data_3ANZ
# 
_entry.id   3ANZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ANZ         
RCSB  RCSB029483   
WWPDB D_1000029483 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          7ahl 
_pdbx_database_related.details        'The same protein but different in space group.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3ANZ 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-16 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yamashita, K.' 1 
'Kawauchi, H.'  2 
'Tanaka, Y.'    3 
'Yao, M.'       4 
'Tanaka, I.'    5 
# 
_citation.id                        primary 
_citation.title                     
'2-Methyl-2,4-pentanediol induces spontaneous assembly of staphylococcal alpha-hemolysin into heptameric pore structure' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            20 
_citation.page_first                448 
_citation.page_last                 456 
_citation.year                      2011 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21280135 
_citation.pdbx_database_id_DOI      10.1002/pro.579 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tanaka, Y.' 1 
primary 'Hirano, N.' 2 
primary 'Kaneko, J.' 3 
primary 'Kamio, Y.'  4 
primary 'Yao, M.'    5 
primary 'Tanaka, I.' 6 
# 
_cell.length_a           102.821 
_cell.length_b           293.877 
_cell.length_c           170.545 
_cell.angle_alpha        90.000 
_cell.angle_beta         92.420 
_cell.angle_gamma        90.000 
_cell.entry_id           3ANZ 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              56 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3ANZ 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Alpha-hemolysin                 34506.363 28   ? ? ? ? 
2 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174   56   ? ? ? ? 
3 non-polymer syn 'ACETIC ACID'                   60.052    28   ? ? ? ? 
4 water       nat water                           18.015    2064 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Alpha-HL, Alpha-toxin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLA
WPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILES
PTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAAENFLDPNKASSLLSSGFSPDFATVITMDRKAS
KQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTNLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLA
WPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILES
PTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAAENFLDPNKASSLLSSGFSPDFATVITMDRKAS
KQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTNLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ASP n 
1 4   SER n 
1 5   ASP n 
1 6   ILE n 
1 7   ASN n 
1 8   ILE n 
1 9   LYS n 
1 10  THR n 
1 11  GLY n 
1 12  THR n 
1 13  THR n 
1 14  ASP n 
1 15  ILE n 
1 16  GLY n 
1 17  SER n 
1 18  ASN n 
1 19  THR n 
1 20  THR n 
1 21  VAL n 
1 22  LYS n 
1 23  THR n 
1 24  GLY n 
1 25  ASP n 
1 26  LEU n 
1 27  VAL n 
1 28  THR n 
1 29  TYR n 
1 30  ASP n 
1 31  LYS n 
1 32  GLU n 
1 33  ASN n 
1 34  GLY n 
1 35  MET n 
1 36  HIS n 
1 37  LYS n 
1 38  LYS n 
1 39  VAL n 
1 40  PHE n 
1 41  TYR n 
1 42  SER n 
1 43  PHE n 
1 44  ILE n 
1 45  ASP n 
1 46  ASP n 
1 47  LYS n 
1 48  ASN n 
1 49  HIS n 
1 50  ASN n 
1 51  LYS n 
1 52  LYS n 
1 53  LEU n 
1 54  LEU n 
1 55  VAL n 
1 56  ILE n 
1 57  ARG n 
1 58  THR n 
1 59  LYS n 
1 60  GLY n 
1 61  THR n 
1 62  ILE n 
1 63  ALA n 
1 64  GLY n 
1 65  GLN n 
1 66  TYR n 
1 67  ARG n 
1 68  VAL n 
1 69  TYR n 
1 70  SER n 
1 71  GLU n 
1 72  GLU n 
1 73  GLY n 
1 74  ALA n 
1 75  ASN n 
1 76  LYS n 
1 77  SER n 
1 78  GLY n 
1 79  LEU n 
1 80  ALA n 
1 81  TRP n 
1 82  PRO n 
1 83  SER n 
1 84  ALA n 
1 85  PHE n 
1 86  LYS n 
1 87  VAL n 
1 88  GLN n 
1 89  LEU n 
1 90  GLN n 
1 91  LEU n 
1 92  PRO n 
1 93  ASP n 
1 94  ASN n 
1 95  GLU n 
1 96  VAL n 
1 97  ALA n 
1 98  GLN n 
1 99  ILE n 
1 100 SER n 
1 101 ASP n 
1 102 TYR n 
1 103 TYR n 
1 104 PRO n 
1 105 ARG n 
1 106 ASN n 
1 107 SER n 
1 108 ILE n 
1 109 ASP n 
1 110 THR n 
1 111 LYS n 
1 112 GLU n 
1 113 TYR n 
1 114 MET n 
1 115 SER n 
1 116 THR n 
1 117 LEU n 
1 118 THR n 
1 119 TYR n 
1 120 GLY n 
1 121 PHE n 
1 122 ASN n 
1 123 GLY n 
1 124 ASN n 
1 125 VAL n 
1 126 THR n 
1 127 GLY n 
1 128 ASP n 
1 129 ASP n 
1 130 THR n 
1 131 GLY n 
1 132 LYS n 
1 133 ILE n 
1 134 GLY n 
1 135 GLY n 
1 136 LEU n 
1 137 ILE n 
1 138 GLY n 
1 139 ALA n 
1 140 ASN n 
1 141 VAL n 
1 142 SER n 
1 143 ILE n 
1 144 GLY n 
1 145 HIS n 
1 146 THR n 
1 147 LEU n 
1 148 LYS n 
1 149 TYR n 
1 150 VAL n 
1 151 GLN n 
1 152 PRO n 
1 153 ASP n 
1 154 PHE n 
1 155 LYS n 
1 156 THR n 
1 157 ILE n 
1 158 LEU n 
1 159 GLU n 
1 160 SER n 
1 161 PRO n 
1 162 THR n 
1 163 ASP n 
1 164 LYS n 
1 165 LYS n 
1 166 VAL n 
1 167 GLY n 
1 168 TRP n 
1 169 LYS n 
1 170 VAL n 
1 171 ILE n 
1 172 PHE n 
1 173 ASN n 
1 174 ASN n 
1 175 MET n 
1 176 VAL n 
1 177 ASN n 
1 178 GLN n 
1 179 ASN n 
1 180 TRP n 
1 181 GLY n 
1 182 PRO n 
1 183 TYR n 
1 184 ASP n 
1 185 ARG n 
1 186 ASP n 
1 187 SER n 
1 188 TRP n 
1 189 ASN n 
1 190 PRO n 
1 191 VAL n 
1 192 TYR n 
1 193 GLY n 
1 194 ASN n 
1 195 GLN n 
1 196 LEU n 
1 197 PHE n 
1 198 MET n 
1 199 LYS n 
1 200 THR n 
1 201 ARG n 
1 202 ASN n 
1 203 GLY n 
1 204 SER n 
1 205 MET n 
1 206 LYS n 
1 207 ALA n 
1 208 ALA n 
1 209 GLU n 
1 210 ASN n 
1 211 PHE n 
1 212 LEU n 
1 213 ASP n 
1 214 PRO n 
1 215 ASN n 
1 216 LYS n 
1 217 ALA n 
1 218 SER n 
1 219 SER n 
1 220 LEU n 
1 221 LEU n 
1 222 SER n 
1 223 SER n 
1 224 GLY n 
1 225 PHE n 
1 226 SER n 
1 227 PRO n 
1 228 ASP n 
1 229 PHE n 
1 230 ALA n 
1 231 THR n 
1 232 VAL n 
1 233 ILE n 
1 234 THR n 
1 235 MET n 
1 236 ASP n 
1 237 ARG n 
1 238 LYS n 
1 239 ALA n 
1 240 SER n 
1 241 LYS n 
1 242 GLN n 
1 243 GLN n 
1 244 THR n 
1 245 ASN n 
1 246 ILE n 
1 247 ASP n 
1 248 VAL n 
1 249 ILE n 
1 250 TYR n 
1 251 GLU n 
1 252 ARG n 
1 253 VAL n 
1 254 ARG n 
1 255 ASP n 
1 256 ASP n 
1 257 TYR n 
1 258 GLN n 
1 259 LEU n 
1 260 HIS n 
1 261 TRP n 
1 262 THR n 
1 263 SER n 
1 264 THR n 
1 265 ASN n 
1 266 TRP n 
1 267 LYS n 
1 268 GLY n 
1 269 THR n 
1 270 ASN n 
1 271 THR n 
1 272 LYS n 
1 273 ASP n 
1 274 LYS n 
1 275 TRP n 
1 276 THR n 
1 277 ASP n 
1 278 ARG n 
1 279 SER n 
1 280 SER n 
1 281 GLU n 
1 282 ARG n 
1 283 TYR n 
1 284 LYS n 
1 285 ILE n 
1 286 ASP n 
1 287 TRP n 
1 288 GLU n 
1 289 LYS n 
1 290 GLU n 
1 291 GLU n 
1 292 MET n 
1 293 THR n 
1 294 ASN n 
1 295 LEU n 
1 296 GLU n 
1 297 HIS n 
1 298 HIS n 
1 299 HIS n 
1 300 HIS n 
1 301 HIS n 
1 302 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'hla, hly, SAV1163' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    MU50 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Staphylococcus aureus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     158878 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'B834(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q99UU6_STAAM 
_struct_ref.pdbx_db_accession          Q99UU6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAW
PSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESP
TDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAAENFLDPNKASSLLSSGFSPDFATVITMDRKASK
QQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
;
_struct_ref.pdbx_align_begin           27 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3ANZ A 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
2  1 3ANZ B 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
3  1 3ANZ C 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
4  1 3ANZ D 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
5  1 3ANZ E 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
6  1 3ANZ F 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
7  1 3ANZ G 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
8  1 3ANZ H 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
9  1 3ANZ I 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
10 1 3ANZ J 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
11 1 3ANZ K 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
12 1 3ANZ L 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
13 1 3ANZ M 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
14 1 3ANZ N 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
15 1 3ANZ O 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
16 1 3ANZ P 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
17 1 3ANZ Q 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
18 1 3ANZ R 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
19 1 3ANZ S 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
20 1 3ANZ T 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
21 1 3ANZ U 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
