOM   2982 N NE2   . GLN B 1 54  ? 35.736 32.828 130.471 1.00 54.12 ? 54  GLN B NE2   1 
ATOM   2983 N N     . SER B 1 55  ? 31.498 35.635 128.954 1.00 27.87 ? 55  SER B N     1 
ATOM   2984 C CA    . SER B 1 55  ? 30.412 35.898 128.107 1.00 28.93 ? 55  SER B CA    1 
ATOM   2985 C C     . SER B 1 55  ? 29.458 36.814 128.816 1.00 28.99 ? 55  SER B C     1 
ATOM   2986 O O     . SER B 1 55  ? 29.536 36.897 130.016 1.00 30.60 ? 55  SER B O     1 
ATOM   2987 C CB    . SER B 1 55  ? 29.799 34.544 127.680 1.00 28.08 ? 55  SER B CB    1 
ATOM   2988 O OG    . SER B 1 55  ? 28.912 34.703 126.641 1.00 26.93 ? 55  SER B OG    1 
ATOM   2989 N N     . THR B 1 56  ? 28.629 37.541 128.072 1.00 29.53 ? 56  THR B N     1 
ATOM   2990 C CA    . THR B 1 56  ? 27.632 38.454 128.602 1.00 29.98 ? 56  THR B CA    1 
ATOM   2991 C C     . THR B 1 56  ? 26.361 38.152 127.902 1.00 31.33 ? 56  THR B C     1 
ATOM   2992 O O     . THR B 1 56  ? 26.374 37.684 126.758 1.00 32.10 ? 56  THR B O     1 
ATOM   2993 C CB    . THR B 1 56  ? 27.984 39.896 128.257 1.00 31.12 ? 56  THR B CB    1 
ATOM   2994 O OG1   . THR B 1 56  ? 28.413 40.538 129.454 1.00 31.76 ? 56  THR B OG1   1 
ATOM   2995 C CG2   . THR B 1 56  ? 26.773 40.747 127.590 1.00 26.46 ? 56  THR B CG2   1 
ATOM   2996 N N     . GLU B 1 57  ? 25.236 38.423 128.548 1.00 32.26 ? 57  GLU B N     1 
ATOM   2997 C CA    . GLU B 1 57  ? 23.975 38.106 127.886 1.00 32.96 ? 57  GLU B CA    1 
ATOM   2998 C C     . GLU B 1 57  ? 23.598 39.057 126.722 1.00 34.12 ? 57  GLU B C     1 
ATOM   2999 O O     . GLU B 1 57  ? 23.572 38.603 125.561 1.00 34.34 ? 57  GLU B O     1 
ATOM   3000 C CB    . GLU B 1 57  ? 22.860 37.822 128.865 1.00 31.68 ? 57  GLU B CB    1 
ATOM   3001 C CG    . GLU B 1 57  ? 21.494 38.164 128.416 1.00 30.12 ? 57  GLU B CG    1 
ATOM   3002 C CD    . GLU B 1 57  ? 20.496 38.221 129.627 1.00 30.48 ? 57  GLU B CD    1 
ATOM   3003 O OE1   . GLU B 1 57  ? 20.896 38.366 130.807 1.00 25.19 ? 57  GLU B OE1   1 
ATOM   3004 O OE2   . GLU B 1 57  ? 19.293 38.116 129.400 1.00 28.14 ? 57  GLU B OE2   1 
ATOM   3005 N N     . ARG B 1 58  ? 23.396 40.354 127.013 1.00 34.54 ? 58  ARG B N     1 
ATOM   3006 C CA    . ARG B 1 58  ? 22.910 41.315 126.011 1.00 33.51 ? 58  ARG B CA    1 
ATOM   3007 C C     . ARG B 1 58  ? 23.761 41.324 124.768 1.00 32.31 ? 58  ARG B C     1 
ATOM   3008 O O     . ARG B 1 58  ? 23.280 41.701 123.728 1.00 32.39 ? 58  ARG B O     1 
ATOM   3009 C CB    . ARG B 1 58  ? 22.692 42.707 126.587 1.00 33.35 ? 58  ARG B CB    1 
ATOM   3010 C CG    . ARG B 1 58  ? 21.548 42.705 127.574 1.00 39.26 ? 58  ARG B CG    1 
ATOM   3011 C CD    . ARG B 1 58  ? 20.746 44.020 127.753 1.00 46.29 ? 58  ARG B CD    1 
ATOM   3012 N NE    . ARG B 1 58  ? 21.669 45.112 127.969 1.00 54.31 ? 58  ARG B NE    1 
ATOM   3013 C CZ    . ARG B 1 58  ? 21.867 46.127 127.114 1.00 59.54 ? 58  ARG B CZ    1 
ATOM   3014 N NH1   . ARG B 1 58  ? 22.794 47.060 127.398 1.00 60.37 ? 58  ARG B NH1   1 
ATOM   3015 N NH2   . ARG B 1 58  ? 21.136 46.237 125.990 1.00 58.71 ? 58  ARG B NH2   1 
ATOM   3016 N N     . ASP B 1 59  ? 24.972 40.782 124.846 1.00 31.50 ? 59  ASP B N     1 
ATOM   3017 C CA    . ASP B 1 59  ? 25.896 40.911 123.739 1.00 30.56 ? 59  ASP B CA    1 
ATOM   3018 C C     . ASP B 1 59  ? 26.634 39.656 123.297 1.00 29.92 ? 59  ASP B C     1 
ATOM   3019 O O     . ASP B 1 59  ? 27.592 39.743 122.555 1.00 29.88 ? 59  ASP B O     1 
ATOM   3020 C CB    . ASP B 1 59  ? 26.940 41.966 124.089 1.00 30.59 ? 59  ASP B CB    1 
ATOM   3021 C CG    . ASP B 1 59  ? 28.210 41.358 124.621 1.00 30.20 ? 59  ASP B CG    1 
ATOM   3022 O OD1   . ASP B 1 59  ? 29.271 41.713 124.135 1.00 23.71 ? 59  ASP B OD1   1 
ATOM   3023 O OD2   . ASP B 1 59  ? 28.139 40.463 125.501 1.00 38.10 ? 59  ASP B OD2   1 
ATOM   3024 N N     . GLU B 1 60  ? 26.231 38.488 123.750 1.00 29.91 ? 60  GLU B N     1 
ATOM   3025 C CA    . GLU B 1 60  ? 26.942 37.278 123.339 1.00 28.62 ? 60  GLU B CA    1 
ATOM   3026 C C     . GLU B 1 60  ? 26.487 36.902 121.960 1.00 28.76 ? 60  GLU B C     1 
ATOM   3027 O O     . GLU B 1 60  ? 27.173 36.186 121.225 1.00 31.23 ? 60  GLU B O     1 
ATOM   3028 C CB    . GLU B 1 60  ? 26.667 36.156 124.318 1.00 29.29 ? 60  GLU B CB    1 
ATOM   3029 C CG    . GLU B 1 60  ? 25.151 35.891 124.629 1.00 25.91 ? 60  GLU B CG    1 
ATOM   3030 C CD    . GLU B 1 60  ? 24.442 34.956 123.561 1.00 24.10 ? 60  GLU B CD    1 
ATOM   3031 O OE1   . GLU B 1 60  ? 25.123 34.273 122.764 1.00 23.45 ? 60  GLU B OE1   1 
ATOM   3032 O OE2   . GLU B 1 60  ? 23.194 34.936 123.463 1.00 22.05 ? 60  GLU B OE2   1 
ATOM   3033 N N     . TYR B 1 61  ? 25.325 37.370 121.572 1.00 28.09 ? 61  TYR B N     1 
ATOM   3034 C CA    . TYR B 1 61  ? 24.902 37.117 120.214 1.00 27.99 ? 61  TYR B CA    1 
ATOM   3035 C C     . TYR B 1 61  ? 26.046 37.484 119.290 1.00 27.69 ? 61  TYR B C     1 
ATOM   3036 O O     . TYR B 1 61  ? 26.231 36.786 118.282 1.00 27.12 ? 61  TYR B O     1 
ATOM   3037 C CB    . TYR B 1 61  ? 23.605 37.873 119.855 1.00 29.06 ? 61  TYR B CB    1 
ATOM   3038 C CG    . TYR B 1 61  ? 23.679 39.350 119.521 1.00 27.63 ? 61  TYR B CG    1 
ATOM   3039 C CD1   . TYR B 1 61  ? 23.315 40.270 120.422 1.00 23.79 ? 61  TYR B CD1   1 
ATOM   3040 C CD2   . TYR B 1 61  ? 24.094 39.784 118.264 1.00 32.13 ? 61  TYR B CD2   1 
ATOM   3041 C CE1   . TYR B 1 61  ? 23.336 41.586 120.132 1.00 23.72 ? 61  TYR B CE1   1 
ATOM   3042 C CE2   . TYR B 1 61  ? 24.168 41.125 117.980 1.00 28.57 ? 61  TYR B CE2   1 
ATOM   3043 C CZ    . TYR B 1 61  ? 23.771 42.029 118.923 1.00 25.50 ? 61  TYR B CZ    1 
ATOM   3044 O OH    . TYR B 1 61  ? 23.833 43.393 118.686 1.00 23.89 ? 61  TYR B OH    1 
ATOM   3045 N N     . ILE B 1 62  ? 26.852 38.495 119.698 1.00 26.53 ? 62  ILE B N     1 
ATOM   3046 C CA    . ILE B 1 62  ? 27.824 39.115 118.783 1.00 25.17 ? 62  ILE B CA    1 
ATOM   3047 C C     . ILE B 1 62  ? 29.055 38.245 118.700 1.00 26.96 ? 62  ILE B C     1 
ATOM   3048 O O     . ILE B 1 62  ? 29.532 37.839 117.649 1.00 26.29 ? 62  ILE B O     1 
ATOM   3049 C CB    . ILE B 1 62  ? 28.184 40.567 119.151 1.00 25.09 ? 62  ILE B CB    1 
ATOM   3050 C CG1   . ILE B 1 62  ? 26.946 41.503 119.156 1.00 24.05 ? 62  ILE B CG1   1 
ATOM   3051 C CG2   . ILE B 1 62  ? 29.161 41.106 118.186 1.00 21.83 ? 62  ILE B CG2   1 
ATOM   3052 C CD1   . ILE B 1 62  ? 27.257 43.016 119.306 1.00 19.67 ? 62  ILE B CD1   1 
ATOM   3053 N N     . TYR B 1 63  ? 29.559 37.925 119.855 1.00 29.16 ? 63  TYR B N     1 
ATOM   3054 C CA    . TYR B 1 63  ? 30.730 37.104 119.917 1.00 30.27 ? 63  TYR B CA    1 
ATOM   3055 C C     . TYR B 1 63  ? 30.460 35.804 119.166 1.00 30.54 ? 63  TYR B C     1 
ATOM   3056 O O     . TYR B 1 63  ? 31.216 35.383 118.317 1.00 33.68 ? 63  TYR B O     1 
ATOM   3057 C CB    . TYR B 1 63  ? 31.058 36.869 121.410 1.00 30.54 ? 63  TYR B CB    1 
ATOM   3058 C CG    . TYR B 1 63  ? 32.102 35.843 121.526 1.00 30.24 ? 63  TYR B CG    1 
ATOM   3059 C CD1   . TYR B 1 63  ? 31.754 34.498 121.691 1.00 29.66 ? 63  TYR B CD1   1 
ATOM   3060 C CD2   . TYR B 1 63  ? 33.440 36.169 121.387 1.00 28.74 ? 63  TYR B CD2   1 
ATOM   3061 C CE1   . TYR B 1 63  ? 32.710 33.526 121.775 1.00 25.66 ? 63  TYR B CE1   1 
ATOM   3062 C CE2   . TYR B 1 63  ? 34.413 35.153 121.432 1.00 31.41 ? 63  TYR B CE2   1 
ATOM   3063 C CZ    . TYR B 1 63  ? 34.008 33.835 121.650 1.00 27.62 ? 63  TYR B CZ    1 
ATOM   3064 O OH    . TYR B 1 63  ? 34.917 32.813 121.697 1.00 31.33 ? 63  TYR B OH    1 
ATOM   3065 N N     . HIS B 1 64  ? 29.349 35.155 119.456 1.00 31.75 ? 64  HIS B N     1 
ATOM   3066 C CA    . HIS B 1 64  ? 29.010 33.865 118.793 1.00 31.09 ? 64  HIS B CA    1 
ATOM   3067 C C     . HIS B 1 64  ? 28.721 34.011 117.320 1.00 31.00 ? 64  HIS B C     1 
ATOM   3068 O O     . HIS B 1 64  ? 28.953 33.088 116.579 1.00 34.13 ? 64  HIS B O     1 
ATOM   3069 C CB    . HIS B 1 64  ? 27.887 33.102 119.552 1.00 29.66 ? 64  HIS B CB    1 
ATOM   3070 C CG    . HIS B 1 64  ? 28.255 32.785 120.986 1.00 31.06 ? 64  HIS B CG    1 
ATOM   3071 N ND1   . HIS B 1 64  ? 27.573 33.290 122.072 1.00 31.16 ? 64  HIS B ND1   1 
ATOM   3072 C CD2   . HIS B 1 64  ? 29.281 32.061 121.504 1.00 30.21 ? 64  HIS B CD2   1 
ATOM   3073 C CE1   . HIS B 1 64  ? 28.150 32.884 123.191 1.00 31.78 ? 64  HIS B CE1   1 
ATOM   3074 N NE2   . HIS B 1 64  ? 29.189 32.135 122.875 1.00 29.55 ? 64  HIS B NE2   1 
ATOM   3075 N N     . GLU B 1 65  ? 28.209 35.157 116.854 1.00 30.31 ? 65  GLU B N     1 
ATOM   3076 C CA    . GLU B 1 65  ? 27.811 35.183 115.491 1.00 26.60 ? 65  GLU B CA    1 
ATOM   3077 C C     . GLU B 1 65  ? 29.107 35.194 114.821 1.00 28.18 ? 65  GLU B C     1 
ATOM   3078 O O     . GLU B 1 65  ? 29.292 34.431 113.910 1.00 30.57 ? 65  GLU B O     1 
ATOM   3079 C CB    . GLU B 1 65  ? 26.892 36.340 115.149 1.00 25.41 ? 65  GLU B CB    1 
ATOM   3080 C CG    . GLU B 1 65  ? 25.406 35.986 115.429 1.00 17.48 ? 65  GLU B CG    1 
ATOM   3081 C CD    . GLU B 1 65  ? 24.504 36.960 114.829 1.00 16.46 ? 65  GLU B CD    1 
ATOM   3082 O OE1   . GLU B 1 65  ? 25.045 37.804 114.059 1.00 30.57 ? 65  GLU B OE1   1 
ATOM   3083 O OE2   . GLU B 1 65  ? 23.261 36.991 115.107 1.00 16.55 ? 65  GLU B OE2   1 
ATOM   3084 N N     . THR B 1 66  ? 30.043 35.951 115.384 1.00 27.87 ? 66  THR B N     1 
ATOM   3085 C CA    . THR B 1 66  ? 31.317 36.267 114.808 1.00 28.23 ? 66  THR B CA    1 
ATOM   3086 C C     . THR B 1 66  ? 32.184 35.016 114.725 1.00 30.91 ? 66  THR B C     1 
ATOM   3087 O O     . THR B 1 66  ? 32.920 34.822 113.755 1.00 31.46 ? 66  THR B O     1 
ATOM   3088 C CB    . THR B 1 66  ? 32.028 37.246 115.809 1.00 28.14 ? 66  THR B CB    1 
ATOM   3089 O OG1   . THR B 1 66  ? 31.157 38.339 116.105 1.00 27.82 ? 66  THR B OG1   1 
ATOM   3090 C CG2   . THR B 1 66  ? 33.371 37.762 115.361 1.00 20.69 ? 66  THR B CG2   1 
ATOM   3091 N N     . LEU B 1 67  ? 32.159 34.220 115.779 1.00 32.04 ? 67  LEU B N     1 
ATOM   3092 C CA    . LEU B 1 67  ? 33.004 33.007 115.880 1.00 34.58 ? 67  LEU B CA    1 
ATOM   3093 C C     . LEU B 1 67  ? 32.721 31.925 114.820 1.00 36.05 ? 67  LEU B C     1 
ATOM   3094 O O     . LEU B 1 67  ? 33.642 31.264 114.242 1.00 36.48 ? 67  LEU B O     1 
ATOM   3095 C CB    . LEU B 1 67  ? 32.731 32.354 117.252 1.00 34.74 ? 67  LEU B CB    1 
ATOM   3096 C CG    . LEU B 1 67  ? 33.405 31.027 117.624 1.00 34.67 ? 67  LEU B CG    1 
ATOM   3097 C CD1   . LEU B 1 67  ? 34.981 31.076 117.501 1.00 30.32 ? 67  LEU B CD1   1 
ATOM   3098 C CD2   . LEU B 1 67  ? 32.982 30.547 119.041 1.00 33.15 ? 67  LEU B CD2   1 
ATOM   3099 N N     . VAL B 1 68  ? 31.427 31.778 114.537 1.00 36.73 ? 68  VAL B N     1 
ATOM   3100 C CA    . VAL B 1 68  ? 30.942 30.530 114.048 1.00 36.05 ? 68  VAL B CA    1 
ATOM   3101 C C     . VAL B 1 68  ? 30.749 30.692 112.602 1.00 36.81 ? 68  VAL B C     1 
ATOM   3102 O O     . VAL B 1 68  ? 31.490 30.098 111.810 1.00 38.48 ? 68  VAL B O     1 
ATOM   3103 C CB    . VAL B 1 68  ? 29.661 30.134 114.804 1.00 35.65 ? 68  VAL B CB    1 
ATOM   3104 C CG1   . VAL B 1 68  ? 28.858 29.192 114.015 1.00 36.37 ? 68  VAL B CG1   1 
ATOM   3105 C CG2   . VAL B 1 68  ? 30.041 29.480 116.062 1.00 33.84 ? 68  VAL B CG2   1 
ATOM   3106 N N     . HIS B 1 69  ? 29.824 31.572 112.232 1.00 36.66 ? 69  HIS B N     1 
ATOM   3107 C CA    . HIS B 1 69  ? 29.356 31.558 110.876 1.00 35.95 ? 69  HIS B CA    1 
ATOM   3108 C C     . HIS B 1 69  ? 30.385 31.786 109.805 1.00 36.95 ? 69  HIS B C     1 
ATOM   3109 O O     . HIS B 1 69  ? 30.136 31.451 108.699 1.00 37.11 ? 69  HIS B O     1 
ATOM   3110 C CB    . HIS B 1 69  ? 28.198 32.491 110.698 1.00 35.52 ? 69  HIS B CB    1 
ATOM   3111 C CG    . HIS B 1 69  ? 27.086 32.238 111.652 1.00 31.76 ? 69  HIS B CG    1 
ATOM   3112 N ND1   . HIS B 1 69  ? 26.610 30.984 111.913 1.00 26.85 ? 69  HIS B ND1   1 
ATOM   3113 C CD2   . HIS B 1 69  ? 26.320 33.089 112.383 1.00 35.07 ? 69  HIS B CD2   1 
ATOM   3114 C CE1   . HIS B 1 69  ? 25.614 31.062 112.784 1.00 27.64 ? 69  HIS B CE1   1 
ATOM   3115 N NE2   . HIS B 1 69  ? 25.429 32.331 113.105 1.00 28.02 ? 69  HIS B NE2   1 
ATOM   3116 N N     . PRO B 1 70  ? 31.507 32.448 110.099 1.00 38.40 ? 70  PRO B N     1 
ATOM   3117 C CA    . PRO B 1 70  ? 32.554 32.563 109.040 1.00 39.44 ? 70  PRO B CA    1 
ATOM   3118 C C     . PRO B 1 70  ? 32.970 31.263 108.321 1.00 40.24 ? 70  PRO B C     1 
ATOM   3119 O O     . PRO B 1 70  ? 32.546 30.998 107.181 1.00 40.84 ? 70  PRO B O     1 
ATOM   3120 C CB    . PRO B 1 70  ? 33.735 33.196 109.797 1.00 39.50 ? 70  PRO B CB    1 
ATOM   3121 C CG    . PRO B 1 70  ? 33.014 34.145 110.759 1.00 39.41 ? 70  PRO B CG    1 
ATOM   3122 C CD    . PRO B 1 70  ? 31.841 33.278 111.275 1.00 38.36 ? 70  PRO B CD    1 
ATOM   3123 N N     . ALA B 1 71  ? 33.855 30.525 108.990 1.00 40.03 ? 71  ALA B N     1 
ATOM   3124 C CA    . ALA B 1 71  ? 33.923 29.062 108.990 1.00 37.91 ? 71  ALA B CA    1 
ATOM   3125 C C     . ALA B 1 71  ? 32.662 28.327 108.497 1.00 37.21 ? 71  ALA B C     1 
ATOM   3126 O O     . ALA B 1 71  ? 32.755 27.474 107.620 1.00 38.02 ? 71  ALA B O     1 
ATOM   3127 C CB    . ALA B 1 71  ? 34.230 28.632 110.411 1.00 37.35 ? 71  ALA B CB    1 
ATOM   3128 N N     . MET B 1 72  ? 31.481 28.576 109.049 1.00 35.71 ? 72  MET B N     1 
ATOM   3129 C CA    . MET B 1 72  ? 30.341 27.820 108.491 1.00 34.24 ? 72  MET B CA    1 
ATOM   3130 C C     . MET B 1 72  ? 29.924 28.279 107.097 1.00 33.24 ? 72  MET B C     1 
ATOM   3131 O O     . MET B 1 72  ? 29.626 27.488 106.235 1.00 31.77 ? 72  MET B O     1 
ATOM   3132 C CB    . MET B 1 72  ? 29.144 27.851 109.362 1.00 32.78 ? 72  MET B CB    1 
ATOM   3133 C CG    . MET B 1 72  ? 29.443 27.426 110.742 1.00 35.02 ? 72  MET B CG    1 
ATOM   3134 S SD    . MET B 1 72  ? 29.614 25.681 110.803 1.00 33.99 ? 72  MET B SD    1 
ATOM   3135 C CE    . MET B 1 72  ? 27.946 25.123 110.901 1.00 36.59 ? 72  MET B CE    1 
ATOM   3136 N N     . LEU B 1 73  ? 29.893 29.571 106.889 1.00 33.34 ? 73  LEU B N     1 
ATOM   3137 C CA    . LEU B 1 73  ? 29.417 30.071 105.616 1.00 32.91 ? 73  LEU B CA    1 
ATOM   3138 C C     . LEU B 1 73  ? 30.508 29.880 104.617 1.00 34.49 ? 73  LEU B C     1 
ATOM   3139 O O     . LEU B 1 73  ? 30.159 29.754 103.429 1.00 34.85 ? 73  LEU B O     1 
ATOM   3140 C CB    . LEU B 1 73  ? 28.931 31.514 105.643 1.00 30.01 ? 73  LEU B CB    1 
ATOM   3141 C CG    . LEU B 1 73  ? 27.702 31.632 106.481 1.00 26.83 ? 73  LEU B CG    1 
ATOM   3142 C CD1   . LEU B 1 73  ? 27.655 32.949 107.134 1.00 23.34 ? 73  LEU B CD1   1 
ATOM   3143 C CD2   . LEU B 1 73  ? 26.403 31.362 105.717 1.00 26.27 ? 73  LEU B CD2   1 
ATOM   3144 N N     . THR B 1 74  ? 31.789 29.780 105.037 1.00 35.01 ? 74  THR B N     1 
ATOM   3145 C CA    . THR B 1 74  ? 32.748 29.434 103.999 1.00 37.32 ? 74  THR B CA    1 
ATOM   3146 C C     . THR B 1 74  ? 32.764 27.988 103.569 1.00 38.71 ? 74  THR B C     1 
ATOM   3147 O O     . THR B 1 74  ? 33.459 27.632 102.632 1.00 40.00 ? 74  THR B O     1 
ATOM   3148 C CB    . THR B 1 74  ? 34.139 29.854 104.215 1.00 37.10 ? 74  THR B CB    1 
ATOM   3149 O OG1   . THR B 1 74  ? 34.724 29.100 105.294 1.00 40.51 ? 74  THR B OG1   1 
ATOM   3150 C CG2   . THR B 1 74  ? 34.233 31.320 104.368 1.00 38.40 ? 74  THR B CG2   1 
ATOM   3151 N N     . HIS B 1 75  ? 32.007 27.137 104.225 1.00 40.96 ? 75  HIS B N     1 
ATOM   3152 C CA    . HIS B 1 75  ? 31.930 25.768 103.775 1.00 43.35 ? 75  HIS B CA    1 
ATOM   3153 C C     . HIS B 1 75  ? 30.634 25.528 103.042 1.00 44.43 ? 75  HIS B C     1 
ATOM   3154 O O     . HIS B 1 75  ? 29.575 25.916 103.530 1.00 44.12 ? 75  HIS B O     1 
ATOM   3155 C CB    . HIS B 1 75  ? 32.073 24.788 104.928 1.00 43.39 ? 75  HIS B CB    1 
ATOM   3156 C CG    . HIS B 1 75  ? 32.134 23.358 104.486 1.00 46.54 ? 75  HIS B CG    1 
ATOM   3157 N ND1   . HIS B 1 75  ? 31.010 22.638 104.116 1.00 50.22 ? 75  HIS B ND1   1 
ATOM   3158 C CD2   . HIS B 1 75  ? 33.191 22.515 104.334 1.00 50.94 ? 75  HIS B CD2   1 
ATOM   3159 C CE1   . HIS B 1 75  ? 31.369 21.407 103.793 1.00 50.57 ? 75  HIS B CE1   1 
ATOM   3160 N NE2   . HIS B 1 75  ? 32.689 21.317 103.882 1.00 52.41 ? 75  HIS B NE2   1 
ATOM   3161 N N     . PRO B 1 76  ? 30.712 24.841 101.886 1.00 46.27 ? 76  PRO B N     1 
ATOM   3162 C CA    . PRO B 1 76  ? 29.574 24.873 100.935 1.00 47.73 ? 76  PRO B CA    1 
ATOM   3163 C C     . PRO B 1 76  ? 28.428 24.009 101.363 1.00 49.75 ? 76  PRO B C     1 
ATOM   3164 O O     . PRO B 1 76  ? 27.302 24.189 100.910 1.00 49.96 ? 76  PRO B O     1 
ATOM   3165 C CB    . PRO B 1 76  ? 30.169 24.373 99.621  1.00 47.61 ? 76  PRO B CB    1 
ATOM   3166 C CG    . PRO B 1 76  ? 31.718 24.183 99.912  1.00 48.07 ? 76  PRO B CG    1 
ATOM   3167 C CD    . PRO B 1 76  ? 31.842 24.028 101.400 1.00 46.06 ? 76  PRO B CD    1 
ATOM   3168 N N     . GLU B 1 77  ? 28.672 23.077 102.265 1.00 52.11 ? 77  GLU B N     1 
ATOM   3169 C CA    . GLU B 1 77  ? 27.540 22.338 102.746 1.00 54.52 ? 77  GLU B CA    1 
ATOM   3170 C C     . GLU B 1 77  ? 28.028 21.480 103.855 1.00 54.75 ? 77  GLU B C     1 
ATOM   3171 O O     . GLU B 1 77  ? 28.219 20.258 103.692 1.00 54.25 ? 77  GLU B O     1 
ATOM   3172 C CB    . GLU B 1 77  ? 26.914 21.507 101.629 1.00 55.07 ? 77  GLU B CB    1 
ATOM   3173 C CG    . GLU B 1 77  ? 25.406 21.225 101.763 1.00 56.84 ? 77  GLU B CG    1 
ATOM   3174 C CD    . GLU B 1 77  ? 24.893 20.465 100.534 1.00 57.61 ? 77  GLU B CD    1 
ATOM   3175 O OE1   . GLU B 1 77  ? 23.949 20.965 99.811  1.00 60.14 ? 77  GLU B OE1   1 
ATOM   3176 O OE2   . GLU B 1 77  ? 25.503 19.389 100.273 1.00 58.76 ? 77  GLU B OE2   1 
ATOM   3177 N N     . PRO B 1 78  ? 28.176 22.111 105.021 1.00 55.49 ? 78  PRO B N     1 
ATOM   3178 C CA    . PRO B 1 78  ? 28.695 21.449 106.212 1.00 55.57 ? 78  PRO B CA    1 
ATOM   3179 C C     . PRO B 1 78  ? 27.672 20.529 106.866 1.00 55.24 ? 78  PRO B C     1 
ATOM   3180 O O     . PRO B 1 78  ? 26.484 20.846 106.983 1.00 54.84 ? 78  PRO B O     1 
ATOM   3181 C CB    . PRO B 1 78  ? 29.101 22.599 107.130 1.00 56.32 ? 78  PRO B CB    1 
ATOM   3182 C CG    . PRO B 1 78  ? 28.726 23.939 106.339 1.00 57.56 ? 78  PRO B CG    1 
ATOM   3183 C CD    . PRO B 1 78  ? 27.774 23.502 105.268 1.00 55.32 ? 78  PRO B CD    1 
ATOM   3184 N N     . LYS B 1 79  ? 28.188 19.371 107.252 1.00 54.96 ? 79  LYS B N     1 
ATOM   3185 C CA    . LYS B 1 79  ? 27.410 18.303 107.815 1.00 54.83 ? 79  LYS B CA    1 
ATOM   3186 C C     . LYS B 1 79  ? 27.879 17.880 109.255 1.00 54.43 ? 79  LYS B C     1 
ATOM   3187 O O     . LYS B 1 79  ? 27.034 17.511 110.103 1.00 55.08 ? 79  LYS B O     1 
ATOM   3188 C CB    . LYS B 1 79  ? 27.413 17.123 106.817 1.00 54.69 ? 79  LYS B CB    1 
ATOM   3189 C CG    . LYS B 1 79  ? 26.556 17.327 105.551 1.00 54.49 ? 79  LYS B CG    1 
ATOM   3190 C CD    . LYS B 1 79  ? 26.960 16.322 104.412 1.00 54.93 ? 79  LYS B CD    1 
ATOM   3191 C CE    . LYS B 1 79  ? 25.929 16.243 103.259 1.00 54.52 ? 79  LYS B CE    1 
ATOM   3192 N NZ    . LYS B 1 79  ? 26.459 15.393 102.187 1.00 53.07 ? 79  LYS B NZ    1 
ATOM   3193 N N     . ARG B 1 80  ? 29.190 17.974 109.547 1.00 53.14 ? 80  ARG B N     1 
ATOM   3194 C CA    . ARG B 1 80  ? 29.772 17.330 110.749 1.00 51.55 ? 80  ARG B CA    1 
ATOM   3195 C C     . ARG B 1 80  ? 30.724 18.290 111.483 1.00 50.40 ? 80  ARG B C     1 
ATOM   3196 O O     . ARG B 1 80  ? 31.784 18.650 110.966 1.00 49.82 ? 80  ARG B O     1 
ATOM   3197 C CB    . ARG B 1 80  ? 30.484 16.026 110.322 1.00 51.50 ? 80  ARG B CB    1 
ATOM   3198 C CG    . ARG B 1 80  ? 30.656 14.961 111.363 1.00 53.39 ? 80  ARG B CG    1 
ATOM   3199 C CD    . ARG B 1 80  ? 30.412 13.551 110.778 1.00 57.11 ? 80  ARG B CD    1 
ATOM   3200 N NE    . ARG B 1 80  ? 29.055 13.464 110.230 1.00 56.83 ? 80  ARG B NE    1 
ATOM   3201 C CZ    . ARG B 1 80  ? 28.466 12.381 109.722 1.00 57.80 ? 80  ARG B CZ    1 
ATOM   3202 N NH1   . ARG B 1 80  ? 29.095 11.202 109.663 1.00 58.78 ? 80  ARG B NH1   1 
ATOM   3203 N NH2   . ARG B 1 80  ? 27.218 12.499 109.259 1.00 57.28 ? 80  ARG B NH2   1 
ATOM   3204 N N     . VAL B 1 81  ? 30.343 18.716 112.685 1.00 49.16 ? 81  VAL B N     1 
ATOM   3205 C CA    . VAL B 1 81  ? 31.027 19.855 113.283 1.00 48.20 ? 81  VAL B CA    1 
ATOM   3206 C C     . VAL B 1 81  ? 31.621 19.499 114.587 1.00 47.88 ? 81  VAL B C     1 
ATOM   3207 O O     . VAL B 1 81  ? 31.000 18.831 115.412 1.00 48.78 ? 81  VAL B O     1 
ATOM   3208 C CB    . VAL B 1 81  ? 30.143 21.121 113.437 1.00 48.54 ? 81  VAL B CB    1 
ATOM   3209 C CG1   . VAL B 1 81  ? 30.861 22.240 114.339 1.00 48.57 ? 81  VAL B CG1   1 
ATOM   3210 C CG2   . VAL B 1 81  ? 29.662 21.666 112.029 1.00 47.56 ? 81  VAL B CG2   1 
ATOM   3211 N N     . LEU B 1 82  ? 32.850 19.903 114.773 1.00 46.65 ? 82  LEU B N     1 
ATOM   3212 C CA    . LEU B 1 82  ? 33.437 19.653 116.051 1.00 47.91 ? 82  LEU B CA    1 
ATOM   3213 C C     . LEU B 1 82  ? 33.380 21.034 116.707 1.00 46.62 ? 82  LEU B C     1 
ATOM   3214 O O     . LEU B 1 82  ? 33.703 22.078 116.060 1.00 46.21 ? 82  LEU B O     1 
ATOM   3215 C CB    . LEU B 1 82  ? 34.885 19.094 115.935 1.00 47.88 ? 82  LEU B CB    1 
ATOM   3216 C CG    . LEU B 1 82  ? 35.668 18.942 117.258 1.00 51.05 ? 82  LEU B CG    1 
ATOM   3217 C CD1   . LEU B 1 82  ? 34.848 18.245 118.410 1.00 51.68 ? 82  LEU B CD1   1 
ATOM   3218 C CD2   . LEU B 1 82  ? 37.057 18.262 117.081 1.00 49.06 ? 82  LEU B CD2   1 
ATOM   3219 N N     . ILE B 1 83  ? 32.896 21.035 117.952 1.00 43.88 ? 83  ILE B N     1 
ATOM   3220 C CA    . ILE B 1 83  ? 32.980 22.231 118.760 1.00 41.43 ? 83  ILE B CA    1 
ATOM   3221 C C     . ILE B 1 83  ? 33.771 21.787 119.932 1.00 39.13 ? 83  ILE B C     1 
ATOM   3222 O O     . ILE B 1 83  ? 33.290 20.959 120.729 1.00 39.47 ? 83  ILE B O     1 
ATOM   3223 C CB    . ILE B 1 83  ? 31.650 22.691 119.338 1.00 41.45 ? 83  ILE B CB    1 
ATOM   3224 C CG1   . ILE B 1 83  ? 30.619 22.886 118.249 1.00 41.64 ? 83  ILE B CG1   1 
ATOM   3225 C CG2   . ILE B 1 83  ? 31.898 23.914 120.219 1.00 38.95 ? 83  ILE B CG2   1 
ATOM   3226 C CD1   . ILE B 1 83  ? 29.235 23.358 118.756 1.00 42.31 ? 83  ILE B CD1   1 
ATOM   3227 N N     . VAL B 1 84  ? 34.961 22.356 120.030 1.00 35.90 ? 84  VAL B N     1 
ATOM   3228 C CA    . VAL B 1 84  ? 35.845 22.180 121.145 1.00 32.92 ? 84  VAL B CA    1 
ATOM   3229 C C     . VAL B 1 84  ? 35.664 23.339 122.029 1.00 32.33 ? 84  VAL B C     1 
ATOM   3230 O O     . VAL B 1 84  ? 35.744 24.477 121.529 1.00 32.67 ? 84  VAL B O     1 
ATOM   3231 C CB    . VAL B 1 84  ? 37.193 22.339 120.677 1.00 33.33 ? 84  VAL B CB    1 
ATOM   3232 C CG1   . VAL B 1 84  ? 38.161 22.509 121.926 1.00 33.67 ? 84  VAL B CG1   1 
ATOM   3233 C CG2   . VAL B 1 84  ? 37.518 21.188 119.647 1.00 28.22 ? 84  VAL B CG2   1 
ATOM   3234 N N     . GLY B 1 85  ? 35.464 23.094 123.331 1.00 30.81 ? 85  GLY B N     1 
ATOM   3235 C CA    . GLY B 1 85  ? 35.130 24.181 124.273 1.00 29.00 ? 85  GLY B CA    1 
ATOM   3236 C C     . GLY B 1 85  ? 33.689 24.668 124.238 1.00 28.62 ? 85  GLY B C     1 
ATOM   3237 O O     . GLY B 1 85  ? 32.815 23.993 123.694 1.00 27.75 ? 85  GLY B O     1 
ATOM   3238 N N     . GLY B 1 86  ? 33.433 25.821 124.874 1.00 29.63 ? 86  GLY B N     1 
ATOM   3239 C CA    . GLY B 1 86  ? 32.158 26.557 124.738 1.00 30.42 ? 86  GLY B CA    1 
ATOM   3240 C C     . GLY B 1 86  ? 31.002 26.122 125.615 1.00 31.28 ? 86  GLY B C     1 
ATOM   3241 O O     . GLY B 1 86  ? 29.810 26.068 125.209 1.00 32.16 ? 86  GLY B O     1 
ATOM   3242 N N     . GLY B 1 87  ? 31.335 25.858 126.858 1.00 32.53 ? 87  GLY B N     1 
ATOM   3243 C CA    . GLY B 1 87  ? 30.367 25.428 127.894 1.00 32.59 ? 87  GLY B CA    1 
ATOM   3244 C C     . GLY B 1 87  ? 28.966 25.939 127.750 1.00 33.31 ? 87  GLY B C     1 
ATOM   3245 O O     . GLY B 1 87  ? 28.024 25.151 127.722 1.00 33.06 ? 87  GLY B O     1 
ATOM   3246 N N     . GLU B 1 88  ? 28.852 27.255 127.599 1.00 33.71 ? 88  GLU B N     1 
ATOM   3247 C CA    . GLU B 1 88  ? 27.597 27.951 127.449 1.00 34.20 ? 88  GLU B CA    1 
ATOM   3248 C C     . GLU B 1 88  ? 26.639 27.298 126.435 1.00 35.00 ? 88  GLU B C     1 
ATOM   3249 O O     . GLU B 1 88  ? 25.398 27.190 126.670 1.00 32.61 ? 88  GLU B O     1 
ATOM   3250 C CB    . GLU B 1 88  ? 27.907 29.380 127.031 1.00 34.64 ? 88  GLU B CB    1 
ATOM   3251 C CG    . GLU B 1 88  ? 29.039 30.055 127.834 1.00 32.53 ? 88  GLU B CG    1 
ATOM   3252 C CD    . GLU B 1 88  ? 30.093 30.605 126.936 1.00 32.12 ? 88  GLU B CD    1 
ATOM   3253 O OE1   . GLU B 1 88  ? 30.864 31.473 127.342 1.00 34.84 ? 88  GLU B OE1   1 
ATOM   3254 O OE2   . GLU B 1 88  ? 30.133 30.197 125.766 1.00 35.31 ? 88  GLU B OE2   1 
ATOM   3255 N N     . GLY B 1 89  ? 27.247 26.789 125.355 1.00 36.57 ? 89  GLY B N     1 
ATOM   3256 C CA    . GLY B 1 89  ? 26.514 26.114 124.276 1.00 37.23 ? 89  GLY B CA    1 
ATOM   3257 C C     . GLY B 1 89  ? 25.755 27.118 123.430 1.00 37.58 ? 89  GLY B C     1 
ATOM   3258 O O     . GLY B 1 89  ? 24.763 26.771 122.804 1.00 39.00 ? 89  GLY B O     1 
ATOM   3259 N N     . ALA B 1 90  ? 26.220 28.363 123.374 1.00 37.53 ? 90  ALA B N     1 
ATOM   3260 C CA    . ALA B 1 90  ? 25.657 29.310 122.385 1.00 37.74 ? 90  ALA B CA    1 
ATOM   3261 C C     . ALA B 1 90  ? 26.432 29.080 121.116 1.00 38.18 ? 90  ALA B C     1 
ATOM   3262 O O     . ALA B 1 90  ? 25.984 29.346 119.965 1.00 37.91 ? 90  ALA B O     1 
ATOM   3263 C CB    . ALA B 1 90  ? 25.803 30.708 122.840 1.00 37.27 ? 90  ALA B CB    1 
ATOM   3264 N N     . THR B 1 91  ? 27.622 28.544 121.348 1.00 38.64 ? 91  THR B N     1 
ATOM   3265 C CA    . THR B 1 91  ? 28.493 28.122 120.260 1.00 38.50 ? 91  THR B CA    1 
ATOM   3266 C C     . THR B 1 91  ? 27.745 27.025 119.509 1.00 38.92 ? 91  THR B C     1 
ATOM   3267 O O     . THR B 1 91  ? 27.638 27.090 118.257 1.00 37.68 ? 91  THR B O     1 
ATOM   3268 C CB    . THR B 1 91  ? 29.894 27.756 120.789 1.00 38.82 ? 91  THR B CB    1 
ATOM   3269 O OG1   . THR B 1 91  ? 30.416 28.868 121.580 1.00 40.25 ? 91  THR B OG1   1 
ATOM   3270 C CG2   . THR B 1 91  ? 30.826 27.395 119.677 1.00 36.20 ? 91  THR B CG2   1 
ATOM   3271 N N     . LEU B 1 92  ? 27.144 26.086 120.270 1.00 39.20 ? 92  LEU B N     1 
ATOM   3272 C CA    . LEU B 1 92  ? 26.214 25.109 119.669 1.00 38.90 ? 92  LEU B CA    1 
ATOM   3273 C C     . LEU B 1 92  ? 24.991 25.717 118.969 1.00 38.73 ? 92  LEU B C     1 
ATOM   3274 O O     . LEU B 1 92  ? 24.766 25.480 117.791 1.00 38.89 ? 92  LEU B O     1 
ATOM   3275 C CB    . LEU B 1 92  ? 25.684 24.149 120.718 1.00 40.64 ? 92  LEU B CB    1 
ATOM   3276 C CG    . LEU B 1 92  ? 25.153 22.773 120.287 1.00 36.75 ? 92  LEU B CG    1 
ATOM   3277 C CD1   . LEU B 1 92  ? 26.284 22.148 119.728 1.00 27.77 ? 92  LEU B CD1   1 
ATOM   3278 C CD2   . LEU B 1 92  ? 24.656 21.931 121.483 1.00 37.21 ? 92  LEU B CD2   1 
ATOM   3279 N N     . ARG B 1 93  ? 24.195 26.468 119.701 1.00 37.52 ? 93  ARG B N     1 
ATOM   3280 C CA    . ARG B 1 93  ? 23.032 27.053 119.095 1.00 37.64 ? 93  ARG B CA    1 
ATOM   3281 C C     . ARG B 1 93  ? 23.300 27.723 117.735 1.00 38.68 ? 93  ARG B C     1 
ATOM   3282 O O     . ARG B 1 93  ? 22.511 27.596 116.794 1.00 38.45 ? 93  ARG B O     1 
ATOM   3283 C CB    . ARG B 1 93  ? 22.474 28.031 120.101 1.00 37.59 ? 93  ARG B CB    1 
ATOM   3284 C CG    . ARG B 1 93  ? 21.399 28.931 119.631 1.00 36.51 ? 93  ARG B CG    1 
ATOM   3285 C CD    . ARG B 1 93  ? 21.535 30.178 120.487 1.00 39.28 ? 93  ARG B CD    1 
ATOM   3286 N NE    . ARG B 1 93  ? 22.475 31.173 119.951 1.00 35.54 ? 93  ARG B NE    1 
ATOM   3287 C CZ    . ARG B 1 93  ? 22.972 32.222 120.631 1.00 38.82 ? 93  ARG B CZ    1 
ATOM   3288 N NH1   . ARG B 1 93  ? 23.788 33.068 120.038 1.00 42.60 ? 93  ARG B NH1   1 
ATOM   3289 N NH2   . ARG B 1 93  ? 22.731 32.440 121.914 1.00 37.23 ? 93  ARG B NH2   1 
ATOM   3290 N N     . GLU B 1 94  ? 24.409 28.456 117.615 1.00 39.72 ? 94  GLU B N     1 
ATOM   3291 C CA    . GLU B 1 94  ? 24.714 29.106 116.311 1.00 40.30 ? 94  GLU B CA    1 
ATOM   3292 C C     . GLU B 1 94  ? 24.999 28.039 115.292 1.00 41.01 ? 94  GLU B C     1 
ATOM   3293 O O     . GLU B 1 94  ? 24.618 28.145 114.114 1.00 42.31 ? 94  GLU B O     1 
ATOM   3294 C CB    . GLU B 1 94  ? 25.905 30.081 116.365 1.00 39.93 ? 94  GLU B CB    1 
ATOM   3295 C CG    . GLU B 1 94  ? 25.618 31.480 116.940 1.00 38.53 ? 94  GLU B CG    1 
ATOM   3296 C CD    . GLU B 1 94  ? 24.352 32.099 116.389 1.00 37.80 ? 94  GLU B CD    1 
ATOM   3297 O OE1   . GLU B 1 94  ? 24.191 32.214 115.147 1.00 34.48 ? 94  GLU B OE1   1 
ATOM   3298 O OE2   . GLU B 1 94  ? 23.510 32.482 117.227 1.00 38.26 ? 94  GLU B OE2   1 
ATOM   3299 N N     . VAL B 1 95  ? 25.664 27.000 115.725 1.00 40.57 ? 95  VAL B N     1 
ATOM   3300 C CA    . VAL B 1 95  ? 26.014 25.971 114.773 1.00 42.01 ? 95  VAL B CA    1 
ATOM   3301 C C     . VAL B 1 95  ? 24.798 25.212 114.299 1.00 42.11 ? 95  VAL B C     1 
ATOM   3302 O O     . VAL B 1 95  ? 24.676 24.914 113.123 1.00 42.54 ? 95  VAL B O     1 
ATOM   3303 C CB    . VAL B 1 95  ? 27.032 25.048 115.351 1.00 41.80 ? 95  VAL B CB    1 
ATOM   3304 C CG1   . VAL B 1 95  ? 26.910 23.641 114.737 1.00 41.84 ? 95  VAL B CG1   1 
ATOM   3305 C CG2   . VAL B 1 95  ? 28.355 25.692 115.116 1.00 41.89 ? 95  VAL B CG2   1 
ATOM   3306 N N     . LEU B 1 96  ? 23.888 24.965 115.215 1.00 42.37 ? 96  LEU B N     1 
ATOM   3307 C CA    . LEU B 1 96  ? 22.747 24.151 114.966 1.00 42.90 ? 96  LEU B CA    1 
ATOM   3308 C C     . LEU B 1 96  ? 21.775 24.977 114.157 1.00 43.17 ? 96  LEU B C     1 