22 1 3ANZ V 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
23 1 3ANZ W 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
24 1 3ANZ X 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
25 1 3ANZ Y 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
26 1 3ANZ Z 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
27 1 3ANZ a 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
28 1 3ANZ b 2 ? 294 ? Q99UU6 27 ? 319 ? 1 293 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  3ANZ MET A 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   1   
1  3ANZ LEU A 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 2   
1  3ANZ GLU A 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 3   
1  3ANZ HIS A 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 4   
1  3ANZ HIS A 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 5   
1  3ANZ HIS A 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 6   
1  3ANZ HIS A 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 7   
1  3ANZ HIS A 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 8   
1  3ANZ HIS A 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 9   
2  3ANZ MET B 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   10  
2  3ANZ LEU B 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 11  
2  3ANZ GLU B 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 12  
2  3ANZ HIS B 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 13  
2  3ANZ HIS B 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 14  
2  3ANZ HIS B 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 15  
2  3ANZ HIS B 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 16  
2  3ANZ HIS B 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 17  
2  3ANZ HIS B 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 18  
3  3ANZ MET C 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   19  
3  3ANZ LEU C 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 20  
3  3ANZ GLU C 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 21  
3  3ANZ HIS C 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 22  
3  3ANZ HIS C 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 23  
3  3ANZ HIS C 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 24  
3  3ANZ HIS C 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 25  
3  3ANZ HIS C 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 26  
3  3ANZ HIS C 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 27  
4  3ANZ MET D 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   28  
4  3ANZ LEU D 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 29  
4  3ANZ GLU D 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 30  
4  3ANZ HIS D 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 31  
4  3ANZ HIS D 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 32  
4  3ANZ HIS D 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 33  
4  3ANZ HIS D 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 34  
4  3ANZ HIS D 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 35  
4  3ANZ HIS D 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 36  
5  3ANZ MET E 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   37  
5  3ANZ LEU E 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 38  
5  3ANZ GLU E 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 39  
5  3ANZ HIS E 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 40  
5  3ANZ HIS E 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 41  
5  3ANZ HIS E 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 42  
5  3ANZ HIS E 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 43  
5  3ANZ HIS E 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 44  
5  3ANZ HIS E 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 45  
6  3ANZ MET F 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   46  
6  3ANZ LEU F 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 47  
6  3ANZ GLU F 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 48  
6  3ANZ HIS F 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 49  
6  3ANZ HIS F 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 50  
6  3ANZ HIS F 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 51  
6  3ANZ HIS F 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 52  
6  3ANZ HIS F 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 53  
6  3ANZ HIS F 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 54  
7  3ANZ MET G 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   55  
7  3ANZ LEU G 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 56  
7  3ANZ GLU G 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 57  
7  3ANZ HIS G 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 58  
7  3ANZ HIS G 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 59  
7  3ANZ HIS G 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 60  
7  3ANZ HIS G 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 61  
7  3ANZ HIS G 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 62  
7  3ANZ HIS G 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 63  
8  3ANZ MET H 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   64  
8  3ANZ LEU H 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 65  
8  3ANZ GLU H 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 66  
8  3ANZ HIS H 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 67  
8  3ANZ HIS H 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 68  
8  3ANZ HIS H 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 69  
8  3ANZ HIS H 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 70  
8  3ANZ HIS H 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 71  
8  3ANZ HIS H 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 72  
9  3ANZ MET I 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   73  
9  3ANZ LEU I 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 74  
9  3ANZ GLU I 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 75  
9  3ANZ HIS I 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 76  
9  3ANZ HIS I 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 77  
9  3ANZ HIS I 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 78  
9  3ANZ HIS I 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 79  
9  3ANZ HIS I 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 80  
9  3ANZ HIS I 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 81  
10 3ANZ MET J 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   82  
10 3ANZ LEU J 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 83  
10 3ANZ GLU J 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 84  
10 3ANZ HIS J 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 85  
10 3ANZ HIS J 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 86  
10 3ANZ HIS J 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 87  
10 3ANZ HIS J 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 88  
10 3ANZ HIS J 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 89  
10 3ANZ HIS J 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 90  
11 3ANZ MET K 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   91  
11 3ANZ LEU K 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 92  
11 3ANZ GLU K 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 93  
11 3ANZ HIS K 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 94  
11 3ANZ HIS K 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 95  
11 3ANZ HIS K 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 96  
11 3ANZ HIS K 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 97  
11 3ANZ HIS K 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 98  
11 3ANZ HIS K 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 99  
12 3ANZ MET L 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   100 
12 3ANZ LEU L 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 101 
12 3ANZ GLU L 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 102 
12 3ANZ HIS L 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 103 
12 3ANZ HIS L 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 104 
12 3ANZ HIS L 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 105 
12 3ANZ HIS L 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 106 
12 3ANZ HIS L 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 107 
12 3ANZ HIS L 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 108 
13 3ANZ MET M 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   109 
13 3ANZ LEU M 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 110 
13 3ANZ GLU M 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 111 