ATOM   3309 O O     . LEU B 1 96  ? 20.576 24.720 114.148 1.00 42.16 ? 96  LEU B O     1 
ATOM   3310 C CB    . LEU B 1 96  ? 22.149 23.840 116.333 1.00 43.32 ? 96  LEU B CB    1 
ATOM   3311 C CG    . LEU B 1 96  ? 22.412 22.481 117.013 1.00 45.38 ? 96  LEU B CG    1 
ATOM   3312 C CD1   . LEU B 1 96  ? 23.436 21.659 116.295 1.00 48.56 ? 96  LEU B CD1   1 
ATOM   3313 C CD2   . LEU B 1 96  ? 22.742 22.518 118.477 1.00 42.94 ? 96  LEU B CD2   1 
ATOM   3314 N N     . LYS B 1 97  ? 22.291 26.020 113.525 1.00 44.02 ? 97  LYS B N     1 
ATOM   3315 C CA    . LYS B 1 97  ? 21.432 26.993 112.928 1.00 45.10 ? 97  LYS B CA    1 
ATOM   3316 C C     . LYS B 1 97  ? 21.536 26.769 111.496 1.00 46.88 ? 97  LYS B C     1 
ATOM   3317 O O     . LYS B 1 97  ? 20.696 27.273 110.737 1.00 48.92 ? 97  LYS B O     1 
ATOM   3318 C CB    . LYS B 1 97  ? 21.856 28.412 113.240 1.00 44.95 ? 97  LYS B CB    1 
ATOM   3319 C CG    . LYS B 1 97  ? 21.115 29.013 114.401 1.00 45.01 ? 97  LYS B CG    1 
ATOM   3320 C CD    . LYS B 1 97  ? 21.112 30.499 114.284 1.00 46.41 ? 97  LYS B CD    1 
ATOM   3321 C CE    . LYS B 1 97  ? 20.968 31.241 115.666 1.00 44.66 ? 97  LYS B CE    1 
ATOM   3322 N NZ    . LYS B 1 97  ? 20.716 32.689 115.390 1.00 40.22 ? 97  LYS B NZ    1 
ATOM   3323 N N     . HIS B 1 98  ? 22.549 26.000 111.097 1.00 47.72 ? 98  HIS B N     1 
ATOM   3324 C CA    . HIS B 1 98  ? 22.722 25.645 109.695 1.00 47.91 ? 98  HIS B CA    1 
ATOM   3325 C C     . HIS B 1 98  ? 22.081 24.277 109.364 1.00 47.40 ? 98  HIS B C     1 
ATOM   3326 O O     . HIS B 1 98  ? 22.570 23.272 109.869 1.00 46.03 ? 98  HIS B O     1 
ATOM   3327 C CB    . HIS B 1 98  ? 24.202 25.612 109.370 1.00 48.66 ? 98  HIS B CB    1 
ATOM   3328 C CG    . HIS B 1 98  ? 24.944 26.913 109.619 1.00 53.77 ? 98  HIS B CG    1 
ATOM   3329 N ND1   . HIS B 1 98  ? 24.882 27.998 108.759 1.00 56.73 ? 98  HIS B ND1   1 
ATOM   3330 C CD2   . HIS B 1 98  ? 25.828 27.269 110.590 1.00 54.94 ? 98  HIS B CD2   1 
ATOM   3331 C CE1   . HIS B 1 98  ? 25.673 28.964 109.200 1.00 54.91 ? 98  HIS B CE1   1 
ATOM   3332 N NE2   . HIS B 1 98  ? 26.262 28.547 110.307 1.00 53.81 ? 98  HIS B NE2   1 
ATOM   3333 N N     . PRO B 1 99  ? 21.000 24.249 108.519 1.00 47.18 ? 99  PRO B N     1 
ATOM   3334 C CA    . PRO B 1 99  ? 20.308 23.098 107.895 1.00 47.09 ? 99  PRO B CA    1 
ATOM   3335 C C     . PRO B 1 99  ? 21.198 21.958 107.596 1.00 46.10 ? 99  PRO B C     1 
ATOM   3336 O O     . PRO B 1 99  ? 20.942 20.832 107.969 1.00 45.00 ? 99  PRO B O     1 
ATOM   3337 C CB    . PRO B 1 99  ? 19.885 23.642 106.522 1.00 47.40 ? 99  PRO B CB    1 
ATOM   3338 C CG    . PRO B 1 99  ? 19.629 25.103 106.761 1.00 49.11 ? 99  PRO B CG    1 
ATOM   3339 C CD    . PRO B 1 99  ? 20.323 25.491 108.119 1.00 48.10 ? 99  PRO B CD    1 
ATOM   3340 N N     . THR B 1 100 ? 22.255 22.262 106.872 1.00 46.64 ? 100 THR B N     1 
ATOM   3341 C CA    . THR B 1 100 ? 23.094 21.210 106.312 1.00 47.08 ? 100 THR B CA    1 
ATOM   3342 C C     . THR B 1 100 ? 23.565 20.185 107.384 1.00 47.22 ? 100 THR B C     1 
ATOM   3343 O O     . THR B 1 100 ? 23.864 19.014 107.078 1.00 46.41 ? 100 THR B O     1 
ATOM   3344 C CB    . THR B 1 100 ? 24.237 21.819 105.514 1.00 46.41 ? 100 THR B CB    1 
ATOM   3345 O OG1   . THR B 1 100 ? 24.759 22.903 106.251 1.00 46.20 ? 100 THR B OG1   1 
ATOM   3346 C CG2   . THR B 1 100 ? 23.725 22.377 104.177 1.00 47.97 ? 100 THR B CG2   1 
ATOM   3347 N N     . VAL B 1 101 ? 23.554 20.638 108.641 1.00 47.24 ? 101 VAL B N     1 
ATOM   3348 C CA    . VAL B 1 101 ? 24.346 20.016 109.689 1.00 46.94 ? 101 VAL B CA    1 
ATOM   3349 C C     . VAL B 1 101 ? 23.642 18.763 110.140 1.00 47.20 ? 101 VAL B C     1 
ATOM   3350 O O     . VAL B 1 101 ? 22.450 18.819 110.520 1.00 46.36 ? 101 VAL B O     1 
ATOM   3351 C CB    . VAL B 1 101 ? 24.580 21.016 110.908 1.00 46.82 ? 101 VAL B CB    1 
ATOM   3352 C CG1   . VAL B 1 101 ? 24.966 20.283 112.269 1.00 43.34 ? 101 VAL B CG1   1 
ATOM   3353 C CG2   . VAL B 1 101 ? 25.552 22.089 110.530 1.00 46.07 ? 101 VAL B CG2   1 
ATOM   3354 N N     . GLU B 1 102 ? 24.358 17.646 110.117 1.00 47.22 ? 102 GLU B N     1 
ATOM   3355 C CA    . GLU B 1 102 ? 23.771 16.449 110.716 1.00 49.83 ? 102 GLU B CA    1 
ATOM   3356 C C     . GLU B 1 102 ? 24.236 16.123 112.177 1.00 51.32 ? 102 GLU B C     1 
ATOM   3357 O O     . GLU B 1 102 ? 23.415 15.720 113.044 1.00 52.04 ? 102 GLU B O     1 
ATOM   3358 C CB    . GLU B 1 102 ? 23.943 15.247 109.798 1.00 49.92 ? 102 GLU B CB    1 
ATOM   3359 C CG    . GLU B 1 102 ? 23.083 15.297 108.527 1.00 51.45 ? 102 GLU B CG    1 
ATOM   3360 C CD    . GLU B 1 102 ? 23.868 14.839 107.303 1.00 53.47 ? 102 GLU B CD    1 
ATOM   3361 O OE1   . GLU B 1 102 ? 24.907 14.136 107.499 1.00 56.26 ? 102 GLU B OE1   1 
ATOM   3362 O OE2   . GLU B 1 102 ? 23.473 15.198 106.161 1.00 51.72 ? 102 GLU B OE2   1 
ATOM   3363 N N     . LYS B 1 103 ? 25.526 16.302 112.453 1.00 51.59 ? 103 LYS B N     1 
ATOM   3364 C CA    . LYS B 1 103 ? 26.049 15.907 113.728 1.00 52.89 ? 103 LYS B CA    1 
ATOM   3365 C C     . LYS B 1 103 ? 27.073 16.933 114.195 1.00 53.69 ? 103 LYS B C     1 
ATOM   3366 O O     . LYS B 1 103 ? 28.108 17.188 113.496 1.00 54.31 ? 103 LYS B O     1 
ATOM   3367 C CB    . LYS B 1 103 ? 26.715 14.514 113.643 1.00 53.73 ? 103 LYS B CB    1 
ATOM   3368 C CG    . LYS B 1 103 ? 27.287 13.981 114.993 1.00 54.47 ? 103 LYS B CG    1 
ATOM   3369 C CD    . LYS B 1 103 ? 26.471 12.796 115.541 1.00 60.14 ? 103 LYS B CD    1 
ATOM   3370 C CE    . LYS B 1 103 ? 27.225 11.439 115.326 1.00 64.30 ? 103 LYS B CE    1 
ATOM   3371 N NZ    . LYS B 1 103 ? 28.685 11.441 115.763 1.00 64.35 ? 103 LYS B NZ    1 
ATOM   3372 N N     . ALA B 1 104 ? 26.808 17.488 115.382 1.00 52.29 ? 104 ALA B N     1 
ATOM   3373 C CA    . ALA B 1 104 ? 27.755 18.369 116.040 1.00 51.99 ? 104 ALA B CA    1 
ATOM   3374 C C     . ALA B 1 104 ? 28.166 17.862 117.418 1.00 51.71 ? 104 ALA B C     1 
ATOM   3375 O O     . ALA B 1 104 ? 27.380 17.852 118.371 1.00 51.58 ? 104 ALA B O     1 
ATOM   3376 C CB    . ALA B 1 104 ? 27.186 19.771 116.134 1.00 51.99 ? 104 ALA B CB    1 
ATOM   3377 N N     . VAL B 1 105 ? 29.414 17.437 117.507 1.00 52.11 ? 105 VAL B N     1 
ATOM   3378 C CA    . VAL B 1 105 ? 29.949 16.879 118.748 1.00 52.61 ? 105 VAL B CA    1 
ATOM   3379 C C     . VAL B 1 105 ? 30.546 18.043 119.550 1.00 51.87 ? 105 VAL B C     1 
ATOM   3380 O O     . VAL B 1 105 ? 31.526 18.657 119.131 1.00 53.33 ? 105 VAL B O     1 
ATOM   3381 C CB    . VAL B 1 105 ? 31.011 15.763 118.487 1.00 52.45 ? 105 VAL B CB    1 
ATOM   3382 C CG1   . VAL B 1 105 ? 31.366 15.090 119.740 1.00 53.08 ? 105 VAL B CG1   1 
ATOM   3383 C CG2   . VAL B 1 105 ? 30.487 14.714 117.564 1.00 53.21 ? 105 VAL B CG2   1 
ATOM   3384 N N     . MET B 1 106 ? 29.915 18.395 120.652 1.00 50.48 ? 106 MET B N     1 
ATOM   3385 C CA    . MET B 1 106 ? 30.507 19.393 121.495 1.00 49.98 ? 106 MET B CA    1 
ATOM   3386 C C     . MET B 1 106 ? 31.414 18.709 122.532 1.00 49.79 ? 106 MET B C     1 
ATOM   3387 O O     . MET B 1 106 ? 30.976 17.776 123.276 1.00 49.03 ? 106 MET B O     1 
ATOM   3388 C CB    . MET B 1 106 ? 29.448 20.285 122.140 1.00 48.34 ? 106 MET B CB    1 
ATOM   3389 C CG    . MET B 1 106 ? 30.126 21.385 122.921 1.00 50.28 ? 106 MET B CG    1 
ATOM   3390 S SD    . MET B 1 106 ? 29.217 22.372 124.149 1.00 50.92 ? 106 MET B SD    1 
ATOM   3391 C CE    . MET B 1 106 ? 27.735 22.667 123.154 1.00 52.67 ? 106 MET B CE    1 
ATOM   3392 N N     . VAL B 1 107 ? 32.673 19.134 122.561 1.00 49.35 ? 107 VAL B N     1 
ATOM   3393 C CA    . VAL B 1 107 ? 33.597 18.470 123.457 1.00 50.22 ? 107 VAL B CA    1 
ATOM   3394 C C     . VAL B 1 107 ? 34.275 19.378 124.462 1.00 51.19 ? 107 VAL B C     1 
ATOM   3395 O O     . VAL B 1 107 ? 35.054 20.256 124.095 1.00 52.31 ? 107 VAL B O     1 
ATOM   3396 C CB    . VAL B 1 107 ? 34.639 17.616 122.736 1.00 50.01 ? 107 VAL B CB    1 
ATOM   3397 C CG1   . VAL B 1 107 ? 35.609 18.494 121.888 1.00 49.63 ? 107 VAL B CG1   1 
ATOM   3398 C CG2   . VAL B 1 107 ? 35.394 16.844 123.762 1.00 47.04 ? 107 VAL B CG2   1 
ATOM   3399 N N     . ASP B 1 108 ? 33.997 19.144 125.735 1.00 51.44 ? 108 ASP B N     1 
ATOM   3400 C CA    . ASP B 1 108 ? 34.387 20.098 126.752 1.00 51.60 ? 108 ASP B CA    1 
ATOM   3401 C C     . ASP B 1 108 ? 34.659 19.476 128.160 1.00 50.76 ? 108 ASP B C     1 
ATOM   3402 O O     . ASP B 1 108 ? 33.739 18.952 128.807 1.00 50.51 ? 108 ASP B O     1 
ATOM   3403 C CB    . ASP B 1 108 ? 33.350 21.240 126.746 1.00 51.42 ? 108 ASP B CB    1 
ATOM   3404 C CG    . ASP B 1 108 ? 33.653 22.344 127.789 1.00 55.35 ? 108 ASP B CG    1 
ATOM   3405 O OD1   . ASP B 1 108 ? 33.268 22.206 128.978 1.00 55.80 ? 108 ASP B OD1   1 
ATOM   3406 O OD2   . ASP B 1 108 ? 34.245 23.390 127.427 1.00 59.81 ? 108 ASP B OD2   1 
ATOM   3407 N N     . ILE B 1 109 ? 35.930 19.492 128.595 1.00 50.25 ? 109 ILE B N     1 
ATOM   3408 C CA    . ILE B 1 109 ? 36.289 19.396 130.029 1.00 50.34 ? 109 ILE B CA    1 
ATOM   3409 C C     . ILE B 1 109 ? 35.322 20.281 130.852 1.00 51.37 ? 109 ILE B C     1 
ATOM   3410 O O     . ILE B 1 109 ? 34.961 21.370 130.410 1.00 53.64 ? 109 ILE B O     1 
ATOM   3411 C CB    . ILE B 1 109 ? 37.721 19.935 130.288 1.00 49.98 ? 109 ILE B CB    1 
ATOM   3412 C CG1   . ILE B 1 109 ? 38.782 18.858 130.297 1.00 49.17 ? 109 ILE B CG1   1 
ATOM   3413 C CG2   . ILE B 1 109 ? 37.851 20.472 131.660 1.00 50.58 ? 109 ILE B CG2   1 
ATOM   3414 C CD1   . ILE B 1 109 ? 40.144 19.422 130.656 1.00 48.34 ? 109 ILE B CD1   1 
ATOM   3415 N N     . ASP B 1 110 ? 34.915 19.839 132.036 1.00 51.70 ? 110 ASP B N     1 
ATOM   3416 C CA    . ASP B 1 110 ? 34.033 20.576 132.971 1.00 51.67 ? 110 ASP B CA    1 
ATOM   3417 C C     . ASP B 1 110 ? 32.527 20.506 132.699 1.00 52.35 ? 110 ASP B C     1 
ATOM   3418 O O     . ASP B 1 110 ? 31.931 21.489 132.208 1.00 52.09 ? 110 ASP B O     1 
ATOM   3419 C CB    . ASP B 1 110 ? 34.453 22.018 133.170 1.00 51.21 ? 110 ASP B CB    1 
ATOM   3420 C CG    . ASP B 1 110 ? 33.939 22.593 134.493 1.00 53.99 ? 110 ASP B CG    1 
ATOM   3421 O OD1   . ASP B 1 110 ? 34.569 23.586 134.957 1.00 55.04 ? 110 ASP B OD1   1 
ATOM   3422 O OD2   . ASP B 1 110 ? 32.950 22.042 135.092 1.00 54.12 ? 110 ASP B OD2   1 
ATOM   3423 N N     . GLY B 1 111 ? 31.920 19.362 133.074 1.00 51.86 ? 111 GLY B N     1 
ATOM   3424 C CA    . GLY B 1 111 ? 30.498 19.110 132.856 1.00 51.57 ? 111 GLY B CA    1 
ATOM   3425 C C     . GLY B 1 111 ? 29.680 19.748 133.965 1.00 52.15 ? 111 GLY B C     1 
ATOM   3426 O O     . GLY B 1 111 ? 28.459 19.793 133.912 1.00 52.54 ? 111 GLY B O     1 
ATOM   3427 N N     . GLU B 1 112 ? 30.367 20.216 134.986 1.00 51.57 ? 112 GLU B N     1 
ATOM   3428 C CA    . GLU B 1 112 ? 29.744 20.819 136.142 1.00 52.06 ? 112 GLU B CA    1 
ATOM   3429 C C     . GLU B 1 112 ? 29.447 22.251 135.678 1.00 51.81 ? 112 GLU B C     1 
ATOM   3430 O O     . GLU B 1 112 ? 28.405 22.845 135.936 1.00 51.64 ? 112 GLU B O     1 
ATOM   3431 C CB    . GLU B 1 112 ? 30.767 20.754 137.311 1.00 51.98 ? 112 GLU B CB    1 
ATOM   3432 C CG    . GLU B 1 112 ? 30.450 21.502 138.623 1.00 52.59 ? 112 GLU B CG    1 
ATOM   3433 C CD    . GLU B 1 112 ? 31.532 21.219 139.728 1.00 52.01 ? 112 GLU B CD    1 
ATOM   3434 O OE1   . GLU B 1 112 ? 31.551 22.012 140.705 1.00 45.90 ? 112 GLU B OE1   1 
ATOM   3435 O OE2   . GLU B 1 112 ? 32.348 20.215 139.588 1.00 48.75 ? 112 GLU B OE2   1 
ATOM   3436 N N     . LEU B 1 113 ? 30.385 22.786 134.926 1.00 51.09 ? 113 LEU B N     1 
ATOM   3437 C CA    . LEU B 1 113 ? 30.194 24.092 134.362 1.00 50.60 ? 113 LEU B CA    1 
ATOM   3438 C C     . LEU B 1 113 ? 29.078 23.925 133.351 1.00 49.79 ? 113 LEU B C     1 
ATOM   3439 O O     . LEU B 1 113 ? 28.058 24.627 133.406 1.00 51.13 ? 113 LEU B O     1 
ATOM   3440 C CB    . LEU B 1 113 ? 31.521 24.635 133.766 1.00 50.54 ? 113 LEU B CB    1 
ATOM   3441 C CG    . LEU B 1 113 ? 31.775 26.067 133.280 1.00 49.54 ? 113 LEU B CG    1 
ATOM   3442 C CD1   . LEU B 1 113 ? 31.563 26.056 131.791 1.00 45.62 ? 113 LEU B CD1   1 
ATOM   3443 C CD2   . LEU B 1 113 ? 30.915 27.133 133.963 1.00 43.36 ? 113 LEU B CD2   1 
ATOM   3444 N N     . VAL B 1 114 ? 29.212 22.951 132.472 1.00 48.50 ? 114 VAL B N     1 
ATOM   3445 C CA    . VAL B 1 114 ? 28.143 22.778 131.529 1.00 46.99 ? 114 VAL B CA    1 
ATOM   3446 C C     . VAL B 1 114 ? 26.839 22.716 132.321 1.00 46.30 ? 114 VAL B C     1 
ATOM   3447 O O     . VAL B 1 114 ? 25.815 23.190 131.865 1.00 46.40 ? 114 VAL B O     1 
ATOM   3448 C CB    . VAL B 1 114 ? 28.350 21.566 130.683 1.00 46.75 ? 114 VAL B CB    1 
ATOM   3449 C CG1   . VAL B 1 114 ? 27.044 21.169 130.071 1.00 46.87 ? 114 VAL B CG1   1 
ATOM   3450 C CG2   . VAL B 1 114 ? 29.414 21.844 129.627 1.00 45.01 ? 114 VAL B CG2   1 
ATOM   3451 N N     . GLU B 1 115 ? 26.857 22.197 133.537 1.00 46.12 ? 115 GLU B N     1 
ATOM   3452 C CA    . GLU B 1 115 ? 25.557 22.088 134.194 1.00 46.90 ? 115 GLU B CA    1 
ATOM   3453 C C     . GLU B 1 115 ? 25.053 23.451 134.547 1.00 46.14 ? 115 GLU B C     1 
ATOM   3454 O O     . GLU B 1 115 ? 23.869 23.714 134.377 1.00 45.23 ? 115 GLU B O     1 
ATOM   3455 C CB    . GLU B 1 115 ? 25.512 21.173 135.415 1.00 47.37 ? 115 GLU B CB    1 
ATOM   3456 C CG    . GLU B 1 115 ? 25.654 19.677 135.109 1.00 51.23 ? 115 GLU B CG    1 
ATOM   3457 C CD    . GLU B 1 115 ? 24.807 19.174 133.953 1.00 56.58 ? 115 GLU B CD    1 
ATOM   3458 O OE1   . GLU B 1 115 ? 23.553 19.043 134.132 1.00 57.81 ? 115 GLU B OE1   1 
ATOM   3459 O OE2   . GLU B 1 115 ? 25.417 18.860 132.875 1.00 60.53 ? 115 GLU B OE2   1 
ATOM   3460 N N     . VAL B 1 116 ? 25.945 24.332 135.004 1.00 45.98 ? 116 VAL B N     1 
ATOM   3461 C CA    . VAL B 1 116 ? 25.498 25.692 135.300 1.00 46.05 ? 116 VAL B CA    1 
ATOM   3462 C C     . VAL B 1 116 ? 24.819 26.290 134.072 1.00 46.28 ? 116 VAL B C     1 
ATOM   3463 O O     . VAL B 1 116 ? 23.631 26.716 134.127 1.00 45.71 ? 116 VAL B O     1 
ATOM   3464 C CB    . VAL B 1 116 ? 26.560 26.679 135.837 1.00 46.24 ? 116 VAL B CB    1 
ATOM   3465 C CG1   . VAL B 1 116 ? 25.795 27.725 136.672 1.00 47.78 ? 116 VAL B CG1   1 
ATOM   3466 C CG2   . VAL B 1 116 ? 27.652 26.013 136.736 1.00 43.23 ? 116 VAL B CG2   1 
ATOM   3467 N N     . ALA B 1 117 ? 25.558 26.285 132.963 1.00 46.31 ? 117 ALA B N     1 
ATOM   3468 C CA    . ALA B 1 117 ? 25.004 26.743 131.703 1.00 46.75 ? 117 ALA B CA    1 
ATOM   3469 C C     . ALA B 1 117 ? 23.567 26.194 131.494 1.00 47.27 ? 117 ALA B C     1 
ATOM   3470 O O     . ALA B 1 117 ? 22.606 26.991 131.317 1.00 48.03 ? 117 ALA B O     1 
ATOM   3471 C CB    . ALA B 1 117 ? 25.913 26.371 130.549 1.00 46.95 ? 117 ALA B CB    1 
ATOM   3472 N N     . LYS B 1 118 ? 23.423 24.852 131.503 1.00 47.00 ? 118 LYS B N     1 
ATOM   3473 C CA    . LYS B 1 118 ? 22.098 24.214 131.498 1.00 45.80 ? 118 LYS B CA    1 
ATOM   3474 C C     . LYS B 1 118 ? 21.227 24.976 132.555 1.00 46.03 ? 118 LYS B C     1 
ATOM   3475 O O     . LYS B 1 118 ? 20.382 25.806 132.168 1.00 45.71 ? 118 LYS B O     1 
ATOM   3476 C CB    . LYS B 1 118 ? 22.199 22.661 131.683 1.00 45.68 ? 118 LYS B CB    1 
ATOM   3477 C CG    . LYS B 1 118 ? 22.431 21.776 130.377 1.00 44.60 ? 118 LYS B CG    1 
ATOM   3478 C CD    . LYS B 1 118 ? 23.263 20.507 130.658 1.00 44.73 ? 118 LYS B CD    1 
ATOM   3479 C CE    . LYS B 1 118 ? 23.181 19.403 129.588 1.00 44.78 ? 118 LYS B CE    1 
ATOM   3480 N NZ    . LYS B 1 118 ? 23.878 18.069 129.978 1.00 43.54 ? 118 LYS B NZ    1 
ATOM   3481 N N     . ARG B 1 119 ? 21.487 24.814 133.858 1.00 45.53 ? 119 ARG B N     1 
ATOM   3482 C CA    . ARG B 1 119 ? 20.537 25.332 134.821 1.00 46.67 ? 119 ARG B CA    1 
ATOM   3483 C C     . ARG B 1 119 ? 20.321 26.842 134.781 1.00 46.86 ? 119 ARG B C     1 
ATOM   3484 O O     . ARG B 1 119 ? 19.206 27.313 135.055 1.00 46.14 ? 119 ARG B O     1 
ATOM   3485 C CB    . ARG B 1 119 ? 20.838 24.887 136.266 1.00 48.64 ? 119 ARG B CB    1 
ATOM   3486 C CG    . ARG B 1 119 ? 20.078 25.731 137.351 1.00 50.47 ? 119 ARG B CG    1 
ATOM   3487 C CD    . ARG B 1 119 ? 18.982 24.998 138.119 1.00 53.85 ? 119 ARG B CD    1 
ATOM   3488 N NE    . ARG B 1 119 ? 18.955 25.588 139.465 1.00 60.10 ? 119 ARG B NE    1 
ATOM   3489 C CZ    . ARG B 1 119 ? 19.800 25.298 140.489 1.00 59.02 ? 119 ARG B CZ    1 
ATOM   3490 N NH1   . ARG B 1 119 ? 20.760 24.375 140.376 1.00 58.15 ? 119 ARG B NH1   1 
ATOM   3491 N NH2   . ARG B 1 119 ? 19.666 25.921 141.660 1.00 56.77 ? 119 ARG B NH2   1 
ATOM   3492 N N     . HIS B 1 120 ? 21.357 27.614 134.446 1.00 46.22 ? 120 HIS B N     1 
ATOM   3493 C CA    . HIS B 1 120 ? 21.255 29.047 134.718 1.00 44.76 ? 120 HIS B CA    1 
ATOM   3494 C C     . HIS B 1 120 ? 21.369 29.954 133.540 1.00 44.12 ? 120 HIS B C     1 
ATOM   3495 O O     . HIS B 1 120 ? 21.007 31.146 133.652 1.00 42.51 ? 120 HIS B O     1 
ATOM   3496 C CB    . HIS B 1 120 ? 22.258 29.452 135.766 1.00 44.61 ? 120 HIS B CB    1 
ATOM   3497 C CG    . HIS B 1 120 ? 21.856 29.048 137.159 1.00 42.87 ? 120 HIS B CG    1 
ATOM   3498 N ND1   . HIS B 1 120 ? 20.709 29.512 137.760 1.00 43.27 ? 120 HIS B ND1   1 
ATOM   3499 C CD2   . HIS B 1 120 ? 22.480 28.273 138.084 1.00 40.35 ? 120 HIS B CD2   1 
ATOM   3500 C CE1   . HIS B 1 120 ? 20.626 29.018 138.985 1.00 42.74 ? 120 HIS B CE1   1 
ATOM   3501 N NE2   . HIS B 1 120 ? 21.693 28.270 139.206 1.00 40.74 ? 120 HIS B NE2   1 
ATOM   3502 N N     . MET B 1 121 ? 21.886 29.386 132.440 1.00 42.45 ? 121 MET B N     1 
ATOM   3503 C CA    . MET B 1 121 ? 22.189 30.134 131.249 1.00 42.28 ? 121 MET B CA    1 
ATOM   3504 C C     . MET B 1 121 ? 21.300 29.751 130.020 1.00 43.30 ? 121 MET B C     1 
ATOM   3505 O O     . MET B 1 121 ? 21.830 29.638 128.906 1.00 42.34 ? 121 MET B O     1 
ATOM   3506 C CB    . MET B 1 121 ? 23.666 29.985 130.921 1.00 41.10 ? 121 MET B CB    1 
ATOM   3507 C CG    . MET B 1 121 ? 24.601 30.600 131.971 1.00 40.02 ? 121 MET B CG    1 
ATOM   3508 S SD    . MET B 1 121 ? 26.425 30.637 131.593 1.00 42.43 ? 121 MET B SD    1 
ATOM   3509 C CE    . MET B 1 121 ? 26.510 31.829 130.282 1.00 28.82 ? 121 MET B CE    1 
ATOM   3510 N N     . PRO B 1 122 ? 19.935 29.623 130.211 1.00 43.28 ? 122 PRO B N     1 
ATOM   3511 C CA    . PRO B 1 122 ? 18.923 29.307 129.163 1.00 42.96 ? 122 PRO B CA    1 
ATOM   3512 C C     . PRO B 1 122 ? 19.129 30.193 127.942 1.00 43.37 ? 122 PRO B C     1 
ATOM   3513 O O     . PRO B 1 122 ? 19.200 29.705 126.773 1.00 44.23 ? 122 PRO B O     1 
ATOM   3514 C CB    . PRO B 1 122 ? 17.619 29.789 129.796 1.00 43.21 ? 122 PRO B CB    1 
ATOM   3515 C CG    . PRO B 1 122 ? 18.037 30.550 131.052 1.00 42.23 ? 122 PRO B CG    1 
ATOM   3516 C CD    . PRO B 1 122 ? 19.268 29.933 131.486 1.00 42.53 ? 122 PRO B CD    1 
ATOM   3517 N N     . GLU B 1 123 ? 19.242 31.491 128.257 1.00 42.40 ? 123 GLU B N     1 
ATOM   3518 C CA    . GLU B 1 123 ? 19.493 32.561 127.307 1.00 41.78 ? 123 GLU B CA    1 
ATOM   3519 C C     . GLU B 1 123 ? 20.585 32.257 126.255 1.00 42.14 ? 123 GLU B C     1 
ATOM   3520 O O     . GLU B 1 123 ? 20.446 32.608 125.081 1.00 41.23 ? 123 GLU B O     1 
ATOM   3521 C CB    . GLU B 1 123 ? 19.814 33.846 128.049 1.00 40.72 ? 123 GLU B CB    1 
ATOM   3522 C CG    . GLU B 1 123 ? 18.697 34.336 128.901 1.00 38.19 ? 123 GLU B CG    1 
ATOM   3523 C CD    . GLU B 1 123 ? 18.925 34.003 130.355 1.00 37.01 ? 123 GLU B CD    1 
ATOM   3524 O OE1   . GLU B 1 123 ? 18.219 34.515 131.224 1.00 36.92 ? 123 GLU B OE1   1 
ATOM   3525 O OE2   . GLU B 1 123 ? 19.811 33.200 130.650 1.00 38.65 ? 123 GLU B OE2   1 
ATOM   3526 N N     . TRP B 1 124 ? 21.653 31.612 126.698 1.00 42.73 ? 124 TRP B N     1 
ATOM   3527 C CA    . TRP B 1 124 ? 22.696 31.126 125.816 1.00 43.99 ? 124 TRP B CA    1 
ATOM   3528 C C     . TRP B 1 124 ? 22.244 29.920 124.945 1.00 45.84 ? 124 TRP B C     1 
ATOM   3529 O O     . TRP B 1 124 ? 22.067 30.090 123.685 1.00 45.19 ? 124 TRP B O     1 
ATOM   3530 C CB    . TRP B 1 124 ? 23.919 30.778 126.642 1.00 42.50 ? 124 TRP B CB    1 
ATOM   3531 C CG    . TRP B 1 124 ? 24.753 32.001 126.964 1.00 42.32 ? 124 TRP B CG    1 
ATOM   3532 C CD1   . TRP B 1 124 ? 25.871 32.439 126.277 1.00 40.87 ? 124 TRP B CD1   1 
ATOM   3533 C CD2   . TRP B 1 124 ? 24.549 32.934 128.026 1.00 38.96 ? 124 TRP B CD2   1 
ATOM   3534 N NE1   . TRP B 1 124 ? 26.362 33.564 126.862 1.00 40.86 ? 124 TRP B NE1   1 
ATOM   3535 C CE2   . TRP B 1 124 ? 25.576 33.897 127.935 1.00 38.55 ? 124 TRP B CE2   1 
ATOM   3536 C CE3   . TRP B 1 124 ? 23.620 33.031 129.057 1.00 39.09 ? 124 TRP B CE3   1 
ATOM   3537 C CZ2   . TRP B 1 124 ? 25.695 34.955 128.822 1.00 38.37 ? 124 TRP B CZ2   1 
ATOM   3538 C CZ3   . TRP B 1 124 ? 23.741 34.074 129.944 1.00 40.83 ? 124 TRP B CZ3   1 
ATOM   3539 C CH2   . TRP B 1 124 ? 24.785 35.036 129.818 1.00 41.55 ? 124 TRP B CH2   1 
ATOM   3540 N N     . HIS B 1 125 ? 21.991 28.763 125.616 1.00 46.87 ? 125 HIS B N     1 
ATOM   3541 C CA    . HIS B 1 125 ? 21.879 27.419 124.941 1.00 47.97 ? 125 HIS B CA    1 
ATOM   3542 C C     . HIS B 1 125 ? 20.653 27.284 124.113 1.00 48.61 ? 125 HIS B C     1 
ATOM   3543 O O     . HIS B 1 125 ? 20.716 26.780 122.988 1.00 48.53 ? 125 HIS B O     1 
ATOM   3544 C CB    . HIS B 1 125 ? 22.076 26.160 125.850 1.00 47.46 ? 125 HIS B CB    1 
ATOM   3545 C CG    . HIS B 1 125 ? 21.209 26.122 127.061 1.00 47.00 ? 125 HIS B CG    1 
ATOM   3546 N ND1   . HIS B 1 125 ? 19.847 25.899 126.995 1.00 46.81 ? 125 HIS B ND1   1 
ATOM   3547 C CD2   . HIS B 1 125 ? 21.512 26.251 128.376 1.00 47.44 ? 125 HIS B CD2   1 
ATOM   3548 C CE1   . HIS B 1 125 ? 19.336 25.935 128.210 1.00 44.79 ? 125 HIS B CE1   1 
ATOM   3549 N NE2   . HIS B 1 125 ? 20.327 26.141 129.067 1.00 51.28 ? 125 HIS B NE2   1 
ATOM   3550 N N     . GLN B 1 126 ? 19.552 27.790 124.652 1.00 49.83 ? 126 GLN B N     1 
ATOM   3551 C CA    . GLN B 1 126 ? 18.322 27.797 123.887 1.00 50.55 ? 126 GLN B CA    1 
ATOM   3552 C C     . GLN B 1 126 ? 17.985 26.387 123.334 1.00 51.05 ? 126 GLN B C     1 
ATOM   3553 O O     . GLN B 1 126 ? 17.801 26.207 122.117 1.00 51.25 ? 126 GLN B O     1 
ATOM   3554 C CB    . GLN B 1 126 ? 18.467 28.825 122.778 1.00 50.28 ? 126 GLN B CB    1 
ATOM   3555 C CG    . GLN B 1 126 ? 18.463 30.210 123.333 1.00 50.27 ? 126 GLN B CG    1 
ATOM   3556 C CD    . GLN B 1 126 ? 18.279 31.213 122.248 1.00 52.23 ? 126 GLN B CD    1 
ATOM   3557 O OE1   . GLN B 1 126 ? 18.571 32.404 122.427 1.00 52.98 ? 126 GLN B OE1   1 
ATOM   3558 N NE2   . GLN B 1 126 ? 17.779 30.753 121.091 1.00 54.82 ? 126 GLN B NE2   1 
ATOM   3559 N N     . GLY B 1 127 ? 17.967 25.396 124.231 1.00 50.30 ? 127 GLY B N     1 
ATOM   3560 C CA    . GLY B 1 127 ? 17.802 24.019 123.840 1.00 49.81 ? 127 GLY B CA    1 
ATOM   3561 C C     . GLY B 1 127 ? 18.907 23.421 122.968 1.00 49.58 ? 127 GLY B C     1 
ATOM   3562 O O     . GLY B 1 127 ? 18.896 22.227 122.724 1.00 50.27 ? 127 GLY B O     1 
ATOM   3563 N N     . ALA B 1 128 ? 19.846 24.223 122.481 1.00 48.83 ? 128 ALA B N     1 
ATOM   3564 C CA    . ALA B 1 128 ? 20.962 23.714 121.675 1.00 47.78 ? 128 ALA B CA    1 
ATOM   3565 C C     . ALA B 1 128 ? 21.404 22.298 122.152 1.00 47.42 ? 128 ALA B C     1 
ATOM   3566 O O     . ALA B 1 128 ? 21.706 21.389 121.326 1.00 47.10 ? 128 ALA B O     1 
ATOM   3567 C CB    . ALA B 1 128 ? 22.160 24.718 121.677 1.00 46.71 ? 128 ALA B CB    1 
ATOM   3568 N N     . PHE B 1 129 ? 21.393 22.099 123.472 1.00 46.23 ? 129 PHE B N     1 
ATOM   3569 C CA    . PHE B 1 129 ? 22.008 20.885 124.062 1.00 45.59 ? 129 PHE B CA    1 
ATOM   3570 C C     . PHE B 1 129 ? 21.217 19.615 123.833 1.00 45.44 ? 129 PHE B C     1 
ATOM   3571 O O     . PHE B 1 129 ? 21.782 18.545 123.947 1.00 45.60 ? 129 PHE B O     1 
ATOM   3572 C CB    . PHE B 1 129 ? 22.244 21.051 125.562 1.00 44.15 ? 129 PHE B CB    1 
ATOM   3573 C CG    . PHE B 1 129 ? 23.529 21.699 125.889 1.00 42.57 ? 129 PHE B CG    1 
ATOM   3574 C CD1   . PHE B 1 129 ? 23.563 22.892 126.591 1.00 42.28 ? 129 PHE B CD1   1 
ATOM   3575 C CD2   . PHE B 1 129 ? 24.730 21.121 125.511 1.00 42.72 ? 129 PHE B CD2   1 
ATOM   3576 C CE1   . PHE B 1 129 ? 24.820 23.545 126.930 1.00 41.54 ? 129 PHE B CE1   1 
ATOM   3577 C CE2   . PHE B 1 129 ? 25.989 21.752 125.836 1.00 43.11 ? 129 PHE B CE2   1 
ATOM   3578 C CZ    . PHE B 1 129 ? 26.029 22.980 126.559 1.00 40.91 ? 129 PHE B CZ    1 
ATOM   3579 N N     . ASP B 1 130 ? 19.918 19.768 123.557 1.00 45.15 ? 130 ASP B N     1 
ATOM   3580 C CA    . ASP B 1 130 ? 18.961 18.666 123.345 1.00 45.37 ? 130 ASP B CA    1 
ATOM   3581 C C     . ASP B 1 130 ? 18.618 18.661 121.889 1.00 44.96 ? 130 ASP B C     1 
ATOM   3582 O O     . ASP B 1 130 ? 17.478 18.471 121.512 1.00 45.17 ? 130 ASP B O     1 
ATOM   3583 C CB    . ASP B 1 130 ? 17.653 18.896 124.089 1.00 43.96 ? 130 ASP B CB    1 
ATOM   3584 C CG    . ASP B 1 130 ? 17.864 19.228 125.509 1.00 45.76 ? 130 ASP B CG    1 
ATOM   3585 O OD1   . ASP B 1 130 ? 18.732 18.620 126.166 1.00 48.65 ? 130 ASP B OD1   1 
ATOM   3586 O OD2   . ASP B 1 130 ? 17.157 20.119 125.984 1.00 45.71 ? 130 ASP B OD2   1 
ATOM   3587 N N     . ASP B 1 131 ? 19.569 18.975 121.042 1.00 44.65 ? 131 ASP B N     1 
ATOM   3588 C CA    . ASP B 1 131 ? 19.231 18.819 119.674 1.00 44.01 ? 131 ASP B CA    1 
ATOM   3589 C C     . ASP B 1 131 ? 19.692 17.381 119.447 1.00 43.34 ? 131 ASP B C     1 
ATOM   3590 O O     . ASP B 1 131 ? 20.783 16.977 119.879 1.00 41.65 ? 131 ASP B O     1 
ATOM   3591 C CB    . ASP B 1 131 ? 19.894 19.901 118.805 1.00 44.66 ? 131 ASP B CB    1 
ATOM   3592 C CG    . ASP B 1 131 ? 19.362 19.928 117.367 1.00 45.17 ? 131 ASP B CG    1 
ATOM   3593 O OD1   . ASP B 1 131 ? 19.365 18.849 116.730 1.00 51.67 ? 131 ASP B OD1   1 
ATOM   3594 O OD2   . ASP B 1 131 ? 18.982 21.006 116.839 1.00 41.06 ? 131 ASP B OD2   1 
ATOM   3595 N N     . PRO B 1 132 ? 18.812 16.590 118.824 1.00 43.40 ? 132 PRO B N     1 
ATOM   3596 C CA    . PRO B 1 132 ? 19.034 15.193 118.416 1.00 43.17 ? 132 PRO B CA    1 
ATOM   3597 C C     . PRO B 1 132 ? 20.314 15.115 117.625 1.00 43.69 ? 132 PRO B C     1 
ATOM   3598 O O     . PRO B 1 132 ? 20.933 14.054 117.585 1.00 43.59 ? 132 PRO B O     1 
ATOM   3599 C CB    . PRO B 1 132 ? 17.861 14.889 117.487 1.00 42.54 ? 132 PRO B CB    1 
ATOM   3600 C CG    . PRO B 1 132 ? 17.304 16.250 117.085 1.00 42.31 ? 132 PRO B CG    1 
ATOM   3601 C CD    . PRO B 1 132 ? 17.518 17.098 118.348 1.00 42.73 ? 132 PRO B CD    1 
ATOM   3602 N N     . ARG B 1 133 ? 20.750 16.241 117.063 1.00 44.87 ? 133 ARG B N     1 
ATOM   3603 C CA    . ARG B 1 133 ? 22.099 16.323 116.454 1.00 46.08 ? 133 ARG B CA    1 
ATOM   3604 C C     . ARG B 1 133 ? 23.318 16.595 117.347 1.00 46.43 ? 133 ARG B C     1 
ATOM   3605 O O     . ARG B 1 133 ? 24.440 16.412 116.891 1.00 47.10 ? 133 ARG B O     1 
ATOM   3606 C CB    . ARG B 1 133 ? 22.097 17.266 115.263 1.00 45.82 ? 133 ARG B CB    1 
ATOM   3607 C CG    . ARG B 1 133 ? 20.964 16.978 114.329 1.00 46.28 ? 133 ARG B CG    1 
ATOM   3608 C CD    . ARG B 1 133 ? 20.785 18.167 113.416 1.00 49.02 ? 133 ARG B CD    1 
ATOM   3609 N NE    . ARG B 1 133 ? 20.204 19.336 114.102 1.00 49.00 ? 133 ARG B NE    1 
ATOM   3610 C CZ    . ARG B 1 133 ? 20.024 20.548 113.541 1.00 50.20 ? 133 ARG B CZ    1 
ATOM   3611 N NH1   . ARG B 1 133 ? 20.368 20.749 112.246 1.00 47.28 ? 133 ARG B NH1   1 
ATOM   3612 N NH2   . ARG B 1 133 ? 19.486 21.565 114.265 1.00 45.06 ? 133 ARG B NH2   1 
ATOM   3613 N N     . ALA B 1 134 ? 23.112 17.025 118.597 1.00 46.76 ? 134 ALA B N     1 
ATOM   3614 C CA    . ALA B 1 134 ? 24.239 17.326 119.522 1.00 46.93 ? 134 ALA B CA    1 
ATOM   3615 C C     . ALA B 1 134 ? 24.760 16.105 120.294 1.00 48.00 ? 134 ALA B C     1 
ATOM   3616 O O     . ALA B 1 134 ? 23.967 15.282 120.830 1.00 47.18 ? 134 ALA B O     1 
ATOM   3617 C CB    . ALA B 1 134 ? 23.860 18.440 120.521 1.00 44.89 ? 134 ALA B CB    1 
ATOM   3618 N N     . VAL B 1 135 ? 26.089 15.995 120.391 1.00 48.69 ? 135 VAL B N     1 
ATOM   3619 C CA    . VAL B 1 135 ? 26.663 14.920 121.234 1.00 49.65 ? 135 VAL B CA    1 
ATOM   3620 C C     . VAL B 1 135 ? 27.490 15.499 122.416 1.00 49.86 ? 135 VAL B C     1 
ATOM   3621 O O     . VAL B 1 135 ? 28.659 15.868 122.306 1.00 50.55 ? 135 VAL B O     1 
ATOM   3622 C CB    . VAL B 1 135 ? 27.440 13.807 120.355 1.00 50.28 ? 135 VAL B CB    1 
ATOM   3623 C CG1   . VAL B 1 135 ? 27.164 12.326 120.820 1.00 49.07 ? 135 VAL B CG1   1 
ATOM   3624 C CG2   . VAL B 1 135 ? 27.079 13.902 118.872 1.00 50.11 ? 135 VAL B CG2   1 
ATOM   3625 N N     . LEU B 1 136 ? 26.873 15.657 123.547 1.00 49.79 ? 136 LEU B N     1 
ATOM   3626 C CA    . LEU B 1 136 ? 27.638 16.257 124.581 1.00 51.77 ? 136 LEU B CA    1 
ATOM   3627 C C     . LEU B 1 136 ? 28.758 15.301 124.908 1.00 52.24 ? 136 LEU B C     1 
ATOM   3628 O O     . LEU B 1 136 ? 28.492 14.186 125.275 1.00 53.86 ? 136 LEU B O     1 
ATOM   3629 C CB    . LEU B 1 136 ? 26.779 16.438 125.822 1.00 52.15 ? 136 LEU B CB    1 
ATOM   3630 C CG    . LEU B 1 136 ? 27.564 17.091 126.942 1.00 54.65 ? 136 LEU B CG    1 
ATOM   3631 C CD1   . LEU B 1 136 ? 28.281 18.314 126.393 1.00 54.61 ? 136 LEU B CD1   1 
ATOM   3632 C CD2   . LEU B 1 136 ? 26.590 17.452 128.119 1.00 59.85 ? 136 LEU B CD2   1 
ATOM   3633 N N     . VAL B 1 137 ? 30.012 15.690 124.818 1.00 51.96 ? 137 VAL B N     1 
ATOM   3634 C CA    . VAL B 1 137 ? 31.007 14.745 125.297 1.00 51.24 ? 137 VAL B CA    1 
ATOM   3635 C C     . VAL B 1 137 ? 31.756 15.349 126.471 1.00 52.59 ? 137 VAL B C     1 
ATOM   3636 O O     . VAL B 1 137 ? 32.205 16.473 126.379 1.00 52.95 ? 137 VAL B O     1 
ATOM   3637 C CB    . VAL B 1 137 ? 31.999 14.391 124.200 1.00 51.05 ? 137 VAL B CB    1 
ATOM   3638 C CG1   . VAL B 1 137 ? 33.121 13.598 124.808 1.00 49.83 ? 137 VAL B CG1   1 
ATOM   3639 C CG2   . VAL B 1 137 ? 31.334 13.655 123.041 1.00 46.35 ? 137 VAL B CG2   1 
ATOM   3640 N N     . ILE B 1 138 ? 31.942 14.647 127.573 1.00 53.83 ? 138 ILE B N     1 
ATOM   3641 C CA    . ILE B 1 138 ? 32.472 15.400 128.688 1.00 55.52 ? 138 ILE B CA    1 
ATOM   3642 C C     . ILE B 1 138 ? 33.959 15.314 128.967 1.00 58.13 ? 138 ILE B C     1 
ATOM   3643 O O     . ILE B 1 138 ? 34.362 15.380 130.099 1.00 59.29 ? 138 ILE B O     1 
ATOM   3644 C CB    . ILE B 1 138 ? 31.563 15.370 129.918 1.00 54.98 ? 138 ILE B CB    1 
ATOM   3645 C CG1   . ILE B 1 138 ? 30.250 16.074 129.535 1.00 55.11 ? 138 ILE B CG1   1 
ATOM   3646 C CG2   . ILE B 1 138 ? 32.148 16.163 131.028 1.00 53.59 ? 138 ILE B CG2   1 
ATOM   3647 C CD1   . ILE B 1 138 ? 29.685 16.962 130.600 1.00 52.00 ? 138 ILE B CD1   1 
ATOM   3648 N N     . ASP B 1 139 ? 34.796 15.272 127.934 1.00 60.88 ? 139 ASP B N     1 
ATOM   3649 C CA    . ASP B 1 139 ? 36.225 14.967 128.138 1.00 63.04 ? 139 ASP B CA    1 
ATOM   3650 C C     . ASP B 1 139 ? 37.209 16.128 127.761 1.00 63.93 ? 139 ASP B C     1 
ATOM   3651 O O     . ASP B 1 139 ? 36.784 17.140 127.231 1.00 64.07 ? 139 ASP B O     1 
ATOM   3652 C CB    . ASP B 1 139 ? 36.501 13.645 127.389 1.00 64.01 ? 139 ASP B CB    1 
ATOM   3653 C CG    . ASP B 1 139 ? 37.971 13.160 127.459 1.00 66.67 ? 139 ASP B CG    1 
ATOM   3654 O OD1   . ASP B 1 139 ? 38.320 12.273 126.629 1.00 69.38 ? 139 ASP B OD1   1 
ATOM   3655 O OD2   . ASP B 1 139 ? 38.773 13.644 128.307 1.00 70.07 ? 139 ASP B OD2   1 
ATOM   3656 N N     . ASP B 1 140 ? 38.497 15.995 128.120 1.00 65.08 ? 140 ASP B N     1 
ATOM   3657 C CA    . ASP B 1 140 ? 39.587 16.810 127.563 1.00 65.02 ? 140 ASP B CA    1 
ATOM   3658 C C     . ASP B 1 140 ? 39.605 16.574 126.057 1.00 64.93 ? 140 ASP B C     1 
ATOM   3659 O O     . ASP B 1 140 ? 39.801 15.496 125.575 1.00 64.34 ? 140 ASP B O     1 
ATOM   3660 C CB    . ASP B 1 140 ? 40.940 16.484 128.253 1.00 65.11 ? 140 ASP B CB    1 
ATOM   3661 C CG    . ASP B 1 140 ? 42.132 17.392 127.771 1.00 66.12 ? 140 ASP B CG    1 
ATOM   3662 O OD1   . ASP B 1 140 ? 42.933 17.885 128.644 1.00 63.21 ? 140 ASP B OD1   1 
ATOM   3663 O OD2   . ASP B 1 140 ? 42.267 17.583 126.519 1.00 69.08 ? 140 ASP B OD2   1 
ATOM   3664 N N     . ALA B 1 141 ? 39.365 17.623 125.310 1.00 66.23 ? 141 ALA B N     1 
ATOM   3665 C CA    . ALA B 1 141 ? 39.144 17.488 123.888 1.00 66.63 ? 141 ALA B CA    1 
ATOM   3666 C C     . ALA B 1 141 ? 40.396 16.988 123.253 1.00 67.02 ? 141 ALA B C     1 
ATOM   3667 O O     . ALA B 1 141 ? 40.422 16.698 122.063 1.00 66.70 ? 141 ALA B O     1 
ATOM   3668 C CB    . ALA B 1 141 ? 38.741 18.822 123.275 1.00 66.59 ? 141 ALA B CB    1 
ATOM   3669 N N     . ARG B 1 142 ? 41.461 16.904 124.023 1.00 67.53 ? 142 ARG B N     1 
ATOM   3670 C CA    . ARG B 1 142 ? 42.630 16.426 123.359 1.00 68.97 ? 142 ARG B CA    1 
ATOM   3671 C C     . ARG B 1 142 ? 42.694 14.898 123.353 1.00 69.63 ? 142 ARG B C     1 
ATOM   3672 O O     . ARG B 1 142 ? 43.000 14.295 122.320 1.00 68.98 ? 142 ARG B O     1 
ATOM   3673 C CB    . ARG B 1 142 ? 43.886 17.055 123.885 1.00 68.74 ? 142 ARG B CB    1 
ATOM   3674 C CG    . ARG B 1 142 ? 44.900 16.961 122.806 1.00 68.17 ? 142 ARG B CG    1 
ATOM   3675 C CD    . ARG B 1 142 ? 46.266 17.245 123.307 1.00 67.32 ? 142 ARG B CD    1 
ATOM   3676 N NE    . ARG B 1 142 ? 47.137 17.060 122.175 1.00 64.95 ? 142 ARG B NE    1 
ATOM   3677 C CZ    . ARG B 1 142 ? 48.356 17.539 122.095 1.00 65.38 ? 142 ARG B CZ    1 
ATOM   3678 N NH1   . ARG B 1 142 ? 48.854 18.255 123.109 1.00 65.27 ? 142 ARG B NH1   1 
ATOM   3679 N NH2   . ARG B 1 142 ? 49.051 17.309 120.988 1.00 63.91 ? 142 ARG B NH2   1 
ATOM   3680 N N     . ALA B 1 143 ? 42.386 14.314 124.519 1.00 70.60 ? 143 ALA B N     1 
ATOM   3681 C CA    . ALA B 1 143 ? 42.026 12.897 124.675 1.00 70.89 ? 143 ALA B CA    1 
ATOM   3682 C C     . ALA B 1 143 ? 40.963 12.448 123.683 1.00 71.28 ? 143 ALA B C     1 
ATOM   3683 O O     . ALA B 1 143 ? 41.191 11.468 122.968 1.00 72.25 ? 143 ALA B O     1 
ATOM   3684 C CB    . ALA B 1 143 ? 41.556 12.598 126.113 1.00 70.86 ? 143 ALA B CB    1 
ATOM   3685 N N     . TYR B 1 144 ? 39.830 13.154 123.601 1.00 71.24 ? 144 TYR B N     1 
ATOM   3686 C CA    . TYR B 1 144 ? 38.785 12.742 122.675 1.00 71.28 ? 144 TYR B CA    1 
ATOM   3687 C C     . TYR B 1 144 ? 39.270 12.548 121.237 1.00 71.38 ? 144 TYR B C     1 
ATOM   3688 O O     . TYR B 1 144 ? 39.327 11.420 120.783 1.00 71.09 ? 144 TYR B O     1 
ATOM   3689 C CB    . TYR B 1 144 ? 37.573 13.646 122.722 1.00 71.60 ? 144 TYR B CB    1 
ATOM   3690 C CG    . TYR B 1 144 ? 36.544 13.310 121.660 1.00 71.97 ? 144 TYR B CG    1 
ATOM   3691 C CD1   . TYR B 1 144 ? 36.637 13.848 120.347 1.00 71.96 ? 144 TYR B CD1   1 
ATOM   3692 C CD2   . TYR B 1 144 ? 35.471 12.477 121.954 1.00 72.06 ? 144 TYR B CD2   1 
ATOM   3693 C CE1   . TYR B 1 144 ? 35.699 13.538 119.347 1.00 71.83 ? 144 TYR B CE1   1 
ATOM   3694 C CE2   . TYR B 1 144 ? 34.495 12.180 120.968 1.00 74.46 ? 144 TYR B CE2   1 
ATOM   3695 C CZ    . TYR B 1 144 ? 34.618 12.707 119.659 1.00 74.16 ? 144 TYR B CZ    1 
ATOM   3696 O OH    . TYR B 1 144 ? 33.637 12.398 118.705 1.00 74.58 ? 144 TYR B OH    1 
ATOM   3697 N N     . LEU B 1 145 ? 39.615 13.624 120.528 1.00 72.10 ? 145 LEU B N     1 
ATOM   3698 C CA    . LEU B 1 145 ? 39.946 13.522 119.083 1.00 73.18 ? 145 LEU B CA    1 
ATOM   3699 C C     . LEU B 1 145 ? 41.247 12.708 118.810 1.00 74.42 ? 145 LEU B C     1 
ATOM   3700 O O     . LEU B 1 145 ? 41.541 12.299 117.673 1.00 74.84 ? 145 LEU B O     1 
ATOM   3701 C CB    . LEU B 1 145 ? 39.899 14.887 118.355 1.00 72.87 ? 145 LEU B CB    1 
ATOM   3702 C CG    . LEU B 1 145 ? 40.149 16.191 119.121 1.00 73.10 ? 145 LEU B CG    1 
ATOM   3703 C CD1   . LEU B 1 145 ? 41.062 15.919 120.294 1.00 74.57 ? 145 LEU B CD1   1 
ATOM   3704 C CD2   . LEU B 1 145 ? 40.753 17.320 118.245 1.00 72.19 ? 145 LEU B CD2   1 
ATOM   3705 N N     . GLU B 1 146 ? 41.990 12.446 119.883 1.00 75.03 ? 146 GLU B N     1 
ATOM   3706 C CA    . GLU B 1 146 ? 43.055 11.445 119.896 1.00 75.36 ? 146 GLU B CA    1 
ATOM   3707 C C     . GLU B 1 146 ? 42.528 9.995  120.080 1.00 75.91 ? 146 GLU B C     1 
ATOM   3708 O O     . GLU B 1 146 ? 43.012 9.072  119.395 1.00 76.10 ? 146 GLU B O     1 
ATOM   3709 C CB    . GLU B 1 146 ? 43.975 11.780 121.042 1.00 74.89 ? 146 GLU B CB    1 
ATOM   3710 C CG    . GLU B 1 146 ? 45.389 11.376 120.847 1.00 75.36 ? 146 GLU B CG    1 
ATOM   3711 C CD    . GLU B 1 146 ? 46.333 12.396 121.449 1.00 75.83 ? 146 GLU B CD    1 
ATOM   3712 O OE1   . GLU B 1 146 ? 47.149 12.915 120.659 1.00 75.30 ? 146 GLU B OE1   1 
ATOM   3713 O OE2   . GLU B 1 146 ? 46.244 12.703 122.679 1.00 74.78 ? 146 GLU B OE2   1 
ATOM   3714 N N     . ARG B 1 147 ? 41.573 9.820  121.018 1.00 75.56 ? 147 ARG B N     1 
ATOM   3715 C CA    . ARG B 1 147 ? 40.886 8.538  121.339 1.00 75.48 ? 147 ARG B CA    1 
ATOM   3716 C C     . ARG B 1 147 ? 39.821 8.097  120.272 1.00 75.78 ? 147 ARG B C     1 
ATOM   3717 O O     . ARG B 1 147 ? 39.219 7.011  120.402 1.00 75.37 ? 147 ARG B O     1 
ATOM   3718 C CB    . ARG B 1 147 ? 40.313 8.593  122.800 1.00 75.18 ? 147 ARG B CB    1 
ATOM   3719 C CG    . ARG B 1 147 ? 39.178 7.588  123.200 1.00 75.35 ? 147 ARG B CG    1 
ATOM   3720 C CD    . ARG B 1 147 ? 37.716 8.172  123.187 1.00 74.12 ? 147 ARG B CD    1 
ATOM   3721 N NE    . ARG B 1 147 ? 37.438 9.220  124.206 1.00 72.89 ? 147 ARG B NE    1 
ATOM   3722 C CZ    . ARG B 1 147 ? 36.224 9.715  124.501 1.00 72.63 ? 147 ARG B CZ    1 
ATOM   3723 N NH1   . ARG B 1 147 ? 35.128 9.273  123.890 1.00 73.21 ? 147 ARG B NH1   1 
ATOM   3724 N NH2   . ARG B 1 147 ? 36.085 10.658 125.419 1.00 70.49 ? 147 ARG B NH2   1 
ATOM   3725 N N     . THR B 1 148 ? 39.614 8.931  119.230 1.00 75.67 ? 148 THR B N     1 
ATOM   3726 C CA    . THR B 1 148 ? 38.698 8.629  118.108 1.00 75.04 ? 148 THR B CA    1 
ATOM   3727 C C     . THR B 1 148 ? 39.356 8.820  116.725 1.00 74.77 ? 148 THR B C     1 
ATOM   3728 O O     . THR B 1 148 ? 40.369 9.523  116.591 1.00 74.34 ? 148 THR B O     1 
ATOM   3729 C CB    . THR B 1 148 ? 37.380 9.441  118.185 1.00 74.89 ? 148 THR B CB    1 
ATOM   3730 O OG1   . THR B 1 148 ? 36.457 9.002  117.163 1.00 74.36 ? 148 THR B OG1   1 
ATOM   3731 C CG2   . THR B 1 148 ? 37.675 10.915 118.004 1.00 74.99 ? 148 THR B CG2   1 
ATOM   3732 N N     . GLU B 1 149 ? 38.766 8.166  115.722 1.00 74.27 ? 149 GLU B N     1 
ATOM   3733 C CA    . GLU B 1 149 ? 39.092 8.376  114.293 1.00 74.36 ? 149 GLU B CA    1 
ATOM   3734 C C     . GLU B 1 149 ? 37.922 9.090  113.537 1.00 73.30 ? 149 GLU B C     1 
ATOM   3735 O O     . GLU B 1 149 ? 37.912 9.187  112.290 1.00 73.40 ? 149 GLU B O     1 
ATOM   3736 C CB    . GLU B 1 149 ? 39.569 7.056  113.568 1.00 74.35 ? 149 GLU B CB    1 
ATOM   3737 C CG    . GLU B 1 149 ? 38.552 5.830  113.467 1.00 75.03 ? 149 GLU B CG    1 
ATOM   3738 C CD    . GLU B 1 149 ? 38.776 4.878  112.222 1.00 75.99 ? 149 GLU B CD    1 
ATOM   3739 O OE1   . GLU B 1 149 ? 39.001 5.398  111.098 1.00 78.87 ? 149 GLU B OE1   1 
ATOM   3740 O OE2   . GLU B 1 149 ? 38.685 3.615  112.340 1.00 76.40 ? 149 GLU B OE2   1 
ATOM   3741 N N     . GLU B 1 150 ? 36.945 9.600  114.288 1.00 71.59 ? 150 GLU B N     1 
ATOM   3742 C CA    . GLU B 1 150 ? 35.866 10.363 113.668 1.00 69.83 ? 150 GLU B CA    1 
ATOM   3743 C C     . GLU B 1 150 ? 36.378 11.567 112.772 1.00 69.03 ? 150 GLU B C     1 
ATOM   3744 O O     . GLU B 1 150 ? 37.415 12.202 113.070 1.00 68.15 ? 150 GLU B O     1 
ATOM   3745 C CB    . GLU B 1 150 ? 34.865 10.792 114.759 1.00 70.17 ? 150 GLU B CB    1 
ATOM   3746 C CG    . GLU B 1 150 ? 33.449 11.058 114.261 1.00 70.97 ? 150 GLU B CG    1 
ATOM   3747 C CD    . GLU B 1 150 ? 32.447 11.058 115.398 1.00 75.62 ? 150 GLU B CD    1 
ATOM   3748 O OE1   . GLU B 1 150 ? 31.478 11.874 115.361 1.00 72.78 ? 150 GLU B OE1   1 
ATOM   3749 O OE2   . GLU B 1 150 ? 32.651 10.234 116.344 1.00 78.69 ? 150 GLU B OE2   1 
ATOM   3750 N N     . ARG B 1 151 ? 35.638 11.870 111.699 1.00 67.69 ? 151 ARG B N     1 
ATOM   3751 C CA    . ARG B 1 151 ? 35.984 12.947 110.713 1.00 66.93 ? 151 ARG B CA    1 
ATOM   3752 C C     . ARG B 1 151 ? 35.095 14.206 110.836 1.00 66.16 ? 151 ARG B C     1 
ATOM   3753 O O     . ARG B 1 151 ? 33.911 14.077 111.210 1.00 66.55 ? 151 ARG B O     1 
ATOM   3754 C CB    . ARG B 1 151 ? 35.725 12.415 109.301 1.00 67.21 ? 151 ARG B CB    1 
ATOM   3755 C CG    . ARG B 1 151 ? 36.624 11.336 108.804 1.00 68.83 ? 151 ARG B CG    1 
ATOM   3756 C CD    . ARG B 1 151 ? 37.486 11.919 107.668 1.00 71.36 ? 151 ARG B CD    1 
ATOM   3757 N NE    . ARG B 1 151 ? 38.819 11.317 107.632 1.00 74.99 ? 151 ARG B NE    1 
ATOM   3758 C CZ    . ARG B 1 151 ? 39.736 11.384 108.615 1.00 76.01 ? 151 ARG B CZ    1 
ATOM   3759 N NH1   . ARG B 1 151 ? 39.500 12.013 109.771 1.00 75.84 ? 151 ARG B NH1   1 
ATOM   3760 N NH2   . ARG B 1 151 ? 40.904 10.786 108.451 1.00 76.23 ? 151 ARG B NH2   1 
ATOM   3761 N N     . TYR B 1 152 ? 35.589 15.401 110.465 1.00 64.39 ? 152 TYR B N     1 
ATOM   3762 C CA    . TYR B 1 152 ? 34.695 16.634 110.462 1.00 62.90 ? 152 TYR B CA    1 
ATOM   3763 C C     . TYR B 1 152 ? 34.820 17.585 109.230 1.00 60.39 ? 152 TYR B C     1 
ATOM   3764 O O     . TYR B 1 152 ? 35.877 17.606 108.571 1.00 61.04 ? 152 TYR B O     1 
ATOM   3765 C CB    . TYR B 1 152 ? 34.837 17.411 111.770 1.00 62.05 ? 152 TYR B CB    1 
ATOM   3766 C CG    . TYR B 1 152 ? 34.650 16.520 112.993 1.00 62.61 ? 152 TYR B CG    1 
ATOM   3767 C CD1   . TYR B 1 152 ? 35.752 16.010 113.732 1.00 61.95 ? 152 TYR B CD1   1 
ATOM   3768 C CD2   . TYR B 1 152 ? 33.371 16.171 113.405 1.00 62.08 ? 152 TYR B CD2   1 
ATOM   3769 C CE1   . TYR B 1 152 ? 35.544 15.176 114.878 1.00 60.73 ? 152 TYR B CE1   1 
ATOM   3770 C CE2   . TYR B 1 152 ? 33.152 15.350 114.508 1.00 62.96 ? 152 TYR B CE2   1 
ATOM   3771 C CZ    . TYR B 1 152 ? 34.219 14.850 115.242 1.00 61.99 ? 152 TYR B CZ    1 
ATOM   3772 O OH    . TYR B 1 152 ? 33.874 14.036 116.312 1.00 62.76 ? 152 TYR B OH    1 
ATOM   3773 N N     . ASP B 1 153 ? 33.752 18.325 108.896 1.00 56.65 ? 153 ASP B N     1 
ATOM   3774 C CA    . ASP B 1 153 ? 33.857 19.408 107.891 1.00 54.13 ? 153 ASP B CA    1 
ATOM   3775 C C     . ASP B 1 153 ? 34.357 20.722 108.548 1.00 50.95 ? 153 ASP B C     1 
ATOM   3776 O O     . ASP B 1 153 ? 35.291 21.353 108.042 1.00 51.62 ? 153 ASP B O     1 
ATOM   3777 C CB    . ASP B 1 153 ? 32.535 19.667 107.126 1.00 54.49 ? 153 ASP B CB    1 
ATOM   3778 C CG    . ASP B 1 153 ? 32.024 18.436 106.365 1.00 57.08 ? 153 ASP B CG    1 
ATOM   3779 O OD1   . ASP B 1 153 ? 32.836 17.910 105.572 1.00 59.70 ? 153 ASP B OD1   1 
ATOM   3780 O OD2   . ASP B 1 153 ? 30.817 18.028 106.512 1.00 57.70 ? 153 ASP B OD2   1 
ATOM   3781 N N     . VAL B 1 154 ? 33.738 21.138 109.651 1.00 46.21 ? 154 VAL B N     1 
ATOM   3782 C CA    . VAL B 1 154 ? 34.165 22.337 110.379 1.00 42.31 ? 154 VAL B CA    1 
ATOM   3783 C C     . VAL B 1 154 ? 34.565 21.964 111.803 1.00 41.33 ? 154 VAL B C     1 
ATOM   3784 O O     . VAL B 1 154 ? 33.824 21.258 112.500 1.00 40.80 ? 154 VAL B O     1 
ATOM   3785 C CB    . VAL B 1 154 ? 33.025 23.360 110.476 1.00 42.04 ? 154 VAL B CB    1 
ATOM   3786 C CG1   . VAL B 1 154 ? 33.437 24.512 111.397 1.00 39.95 ? 154 VAL B CG1   1 
ATOM   3787 C CG2   . VAL B 1 154 ? 32.569 23.821 109.100 1.00 37.63 ? 154 VAL B CG2   1 
ATOM   3788 N N     . VAL B 1 155 ? 35.736 22.389 112.246 1.00 39.77 ? 155 VAL B N     1 
ATOM   3789 C CA    . VAL B 1 155 ? 35.974 22.432 113.696 1.00 38.80 ? 155 VAL B CA    1 
ATOM   3790 C C     . VAL B 1 155 ? 35.778 23.887 114.116 1.00 38.79 ? 155 VAL B C     1 
ATOM   3791 O O     . VAL B 1 155 ? 35.919 24.828 113.285 1.00 39.83 ? 155 VAL B O     1 
ATOM   3792 C CB    . VAL B 1 155 ? 37.394 22.058 114.075 1.00 39.58 ? 155 VAL B CB    1 
ATOM   3793 C CG1   . VAL B 1 155 ? 37.506 21.840 115.639 1.00 40.29 ? 155 VAL B CG1   1 
ATOM   3794 C CG2   . VAL B 1 155 ? 37.860 20.830 113.284 1.00 38.82 ? 155 VAL B CG2   1 
ATOM   3795 N N     . ILE B 1 156 ? 35.416 24.090 115.391 1.00 37.31 ? 156 ILE B N     1 
ATOM   3796 C CA    . ILE B 1 156 ? 35.312 25.439 115.970 1.00 33.00 ? 156 ILE B CA    1 
ATOM   3797 C C     . ILE B 1 156 ? 35.833 25.320 117.353 1.00 33.32 ? 156 ILE B C     1 
ATOM   3798 O O     . ILE B 1 156 ? 35.297 24.548 118.159 1.00 31.07 ? 156 ILE B O     1 
ATOM   3799 C CB    . ILE B 1 156 ? 33.908 25.973 116.083 1.00 31.96 ? 156 ILE B CB    1 
ATOM   3800 C CG1   . ILE B 1 156 ? 33.233 26.191 114.712 1.00 29.08 ? 156 ILE B CG1   1 
ATOM   3801 C CG2   . ILE B 1 156 ? 33.944 27.252 116.967 1.00 30.48 ? 156 ILE B CG2   1 
ATOM   3802 C CD1   . ILE B 1 156 ? 33.923 27.233 113.776 1.00 23.72 ? 156 ILE B CD1   1 
ATOM   3803 N N     . ILE B 1 157 ? 36.879 26.104 117.605 1.00 33.46 ? 157 ILE B N     1 
ATOM   3804 C CA    . ILE B 1 157 ? 37.653 25.998 118.801 1.00 33.97 ? 157 ILE B CA    1 
ATOM   3805 C C     . ILE B 1 157 ? 37.353 27.181 119.696 1.00 34.75 ? 157 ILE B C     1 
ATOM   3806 O O     . ILE B 1 157 ? 37.840 28.287 119.443 1.00 34.29 ? 157 ILE B O     1 
ATOM   3807 C CB    . ILE B 1 157 ? 39.069 25.939 118.367 1.00 33.76 ? 157 ILE B CB    1 
ATOM   3808 C CG1   . ILE B 1 157 ? 39.199 24.616 117.612 1.00 34.09 ? 157 ILE B CG1   1 
ATOM   3809 C CG2   . ILE B 1 157 ? 40.038 25.971 119.559 1.00 35.28 ? 157 ILE B CG2   1 
ATOM   3810 C CD1   . ILE B 1 157 ? 40.369 24.482 116.949 1.00 29.51 ? 157 ILE B CD1   1 
ATOM   3811 N N     . ASP B 1 158 ? 36.490 26.960 120.686 1.00 35.40 ? 158 ASP B N     1 
ATOM   3812 C CA    . ASP B 1 158 ? 35.933 28.075 121.442 1.00 38.03 ? 158 ASP B CA    1 
ATOM   3813 C C     . ASP B 1 158 ? 36.530 27.950 122.779 1.00 38.89 ? 158 ASP B C     1 
ATOM   3814 O O     . ASP B 1 158 ? 35.852 27.710 123.778 1.00 38.76 ? 158 ASP B O     1 
ATOM   3815 C CB    . ASP B 1 158 ? 34.393 28.028 121.555 1.00 38.06 ? 158 ASP B CB    1 
ATOM   3816 C CG    . ASP B 1 158 ? 33.824 29.187 122.401 1.00 40.41 ? 158 ASP B CG    1 
ATOM   3817 O OD1   . ASP B 1 158 ? 32.671 29.099 122.890 1.00 43.13 ? 158 ASP B OD1   1 
ATOM   3818 O OD2   . ASP B 1 158 ? 34.540 30.195 122.588 1.00 37.99 ? 158 ASP B OD2   1 
ATOM   3819 N N     . LEU B 1 159 ? 37.829 28.059 122.804 1.00 41.25 ? 159 LEU B N     1 
ATOM   3820 C CA    . LEU B 1 159 ? 38.488 27.675 124.023 1.00 43.94 ? 159 LEU B CA    1 
ATOM   3821 C C     . LEU B 1 159 ? 38.648 28.868 124.908 1.00 45.14 ? 159 LEU B C     1 
ATOM   3822 O O     . LEU B 1 159 ? 37.700 29.536 125.188 1.00 46.11 ? 159 LEU B O     1 
ATOM   3823 C CB    . LEU B 1 159 ? 39.802 26.993 123.701 1.00 44.04 ? 159 LEU B CB    1 
ATOM   3824 C CG    . LEU B 1 159 ? 39.676 25.501 123.721 1.00 44.49 ? 159 LEU B CG    1 
ATOM   3825 C CD1   . LEU B 1 159 ? 40.929 24.959 123.091 1.00 44.56 ? 159 LEU B CD1   1 
ATOM   3826 C CD2   . LEU B 1 159 ? 39.589 25.123 125.192 1.00 42.31 ? 159 LEU B CD2   1 
ATOM   3827 N N     . THR B 1 160 ? 39.848 29.134 125.362 1.00 47.57 ? 160 THR B N     1 
ATOM   3828 C CA    . THR B 1 160 ? 40.077 30.253 126.227 1.00 49.97 ? 160 THR B CA    1 
ATOM   3829 C C     . THR B 1 160 ? 41.559 30.483 126.305 1.00 51.79 ? 160 THR B C     1 
ATOM   3830 O O     . THR B 1 160 ? 42.307 29.535 126.290 1.00 51.45 ? 160 THR B O     1 
ATOM   3831 C CB    . THR B 1 160 ? 39.558 30.026 127.657 1.00 50.09 ? 160 THR B CB    1 
ATOM   3832 O OG1   . THR B 1 160 ? 40.354 30.858 128.519 1.00 49.95 ? 160 THR B OG1   1 
ATOM   3833 C CG2   . THR B 1 160 ? 39.658 28.556 128.080 1.00 47.31 ? 160 THR B CG2   1 
ATOM   3834 N N     . ASP B 1 161 ? 41.976 31.743 126.399 1.00 55.24 ? 161 ASP B N     1 
ATOM   3835 C CA    . ASP B 1 161 ? 43.395 32.112 126.358 1.00 57.90 ? 161 ASP B CA    1 
ATOM   3836 C C     . ASP B 1 161 ? 43.977 31.237 127.452 1.00 59.19 ? 161 ASP B C     1 
ATOM   3837 O O     . ASP B 1 161 ? 43.302 31.048 128.446 1.00 60.20 ? 161 ASP B O     1 
ATOM   3838 C CB    . ASP B 1 161 ? 43.564 33.621 126.630 1.00 58.09 ? 161 ASP B CB    1 
ATOM   3839 C CG    . ASP B 1 161 ? 42.754 34.518 125.626 1.00 61.01 ? 161 ASP B CG    1 
ATOM   3840 O OD1   . ASP B 1 161 ? 43.195 35.675 125.349 1.00 64.06 ? 161 ASP B OD1   1 
ATOM   3841 O OD2   . ASP B 1 161 ? 41.667 34.089 125.116 1.00 60.95 ? 161 ASP B OD2   1 
ATOM   3842 N N     . PRO B 1 162 ? 45.183 30.639 127.263 1.00 60.46 ? 162 PRO B N     1 
ATOM   3843 C CA    . PRO B 1 162 ? 45.596 29.566 128.167 1.00 61.33 ? 162 PRO B CA    1 
ATOM   3844 C C     . PRO B 1 162 ? 46.565 30.084 129.216 1.00 63.00 ? 162 PRO B C     1 
ATOM   3845 O O     . PRO B 1 162 ? 47.770 29.911 129.089 1.00 63.65 ? 162 PRO B O     1 
ATOM   3846 C CB    . PRO B 1 162 ? 46.337 28.630 127.225 1.00 61.04 ? 162 PRO B CB    1 
ATOM   3847 C CG    . PRO B 1 162 ? 46.956 29.570 126.194 1.00 60.19 ? 162 PRO B CG    1 
ATOM   3848 C CD    . PRO B 1 162 ? 46.228 30.894 126.256 1.00 59.92 ? 162 PRO B CD    1 
ATOM   3849 N N     . VAL B 1 163 ? 46.066 30.713 130.254 1.00 64.83 ? 163 VAL B N     1 
ATOM   3850 C CA    . VAL B 1 163 ? 46.970 31.475 131.071 1.00 67.07 ? 163 VAL B CA    1 
ATOM   3851 C C     . VAL B 1 163 ? 47.793 30.615 132.073 1.00 68.78 ? 163 VAL B C     1 
ATOM   3852 O O     . VAL B 1 163 ? 47.275 29.629 132.618 1.00 68.63 ? 163 VAL B O     1 
ATOM   3853 C CB    . VAL B 1 163 ? 46.212 32.619 131.769 1.00 67.43 ? 163 VAL B CB    1 
ATOM   3854 C CG1   . VAL B 1 163 ? 47.205 33.689 132.305 1.00 67.21 ? 163 VAL B CG1   1 
ATOM   3855 C CG2   . VAL B 1 163 ? 45.161 33.231 130.808 1.00 66.30 ? 163 VAL B CG2   1 
ATOM   3856 N N     . GLY B 1 164 ? 49.081 30.979 132.242 1.00 70.42 ? 164 GLY B N     1 
ATOM   3857 C CA    . GLY B 1 164 ? 49.960 30.502 133.329 1.00 72.10 ? 164 GLY B CA    1 
ATOM   3858 C C     . GLY B 1 164 ? 50.639 29.177 133.060 1.00 73.43 ? 164 GLY B C     1 
ATOM   3859 O O     . GLY B 1 164 ? 50.105 28.342 132.309 1.00 73.78 ? 164 GLY B O     1 
ATOM   3860 N N     . GLU B 1 165 ? 51.802 28.971 133.679 1.00 74.41 ? 165 GLU B N     1 
ATOM   3861 C CA    . GLU B 1 165 ? 52.590 27.737 133.459 1.00 75.80 ? 165 GLU B CA    1 
ATOM   3862 C C     . GLU B 1 165 ? 51.762 26.493 133.730 1.00 76.01 ? 165 GLU B C     1 
ATOM   3863 O O     . GLU B 1 165 ? 51.605 25.603 132.852 1.00 75.78 ? 165 GLU B O     1 
ATOM   3864 C CB    . GLU B 1 165 ? 53.868 27.693 134.328 1.00 76.28 ? 165 GLU B CB    1 
ATOM   3865 C CG    . GLU B 1 165 ? 55.043 26.888 133.686 1.00 77.63 ? 165 GLU B CG    1 
ATOM   3866 C CD    . GLU B 1 165 ? 56.431 27.579 133.875 1.00 79.87 ? 165 GLU B CD    1 
ATOM   3867 O OE1   . GLU B 1 165 ? 56.536 28.421 134.807 1.00 82.05 ? 165 GLU B OE1   1 
ATOM   3868 O OE2   . GLU B 1 165 ? 57.410 27.292 133.121 1.00 76.48 ? 165 GLU B OE2   1 
ATOM   3869 N N     . ASP B 1 166 ? 51.237 26.436 134.952 1.00 76.25 ? 166 ASP B N     1 
ATOM   3870 C CA    . ASP B 1 166 ? 50.446 25.286 135.341 1.00 76.76 ? 166 ASP B CA    1 
ATOM   3871 C C     . ASP B 1 166 ? 48.976 25.308 134.808 1.00 76.83 ? 166 ASP B C     1 
ATOM   3872 O O     . ASP B 1 166 ? 48.111 26.119 135.265 1.00 76.57 ? 166 ASP B O     1 
ATOM   3873 C CB    . ASP B 1 166 ? 50.538 25.042 136.847 1.00 77.25 ? 166 ASP B CB    1 
ATOM   3874 C CG    . ASP B 1 166 ? 49.793 23.784 137.272 1.00 77.15 ? 166 ASP B CG    1 
ATOM   3875 O OD1   . ASP B 1 166 ? 49.623 22.833 136.459 1.00 78.00 ? 166 ASP B OD1   1 
ATOM   3876 O OD2   . ASP B 1 166 ? 49.360 23.766 138.429 1.00 77.15 ? 166 ASP B OD2   1 
ATOM   3877 N N     . ASN B 1 167 ? 48.741 24.403 133.838 1.00 76.09 ? 167 ASN B N     1 
ATOM   3878 C CA    . ASN B 1 167 ? 47.490 24.296 133.040 1.00 75.23 ? 167 ASN B CA    1 
ATOM   3879 C C     . ASN B 1 167 ? 47.625 23.184 131.976 1.00 74.96 ? 167 ASN B C     1 
ATOM   3880 O O     . ASN B 1 167 ? 48.375 23.358 131.010 1.00 74.54 ? 167 ASN B O     1 
ATOM   3881 C CB    . ASN B 1 167 ? 47.119 25.640 132.350 1.00 74.89 ? 167 ASN B CB    1 
ATOM   3882 C CG    . ASN B 1 167 ? 45.629 25.722 131.965 1.00 74.23 ? 167 ASN B CG    1 
ATOM   3883 O OD1   . ASN B 1 167 ? 45.036 26.792 132.020 1.00 73.94 ? 167 ASN B OD1   1 
ATOM   3884 N ND2   . ASN B 1 167 ? 45.030 24.596 131.592 1.00 70.84 ? 167 ASN B ND2   1 
ATOM   3885 N N     . PRO B 1 168 ? 46.947 22.016 132.180 1.00 74.66 ? 168 PRO B N     1 
ATOM   3886 C CA    . PRO B 1 168 ? 46.865 20.958 131.092 1.00 73.58 ? 168 PRO B CA    1 
ATOM   3887 C C     . PRO B 1 168 ? 46.287 21.418 129.708 1.00 72.24 ? 168 PRO B C     1 
ATOM   3888 O O     . PRO B 1 168 ? 46.275 20.614 128.763 1.00 71.39 ? 168 PRO B O     1 
ATOM   3889 C CB    . PRO B 1 168 ? 46.001 19.813 131.727 1.00 74.38 ? 168 PRO B CB    1 
ATOM   3890 C CG    . PRO B 1 168 ? 45.364 20.426 133.007 1.00 74.47 ? 168 PRO B CG    1 
ATOM   3891 C CD    . PRO B 1 168 ? 46.283 21.583 133.438 1.00 74.58 ? 168 PRO B CD    1 
ATOM   3892 N N     . ALA B 1 169 ? 45.867 22.699 129.613 1.00 70.73 ? 169 ALA B N     1 
ATOM   3893 C CA    . ALA B 1 169 ? 45.105 23.272 128.460 1.00 69.21 ? 169 ALA B CA    1 
ATOM   3894 C C     . ALA B 1 169 ? 45.962 24.180 127.521 1.00 66.90 ? 169 ALA B C     1 
ATOM   3895 O O     . ALA B 1 169 ? 45.512 24.568 126.406 1.00 65.46 ? 169 ALA B O     1 
ATOM   3896 C CB    . ALA B 1 169 ? 43.831 23.991 128.958 1.00 68.33 ? 169 ALA B CB    1 
ATOM   3897 N N     . ARG B 1 170 ? 47.197 24.492 127.977 1.00 64.95 ? 170 ARG B N     1 
ATOM   3898 C CA    . ARG B 1 170 ? 48.290 24.964 127.092 1.00 62.44 ? 170 ARG B CA    1 
ATOM   3899 C C     . ARG B 1 170 ? 48.588 23.912 126.037 1.00 60.92 ? 170 ARG B C     1 
ATOM   3900 O O     . ARG B 1 170 ? 49.236 24.221 125.058 1.00 60.49 ? 170 ARG B O     1 
ATOM   3901 C CB    . ARG B 1 170 ? 49.624 25.199 127.803 1.00 61.95 ? 170 ARG B CB    1 
ATOM   3902 C CG    . ARG B 1 170 ? 49.634 25.602 129.234 1.00 61.77 ? 170 ARG B CG    1 
ATOM   3903 C CD    . ARG B 1 170 ? 51.004 25.191 129.887 1.00 62.80 ? 170 ARG B CD    1 
ATOM   3904 N NE    . ARG B 1 170 ? 52.236 25.606 129.166 1.00 62.62 ? 170 ARG B NE    1 
ATOM   3905 C CZ    . ARG B 1 170 ? 53.468 25.615 129.709 1.00 60.92 ? 170 ARG B CZ    1 
ATOM   3906 N NH1   . ARG B 1 170 ? 54.532 26.020 129.006 1.00 52.61 ? 170 ARG B NH1   1 
ATOM   3907 N NH2   . ARG B 1 170 ? 53.614 25.225 130.983 1.00 62.13 ? 170 ARG B NH2   1 
ATOM   3908 N N     . LEU B 1 171 ? 48.171 22.666 126.288 1.00 59.50 ? 171 LEU B N     1 
ATOM   3909 C CA    . LEU B 1 171 ? 48.292 21.560 125.339 1.00 57.67 ? 171 LEU B CA    1 
ATOM   3910 C C     . LEU B 1 171 ? 47.214 21.649 124.269 1.00 57.10 ? 171 LEU B C     1 
ATOM   3911 O O     . LEU B 1 171 ? 47.156 20.791 123.358 1.00 58.20 ? 171 LEU B O     1 
ATOM   3912 C CB    . LEU B 1 171 ? 48.169 20.187 126.033 1.00 57.70 ? 171 LEU B CB    1 
ATOM   3913 C CG    . LEU B 1 171 ? 49.184 19.527 126.996 1.00 57.70 ? 171 LEU B CG    1 
ATOM   3914 C CD1   . LEU B 1 171 ? 49.009 17.938 127.264 1.00 53.11 ? 171 LEU B CD1   1 
ATOM   3915 C CD2   . LEU B 1 171 ? 50.606 19.888 126.539 1.00 57.27 ? 171 LEU B CD2   1 
ATOM   3916 N N     . LEU B 1 172 ? 46.354 22.668 124.352 1.00 55.08 ? 172 LEU B N     1 
ATOM   3917 C CA    . LEU B 1 172 ? 45.336 22.832 123.330 1.00 53.15 ? 172 LEU B CA    1 
ATOM   3918 C C     . LEU B 1 172 ? 45.743 23.957 122.442 1.00 51.39 ? 172 LEU B C     1 
ATOM   3919 O O     . LEU B 1 172 ? 45.008 24.380 121.588 1.00 51.07 ? 172 LEU B O     1 
ATOM   3920 C CB    . LEU B 1 172 ? 43.939 23.020 123.947 1.00 53.35 ? 172 LEU B CB    1 
ATOM   3921 C CG    . LEU B 1 172 ? 43.255 21.670 124.220 1.00 53.98 ? 172 LEU B CG    1 
ATOM   3922 C CD1   . LEU B 1 172 ? 43.684 21.098 125.604 1.00 56.21 ? 172 LEU B CD1   1 
ATOM   3923 C CD2   . LEU B 1 172 ? 41.763 21.639 124.077 1.00 51.59 ? 172 LEU B CD2   1 
ATOM   3924 N N     . TYR B 1 173 ? 46.954 24.421 122.662 1.00 50.17 ? 173 TYR B N     1 
ATOM   3925 C CA    . TYR B 1 173 ? 47.502 25.559 121.955 1.00 49.22 ? 173 TYR B CA    1 
ATOM   3926 C C     . TYR B 1 173 ? 48.805 25.246 121.149 1.00 50.11 ? 173 TYR B C     1 
ATOM   3927 O O     . TYR B 1 173 ? 49.684 26.108 120.977 1.00 50.83 ? 173 TYR B O     1 
ATOM   3928 C CB    . TYR B 1 173 ? 47.605 26.742 122.936 1.00 47.02 ? 173 TYR B CB    1 
ATOM   3929 C CG    . TYR B 1 173 ? 46.263 27.448 123.105 1.00 45.64 ? 173 TYR B CG    1 
ATOM   3930 C CD1   . TYR B 1 173 ? 45.282 26.946 123.986 1.00 45.53 ? 173 TYR B CD1   1 
ATOM   3931 C CD2   . TYR B 1 173 ? 45.926 28.575 122.312 1.00 43.57 ? 173 TYR B CD2   1 
ATOM   3932 C CE1   . TYR B 1 173 ? 43.978 27.587 124.111 1.00 46.76 ? 173 TYR B CE1   1 
ATOM   3933 C CE2   . TYR B 1 173 ? 44.643 29.222 122.422 1.00 44.06 ? 173 TYR B CE2   1 
ATOM   3934 C CZ    . TYR B 1 173 ? 43.672 28.727 123.325 1.00 46.03 ? 173 TYR B CZ    1 
ATOM   3935 O OH    . TYR B 1 173 ? 42.436 29.320 123.436 1.00 39.21 ? 173 TYR B OH    1 
ATOM   3936 N N     . THR B 1 174 ? 48.926 24.026 120.610 1.00 50.68 ? 174 THR B N     1 
ATOM   3937 C CA    . THR B 1 174 ? 50.135 23.686 119.853 1.00 50.36 ? 174 THR B CA    1 
ATOM   3938 C C     . THR B 1 174 ? 49.871 23.082 118.473 1.00 51.75 ? 174 THR B C     1 
ATOM   3939 O O     . THR B 1 174 ? 48.770 22.489 118.188 1.00 50.93 ? 174 THR B O     1 
ATOM   3940 C CB    . THR B 1 174 ? 51.003 22.718 120.599 1.00 49.96 ? 174 THR B CB    1 
ATOM   3941 O OG1   . THR B 1 174 ? 50.405 21.421 120.511 1.00 50.72 ? 174 THR B OG1   1 
ATOM   3942 C CG2   . THR B 1 174 ? 51.188 23.157 122.065 1.00 49.67 ? 174 THR B CG2   1 
ATOM   3943 N N     . VAL B 1 175 ? 50.910 23.187 117.636 1.00 51.90 ? 175 VAL B N     1 
ATOM   3944 C CA    . VAL B 1 175 ? 50.805 22.767 116.240 1.00 52.89 ? 175 VAL B CA    1 
ATOM   3945 C C     . VAL B 1 175 ? 50.560 21.290 116.089 1.00 53.39 ? 175 VAL B C     1 
ATOM   3946 O O     . VAL B 1 175 ? 50.178 20.822 114.995 1.00 52.07 ? 175 VAL B O     1 
ATOM   3947 C CB    . VAL B 1 175 ? 52.079 23.029 115.519 1.00 53.13 ? 175 VAL B CB    1 
ATOM   3948 C CG1   . VAL B 1 175 ? 51.936 24.265 114.662 1.00 53.50 ? 175 VAL B CG1   1 
ATOM   3949 C CG2   . VAL B 1 175 ? 53.223 23.081 116.510 1.00 50.71 ? 175 VAL B CG2   1 
ATOM   3950 N N     . GLU B 1 176 ? 50.844 20.562 117.181 1.00 53.72 ? 176 GLU B N     1 
ATOM   3951 C CA    . GLU B 1 176 ? 50.478 19.136 117.263 1.00 54.24 ? 176 GLU B CA    1 
ATOM   3952 C C     . GLU B 1 176 ? 49.010 18.984 117.605 1.00 54.70 ? 176 GLU B C     1 
ATOM   3953 O O     . GLU B 1 176 ? 48.317 18.169 116.970 1.00 55.01 ? 176 GLU B O     1 
ATOM   3954 C CB    . GLU B 1 176 ? 51.388 18.293 118.164 1.00 53.31 ? 176 GLU B CB    1 
ATOM   3955 C CG    . GLU B 1 176 ? 52.282 19.050 119.008 1.00 52.13 ? 176 GLU B CG    1 
ATOM   3956 C CD    . GLU B 1 176 ? 53.556 19.362 118.326 1.00 54.44 ? 176 GLU B CD    1 
ATOM   3957 O OE1   . GLU B 1 176 ? 54.537 19.617 119.046 1.00 55.15 ? 176 GLU B OE1   1 
ATOM   3958 O OE2   . GLU B 1 176 ? 53.595 19.371 117.072 1.00 54.40 ? 176 GLU B OE2   1 
ATOM   3959 N N     . PHE B 1 177 ? 48.519 19.803 118.537 1.00 54.74 ? 177 PHE B N     1 
ATOM   3960 C CA    . PHE B 1 177 ? 47.080 19.931 118.642 1.00 54.92 ? 177 PHE B CA    1 
ATOM   3961 C C     . PHE B 1 177 ? 46.374 20.411 117.327 1.00 54.97 ? 177 PHE B C     1 
ATOM   3962 O O     . PHE B 1 177 ? 45.375 19.807 116.896 1.00 54.87 ? 177 PHE B O     1 