13 3ANZ HIS M 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 112 
13 3ANZ HIS M 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 113 
13 3ANZ HIS M 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 114 
13 3ANZ HIS M 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 115 
13 3ANZ HIS M 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 116 
13 3ANZ HIS M 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 117 
14 3ANZ MET N 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   118 
14 3ANZ LEU N 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 119 
14 3ANZ GLU N 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 120 
14 3ANZ HIS N 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 121 
14 3ANZ HIS N 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 122 
14 3ANZ HIS N 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 123 
14 3ANZ HIS N 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 124 
14 3ANZ HIS N 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 125 
14 3ANZ HIS N 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 126 
15 3ANZ MET O 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   127 
15 3ANZ LEU O 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 128 
15 3ANZ GLU O 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 129 
15 3ANZ HIS O 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 130 
15 3ANZ HIS O 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 131 
15 3ANZ HIS O 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 132 
15 3ANZ HIS O 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 133 
15 3ANZ HIS O 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 134 
15 3ANZ HIS O 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 135 
16 3ANZ MET P 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   136 
16 3ANZ LEU P 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 137 
16 3ANZ GLU P 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 138 
16 3ANZ HIS P 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 139 
16 3ANZ HIS P 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 140 
16 3ANZ HIS P 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 141 
16 3ANZ HIS P 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 142 
16 3ANZ HIS P 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 143 
16 3ANZ HIS P 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 144 
17 3ANZ MET Q 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   145 
17 3ANZ LEU Q 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 146 
17 3ANZ GLU Q 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 147 
17 3ANZ HIS Q 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 148 
17 3ANZ HIS Q 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 149 
17 3ANZ HIS Q 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 150 
17 3ANZ HIS Q 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 151 
17 3ANZ HIS Q 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 152 
17 3ANZ HIS Q 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 153 
18 3ANZ MET R 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   154 
18 3ANZ LEU R 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 155 
18 3ANZ GLU R 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 156 
18 3ANZ HIS R 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 157 
18 3ANZ HIS R 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 158 
18 3ANZ HIS R 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 159 
18 3ANZ HIS R 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 160 
18 3ANZ HIS R 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 161 
18 3ANZ HIS R 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 162 
19 3ANZ MET S 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   163 
19 3ANZ LEU S 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 164 
19 3ANZ GLU S 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 165 
19 3ANZ HIS S 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 166 
19 3ANZ HIS S 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 167 
19 3ANZ HIS S 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 168 
19 3ANZ HIS S 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 169 
19 3ANZ HIS S 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 170 
19 3ANZ HIS S 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 171 
20 3ANZ MET T 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   172 
20 3ANZ LEU T 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 173 
20 3ANZ GLU T 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 174 
20 3ANZ HIS T 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 175 
20 3ANZ HIS T 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 176 
20 3ANZ HIS T 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 177 
20 3ANZ HIS T 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 178 
20 3ANZ HIS T 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 179 
20 3ANZ HIS T 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 180 
21 3ANZ MET U 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   181 
21 3ANZ LEU U 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 182 
21 3ANZ GLU U 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 183 
21 3ANZ HIS U 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 184 
21 3ANZ HIS U 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 185 
21 3ANZ HIS U 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 186 
21 3ANZ HIS U 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 187 
21 3ANZ HIS U 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 188 
21 3ANZ HIS U 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 189 
22 3ANZ MET V 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   190 
22 3ANZ LEU V 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 191 
22 3ANZ GLU V 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 192 
22 3ANZ HIS V 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 193 
22 3ANZ HIS V 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 194 
22 3ANZ HIS V 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 195 
22 3ANZ HIS V 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 196 
22 3ANZ HIS V 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 197 
22 3ANZ HIS V 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 198 
23 3ANZ MET W 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   199 
23 3ANZ LEU W 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 200 
23 3ANZ GLU W 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 201 
23 3ANZ HIS W 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 202 
23 3ANZ HIS W 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 203 
23 3ANZ HIS W 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 204 
23 3ANZ HIS W 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 205 
23 3ANZ HIS W 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 206 
23 3ANZ HIS W 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 207 
24 3ANZ MET X 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   208 
24 3ANZ LEU X 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 209 
24 3ANZ GLU X 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 210 
24 3ANZ HIS X 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 211 
24 3ANZ HIS X 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 212 
24 3ANZ HIS X 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 213 
24 3ANZ HIS X 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 214 
24 3ANZ HIS X 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 215 
24 3ANZ HIS X 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 216 
25 3ANZ MET Y 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   217 
25 3ANZ LEU Y 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 218 
25 3ANZ GLU Y 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 219 
25 3ANZ HIS Y 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 220 
25 3ANZ HIS Y 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 221 
25 3ANZ HIS Y 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 222 
25 3ANZ HIS Y 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 223 
25 3ANZ HIS Y 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 224 
25 3ANZ HIS Y 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 225 
26 3ANZ MET Z 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   226 
26 3ANZ LEU Z 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 227 
26 3ANZ GLU Z 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 228 
26 3ANZ HIS Z 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 229 
26 3ANZ HIS Z 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 230 
26 3ANZ HIS Z 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 231 
26 3ANZ HIS Z 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 232 
26 3ANZ HIS Z 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 233 
26 3ANZ HIS Z 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 234 
27 3ANZ MET a 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   235 
27 3ANZ LEU a 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 236 
27 3ANZ GLU a 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 237 
27 3ANZ HIS a 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 238 
27 3ANZ HIS a 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 239 
27 3ANZ HIS a 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 240 
27 3ANZ HIS a 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 241 
27 3ANZ HIS a 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 242 
27 3ANZ HIS a 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 243 
28 3ANZ MET b 1   ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 0   244 
28 3ANZ LEU b 295 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 294 245 
28 3ANZ GLU b 296 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 295 246 
28 3ANZ HIS b 297 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 296 247 
28 3ANZ HIS b 298 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 297 248 
28 3ANZ HIS b 299 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 298 249 
28 3ANZ HIS b 300 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 299 250 
28 3ANZ HIS b 301 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 300 251 
28 3ANZ HIS b 302 ? UNP Q99UU6 ? ? 'EXPRESSION TAG' 301 252 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer         . 'ACETIC ACID'                   ? 'C2 H4 O2'       60.052  
ALA 'L-peptide linking' y ALANINE                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE                       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                      ? 'C5 H11 N O2 S'  149.211 
MPD non-polymer         . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2'      118.174 
PHE 'L-peptide linking' y PHENYLALANINE                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3ANZ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        0.402 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.66 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   53.84 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    'HEPES, Ammonium acetate, MPD, pH 7.5, vapor diffusion, sitting drop, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-03-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-5A' 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-5A 
# 
_reflns.entry_id                     3ANZ 
_reflns.d_resolution_high            2.300 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   439066 
_reflns.pdbx_Rmerge_I_obs            0.085 
_reflns.pdbx_netI_over_sigmaI        16.300 
_reflns.pdbx_chi_squared             36.345 
_reflns.pdbx_redundancy              3.400 
_reflns.percent_possible_obs         99.100 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.300 2.340  ? ? ? ? 0.399 ? ? 2.604 3.100 ? ? ? 21874 ? ? ? ? 99.000 ? ? 1  1 
2.340 2.380  ? ? ? ? 0.416 ? ? 2.539 3.100 ? ? ? 21923 ? ? ? ? 99.000 ? ? 2  1 
2.380 2.430  ? ? ? ? 0.361 ? ? 2.613 3.200 ? ? ? 21836 ? ? ? ? 99.100 ? ? 3  1 
2.430 2.480  ? ? ? ? 0.347 ? ? 2.604 3.200 ? ? ? 21831 ? ? ? ? 99.100 ? ? 4  1 
2.480 2.530  ? ? ? ? 0.310 ? ? 2.686 3.200 ? ? ? 21954 ? ? ? ? 99.000 ? ? 5  1 
2.530 2.590  ? ? ? ? 0.242 ? ? 2.812 3.200 ? ? ? 21864 ? ? ? ? 99.000 ? ? 6  1 
2.590 2.660  ? ? ? ? 0.219 ? ? 3.009 3.300 ? ? ? 21895 ? ? ? ? 99.000 ? ? 7  1 
2.660 2.730  ? ? ? ? 0.198 ? ? 3.064 3.300 ? ? ? 21899 ? ? ? ? 99.000 ? ? 8  1 
2.730 2.810  ? ? ? ? 0.165 ? ? 3.253 3.300 ? ? ? 21902 ? ? ? ? 98.900 ? ? 9  1 
2.810 2.900  ? ? ? ? 0.149 ? ? 3.409 3.400 ? ? ? 21946 ? ? ? ? 99.100 ? ? 10 1 
2.900 3.000  ? ? ? ? 0.128 ? ? 3.711 3.400 ? ? ? 21942 ? ? ? ? 99.300 ? ? 11 1 
3.000 3.120  ? ? ? ? 0.111 ? ? 4.115 3.500 ? ? ? 22080 ? ? ? ? 99.700 ? ? 12 1 
3.120 3.260  ? ? ? ? 0.098 ? ? 4.737 3.600 ? ? ? 22087 ? ? ? ? 99.900 ? ? 13 1 
3.260 3.440  ? ? ? ? 0.088 ? ? 5.173 3.600 ? ? ? 22136 ? ? ? ? 99.900 ? ? 14 1 
3.440 3.650  ? ? ? ? 0.081 ? ? 6.268 3.700 ? ? ? 22117 ? ? ? ? 99.900 ? ? 15 1 
3.650 3.930  ? ? ? ? 0.076 ? ? 6.774 3.700 ? ? ? 22130 ? ? ? ? 99.800 ? ? 16 1 
3.930 4.330  ? ? ? ? 0.068 ? ? 7.003 3.700 ? ? ? 22063 ? ? ? ? 99.600 ? ? 17 1 
4.330 4.950  ? ? ? ? 0.057 ? ? 7.082 3.600 ? ? ? 22041 ? ? ? ? 99.400 ? ? 18 1 
4.950 6.240  ? ? ? ? 0.052 ? ? 6.734 3.700 ? ? ? 22208 ? ? ? ? 99.900 ? ? 19 1 
6.240 50.000 ? ? ? ? 0.066 ? ? 0.048 3.700 ? ? ? 21338 ? ? ? ? 95.300 ? ? 20 1 
# 
_refine.entry_id                                 3ANZ 
_refine.ls_d_res_high                            2.3030 
_refine.ls_d_res_low                             19.9840 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    97.8500 
_refine.ls_number_reflns_obs                     433754 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2045 
_refine.ls_R_factor_R_work                       0.1931 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2262 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 7.1000 
_refine.ls_number_reflns_R_free                  30815 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               51.6053 
_refine.solvent_model_param_bsol                 60.221 
_refine.solvent_model_param_ksol                 0.373 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            17.7194 
_refine.aniso_B[2][2]                            -14.7581 
_refine.aniso_B[3][3]                            -2.9613 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            17.7253 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.28 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             0.90 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.61 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      7AHL 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7425 
_refine.B_iso_max                                182.050 
_refine.B_iso_min                                17.950 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 30.92 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        65983 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         560 
_refine_hist.number_atoms_solvent             2064 
_refine_hist.number_atoms_total               68607 
_refine_hist.d_res_high                       2.3030 
_refine_hist.d_res_low                        19.9840 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 67915 'X-RAY DIFFRACTION' ? 
f_angle_d          0.911  ? ? 91916 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.111 ? ? 24936 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.058  ? ? 9839  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 11782 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  A 1830 ?     ? POSITIONAL 1 1  'X-RAY DIFFRACTION' ? ? ? 
2  B 1830 0.032 ? POSITIONAL 1 2  'X-RAY DIFFRACTION' ? ? ? 
3  C 1830 0.032 ? POSITIONAL 1 3  'X-RAY DIFFRACTION' ? ? ? 
4  D 1830 0.031 ? POSITIONAL 1 4  'X-RAY DIFFRACTION' ? ? ? 
5  E 1830 0.030 ? POSITIONAL 1 5  'X-RAY DIFFRACTION' ? ? ? 
6  F 1830 0.030 ? POSITIONAL 1 6  'X-RAY DIFFRACTION' ? ? ? 
7  G 1830 0.032 ? POSITIONAL 1 7  'X-RAY DIFFRACTION' ? ? ? 
8  H 1830 0.023 ? POSITIONAL 1 8  'X-RAY DIFFRACTION' ? ? ? 
9  I 1830 0.032 ? POSITIONAL 1 9  'X-RAY DIFFRACTION' ? ? ? 
10 J 1830 0.033 ? POSITIONAL 1 10 'X-RAY DIFFRACTION' ? ? ? 
11 K 1830 0.035 ? POSITIONAL 1 11 'X-RAY DIFFRACTION' ? ? ? 
12 L 1830 0.033 ? POSITIONAL 1 12 'X-RAY DIFFRACTION' ? ? ? 
13 M 1830 0.030 ? POSITIONAL 1 13 'X-RAY DIFFRACTION' ? ? ? 
14 N 1830 0.032 ? POSITIONAL 1 14 'X-RAY DIFFRACTION' ? ? ? 
15 O 1830 0.033 ? POSITIONAL 1 15 'X-RAY DIFFRACTION' ? ? ? 
16 P 1830 0.033 ? POSITIONAL 1 16 'X-RAY DIFFRACTION' ? ? ? 
17 Q 1830 0.031 ? POSITIONAL 1 17 'X-RAY DIFFRACTION' ? ? ? 
18 R 1830 0.032 ? POSITIONAL 1 18 'X-RAY DIFFRACTION' ? ? ? 
19 S 1830 0.030 ? POSITIONAL 1 19 'X-RAY DIFFRACTION' ? ? ? 
20 T 1830 0.028 ? POSITIONAL 1 20 'X-RAY DIFFRACTION' ? ? ? 
21 U 1830 0.032 ? POSITIONAL 1 21 'X-RAY DIFFRACTION' ? ? ? 
22 V 1830 0.032 ? POSITIONAL 1 22 'X-RAY DIFFRACTION' ? ? ? 
23 W 1830 0.029 ? POSITIONAL 1 23 'X-RAY DIFFRACTION' ? ? ? 
24 X 1830 0.029 ? POSITIONAL 1 24 'X-RAY DIFFRACTION' ? ? ? 
25 Y 1830 0.032 ? POSITIONAL 1 25 'X-RAY DIFFRACTION' ? ? ? 
26 Z 1830 0.029 ? POSITIONAL 1 26 'X-RAY DIFFRACTION' ? ? ? 
27 a 1830 0.026 ? POSITIONAL 1 27 'X-RAY DIFFRACTION' ? ? ? 