ATOM   3963 C CB    . PHE B 1 177 ? 46.670 20.774 119.833 1.00 55.37 ? 177 PHE B CB    1 
ATOM   3964 C CG    . PHE B 1 177 ? 45.202 21.025 119.874 1.00 56.53 ? 177 PHE B CG    1 
ATOM   3965 C CD1   . PHE B 1 177 ? 44.665 22.179 119.303 1.00 56.91 ? 177 PHE B CD1   1 
ATOM   3966 C CD2   . PHE B 1 177 ? 44.341 20.070 120.395 1.00 57.30 ? 177 PHE B CD2   1 
ATOM   3967 C CE1   . PHE B 1 177 ? 43.304 22.394 119.300 1.00 55.58 ? 177 PHE B CE1   1 
ATOM   3968 C CE2   . PHE B 1 177 ? 42.987 20.277 120.394 1.00 57.98 ? 177 PHE B CE2   1 
ATOM   3969 C CZ    . PHE B 1 177 ? 42.471 21.450 119.844 1.00 56.59 ? 177 PHE B CZ    1 
ATOM   3970 N N     . TYR B 1 178 ? 46.870 21.460 116.666 1.00 54.77 ? 178 TYR B N     1 
ATOM   3971 C CA    . TYR B 1 178 ? 46.137 21.921 115.460 1.00 54.88 ? 178 TYR B CA    1 
ATOM   3972 C C     . TYR B 1 178 ? 46.246 20.903 114.310 1.00 55.53 ? 178 TYR B C     1 
ATOM   3973 O O     . TYR B 1 178 ? 45.333 20.740 113.485 1.00 53.87 ? 178 TYR B O     1 
ATOM   3974 C CB    . TYR B 1 178 ? 46.516 23.339 114.999 1.00 54.26 ? 178 TYR B CB    1 
ATOM   3975 C CG    . TYR B 1 178 ? 46.332 24.421 116.042 1.00 53.16 ? 178 TYR B CG    1 
ATOM   3976 C CD1   . TYR B 1 178 ? 47.430 25.235 116.424 1.00 54.36 ? 178 TYR B CD1   1 
ATOM   3977 C CD2   . TYR B 1 178 ? 45.106 24.618 116.686 1.00 50.92 ? 178 TYR B CD2   1 
ATOM   3978 C CE1   . TYR B 1 178 ? 47.314 26.246 117.410 1.00 53.58 ? 178 TYR B CE1   1 
ATOM   3979 C CE2   . TYR B 1 178 ? 44.971 25.642 117.688 1.00 53.94 ? 178 TYR B CE2   1 
ATOM   3980 C CZ    . TYR B 1 178 ? 46.078 26.449 118.039 1.00 53.54 ? 178 TYR B CZ    1 
ATOM   3981 O OH    . TYR B 1 178 ? 45.986 27.423 118.997 1.00 50.86 ? 178 TYR B OH    1 
ATOM   3982 N N     . ARG B 1 179 ? 47.374 20.185 114.298 1.00 56.92 ? 179 ARG B N     1 
ATOM   3983 C CA    . ARG B 1 179 ? 47.506 19.033 113.390 1.00 56.81 ? 179 ARG B CA    1 
ATOM   3984 C C     . ARG B 1 179 ? 46.450 17.968 113.696 1.00 57.17 ? 179 ARG B C     1 
ATOM   3985 O O     . ARG B 1 179 ? 45.829 17.448 112.737 1.00 57.07 ? 179 ARG B O     1 
ATOM   3986 C CB    . ARG B 1 179 ? 48.913 18.481 113.360 1.00 55.77 ? 179 ARG B CB    1 
ATOM   3987 C CG    . ARG B 1 179 ? 49.729 19.286 112.430 1.00 53.16 ? 179 ARG B CG    1 
ATOM   3988 C CD    . ARG B 1 179 ? 51.191 19.148 112.739 1.00 48.89 ? 179 ARG B CD    1 
ATOM   3989 N NE    . ARG B 1 179 ? 52.002 19.805 111.714 1.00 44.93 ? 179 ARG B NE    1 
ATOM   3990 C CZ    . ARG B 1 179 ? 53.246 20.267 111.892 1.00 42.66 ? 179 ARG B CZ    1 
ATOM   3991 N NH1   . ARG B 1 179 ? 53.882 20.831 110.858 1.00 39.27 ? 179 ARG B NH1   1 
ATOM   3992 N NH2   . ARG B 1 179 ? 53.858 20.136 113.074 1.00 37.97 ? 179 ARG B NH2   1 
ATOM   3993 N N     . LEU B 1 180 ? 46.213 17.706 114.997 1.00 56.20 ? 180 LEU B N     1 
ATOM   3994 C CA    . LEU B 1 180 ? 45.270 16.693 115.393 1.00 55.82 ? 180 LEU B CA    1 
ATOM   3995 C C     . LEU B 1 180 ? 44.004 17.098 114.812 1.00 55.53 ? 180 LEU B C     1 
ATOM   3996 O O     . LEU B 1 180 ? 43.326 16.287 114.150 1.00 56.21 ? 180 LEU B O     1 
ATOM   3997 C CB    . LEU B 1 180 ? 45.031 16.680 116.870 1.00 56.69 ? 180 LEU B CB    1 
ATOM   3998 C CG    . LEU B 1 180 ? 45.077 15.232 117.357 1.00 58.86 ? 180 LEU B CG    1 
ATOM   3999 C CD1   . LEU B 1 180 ? 46.568 14.786 117.343 1.00 58.91 ? 180 LEU B CD1   1 
ATOM   4000 C CD2   . LEU B 1 180 ? 44.429 15.055 118.768 1.00 60.78 ? 180 LEU B CD2   1 
ATOM   4001 N N     . VAL B 1 181 ? 43.684 18.371 115.047 1.00 54.62 ? 181 VAL B N     1 
ATOM   4002 C CA    . VAL B 1 181 ? 42.507 18.986 114.423 1.00 53.29 ? 181 VAL B CA    1 
ATOM   4003 C C     . VAL B 1 181 ? 42.525 18.787 112.893 1.00 52.53 ? 181 VAL B C     1 
ATOM   4004 O O     . VAL B 1 181 ? 41.614 18.184 112.351 1.00 52.62 ? 181 VAL B O     1 
ATOM   4005 C CB    . VAL B 1 181 ? 42.338 20.472 114.792 1.00 53.40 ? 181 VAL B CB    1 
ATOM   4006 C CG1   . VAL B 1 181 ? 40.919 20.793 114.736 1.00 52.05 ? 181 VAL B CG1   1 
ATOM   4007 C CG2   . VAL B 1 181 ? 42.920 20.815 116.224 1.00 52.62 ? 181 VAL B CG2   1 
ATOM   4008 N N     . LYS B 1 182 ? 43.574 19.237 112.214 1.00 51.89 ? 182 LYS B N     1 
ATOM   4009 C CA    . LYS B 1 182 ? 43.755 18.981 110.763 1.00 51.86 ? 182 LYS B CA    1 
ATOM   4010 C C     . LYS B 1 182 ? 43.454 17.507 110.296 1.00 52.82 ? 182 LYS B C     1 
ATOM   4011 O O     . LYS B 1 182 ? 42.598 17.262 109.407 1.00 52.04 ? 182 LYS B O     1 
ATOM   4012 C CB    . LYS B 1 182 ? 45.167 19.370 110.371 1.00 50.28 ? 182 LYS B CB    1 
ATOM   4013 C CG    . LYS B 1 182 ? 45.324 19.630 108.936 1.00 48.32 ? 182 LYS B CG    1 
ATOM   4014 C CD    . LYS B 1 182 ? 46.784 19.723 108.711 1.00 48.33 ? 182 LYS B CD    1 
ATOM   4015 C CE    . LYS B 1 182 ? 47.048 20.477 107.456 1.00 51.21 ? 182 LYS B CE    1 
ATOM   4016 N NZ    . LYS B 1 182 ? 48.423 21.101 107.194 1.00 51.33 ? 182 LYS B NZ    1 
ATOM   4017 N N     . ALA B 1 183 ? 44.160 16.553 110.926 1.00 53.91 ? 183 ALA B N     1 
ATOM   4018 C CA    . ALA B 1 183 ? 44.011 15.121 110.665 1.00 55.31 ? 183 ALA B CA    1 
ATOM   4019 C C     . ALA B 1 183 ? 42.576 14.714 110.735 1.00 56.47 ? 183 ALA B C     1 
ATOM   4020 O O     . ALA B 1 183 ? 42.196 13.760 110.075 1.00 56.37 ? 183 ALA B O     1 
ATOM   4021 C CB    . ALA B 1 183 ? 44.787 14.296 111.655 1.00 54.73 ? 183 ALA B CB    1 
ATOM   4022 N N     . HIS B 1 184 ? 41.794 15.424 111.546 1.00 57.79 ? 184 HIS B N     1 
ATOM   4023 C CA    . HIS B 1 184 ? 40.401 15.070 111.791 1.00 59.15 ? 184 HIS B CA    1 
ATOM   4024 C C     . HIS B 1 184 ? 39.418 15.863 110.921 1.00 60.48 ? 184 HIS B C     1 
ATOM   4025 O O     . HIS B 1 184 ? 38.204 15.965 111.244 1.00 60.85 ? 184 HIS B O     1 
ATOM   4026 C CB    . HIS B 1 184 ? 40.084 15.171 113.295 1.00 59.33 ? 184 HIS B CB    1 
ATOM   4027 C CG    . HIS B 1 184 ? 40.444 13.937 114.063 1.00 59.63 ? 184 HIS B CG    1 
ATOM   4028 N ND1   . HIS B 1 184 ? 41.714 13.400 114.054 1.00 60.55 ? 184 HIS B ND1   1 
ATOM   4029 C CD2   . HIS B 1 184 ? 39.699 13.122 114.844 1.00 60.37 ? 184 HIS B CD2   1 
ATOM   4030 C CE1   . HIS B 1 184 ? 41.741 12.314 114.806 1.00 61.87 ? 184 HIS B CE1   1 
ATOM   4031 N NE2   . HIS B 1 184 ? 40.531 12.126 115.303 1.00 62.17 ? 184 HIS B NE2   1 
ATOM   4032 N N     . LEU B 1 185 ? 39.943 16.379 109.799 1.00 61.56 ? 185 LEU B N     1 
ATOM   4033 C CA    . LEU B 1 185 ? 39.150 17.129 108.817 1.00 62.58 ? 185 LEU B CA    1 
ATOM   4034 C C     . LEU B 1 185 ? 38.675 16.337 107.598 1.00 62.54 ? 185 LEU B C     1 
ATOM   4035 O O     . LEU B 1 185 ? 39.285 15.345 107.279 1.00 63.61 ? 185 LEU B O     1 
ATOM   4036 C CB    . LEU B 1 185 ? 39.967 18.307 108.343 1.00 62.76 ? 185 LEU B CB    1 
ATOM   4037 C CG    . LEU B 1 185 ? 39.670 19.468 109.311 1.00 65.02 ? 185 LEU B CG    1 
ATOM   4038 C CD1   . LEU B 1 185 ? 40.159 20.815 108.723 1.00 65.42 ? 185 LEU B CD1   1 
ATOM   4039 C CD2   . LEU B 1 185 ? 38.161 19.525 109.690 1.00 64.68 ? 185 LEU B CD2   1 
ATOM   4040 N N     . ASN B 1 186 ? 37.617 16.772 106.915 1.00 61.84 ? 186 ASN B N     1 
ATOM   4041 C CA    . ASN B 1 186 ? 37.228 16.186 105.615 1.00 61.52 ? 186 ASN B CA    1 
ATOM   4042 C C     . ASN B 1 186 ? 38.026 16.867 104.523 1.00 61.11 ? 186 ASN B C     1 
ATOM   4043 O O     . ASN B 1 186 ? 38.930 17.627 104.868 1.00 60.72 ? 186 ASN B O     1 
ATOM   4044 C CB    . ASN B 1 186 ? 35.731 16.334 105.371 1.00 61.78 ? 186 ASN B CB    1 
ATOM   4045 C CG    . ASN B 1 186 ? 34.888 15.530 106.371 1.00 62.96 ? 186 ASN B CG    1 
ATOM   4046 O OD1   . ASN B 1 186 ? 33.672 15.379 106.203 1.00 59.00 ? 186 ASN B OD1   1 
ATOM   4047 N ND2   . ASN B 1 186 ? 35.543 15.016 107.429 1.00 65.56 ? 186 ASN B ND2   1 
ATOM   4048 N N     . PRO B 1 187 ? 37.739 16.595 103.215 1.00 61.20 ? 187 PRO B N     1 
ATOM   4049 C CA    . PRO B 1 187 ? 38.729 17.161 102.283 1.00 60.78 ? 187 PRO B CA    1 
ATOM   4050 C C     . PRO B 1 187 ? 38.536 18.674 102.163 1.00 60.29 ? 187 PRO B C     1 
ATOM   4051 O O     . PRO B 1 187 ? 39.542 19.435 102.219 1.00 60.20 ? 187 PRO B O     1 
ATOM   4052 C CB    . PRO B 1 187 ? 38.467 16.406 100.957 1.00 61.10 ? 187 PRO B CB    1 
ATOM   4053 C CG    . PRO B 1 187 ? 36.971 16.034 100.996 1.00 61.54 ? 187 PRO B CG    1 
ATOM   4054 C CD    . PRO B 1 187 ? 36.653 15.868 102.502 1.00 61.52 ? 187 PRO B CD    1 
ATOM   4055 N N     . GLY B 1 188 ? 37.264 19.104 102.044 1.00 59.05 ? 188 GLY B N     1 
ATOM   4056 C CA    . GLY B 1 188 ? 36.925 20.535 101.978 1.00 57.40 ? 188 GLY B CA    1 
ATOM   4057 C C     . GLY B 1 188 ? 37.094 21.282 103.294 1.00 56.36 ? 188 GLY B C     1 
ATOM   4058 O O     . GLY B 1 188 ? 37.303 22.469 103.314 1.00 56.05 ? 188 GLY B O     1 
ATOM   4059 N N     . GLY B 1 189 ? 37.006 20.567 104.399 1.00 55.94 ? 189 GLY B N     1 
ATOM   4060 C CA    . GLY B 1 189 ? 37.094 21.127 105.740 1.00 56.22 ? 189 GLY B CA    1 
ATOM   4061 C C     . GLY B 1 189 ? 37.923 22.357 106.138 1.00 55.98 ? 189 GLY B C     1 
ATOM   4062 O O     . GLY B 1 189 ? 39.090 22.519 105.718 1.00 56.88 ? 189 GLY B O     1 
ATOM   4063 N N     . VAL B 1 190 ? 37.290 23.192 106.991 1.00 54.74 ? 190 VAL B N     1 
ATOM   4064 C CA    . VAL B 1 190 ? 37.861 24.430 107.605 1.00 52.76 ? 190 VAL B CA    1 
ATOM   4065 C C     . VAL B 1 190 ? 37.811 24.477 109.159 1.00 51.33 ? 190 VAL B C     1 
ATOM   4066 O O     . VAL B 1 190 ? 36.809 24.138 109.776 1.00 50.75 ? 190 VAL B O     1 
ATOM   4067 C CB    . VAL B 1 190 ? 37.235 25.763 106.986 1.00 52.20 ? 190 VAL B CB    1 
ATOM   4068 C CG1   . VAL B 1 190 ? 35.757 25.798 107.107 1.00 52.08 ? 190 VAL B CG1   1 
ATOM   4069 C CG2   . VAL B 1 190 ? 37.814 27.004 107.634 1.00 51.93 ? 190 VAL B CG2   1 
ATOM   4070 N N     . MET B 1 191 ? 38.909 24.868 109.794 1.00 49.58 ? 191 MET B N     1 
ATOM   4071 C CA    . MET B 1 191 ? 38.779 25.275 111.170 1.00 48.16 ? 191 MET B CA    1 
ATOM   4072 C C     . MET B 1 191 ? 38.473 26.755 111.252 1.00 47.68 ? 191 MET B C     1 
ATOM   4073 O O     . MET B 1 191 ? 38.947 27.578 110.389 1.00 46.65 ? 191 MET B O     1 
ATOM   4074 C CB    . MET B 1 191 ? 40.051 25.084 111.928 1.00 47.64 ? 191 MET B CB    1 
ATOM   4075 C CG    . MET B 1 191 ? 39.889 25.662 113.283 1.00 47.32 ? 191 MET B CG    1 
ATOM   4076 S SD    . MET B 1 191 ? 41.326 25.198 114.169 1.00 48.91 ? 191 MET B SD    1 
ATOM   4077 C CE    . MET B 1 191 ? 42.326 26.686 114.044 1.00 49.57 ? 191 MET B CE    1 
ATOM   4078 N N     . GLY B 1 192 ? 37.750 27.109 112.325 1.00 45.91 ? 192 GLY B N     1 
ATOM   4079 C CA    . GLY B 1 192 ? 37.635 28.507 112.708 1.00 43.13 ? 192 GLY B CA    1 
ATOM   4080 C C     . GLY B 1 192 ? 37.627 28.546 114.190 1.00 41.46 ? 192 GLY B C     1 
ATOM   4081 O O     . GLY B 1 192 ? 37.063 27.678 114.784 1.00 42.20 ? 192 GLY B O     1 
ATOM   4082 N N     . MET B 1 193 ? 38.253 29.560 114.785 1.00 40.58 ? 193 MET B N     1 
ATOM   4083 C CA    . MET B 1 193 ? 38.441 29.639 116.234 1.00 39.06 ? 193 MET B CA    1 
ATOM   4084 C C     . MET B 1 193 ? 38.559 31.111 116.784 1.00 38.93 ? 193 MET B C     1 
ATOM   4085 O O     . MET B 1 193 ? 38.784 32.094 116.039 1.00 39.39 ? 193 MET B O     1 
ATOM   4086 C CB    . MET B 1 193 ? 39.687 28.853 116.573 1.00 38.69 ? 193 MET B CB    1 
ATOM   4087 C CG    . MET B 1 193 ? 40.894 29.513 115.992 1.00 37.03 ? 193 MET B CG    1 
ATOM   4088 S SD    . MET B 1 193 ? 42.553 29.213 116.636 1.00 41.11 ? 193 MET B SD    1 
ATOM   4089 C CE    . MET B 1 193 ? 42.224 28.206 118.035 1.00 33.59 ? 193 MET B CE    1 
ATOM   4090 N N     . GLN B 1 194 ? 38.399 31.261 118.097 1.00 37.70 ? 194 GLN B N     1 
ATOM   4091 C CA    . GLN B 1 194 ? 38.830 32.454 118.820 1.00 36.45 ? 194 GLN B CA    1 
ATOM   4092 C C     . GLN B 1 194 ? 40.356 32.454 119.194 1.00 35.33 ? 194 GLN B C     1 
ATOM   4093 O O     . GLN B 1 194 ? 40.943 31.408 119.504 1.00 36.52 ? 194 GLN B O     1 
ATOM   4094 C CB    . GLN B 1 194 ? 38.011 32.554 120.055 1.00 36.94 ? 194 GLN B CB    1 
ATOM   4095 C CG    . GLN B 1 194 ? 38.271 33.772 120.868 1.00 40.41 ? 194 GLN B CG    1 
ATOM   4096 C CD    . GLN B 1 194 ? 39.242 33.588 122.003 1.00 41.25 ? 194 GLN B CD    1 
ATOM   4097 O OE1   . GLN B 1 194 ? 40.189 34.373 122.114 1.00 40.59 ? 194 GLN B OE1   1 
ATOM   4098 N NE2   . GLN B 1 194 ? 38.987 32.601 122.893 1.00 39.97 ? 194 GLN B NE2   1 
ATOM   4099 N N     . ALA B 1 195 ? 40.998 33.622 119.123 1.00 32.86 ? 195 ALA B N     1 
ATOM   4100 C CA    . ALA B 1 195 ? 42.477 33.751 119.151 1.00 30.90 ? 195 ALA B CA    1 
ATOM   4101 C C     . ALA B 1 195 ? 43.028 34.962 119.935 1.00 29.72 ? 195 ALA B C     1 
ATOM   4102 O O     . ALA B 1 195 ? 44.099 35.458 119.608 1.00 28.33 ? 195 ALA B O     1 
ATOM   4103 C CB    . ALA B 1 195 ? 43.103 33.714 117.689 1.00 30.37 ? 195 ALA B CB    1 
ATOM   4104 N N     . GLY B 1 196 ? 42.300 35.418 120.951 1.00 29.82 ? 196 GLY B N     1 
ATOM   4105 C CA    . GLY B 1 196 ? 42.871 36.277 121.975 1.00 33.25 ? 196 GLY B CA    1 
ATOM   4106 C C     . GLY B 1 196 ? 42.484 37.721 121.806 1.00 34.90 ? 196 GLY B C     1 
ATOM   4107 O O     . GLY B 1 196 ? 41.833 38.049 120.815 1.00 35.98 ? 196 GLY B O     1 
ATOM   4108 N N     . MET B 1 197 ? 42.864 38.603 122.742 1.00 36.68 ? 197 MET B N     1 
ATOM   4109 C CA    . MET B 1 197 ? 42.589 40.040 122.477 1.00 36.82 ? 197 MET B CA    1 
ATOM   4110 C C     . MET B 1 197 ? 43.598 40.562 121.570 1.00 36.76 ? 197 MET B C     1 
ATOM   4111 O O     . MET B 1 197 ? 44.628 39.923 121.288 1.00 38.38 ? 197 MET B O     1 
ATOM   4112 C CB    . MET B 1 197 ? 42.376 40.970 123.690 1.00 36.99 ? 197 MET B CB    1 
ATOM   4113 C CG    . MET B 1 197 ? 42.869 40.521 124.974 1.00 36.98 ? 197 MET B CG    1 
ATOM   4114 S SD    . MET B 1 197 ? 43.963 41.799 125.604 1.00 48.81 ? 197 MET B SD    1 
ATOM   4115 C CE    . MET B 1 197 ? 44.539 41.024 127.130 1.00 44.20 ? 197 MET B CE    1 
ATOM   4116 N N     . ILE B 1 198 ? 43.282 41.723 121.040 1.00 36.09 ? 198 ILE B N     1 
ATOM   4117 C CA    . ILE B 1 198 ? 44.204 42.353 120.153 1.00 33.34 ? 198 ILE B CA    1 
ATOM   4118 C C     . ILE B 1 198 ? 44.457 43.616 120.855 1.00 33.86 ? 198 ILE B C     1 
ATOM   4119 O O     . ILE B 1 198 ? 43.577 44.476 121.045 1.00 34.67 ? 198 ILE B O     1 
ATOM   4120 C CB    . ILE B 1 198 ? 43.637 42.571 118.792 1.00 30.18 ? 198 ILE B CB    1 
ATOM   4121 C CG1   . ILE B 1 198 ? 43.538 41.246 118.124 1.00 28.37 ? 198 ILE B CG1   1 
ATOM   4122 C CG2   . ILE B 1 198 ? 44.572 43.401 118.043 1.00 31.08 ? 198 ILE B CG2   1 
ATOM   4123 C CD1   . ILE B 1 198 ? 42.654 41.153 116.838 1.00 22.18 ? 198 ILE B CD1   1 
ATOM   4124 N N     . LEU B 1 199 ? 45.693 43.730 121.263 1.00 34.67 ? 199 LEU B N     1 
ATOM   4125 C CA    . LEU B 1 199 ? 46.087 44.846 122.131 1.00 34.59 ? 199 LEU B CA    1 
ATOM   4126 C C     . LEU B 1 199 ? 47.592 44.833 121.968 1.00 35.81 ? 199 LEU B C     1 
ATOM   4127 O O     . LEU B 1 199 ? 48.349 44.114 122.708 1.00 35.42 ? 199 LEU B O     1 
ATOM   4128 C CB    . LEU B 1 199 ? 45.655 44.608 123.583 1.00 31.30 ? 199 LEU B CB    1 
ATOM   4129 C CG    . LEU B 1 199 ? 45.545 45.813 124.503 1.00 30.80 ? 199 LEU B CG    1 
ATOM   4130 C CD1   . LEU B 1 199 ? 44.519 46.743 124.009 1.00 21.17 ? 199 LEU B CD1   1 
ATOM   4131 C CD2   . LEU B 1 199 ? 45.183 45.371 125.983 1.00 33.15 ? 199 LEU B CD2   1 
ATOM   4132 N N     . LEU B 1 200 ? 47.990 45.561 120.945 1.00 36.63 ? 200 LEU B N     1 
ATOM   4133 C CA    . LEU B 1 200 ? 49.289 45.362 120.395 1.00 39.23 ? 200 LEU B CA    1 
ATOM   4134 C C     . LEU B 1 200 ? 50.387 45.900 121.286 1.00 42.18 ? 200 LEU B C     1 
ATOM   4135 O O     . LEU B 1 200 ? 51.541 45.510 121.175 1.00 42.56 ? 200 LEU B O     1 
ATOM   4136 C CB    . LEU B 1 200 ? 49.331 45.978 119.038 1.00 38.37 ? 200 LEU B CB    1 
ATOM   4137 C CG    . LEU B 1 200 ? 48.770 45.037 117.985 1.00 36.41 ? 200 LEU B CG    1 
ATOM   4138 C CD1   . LEU B 1 200 ? 48.890 45.789 116.670 1.00 37.46 ? 200 LEU B CD1   1 
ATOM   4139 C CD2   . LEU B 1 200 ? 49.520 43.640 117.988 1.00 29.05 ? 200 LEU B CD2   1 
ATOM   4140 N N     . THR B 1 201 ? 50.013 46.761 122.225 1.00 45.90 ? 201 THR B N     1 
ATOM   4141 C CA    . THR B 1 201 ? 51.017 47.319 123.119 1.00 48.22 ? 201 THR B CA    1 
ATOM   4142 C C     . THR B 1 201 ? 51.288 46.476 124.315 1.00 50.42 ? 201 THR B C     1 
ATOM   4143 O O     . THR B 1 201 ? 52.368 46.636 124.919 1.00 52.21 ? 201 THR B O     1 
ATOM   4144 C CB    . THR B 1 201 ? 50.647 48.678 123.647 1.00 47.05 ? 201 THR B CB    1 
ATOM   4145 O OG1   . THR B 1 201 ? 49.251 48.843 123.479 1.00 49.41 ? 201 THR B OG1   1 
ATOM   4146 C CG2   . THR B 1 201 ? 51.366 49.741 122.928 1.00 46.00 ? 201 THR B CG2   1 
ATOM   4147 N N     . HIS B 1 202 ? 50.344 45.639 124.734 1.00 52.27 ? 202 HIS B N     1 
ATOM   4148 C CA    . HIS B 1 202 ? 50.644 44.801 125.921 1.00 54.72 ? 202 HIS B CA    1 
ATOM   4149 C C     . HIS B 1 202 ? 51.251 43.447 125.534 1.00 56.15 ? 202 HIS B C     1 
ATOM   4150 O O     . HIS B 1 202 ? 52.117 42.969 126.287 1.00 57.55 ? 202 HIS B O     1 
ATOM   4151 C CB    . HIS B 1 202 ? 49.482 44.670 126.896 1.00 54.33 ? 202 HIS B CB    1 
ATOM   4152 C CG    . HIS B 1 202 ? 48.918 45.996 127.328 1.00 57.73 ? 202 HIS B CG    1 
ATOM   4153 N ND1   . HIS B 1 202 ? 48.655 47.027 126.440 1.00 60.87 ? 202 HIS B ND1   1 
ATOM   4154 C CD2   . HIS B 1 202 ? 48.550 46.463 128.548 1.00 58.65 ? 202 HIS B CD2   1 
ATOM   4155 C CE1   . HIS B 1 202 ? 48.153 48.066 127.095 1.00 58.31 ? 202 HIS B CE1   1 
ATOM   4156 N NE2   . HIS B 1 202 ? 48.080 47.751 128.375 1.00 58.30 ? 202 HIS B NE2   1 
ATOM   4157 N N     . HIS B 1 203 ? 50.888 42.884 124.351 1.00 56.12 ? 203 HIS B N     1 
ATOM   4158 C CA    . HIS B 1 203 ? 51.214 41.473 123.988 1.00 54.86 ? 203 HIS B CA    1 
ATOM   4159 C C     . HIS B 1 203 ? 50.815 40.936 122.593 1.00 53.43 ? 203 HIS B C     1 
ATOM   4160 O O     . HIS B 1 203 ? 50.009 41.537 121.882 1.00 54.14 ? 203 HIS B O     1 
ATOM   4161 C CB    . HIS B 1 203 ? 50.453 40.586 124.931 1.00 55.68 ? 203 HIS B CB    1 
ATOM   4162 C CG    . HIS B 1 203 ? 48.992 40.544 124.651 1.00 55.52 ? 203 HIS B CG    1 
ATOM   4163 N ND1   . HIS B 1 203 ? 48.447 39.723 123.681 1.00 58.05 ? 203 HIS B ND1   1 
ATOM   4164 C CD2   . HIS B 1 203 ? 47.966 41.203 125.218 1.00 55.61 ? 203 HIS B CD2   1 
ATOM   4165 C CE1   . HIS B 1 203 ? 47.139 39.855 123.680 1.00 58.06 ? 203 HIS B CE1   1 
ATOM   4166 N NE2   . HIS B 1 203 ? 46.822 40.747 124.605 1.00 61.00 ? 203 HIS B NE2   1 
ATOM   4167 N N     . ARG B 1 204 ? 51.287 39.726 122.283 1.00 51.24 ? 204 ARG B N     1 
ATOM   4168 C CA    . ARG B 1 204 ? 51.118 39.175 120.938 1.00 49.40 ? 204 ARG B CA    1 
ATOM   4169 C C     . ARG B 1 204 ? 50.443 37.823 120.890 1.00 46.89 ? 204 ARG B C     1 
ATOM   4170 O O     . ARG B 1 204 ? 50.660 37.050 119.929 1.00 47.23 ? 204 ARG B O     1 
ATOM   4171 C CB    . ARG B 1 204 ? 52.421 39.187 120.091 1.00 49.67 ? 204 ARG B CB    1 
ATOM   4172 C CG    . ARG B 1 204 ? 53.723 39.861 120.687 1.00 53.78 ? 204 ARG B CG    1 
ATOM   4173 C CD    . ARG B 1 204 ? 54.767 38.833 121.318 1.00 55.37 ? 204 ARG B CD    1 
ATOM   4174 N NE    . ARG B 1 204 ? 55.774 38.206 120.416 1.00 55.67 ? 204 ARG B NE    1 
ATOM   4175 C CZ    . ARG B 1 204 ? 56.742 37.369 120.839 1.00 55.85 ? 204 ARG B CZ    1 
ATOM   4176 N NH1   . ARG B 1 204 ? 57.591 36.824 119.981 1.00 58.15 ? 204 ARG B NH1   1 
ATOM   4177 N NH2   . ARG B 1 204 ? 56.875 37.060 122.125 1.00 54.97 ? 204 ARG B NH2   1 
ATOM   4178 N N     . VAL B 1 205 ? 49.579 37.562 121.879 1.00 43.18 ? 205 VAL B N     1 
ATOM   4179 C CA    . VAL B 1 205 ? 48.688 36.404 121.861 1.00 37.89 ? 205 VAL B CA    1 
ATOM   4180 C C     . VAL B 1 205 ? 48.115 36.162 120.470 1.00 36.18 ? 205 VAL B C     1 
ATOM   4181 O O     . VAL B 1 205 ? 48.325 35.086 119.870 1.00 36.42 ? 205 VAL B O     1 
ATOM   4182 C CB    . VAL B 1 205 ? 47.578 36.578 122.873 1.00 38.71 ? 205 VAL B CB    1 
ATOM   4183 C CG1   . VAL B 1 205 ? 46.510 35.406 122.831 1.00 33.16 ? 205 VAL B CG1   1 
ATOM   4184 C CG2   . VAL B 1 205 ? 48.221 36.816 124.253 1.00 37.17 ? 205 VAL B CG2   1 
ATOM   4185 N N     . HIS B 1 206 ? 47.422 37.149 119.923 1.00 33.40 ? 206 HIS B N     1 
ATOM   4186 C CA    . HIS B 1 206 ? 46.729 36.897 118.658 1.00 31.42 ? 206 HIS B CA    1 
ATOM   4187 C C     . HIS B 1 206 ? 47.726 36.474 117.550 1.00 30.31 ? 206 HIS B C     1 
ATOM   4188 O O     . HIS B 1 206 ? 47.627 35.380 116.964 1.00 27.04 ? 206 HIS B O     1 
ATOM   4189 C CB    . HIS B 1 206 ? 45.790 38.013 118.197 1.00 30.85 ? 206 HIS B CB    1 
ATOM   4190 C CG    . HIS B 1 206 ? 45.150 37.671 116.922 1.00 34.25 ? 206 HIS B CG    1 
ATOM   4191 N ND1   . HIS B 1 206 ? 44.151 36.731 116.850 1.00 36.19 ? 206 HIS B ND1   1 
ATOM   4192 C CD2   . HIS B 1 206 ? 45.489 37.958 115.642 1.00 36.77 ? 206 HIS B CD2   1 
ATOM   4193 C CE1   . HIS B 1 206 ? 43.816 36.544 115.581 1.00 34.83 ? 206 HIS B CE1   1 
ATOM   4194 N NE2   . HIS B 1 206 ? 44.629 37.255 114.827 1.00 33.76 ? 206 HIS B NE2   1 
ATOM   4195 N N     . PRO B 1 207 ? 48.736 37.324 117.312 1.00 30.32 ? 207 PRO B N     1 
ATOM   4196 C CA    . PRO B 1 207 ? 49.746 37.000 116.289 1.00 31.48 ? 207 PRO B CA    1 
ATOM   4197 C C     . PRO B 1 207 ? 50.338 35.590 116.541 1.00 33.01 ? 207 PRO B C     1 
ATOM   4198 O O     . PRO B 1 207 ? 50.369 34.753 115.615 1.00 32.41 ? 207 PRO B O     1 
ATOM   4199 C CB    . PRO B 1 207 ? 50.822 38.097 116.491 1.00 31.45 ? 207 PRO B CB    1 
ATOM   4200 C CG    . PRO B 1 207 ? 50.045 39.255 117.097 1.00 30.61 ? 207 PRO B CG    1 
ATOM   4201 C CD    . PRO B 1 207 ? 49.030 38.583 118.009 1.00 29.64 ? 207 PRO B CD    1 
ATOM   4202 N N     . VAL B 1 208 ? 50.690 35.306 117.804 1.00 32.39 ? 208 VAL B N     1 
ATOM   4203 C CA    . VAL B 1 208 ? 51.265 34.023 118.090 1.00 32.95 ? 208 VAL B CA    1 
ATOM   4204 C C     . VAL B 1 208 ? 50.344 32.902 117.955 1.00 33.24 ? 208 VAL B C     1 
ATOM   4205 O O     . VAL B 1 208 ? 50.793 31.814 117.594 1.00 33.43 ? 208 VAL B O     1 
ATOM   4206 C CB    . VAL B 1 208 ? 51.841 33.876 119.521 1.00 33.69 ? 208 VAL B CB    1 
ATOM   4207 C CG1   . VAL B 1 208 ? 52.400 32.437 119.715 1.00 35.60 ? 208 VAL B CG1   1 
ATOM   4208 C CG2   . VAL B 1 208 ? 52.924 34.897 119.800 1.00 32.59 ? 208 VAL B CG2   1 
ATOM   4209 N N     . VAL B 1 209 ? 49.079 33.087 118.326 1.00 34.62 ? 209 VAL B N     1 
ATOM   4210 C CA    . VAL B 1 209 ? 48.123 31.985 118.006 1.00 36.37 ? 209 VAL B CA    1 
ATOM   4211 C C     . VAL B 1 209 ? 48.060 31.784 116.500 1.00 36.96 ? 209 VAL B C     1 
ATOM   4212 O O     . VAL B 1 209 ? 47.825 30.665 116.057 1.00 36.59 ? 209 VAL B O     1 
ATOM   4213 C CB    . VAL B 1 209 ? 46.686 32.182 118.532 1.00 35.28 ? 209 VAL B CB    1 
ATOM   4214 C CG1   . VAL B 1 209 ? 45.778 31.055 118.068 1.00 36.36 ? 209 VAL B CG1   1 
ATOM   4215 C CG2   . VAL B 1 209 ? 46.702 32.236 120.042 1.00 40.06 ? 209 VAL B CG2   1 
ATOM   4216 N N     . HIS B 1 210 ? 48.257 32.879 115.758 1.00 37.56 ? 210 HIS B N     1 
ATOM   4217 C CA    . HIS B 1 210 ? 48.175 32.836 114.362 1.00 40.82 ? 210 HIS B CA    1 
ATOM   4218 C C     . HIS B 1 210 ? 49.425 32.102 113.776 1.00 42.65 ? 210 HIS B C     1 
ATOM   4219 O O     . HIS B 1 210 ? 49.275 31.099 113.045 1.00 42.18 ? 210 HIS B O     1 
ATOM   4220 C CB    . HIS B 1 210 ? 47.960 34.245 113.836 1.00 40.67 ? 210 HIS B CB    1 
ATOM   4221 C CG    . HIS B 1 210 ? 47.843 34.336 112.332 1.00 44.08 ? 210 HIS B CG    1 
ATOM   4222 N ND1   . HIS B 1 210 ? 46.638 34.281 111.659 1.00 45.88 ? 210 HIS B ND1   1 
ATOM   4223 C CD2   . HIS B 1 210 ? 48.785 34.518 111.372 1.00 45.92 ? 210 HIS B CD2   1 
ATOM   4224 C CE1   . HIS B 1 210 ? 46.835 34.424 110.357 1.00 43.57 ? 210 HIS B CE1   1 
ATOM   4225 N NE2   . HIS B 1 210 ? 48.129 34.573 110.155 1.00 45.26 ? 210 HIS B NE2   1 
ATOM   4226 N N     . ARG B 1 211 ? 50.632 32.598 114.117 1.00 43.75 ? 211 ARG B N     1 
ATOM   4227 C CA    . ARG B 1 211 ? 51.920 31.896 113.880 1.00 44.36 ? 211 ARG B CA    1 
ATOM   4228 C C     . ARG B 1 211 ? 51.893 30.358 114.229 1.00 44.89 ? 211 ARG B C     1 
ATOM   4229 O O     . ARG B 1 211 ? 52.269 29.511 113.420 1.00 44.76 ? 211 ARG B O     1 
ATOM   4230 C CB    . ARG B 1 211 ? 53.059 32.623 114.627 1.00 44.18 ? 211 ARG B CB    1 
ATOM   4231 C CG    . ARG B 1 211 ? 54.453 32.504 113.996 1.00 44.21 ? 211 ARG B CG    1 
ATOM   4232 C CD    . ARG B 1 211 ? 54.439 33.011 112.556 1.00 47.53 ? 211 ARG B CD    1 
ATOM   4233 N NE    . ARG B 1 211 ? 55.315 32.179 111.731 1.00 53.14 ? 211 ARG B NE    1 
ATOM   4234 C CZ    . ARG B 1 211 ? 55.192 30.849 111.607 1.00 54.97 ? 211 ARG B CZ    1 
ATOM   4235 N NH1   . ARG B 1 211 ? 56.025 30.153 110.856 1.00 54.15 ? 211 ARG B NH1   1 
ATOM   4236 N NH2   . ARG B 1 211 ? 54.233 30.192 112.252 1.00 54.87 ? 211 ARG B NH2   1 
ATOM   4237 N N     . THR B 1 212 ? 51.444 29.992 115.427 1.00 45.28 ? 212 THR B N     1 
ATOM   4238 C CA    . THR B 1 212 ? 51.230 28.570 115.729 1.00 45.28 ? 212 THR B CA    1 
ATOM   4239 C C     . THR B 1 212 ? 50.384 27.894 114.650 1.00 45.02 ? 212 THR B C     1 
ATOM   4240 O O     . THR B 1 212 ? 50.801 26.925 114.103 1.00 45.12 ? 212 THR B O     1 
ATOM   4241 C CB    . THR B 1 212 ? 50.582 28.364 117.088 1.00 44.89 ? 212 THR B CB    1 
ATOM   4242 O OG1   . THR B 1 212 ? 51.280 29.131 118.082 1.00 48.41 ? 212 THR B OG1   1 
ATOM   4243 C CG2   . THR B 1 212 ? 50.617 26.916 117.484 1.00 45.90 ? 212 THR B CG2   1 
ATOM   4244 N N     . VAL B 1 213 ? 49.216 28.417 114.324 1.00 45.26 ? 213 VAL B N     1 
ATOM   4245 C CA    . VAL B 1 213 ? 48.408 27.822 113.264 1.00 45.52 ? 213 VAL B CA    1 
ATOM   4246 C C     . VAL B 1 213 ? 48.965 27.910 111.802 1.00 46.83 ? 213 VAL B C     1 
ATOM   4247 O O     . VAL B 1 213 ? 48.655 27.048 110.960 1.00 45.97 ? 213 VAL B O     1 
ATOM   4248 C CB    . VAL B 1 213 ? 46.995 28.362 113.316 1.00 44.27 ? 213 VAL B CB    1 
ATOM   4249 C CG1   . VAL B 1 213 ? 46.165 27.661 112.368 1.00 42.67 ? 213 VAL B CG1   1 
ATOM   4250 C CG2   . VAL B 1 213 ? 46.437 28.161 114.659 1.00 44.14 ? 213 VAL B CG2   1 
ATOM   4251 N N     . ARG B 1 214 ? 49.772 28.932 111.477 1.00 48.91 ? 214 ARG B N     1 
ATOM   4252 C CA    . ARG B 1 214 ? 50.341 29.010 110.101 1.00 50.72 ? 214 ARG B CA    1 
ATOM   4253 C C     . ARG B 1 214 ? 51.129 27.719 109.878 1.00 51.88 ? 214 ARG B C     1 
ATOM   4254 O O     . ARG B 1 214 ? 51.039 27.099 108.795 1.00 52.60 ? 214 ARG B O     1 
ATOM   4255 C CB    . ARG B 1 214 ? 51.208 30.247 109.889 1.00 51.41 ? 214 ARG B CB    1 
ATOM   4256 C CG    . ARG B 1 214 ? 50.482 31.576 109.375 1.00 55.71 ? 214 ARG B CG    1 
ATOM   4257 C CD    . ARG B 1 214 ? 50.658 31.917 107.793 1.00 63.76 ? 214 ARG B CD    1 
ATOM   4258 N NE    . ARG B 1 214 ? 50.510 30.781 106.805 1.00 68.90 ? 214 ARG B NE    1 
ATOM   4259 C CZ    . ARG B 1 214 ? 51.500 29.983 106.330 1.00 70.37 ? 214 ARG B CZ    1 
ATOM   4260 N NH1   . ARG B 1 214 ? 52.770 30.124 106.718 1.00 71.58 ? 214 ARG B NH1   1 
ATOM   4261 N NH2   . ARG B 1 214 ? 51.230 29.020 105.453 1.00 70.03 ? 214 ARG B NH2   1 
ATOM   4262 N N     . GLU B 1 215 ? 51.807 27.266 110.951 1.00 51.93 ? 215 GLU B N     1 
ATOM   4263 C CA    . GLU B 1 215 ? 52.579 26.005 111.014 1.00 51.90 ? 215 GLU B CA    1 
ATOM   4264 C C     . GLU B 1 215 ? 51.837 24.685 110.750 1.00 51.75 ? 215 GLU B C     1 
ATOM   4265 O O     . GLU B 1 215 ? 52.443 23.726 110.238 1.00 51.85 ? 215 GLU B O     1 
ATOM   4266 C CB    . GLU B 1 215 ? 53.291 25.923 112.357 1.00 52.40 ? 215 GLU B CB    1 
ATOM   4267 C CG    . GLU B 1 215 ? 54.764 25.639 112.254 1.00 55.31 ? 215 GLU B CG    1 
ATOM   4268 C CD    . GLU B 1 215 ? 55.507 26.566 111.252 1.00 59.79 ? 215 GLU B CD    1 
ATOM   4269 O OE1   . GLU B 1 215 ? 55.124 27.745 111.039 1.00 58.75 ? 215 GLU B OE1   1 
ATOM   4270 O OE2   . GLU B 1 215 ? 56.511 26.100 110.675 1.00 62.73 ? 215 GLU B OE2   1 
ATOM   4271 N N     . ALA B 1 216 ? 50.541 24.622 111.061 1.00 50.80 ? 216 ALA B N     1 
ATOM   4272 C CA    . ALA B 1 216 ? 49.791 23.411 110.762 1.00 49.98 ? 216 ALA B CA    1 
ATOM   4273 C C     . ALA B 1 216 ? 48.649 23.501 109.743 1.00 49.89 ? 216 ALA B C     1 
ATOM   4274 O O     . ALA B 1 216 ? 47.822 22.583 109.715 1.00 49.55 ? 216 ALA B O     1 
ATOM   4275 C CB    . ALA B 1 216 ? 49.285 22.758 112.045 1.00 49.35 ? 216 ALA B CB    1 
ATOM   4276 N N     . PHE B 1 217 ? 48.561 24.581 108.955 1.00 49.80 ? 217 PHE B N     1 
ATOM   4277 C CA    . PHE B 1 217 ? 47.650 24.647 107.737 1.00 50.12 ? 217 PHE B CA    1 
ATOM   4278 C C     . PHE B 1 217 ? 48.251 25.573 106.645 1.00 51.54 ? 217 PHE B C     1 
ATOM   4279 O O     . PHE B 1 217 ? 49.054 26.463 106.968 1.00 50.92 ? 217 PHE B O     1 
ATOM   4280 C CB    . PHE B 1 217 ? 46.246 25.204 108.030 1.00 48.69 ? 217 PHE B CB    1 
ATOM   4281 C CG    . PHE B 1 217 ? 45.468 24.476 109.081 1.00 49.01 ? 217 PHE B CG    1 
ATOM   4282 C CD1   . PHE B 1 217 ? 44.247 23.832 108.730 1.00 46.40 ? 217 PHE B CD1   1 
ATOM   4283 C CD2   . PHE B 1 217 ? 45.887 24.486 110.448 1.00 49.90 ? 217 PHE B CD2   1 
ATOM   4284 C CE1   . PHE B 1 217 ? 43.468 23.167 109.681 1.00 45.80 ? 217 PHE B CE1   1 
ATOM   4285 C CE2   . PHE B 1 217 ? 45.108 23.810 111.440 1.00 51.13 ? 217 PHE B CE2   1 
ATOM   4286 C CZ    . PHE B 1 217 ? 43.881 23.153 111.045 1.00 48.24 ? 217 PHE B CZ    1 
ATOM   4287 N N     . ARG B 1 218 ? 47.864 25.404 105.364 1.00 53.73 ? 218 ARG B N     1 
ATOM   4288 C CA    . ARG B 1 218 ? 48.472 26.288 104.330 1.00 54.90 ? 218 ARG B CA    1 
ATOM   4289 C C     . ARG B 1 218 ? 47.979 27.708 104.597 1.00 54.45 ? 218 ARG B C     1 
ATOM   4290 O O     . ARG B 1 218 ? 48.771 28.549 105.011 1.00 54.63 ? 218 ARG B O     1 