28 b 1830 0.031 ? POSITIONAL 1 28 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.3030 2.3292  12449 0.2834 90.00  0.3464 . . 952  . . . . 
'X-RAY DIFFRACTION' . 2.3292 2.3565  13298 0.2868 98.00  0.3240 . . 1021 . . . . 
'X-RAY DIFFRACTION' . 2.3565 2.3852  13355 0.2860 97.00  0.3455 . . 1032 . . . . 
'X-RAY DIFFRACTION' . 2.3852 2.4154  13318 0.2647 98.00  0.3270 . . 1075 . . . . 
'X-RAY DIFFRACTION' . 2.4154 2.4471  13485 0.2673 98.00  0.3224 . . 1039 . . . . 
'X-RAY DIFFRACTION' . 2.4471 2.4806  13280 0.2744 98.00  0.3191 . . 1052 . . . . 
'X-RAY DIFFRACTION' . 2.4806 2.5159  13318 0.2668 98.00  0.3188 . . 1067 . . . . 
'X-RAY DIFFRACTION' . 2.5159 2.5534  13490 0.2499 98.00  0.2978 . . 991  . . . . 
'X-RAY DIFFRACTION' . 2.5534 2.5932  13448 0.2403 98.00  0.3013 . . 958  . . . . 
'X-RAY DIFFRACTION' . 2.5932 2.6356  13498 0.2312 98.00  0.2832 . . 1036 . . . . 
'X-RAY DIFFRACTION' . 2.6356 2.6810  13246 0.2341 98.00  0.2727 . . 1055 . . . . 
'X-RAY DIFFRACTION' . 2.6810 2.7296  13340 0.2393 97.00  0.2961 . . 1037 . . . . 
'X-RAY DIFFRACTION' . 2.7296 2.7820  13522 0.2243 98.00  0.2825 . . 1000 . . . . 
'X-RAY DIFFRACTION' . 2.7820 2.8386  13332 0.2220 98.00  0.2718 . . 1045 . . . . 
'X-RAY DIFFRACTION' . 2.8386 2.9002  13460 0.2163 98.00  0.2745 . . 969  . . . . 
'X-RAY DIFFRACTION' . 2.9002 2.9674  13456 0.2179 98.00  0.2722 . . 1039 . . . . 
'X-RAY DIFFRACTION' . 2.9674 3.0414  13547 0.2163 99.00  0.2554 . . 1028 . . . . 
'X-RAY DIFFRACTION' . 3.0414 3.1233  13539 0.2041 99.00  0.2375 . . 1031 . . . . 
'X-RAY DIFFRACTION' . 3.1233 3.2149  13583 0.1945 99.00  0.2337 . . 1054 . . . . 
'X-RAY DIFFRACTION' . 3.2149 3.3182  13545 0.1916 99.00  0.2347 . . 1030 . . . . 
'X-RAY DIFFRACTION' . 3.3182 3.4362  13528 0.1828 99.00  0.2193 . . 1074 . . . . 
'X-RAY DIFFRACTION' . 3.4362 3.5730  13566 0.1702 99.00  0.2109 . . 1027 . . . . 
'X-RAY DIFFRACTION' . 3.5730 3.7346  13603 0.1656 99.00  0.1930 . . 1008 . . . . 
'X-RAY DIFFRACTION' . 3.7346 3.9301  13576 0.1677 99.00  0.1902 . . 1072 . . . . 
'X-RAY DIFFRACTION' . 3.9301 4.1743  13689 0.1676 99.00  0.1960 . . 947  . . . . 
'X-RAY DIFFRACTION' . 4.1743 4.4932  13599 0.1514 99.00  0.1660 . . 1061 . . . . 
'X-RAY DIFFRACTION' . 4.4932 4.9392  13579 0.1445 99.00  0.1623 . . 1058 . . . . 
'X-RAY DIFFRACTION' . 4.9392 5.6398  13706 0.1694 100.00 0.1870 . . 1004 . . . . 
'X-RAY DIFFRACTION' . 5.6398 7.0532  13746 0.2025 100.00 0.2255 . . 1086 . . . . 
'X-RAY DIFFRACTION' . 7.0532 19.9851 12838 0.1723 92.00  0.1802 . . 967  . . . . 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1  given ? 0.692301  -0.100461 -0.714582 0.380060  0.892545  0.242728  0.613412  -0.439625 0.656091  40.959599   -13.958100 
19.676800   
2  given ? 0.007726  0.158019  -0.987406 0.749669  0.652557  0.110298  0.661767  -0.741080 -0.113421 56.595600   -6.431880  
63.800999   
3  given ? -0.538402 0.572908  -0.617980 0.834544  0.464206  -0.296730 0.116871  -0.675492 -0.728047 35.288700   17.013300  
99.027802   
4  given ? -0.537435 0.834366  0.122459  0.571636  0.467200  -0.674505 -0.619997 -0.292501 -0.728044 -7.023170   38.610500  
98.855202   
5  given ? 0.011685  0.741736  0.670590  0.161237  0.660462  -0.733344 -0.986847 0.116693  -0.111877 -38.395699  41.963001  
63.603500   
6  given ? 0.696816  0.368800  0.615170  -0.094497 0.897407  -0.430964 -0.710997 0.242171  0.660179  -35.155701  24.496901  
19.450001   
7  given ? 0.999943  -0.000758 0.010668  0.000760  1.000000  -0.000196 -0.010668 0.000204  0.999943  -49.829601  -1.542640  
-84.665604  
8  given ? 0.700643  -0.100819 -0.706353 0.377237  0.892632  0.246780  0.605633  -0.439367 0.663449  66.940903   -54.785000 
-65.824997  
9  given ? 0.017701  0.156948  -0.987448 0.750058  0.650957  0.116911  0.661135  -0.742713 -0.106197 139.567001  -54.031799 
41.655300   
10 given ? -0.529936 0.573984  -0.624268 0.839123  0.461369  -0.288118 0.122643  -0.676522 -0.726139 113.514000  -0.262347  
155.828003  
11 given ? -0.538536 0.833950  0.120444  0.577333  0.469320  -0.668150 -0.613731 -0.290286 -0.734213 7.631740    66.498199  
191.826996  
12 given ? 0.005952  0.740360  0.672184  0.168136  0.661885  -0.730505 -0.985746 0.117367  -0.120542 -97.128700  94.864403  
121.817001  
13 given ? 0.691000  0.367977  0.622183  -0.088474 0.897313  -0.432437 -0.717420 0.243767  0.652600  -122.489998 64.345398  
-1.417860   
14 given ? 0.933699  -0.148501 0.325812  0.151933  -0.659643 -0.736062 0.324226  0.736762  -0.593346 -39.692200  120.304001 
40.456699   
15 given ? 0.395741  -0.562585 0.725870  0.569771  -0.469475 -0.674503 0.720243  0.680508  0.134754  -27.629400  88.246498  
-30.977800  
16 given ? -0.289201 -0.831481 0.474344  0.830871  -0.464122 -0.306992 0.475412  0.305336  0.825078  35.049000   47.904701  
-56.123402  
17 given ? -0.620098 -0.750711 -0.227841 0.751571  -0.651735 0.101894  -0.224985 -0.108054 0.968352  100.401001  28.508900  
-16.673901  
18 given ? -0.341153 -0.382130 -0.858831 0.381162  -0.891396 0.245211  -0.859262 -0.243699 0.449756  119.737000  44.796501  
57.838902   
19 given ? 0.338037  -0.006767 -0.941109 0.006213  -0.999936 0.009422  -0.941112 -0.009032 -0.337973 78.532799   84.881302  
111.750000  
20 given ? 0.905818  0.100895  -0.411477 -0.096230 -0.896846 -0.431748 -0.412593 0.430682  -0.802671 7.137620    118.791000 
103.702003  
21 given ? 0.929596  -0.147805 0.337647  0.161184  -0.660815 -0.733037 0.331468  0.735851  -0.590467 -113.587997 176.029007 
73.774902   
22 given ? 0.392028  -0.562182 0.728193  0.574749  -0.468387 -0.671027 0.718316  0.681589  0.139493  -107.982002 118.578003 
-78.613998  
23 given ? -0.294752 -0.830737 0.472225  0.834105  -0.464797 -0.297040 0.466251  0.306332  0.829922  10.181400   33.410198  
-150.136993 
24 given ? -0.619082 -0.749514 -0.234451 0.748287  -0.653586 0.113546  -0.238338 -0.105142 0.965474  151.593002  -16.747101 
-87.464897  
25 given ? -0.331697 -0.384310 -0.861558 0.379190  -0.890553 0.251257  -0.863824 -0.243353 0.441121  210.063995  6.039160   
62.473301   
26 given ? 0.348688  -0.007192 -0.937211 0.007618  -0.999916 0.010508  -0.937208 -0.010803 -0.348604 141.569000  85.065002  
187.246994  
27 given ? 0.911031  0.100971  -0.399783 -0.090082 -0.897396 -0.431932 -0.402377 0.429517  -0.808461 -3.313120   161.350006 
191.729996  
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1  A 
1 2  B 
1 3  C 
1 4  D 
1 5  E 
1 6  F 
1 7  G 
1 8  H 
1 9  I 
1 10 J 
1 11 K 
1 12 L 
1 13 M 
1 14 N 
1 15 O 
1 16 P 
1 17 Q 
1 18 R 
1 19 S 
1 20 T 
1 21 U 
1 22 V 
1 23 W 
1 24 X 
1 25 Y 
1 26 Z 
1 27 a 
1 28 b 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain A and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain B and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain C and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain D and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain E and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain F and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain G and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain H and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain I and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain J and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain K and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain L and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain M and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain N and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain O and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain P and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain Q and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain R and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain S and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
20 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain T and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
21 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain U and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
22 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain V and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
23 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain W and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
24 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain X and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
25 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain Y and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
26 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain Z and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
27 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain a and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
28 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'chain b and (resseq 1:12 or resseq 19:64 or resseq 76:89 or resseq 97:124 or resseq 136:189 or resseq 210:254 or resseq 266:293 )' 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3ANZ 
_struct.title                     'Crystal Structure of alpha-hemolysin' 
_struct.pdbx_descriptor           Alpha-hemolysin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ANZ 
_struct_keywords.text            'heptamer, TOXIN' 
_struct_keywords.pdbx_keywords   TOXIN 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 1 ? 
X  N N 1 ? 
Y  N N 1 ? 
Z  N N 1 ? 
AA N N 1 ? 
BA N N 1 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 3 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 3 ? 
OA N N 3 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 3 ? 
SA N N 2 ? 
TA N N 2 ? 
UA N N 3 ? 
VA N N 2 ? 
WA N N 2 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 3 ? 
AB N N 3 ? 
BB N N 2 ? 
CB N N 2 ? 
DB N N 2 ? 
EB N N 2 ? 
FB N N 3 ? 
GB N N 2 ? 
HB N N 2 ? 
IB N N 3 ? 
JB N N 3 ? 
KB N N 2 ? 
LB N N 2 ? 
MB N N 3 ? 
NB N N 2 ? 
OB N N 2 ? 
PB N N 3 ? 
QB N N 2 ? 
RB N N 2 ? 
SB N N 2 ? 
TB N N 2 ? 
UB N N 3 ? 
VB N N 3 ? 
WB N N 2 ? 
XB N N 2 ? 
YB N N 3 ? 
ZB N N 2 ? 
AC N N 2 ? 
BC N N 3 ? 
CC N N 2 ? 
DC N N 2 ? 
EC N N 2 ? 
FC N N 2 ? 
GC N N 3 ? 
HC N N 3 ? 
IC N N 2 ? 
JC N N 2 ? 
KC N N 3 ? 
LC N N 2 ? 
MC N N 2 ? 
NC N N 2 ? 
OC N N 2 ? 
PC N N 3 ? 
QC N N 2 ? 
RC N N 2 ? 
SC N N 3 ? 
TC N N 2 ? 
UC N N 2 ? 
VC N N 2 ? 
WC N N 3 ? 
XC N N 2 ? 
YC N N 2 ? 
ZC N N 3 ? 
AD N N 2 ? 
BD N N 3 ? 
CD N N 2 ? 
DD N N 2 ? 
ED N N 3 ? 
FD N N 2 ? 
GD N N 2 ? 
HD N N 3 ? 
ID N N 4 ? 
JD N N 4 ? 
KD N N 4 ? 
LD N N 4 ? 
MD N N 4 ? 
ND N N 4 ? 
OD N N 4 ? 
PD N N 4 ? 
QD N N 4 ? 
RD N N 4 ? 
SD N N 4 ? 
TD N N 4 ? 
UD N N 4 ? 
VD N N 4 ? 
WD N N 4 ? 
XD N N 4 ? 
YD N N 4 ? 
ZD N N 4 ? 
AE N N 4 ? 
BE N N 4 ? 
CE N N 4 ? 
DE N N 4 ? 
EE N N 4 ? 
FE N N 4 ? 
GE N N 4 ? 
HE N N 4 ? 
IE N N 4 ? 