ATOM   4291 C CB    . ARG B 1 218 ? 48.256 25.830 102.857 1.00 55.75 ? 218 ARG B CB    1 
ATOM   4292 C CG    . ARG B 1 218 ? 49.439 26.137 101.877 1.00 57.53 ? 218 ARG B CG    1 
ATOM   4293 C CD    . ARG B 1 218 ? 49.720 27.664 101.575 1.00 67.29 ? 218 ARG B CD    1 
ATOM   4294 N NE    . ARG B 1 218 ? 49.611 28.029 100.138 1.00 71.47 ? 218 ARG B NE    1 
ATOM   4295 C CZ    . ARG B 1 218 ? 50.569 28.572 99.359  1.00 72.03 ? 218 ARG B CZ    1 
ATOM   4296 N NH1   . ARG B 1 218 ? 51.785 28.878 99.837  1.00 70.95 ? 218 ARG B NH1   1 
ATOM   4297 N NH2   . ARG B 1 218 ? 50.295 28.811 98.072  1.00 70.77 ? 218 ARG B NH2   1 
ATOM   4298 N N     . TYR B 1 219 ? 46.655 27.887 104.472 1.00 53.86 ? 219 TYR B N     1 
ATOM   4299 C CA    . TYR B 1 219 ? 45.887 29.158 104.526 1.00 53.05 ? 219 TYR B CA    1 
ATOM   4300 C C     . TYR B 1 219 ? 45.417 29.632 105.911 1.00 50.68 ? 219 TYR B C     1 
ATOM   4301 O O     . TYR B 1 219 ? 44.554 29.019 106.499 1.00 50.34 ? 219 TYR B O     1 
ATOM   4302 C CB    . TYR B 1 219 ? 44.685 29.005 103.585 1.00 54.44 ? 219 TYR B CB    1 
ATOM   4303 C CG    . TYR B 1 219 ? 45.167 28.339 102.335 1.00 58.65 ? 219 TYR B CG    1 
ATOM   4304 C CD1   . TYR B 1 219 ? 45.357 26.951 102.292 1.00 60.17 ? 219 TYR B CD1   1 
ATOM   4305 C CD2   . TYR B 1 219 ? 45.524 29.093 101.227 1.00 59.12 ? 219 TYR B CD2   1 
ATOM   4306 C CE1   . TYR B 1 219 ? 45.878 26.341 101.182 1.00 60.24 ? 219 TYR B CE1   1 
ATOM   4307 C CE2   . TYR B 1 219 ? 46.016 28.494 100.113 1.00 60.62 ? 219 TYR B CE2   1 
ATOM   4308 C CZ    . TYR B 1 219 ? 46.196 27.123 100.080 1.00 60.72 ? 219 TYR B CZ    1 
ATOM   4309 O OH    . TYR B 1 219 ? 46.698 26.537 98.926  1.00 60.79 ? 219 TYR B OH    1 
ATOM   4310 N N     . VAL B 1 220 ? 45.965 30.739 106.414 1.00 48.77 ? 220 VAL B N     1 
ATOM   4311 C CA    . VAL B 1 220 ? 45.534 31.261 107.716 1.00 46.70 ? 220 VAL B CA    1 
ATOM   4312 C C     . VAL B 1 220 ? 45.028 32.689 107.622 1.00 45.91 ? 220 VAL B C     1 
ATOM   4313 O O     . VAL B 1 220 ? 45.771 33.621 107.287 1.00 45.69 ? 220 VAL B O     1 
ATOM   4314 C CB    . VAL B 1 220 ? 46.633 31.186 108.760 1.00 46.36 ? 220 VAL B CB    1 
ATOM   4315 C CG1   . VAL B 1 220 ? 46.015 31.338 110.128 1.00 44.11 ? 220 VAL B CG1   1 
ATOM   4316 C CG2   . VAL B 1 220 ? 47.442 29.840 108.600 1.00 45.48 ? 220 VAL B CG2   1 
ATOM   4317 N N     . ARG B 1 221 ? 43.744 32.859 107.915 1.00 44.47 ? 221 ARG B N     1 
ATOM   4318 C CA    . ARG B 1 221 ? 43.167 34.178 107.823 1.00 43.11 ? 221 ARG B CA    1 
ATOM   4319 C C     . ARG B 1 221 ? 42.676 34.699 109.199 1.00 41.62 ? 221 ARG B C     1 
ATOM   4320 O O     . ARG B 1 221 ? 41.700 34.191 109.761 1.00 42.67 ? 221 ARG B O     1 
ATOM   4321 C CB    . ARG B 1 221 ? 42.110 34.199 106.702 1.00 43.13 ? 221 ARG B CB    1 
ATOM   4322 C CG    . ARG B 1 221 ? 42.682 33.995 105.320 1.00 40.93 ? 221 ARG B CG    1 
ATOM   4323 C CD    . ARG B 1 221 ? 43.643 35.089 104.941 1.00 46.12 ? 221 ARG B CD    1 
ATOM   4324 N NE    . ARG B 1 221 ? 44.225 34.858 103.603 1.00 52.93 ? 221 ARG B NE    1 
ATOM   4325 C CZ    . ARG B 1 221 ? 45.057 35.683 102.928 1.00 54.65 ? 221 ARG B CZ    1 
ATOM   4326 N NH1   . ARG B 1 221 ? 45.415 36.859 103.413 1.00 52.84 ? 221 ARG B NH1   1 
ATOM   4327 N NH2   . ARG B 1 221 ? 45.546 35.333 101.735 1.00 56.63 ? 221 ARG B NH2   1 
ATOM   4328 N N     . SER B 1 222 ? 43.375 35.683 109.738 1.00 38.44 ? 222 SER B N     1 
ATOM   4329 C CA    . SER B 1 222 ? 42.847 36.454 110.844 1.00 37.79 ? 222 SER B CA    1 
ATOM   4330 C C     . SER B 1 222 ? 41.705 37.403 110.505 1.00 37.64 ? 222 SER B C     1 
ATOM   4331 O O     . SER B 1 222 ? 41.682 38.146 109.481 1.00 38.57 ? 222 SER B O     1 
ATOM   4332 C CB    . SER B 1 222 ? 43.915 37.318 111.401 1.00 37.76 ? 222 SER B CB    1 
ATOM   4333 O OG    . SER B 1 222 ? 45.078 36.550 111.622 1.00 38.59 ? 222 SER B OG    1 
ATOM   4334 N N     . TYR B 1 223 ? 40.721 37.377 111.379 1.00 36.40 ? 223 TYR B N     1 
ATOM   4335 C CA    . TYR B 1 223 ? 39.688 38.404 111.371 1.00 34.28 ? 223 TYR B CA    1 
ATOM   4336 C C     . TYR B 1 223 ? 39.463 38.740 112.811 1.00 33.64 ? 223 TYR B C     1 
ATOM   4337 O O     . TYR B 1 223 ? 39.931 38.025 113.696 1.00 34.03 ? 223 TYR B O     1 
ATOM   4338 C CB    . TYR B 1 223 ? 38.403 37.941 110.696 1.00 32.85 ? 223 TYR B CB    1 
ATOM   4339 C CG    . TYR B 1 223 ? 37.624 36.807 111.324 1.00 29.04 ? 223 TYR B CG    1 
ATOM   4340 C CD1   . TYR B 1 223 ? 38.054 35.484 111.221 1.00 30.67 ? 223 TYR B CD1   1 
ATOM   4341 C CD2   . TYR B 1 223 ? 36.414 37.028 111.907 1.00 23.93 ? 223 TYR B CD2   1 
ATOM   4342 C CE1   . TYR B 1 223 ? 37.323 34.428 111.715 1.00 22.88 ? 223 TYR B CE1   1 
ATOM   4343 C CE2   . TYR B 1 223 ? 35.698 36.004 112.433 1.00 24.27 ? 223 TYR B CE2   1 
ATOM   4344 C CZ    . TYR B 1 223 ? 36.144 34.699 112.338 1.00 28.38 ? 223 TYR B CZ    1 
ATOM   4345 O OH    . TYR B 1 223 ? 35.336 33.636 112.818 1.00 31.61 ? 223 TYR B OH    1 
ATOM   4346 N N     . LYS B 1 224 ? 38.747 39.817 113.050 1.00 32.14 ? 224 LYS B N     1 
ATOM   4347 C CA    . LYS B 1 224 ? 38.554 40.267 114.411 1.00 30.28 ? 224 LYS B CA    1 
ATOM   4348 C C     . LYS B 1 224 ? 37.345 41.089 114.420 1.00 28.71 ? 224 LYS B C     1 
ATOM   4349 O O     . LYS B 1 224 ? 36.897 41.502 113.373 1.00 31.15 ? 224 LYS B O     1 
ATOM   4350 C CB    . LYS B 1 224 ? 39.727 41.131 114.820 1.00 30.33 ? 224 LYS B CB    1 
ATOM   4351 C CG    . LYS B 1 224 ? 40.267 42.006 113.774 1.00 29.31 ? 224 LYS B CG    1 
ATOM   4352 C CD    . LYS B 1 224 ? 39.428 43.204 113.569 1.00 29.05 ? 224 LYS B CD    1 
ATOM   4353 C CE    . LYS B 1 224 ? 40.380 44.222 113.050 1.00 32.79 ? 224 LYS B CE    1 
ATOM   4354 N NZ    . LYS B 1 224 ? 40.058 45.640 113.232 1.00 36.49 ? 224 LYS B NZ    1 
ATOM   4355 N N     . ASN B 1 225 ? 36.827 41.352 115.587 1.00 27.05 ? 225 ASN B N     1 
ATOM   4356 C CA    . ASN B 1 225 ? 35.680 42.228 115.768 1.00 25.67 ? 225 ASN B CA    1 
ATOM   4357 C C     . ASN B 1 225 ? 35.707 42.742 117.203 1.00 27.13 ? 225 ASN B C     1 
ATOM   4358 O O     . ASN B 1 225 ? 36.454 42.179 118.058 1.00 28.04 ? 225 ASN B O     1 
ATOM   4359 C CB    . ASN B 1 225 ? 34.489 41.369 115.564 1.00 23.10 ? 225 ASN B CB    1 
ATOM   4360 C CG    . ASN B 1 225 ? 33.188 42.124 115.325 1.00 17.26 ? 225 ASN B CG    1 
ATOM   4361 O OD1   . ASN B 1 225 ? 33.118 43.324 115.123 1.00 13.95 ? 225 ASN B OD1   1 
ATOM   4362 N ND2   . ASN B 1 225 ? 32.143 41.383 115.383 1.00 4.89  ? 225 ASN B ND2   1 
ATOM   4363 N N     . HIS B 1 226 ? 34.959 43.830 117.469 1.00 28.74 ? 226 HIS B N     1 
ATOM   4364 C CA    . HIS B 1 226 ? 34.861 44.476 118.852 1.00 28.36 ? 226 HIS B CA    1 
ATOM   4365 C C     . HIS B 1 226 ? 33.719 43.921 119.726 1.00 27.54 ? 226 HIS B C     1 
ATOM   4366 O O     . HIS B 1 226 ? 32.545 44.185 119.420 1.00 29.84 ? 226 HIS B O     1 
ATOM   4367 C CB    . HIS B 1 226 ? 34.748 46.019 118.817 1.00 27.83 ? 226 HIS B CB    1 
ATOM   4368 C CG    . HIS B 1 226 ? 34.681 46.601 120.186 1.00 32.90 ? 226 HIS B CG    1 
ATOM   4369 N ND1   . HIS B 1 226 ? 35.809 46.750 120.992 1.00 34.14 ? 226 HIS B ND1   1 
ATOM   4370 C CD2   . HIS B 1 226 ? 33.619 46.999 120.937 1.00 33.79 ? 226 HIS B CD2   1 
ATOM   4371 C CE1   . HIS B 1 226 ? 35.452 47.237 122.165 1.00 30.85 ? 226 HIS B CE1   1 
ATOM   4372 N NE2   . HIS B 1 226 ? 34.129 47.394 122.155 1.00 37.35 ? 226 HIS B NE2   1 
ATOM   4373 N N     . ILE B 1 227 ? 34.026 43.164 120.781 1.00 25.50 ? 227 ILE B N     1 
ATOM   4374 C CA    . ILE B 1 227 ? 32.955 42.683 121.681 1.00 24.51 ? 227 ILE B CA    1 
ATOM   4375 C C     . ILE B 1 227 ? 32.586 43.563 122.862 1.00 24.30 ? 227 ILE B C     1 
ATOM   4376 O O     . ILE B 1 227 ? 33.327 43.657 123.896 1.00 22.93 ? 227 ILE B O     1 
ATOM   4377 C CB    . ILE B 1 227 ? 33.190 41.256 122.234 1.00 25.64 ? 227 ILE B CB    1 
ATOM   4378 C CG1   . ILE B 1 227 ? 33.121 40.228 121.089 1.00 22.05 ? 227 ILE B CG1   1 
ATOM   4379 C CG2   . ILE B 1 227 ? 32.112 40.963 123.133 1.00 24.92 ? 227 ILE B CG2   1 
ATOM   4380 C CD1   . ILE B 1 227 ? 34.330 40.094 120.634 1.00 17.92 ? 227 ILE B CD1   1 
ATOM   4381 N N     . PRO B 1 228 ? 31.428 44.204 122.712 1.00 23.19 ? 228 PRO B N     1 
ATOM   4382 C CA    . PRO B 1 228 ? 31.211 45.274 123.616 1.00 23.69 ? 228 PRO B CA    1 
ATOM   4383 C C     . PRO B 1 228 ? 31.396 44.894 125.066 1.00 22.89 ? 228 PRO B C     1 
ATOM   4384 O O     . PRO B 1 228 ? 32.141 45.566 125.732 1.00 22.47 ? 228 PRO B O     1 
ATOM   4385 C CB    . PRO B 1 228 ? 29.793 45.707 123.318 1.00 24.95 ? 228 PRO B CB    1 
ATOM   4386 C CG    . PRO B 1 228 ? 29.575 45.237 121.811 1.00 22.28 ? 228 PRO B CG    1 
ATOM   4387 C CD    . PRO B 1 228 ? 30.349 44.033 121.714 1.00 22.38 ? 228 PRO B CD    1 
ATOM   4388 N N     . GLY B 1 229 ? 30.732 43.862 125.533 1.00 22.09 ? 229 GLY B N     1 
ATOM   4389 C CA    . GLY B 1 229 ? 30.761 43.511 126.938 1.00 21.24 ? 229 GLY B CA    1 
ATOM   4390 C C     . GLY B 1 229 ? 32.184 43.097 127.408 1.00 22.87 ? 229 GLY B C     1 
ATOM   4391 O O     . GLY B 1 229 ? 32.473 43.171 128.643 1.00 21.25 ? 229 GLY B O     1 
ATOM   4392 N N     . PHE B 1 230 ? 33.081 42.689 126.467 1.00 20.19 ? 230 PHE B N     1 
ATOM   4393 C CA    . PHE B 1 230 ? 34.446 42.568 126.857 1.00 19.63 ? 230 PHE B CA    1 
ATOM   4394 C C     . PHE B 1 230 ? 35.219 43.919 126.962 1.00 21.26 ? 230 PHE B C     1 
ATOM   4395 O O     . PHE B 1 230 ? 36.324 44.006 127.563 1.00 22.68 ? 230 PHE B O     1 
ATOM   4396 C CB    . PHE B 1 230 ? 35.164 41.652 125.886 1.00 19.29 ? 230 PHE B CB    1 
ATOM   4397 C CG    . PHE B 1 230 ? 34.664 40.174 125.874 1.00 20.62 ? 230 PHE B CG    1 
ATOM   4398 C CD1   . PHE B 1 230 ? 33.712 39.705 126.748 1.00 20.53 ? 230 PHE B CD1   1 
ATOM   4399 C CD2   . PHE B 1 230 ? 35.198 39.259 124.941 1.00 21.19 ? 230 PHE B CD2   1 
ATOM   4400 C CE1   . PHE B 1 230 ? 33.304 38.345 126.669 1.00 25.02 ? 230 PHE B CE1   1 
ATOM   4401 C CE2   . PHE B 1 230 ? 34.825 37.918 124.876 1.00 20.00 ? 230 PHE B CE2   1 
ATOM   4402 C CZ    . PHE B 1 230 ? 33.877 37.449 125.740 1.00 21.19 ? 230 PHE B CZ    1 
ATOM   4403 N N     . PHE B 1 231 ? 34.753 44.971 126.266 1.00 21.78 ? 231 PHE B N     1 
ATOM   4404 C CA    . PHE B 1 231 ? 35.558 46.179 126.076 1.00 19.86 ? 231 PHE B CA    1 
ATOM   4405 C C     . PHE B 1 231 ? 36.891 45.875 125.458 1.00 21.78 ? 231 PHE B C     1 
ATOM   4406 O O     . PHE B 1 231 ? 37.852 46.636 125.615 1.00 22.40 ? 231 PHE B O     1 
ATOM   4407 C CB    . PHE B 1 231 ? 35.768 46.860 127.410 1.00 20.16 ? 231 PHE B CB    1 
ATOM   4408 C CG    . PHE B 1 231 ? 34.498 47.259 128.042 1.00 15.18 ? 231 PHE B CG    1 
ATOM   4409 C CD1   . PHE B 1 231 ? 33.687 46.319 128.685 1.00 11.64 ? 231 PHE B CD1   1 
ATOM   4410 C CD2   . PHE B 1 231 ? 34.052 48.521 127.916 1.00 10.56 ? 231 PHE B CD2   1 
ATOM   4411 C CE1   . PHE B 1 231 ? 32.433 46.694 129.256 1.00 11.80 ? 231 PHE B CE1   1 
ATOM   4412 C CE2   . PHE B 1 231 ? 32.782 48.879 128.490 1.00 12.36 ? 231 PHE B CE2   1 
ATOM   4413 C CZ    . PHE B 1 231 ? 32.001 47.958 129.139 1.00 10.35 ? 231 PHE B CZ    1 
ATOM   4414 N N     . LEU B 1 232 ? 36.918 44.791 124.687 1.00 23.16 ? 232 LEU B N     1 
ATOM   4415 C CA    . LEU B 1 232 ? 38.095 44.373 123.963 1.00 25.21 ? 232 LEU B CA    1 
ATOM   4416 C C     . LEU B 1 232 ? 37.919 44.173 122.458 1.00 26.08 ? 232 LEU B C     1 
ATOM   4417 O O     . LEU B 1 232 ? 36.864 43.749 122.007 1.00 25.63 ? 232 LEU B O     1 
ATOM   4418 C CB    . LEU B 1 232 ? 38.601 43.065 124.549 1.00 24.21 ? 232 LEU B CB    1 
ATOM   4419 C CG    . LEU B 1 232 ? 39.714 43.093 125.586 1.00 22.14 ? 232 LEU B CG    1 
ATOM   4420 C CD1   . LEU B 1 232 ? 40.182 44.480 125.945 1.00 20.28 ? 232 LEU B CD1   1 
ATOM   4421 C CD2   . LEU B 1 232 ? 39.259 42.231 126.780 1.00 12.06 ? 232 LEU B CD2   1 
ATOM   4422 N N     . ASN B 1 233 ? 38.998 44.404 121.710 1.00 27.74 ? 233 ASN B N     1 
ATOM   4423 C CA    . ASN B 1 233 ? 39.061 43.860 120.308 1.00 29.26 ? 233 ASN B CA    1 
ATOM   4424 C C     . ASN B 1 233 ? 39.464 42.402 120.205 1.00 28.27 ? 233 ASN B C     1 
ATOM   4425 O O     . ASN B 1 233 ? 40.638 42.044 120.317 1.00 25.77 ? 233 ASN B O     1 
ATOM   4426 C CB    . ASN B 1 233 ? 40.071 44.587 119.452 1.00 29.25 ? 233 ASN B CB    1 
ATOM   4427 C CG    . ASN B 1 233 ? 39.652 44.601 118.092 1.00 30.97 ? 233 ASN B CG    1 
ATOM   4428 O OD1   . ASN B 1 233 ? 40.125 45.381 117.271 1.00 33.65 ? 233 ASN B OD1   1 
ATOM   4429 N ND2   . ASN B 1 233 ? 38.612 43.810 117.829 1.00 37.77 ? 233 ASN B ND2   1 
ATOM   4430 N N     . PHE B 1 234 ? 38.512 41.533 119.991 1.00 29.88 ? 234 PHE B N     1 
ATOM   4431 C CA    . PHE B 1 234 ? 38.947 40.132 119.969 1.00 31.07 ? 234 PHE B CA    1 
ATOM   4432 C C     . PHE B 1 234 ? 39.438 39.688 118.667 1.00 29.57 ? 234 PHE B C     1 
ATOM   4433 O O     . PHE B 1 234 ? 38.983 40.199 117.673 1.00 31.15 ? 234 PHE B O     1 
ATOM   4434 C CB    . PHE B 1 234 ? 37.914 39.183 120.532 1.00 32.57 ? 234 PHE B CB    1 
ATOM   4435 C CG    . PHE B 1 234 ? 38.351 38.573 121.823 1.00 35.74 ? 234 PHE B CG    1 
ATOM   4436 C CD1   . PHE B 1 234 ? 38.728 37.212 121.870 1.00 37.57 ? 234 PHE B CD1   1 
ATOM   4437 C CD2   . PHE B 1 234 ? 38.487 39.370 122.964 1.00 36.81 ? 234 PHE B CD2   1 
ATOM   4438 C CE1   . PHE B 1 234 ? 39.146 36.646 123.023 1.00 37.63 ? 234 PHE B CE1   1 
ATOM   4439 C CE2   . PHE B 1 234 ? 38.889 38.817 124.175 1.00 40.56 ? 234 PHE B CE2   1 
ATOM   4440 C CZ    . PHE B 1 234 ? 39.262 37.456 124.206 1.00 40.16 ? 234 PHE B CZ    1 
ATOM   4441 N N     . GLY B 1 235 ? 40.380 38.770 118.678 1.00 28.58 ? 235 GLY B N     1 
ATOM   4442 C CA    . GLY B 1 235 ? 40.984 38.276 117.449 1.00 27.92 ? 235 GLY B CA    1 
ATOM   4443 C C     . GLY B 1 235 ? 40.495 36.896 117.182 1.00 27.21 ? 235 GLY B C     1 
ATOM   4444 O O     . GLY B 1 235 ? 40.362 36.098 118.086 1.00 25.03 ? 235 GLY B O     1 
ATOM   4445 N N     . PHE B 1 236 ? 40.146 36.637 115.931 1.00 29.56 ? 236 PHE B N     1 
ATOM   4446 C CA    . PHE B 1 236 ? 39.737 35.263 115.462 1.00 30.70 ? 236 PHE B CA    1 
ATOM   4447 C C     . PHE B 1 236 ? 40.554 34.946 114.264 1.00 30.70 ? 236 PHE B C     1 
ATOM   4448 O O     . PHE B 1 236 ? 41.382 35.802 113.846 1.00 30.70 ? 236 PHE B O     1 
ATOM   4449 C CB    . PHE B 1 236 ? 38.263 35.204 115.110 1.00 30.07 ? 236 PHE B CB    1 
ATOM   4450 C CG    . PHE B 1 236 ? 37.389 35.710 116.203 1.00 29.07 ? 236 PHE B CG    1 
ATOM   4451 C CD1   . PHE B 1 236 ? 36.933 34.870 117.178 1.00 29.33 ? 236 PHE B CD1   1 
ATOM   4452 C CD2   . PHE B 1 236 ? 37.077 37.034 116.277 1.00 26.48 ? 236 PHE B CD2   1 
ATOM   4453 C CE1   . PHE B 1 236 ? 36.118 35.341 118.201 1.00 30.63 ? 236 PHE B CE1   1 
ATOM   4454 C CE2   . PHE B 1 236 ? 36.296 37.514 117.276 1.00 28.25 ? 236 PHE B CE2   1 
ATOM   4455 C CZ    . PHE B 1 236 ? 35.800 36.668 118.244 1.00 30.25 ? 236 PHE B CZ    1 
ATOM   4456 N N     . LEU B 1 237 ? 40.360 33.717 113.772 1.00 30.87 ? 237 LEU B N     1 
ATOM   4457 C CA    . LEU B 1 237 ? 40.990 33.199 112.542 1.00 31.51 ? 237 LEU B CA    1 
ATOM   4458 C C     . LEU B 1 237 ? 40.279 31.984 111.943 1.00 32.90 ? 237 LEU B C     1 
ATOM   4459 O O     . LEU B 1 237 ? 39.468 31.319 112.607 1.00 33.10 ? 237 LEU B O     1 
ATOM   4460 C CB    . LEU B 1 237 ? 42.483 32.925 112.743 1.00 31.42 ? 237 LEU B CB    1 
ATOM   4461 C CG    . LEU B 1 237 ? 43.242 31.604 113.077 1.00 31.09 ? 237 LEU B CG    1 
ATOM   4462 C CD1   . LEU B 1 237 ? 44.641 31.873 113.766 1.00 25.10 ? 237 LEU B CD1   1 
ATOM   4463 C CD2   . LEU B 1 237 ? 42.441 30.456 113.795 1.00 23.47 ? 237 LEU B CD2   1 
ATOM   4464 N N     . LEU B 1 238 ? 40.524 31.776 110.650 1.00 34.31 ? 238 LEU B N     1 
ATOM   4465 C CA    . LEU B 1 238 ? 40.155 30.563 109.913 1.00 35.49 ? 238 LEU B CA    1 
ATOM   4466 C C     . LEU B 1 238 ? 41.422 29.966 109.292 1.00 38.01 ? 238 LEU B C     1 
ATOM   4467 O O     . LEU B 1 238 ? 42.390 30.689 108.907 1.00 38.43 ? 238 LEU B O     1 
ATOM   4468 C CB    . LEU B 1 238 ? 39.168 30.863 108.806 1.00 34.50 ? 238 LEU B CB    1 
ATOM   4469 C CG    . LEU B 1 238 ? 37.693 31.025 109.035 1.00 31.63 ? 238 LEU B CG    1 
ATOM   4470 C CD1   . LEU B 1 238 ? 37.391 31.280 110.469 1.00 35.03 ? 238 LEU B CD1   1 
ATOM   4471 C CD2   . LEU B 1 238 ? 37.042 32.089 108.075 1.00 33.86 ? 238 LEU B CD2   1 
ATOM   4472 N N     . ALA B 1 239 ? 41.440 28.640 109.238 1.00 40.70 ? 239 ALA B N     1 
ATOM   4473 C CA    . ALA B 1 239 ? 42.553 27.921 108.681 1.00 42.53 ? 239 ALA B CA    1 
ATOM   4474 C C     . ALA B 1 239 ? 41.988 26.755 107.897 1.00 45.91 ? 239 ALA B C     1 
ATOM   4475 O O     . ALA B 1 239 ? 41.050 26.083 108.352 1.00 46.98 ? 239 ALA B O     1 
ATOM   4476 C CB    . ALA B 1 239 ? 43.431 27.477 109.749 1.00 41.20 ? 239 ALA B CB    1 
ATOM   4477 N N     . SER B 1 240 ? 42.513 26.532 106.694 1.00 49.02 ? 240 SER B N     1 
ATOM   4478 C CA    . SER B 1 240 ? 42.228 25.297 105.978 1.00 52.42 ? 240 SER B CA    1 
ATOM   4479 C C     . SER B 1 240 ? 43.406 24.926 105.070 1.00 54.69 ? 240 SER B C     1 
ATOM   4480 O O     . SER B 1 240 ? 44.248 25.761 104.749 1.00 54.99 ? 240 SER B O     1 
ATOM   4481 C CB    . SER B 1 240 ? 40.888 25.379 105.238 1.00 52.37 ? 240 SER B CB    1 
ATOM   4482 O OG    . SER B 1 240 ? 40.987 24.927 103.899 1.00 55.13 ? 240 SER B OG    1 
ATOM   4483 N N     . ASP B 1 241 ? 43.485 23.647 104.703 1.00 57.07 ? 241 ASP B N     1 
ATOM   4484 C CA    . ASP B 1 241 ? 44.555 23.183 103.850 1.00 57.89 ? 241 ASP B CA    1 
ATOM   4485 C C     . ASP B 1 241 ? 44.094 23.255 102.439 1.00 58.45 ? 241 ASP B C     1 
ATOM   4486 O O     . ASP B 1 241 ? 44.924 23.289 101.558 1.00 58.16 ? 241 ASP B O     1 
ATOM   4487 C CB    . ASP B 1 241 ? 44.980 21.770 104.200 1.00 57.95 ? 241 ASP B CB    1 
ATOM   4488 C CG    . ASP B 1 241 ? 46.362 21.726 104.822 1.00 60.07 ? 241 ASP B CG    1 
ATOM   4489 O OD1   . ASP B 1 241 ? 46.916 20.608 104.962 1.00 59.93 ? 241 ASP B OD1   1 
ATOM   4490 O OD2   . ASP B 1 241 ? 46.908 22.804 105.186 1.00 62.73 ? 241 ASP B OD2   1 
ATOM   4491 N N     . ALA B 1 242 ? 42.774 23.278 102.238 1.00 59.44 ? 242 ALA B N     1 
ATOM   4492 C CA    . ALA B 1 242 ? 42.174 23.354 100.897 1.00 60.73 ? 242 ALA B CA    1 
ATOM   4493 C C     . ALA B 1 242 ? 42.325 24.771 100.268 1.00 61.67 ? 242 ALA B C     1 
ATOM   4494 O O     . ALA B 1 242 ? 43.436 25.221 99.965  1.00 62.14 ? 242 ALA B O     1 
ATOM   4495 C CB    . ALA B 1 242 ? 40.705 22.889 100.918 1.00 60.08 ? 242 ALA B CB    1 
ATOM   4496 N N     . PHE B 1 243 ? 41.222 25.475 100.062 1.00 62.33 ? 243 PHE B N     1 
ATOM   4497 C CA    . PHE B 1 243 ? 41.255 26.904 99.697  1.00 62.87 ? 243 PHE B CA    1 
ATOM   4498 C C     . PHE B 1 243 ? 41.914 27.976 100.748 1.00 62.53 ? 243 PHE B C     1 
ATOM   4499 O O     . PHE B 1 243 ? 42.237 27.627 101.883 1.00 63.18 ? 243 PHE B O     1 
ATOM   4500 C CB    . PHE B 1 243 ? 39.807 27.237 99.336  1.00 63.69 ? 243 PHE B CB    1 
ATOM   4501 C CG    . PHE B 1 243 ? 38.823 26.961 100.463 1.00 66.59 ? 243 PHE B CG    1 
ATOM   4502 C CD1   . PHE B 1 243 ? 39.150 26.065 101.511 1.00 67.72 ? 243 PHE B CD1   1 
ATOM   4503 C CD2   . PHE B 1 243 ? 37.568 27.614 100.492 1.00 69.47 ? 243 PHE B CD2   1 
ATOM   4504 C CE1   . PHE B 1 243 ? 38.255 25.811 102.557 1.00 68.25 ? 243 PHE B CE1   1 
ATOM   4505 C CE2   . PHE B 1 243 ? 36.654 27.379 101.532 1.00 70.42 ? 243 PHE B CE2   1 
ATOM   4506 C CZ    . PHE B 1 243 ? 36.998 26.467 102.574 1.00 68.91 ? 243 PHE B CZ    1 
ATOM   4507 N N     . ASP B 1 244 ? 42.179 29.219 100.298 1.00 61.40 ? 244 ASP B N     1 
ATOM   4508 C CA    . ASP B 1 244 ? 42.147 30.509 101.094 1.00 60.67 ? 244 ASP B CA    1 
ATOM   4509 C C     . ASP B 1 244 ? 40.694 30.765 101.587 1.00 60.27 ? 244 ASP B C     1 
ATOM   4510 O O     . ASP B 1 244 ? 39.813 31.126 100.773 1.00 59.82 ? 244 ASP B O     1 
ATOM   4511 C CB    . ASP B 1 244 ? 42.622 31.696 100.177 1.00 59.61 ? 244 ASP B CB    1 
ATOM   4512 C CG    . ASP B 1 244 ? 42.825 33.047 100.906 1.00 59.23 ? 244 ASP B CG    1 
ATOM   4513 O OD1   . ASP B 1 244 ? 42.655 33.118 102.138 1.00 58.58 ? 244 ASP B OD1   1 
ATOM   4514 O OD2   . ASP B 1 244 ? 43.150 34.065 100.235 1.00 49.80 ? 244 ASP B OD2   1 
ATOM   4515 N N     . PRO B 1 245 ? 40.438 30.640 102.923 1.00 59.77 ? 245 PRO B N     1 
ATOM   4516 C CA    . PRO B 1 245 ? 39.080 30.854 103.496 1.00 59.29 ? 245 PRO B CA    1 
ATOM   4517 C C     . PRO B 1 245 ? 38.631 32.283 103.446 1.00 58.17 ? 245 PRO B C     1 
ATOM   4518 O O     . PRO B 1 245 ? 37.465 32.555 103.706 1.00 57.31 ? 245 PRO B O     1 
ATOM   4519 C CB    . PRO B 1 245 ? 39.228 30.454 104.969 1.00 59.01 ? 245 PRO B CB    1 
ATOM   4520 C CG    . PRO B 1 245 ? 40.643 30.385 105.220 1.00 59.20 ? 245 PRO B CG    1 
ATOM   4521 C CD    . PRO B 1 245 ? 41.433 30.350 103.957 1.00 58.86 ? 245 PRO B CD    1 
ATOM   4522 N N     . ALA B 1 246 ? 39.577 33.162 103.112 1.00 58.46 ? 246 ALA B N     1 
ATOM   4523 C CA    . ALA B 1 246 ? 39.417 34.620 103.110 1.00 59.24 ? 246 ALA B CA    1 
ATOM   4524 C C     . ALA B 1 246 ? 39.040 35.201 101.806 1.00 59.38 ? 246 ALA B C     1 
ATOM   4525 O O     . ALA B 1 246 ? 38.550 36.325 101.796 1.00 60.44 ? 246 ALA B O     1 
ATOM   4526 C CB    . ALA B 1 246 ? 40.694 35.325 103.574 1.00 59.09 ? 246 ALA B CB    1 
ATOM   4527 N N     . ALA B 1 247 ? 39.353 34.502 100.712 1.00 59.58 ? 247 ALA B N     1 
ATOM   4528 C CA    . ALA B 1 247 ? 39.030 34.982 99.349  1.00 59.38 ? 247 ALA B CA    1 
ATOM   4529 C C     . ALA B 1 247 ? 37.662 34.466 98.949  1.00 59.06 ? 247 ALA B C     1 
ATOM   4530 O O     . ALA B 1 247 ? 37.526 33.575 98.121  1.00 58.93 ? 247 ALA B O     1 
ATOM   4531 C CB    . ALA B 1 247 ? 40.090 34.540 98.311  1.00 59.39 ? 247 ALA B CB    1 
ATOM   4532 N N     . PHE B 1 248 ? 36.625 35.011 99.539  1.00 58.00 ? 248 PHE B N     1 
ATOM   4533 C CA    . PHE B 1 248 ? 35.343 34.473 99.209  1.00 57.88 ? 248 PHE B CA    1 
ATOM   4534 C C     . PHE B 1 248 ? 34.953 35.471 98.199  1.00 56.68 ? 248 PHE B C     1 
ATOM   4535 O O     . PHE B 1 248 ? 35.714 36.375 98.004  1.00 55.47 ? 248 PHE B O     1 
ATOM   4536 C CB    . PHE B 1 248 ? 34.377 34.415 100.437 1.00 58.76 ? 248 PHE B CB    1 
ATOM   4537 C CG    . PHE B 1 248 ? 34.745 35.367 101.619 1.00 57.95 ? 248 PHE B CG    1 
ATOM   4538 C CD1   . PHE B 1 248 ? 35.121 36.692 101.414 1.00 58.66 ? 248 PHE B CD1   1 
ATOM   4539 C CD2   . PHE B 1 248 ? 34.662 34.925 102.917 1.00 56.37 ? 248 PHE B CD2   1 
ATOM   4540 C CE1   . PHE B 1 248 ? 35.450 37.514 102.485 1.00 57.51 ? 248 PHE B CE1   1 
ATOM   4541 C CE2   . PHE B 1 248 ? 34.977 35.749 103.966 1.00 54.35 ? 248 PHE B CE2   1 
ATOM   4542 C CZ    . PHE B 1 248 ? 35.368 37.033 103.753 1.00 56.61 ? 248 PHE B CZ    1 
ATOM   4543 N N     . SER B 1 249 ? 33.846 35.246 97.505  1.00 56.86 ? 249 SER B N     1 
ATOM   4544 C CA    . SER B 1 249 ? 33.035 36.332 96.976  1.00 57.41 ? 249 SER B CA    1 
ATOM   4545 C C     . SER B 1 249 ? 32.112 36.853 98.141  1.00 58.58 ? 249 SER B C     1 
ATOM   4546 O O     . SER B 1 249 ? 31.856 36.102 99.105  1.00 58.86 ? 249 SER B O     1 
ATOM   4547 C CB    . SER B 1 249 ? 32.213 35.841 95.769  1.00 56.52 ? 249 SER B CB    1 
ATOM   4548 O OG    . SER B 1 249 ? 31.171 36.762 95.447  1.00 52.43 ? 249 SER B OG    1 
ATOM   4549 N N     . GLU B 1 250 ? 31.656 38.129 98.067  1.00 59.29 ? 250 GLU B N     1 
ATOM   4550 C CA    . GLU B 1 250 ? 30.516 38.672 98.873  1.00 58.55 ? 250 GLU B CA    1 
ATOM   4551 C C     . GLU B 1 250 ? 29.073 38.328 98.341  1.00 58.64 ? 250 GLU B C     1 
ATOM   4552 O O     . GLU B 1 250 ? 28.108 38.283 99.130  1.00 59.16 ? 250 GLU B O     1 
ATOM   4553 C CB    . GLU B 1 250 ? 30.639 40.166 99.033  1.00 59.27 ? 250 GLU B CB    1 
ATOM   4554 C CG    . GLU B 1 250 ? 29.664 40.681 100.028 1.00 63.00 ? 250 GLU B CG    1 
ATOM   4555 C CD    . GLU B 1 250 ? 29.110 42.022 99.612  1.00 71.29 ? 250 GLU B CD    1 
ATOM   4556 O OE1   . GLU B 1 250 ? 27.895 42.266 99.829  1.00 73.61 ? 250 GLU B OE1   1 
ATOM   4557 O OE2   . GLU B 1 250 ? 29.892 42.847 99.055  1.00 72.25 ? 250 GLU B OE2   1 
ATOM   4558 N N     . GLY B 1 251 ? 28.947 38.042 97.030  1.00 57.44 ? 251 GLY B N     1 
ATOM   4559 C CA    . GLY B 1 251 ? 27.707 37.522 96.408  1.00 55.03 ? 251 GLY B CA    1 
ATOM   4560 C C     . GLY B 1 251 ? 27.320 36.168 96.964  1.00 52.86 ? 251 GLY B C     1 
ATOM   4561 O O     . GLY B 1 251 ? 26.138 35.868 97.158  1.00 51.99 ? 251 GLY B O     1 
ATOM   4562 N N     . VAL B 1 252 ? 28.341 35.360 97.227  1.00 51.48 ? 252 VAL B N     1 
ATOM   4563 C CA    . VAL B 1 252 ? 28.198 33.975 97.667  1.00 50.46 ? 252 VAL B CA    1 
ATOM   4564 C C     . VAL B 1 252 ? 27.844 33.789 99.148  1.00 50.07 ? 252 VAL B C     1 
ATOM   4565 O O     . VAL B 1 252 ? 27.083 32.883 99.516  1.00 50.48 ? 252 VAL B O     1 
ATOM   4566 C CB    . VAL B 1 252 ? 29.539 33.259 97.543  1.00 51.11 ? 252 VAL B CB    1 
ATOM   4567 C CG1   . VAL B 1 252 ? 29.429 31.751 98.017  1.00 47.33 ? 252 VAL B CG1   1 
ATOM   4568 C CG2   . VAL B 1 252 ? 30.098 33.446 96.162  1.00 51.04 ? 252 VAL B CG2   1 
ATOM   4569 N N     . ILE B 1 253 ? 28.477 34.592 99.995  1.00 47.60 ? 253 ILE B N     1 
ATOM   4570 C CA    . ILE B 1 253 ? 28.222 34.531 101.392 1.00 45.79 ? 253 ILE B CA    1 
ATOM   4571 C C     . ILE B 1 253 ? 26.725 34.886 101.610 1.00 44.39 ? 253 ILE B C     1 
ATOM   4572 O O     . ILE B 1 253 ? 26.006 34.161 102.228 1.00 43.90 ? 253 ILE B O     1 
ATOM   4573 C CB    . ILE B 1 253 ? 29.257 35.422 102.142 1.00 44.87 ? 253 ILE B CB    1 
ATOM   4574 C CG1   . ILE B 1 253 ? 30.359 34.587 102.783 1.00 45.28 ? 253 ILE B CG1   1 
ATOM   4575 C CG2   . ILE B 1 253 ? 28.626 36.015 103.296 1.00 46.73 ? 253 ILE B CG2   1 
ATOM   4576 C CD1   . ILE B 1 253 ? 31.216 33.642 101.882 1.00 46.84 ? 253 ILE B CD1   1 
ATOM   4577 N N     . GLU B 1 254 ? 26.296 36.019 101.097 1.00 43.81 ? 254 GLU B N     1 
ATOM   4578 C CA    . GLU B 1 254 ? 24.895 36.365 100.917 1.00 44.32 ? 254 GLU B CA    1 
ATOM   4579 C C     . GLU B 1 254 ? 23.930 35.209 100.440 1.00 43.51 ? 254 GLU B C     1 
ATOM   4580 O O     . GLU B 1 254 ? 22.831 34.986 100.944 1.00 42.47 ? 254 GLU B O     1 
ATOM   4581 C CB    . GLU B 1 254 ? 24.879 37.496 99.862  1.00 44.32 ? 254 GLU B CB    1 
ATOM   4582 C CG    . GLU B 1 254 ? 23.532 38.062 99.615  1.00 44.66 ? 254 GLU B CG    1 
ATOM   4583 C CD    . GLU B 1 254 ? 22.998 38.756 100.857 1.00 49.04 ? 254 GLU B CD    1 
ATOM   4584 O OE1   . GLU B 1 254 ? 23.800 39.313 101.674 1.00 48.90 ? 254 GLU B OE1   1 
ATOM   4585 O OE2   . GLU B 1 254 ? 21.757 38.711 101.032 1.00 51.64 ? 254 GLU B OE2   1 
ATOM   4586 N N     . ALA B 1 255 ? 24.374 34.523 99.406  1.00 43.45 ? 255 ALA B N     1 
ATOM   4587 C CA    . ALA B 1 255 ? 23.698 33.388 98.879  1.00 42.64 ? 255 ALA B CA    1 
ATOM   4588 C C     . ALA B 1 255 ? 23.370 32.532 100.070 1.00 42.80 ? 255 ALA B C     1 
ATOM   4589 O O     . ALA B 1 255 ? 22.178 32.376 100.440 1.00 43.43 ? 255 ALA B O     1 
ATOM   4590 C CB    . ALA B 1 255 ? 24.625 32.669 97.979  1.00 41.53 ? 255 ALA B CB    1 
ATOM   4591 N N     . ARG B 1 256 ? 24.438 32.044 100.698 1.00 41.37 ? 256 ARG B N     1 
ATOM   4592 C CA    . ARG B 1 256 ? 24.348 31.001 101.683 1.00 41.16 ? 256 ARG B CA    1 
ATOM   4593 C C     . ARG B 1 256 ? 23.620 31.378 102.946 1.00 40.24 ? 256 ARG B C     1 
ATOM   4594 O O     . ARG B 1 256 ? 22.989 30.546 103.526 1.00 41.38 ? 256 ARG B O     1 
ATOM   4595 C CB    . ARG B 1 256 ? 25.716 30.454 101.968 1.00 41.51 ? 256 ARG B CB    1 
ATOM   4596 C CG    . ARG B 1 256 ? 26.400 30.027 100.676 1.00 44.23 ? 256 ARG B CG    1 
ATOM   4597 C CD    . ARG B 1 256 ? 27.754 29.437 100.953 1.00 48.88 ? 256 ARG B CD    1 
ATOM   4598 N NE    . ARG B 1 256 ? 28.428 29.002 99.741  1.00 50.37 ? 256 ARG B NE    1 
ATOM   4599 C CZ    . ARG B 1 256 ? 29.668 28.506 99.677  1.00 53.90 ? 256 ARG B CZ    1 
ATOM   4600 N NH1   . ARG B 1 256 ? 30.458 28.336 100.766 1.00 53.68 ? 256 ARG B NH1   1 
ATOM   4601 N NH2   . ARG B 1 256 ? 30.130 28.168 98.480  1.00 54.51 ? 256 ARG B NH2   1 
ATOM   4602 N N     . ILE B 1 257 ? 23.640 32.652 103.312 1.00 39.23 ? 257 ILE B N     1 
ATOM   4603 C CA    . ILE B 1 257 ? 22.816 33.170 104.347 1.00 37.88 ? 257 ILE B CA    1 
ATOM   4604 C C     . ILE B 1 257 ? 21.354 33.025 103.990 1.00 40.27 ? 257 ILE B C     1 
ATOM   4605 O O     . ILE B 1 257 ? 20.665 32.180 104.594 1.00 41.22 ? 257 ILE B O     1 
ATOM   4606 C CB    . ILE B 1 257 ? 23.194 34.641 104.712 1.00 37.51 ? 257 ILE B CB    1 
ATOM   4607 C CG1   . ILE B 1 257 ? 24.635 34.652 105.178 1.00 34.01 ? 257 ILE B CG1   1 
ATOM   4608 C CG2   . ILE B 1 257 ? 22.267 35.214 105.838 1.00 33.35 ? 257 ILE B CG2   1 
ATOM   4609 C CD1   . ILE B 1 257 ? 25.191 35.938 105.673 1.00 29.76 ? 257 ILE B CD1   1 
ATOM   4610 N N     . ARG B 1 258 ? 20.878 33.818 103.030 1.00 41.82 ? 258 ARG B N     1 
ATOM   4611 C CA    . ARG B 1 258 ? 19.471 33.766 102.557 1.00 44.54 ? 258 ARG B CA    1 
ATOM   4612 C C     . ARG B 1 258 ? 19.023 32.314 102.395 1.00 45.93 ? 258 ARG B C     1 
ATOM   4613 O O     . ARG B 1 258 ? 17.958 31.905 102.866 1.00 46.46 ? 258 ARG B O     1 
ATOM   4614 C CB    . ARG B 1 258 ? 19.342 34.403 101.159 1.00 45.37 ? 258 ARG B CB    1 
ATOM   4615 C CG    . ARG B 1 258 ? 19.556 35.865 101.056 1.00 47.55 ? 258 ARG B CG    1 
ATOM   4616 C CD    . ARG B 1 258 ? 18.234 36.677 101.101 1.00 55.43 ? 258 ARG B CD    1 
ATOM   4617 N NE    . ARG B 1 258 ? 18.598 38.070 101.373 1.00 63.07 ? 258 ARG B NE    1 