JE N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ALA A  2   ? ASN A  7   ? ALA A 1   ASN A 6   5 ? 6 
HELX_P HELX_P2   2   LYS A  206 ? ASN A  210 ? LYS A 205 ASN A 209 5 ? 5 
HELX_P HELX_P3   3   ASP A  213 ? ALA A  217 ? ASP A 212 ALA A 216 5 ? 5 
HELX_P HELX_P4   4   SER A  218 ? SER A  223 ? SER A 217 SER A 222 1 ? 6 
HELX_P HELX_P5   5   ALA B  2   ? ASN B  7   ? ALA B 1   ASN B 6   5 ? 6 
HELX_P HELX_P6   6   LYS B  206 ? ASN B  210 ? LYS B 205 ASN B 209 5 ? 5 
HELX_P HELX_P7   7   ASP B  213 ? ALA B  217 ? ASP B 212 ALA B 216 5 ? 5 
HELX_P HELX_P8   8   SER B  218 ? SER B  223 ? SER B 217 SER B 222 1 ? 6 
HELX_P HELX_P9   9   ALA C  2   ? ASN C  7   ? ALA C 1   ASN C 6   5 ? 6 
HELX_P HELX_P10  10  LYS C  206 ? ASN C  210 ? LYS C 205 ASN C 209 5 ? 5 
HELX_P HELX_P11  11  ASP C  213 ? ALA C  217 ? ASP C 212 ALA C 216 5 ? 5 
HELX_P HELX_P12  12  SER C  218 ? SER C  223 ? SER C 217 SER C 222 1 ? 6 
HELX_P HELX_P13  13  ALA D  2   ? ASN D  7   ? ALA D 1   ASN D 6   5 ? 6 
HELX_P HELX_P14  14  LYS D  206 ? ASN D  210 ? LYS D 205 ASN D 209 5 ? 5 
HELX_P HELX_P15  15  ASP D  213 ? ALA D  217 ? ASP D 212 ALA D 216 5 ? 5 
HELX_P HELX_P16  16  SER D  218 ? SER D  223 ? SER D 217 SER D 222 1 ? 6 
HELX_P HELX_P17  17  ALA E  2   ? ASN E  7   ? ALA E 1   ASN E 6   5 ? 6 
HELX_P HELX_P18  18  ASP E  213 ? ALA E  217 ? ASP E 212 ALA E 216 5 ? 5 
HELX_P HELX_P19  19  SER E  218 ? SER E  223 ? SER E 217 SER E 222 1 ? 6 
HELX_P HELX_P20  20  ALA F  2   ? ASN F  7   ? ALA F 1   ASN F 6   5 ? 6 
HELX_P HELX_P21  21  LYS F  206 ? ASN F  210 ? LYS F 205 ASN F 209 5 ? 5 
HELX_P HELX_P22  22  ASP F  213 ? ALA F  217 ? ASP F 212 ALA F 216 5 ? 5 
HELX_P HELX_P23  23  SER F  218 ? SER F  223 ? SER F 217 SER F 222 1 ? 6 
HELX_P HELX_P24  24  ALA G  2   ? ASN G  7   ? ALA G 1   ASN G 6   5 ? 6 
HELX_P HELX_P25  25  LYS G  206 ? ASN G  210 ? LYS G 205 ASN G 209 5 ? 5 
HELX_P HELX_P26  26  ASP G  213 ? ALA G  217 ? ASP G 212 ALA G 216 5 ? 5 
HELX_P HELX_P27  27  SER G  218 ? SER G  223 ? SER G 217 SER G 222 1 ? 6 
HELX_P HELX_P28  28  ALA H  2   ? ASN H  7   ? ALA H 1   ASN H 6   5 ? 6 
HELX_P HELX_P29  29  LYS H  206 ? ASN H  210 ? LYS H 205 ASN H 209 5 ? 5 
HELX_P HELX_P30  30  ASP H  213 ? ALA H  217 ? ASP H 212 ALA H 216 5 ? 5 
HELX_P HELX_P31  31  SER H  218 ? SER H  223 ? SER H 217 SER H 222 1 ? 6 
HELX_P HELX_P32  32  ALA I  2   ? ASN I  7   ? ALA I 1   ASN I 6   5 ? 6 
HELX_P HELX_P33  33  LYS I  206 ? ASN I  210 ? LYS I 205 ASN I 209 5 ? 5 
HELX_P HELX_P34  34  ASP I  213 ? ALA I  217 ? ASP I 212 ALA I 216 5 ? 5 
HELX_P HELX_P35  35  SER I  218 ? SER I  223 ? SER I 217 SER I 222 1 ? 6 
HELX_P HELX_P36  36  ALA J  2   ? ASN J  7   ? ALA J 1   ASN J 6   5 ? 6 
HELX_P HELX_P37  37  LYS J  206 ? ASN J  210 ? LYS J 205 ASN J 209 5 ? 5 
HELX_P HELX_P38  38  ASP J  213 ? ALA J  217 ? ASP J 212 ALA J 216 5 ? 5 
HELX_P HELX_P39  39  SER J  218 ? SER J  223 ? SER J 217 SER J 222 1 ? 6 
HELX_P HELX_P40  40  ALA K  2   ? ASN K  7   ? ALA K 1   ASN K 6   5 ? 6 
HELX_P HELX_P41  41  LYS K  206 ? ASN K  210 ? LYS K 205 ASN K 209 5 ? 5 
HELX_P HELX_P42  42  ASP K  213 ? ALA K  217 ? ASP K 212 ALA K 216 5 ? 5 
HELX_P HELX_P43  43  SER K  218 ? SER K  223 ? SER K 217 SER K 222 1 ? 6 
HELX_P HELX_P44  44  ALA L  2   ? ASN L  7   ? ALA L 1   ASN L 6   5 ? 6 
HELX_P HELX_P45  45  LYS L  206 ? ASN L  210 ? LYS L 205 ASN L 209 5 ? 5 
HELX_P HELX_P46  46  ASP L  213 ? ALA L  217 ? ASP L 212 ALA L 216 5 ? 5 
HELX_P HELX_P47  47  SER L  218 ? SER L  223 ? SER L 217 SER L 222 1 ? 6 
HELX_P HELX_P48  48  ALA M  2   ? ASN M  7   ? ALA M 1   ASN M 6   5 ? 6 
HELX_P HELX_P49  49  LYS M  206 ? ASN M  210 ? LYS M 205 ASN M 209 5 ? 5 
HELX_P HELX_P50  50  ASP M  213 ? ALA M  217 ? ASP M 212 ALA M 216 5 ? 5 
HELX_P HELX_P51  51  SER M  218 ? SER M  223 ? SER M 217 SER M 222 1 ? 6 
HELX_P HELX_P52  52  ALA N  2   ? ASN N  7   ? ALA N 1   ASN N 6   5 ? 6 
HELX_P HELX_P53  53  LYS N  206 ? ASN N  210 ? LYS N 205 ASN N 209 5 ? 5 
HELX_P HELX_P54  54  ASP N  213 ? ALA N  217 ? ASP N 212 ALA N 216 5 ? 5 
HELX_P HELX_P55  55  SER N  218 ? SER N  223 ? SER N 217 SER N 222 1 ? 6 
HELX_P HELX_P56  56  ALA O  2   ? ASN O  7   ? ALA O 1   ASN O 6   5 ? 6 