ATOM   4618 C CZ    . ARG B 1 258 ? 19.258 38.869 100.519 1.00 66.79 ? 258 ARG B CZ    1 
ATOM   4619 N NH1   . ARG B 1 258 ? 19.598 38.421 99.302  1.00 67.48 ? 258 ARG B NH1   1 
ATOM   4620 N NH2   . ARG B 1 258 ? 19.588 40.122 100.877 1.00 66.92 ? 258 ARG B NH2   1 
ATOM   4621 N N     . GLU B 1 259 ? 19.854 31.574 101.659 1.00 47.23 ? 259 GLU B N     1 
ATOM   4622 C CA    . GLU B 1 259 ? 19.740 30.141 101.409 1.00 48.52 ? 259 GLU B CA    1 
ATOM   4623 C C     . GLU B 1 259 ? 19.370 29.313 102.677 1.00 47.73 ? 259 GLU B C     1 
ATOM   4624 O O     . GLU B 1 259 ? 18.249 28.810 102.807 1.00 46.32 ? 259 GLU B O     1 
ATOM   4625 C CB    . GLU B 1 259 ? 21.107 29.695 100.854 1.00 50.50 ? 259 GLU B CB    1 
ATOM   4626 C CG    . GLU B 1 259 ? 21.066 28.685 99.714  1.00 55.09 ? 259 GLU B CG    1 
ATOM   4627 C CD    . GLU B 1 259 ? 20.309 27.490 100.168 1.00 61.86 ? 259 GLU B CD    1 
ATOM   4628 O OE1   . GLU B 1 259 ? 19.951 27.514 101.375 1.00 61.23 ? 259 GLU B OE1   1 
ATOM   4629 O OE2   . GLU B 1 259 ? 20.062 26.550 99.360  1.00 65.65 ? 259 GLU B OE2   1 
ATOM   4630 N N     . ARG B 1 260 ? 20.316 29.216 103.616 1.00 46.72 ? 260 ARG B N     1 
ATOM   4631 C CA    . ARG B 1 260 ? 20.121 28.442 104.842 1.00 45.60 ? 260 ARG B CA    1 
ATOM   4632 C C     . ARG B 1 260 ? 19.298 29.093 105.942 1.00 45.13 ? 260 ARG B C     1 
ATOM   4633 O O     . ARG B 1 260 ? 19.362 28.629 107.069 1.00 44.22 ? 260 ARG B O     1 
ATOM   4634 C CB    . ARG B 1 260 ? 21.478 28.031 105.465 1.00 45.33 ? 260 ARG B CB    1 
ATOM   4635 C CG    . ARG B 1 260 ? 22.544 27.616 104.520 1.00 41.12 ? 260 ARG B CG    1 
ATOM   4636 C CD    . ARG B 1 260 ? 23.888 27.792 105.173 1.00 40.93 ? 260 ARG B CD    1 
ATOM   4637 N NE    . ARG B 1 260 ? 25.018 27.240 104.432 1.00 40.00 ? 260 ARG B NE    1 
ATOM   4638 C CZ    . ARG B 1 260 ? 26.232 27.089 104.931 1.00 38.31 ? 260 ARG B CZ    1 
ATOM   4639 N NH1   . ARG B 1 260 ? 26.496 27.470 106.187 1.00 41.05 ? 260 ARG B NH1   1 
ATOM   4640 N NH2   . ARG B 1 260 ? 27.187 26.588 104.162 1.00 38.79 ? 260 ARG B NH2   1 
ATOM   4641 N N     . ASN B 1 261 ? 18.579 30.170 105.631 1.00 45.44 ? 261 ASN B N     1 
ATOM   4642 C CA    . ASN B 1 261 ? 17.705 30.891 106.620 1.00 46.55 ? 261 ASN B CA    1 
ATOM   4643 C C     . ASN B 1 261 ? 18.279 31.060 108.005 1.00 45.92 ? 261 ASN B C     1 
ATOM   4644 O O     . ASN B 1 261 ? 17.605 30.771 109.038 1.00 44.71 ? 261 ASN B O     1 
ATOM   4645 C CB    . ASN B 1 261 ? 16.300 30.290 106.759 1.00 47.32 ? 261 ASN B CB    1 
ATOM   4646 C CG    . ASN B 1 261 ? 15.604 30.184 105.444 1.00 49.65 ? 261 ASN B CG    1 
ATOM   4647 O OD1   . ASN B 1 261 ? 15.622 31.145 104.648 1.00 54.54 ? 261 ASN B OD1   1 
ATOM   4648 N ND2   . ASN B 1 261 ? 15.035 29.003 105.156 1.00 50.81 ? 261 ASN B ND2   1 
ATOM   4649 N N     . LEU B 1 262 ? 19.547 31.494 107.984 1.00 44.88 ? 262 LEU B N     1 
ATOM   4650 C CA    . LEU B 1 262 ? 20.273 31.911 109.144 1.00 43.18 ? 262 LEU B CA    1 
ATOM   4651 C C     . LEU B 1 262 ? 19.573 33.144 109.674 1.00 42.70 ? 262 LEU B C     1 
ATOM   4652 O O     . LEU B 1 262 ? 19.375 34.116 108.933 1.00 41.99 ? 262 LEU B O     1 
ATOM   4653 C CB    . LEU B 1 262 ? 21.660 32.256 108.712 1.00 42.20 ? 262 LEU B CB    1 
ATOM   4654 C CG    . LEU B 1 262 ? 22.635 31.106 108.763 1.00 43.36 ? 262 LEU B CG    1 
ATOM   4655 C CD1   . LEU B 1 262 ? 24.081 31.730 108.713 1.00 42.62 ? 262 LEU B CD1   1 
ATOM   4656 C CD2   . LEU B 1 262 ? 22.427 30.272 110.007 1.00 42.64 ? 262 LEU B CD2   1 
ATOM   4657 N N     . ALA B 1 263 ? 19.130 33.089 110.931 1.00 42.58 ? 263 ALA B N     1 
ATOM   4658 C CA    . ALA B 1 263 ? 18.696 34.325 111.614 1.00 41.98 ? 263 ALA B CA    1 
ATOM   4659 C C     . ALA B 1 263 ? 19.998 34.937 112.049 1.00 40.79 ? 263 ALA B C     1 
ATOM   4660 O O     . ALA B 1 263 ? 20.799 34.262 112.722 1.00 42.31 ? 263 ALA B O     1 
ATOM   4661 C CB    . ALA B 1 263 ? 17.869 33.993 112.829 1.00 42.66 ? 263 ALA B CB    1 
ATOM   4662 N N     . LEU B 1 264 ? 20.254 36.179 111.662 1.00 38.39 ? 264 LEU B N     1 
ATOM   4663 C CA    . LEU B 1 264 ? 21.483 36.883 112.139 1.00 35.51 ? 264 LEU B CA    1 
ATOM   4664 C C     . LEU B 1 264 ? 21.078 38.141 112.817 1.00 34.60 ? 264 LEU B C     1 
ATOM   4665 O O     . LEU B 1 264 ? 20.002 38.690 112.511 1.00 34.31 ? 264 LEU B O     1 
ATOM   4666 C CB    . LEU B 1 264 ? 22.513 37.122 111.049 1.00 33.49 ? 264 LEU B CB    1 
ATOM   4667 C CG    . LEU B 1 264 ? 23.014 35.729 110.798 1.00 33.37 ? 264 LEU B CG    1 
ATOM   4668 C CD1   . LEU B 1 264 ? 23.932 35.579 109.560 1.00 32.15 ? 264 LEU B CD1   1 
ATOM   4669 C CD2   . LEU B 1 264 ? 23.659 35.214 112.088 1.00 34.48 ? 264 LEU B CD2   1 
ATOM   4670 N N     . ARG B 1 265 ? 21.865 38.557 113.801 1.00 33.40 ? 265 ARG B N     1 
ATOM   4671 C CA    . ARG B 1 265 ? 21.468 39.746 114.520 1.00 32.76 ? 265 ARG B CA    1 
ATOM   4672 C C     . ARG B 1 265 ? 22.547 40.715 114.492 1.00 32.00 ? 265 ARG B C     1 
ATOM   4673 O O     . ARG B 1 265 ? 22.261 41.884 114.562 1.00 32.09 ? 265 ARG B O     1 
ATOM   4674 C CB    . ARG B 1 265 ? 20.931 39.444 115.906 1.00 32.47 ? 265 ARG B CB    1 
ATOM   4675 C CG    . ARG B 1 265 ? 19.500 38.903 115.745 1.00 34.78 ? 265 ARG B CG    1 
ATOM   4676 C CD    . ARG B 1 265 ? 18.762 38.688 117.048 1.00 42.87 ? 265 ARG B CD    1 
ATOM   4677 N NE    . ARG B 1 265 ? 19.367 39.427 118.135 1.00 41.65 ? 265 ARG B NE    1 
ATOM   4678 C CZ    . ARG B 1 265 ? 19.871 38.861 119.224 1.00 44.41 ? 265 ARG B CZ    1 
ATOM   4679 N NH1   . ARG B 1 265 ? 19.791 37.543 119.381 1.00 43.23 ? 265 ARG B NH1   1 
ATOM   4680 N NH2   . ARG B 1 265 ? 20.430 39.628 120.157 1.00 43.64 ? 265 ARG B NH2   1 
ATOM   4681 N N     . HIS B 1 266 ? 23.770 40.216 114.254 1.00 31.22 ? 266 HIS B N     1 
ATOM   4682 C CA    . HIS B 1 266 ? 24.954 41.043 114.196 1.00 30.41 ? 266 HIS B CA    1 
ATOM   4683 C C     . HIS B 1 266 ? 25.494 41.050 112.769 1.00 30.82 ? 266 HIS B C     1 
ATOM   4684 O O     . HIS B 1 266 ? 25.535 42.092 112.115 1.00 31.21 ? 266 HIS B O     1 
ATOM   4685 C CB    . HIS B 1 266 ? 26.017 40.521 115.176 1.00 29.47 ? 266 HIS B CB    1 
ATOM   4686 C CG    . HIS B 1 266 ? 27.291 41.310 115.179 1.00 27.35 ? 266 HIS B CG    1 
ATOM   4687 N ND1   . HIS B 1 266 ? 27.365 42.591 115.672 1.00 24.99 ? 266 HIS B ND1   1 
ATOM   4688 C CD2   . HIS B 1 266 ? 28.557 40.969 114.810 1.00 25.08 ? 266 HIS B CD2   1 
ATOM   4689 C CE1   . HIS B 1 266 ? 28.613 43.022 115.565 1.00 28.91 ? 266 HIS B CE1   1 
ATOM   4690 N NE2   . HIS B 1 266 ? 29.352 42.069 115.012 1.00 24.17 ? 266 HIS B NE2   1 
ATOM   4691 N N     . LEU B 1 267 ? 25.883 39.861 112.278 1.00 30.98 ? 267 LEU B N     1 
ATOM   4692 C CA    . LEU B 1 267 ? 26.599 39.713 110.984 1.00 28.66 ? 267 LEU B CA    1 
ATOM   4693 C C     . LEU B 1 267 ? 25.727 40.019 109.749 1.00 28.89 ? 267 LEU B C     1 
ATOM   4694 O O     . LEU B 1 267 ? 24.494 39.914 109.765 1.00 27.27 ? 267 LEU B O     1 
ATOM   4695 C CB    . LEU B 1 267 ? 27.178 38.298 110.872 1.00 27.84 ? 267 LEU B CB    1 
ATOM   4696 C CG    . LEU B 1 267 ? 28.366 37.900 111.803 1.00 25.09 ? 267 LEU B CG    1 
ATOM   4697 C CD1   . LEU B 1 267 ? 28.821 36.470 111.532 1.00 26.16 ? 267 LEU B CD1   1 
ATOM   4698 C CD2   . LEU B 1 267 ? 29.555 38.611 111.495 1.00 21.39 ? 267 LEU B CD2   1 
ATOM   4699 N N     . THR B 1 268 ? 26.378 40.446 108.679 1.00 29.32 ? 268 THR B N     1 
ATOM   4700 C CA    . THR B 1 268 ? 25.730 40.579 107.401 1.00 27.97 ? 268 THR B CA    1 
ATOM   4701 C C     . THR B 1 268 ? 26.857 40.193 106.519 1.00 29.68 ? 268 THR B C     1 
ATOM   4702 O O     . THR B 1 268 ? 28.021 40.098 106.993 1.00 28.98 ? 268 THR B O     1 
ATOM   4703 C CB    . THR B 1 268 ? 25.412 42.039 107.089 1.00 28.41 ? 268 THR B CB    1 
ATOM   4704 O OG1   . THR B 1 268 ? 26.628 42.822 107.015 1.00 25.88 ? 268 THR B OG1   1 
ATOM   4705 C CG2   . THR B 1 268 ? 24.448 42.637 108.083 1.00 25.48 ? 268 THR B CG2   1 
ATOM   4706 N N     . ALA B 1 269 ? 26.553 39.993 105.236 1.00 30.73 ? 269 ALA B N     1 
ATOM   4707 C CA    . ALA B 1 269 ? 27.566 39.447 104.339 1.00 31.84 ? 269 ALA B CA    1 
ATOM   4708 C C     . ALA B 1 269 ? 28.716 40.468 104.282 1.00 31.51 ? 269 ALA B C     1 
ATOM   4709 O O     . ALA B 1 269 ? 29.914 40.143 104.560 1.00 31.20 ? 269 ALA B O     1 
ATOM   4710 C CB    . ALA B 1 269 ? 26.989 39.108 102.951 1.00 31.94 ? 269 ALA B CB    1 
ATOM   4711 N N     . PRO B 1 270 ? 28.341 41.719 104.012 1.00 30.02 ? 270 PRO B N     1 
ATOM   4712 C CA    . PRO B 1 270 ? 29.322 42.771 103.921 1.00 29.18 ? 270 PRO B CA    1 
ATOM   4713 C C     . PRO B 1 270 ? 30.184 42.806 105.179 1.00 27.62 ? 270 PRO B C     1 
ATOM   4714 O O     . PRO B 1 270 ? 31.421 42.669 105.107 1.00 26.32 ? 270 PRO B O     1 
ATOM   4715 C CB    . PRO B 1 270 ? 28.451 44.050 103.763 1.00 27.37 ? 270 PRO B CB    1 
ATOM   4716 C CG    . PRO B 1 270 ? 27.306 43.600 103.121 1.00 26.88 ? 270 PRO B CG    1 
ATOM   4717 C CD    . PRO B 1 270 ? 26.997 42.245 103.753 1.00 30.41 ? 270 PRO B CD    1 
ATOM   4718 N N     . TYR B 1 271 ? 29.514 42.996 106.314 1.00 28.55 ? 271 TYR B N     1 
ATOM   4719 C CA    . TYR B 1 271 ? 30.203 43.153 107.620 1.00 28.63 ? 271 TYR B CA    1 
ATOM   4720 C C     . TYR B 1 271 ? 31.136 41.991 107.823 1.00 29.64 ? 271 TYR B C     1 
ATOM   4721 O O     . TYR B 1 271 ? 32.325 42.178 108.136 1.00 30.07 ? 271 TYR B O     1 
ATOM   4722 C CB    . TYR B 1 271 ? 29.228 43.179 108.828 1.00 27.87 ? 271 TYR B CB    1 
ATOM   4723 C CG    . TYR B 1 271 ? 30.009 43.626 110.043 1.00 27.13 ? 271 TYR B CG    1 
ATOM   4724 C CD1   . TYR B 1 271 ? 30.289 42.770 111.068 1.00 26.53 ? 271 TYR B CD1   1 
ATOM   4725 C CD2   . TYR B 1 271 ? 30.584 44.918 110.080 1.00 31.94 ? 271 TYR B CD2   1 
ATOM   4726 C CE1   . TYR B 1 271 ? 31.064 43.193 112.138 1.00 31.80 ? 271 TYR B CE1   1 
ATOM   4727 C CE2   . TYR B 1 271 ? 31.351 45.359 111.139 1.00 29.09 ? 271 TYR B CE2   1 
ATOM   4728 C CZ    . TYR B 1 271 ? 31.584 44.490 112.166 1.00 28.50 ? 271 TYR B CZ    1 
ATOM   4729 O OH    . TYR B 1 271 ? 32.359 44.898 113.202 1.00 22.57 ? 271 TYR B OH    1 
ATOM   4730 N N     . LEU B 1 272 ? 30.588 40.774 107.661 1.00 30.35 ? 272 LEU B N     1 
ATOM   4731 C CA    . LEU B 1 272 ? 31.370 39.594 107.898 1.00 30.02 ? 272 LEU B CA    1 
ATOM   4732 C C     . LEU B 1 272 ? 32.644 39.647 107.073 1.00 31.88 ? 272 LEU B C     1 
ATOM   4733 O O     . LEU B 1 272 ? 33.679 39.155 107.500 1.00 32.86 ? 272 LEU B O     1 
ATOM   4734 C CB    . LEU B 1 272 ? 30.572 38.364 107.584 1.00 28.13 ? 272 LEU B CB    1 
ATOM   4735 C CG    . LEU B 1 272 ? 31.263 37.010 107.652 1.00 24.73 ? 272 LEU B CG    1 
ATOM   4736 C CD1   . LEU B 1 272 ? 30.237 36.013 107.861 1.00 18.58 ? 272 LEU B CD1   1 
ATOM   4737 C CD2   . LEU B 1 272 ? 32.079 36.639 106.341 1.00 27.11 ? 272 LEU B CD2   1 
ATOM   4738 N N     . GLU B 1 273 ? 32.606 40.220 105.895 1.00 33.35 ? 273 GLU B N     1 
ATOM   4739 C CA    . GLU B 1 273 ? 33.703 39.911 105.010 1.00 37.01 ? 273 GLU B CA    1 
ATOM   4740 C C     . GLU B 1 273 ? 34.769 40.936 105.337 1.00 35.98 ? 273 GLU B C     1 
ATOM   4741 O O     . GLU B 1 273 ? 35.956 40.638 105.419 1.00 38.01 ? 273 GLU B O     1 
ATOM   4742 C CB    . GLU B 1 273 ? 33.224 39.901 103.549 1.00 36.52 ? 273 GLU B CB    1 
ATOM   4743 C CG    . GLU B 1 273 ? 34.047 40.889 102.622 1.00 42.67 ? 273 GLU B CG    1 
ATOM   4744 C CD    . GLU B 1 273 ? 33.620 40.837 101.102 1.00 43.44 ? 273 GLU B CD    1 
ATOM   4745 O OE1   . GLU B 1 273 ? 33.650 41.962 100.443 1.00 39.68 ? 273 GLU B OE1   1 
ATOM   4746 O OE2   . GLU B 1 273 ? 33.246 39.664 100.626 1.00 49.90 ? 273 GLU B OE2   1 
ATOM   4747 N N     . ALA B 1 274 ? 34.314 42.154 105.589 1.00 35.07 ? 274 ALA B N     1 
ATOM   4748 C CA    . ALA B 1 274 ? 35.127 43.195 106.212 1.00 32.95 ? 274 ALA B CA    1 
ATOM   4749 C C     . ALA B 1 274 ? 35.873 42.826 107.540 1.00 31.79 ? 274 ALA B C     1 
ATOM   4750 O O     . ALA B 1 274 ? 36.962 43.245 107.765 1.00 32.73 ? 274 ALA B O     1 
ATOM   4751 C CB    . ALA B 1 274 ? 34.271 44.361 106.422 1.00 33.46 ? 274 ALA B CB    1 
ATOM   4752 N N     . MET B 1 275 ? 35.310 42.079 108.447 1.00 29.71 ? 275 MET B N     1 
ATOM   4753 C CA    . MET B 1 275 ? 36.077 41.699 109.577 1.00 28.18 ? 275 MET B CA    1 
ATOM   4754 C C     . MET B 1 275 ? 37.437 41.234 109.173 1.00 29.45 ? 275 MET B C     1 
ATOM   4755 O O     . MET B 1 275 ? 38.391 41.228 110.027 1.00 30.32 ? 275 MET B O     1 
ATOM   4756 C CB    . MET B 1 275 ? 35.409 40.532 110.297 1.00 28.78 ? 275 MET B CB    1 
ATOM   4757 C CG    . MET B 1 275 ? 33.949 40.796 110.637 1.00 28.48 ? 275 MET B CG    1 
ATOM   4758 S SD    . MET B 1 275 ? 33.448 39.807 112.052 1.00 25.03 ? 275 MET B SD    1 
ATOM   4759 C CE    . MET B 1 275 ? 33.787 38.265 111.354 1.00 21.14 ? 275 MET B CE    1 
ATOM   4760 N N     . PHE B 1 276 ? 37.539 40.759 107.911 1.00 29.34 ? 276 PHE B N     1 
ATOM   4761 C CA    . PHE B 1 276 ? 38.815 40.262 107.379 1.00 27.18 ? 276 PHE B CA    1 
ATOM   4762 C C     . PHE B 1 276 ? 39.765 41.311 106.788 1.00 25.93 ? 276 PHE B C     1 
ATOM   4763 O O     . PHE B 1 276 ? 40.673 40.930 106.088 1.00 26.04 ? 276 PHE B O     1 
ATOM   4764 C CB    . PHE B 1 276 ? 38.571 39.211 106.343 1.00 27.94 ? 276 PHE B CB    1 
ATOM   4765 C CG    . PHE B 1 276 ? 38.098 37.982 106.915 1.00 29.46 ? 276 PHE B CG    1 
ATOM   4766 C CD1   . PHE B 1 276 ? 38.974 36.954 107.148 1.00 29.54 ? 276 PHE B CD1   1 
ATOM   4767 C CD2   . PHE B 1 276 ? 36.735 37.858 107.296 1.00 31.12 ? 276 PHE B CD2   1 
ATOM   4768 C CE1   . PHE B 1 276 ? 38.506 35.800 107.788 1.00 30.23 ? 276 PHE B CE1   1 
ATOM   4769 C CE2   . PHE B 1 276 ? 36.260 36.712 107.892 1.00 27.42 ? 276 PHE B CE2   1 
ATOM   4770 C CZ    . PHE B 1 276 ? 37.137 35.679 108.134 1.00 27.54 ? 276 PHE B CZ    1 
ATOM   4771 N N     . VAL B 1 277 ? 39.531 42.610 107.033 1.00 23.92 ? 277 VAL B N     1 
ATOM   4772 C CA    . VAL B 1 277 ? 40.365 43.698 106.551 1.00 23.07 ? 277 VAL B CA    1 
ATOM   4773 C C     . VAL B 1 277 ? 41.200 44.341 107.692 1.00 23.90 ? 277 VAL B C     1 
ATOM   4774 O O     . VAL B 1 277 ? 40.670 45.039 108.548 1.00 24.09 ? 277 VAL B O     1 
ATOM   4775 C CB    . VAL B 1 277 ? 39.513 44.682 105.745 1.00 24.70 ? 277 VAL B CB    1 
ATOM   4776 C CG1   . VAL B 1 277 ? 40.367 45.928 105.328 1.00 24.62 ? 277 VAL B CG1   1 
ATOM   4777 C CG2   . VAL B 1 277 ? 38.720 43.911 104.500 1.00 20.97 ? 277 VAL B CG2   1 
ATOM   4778 N N     . LEU B 1 278 ? 42.485 44.012 107.768 1.00 23.28 ? 278 LEU B N     1 
ATOM   4779 C CA    . LEU B 1 278 ? 43.230 44.409 108.922 1.00 24.45 ? 278 LEU B CA    1 
ATOM   4780 C C     . LEU B 1 278 ? 44.052 45.703 108.745 1.00 25.10 ? 278 LEU B C     1 
ATOM   4781 O O     . LEU B 1 278 ? 44.474 46.024 107.629 1.00 27.17 ? 278 LEU B O     1 
ATOM   4782 C CB    . LEU B 1 278 ? 44.148 43.274 109.434 1.00 24.89 ? 278 LEU B CB    1 
ATOM   4783 C CG    . LEU B 1 278 ? 43.858 41.784 109.526 1.00 24.89 ? 278 LEU B CG    1 
ATOM   4784 C CD1   . LEU B 1 278 ? 42.684 41.414 110.408 1.00 19.54 ? 278 LEU B CD1   1 
ATOM   4785 C CD2   . LEU B 1 278 ? 43.611 41.302 108.049 1.00 30.77 ? 278 LEU B CD2   1 
ATOM   4786 N N     . PRO B 1 279 ? 44.274 46.459 109.836 1.00 24.26 ? 279 PRO B N     1 
ATOM   4787 C CA    . PRO B 1 279 ? 44.954 47.729 109.590 1.00 25.42 ? 279 PRO B CA    1 
ATOM   4788 C C     . PRO B 1 279 ? 46.470 47.454 109.439 1.00 26.09 ? 279 PRO B C     1 
ATOM   4789 O O     . PRO B 1 279 ? 46.884 46.320 109.745 1.00 26.55 ? 279 PRO B O     1 
ATOM   4790 C CB    . PRO B 1 279 ? 44.621 48.534 110.849 1.00 25.50 ? 279 PRO B CB    1 
ATOM   4791 C CG    . PRO B 1 279 ? 44.496 47.438 111.960 1.00 24.25 ? 279 PRO B CG    1 
ATOM   4792 C CD    . PRO B 1 279 ? 43.914 46.247 111.255 1.00 22.98 ? 279 PRO B CD    1 
ATOM   4793 N N     . LYS B 1 280 ? 47.259 48.417 108.941 1.00 25.95 ? 280 LYS B N     1 
ATOM   4794 C CA    . LYS B 1 280 ? 48.692 48.211 108.776 1.00 26.84 ? 280 LYS B CA    1 
ATOM   4795 C C     . LYS B 1 280 ? 49.359 47.591 110.009 1.00 27.64 ? 280 LYS B C     1 
ATOM   4796 O O     . LYS B 1 280 ? 50.091 46.649 109.875 1.00 30.84 ? 280 LYS B O     1 
ATOM   4797 C CB    . LYS B 1 280 ? 49.385 49.534 108.520 1.00 27.22 ? 280 LYS B CB    1 
ATOM   4798 C CG    . LYS B 1 280 ? 50.964 49.436 108.547 1.00 26.73 ? 280 LYS B CG    1 
ATOM   4799 C CD    . LYS B 1 280 ? 51.682 50.482 107.616 1.00 28.34 ? 280 LYS B CD    1 
ATOM   4800 C CE    . LYS B 1 280 ? 50.976 50.533 106.238 1.00 31.29 ? 280 LYS B CE    1 
ATOM   4801 N NZ    . LYS B 1 280 ? 50.806 51.994 105.706 1.00 40.21 ? 280 LYS B NZ    1 
ATOM   4802 N N     . ASP B 1 281 ? 49.088 48.094 111.202 1.00 27.49 ? 281 ASP B N     1 
ATOM   4803 C CA    . ASP B 1 281 ? 49.837 47.712 112.427 1.00 26.75 ? 281 ASP B CA    1 
ATOM   4804 C C     . ASP B 1 281 ? 49.589 46.255 112.701 1.00 27.02 ? 281 ASP B C     1 
ATOM   4805 O O     . ASP B 1 281 ? 50.524 45.525 113.099 1.00 29.04 ? 281 ASP B O     1 
ATOM   4806 C CB    . ASP B 1 281 ? 49.475 48.562 113.744 1.00 24.58 ? 281 ASP B CB    1 
ATOM   4807 C CG    . ASP B 1 281 ? 48.037 49.102 113.763 1.00 25.22 ? 281 ASP B CG    1 
ATOM   4808 O OD1   . ASP B 1 281 ? 47.028 48.354 113.700 1.00 26.81 ? 281 ASP B OD1   1 
ATOM   4809 O OD2   . ASP B 1 281 ? 47.877 50.343 113.853 1.00 31.85 ? 281 ASP B OD2   1 
ATOM   4810 N N     . LEU B 1 282 ? 48.359 45.827 112.508 1.00 23.89 ? 282 LEU B N     1 
ATOM   4811 C CA    . LEU B 1 282 ? 48.063 44.538 112.877 1.00 23.92 ? 282 LEU B CA    1 
ATOM   4812 C C     . LEU B 1 282 ? 48.612 43.561 111.828 1.00 26.15 ? 282 LEU B C     1 
ATOM   4813 O O     . LEU B 1 282 ? 49.055 42.517 112.180 1.00 27.19 ? 282 LEU B O     1 
ATOM   4814 C CB    . LEU B 1 282 ? 46.559 44.401 112.967 1.00 23.25 ? 282 LEU B CB    1 
ATOM   4815 C CG    . LEU B 1 282 ? 46.001 42.970 112.837 1.00 21.03 ? 282 LEU B CG    1 
ATOM   4816 C CD1   . LEU B 1 282 ? 46.765 41.977 113.831 1.00 24.26 ? 282 LEU B CD1   1 
ATOM   4817 C CD2   . LEU B 1 282 ? 44.522 43.049 113.122 1.00 17.37 ? 282 LEU B CD2   1 
ATOM   4818 N N     . LEU B 1 283 ? 48.499 43.845 110.535 1.00 27.45 ? 283 LEU B N     1 
ATOM   4819 C CA    . LEU B 1 283 ? 49.114 42.981 109.528 1.00 28.81 ? 283 LEU B CA    1 
ATOM   4820 C C     . LEU B 1 283 ? 50.632 42.821 109.822 1.00 30.20 ? 283 LEU B C     1 
ATOM   4821 O O     . LEU B 1 283 ? 51.156 41.725 109.665 1.00 28.62 ? 283 LEU B O     1 
ATOM   4822 C CB    . LEU B 1 283 ? 48.929 43.550 108.109 1.00 27.53 ? 283 LEU B CB    1 
ATOM   4823 C CG    . LEU B 1 283 ? 47.471 43.547 107.711 1.00 26.90 ? 283 LEU B CG    1 
ATOM   4824 C CD1   . LEU B 1 283 ? 47.183 44.688 106.795 1.00 25.77 ? 283 LEU B CD1   1 
ATOM   4825 C CD2   . LEU B 1 283 ? 47.070 42.268 107.097 1.00 25.44 ? 283 LEU B CD2   1 
ATOM   4826 N N     . GLU B 1 284 ? 51.324 43.906 110.213 1.00 31.29 ? 284 GLU B N     1 
ATOM   4827 C CA    . GLU B 1 284 ? 52.755 43.777 110.461 1.00 33.70 ? 284 GLU B CA    1 
ATOM   4828 C C     . GLU B 1 284 ? 52.921 42.827 111.615 1.00 33.31 ? 284 GLU B C     1 
ATOM   4829 O O     . GLU B 1 284 ? 53.586 41.792 111.447 1.00 34.46 ? 284 GLU B O     1 
ATOM   4830 C CB    . GLU B 1 284 ? 53.455 45.105 110.766 1.00 33.83 ? 284 GLU B CB    1 
ATOM   4831 C CG    . GLU B 1 284 ? 53.318 46.113 109.608 1.00 38.27 ? 284 GLU B CG    1 
ATOM   4832 C CD    . GLU B 1 284 ? 54.087 47.448 109.784 1.00 37.85 ? 284 GLU B CD    1 
ATOM   4833 O OE1   . GLU B 1 284 ? 54.099 48.261 108.807 1.00 42.46 ? 284 GLU B OE1   1 
ATOM   4834 O OE2   . GLU B 1 284 ? 54.629 47.718 110.884 1.00 45.84 ? 284 GLU B OE2   1 
ATOM   4835 N N     . ALA B 1 285 ? 52.313 43.146 112.777 1.00 32.33 ? 285 ALA B N     1 
ATOM   4836 C CA    . ALA B 1 285 ? 52.384 42.308 113.968 1.00 30.84 ? 285 ALA B CA    1 
ATOM   4837 C C     . ALA B 1 285 ? 52.303 40.786 113.689 1.00 31.31 ? 285 ALA B C     1 
ATOM   4838 O O     . ALA B 1 285 ? 53.077 39.963 114.319 1.00 31.17 ? 285 ALA B O     1 
ATOM   4839 C CB    . ALA B 1 285 ? 51.345 42.698 114.893 1.00 31.05 ? 285 ALA B CB    1 
ATOM   4840 N N     . LEU B 1 286 ? 51.380 40.436 112.793 1.00 29.62 ? 286 LEU B N     1 
ATOM   4841 C CA    . LEU B 1 286 ? 51.236 39.135 112.217 1.00 31.25 ? 286 LEU B CA    1 
ATOM   4842 C C     . LEU B 1 286 ? 52.402 38.727 111.314 1.00 33.10 ? 286 LEU B C     1 
ATOM   4843 O O     . LEU B 1 286 ? 52.922 37.635 111.399 1.00 30.71 ? 286 LEU B O     1 
ATOM   4844 C CB    . LEU B 1 286 ? 49.990 39.106 111.342 1.00 30.78 ? 286 LEU B CB    1 
ATOM   4845 C CG    . LEU B 1 286 ? 48.611 39.228 111.889 1.00 30.37 ? 286 LEU B CG    1 
ATOM   4846 C CD1   . LEU B 1 286 ? 47.667 38.997 110.756 1.00 33.98 ? 286 LEU B CD1   1 
ATOM   4847 C CD2   . LEU B 1 286 ? 48.485 38.096 112.852 1.00 34.99 ? 286 LEU B CD2   1 
ATOM   4848 N N     . GLU B 1 287 ? 52.760 39.583 110.369 1.00 38.53 ? 287 GLU B N     1 
ATOM   4849 C CA    . GLU B 1 287 ? 53.794 39.159 109.404 1.00 43.61 ? 287 GLU B CA    1 
ATOM   4850 C C     . GLU B 1 287 ? 55.067 39.129 110.199 1.00 43.07 ? 287 GLU B C     1 
ATOM   4851 O O     . GLU B 1 287 ? 55.844 38.278 109.929 1.00 42.82 ? 287 GLU B O     1 
ATOM   4852 C CB    . GLU B 1 287 ? 53.965 39.984 108.092 1.00 43.36 ? 287 GLU B CB    1 
ATOM   4853 C CG    . GLU B 1 287 ? 52.684 40.485 107.261 1.00 48.00 ? 287 GLU B CG    1 
ATOM   4854 C CD    . GLU B 1 287 ? 52.964 41.912 106.514 1.00 49.35 ? 287 GLU B CD    1 
ATOM   4855 O OE1   . GLU B 1 287 ? 54.158 42.252 106.144 1.00 53.57 ? 287 GLU B OE1   1 
ATOM   4856 O OE2   . GLU B 1 287 ? 51.987 42.716 106.337 1.00 55.03 ? 287 GLU B OE2   1 
ATOM   4857 N N     . LYS B 1 288 ? 55.225 39.966 111.233 1.00 44.98 ? 288 LYS B N     1 
ATOM   4858 C CA    . LYS B 1 288 ? 56.448 39.918 112.103 1.00 47.44 ? 288 LYS B CA    1 
ATOM   4859 C C     . LYS B 1 288 ? 56.563 38.777 113.170 1.00 47.15 ? 288 LYS B C     1 
ATOM   4860 O O     . LYS B 1 288 ? 57.675 38.533 113.646 1.00 46.18 ? 288 LYS B O     1 
ATOM   4861 C CB    . LYS B 1 288 ? 56.829 41.311 112.686 1.00 46.37 ? 288 LYS B CB    1 
ATOM   4862 C CG    . LYS B 1 288 ? 56.691 41.503 114.270 1.00 50.74 ? 288 LYS B CG    1 
ATOM   4863 C CD    . LYS B 1 288 ? 57.835 42.417 115.029 1.00 49.23 ? 288 LYS B CD    1 
ATOM   4864 C CE    . LYS B 1 288 ? 57.692 43.986 114.875 1.00 50.88 ? 288 LYS B CE    1 
ATOM   4865 N NZ    . LYS B 1 288 ? 58.642 44.818 115.727 1.00 52.40 ? 288 LYS B NZ    1 
ATOM   4866 N N     . GLU B 1 289 ? 55.452 38.089 113.509 1.00 48.08 ? 289 GLU B N     1 
ATOM   4867 C CA    . GLU B 1 289 ? 55.455 37.017 114.546 1.00 48.75 ? 289 GLU B CA    1 
ATOM   4868 C C     . GLU B 1 289 ? 56.165 35.788 114.048 1.00 50.36 ? 289 GLU B C     1 
ATOM   4869 O O     . GLU B 1 289 ? 56.017 35.405 112.852 1.00 50.02 ? 289 GLU B O     1 
ATOM   4870 C CB    . GLU B 1 289 ? 54.062 36.533 114.947 1.00 48.74 ? 289 GLU B CB    1 
ATOM   4871 C CG    . GLU B 1 289 ? 54.010 36.089 116.354 1.00 48.51 ? 289 GLU B CG    1 
ATOM   4872 C CD    . GLU B 1 289 ? 54.803 37.046 117.227 1.00 54.84 ? 289 GLU B CD    1 
ATOM   4873 O OE1   . GLU B 1 289 ? 55.741 36.570 117.914 1.00 57.87 ? 289 GLU B OE1   1 
ATOM   4874 O OE2   . GLU B 1 289 ? 54.538 38.286 117.189 1.00 56.18 ? 289 GLU B OE2   1 
ATOM   4875 N N     . THR B 1 290 ? 56.862 35.164 115.008 1.00 51.34 ? 290 THR B N     1 
ATOM   4876 C CA    . THR B 1 290 ? 57.869 34.110 114.828 1.00 52.46 ? 290 THR B CA    1 
ATOM   4877 C C     . THR B 1 290 ? 57.519 32.948 115.767 1.00 53.85 ? 290 THR B C     1 
ATOM   4878 O O     . THR B 1 290 ? 57.509 31.764 115.357 1.00 54.95 ? 290 THR B O     1 
ATOM   4879 C CB    . THR B 1 290 ? 59.374 34.617 115.151 1.00 52.51 ? 290 THR B CB    1 
ATOM   4880 O OG1   . THR B 1 290 ? 60.002 33.720 116.062 1.00 50.74 ? 290 THR B OG1   1 
ATOM   4881 C CG2   . THR B 1 290 ? 59.439 36.021 115.810 1.00 50.84 ? 290 THR B CG2   1 
ATOM   4882 N N     . MET B 1 291 ? 57.228 33.289 117.032 1.00 54.14 ? 291 MET B N     1 
ATOM   4883 C CA    . MET B 1 291 ? 57.081 32.269 118.052 1.00 53.22 ? 291 MET B CA    1 
ATOM   4884 C C     . MET B 1 291 ? 56.063 31.283 117.559 1.00 53.29 ? 291 MET B C     1 
ATOM   4885 O O     . MET B 1 291 ? 54.930 31.649 117.409 1.00 54.24 ? 291 MET B O     1 
ATOM   4886 C CB    . MET B 1 291 ? 56.619 32.867 119.365 1.00 52.28 ? 291 MET B CB    1 
ATOM   4887 C CG    . MET B 1 291 ? 56.057 31.819 120.311 1.00 51.85 ? 291 MET B CG    1 
ATOM   4888 S SD    . MET B 1 291 ? 55.496 32.377 121.973 1.00 52.57 ? 291 MET B SD    1 
ATOM   4889 C CE    . MET B 1 291 ? 57.012 33.192 122.592 1.00 45.58 ? 291 MET B CE    1 
ATOM   4890 N N     . VAL B 1 292 ? 56.473 30.051 117.254 1.00 53.79 ? 292 VAL B N     1 
ATOM   4891 C CA    . VAL B 1 292 ? 55.524 28.917 117.058 1.00 53.69 ? 292 VAL B CA    1 
ATOM   4892 C C     . VAL B 1 292 ? 55.457 28.074 118.353 1.00 53.63 ? 292 VAL B C     1 
ATOM   4893 O O     . VAL B 1 292 ? 56.479 27.908 119.021 1.00 52.98 ? 292 VAL B O     1 
ATOM   4894 C CB    . VAL B 1 292 ? 55.858 28.010 115.758 1.00 53.85 ? 292 VAL B CB    1 
ATOM   4895 C CG1   . VAL B 1 292 ? 54.711 27.067 115.406 1.00 52.24 ? 292 VAL B CG1   1 
ATOM   4896 C CG2   . VAL B 1 292 ? 56.228 28.857 114.526 1.00 54.05 ? 292 VAL B CG2   1 
ATOM   4897 N N     . SER B 1 293 ? 54.275 27.553 118.709 1.00 54.46 ? 293 SER B N     1 
ATOM   4898 C CA    . SER B 1 293 ? 54.153 26.677 119.910 1.00 55.62 ? 293 SER B CA    1 
ATOM   4899 C C     . SER B 1 293 ? 53.773 25.250 119.599 1.00 57.48 ? 293 SER B C     1 
ATOM   4900 O O     . SER B 1 293 ? 52.865 24.970 118.810 1.00 57.97 ? 293 SER B O     1 
ATOM   4901 C CB    . SER B 1 293 ? 53.221 27.194 121.022 1.00 54.71 ? 293 SER B CB    1 
ATOM   4902 O OG    . SER B 1 293 ? 51.950 26.569 120.946 1.00 49.69 ? 293 SER B OG    1 
ATOM   4903 N N     . THR B 1 294 ? 54.430 24.383 120.381 1.00 60.38 ? 294 THR B N     1 
ATOM   4904 C CA    . THR B 1 294 ? 54.676 22.950 120.139 1.00 60.90 ? 294 THR B CA    1 
ATOM   4905 C C     . THR B 1 294 ? 54.483 22.198 121.455 1.00 62.74 ? 294 THR B C     1 
ATOM   4906 O O     . THR B 1 294 ? 54.708 22.764 122.526 1.00 63.07 ? 294 THR B O     1 
ATOM   4907 C CB    . THR B 1 294 ? 56.164 22.733 119.756 1.00 60.64 ? 294 THR B CB    1 
ATOM   4908 O OG1   . THR B 1 294 ? 56.978 23.149 120.849 1.00 56.17 ? 294 THR B OG1   1 
ATOM   4909 C CG2   . THR B 1 294 ? 56.553 23.478 118.483 1.00 56.23 ? 294 THR B CG2   1 
ATOM   4910 N N     . ASP B 1 295 ? 54.084 20.928 121.392 1.00 64.84 ? 295 ASP B N     1 
ATOM   4911 C CA    . ASP B 1 295 ? 54.014 20.117 122.629 1.00 66.71 ? 295 ASP B CA    1 
ATOM   4912 C C     . ASP B 1 295 ? 55.333 20.183 123.406 1.00 66.24 ? 295 ASP B C     1 
ATOM   4913 O O     . ASP B 1 295 ? 55.337 20.227 124.625 1.00 66.31 ? 295 ASP B O     1 
ATOM   4914 C CB    . ASP B 1 295 ? 53.641 18.649 122.340 1.00 67.74 ? 295 ASP B CB    1 
ATOM   4915 C CG    . ASP B 1 295 ? 52.132 18.441 122.028 1.00 70.72 ? 295 ASP B CG    1 
ATOM   4916 O OD1   . ASP B 1 295 ? 51.850 17.641 121.094 1.00 74.11 ? 295 ASP B OD1   1 
ATOM   4917 O OD2   . ASP B 1 295 ? 51.238 19.043 122.703 1.00 72.79 ? 295 ASP B OD2   1 
ATOM   4918 N N     . GLN B 1 296 ? 56.430 20.213 122.662 1.00 66.21 ? 296 GLN B N     1 
ATOM   4919 C CA    . GLN B 1 296 ? 57.771 20.302 123.195 1.00 66.59 ? 296 GLN B CA    1 
ATOM   4920 C C     . GLN B 1 296 ? 58.019 21.522 124.127 1.00 66.87 ? 296 GLN B C     1 
ATOM   4921 O O     . GLN B 1 296 ? 58.418 21.346 125.270 1.00 67.22 ? 296 GLN B O     1 
ATOM   4922 C CB    . GLN B 1 296 ? 58.738 20.266 122.001 1.00 67.17 ? 296 GLN B CB    1 
ATOM   4923 C CG    . GLN B 1 296 ? 60.244 20.310 122.342 1.00 66.22 ? 296 GLN B CG    1 
ATOM   4924 C CD    . GLN B 1 296 ? 60.843 18.950 122.385 1.00 65.13 ? 296 GLN B CD    1 
ATOM   4925 O OE1   . GLN B 1 296 ? 60.132 17.944 122.509 1.00 62.46 ? 296 GLN B OE1   1 
ATOM   4926 N NE2   . GLN B 1 296 ? 62.158 18.896 122.284 1.00 67.51 ? 296 GLN B NE2   1 
ATOM   4927 N N     . ASN B 1 297 ? 57.831 22.742 123.603 1.00 67.48 ? 297 ASN B N     1 
ATOM   4928 C CA    . ASN B 1 297 ? 57.719 24.019 124.381 1.00 67.16 ? 297 ASN B CA    1 
ATOM   4929 C C     . ASN B 1 297 ? 56.322 24.673 124.128 1.00 66.72 ? 297 ASN B C     1 
ATOM   4930 O O     . ASN B 1 297 ? 56.146 25.470 123.176 1.00 65.95 ? 297 ASN B O     1 
ATOM   4931 C CB    . ASN B 1 297 ? 58.795 25.071 124.009 1.00 67.00 ? 297 ASN B CB    1 
ATOM   4932 C CG    . ASN B 1 297 ? 60.182 24.507 123.911 1.00 66.97 ? 297 ASN B CG    1 
ATOM   4933 O OD1   . ASN B 1 297 ? 60.369 23.415 123.385 1.00 68.29 ? 297 ASN B OD1   1 
ATOM   4934 N ND2   . ASN B 1 297 ? 61.181 25.274 124.364 1.00 63.91 ? 297 ASN B ND2   1 
ATOM   4935 N N     . PRO B 1 298 ? 55.318 24.328 124.952 1.00 66.06 ? 298 PRO B N     1 
ATOM   4936 C CA    . PRO B 1 298 ? 54.093 25.013 124.676 1.00 66.10 ? 298 PRO B CA    1 
ATOM   4937 C C     . PRO B 1 298 ? 54.177 26.466 125.191 1.00 66.70 ? 298 PRO B C     1 
ATOM   4938 O O     . PRO B 1 298 ? 54.969 26.753 126.125 1.00 67.28 ? 298 PRO B O     1 
ATOM   4939 C CB    . PRO B 1 298 ? 53.079 24.186 125.442 1.00 65.60 ? 298 PRO B CB    1 
ATOM   4940 C CG    . PRO B 1 298 ? 53.836 23.639 126.548 1.00 64.87 ? 298 PRO B CG    1 
ATOM   4941 C CD    . PRO B 1 298 ? 55.192 23.395 126.082 1.00 65.46 ? 298 PRO B CD    1 
ATOM   4942 N N     . PHE B 1 299 ? 53.392 27.357 124.567 1.00 66.32 ? 299 PHE B N     1 
ATOM   4943 C CA    . PHE B 1 299 ? 53.237 28.725 125.027 1.00 66.35 ? 299 PHE B CA    1 
ATOM   4944 C C     . PHE B 1 299 ? 52.031 28.863 125.990 1.00 66.68 ? 299 PHE B C     1 
ATOM   4945 O O     . PHE B 1 299 ? 50.975 28.252 125.798 1.00 65.59 ? 299 PHE B O     1 
ATOM   4946 C CB    . PHE B 1 299 ? 53.156 29.708 123.834 1.00 66.18 ? 299 PHE B CB    1 
ATOM   4947 C CG    . PHE B 1 299 ? 51.788 30.388 123.661 1.00 66.73 ? 299 PHE B CG    1 
ATOM   4948 C CD1   . PHE B 1 299 ? 51.475 31.571 124.361 1.00 68.25 ? 299 PHE B CD1   1 
ATOM   4949 C CD2   . PHE B 1 299 ? 50.826 29.866 122.790 1.00 65.37 ? 299 PHE B CD2   1 
ATOM   4950 C CE1   . PHE B 1 299 ? 50.213 32.198 124.224 1.00 65.85 ? 299 PHE B CE1   1 
ATOM   4951 C CE2   . PHE B 1 299 ? 49.596 30.473 122.639 1.00 64.42 ? 299 PHE B CE2   1 
ATOM   4952 C CZ    . PHE B 1 299 ? 49.282 31.646 123.369 1.00 65.91 ? 299 PHE B CZ    1 
ATOM   4953 N N     . TYR B 1 300 ? 52.232 29.664 127.038 1.00 67.73 ? 300 TYR B N     1 
ATOM   4954 C CA    . TYR B 1 300 ? 51.186 30.058 127.978 1.00 68.31 ? 300 TYR B CA    1 
ATOM   4955 C C     . TYR B 1 300 ? 51.205 31.578 128.022 1.00 68.99 ? 300 TYR B C     1 
ATOM   4956 O O     . TYR B 1 300 ? 52.128 32.236 127.481 1.00 67.59 ? 300 TYR B O     1 
ATOM   4957 C CB    . TYR B 1 300 ? 51.452 29.487 129.393 1.00 68.79 ? 300 TYR B CB    1 
ATOM   4958 C CG    . TYR B 1 300 ? 52.840 29.837 129.986 1.00 69.05 ? 300 TYR B CG    1 
ATOM   4959 C CD1   . TYR B 1 300 ? 53.994 29.168 129.545 1.00 69.46 ? 300 TYR B CD1   1 
ATOM   4960 C CD2   . TYR B 1 300 ? 52.988 30.821 130.994 1.00 69.38 ? 300 TYR B CD2   1 
ATOM   4961 C CE1   . TYR B 1 300 ? 55.266 29.472 130.049 1.00 69.81 ? 300 TYR B CE1   1 
ATOM   4962 C CE2   . TYR B 1 300 ? 54.272 31.149 131.512 1.00 69.79 ? 300 TYR B CE2   1 
ATOM   4963 C CZ    . TYR B 1 300 ? 55.414 30.455 131.025 1.00 69.91 ? 300 TYR B CZ    1 
ATOM   4964 O OH    . TYR B 1 300 ? 56.701 30.724 131.478 1.00 68.34 ? 300 TYR B OH    1 
ATOM   4965 N N     . VAL B 1 301 ? 50.214 32.124 128.719 1.00 70.14 ? 301 VAL B N     1 
ATOM   4966 C CA    . VAL B 1 301 ? 50.137 33.566 128.945 1.00 71.82 ? 301 VAL B CA    1 
ATOM   4967 C C     . VAL B 1 301 ? 50.735 34.038 130.286 1.00 73.17 ? 301 VAL B C     1 
ATOM   4968 O O     . VAL B 1 301 ? 50.248 33.692 131.394 1.00 72.82 ? 301 VAL B O     1 
ATOM   4969 C CB    . VAL B 1 301 ? 48.691 34.064 128.772 1.00 71.68 ? 301 VAL B CB    1 
ATOM   4970 C CG1   . VAL B 1 301 ? 48.574 35.547 129.143 1.00 72.24 ? 301 VAL B CG1   1 
ATOM   4971 C CG2   . VAL B 1 301 ? 48.209 33.780 127.344 1.00 70.89 ? 301 VAL B CG2   1 
ATOM   4972 N N     . THR B 1 302 ? 51.800 34.840 130.173 1.00 75.47 ? 302 THR B N     1 
ATOM   4973 C CA    . THR B 1 302 ? 52.501 35.368 131.369 1.00 77.42 ? 302 THR B CA    1 
ATOM   4974 C C     . THR B 1 302 ? 51.547 36.250 132.198 1.00 79.04 ? 302 THR B C     1 
ATOM   4975 O O     . THR B 1 302 ? 50.706 36.945 131.615 1.00 78.98 ? 302 THR B O     1 
ATOM   4976 C CB    . THR B 1 302 ? 53.871 36.059 131.041 1.00 76.88 ? 302 THR B CB    1 
ATOM   4977 O OG1   . THR B 1 302 ? 53.674 37.377 130.536 1.00 76.54 ? 302 THR B OG1   1 
ATOM   4978 C CG2   . THR B 1 302 ? 54.648 35.256 130.011 1.00 78.07 ? 302 THR B CG2   1 
ATOM   4979 N N     . PRO B 1 303 ? 51.625 36.180 133.556 1.00 80.80 ? 303 PRO B N     1 
ATOM   4980 C CA    . PRO B 1 303 ? 50.685 37.067 134.245 1.00 81.95 ? 303 PRO B CA    1 
ATOM   4981 C C     . PRO B 1 303 ? 51.041 38.569 134.112 1.00 82.86 ? 303 PRO B C     1 
ATOM   4982 O O     . PRO B 1 303 ? 50.349 39.374 134.685 1.00 83.63 ? 303 PRO B O     1 
ATOM   4983 C CB    . PRO B 1 303 ? 50.692 36.559 135.709 1.00 82.14 ? 303 PRO B CB    1 
ATOM   4984 C CG    . PRO B 1 303 ? 51.563 35.289 135.725 1.00 81.62 ? 303 PRO B CG    1 
ATOM   4985 C CD    . PRO B 1 303 ? 52.450 35.403 134.509 1.00 80.82 ? 303 PRO B CD    1 
ATOM   4986 N N     . GLU B 1 304 ? 52.108 38.920 133.372 1.00 83.98 ? 304 GLU B N     1 
ATOM   4987 C CA    . GLU B 1 304 ? 52.340 40.282 132.790 1.00 84.72 ? 304 GLU B CA    1 
ATOM   4988 C C     . GLU B 1 304 ? 51.566 40.452 131.476 1.00 85.90 ? 304 GLU B C     1 
ATOM   4989 O O     . GLU B 1 304 ? 51.758 41.451 130.755 1.00 86.27 ? 304 GLU B O     1 
ATOM   4990 C CB    . GLU B 1 304 ? 53.827 40.517 132.466 1.00 84.24 ? 304 GLU B CB    1 
ATOM   4991 C CG    . GLU B 1 304 ? 54.705 40.894 133.630 1.00 84.24 ? 304 GLU B CG    1 
ATOM   4992 C CD    . GLU B 1 304 ? 54.288 40.165 134.878 1.00 84.93 ? 304 GLU B CD    1 
ATOM   4993 O OE1   . GLU B 1 304 ? 53.293 40.595 135.514 1.00 85.51 ? 304 GLU B OE1   1 
ATOM   4994 O OE2   . GLU B 1 304 ? 54.931 39.148 135.209 1.00 84.27 ? 304 GLU B OE2   1 
ATOM   4995 N N     . GLY B 1 305 ? 50.731 39.450 131.159 1.00 86.71 ? 305 GLY B N     1 
ATOM   4996 C CA    . GLY B 1 305 ? 49.922 39.375 129.935 1.00 87.16 ? 305 GLY B CA    1 
ATOM   4997 C C     . GLY B 1 305 ? 50.635 39.495 128.595 1.00 87.44 ? 305 GLY B C     1 
ATOM   4998 O O     . GLY B 1 305 ? 50.238 40.357 127.789 1.00 87.56 ? 305 GLY B O     1 
ATOM   4999 N N     . GLU B 1 306 ? 51.686 38.668 128.379 1.00 87.45 ? 306 GLU B N     1 
ATOM   5000 C CA    . GLU B 1 306 ? 52.337 38.423 127.037 1.00 86.68 ? 306 GLU B CA    1 
ATOM   5001 C C     . GLU B 1 306 ? 52.770 36.973 126.746 1.00 85.65 ? 306 GLU B C     1 
ATOM   5002 O O     . GLU B 1 306 ? 52.939 36.144 127.661 1.00 85.25 ? 306 GLU B O     1 
ATOM   5003 C CB    . GLU B 1 306 ? 53.519 39.362 126.777 1.00 86.91 ? 306 GLU B CB    1 
ATOM   5004 C CG    . GLU B 1 306 ? 54.810 38.915 127.420 1.00 87.88 ? 306 GLU B CG    1 
ATOM   5005 C CD    . GLU B 1 306 ? 55.781 40.057 127.587 1.00 88.95 ? 306 GLU B CD    1 
ATOM   5006 O OE1   . GLU B 1 306 ? 55.829 40.623 128.699 1.00 87.25 ? 306 GLU B OE1   1 
ATOM   5007 O OE2   . GLU B 1 306 ? 56.478 40.401 126.604 1.00 91.43 ? 306 GLU B OE2   1 
ATOM   5008 N N     . ALA B 1 307 ? 52.960 36.689 125.458 1.00 84.49 ? 307 ALA B N     1 
ATOM   5009 C CA    . ALA B 1 307 ? 53.294 35.333 125.024 1.00 83.23 ? 307 ALA B CA    1 
ATOM   5010 C C     . ALA B 1 307 ? 54.678 34.884 125.455 1.00 82.29 ? 307 ALA B C     1 
ATOM   5011 O O     . ALA B 1 307 ? 55.650 35.596 125.235 1.00 81.95 ? 307 ALA B O     1 
ATOM   5012 C CB    . ALA B 1 307 ? 53.162 35.223 123.546 1.00 83.25 ? 307 ALA B CB    1 
ATOM   5013 N N     . ARG B 1 308 ? 54.738 33.697 126.066 1.00 81.80 ? 308 ARG B N     1 
ATOM   5014 C CA    . ARG B 1 308 ? 55.993 33.037 126.453 1.00 81.17 ? 308 ARG B CA    1 
ATOM   5015 C C     . ARG B 1 308 ? 56.011 31.518 126.206 1.00 80.68 ? 308 ARG B C     1 
ATOM   5016 O O     . ARG B 1 308 ? 55.019 30.820 126.378 1.00 80.05 ? 308 ARG B O     1 
ATOM   5017 C CB    . ARG B 1 308 ? 56.363 33.353 127.899 1.00 81.00 ? 308 ARG B CB    1 
ATOM   5018 C CG    . ARG B 1 308 ? 57.850 33.146 128.189 1.00 81.82 ? 308 ARG B CG    1 
ATOM   5019 C CD    . ARG B 1 308 ? 58.277 33.369 129.677 1.00 81.27 ? 308 ARG B CD    1 
ATOM   5020 N NE    . ARG B 1 308 ? 59.741 33.407 129.809 1.00 79.83 ? 308 ARG B NE    1 
ATOM   5021 C CZ    . ARG B 1 308 ? 60.515 34.346 129.261 1.00 79.03 ? 308 ARG B CZ    1 
ATOM   5022 N NH1   . ARG B 1 308 ? 59.983 35.315 128.549 1.00 78.82 ? 308 ARG B NH1   1 
ATOM   5023 N NH2   . ARG B 1 308 ? 61.828 34.327 129.408 1.00 80.64 ? 308 ARG B NH2   1 
ATOM   5024 N N     . GLN B 1 309 ? 57.171 31.047 125.774 1.00 81.02 ? 309 GLN B N     1 
ATOM   5025 C CA    . GLN B 1 309 ? 57.437 29.645 125.520 1.00 81.73 ? 309 GLN B CA    1 
ATOM   5026 C C     . GLN B 1 309 ? 58.296 29.149 126.631 1.00 81.92 ? 309 GLN B C     1 
ATOM   5027 O O     . GLN B 1 309 ? 59.157 29.876 127.103 1.00 81.56 ? 309 GLN B O     1 
ATOM   5028 C CB    . GLN B 1 309 ? 58.348 29.498 124.320 1.00 81.81 ? 309 GLN B CB    1 
ATOM   5029 C CG    . GLN B 1 309 ? 57.752 29.613 122.965 1.00 82.59 ? 309 GLN B CG    1 
ATOM   5030 C CD    . GLN B 1 309 ? 58.841 29.961 121.947 1.00 84.69 ? 309 GLN B CD    1 
ATOM   5031 O OE1   . GLN B 1 309 ? 59.683 30.865 122.174 1.00 83.80 ? 309 GLN B OE1   1 
ATOM   5032 N NE2   . GLN B 1 309 ? 58.842 29.241 120.824 1.00 83.63 ? 309 GLN B NE2   1 
ATOM   5033 N N     . ALA B 1 310 ? 58.115 27.889 126.989 1.00 82.48 ? 310 ALA B N     1 
ATOM   5034 C CA    . ALA B 1 310 ? 58.965 27.216 127.947 1.00 83.77 ? 310 ALA B CA    1 
ATOM   5035 C C     . ALA B 1 310 ? 58.621 25.730 127.805 1.00 84.49 ? 310 ALA B C     1 
ATOM   5036 O O     . ALA B 1 310 ? 57.461 25.418 127.467 1.00 84.17 ? 310 ALA B O     1 
ATOM   5037 C CB    . ALA B 1 310 ? 58.689 27.721 129.366 1.00 82.81 ? 310 ALA B CB    1 
ATOM   5038 N N     . PRO B 1 311 ? 59.623 24.814 128.035 1.00 85.50 ? 311 PRO B N     1 
ATOM   5039 C CA    . PRO B 1 311 ? 59.506 23.328 127.899 1.00 85.73 ? 311 PRO B CA    1 
ATOM   5040 C C     . PRO B 1 311 ? 58.472 22.679 128.819 1.00 87.10 ? 311 PRO B C     1 
ATOM   5041 O O     . PRO B 1 311 ? 58.105 23.283 129.841 1.00 87.11 ? 311 PRO B O     1 
ATOM   5042 C CB    . PRO B 1 311 ? 60.906 22.810 128.267 1.00 85.28 ? 311 PRO B CB    1 
ATOM   5043 C CG    . PRO B 1 311 ? 61.611 23.910 128.873 1.00 84.96 ? 311 PRO B CG    1 
ATOM   5044 C CD    . PRO B 1 311 ? 60.995 25.202 128.435 1.00 85.25 ? 311 PRO B CD    1 
ATOM   5045 N N     . TYR B 1 312 ? 58.044 21.451 128.476 1.00 88.54 ? 312 TYR B N     1 
ATOM   5046 C CA    . TYR B 1 312 ? 56.925 20.734 129.174 1.00 90.14 ? 312 TYR B CA    1 
ATOM   5047 C C     . TYR B 1 312 ? 57.201 19.957 130.504 1.00 90.65 ? 312 TYR B C     1 
ATOM   5048 O O     . TYR B 1 312 ? 57.723 18.818 130.474 1.00 90.73 ? 312 TYR B O     1 
ATOM   5049 C CB    . TYR B 1 312 ? 56.165 19.830 128.194 1.00 90.35 ? 312 TYR B CB    1 
ATOM   5050 C CG    . TYR B 1 312 ? 54.770 19.516 128.672 1.00 91.20 ? 312 TYR B CG    1 
ATOM   5051 C CD1   . TYR B 1 312 ? 54.187 18.282 128.380 1.00 92.35 ? 312 TYR B CD1   1 
ATOM   5052 C CD2   . TYR B 1 312 ? 54.037 20.450 129.440 1.00 90.54 ? 312 TYR B CD2   1 
ATOM   5053 C CE1   . TYR B 1 312 ? 52.913 17.981 128.809 1.00 93.52 ? 312 TYR B CE1   1 
ATOM   5054 C CE2   . TYR B 1 312 ? 52.759 20.172 129.876 1.00 91.93 ? 312 TYR B CE2   1 
ATOM   5055 C CZ    . TYR B 1 312 ? 52.194 18.924 129.563 1.00 93.23 ? 312 TYR B CZ    1 
ATOM   5056 O OH    . TYR B 1 312 ? 50.915 18.582 129.989 1.00 93.12 ? 312 TYR B OH    1 
ATOM   5057 N N     . LYS B 1 313 ? 56.795 20.560 131.643 1.00 90.97 ? 313 LYS B N     1 
ATOM   5058 C CA    . LYS B 1 313 ? 57.049 20.013 133.005 1.00 90.77 ? 313 LYS B CA    1 
ATOM   5059 C C     . LYS B 1 313 ? 56.283 18.697 133.354 1.00 90.76 ? 313 LYS B C     1 
ATOM   5060 O O     . LYS B 1 313 ? 56.848 17.599 133.220 1.00 90.26 ? 313 LYS B O     1 
ATOM   5061 C CB    . LYS B 1 313 ? 56.890 21.110 134.100 1.00 91.08 ? 313 LYS B CB    1 
ATOM   5062 C CG    . LYS B 1 313 ? 55.872 22.230 133.788 1.00 90.20 ? 313 LYS B CG    1 
ATOM   5063 C CD    . LYS B 1 313 ? 55.233 22.779 135.062 1.00 87.59 ? 313 LYS B CD    1 
ATOM   5064 C CE    . LYS B 1 313 ? 53.796 23.229 134.800 1.00 84.62 ? 313 LYS B CE    1 
ATOM   5065 N NZ    . LYS B 1 313 ? 52.986 22.169 134.140 1.00 80.08 ? 313 LYS B NZ    1 
HETATM 5066 C CS    . MTA C 2 .   ? 38.428 66.523 125.188 0.00 88.80 ? 315 MTA A CS    1 
HETATM 5067 S "S5'" . MTA C 2 .   ? 37.999 66.318 123.428 0.00 89.55 ? 315 MTA A "S5'" 1 
HETATM 5068 C "C5'" . MTA C 2 .   ? 38.365 67.560 123.010 1.00 55.84 ? 315 MTA A "C5'" 1 
HETATM 5069 C "C4'" . MTA C 2 .   ? 38.990 68.989 123.082 1.00 56.00 ? 315 MTA A "C4'" 1 
HETATM 5070 O "O4'" . MTA C 2 .   ? 38.167 70.099 122.635 1.00 52.10 ? 315 MTA A "O4'" 1 
HETATM 5071 C "C2'" . MTA C 2 .   ? 38.491 70.506 124.911 1.00 52.22 ? 315 MTA A "C2'" 1 
HETATM 5072 O "O2'" . MTA C 2 .   ? 39.298 71.447 125.615 1.00 49.91 ? 315 MTA A "O2'" 1 
HETATM 5073 C "C3'" . MTA C 2 .   ? 39.395 69.374 124.491 1.00 54.16 ? 315 MTA A "C3'" 1 
HETATM 5074 O "O3'" . MTA C 2 .   ? 40.686 69.937 124.344 1.00 54.29 ? 315 MTA A "O3'" 1 
HETATM 5075 C "C1'" . MTA C 2 .   ? 38.029 71.157 123.611 1.00 50.10 ? 315 MTA A "C1'" 1 
HETATM 5076 N N9    . MTA C 2 .   ? 36.707 71.968 123.681 1.00 49.74 ? 315 MTA A N9    1 
HETATM 5077 C C8    . MTA C 2 .   ? 35.671 71.820 124.549 1.00 48.36 ? 315 MTA A C8    1 
HETATM 5078 N N7    . MTA C 2 .   ? 34.678 72.738 124.298 1.00 48.25 ? 315 MTA A N7    1 
HETATM 5079 C C5    . MTA C 2 .   ? 35.025 73.517 123.276 1.00 45.95 ? 315 MTA A C5    1 
HETATM 5080 C C6    . MTA C 2 .   ? 34.445 74.670 122.521 1.00 50.12 ? 315 MTA A C6    1 
HETATM 5081 N N6    . MTA C 2 .   ? 33.229 75.210 122.831 1.00 50.69 ? 315 MTA A N6    1 
HETATM 5082 N N1    . MTA C 2 .   ? 35.150 75.216 121.489 1.00 48.85 ? 315 MTA A N1    1 
HETATM 5083 C C2    . MTA C 2 .   ? 36.349 74.726 121.199 1.00 48.00 ? 315 MTA A C2    1 
HETATM 5084 N N3    . MTA C 2 .   ? 36.915 73.694 121.846 1.00 47.38 ? 315 MTA A N3    1 
HETATM 5085 C C4    . MTA C 2 .   ? 36.339 73.025 122.875 1.00 47.50 ? 315 MTA A C4    1 
HETATM 5086 C CS    . MTA D 2 .   ? 33.143 29.581 128.333 0.00 87.91 ? 315 MTA B CS    1 
HETATM 5087 S "S5'" . MTA D 2 .   ? 34.141 29.531 126.818 0.00 89.05 ? 315 MTA B "S5'" 1 
HETATM 5088 C "C5'" . MTA D 2 .   ? 34.583 28.449 127.199 1.00 63.12 ? 315 MTA B "C5'" 1 
HETATM 5089 C "C4'" . MTA D 2 .   ? 34.720 26.915 127.426 1.00 65.97 ? 315 MTA B "C4'" 1 
HETATM 5090 O "O4'" . MTA D 2 .   ? 35.972 26.202 127.114 1.00 66.25 ? 315 MTA B "O4'" 1 
HETATM 5091 C "C2'" . MTA D 2 .   ? 35.643 25.779 129.422 1.00 64.71 ? 315 MTA B "C2'" 1 
HETATM 5092 O "O2'" . MTA D 2 .   ? 35.398 24.691 130.326 1.00 60.01 ? 315 MTA B "O2'" 1 
HETATM 5093 C "C3'" . MTA D 2 .   ? 34.416 26.467 128.861 1.00 64.79 ? 315 MTA B "C3'" 1 
HETATM 5094 O "O3'" . MTA D 2 .   ? 33.489 25.389 128.737 1.00 62.59 ? 315 MTA B "O3'" 1 
HETATM 5095 C "C1'" . MTA D 2 .   ? 36.092 25.131 128.137 1.00 68.14 ? 315 MTA B "C1'" 1 
HETATM 5096 N N9    . MTA D 2 .   ? 37.414 24.390 128.305 1.00 71.36 ? 315 MTA B N9    1 
HETATM 5097 C C8    . MTA D 2 .   ? 38.474 24.768 129.090 1.00 68.65 ? 315 MTA B C8    1 
HETATM 5098 N N7    . MTA D 2 .   ? 39.498 23.880 128.949 1.00 67.37 ? 315 MTA B N7    1 
HETATM 5099 C C5    . MTA D 2 .   ? 39.118 22.902 128.069 1.00 68.21 ? 315 MTA B C5    1 
HETATM 5100 C C6    . MTA D 2 .   ? 39.735 21.663 127.445 1.00 67.41 ? 315 MTA B C6    1 
HETATM 5101 N N6    . MTA D 2 .   ? 41.010 21.272 127.758 1.00 67.29 ? 315 MTA B N6    1 
HETATM 5102 N N1    . MTA D 2 .   ? 38.986 20.925 126.576 1.00 64.71 ? 315 MTA B N1    1 
HETATM 5103 C C2    . MTA D 2 .   ? 37.734 21.312 126.241 1.00 67.45 ? 315 MTA B C2    1 
HETATM 5104 N N3    . MTA D 2 .   ? 37.121 22.415 126.747 1.00 68.95 ? 315 MTA B N3    1 
HETATM 5105 C C4    . MTA D 2 .   ? 37.738 23.235 127.657 1.00 68.82 ? 315 MTA B C4    1 
HETATM 5106 O O     . HOH E 3 .   ? 44.500 65.977 118.978 1.00 26.79 ? 316 HOH A O     1 
HETATM 5107 O O     . HOH E 3 .   ? 40.361 49.905 115.527 1.00 40.56 ? 317 HOH A O     1 
HETATM 5108 O O     . HOH E 3 .   ? 29.041 68.224 117.439 1.00 32.08 ? 318 HOH A O     1 
HETATM 5109 O O     . HOH E 3 .   ? 43.384 57.757 122.722 1.00 21.30 ? 319 HOH A O     1 
HETATM 5110 O O     . HOH E 3 .   ? 50.235 57.231 118.586 1.00 19.31 ? 320 HOH A O     1 
HETATM 5111 O O     . HOH E 3 .   ? 49.973 58.793 112.598 1.00 20.55 ? 321 HOH A O     1 
HETATM 5112 O O     . HOH E 3 .   ? 29.045 53.847 106.093 1.00 37.81 ? 322 HOH A O     1 
HETATM 5113 O O     . HOH E 3 .   ? 25.413 55.619 107.661 1.00 11.28 ? 323 HOH A O     1 
HETATM 5114 O O     . HOH E 3 .   ? 50.831 44.819 144.771 1.00 41.10 ? 324 HOH A O     1 
HETATM 5115 O O     . HOH E 3 .   ? 18.787 54.731 117.885 1.00 28.18 ? 325 HOH A O     1 
HETATM 5116 O O     . HOH E 3 .   ? 40.898 53.006 96.688  1.00 44.13 ? 326 HOH A O     1 
HETATM 5117 O O     . HOH E 3 .   ? 47.511 52.168 101.676 1.00 12.93 ? 327 HOH A O     1 
HETATM 5118 O O     . HOH E 3 .   ? 55.832 56.730 128.299 1.00 30.61 ? 328 HOH A O     1 
HETATM 5119 O O     . HOH E 3 .   ? 32.627 49.807 123.024 1.00 22.61 ? 329 HOH A O     1 
HETATM 5120 O O     . HOH E 3 .   ? 57.112 71.788 112.945 1.00 20.44 ? 330 HOH A O     1 
HETATM 5121 O O     . HOH E 3 .   ? 52.398 60.104 121.278 1.00 31.48 ? 331 HOH A O     1 
HETATM 5122 O O     . HOH E 3 .   ? 47.531 52.148 133.196 1.00 25.43 ? 332 HOH A O     1 
HETATM 5123 O O     . HOH E 3 .   ? 30.717 52.784 101.822 1.00 45.56 ? 333 HOH A O     1 
HETATM 5124 O O     . HOH E 3 .   ? 57.344 69.808 125.526 1.00 19.16 ? 334 HOH A O     1 
HETATM 5125 O O     . HOH E 3 .   ? 44.884 68.966 117.022 1.00 44.83 ? 335 HOH A O     1 
HETATM 5126 O O     . HOH E 3 .   ? 29.416 70.131 101.169 1.00 39.00 ? 336 HOH A O     1 
HETATM 5127 O O     . HOH E 3 .   ? 37.598 48.131 109.571 1.00 39.55 ? 337 HOH A O     1 
HETATM 5128 O O     . HOH E 3 .   ? 50.490 77.134 116.938 1.00 20.58 ? 338 HOH A O     1 
HETATM 5129 O O     . HOH E 3 .   ? 52.583 60.856 105.748 1.00 30.94 ? 339 HOH A O     1 
HETATM 5130 O O     . HOH E 3 .   ? 32.553 79.667 96.785  1.00 19.60 ? 340 HOH A O     1 
HETATM 5131 O O     . HOH E 3 .   ? 48.197 69.209 141.773 1.00 54.58 ? 341 HOH A O     1 
HETATM 5132 O O     . HOH E 3 .   ? 37.892 49.186 98.886  1.00 30.89 ? 342 HOH A O     1 
HETATM 5133 O O     . HOH E 3 .   ? 55.262 45.954 136.243 1.00 29.48 ? 343 HOH A O     1 
HETATM 5134 O O     . HOH E 3 .   ? 53.526 51.337 113.749 1.00 18.95 ? 344 HOH A O     1 
HETATM 5135 O O     . HOH E 3 .   ? 26.520 55.829 121.113 1.00 31.76 ? 345 HOH A O     1 
HETATM 5136 O O     . HOH E 3 .   ? 53.788 58.730 117.095 1.00 30.64 ? 346 HOH A O     1 
HETATM 5137 O O     . HOH E 3 .   ? 50.954 77.748 119.785 1.00 29.73 ? 347 HOH A O     1 
HETATM 5138 O O     . HOH E 3 .   ? 28.559 51.465 139.119 1.00 27.45 ? 348 HOH A O     1 
HETATM 5139 O O     . HOH E 3 .   ? 54.512 66.434 105.117 1.00 38.73 ? 349 HOH A O     1 
HETATM 5140 O O     . HOH E 3 .   ? 57.190 58.772 128.164 1.00 32.51 ? 350 HOH A O     1 
HETATM 5141 O O     . HOH E 3 .   ? 53.653 54.824 119.105 1.00 34.15 ? 351 HOH A O     1 
HETATM 5142 O O     . HOH E 3 .   ? 15.310 70.714 110.597 1.00 32.15 ? 352 HOH A O     1 
HETATM 5143 O O     . HOH E 3 .   ? 19.031 58.687 105.557 1.00 20.57 ? 353 HOH A O     1 
HETATM 5144 O O     . HOH E 3 .   ? 16.191 68.278 106.605 1.00 29.59 ? 354 HOH A O     1 
HETATM 5145 O O     . HOH E 3 .   ? 36.234 49.150 112.225 1.00 24.44 ? 355 HOH A O     1 
HETATM 5146 O O     . HOH E 3 .   ? 35.361 47.459 102.855 1.00 29.95 ? 356 HOH A O     1 
HETATM 5147 O O     . HOH E 3 .   ? 34.783 48.816 115.368 1.00 47.53 ? 357 HOH A O     1 
HETATM 5148 O O     . HOH E 3 .   ? 33.570 46.956 109.983 1.00 14.30 ? 358 HOH A O     1 
HETATM 5149 O O     . HOH E 3 .   ? 52.726 49.747 116.094 1.00 25.35 ? 359 HOH A O     1 
HETATM 5150 O O     . HOH E 3 .   ? 50.756 70.375 136.800 1.00 37.81 ? 360 HOH A O     1 
HETATM 5151 O O     . HOH E 3 .   ? 49.374 80.252 115.560 1.00 9.63  ? 361 HOH A O     1 
HETATM 5152 O O     . HOH E 3 .   ? 37.594 56.867 127.006 1.00 38.59 ? 362 HOH A O     1 
HETATM 5153 O O     . HOH E 3 .   ? 27.876 56.199 129.094 1.00 49.15 ? 363 HOH A O     1 
HETATM 5154 O O     . HOH E 3 .   ? 33.415 65.344 118.360 1.00 17.29 ? 364 HOH A O     1 
HETATM 5155 O O     . HOH E 3 .   ? 27.895 47.109 117.682 1.00 30.98 ? 365 HOH A O     1 
HETATM 5156 O O     . HOH E 3 .   ? 51.200 52.501 141.522 1.00 37.15 ? 366 HOH A O     1 
HETATM 5157 O O     . HOH E 3 .   ? 20.132 43.747 114.898 1.00 40.47 ? 367 HOH A O     1 
HETATM 5158 O O     . HOH E 3 .   ? 20.557 47.961 117.021 1.00 39.89 ? 368 HOH A O     1 
HETATM 5159 O O     . HOH E 3 .   ? 48.525 73.756 97.513  1.00 21.45 ? 369 HOH A O     1 
HETATM 5160 O O     . HOH E 3 .   ? 55.043 70.676 111.117 1.00 25.98 ? 370 HOH A O     1 
HETATM 5161 O O     . HOH E 3 .   ? 52.561 66.305 110.427 1.00 36.92 ? 371 HOH A O     1 
HETATM 5162 O O     . HOH E 3 .   ? 56.764 63.207 130.800 1.00 32.69 ? 372 HOH A O     1 
HETATM 5163 O O     . HOH E 3 .   ? 10.751 57.230 118.334 1.00 24.66 ? 373 HOH A O     1 
HETATM 5164 O O     . HOH E 3 .   ? 45.275 49.624 97.997  1.00 37.70 ? 374 HOH A O     1 
HETATM 5165 O O     . HOH E 3 .   ? 32.739 56.198 128.158 1.00 36.42 ? 375 HOH A O     1 
HETATM 5166 O O     . HOH E 3 .   ? 55.882 56.397 108.430 1.00 52.22 ? 376 HOH A O     1 
HETATM 5167 O O     . HOH E 3 .   ? 20.812 75.470 105.397 1.00 54.61 ? 377 HOH A O     1 
HETATM 5168 O O     . HOH E 3 .   ? 54.414 57.591 110.341 1.00 28.25 ? 378 HOH A O     1 
HETATM 5169 O O     . HOH E 3 .   ? 55.429 53.091 141.469 1.00 36.87 ? 379 HOH A O     1 
HETATM 5170 O O     . HOH E 3 .   ? 52.972 65.528 140.008 1.00 17.61 ? 380 HOH A O     1 
HETATM 5171 O O     . HOH E 3 .   ? 31.768 76.972 127.861 1.00 29.67 ? 381 HOH A O     1 
HETATM 5172 O O     . HOH E 3 .   ? 56.775 58.033 121.833 1.00 48.28 ? 382 HOH A O     1 
HETATM 5173 O O     . HOH E 3 .   ? 18.703 76.818 111.536 1.00 32.87 ? 383 HOH A O     1 
HETATM 5174 O O     . HOH E 3 .   ? 50.154 80.361 118.009 1.00 26.90 ? 384 HOH A O     1 
HETATM 5175 O O     . HOH E 3 .   ? 43.069 83.939 121.129 1.00 42.29 ? 385 HOH A O     1 
HETATM 5176 O O     . HOH E 3 .   ? 42.875 50.613 96.617  1.00 42.37 ? 386 HOH A O     1 
HETATM 5177 O O     . HOH E 3 .   ? 53.630 68.388 112.074 1.00 18.42 ? 387 HOH A O     1 
HETATM 5178 O O     . HOH E 3 .   ? 21.797 58.471 100.636 1.00 37.64 ? 388 HOH A O     1 
HETATM 5179 O O     . HOH E 3 .   ? 47.003 46.801 98.641  1.00 32.55 ? 389 HOH A O     1 
HETATM 5180 O O     . HOH E 3 .   ? 53.410 50.695 125.044 1.00 31.99 ? 390 HOH A O     1 
HETATM 5181 O O     . HOH E 3 .   ? 20.141 72.848 106.293 1.00 31.03 ? 391 HOH A O     1 
HETATM 5182 O O     . HOH E 3 .   ? 33.881 50.536 99.356  1.00 36.67 ? 392 HOH A O     1 
HETATM 5183 O O     . HOH E 3 .   ? 15.795 50.023 111.106 1.00 42.81 ? 393 HOH A O     1 
HETATM 5184 O O     . HOH E 3 .   ? 56.178 56.221 140.967 1.00 33.49 ? 394 HOH A O     1 
HETATM 5185 O O     . HOH E 3 .   ? 11.561 50.955 119.129 1.00 35.63 ? 395 HOH A O     1 
HETATM 5186 O O     . HOH E 3 .   ? 26.451 80.814 117.641 1.00 19.07 ? 396 HOH A O     1 
HETATM 5187 O O     . HOH E 3 .   ? 45.772 55.308 90.594  1.00 24.71 ? 397 HOH A O     1 
HETATM 5188 O O     . HOH E 3 .   ? 17.979 65.282 97.822  1.00 33.42 ? 398 HOH A O     1 
HETATM 5189 O O     . HOH E 3 .   ? 54.206 68.475 108.371 1.00 33.95 ? 399 HOH A O     1 
HETATM 5190 O O     . HOH E 3 .   ? 54.611 65.615 101.563 1.00 28.35 ? 400 HOH A O     1 
HETATM 5191 O O     . HOH E 3 .   ? 14.788 59.382 124.052 1.00 35.51 ? 401 HOH A O     1 
HETATM 5192 O O     . HOH E 3 .   ? 26.196 78.806 103.640 1.00 46.08 ? 402 HOH A O     1 
HETATM 5193 O O     . HOH E 3 .   ? 31.425 91.858 107.694 1.00 38.50 ? 403 HOH A O     1 
HETATM 5194 O O     . HOH E 3 .   ? 17.313 66.326 103.047 1.00 24.41 ? 404 HOH A O     1 
HETATM 5195 O O     . HOH E 3 .   ? 47.683 46.318 95.995  1.00 41.46 ? 405 HOH A O     1 
HETATM 5196 O O     . HOH E 3 .   ? 55.107 56.085 95.164  1.00 28.51 ? 406 HOH A O     1 
HETATM 5197 O O     . HOH E 3 .   ? 22.614 55.381 106.398 1.00 26.52 ? 407 HOH A O     1 
HETATM 5198 O O     . HOH E 3 .   ? 16.517 66.235 136.099 1.00 36.52 ? 408 HOH A O     1 
HETATM 5199 O O     . HOH E 3 .   ? 19.816 59.495 102.468 1.00 39.32 ? 409 HOH A O     1 
HETATM 5200 O O     . HOH E 3 .   ? 33.369 64.117 126.755 1.00 23.91 ? 410 HOH A O     1 
HETATM 5201 O O     . HOH E 3 .   ? 21.211 79.373 122.944 1.00 32.02 ? 411 HOH A O     1 
HETATM 5202 O O     . HOH E 3 .   ? 41.250 47.925 124.288 1.00 47.87 ? 412 HOH A O     1 
HETATM 5203 O O     . HOH E 3 .   ? 28.972 72.277 97.758  1.00 30.70 ? 413 HOH A O     1 
HETATM 5204 O O     . HOH E 3 .   ? 35.099 68.695 96.897  1.00 34.19 ? 414 HOH A O     1 
HETATM 5205 O O     . HOH E 3 .   ? 36.976 61.687 124.387 1.00 35.25 ? 415 HOH A O     1 
HETATM 5206 O O     . HOH E 3 .   ? 32.389 70.584 127.812 1.00 41.72 ? 416 HOH A O     1 
HETATM 5207 O O     . HOH E 3 .   ? 33.126 49.059 89.058  1.00 30.21 ? 417 HOH A O     1 
HETATM 5208 O O     . HOH F 3 .   ? 50.904 34.120 99.870  1.00 36.29 ? 316 HOH B O     1 
HETATM 5209 O O     . HOH F 3 .   ? 29.822 47.645 102.370 1.00 39.82 ? 317 HOH B O     1 
HETATM 5210 O O     . HOH F 3 .   ? 43.599 26.250 119.883 1.00 24.09 ? 318 HOH B O     1 
HETATM 5211 O O     . HOH F 3 .   ? 28.468 25.031 122.234 1.00 12.81 ? 319 HOH B O     1 
HETATM 5212 O O     . HOH F 3 .   ? 50.431 26.944 123.552 1.00 22.72 ? 320 HOH B O     1 
HETATM 5213 O O     . HOH F 3 .   ? 26.343 45.114 106.560 1.00 45.10 ? 321 HOH B O     1 
HETATM 5214 O O     . HOH F 3 .   ? 23.104 38.233 122.597 1.00 14.68 ? 322 HOH B O     1 
HETATM 5215 O O     . HOH F 3 .   ? 41.370 45.516 123.015 1.00 27.06 ? 323 HOH B O     1 
HETATM 5216 O O     . HOH F 3 .   ? 18.847 39.638 132.305 1.00 22.19 ? 324 HOH B O     1 
HETATM 5217 O O     . HOH F 3 .   ? 47.172 40.379 120.563 1.00 21.11 ? 325 HOH B O     1 
HETATM 5218 O O     . HOH F 3 .   ? 51.276 35.473 113.165 1.00 20.54 ? 326 HOH B O     1 
HETATM 5219 O O     . HOH F 3 .   ? 29.607 38.747 124.977 1.00 27.28 ? 327 HOH B O     1 
HETATM 5220 O O     . HOH F 3 .   ? 45.616 52.524 131.153 1.00 35.36 ? 328 HOH B O     1 
HETATM 5221 O O     . HOH F 3 .   ? 31.610 44.923 116.684 1.00 25.66 ? 329 HOH B O     1 
HETATM 5222 O O     . HOH F 3 .   ? 33.118 48.114 124.638 1.00 13.59 ? 330 HOH B O     1 
HETATM 5223 O O     . HOH F 3 .   ? 36.657 41.273 128.755 1.00 34.81 ? 331 HOH B O     1 
HETATM 5224 O O     . HOH F 3 .   ? 55.685 16.664 114.633 1.00 35.98 ? 332 HOH B O     1 
HETATM 5225 O O     . HOH F 3 .   ? 46.339 47.522 119.353 1.00 7.65  ? 333 HOH B O     1 
HETATM 5226 O O     . HOH F 3 .   ? 33.941 44.512 110.011 1.00 17.90 ? 334 HOH B O     1 
HETATM 5227 O O     . HOH F 3 .   ? 43.256 42.954 104.338 1.00 31.78 ? 335 HOH B O     1 
HETATM 5228 O O     . HOH F 3 .   ? 35.206 44.072 112.902 1.00 12.00 ? 336 HOH B O     1 
HETATM 5229 O O     . HOH F 3 .   ? 23.479 17.529 126.809 1.00 39.32 ? 337 HOH B O     1 
HETATM 5230 O O     . HOH F 3 .   ? 21.281 36.436 97.753  1.00 46.50 ? 338 HOH B O     1 
HETATM 5231 O O     . HOH F 3 .   ? 20.644 32.064 98.386  1.00 36.48 ? 339 HOH B O     1 
HETATM 5232 O O     . HOH F 3 .   ? 41.000 41.098 102.809 1.00 28.77 ? 340 HOH B O     1 
HETATM 5233 O O     . HOH F 3 .   ? 23.004 40.291 104.413 1.00 36.63 ? 341 HOH B O     1 
HETATM 5234 O O     . HOH F 3 .   ? 48.807 52.257 104.336 1.00 18.88 ? 342 HOH B O     1 
HETATM 5235 O O     . HOH F 3 .   ? 52.592 46.709 115.210 1.00 20.75 ? 343 HOH B O     1 
HETATM 5236 O O     . HOH F 3 .   ? 20.215 22.671 125.614 1.00 43.50 ? 344 HOH B O     1 
HETATM 5237 O O     . HOH F 3 .   ? 37.903 45.620 112.390 1.00 24.08 ? 345 HOH B O     1 
HETATM 5238 O O     . HOH F 3 .   ? 23.852 44.907 105.596 1.00 35.51 ? 346 HOH B O     1 
HETATM 5239 O O     . HOH F 3 .   ? 31.983 43.863 102.294 1.00 33.08 ? 347 HOH B O     1 
HETATM 5240 O O     . HOH F 3 .   ? 41.857 44.144 102.313 1.00 36.72 ? 348 HOH B O     1 
HETATM 5241 O O     . HOH F 3 .   ? 20.203 33.587 118.576 1.00 31.36 ? 349 HOH B O     1 
HETATM 5242 O O     . HOH F 3 .   ? 18.918 36.129 123.283 1.00 31.74 ? 350 HOH B O     1 
HETATM 5243 O O     . HOH F 3 .   ? 20.069 27.407 116.799 1.00 37.18 ? 351 HOH B O     1 
HETATM 5244 O O     . HOH F 3 .   ? 17.927 37.071 132.992 1.00 38.19 ? 352 HOH B O     1 
HETATM 5245 O O     . HOH F 3 .   ? 46.575 40.241 103.851 1.00 51.87 ? 353 HOH B O     1 
HETATM 5246 O O     . HOH F 3 .   ? 50.456 47.454 105.456 1.00 31.75 ? 354 HOH B O     1 
HETATM 5247 O O     . HOH F 3 .   ? 46.363 47.774 116.604 1.00 19.35 ? 355 HOH B O     1 
HETATM 5248 O O     . HOH F 3 .   ? 53.200 32.501 134.607 1.00 47.41 ? 356 HOH B O     1 
HETATM 5249 O O     . HOH F 3 .   ? 46.150 37.254 108.232 1.00 13.59 ? 357 HOH B O     1 
HETATM 5250 O O     . HOH F 3 .   ? 25.657 28.978 143.836 1.00 16.76 ? 358 HOH B O     1 
HETATM 5251 O O     . HOH F 3 .   ? 44.566 47.462 116.151 1.00 39.43 ? 359 HOH B O     1 
HETATM 5252 O O     . HOH F 3 .   ? 52.300 24.250 106.997 1.00 29.35 ? 360 HOH B O     1 
HETATM 5253 O O     . HOH F 3 .   ? 46.828 16.569 109.421 1.00 39.62 ? 361 HOH B O     1 
HETATM 5254 O O     . HOH F 3 .   ? 48.128 49.303 121.534 1.00 35.14 ? 362 HOH B O     1 
HETATM 5255 O O     . HOH F 3 .   ? 58.414 31.169 112.167 1.00 37.86 ? 363 HOH B O     1 
HETATM 5256 O O     . HOH F 3 .   ? 25.086 33.032 94.814  1.00 23.11 ? 364 HOH B O     1 
HETATM 5257 O O     . HOH F 3 .   ? 60.689 39.641 112.014 1.00 18.74 ? 365 HOH B O     1 
HETATM 5258 O O     . HOH F 3 .   ? 15.884 31.627 111.374 1.00 25.67 ? 366 HOH B O     1 
HETATM 5259 O O     . HOH F 3 .   ? 49.589 17.646 109.439 1.00 37.74 ? 367 HOH B O     1 
HETATM 5260 O O     . HOH F 3 .   ? 52.950 43.142 119.072 1.00 36.26 ? 368 HOH B O     1 
HETATM 5261 O O     . HOH F 3 .   ? 38.171 39.191 102.436 1.00 44.92 ? 369 HOH B O     1 
HETATM 5262 O O     . HOH F 3 .   ? 24.598 16.284 123.968 1.00 49.66 ? 370 HOH B O     1 
HETATM 5263 O O     . HOH F 3 .   ? 49.124 43.956 102.442 1.00 27.57 ? 371 HOH B O     1 
HETATM 5264 O O     . HOH F 3 .   ? 33.339 56.007 150.859 1.00 42.34 ? 372 HOH B O     1 
HETATM 5265 O O     . HOH F 3 .   ? 51.402 42.255 136.985 1.00 49.63 ? 373 HOH B O     1 
HETATM 5266 O O     . HOH F 3 .   ? 18.194 30.188 112.204 1.00 21.17 ? 374 HOH B O     1 
HETATM 5267 O O     . HOH F 3 .   ? 52.873 44.094 122.744 1.00 22.30 ? 375 HOH B O     1 
HETATM 5268 O O     . HOH F 3 .   ? 11.580 32.629 109.143 1.00 42.50 ? 376 HOH B O     1 
HETATM 5269 O O     . HOH F 3 .   ? 43.544 17.808 132.696 1.00 45.29 ? 377 HOH B O     1 
HETATM 5270 O O     . HOH F 3 .   ? 28.318 17.099 136.224 1.00 26.72 ? 378 HOH B O     1 
HETATM 5271 O O     . HOH F 3 .   ? 18.698 41.855 141.160 1.00 47.84 ? 379 HOH B O     1 
HETATM 5272 O O     . HOH F 3 .   ? 29.997 26.094 144.564 1.00 41.42 ? 380 HOH B O     1 
HETATM 5273 O O     . HOH F 3 .   ? 30.463 21.024 98.143  1.00 17.35 ? 381 HOH B O     1 
HETATM 5274 O O     . HOH F 3 .   ? 27.480 8.334  111.875 1.00 28.33 ? 382 HOH B O     1 
HETATM 5275 O O     . HOH F 3 .   ? 19.697 21.577 128.881 1.00 26.16 ? 383 HOH B O     1 
HETATM 5276 O O     . HOH F 3 .   ? 20.549 16.953 130.536 1.00 34.29 ? 384 HOH B O     1 
HETATM 5277 O O     . HOH F 3 .   ? 12.365 31.713 120.313 1.00 34.10 ? 385 HOH B O     1 
HETATM 5278 O O     . HOH F 3 .   ? 41.866 18.535 103.296 1.00 33.07 ? 386 HOH B O     1 
HETATM 5279 O O     . HOH F 3 .   ? 20.468 46.468 101.671 1.00 36.28 ? 387 HOH B O     1 
HETATM 5280 O O     . HOH F 3 .   ? 20.665 17.933 128.059 1.00 26.22 ? 388 HOH B O     1 
HETATM 5281 O O     . HOH F 3 .   ? 13.492 33.500 125.090 1.00 25.57 ? 389 HOH B O     1 
HETATM 5282 O O     . HOH F 3 .   ? 53.911 17.076 108.839 1.00 26.67 ? 390 HOH B O     1 
HETATM 5283 O O     . HOH F 3 .   ? 31.134 47.172 97.064  1.00 38.84 ? 391 HOH B O     1 
HETATM 5284 O O     . HOH F 3 .   ? 54.265 51.272 110.175 1.00 27.58 ? 392 HOH B O     1 
HETATM 5285 O O     . HOH F 3 .   ? 34.094 25.819 146.431 1.00 56.44 ? 393 HOH B O     1 
HETATM 5286 O O     . HOH F 3 .   ? 32.087 25.099 145.936 1.00 20.63 ? 394 HOH B O     1 
HETATM 5287 O O     . HOH F 3 .   ? 31.563 31.127 123.893 1.00 27.72 ? 395 HOH B O     1 
HETATM 5288 O O     . HOH F 3 .   ? 36.818 35.200 126.584 1.00 31.85 ? 396 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   TYR 3   3   3   TYR TYR A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   MET 5   5   5   MET MET A . n 
A 1 6   TYR 6   6   6   TYR TYR A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  HIS 10  10  10  HIS HIS A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  THR 12  12  12  THR THR A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  ARG 58  58  58  ARG ARG A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  MET 72  72  72  MET MET A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  HIS 75  75  75  HIS HIS A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  VAL 81  81  81  VAL VAL A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  HIS 98  98  98  HIS HIS A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 MET 106 106 106 MET MET A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 HIS 120 120 120 HIS HIS A . n 
A 1 121 MET 121 121 121 MET MET A . n 
A 1 122 PRO 122 122 122 PRO PRO A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 TRP 124 124 124 TRP TRP A . n 
A 1 125 HIS 125 125 125 HIS HIS A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 PRO 132 132 132 PRO PRO A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 VAL 163 163 163 VAL VAL A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 THR 174 174 174 THR THR A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 TYR 178 178 178 TYR TYR A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 HIS 184 184 184 HIS HIS A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 MET 191 191 191 MET MET A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 MET 193 193 193 MET MET A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 MET 197 197 197 MET MET A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 HIS 202 202 202 HIS HIS A . n 
A 1 203 HIS 203 203 203 HIS HIS A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 HIS 206 206 206 HIS HIS A . n 
A 1 207 PRO 207 207 207 PRO PRO A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 HIS 210 210 210 HIS HIS A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 THR 212 212 212 THR THR A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 TYR 219 219 219 TYR TYR A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 TYR 223 223 223 TYR TYR A . n 
A 1 224 LYS 224 224 224 LYS LYS A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 HIS 226 226 226 HIS HIS A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 PRO 228 228 228 PRO PRO A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 PHE 234 234 234 PHE PHE A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 PHE 236 236 236 PHE PHE A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 LEU 238 238 238 LEU LEU A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ASP 241 241 241 ASP ASP A . n 
A 1 242 ALA 242 242 242 ALA ALA A . n 
A 1 243 PHE 243 243 243 PHE PHE A . n 
A 1 244 ASP 244 244 244 ASP ASP A . n 
A 1 245 PRO 245 245 245 PRO PRO A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 PHE 248 248 248 PHE PHE A . n 
A 1 249 SER 249 249 249 SER SER A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 ILE 253 253 253 ILE ILE A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 ARG 258 258 258 ARG ARG A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ALA 263 263 263 ALA ALA A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ARG 265 265 265 ARG ARG A . n 
A 1 266 HIS 266 266 266 HIS HIS A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 THR 268 268 268 THR THR A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 MET 275 275 275 MET MET A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 LYS 280 280 280 LYS LYS A . n 
A 1 281 ASP 281 281 281 ASP ASP A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 GLU 284 284 284 GLU GLU A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 LYS 288 288 288 LYS LYS A . n 
A 1 289 GLU 289 289 289 GLU GLU A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 MET 291 291 291 MET MET A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 GLN 296 296 296 GLN GLN A . n 
A 1 297 ASN 297 297 297 ASN ASN A . n 
A 1 298 PRO 298 298 298 PRO PRO A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 TYR 300 300 300 TYR TYR A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 THR 302 302 302 THR THR A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 GLU 304 304 304 GLU GLU A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 ALA 307 307 307 ALA ALA A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 GLN 309 309 309 GLN GLN A . n 
A 1 310 ALA 310 310 310 ALA ALA A . n 
A 1 311 PRO 311 311 311 PRO PRO A . n 
A 1 312 TYR 312 312 312 TYR TYR A . n 
A 1 313 LYS 313 313 ?   ?   ?   A . n 
A 1 314 GLY 314 314 ?   ?   ?   A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   ASP 2   2   2   ASP ASP B . n 
B 1 3   TYR 3   3   3   TYR TYR B . n 
B 1 4   GLY 4   4   4   GLY GLY B . n 
B 1 5   MET 5   5   5   MET MET B . n 
B 1 6   TYR 6   6   6   TYR TYR B . n 
B 1 7   PHE 7   7   7   PHE PHE B . n 
B 1 8   PHE 8   8   8   PHE PHE B . n 
B 1 9   GLU 9   9   9   GLU GLU B . n 
B 1 10  HIS 10  10  10  HIS HIS B . n 
B 1 11  VAL 11  11  11  VAL VAL B . n 
B 1 12  THR 12  12  12  THR THR B . n 
B 1 13  PRO 13  13  13  PRO PRO B . n 
B 1 14  TYR 14  14  14  TYR TYR B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  THR 16  16  16  THR THR B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  VAL 18  18  18  VAL VAL B . n 
B 1 19  ARG 19  19  19  ARG ARG B . n 
B 1 20  ARG 20  20  20  ARG ARG B . n 
B 1 21  MET 21  21  21  MET MET B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  ARG 23  23  23  ARG ARG B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  ALA 26  26  26  ALA ALA B . n 
B 1 27  SER 27  27  27  SER SER B . n 
B 1 28  GLY 28  28  28  GLY GLY B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  THR 30  30  30  THR THR B . n 
B 1 31  PRO 31  31  31  PRO PRO B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  GLN 33  33  33  GLN GLN B . n 
B 1 34  ASP 34  34  34  ASP ASP B . n 
B 1 35  TYR 35  35  35  TYR TYR B . n 
B 1 36  PHE 36  36  36  PHE PHE B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  PHE 38  38  38  PHE PHE B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  GLY 42  42  42  GLY GLY B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  GLY 44  44  44  GLY GLY B . n 
B 1 45  LYS 45  45  45  LYS LYS B . n 
B 1 46  VAL 46  46  46  VAL VAL B . n 
B 1 47  LEU 47  47  47  LEU LEU B . n 
B 1 48  ILE 48  48  48  ILE ILE B . n 
B 1 49  LEU 49  49  49  LEU LEU B . n 
B 1 50  ASP 50  50  50  ASP ASP B . n 
B 1 51  LYS 51  51  51  LYS LYS B . n 
B 1 52  ASP 52  52  52  ASP ASP B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  GLN 54  54  54  GLN GLN B . n 
B 1 55  SER 55  55  55  SER SER B . n 
B 1 56  THR 56  56  56  THR THR B . n 
B 1 57  GLU 57  57  57  GLU GLU B . n 
B 1 58  ARG 58  58  58  ARG ARG B . n 
B 1 59  ASP 59  59  59  ASP ASP B . n 
B 1 60  GLU 60  60  60  GLU GLU B . n 
B 1 61  TYR 61  61  61  TYR TYR B . n 
B 1 62  ILE 62  62  62  ILE ILE B . n 
B 1 63  TYR 63  63  63  TYR TYR B . n 
B 1 64  HIS 64  64  64  HIS HIS B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  THR 66  66  66  THR THR B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  PRO 70  70  70  PRO PRO B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  MET 72  72  72  MET MET B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  THR 74  74  74  THR THR B . n 
B 1 75  HIS 75  75  75  HIS HIS B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  ARG 80  80  80  ARG ARG B . n 
B 1 81  VAL 81  81  81  VAL VAL B . n 
B 1 82  LEU 82  82  82  LEU LEU B . n 
B 1 83  ILE 83  83  83  ILE ILE B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  GLY 85  85  85  GLY GLY B . n 
B 1 86  GLY 86  86  86  GLY GLY B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  GLU 88  88  88  GLU GLU B . n 
B 1 89  GLY 89  89  89  GLY GLY B . n 
B 1 90  ALA 90  90  90  ALA ALA B . n 
B 1 91  THR 91  91  91  THR THR B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  ARG 93  93  93  ARG ARG B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  LYS 97  97  97  LYS LYS B . n 
B 1 98  HIS 98  98  98  HIS HIS B . n 
B 1 99  PRO 99  99  99  PRO PRO B . n 
B 1 100 THR 100 100 100 THR THR B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 GLU 102 102 102 GLU GLU B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 VAL 105 105 105 VAL VAL B . n 
B 1 106 MET 106 106 106 MET MET B . n 
B 1 107 VAL 107 107 107 VAL VAL B . n 
B 1 108 ASP 108 108 108 ASP ASP B . n 
B 1 109 ILE 109 109 109 ILE ILE B . n 
B 1 110 ASP 110 110 110 ASP ASP B . n 
B 1 111 GLY 111 111 111 GLY GLY B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 VAL 116 116 116 VAL VAL B . n 
B 1 117 ALA 117 117 117 ALA ALA B . n 
B 1 118 LYS 118 118 118 LYS LYS B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 HIS 120 120 120 HIS HIS B . n 
B 1 121 MET 121 121 121 MET MET B . n 
B 1 122 PRO 122 122 122 PRO PRO B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 TRP 124 124 124 TRP TRP B . n 
B 1 125 HIS 125 125 125 HIS HIS B . n 
B 1 126 GLN 126 126 126 GLN GLN B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 PHE 129 129 129 PHE PHE B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 PRO 132 132 132 PRO PRO B . n 
B 1 133 ARG 133 133 133 ARG ARG B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 LEU 136 136 136 LEU LEU B . n 
B 1 137 VAL 137 137 137 VAL VAL B . n 
B 1 138 ILE 138 138 138 ILE ILE B . n 
B 1 139 ASP 139 139 139 ASP ASP B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 ALA 141 141 141 ALA ALA B . n 
B 1 142 ARG 142 142 142 ARG ARG B . n 
B 1 143 ALA 143 143 143 ALA ALA B . n 
B 1 144 TYR 144 144 144 TYR TYR B . n 
B 1 145 LEU 145 145 145 LEU LEU B . n 
B 1 146 GLU 146 146 146 GLU GLU B . n 
B 1 147 ARG 147 147 147 ARG ARG B . n 
B 1 148 THR 148 148 148 THR THR B . n 
B 1 149 GLU 149 149 149 GLU GLU B . n 
B 1 150 GLU 150 150 150 GLU GLU B . n 
B 1 151 ARG 151 151 151 ARG ARG B . n 
B 1 152 TYR 152 152 152 TYR TYR B . n 
B 1 153 ASP 153 153 153 ASP ASP B . n 
B 1 154 VAL 154 154 154 VAL VAL B . n 
B 1 155 VAL 155 155 155 VAL VAL B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 ILE 157 157 157 ILE ILE B . n 
B 1 158 ASP 158 158 158 ASP ASP B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 THR 160 160 160 THR THR B . n 
B 1 161 ASP 161 161 161 ASP ASP B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 VAL 163 163 163 VAL VAL B . n 
B 1 164 GLY 164 164 164 GLY GLY B . n 
B 1 165 GLU 165 165 165 GLU GLU B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 ASN 167 167 167 ASN ASN B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 ARG 170 170 170 ARG ARG B . n 
B 1 171 LEU 171 171 171 LEU LEU B . n 
B 1 172 LEU 172 172 172 LEU LEU B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 THR 174 174 174 THR THR B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 GLU 176 176 176 GLU GLU B . n 
B 1 177 PHE 177 177 177 PHE PHE B . n 
B 1 178 TYR 178 178 178 TYR TYR B . n 
B 1 179 ARG 179 179 179 ARG ARG B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 VAL 181 181 181 VAL VAL B . n 
B 1 182 LYS 182 182 182 LYS LYS B . n 
B 1 183 ALA 183 183 183 ALA ALA B . n 
B 1 184 HIS 184 184 184 HIS HIS B . n 
B 1 185 LEU 185 185 185 LEU LEU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 PRO 187 187 187 PRO PRO B . n 
B 1 188 GLY 188 188 188 GLY GLY B . n 
B 1 189 GLY 189 189 189 GLY GLY B . n 
B 1 190 VAL 190 190 190 VAL VAL B . n 
B 1 191 MET 191 191 191 MET MET B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 MET 193 193 193 MET MET B . n 
B 1 194 GLN 194 194 194 GLN GLN B . n 
B 1 195 ALA 195 195 195 ALA ALA B . n 
B 1 196 GLY 196 196 196 GLY GLY B . n 
B 1 197 MET 197 197 197 MET MET B . n 
B 1 198 ILE 198 198 198 ILE ILE B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 THR 201 201 201 THR THR B . n 
B 1 202 HIS 202 202 202 HIS HIS B . n 
B 1 203 HIS 203 203 203 HIS HIS B . n 
B 1 204 ARG 204 204 204 ARG ARG B . n 
B 1 205 VAL 205 205 205 VAL VAL B . n 
B 1 206 HIS 206 206 206 HIS HIS B . n 
B 1 207 PRO 207 207 207 PRO PRO B . n 
B 1 208 VAL 208 208 208 VAL VAL B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 HIS 210 210 210 HIS HIS B . n 
B 1 211 ARG 211 211 211 ARG ARG B . n 
B 1 212 THR 212 212 212 THR THR B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 ARG 214 214 214 ARG ARG B . n 
B 1 215 GLU 215 215 215 GLU GLU B . n 
B 1 216 ALA 216 216 216 ALA ALA B . n 
B 1 217 PHE 217 217 217 PHE PHE B . n 
B 1 218 ARG 218 218 218 ARG ARG B . n 
B 1 219 TYR 219 219 219 TYR TYR B . n 
B 1 220 VAL 220 220 220 VAL VAL B . n 
B 1 221 ARG 221 221 221 ARG ARG B . n 
B 1 222 SER 222 222 222 SER SER B . n 
B 1 223 TYR 223 223 223 TYR TYR B . n 
B 1 224 LYS 224 224 224 LYS LYS B . n 
B 1 225 ASN 225 225 225 ASN ASN B . n 
B 1 226 HIS 226 226 226 HIS HIS B . n 
B 1 227 ILE 227 227 227 ILE ILE B . n 
B 1 228 PRO 228 228 228 PRO PRO B . n 
B 1 229 GLY 229 229 229 GLY GLY B . n 
B 1 230 PHE 230 230 230 PHE PHE B . n 
B 1 231 PHE 231 231 231 PHE PHE B . n 
B 1 232 LEU 232 232 232 LEU LEU B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 PHE 234 234 234 PHE PHE B . n 
B 1 235 GLY 235 235 235 GLY GLY B . n 
B 1 236 PHE 236 236 236 PHE PHE B . n 
B 1 237 LEU 237 237 237 LEU LEU B . n 
B 1 238 LEU 238 238 238 LEU LEU B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ASP 241 241 241 ASP ASP B . n 
B 1 242 ALA 242 242 242 ALA ALA B . n 
B 1 243 PHE 243 243 243 PHE PHE B . n 
B 1 244 ASP 244 244 244 ASP ASP B . n 
B 1 245 PRO 245 245 245 PRO PRO B . n 
B 1 246 ALA 246 246 246 ALA ALA B . n 
B 1 247 ALA 247 247 247 ALA ALA B . n 
B 1 248 PHE 248 248 248 PHE PHE B . n 
B 1 249 SER 249 249 249 SER SER B . n 
B 1 250 GLU 250 250 250 GLU GLU B . n 
B 1 251 GLY 251 251 251 GLY GLY B . n 
B 1 252 VAL 252 252 252 VAL VAL B . n 
B 1 253 ILE 253 253 253 ILE ILE B . n 
B 1 254 GLU 254 254 254 GLU GLU B . n 
B 1 255 ALA 255 255 255 ALA ALA B . n 
B 1 256 ARG 256 256 256 ARG ARG B . n 
B 1 257 ILE 257 257 257 ILE ILE B . n 
B 1 258 ARG 258 258 258 ARG ARG B . n 
B 1 259 GLU 259 259 259 GLU GLU B . n 
B 1 260 ARG 260 260 260 ARG ARG B . n 
B 1 261 ASN 261 261 261 ASN ASN B . n 
B 1 262 LEU 262 262 262 LEU LEU B . n 
B 1 263 ALA 263 263 263 ALA ALA B . n 
B 1 264 LEU 264 264 264 LEU LEU B . n 
B 1 265 ARG 265 265 265 ARG ARG B . n 
B 1 266 HIS 266 266 266 HIS HIS B . n 
B 1 267 LEU 267 267 267 LEU LEU B . n 
B 1 268 THR 268 268 268 THR THR B . n 
B 1 269 ALA 269 269 269 ALA ALA B . n 
B 1 270 PRO 270 270 270 PRO PRO B . n 
B 1 271 TYR 271 271 271 TYR TYR B . n 
B 1 272 LEU 272 272 272 LEU LEU B . n 
B 1 273 GLU 273 273 273 GLU GLU B . n 
B 1 274 ALA 274 274 274 ALA ALA B . n 
B 1 275 MET 275 275 275 MET MET B . n 
B 1 276 PHE 276 276 276 PHE PHE B . n 
B 1 277 VAL 277 277 277 VAL VAL B . n 
B 1 278 LEU 278 278 278 LEU LEU B . n 
B 1 279 PRO 279 279 279 PRO PRO B . n 
B 1 280 LYS 280 280 280 LYS LYS B . n 
B 1 281 ASP 281 281 281 ASP ASP B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 LEU 283 283 283 LEU LEU B . n 
B 1 284 GLU 284 284 284 GLU GLU B . n 
B 1 285 ALA 285 285 285 ALA ALA B . n 
B 1 286 LEU 286 286 286 LEU LEU B . n 
B 1 287 GLU 287 287 287 GLU GLU B . n 
B 1 288 LYS 288 288 288 LYS LYS B . n 
B 1 289 GLU 289 289 289 GLU GLU B . n 
B 1 290 THR 290 290 290 THR THR B . n 
B 1 291 MET 291 291 291 MET MET B . n 
B 1 292 VAL 292 292 292 VAL VAL B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 THR 294 294 294 THR THR B . n 
B 1 295 ASP 295 295 295 ASP ASP B . n 
B 1 296 GLN 296 296 296 GLN GLN B . n 
B 1 297 ASN 297 297 297 ASN ASN B . n 
B 1 298 PRO 298 298 298 PRO PRO B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 TYR 300 300 300 TYR TYR B . n 
B 1 301 VAL 301 301 301 VAL VAL B . n 
B 1 302 THR 302 302 302 THR THR B . n 
B 1 303 PRO 303 303 303 PRO PRO B . n 
B 1 304 GLU 304 304 304 GLU GLU B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 GLU 306 306 306 GLU GLU B . n 
B 1 307 ALA 307 307 307 ALA ALA B . n 
B 1 308 ARG 308 308 308 ARG ARG B . n 
B 1 309 GLN 309 309 309 GLN GLN B . n 
B 1 310 ALA 310 310 310 ALA ALA B . n 
B 1 311 PRO 311 311 311 PRO PRO B . n 
B 1 312 TYR 312 312 312 TYR TYR B . n 
B 1 313 LYS 313 313 313 LYS LYS B . n 
B 1 314 GLY 314 314 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10500 ? 
1 MORE         -88   ? 
1 'SSA (A^2)'  43700 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_666 -y+1,-x+1,-z+3/2 0.0000000000 -1.0000000000 0.0000000000 88.0400000000 -1.0000000000 
0.0000000000 0.0000000000 88.0400000000 0.0000000000 0.0000000000 -1.0000000000 286.5000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-04-13 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2014-01-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOLREP phasing          .        ? 1 
REFMAC refinement       5.2.0019 ? 2 
MOSFLM 'data reduction' .        ? 3 
SCALA  'data scaling'   .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 N   A ALA 263 ? ? O   A HOH 339 ? ? 1.86 
2 1 O   B HOH 355 ? ? O   B HOH 359 ? ? 1.88 
3 1 O   B ALA 141 ? ? CD1 B LEU 145 ? ? 2.04 
4 1 OE2 A GLU 146 ? ? O   A HOH 396 ? ? 2.08 
5 1 NZ  A LYS 182 ? ? OD1 A ASP 241 ? ? 2.08 
6 1 O   A THR 201 ? ? NH1 B ARG 58  ? ? 2.09 
7 1 OD1 A ASN 225 ? ? O   A HOH 317 ? ? 2.12 
8 1 O   B HOH 393 ? ? O   B HOH 394 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 406 ? ? 1_555 O A HOH 406 ? ? 7_556 1.54 
2 1 O A HOH 405 ? ? 1_555 O A HOH 405 ? ? 7_556 2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CE2 A TYR 61  ? ? CD2 A TYR 61  ? ? 1.487 1.389 0.098 0.015 N 
2 1 C   A TYR 61  ? ? O   A TYR 61  ? ? 1.346 1.229 0.117 0.019 N 
3 1 CG  A GLU 150 ? ? CD  A GLU 150 ? ? 1.607 1.515 0.092 0.015 N 
4 1 CB  A VAL 181 ? ? CG2 A VAL 181 ? ? 1.714 1.524 0.190 0.021 N 
5 1 CD  B GLU 273 ? ? OE2 B GLU 273 ? ? 1.320 1.252 0.068 0.011 N 
6 1 CB  B VAL 277 ? ? CG2 B VAL 277 ? ? 1.665 1.524 0.141 0.021 N 
7 1 CG  B GLU 287 ? ? CD  B GLU 287 ? ? 1.635 1.515 0.120 0.015 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB  A ILE 25  ? ? CA A ILE 25  ? ? C   A ILE 25  ? ? 97.62  111.60 -13.98 2.00 N 
2  1 CB  A LEU 49  ? ? CG A LEU 49  ? ? CD1 A LEU 49  ? ? 97.57  111.00 -13.43 1.70 N 
3  1 NE  A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 123.46 120.30 3.16   0.50 N 
4  1 C   A ASP 161 ? ? N  A PRO 162 ? ? CA  A PRO 162 ? ? 108.79 119.30 -10.51 1.50 Y 
5  1 C   A ASN 186 ? ? N  A PRO 187 ? ? CA  A PRO 187 ? ? 107.50 119.30 -11.80 1.50 Y 
6  1 CB  A LEU 200 ? ? CG A LEU 200 ? ? CD1 A LEU 200 ? ? 121.38 111.00 10.38  1.70 N 
7  1 CB  A LEU 200 ? ? CG A LEU 200 ? ? CD2 A LEU 200 ? ? 95.73  111.00 -15.27 1.70 N 
8  1 CG1 A VAL 209 ? ? CB A VAL 209 ? ? CG2 A VAL 209 ? ? 100.35 110.90 -10.55 1.60 N 
9  1 CG  A ARG 221 ? ? CD A ARG 221 ? ? NE  A ARG 221 ? ? 98.52  111.80 -13.28 2.10 N 
10 1 NE  A ARG 308 ? ? CZ A ARG 308 ? ? NH1 A ARG 308 ? ? 116.39 120.30 -3.91  0.50 N 
11 1 NE  A ARG 308 ? ? CZ A ARG 308 ? ? NH2 A ARG 308 ? ? 123.50 120.30 3.20   0.50 N 
12 1 C   B THR 12  ? ? N  B PRO 13  ? ? CA  B PRO 13  ? ? 108.42 119.30 -10.88 1.50 Y 
13 1 NE  B ARG 20  ? ? CZ B ARG 20  ? ? NH1 B ARG 20  ? ? 123.38 120.30 3.08   0.50 N 
14 1 NE  B ARG 93  ? ? CZ B ARG 93  ? ? NH2 B ARG 93  ? ? 123.45 120.30 3.15   0.50 N 
15 1 C   B HIS 98  ? ? N  B PRO 99  ? ? CA  B PRO 99  ? ? 130.04 119.30 10.74  1.50 Y 
16 1 CA  B LEU 237 ? ? CB B LEU 237 ? ? CG  B LEU 237 ? ? 130.86 115.30 15.56  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 2   ? ? -47.37  157.50  
2  1 VAL A 11  ? ? -146.76 -51.00  
3  1 ARG A 23  ? ? -174.68 137.10  
4  1 PRO A 31  ? ? -78.82  38.06   
5  1 PHE A 32  ? ? -162.28 -20.46  
6  1 ASP A 50  ? ? 47.04   -96.58  
7  1 VAL A 68  ? ? -102.03 -60.33  
8  1 PRO A 78  ? ? -58.30  104.88  
9  1 THR A 100 ? ? -68.04  1.20    
10 1 ASP A 108 ? ? -167.83 108.80  
11 1 ILE A 109 ? ? -33.85  -33.95  
12 1 TRP A 124 ? ? -87.65  -78.33  
13 1 ALA A 128 ? ? 15.29   -78.86  
14 1 GLU A 150 ? ? -48.11  153.04  
15 1 ASP A 161 ? ? -40.75  151.01  
16 1 LEU A 171 ? ? -69.08  10.58   
17 1 HIS A 184 ? ? -91.06  33.51   
18 1 ALA A 195 ? ? -116.13 61.15   
19 1 LEU A 199 ? ? -168.04 72.61   
20 1 HIS A 202 ? ? -73.16  -72.39  
21 1 PHE A 243 ? ? 174.61  153.96  
22 1 ARG A 258 ? ? -64.95  -70.55  
23 1 ASP B 2   ? ? -77.93  -154.25 
24 1 ARG B 23  ? ? -171.08 130.57  
25 1 ALA B 26  ? ? 156.60  122.04  
26 1 THR B 30  ? ? -24.57  154.71  
27 1 ASP B 50  ? ? 47.88   -99.85  
28 1 VAL B 68  ? ? -102.65 -64.34  
29 1 PRO B 70  ? ? -49.73  -81.48  
30 1 ALA B 71  ? ? -17.35  -54.47  
31 1 GLU B 77  ? ? -173.16 79.53   
32 1 ASP B 110 ? ? 81.87   77.59   
33 1 LYS B 118 ? ? -45.41  -71.38  
34 1 ALA B 128 ? ? -34.31  -38.58  
35 1 ILE B 138 ? ? -98.96  38.17   
36 1 TYR B 144 ? ? -52.73  -70.29  
37 1 ASP B 158 ? ? -111.05 62.16   
38 1 LEU B 159 ? ? -92.22  -127.05 
39 1 ASN B 167 ? ? 177.08  106.54  
40 1 PRO B 168 ? ? -55.87  -2.31   
41 1 ALA B 195 ? ? -141.95 28.84   
42 1 LEU B 199 ? ? -162.42 87.94   
43 1 ALA B 242 ? ? -73.40  -114.03 
44 1 ILE B 257 ? ? -62.40  -71.57  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LEU A 199 ? ? LEU A 200 ? ? -142.28 
2 1 HIS A 202 ? ? HIS A 203 ? ? -145.06 
3 1 HIS A 203 ? ? ARG A 204 ? ? -137.18 
4 1 PRO B 70  ? ? ALA B 71  ? ? 146.07  
5 1 PHE B 243 ? ? ASP B 244 ? ? 148.71  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 0 A MTA 315 ? CS    ? C MTA ? CS    
2 1 N 0 A MTA 315 ? "S5'" ? C MTA ? "S5'" 
3 1 N 0 B MTA 315 ? CS    ? D MTA ? CS    
4 1 N 0 B MTA 315 ? "S5'" ? D MTA ? "S5'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 313 ? A LYS 313 
2 1 Y 1 A GLY 314 ? A GLY 314 
3 1 Y 1 B GLY 314 ? B GLY 314 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "5'-DEOXY-5'-METHYLTHIOADENOSINE" MTA 
3 water                             HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MTA 1   315 315 MTA MTA A . 
D 2 MTA 1   315 315 MTA MTA B . 
E 3 HOH 1   316 316 HOH HOH A . 
E 3 HOH 2   317 317 HOH HOH A . 
E 3 HOH 3   318 318 HOH HOH A . 
E 3 HOH 4   319 319 HOH HOH A . 
E 3 HOH 5   320 320 HOH HOH A . 
E 3 HOH 6   321 321 HOH HOH A . 
E 3 HOH 7   322 322 HOH HOH A . 
E 3 HOH 8   323 323 HOH HOH A . 
E 3 HOH 9   324 324 HOH HOH A . 
E 3 HOH 10  325 325 HOH HOH A . 
E 3 HOH 11  326 326 HOH HOH A . 
E 3 HOH 12  327 327 HOH HOH A . 
E 3 HOH 13  328 328 HOH HOH A . 
E 3 HOH 14  329 329 HOH HOH A . 
E 3 HOH 15  330 330 HOH HOH A . 
E 3 HOH 16  331 331 HOH HOH A . 
E 3 HOH 17  332 332 HOH HOH A . 
E 3 HOH 18  333 333 HOH HOH A . 
E 3 HOH 19  334 334 HOH HOH A . 
E 3 HOH 20  335 335 HOH HOH A . 
E 3 HOH 21  336 336 HOH HOH A . 
E 3 HOH 22  337 337 HOH HOH A . 
E 3 HOH 23  338 338 HOH HOH A . 
E 3 HOH 24  339 339 HOH HOH A . 
E 3 HOH 25  340 340 HOH HOH A . 
E 3 HOH 26  341 341 HOH HOH A . 
E 3 HOH 27  342 342 HOH HOH A . 
E 3 HOH 28  343 343 HOH HOH A . 
E 3 HOH 29  344 344 HOH HOH A . 
E 3 HOH 30  345 345 HOH HOH A . 
E 3 HOH 31  346 346 HOH HOH A . 
E 3 HOH 32  347 347 HOH HOH A . 
E 3 HOH 33  348 348 HOH HOH A . 
E 3 HOH 34  349 349 HOH HOH A . 
E 3 HOH 35  350 350 HOH HOH A . 
E 3 HOH 36  351 351 HOH HOH A . 
E 3 HOH 37  352 352 HOH HOH A . 
E 3 HOH 38  353 353 HOH HOH A . 
E 3 HOH 39  354 354 HOH HOH A . 
E 3 HOH 40  355 355 HOH HOH A . 
E 3 HOH 41  356 356 HOH HOH A . 
E 3 HOH 42  357 357 HOH HOH A . 
E 3 HOH 43  358 358 HOH HOH A . 
E 3 HOH 44  359 359 HOH HOH A . 
E 3 HOH 45  360 360 HOH HOH A . 
E 3 HOH 46  361 361 HOH HOH A . 
E 3 HOH 47  362 362 HOH HOH A . 
E 3 HOH 48  363 363 HOH HOH A . 
E 3 HOH 49  364 364 HOH HOH A . 
E 3 HOH 50  365 365 HOH HOH A . 
E 3 HOH 51  366 366 HOH HOH A . 
E 3 HOH 52  367 367 HOH HOH A . 
E 3 HOH 53  368 368 HOH HOH A . 
E 3 HOH 54  369 369 HOH HOH A . 
E 3 HOH 55  370 370 HOH HOH A . 
E 3 HOH 56  371 371 HOH HOH A . 
E 3 HOH 57  372 372 HOH HOH A . 
E 3 HOH 58  373 373 HOH HOH A . 
E 3 HOH 59  374 374 HOH HOH A . 
E 3 HOH 60  375 375 HOH HOH A . 
E 3 HOH 61  376 376 HOH HOH A . 
E 3 HOH 62  377 377 HOH HOH A . 
E 3 HOH 63  378 378 HOH HOH A . 
E 3 HOH 64  379 379 HOH HOH A . 
E 3 HOH 65  380 380 HOH HOH A . 
E 3 HOH 66  381 381 HOH HOH A . 
E 3 HOH 67  382 382 HOH HOH A . 
E 3 HOH 68  383 383 HOH HOH A . 
E 3 HOH 69  384 384 HOH HOH A . 
E 3 HOH 70  385 385 HOH HOH A . 
E 3 HOH 71  386 386 HOH HOH A . 
E 3 HOH 72  387 387 HOH HOH A . 
E 3 HOH 73  388 388 HOH HOH A . 
E 3 HOH 74  389 389 HOH HOH A . 
E 3 HOH 75  390 390 HOH HOH A . 
E 3 HOH 76  391 391 HOH HOH A . 
E 3 HOH 77  392 392 HOH HOH A . 
E 3 HOH 78  393 393 HOH HOH A . 
E 3 HOH 79  394 394 HOH HOH A . 
E 3 HOH 80  395 395 HOH HOH A . 
E 3 HOH 81  396 396 HOH HOH A . 
E 3 HOH 82  397 397 HOH HOH A . 
E 3 HOH 83  398 398 HOH HOH A . 
E 3 HOH 84  399 399 HOH HOH A . 
E 3 HOH 85  400 400 HOH HOH A . 
E 3 HOH 86  401 401 HOH HOH A . 
E 3 HOH 87  402 402 HOH HOH A . 
E 3 HOH 88  403 403 HOH HOH A . 
E 3 HOH 89  404 404 HOH HOH A . 
E 3 HOH 90  405 405 HOH HOH A . 
E 3 HOH 91  406 406 HOH HOH A . 
E 3 HOH 92  407 407 HOH HOH A . 
E 3 HOH 93  408 408 HOH HOH A . 
E 3 HOH 94  409 409 HOH HOH A . 
E 3 HOH 95  410 410 HOH HOH A . 
E 3 HOH 96  411 411 HOH HOH A . 
E 3 HOH 97  412 412 HOH HOH A . 
E 3 HOH 98  413 413 HOH HOH A . 
E 3 HOH 99  414 414 HOH HOH A . 
E 3 HOH 100 415 415 HOH HOH A . 
E 3 HOH 101 416 416 HOH HOH A . 
E 3 HOH 102 417 417 HOH HOH A . 
F 3 HOH 1   316 316 HOH HOH B . 
F 3 HOH 2   317 317 HOH HOH B . 
F 3 HOH 3   318 318 HOH HOH B . 
F 3 HOH 4   319 319 HOH HOH B . 
F 3 HOH 5   320 320 HOH HOH B . 
F 3 HOH 6   321 321 HOH HOH B . 
F 3 HOH 7   322 322 HOH HOH B . 
F 3 HOH 8   323 323 HOH HOH B . 
F 3 HOH 9   324 324 HOH HOH B . 
F 3 HOH 10  325 325 HOH HOH B . 
F 3 HOH 11  326 326 HOH HOH B . 
F 3 HOH 12  327 327 HOH HOH B . 
F 3 HOH 13  328 328 HOH HOH B . 
F 3 HOH 14  329 329 HOH HOH B . 
F 3 HOH 15  330 330 HOH HOH B . 
F 3 HOH 16  331 331 HOH HOH B . 
F 3 HOH 17  332 332 HOH HOH B . 
F 3 HOH 18  333 333 HOH HOH B . 
F 3 HOH 19  334 334 HOH HOH B . 
F 3 HOH 20  335 335 HOH HOH B . 
F 3 HOH 21  336 336 HOH HOH B . 
F 3 HOH 22  337 337 HOH HOH B . 
F 3 HOH 23  338 338 HOH HOH B . 
F 3 HOH 24  339 339 HOH HOH B . 
F 3 HOH 25  340 340 HOH HOH B . 
F 3 HOH 26  341 341 HOH HOH B . 
F 3 HOH 27  342 342 HOH HOH B . 
F 3 HOH 28  343 343 HOH HOH B . 
F 3 HOH 29  344 344 HOH HOH B . 
F 3 HOH 30  345 345 HOH HOH B . 
F 3 HOH 31  346 346 HOH HOH B . 
F 3 HOH 32  347 347 HOH HOH B . 
F 3 HOH 33  348 348 HOH HOH B . 
F 3 HOH 34  349 349 HOH HOH B . 
F 3 HOH 35  350 350 HOH HOH B . 
F 3 HOH 36  351 351 HOH HOH B . 
F 3 HOH 37  352 352 HOH HOH B . 
F 3 HOH 38  353 353 HOH HOH B . 
F 3 HOH 39  354 354 HOH HOH B . 
F 3 HOH 40  355 355 HOH HOH B . 
F 3 HOH 41  356 356 HOH HOH B . 
F 3 HOH 42  357 357 HOH HOH B . 
F 3 HOH 43  358 358 HOH HOH B . 
F 3 HOH 44  359 359 HOH HOH B . 
F 3 HOH 45  360 360 HOH HOH B . 
F 3 HOH 46  361 361 HOH HOH B . 
F 3 HOH 47  362 362 HOH HOH B . 
F 3 HOH 48  363 363 HOH HOH B . 
F 3 HOH 49  364 364 HOH HOH B . 
F 3 HOH 50  365 365 HOH HOH B . 
F 3 HOH 51  366 366 HOH HOH B . 
F 3 HOH 52  367 367 HOH HOH B . 
F 3 HOH 53  368 368 HOH HOH B . 
F 3 HOH 54  369 369 HOH HOH B . 
F 3 HOH 55  370 370 HOH HOH B . 
F 3 HOH 56  371 371 HOH HOH B . 
F 3 HOH 57  372 372 HOH HOH B . 
F 3 HOH 58  373 373 HOH HOH B . 
F 3 HOH 59  374 374 HOH HOH B . 
F 3 HOH 60  375 375 HOH HOH B . 
F 3 HOH 61  376 376 HOH HOH B . 
F 3 HOH 62  377 377 HOH HOH B . 
F 3 HOH 63  378 378 HOH HOH B . 
F 3 HOH 64  379 379 HOH HOH B . 
F 3 HOH 65  380 380 HOH HOH B . 
F 3 HOH 66  381 381 HOH HOH B . 
F 3 HOH 67  382 382 HOH HOH B . 
F 3 HOH 68  383 383 HOH HOH B . 
F 3 HOH 69  384 384 HOH HOH B . 
F 3 HOH 70  385 385 HOH HOH B . 
F 3 HOH 71  386 386 HOH HOH B . 
F 3 HOH 72  387 387 HOH HOH B . 
F 3 HOH 73  388 388 HOH HOH B . 
F 3 HOH 74  389 389 HOH HOH B . 
F 3 HOH 75  390 390 HOH HOH B . 
F 3 HOH 76  391 391 HOH HOH B . 
F 3 HOH 77  392 392 HOH HOH B . 
F 3 HOH 78  393 393 HOH HOH B . 
F 3 HOH 79  394 394 HOH HOH B . 
F 3 HOH 80  395 395 HOH HOH B . 
F 3 HOH 81  396 396 HOH HOH B . 
#