HELX_P HELX_P57  57  LYS O  206 ? ASN O  210 ? LYS O 205 ASN O 209 5 ? 5 
HELX_P HELX_P58  58  ASP O  213 ? ALA O  217 ? ASP O 212 ALA O 216 5 ? 5 
HELX_P HELX_P59  59  SER O  218 ? SER O  223 ? SER O 217 SER O 222 1 ? 6 
HELX_P HELX_P60  60  ALA P  2   ? ASN P  7   ? ALA P 1   ASN P 6   5 ? 6 
HELX_P HELX_P61  61  LYS P  206 ? ASN P  210 ? LYS P 205 ASN P 209 5 ? 5 
HELX_P HELX_P62  62  ASP P  213 ? ALA P  217 ? ASP P 212 ALA P 216 5 ? 5 
HELX_P HELX_P63  63  SER P  218 ? SER P  223 ? SER P 217 SER P 222 1 ? 6 
HELX_P HELX_P64  64  ALA Q  2   ? ASN Q  7   ? ALA Q 1   ASN Q 6   5 ? 6 
HELX_P HELX_P65  65  LYS Q  206 ? ASN Q  210 ? LYS Q 205 ASN Q 209 5 ? 5 
HELX_P HELX_P66  66  ASP Q  213 ? ALA Q  217 ? ASP Q 212 ALA Q 216 5 ? 5 
HELX_P HELX_P67  67  SER Q  218 ? SER Q  223 ? SER Q 217 SER Q 222 1 ? 6 
HELX_P HELX_P68  68  ALA R  2   ? ASN R  7   ? ALA R 1   ASN R 6   5 ? 6 
HELX_P HELX_P69  69  LYS R  206 ? ASN R  210 ? LYS R 205 ASN R 209 5 ? 5 
HELX_P HELX_P70  70  ASP R  213 ? ALA R  217 ? ASP R 212 ALA R 216 5 ? 5 
HELX_P HELX_P71  71  SER R  218 ? SER R  223 ? SER R 217 SER R 222 1 ? 6 
HELX_P HELX_P72  72  ALA S  2   ? ASN S  7   ? ALA S 1   ASN S 6   5 ? 6 
HELX_P HELX_P73  73  LYS S  206 ? ASN S  210 ? LYS S 205 ASN S 209 5 ? 5 
HELX_P HELX_P74  74  ASP S  213 ? ALA S  217 ? ASP S 212 ALA S 216 5 ? 5 
HELX_P HELX_P75  75  SER S  218 ? SER S  223 ? SER S 217 SER S 222 1 ? 6 
HELX_P HELX_P76  76  ALA T  2   ? ASN T  7   ? ALA T 1   ASN T 6   5 ? 6 
HELX_P HELX_P77  77  LYS T  206 ? ASN T  210 ? LYS T 205 ASN T 209 5 ? 5 
HELX_P HELX_P78  78  ASP T  213 ? ALA T  217 ? ASP T 212 ALA T 216 5 ? 5 
HELX_P HELX_P79  79  SER T  218 ? SER T  223 ? SER T 217 SER T 222 1 ? 6 
HELX_P HELX_P80  80  ALA U  2   ? ASN U  7   ? ALA U 1   ASN U 6   5 ? 6 
HELX_P HELX_P81  81  LYS U  206 ? ASN U  210 ? LYS U 205 ASN U 209 5 ? 5 
HELX_P HELX_P82  82  ASP U  213 ? ALA U  217 ? ASP U 212 ALA U 216 5 ? 5 
HELX_P HELX_P83  83  SER U  218 ? SER U  223 ? SER U 217 SER U 222 1 ? 6 
HELX_P HELX_P84  84  ALA V  2   ? ASN V  7   ? ALA V 1   ASN V 6   5 ? 6 
HELX_P HELX_P85  85  LYS V  206 ? ASN V  210 ? LYS V 205 ASN V 209 5 ? 5 
HELX_P HELX_P86  86  ASP V  213 ? ALA V  217 ? ASP V 212 ALA V 216 5 ? 5 
HELX_P HELX_P87  87  SER V  218 ? SER V  223 ? SER V 217 SER V 222 1 ? 6 
HELX_P HELX_P88  88  ALA W  2   ? ASN W  7   ? ALA W 1   ASN W 6   5 ? 6 
HELX_P HELX_P89  89  LYS W  206 ? ASN W  210 ? LYS W 205 ASN W 209 5 ? 5 
HELX_P HELX_P90  90  ASP W  213 ? ALA W  217 ? ASP W 212 ALA W 216 5 ? 5 
HELX_P HELX_P91  91  SER W  218 ? SER W  223 ? SER W 217 SER W 222 1 ? 6 
HELX_P HELX_P92  92  ALA X  2   ? ASN X  7   ? ALA X 1   ASN X 6   5 ? 6 
HELX_P HELX_P93  93  LYS X  206 ? ASN X  210 ? LYS X 205 ASN X 209 5 ? 5 
HELX_P HELX_P94  94  ASP X  213 ? ALA X  217 ? ASP X 212 ALA X 216 5 ? 5 
HELX_P HELX_P95  95  SER X  218 ? SER X  223 ? SER X 217 SER X 222 1 ? 6 
HELX_P HELX_P96  96  ALA Y  2   ? ASN Y  7   ? ALA Y 1   ASN Y 6   5 ? 6 
HELX_P HELX_P97  97  LYS Y  206 ? ASN Y  210 ? LYS Y 205 ASN Y 209 5 ? 5 
HELX_P HELX_P98  98  ASP Y  213 ? ALA Y  217 ? ASP Y 212 ALA Y 216 5 ? 5 
HELX_P HELX_P99  99  SER Y  218 ? SER Y  223 ? SER Y 217 SER Y 222 1 ? 6 
HELX_P HELX_P100 100 ALA Z  2   ? ASN Z  7   ? ALA Z 1   ASN Z 6   5 ? 6 
HELX_P HELX_P101 101 LYS Z  206 ? ASN Z  210 ? LYS Z 205 ASN Z 209 5 ? 5 
HELX_P HELX_P102 102 ASP Z  213 ? ALA Z  217 ? ASP Z 212 ALA Z 216 5 ? 5 
HELX_P HELX_P103 103 SER Z  218 ? SER Z  223 ? SER Z 217 SER Z 222 1 ? 6 
HELX_P HELX_P104 104 ALA AA 2   ? ASN AA 7   ? ALA a 1   ASN a 6   5 ? 6 
HELX_P HELX_P105 105 LYS AA 206 ? ASN AA 210 ? LYS a 205 ASN a 209 5 ? 5 
HELX_P HELX_P106 106 ASP AA 213 ? ALA AA 217 ? ASP a 212 ALA a 216 5 ? 5 
HELX_P HELX_P107 107 SER AA 218 ? SER AA 223 ? SER a 217 SER a 222 1 ? 6 
HELX_P HELX_P108 108 ALA BA 2   ? ASN BA 7   ? ALA b 1   ASN b 6   5 ? 6 
HELX_P HELX_P109 109 LYS BA 206 ? ASN BA 210 ? LYS b 205 ASN b 209 5 ? 5 
HELX_P HELX_P110 110 ASP BA 213 ? ALA BA 217 ? ASP b 212 ALA b 216 5 ? 5 
HELX_P HELX_P111 111 SER BA 218 ? SER BA 223 ? SER b 217 SER b 222 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  TYR 103 A  . ? TYR 102 A PRO 104 A  ? PRO 103 A 1 3.27  
2  GLY 181 A  . ? GLY 180 A PRO 182 A  ? PRO 181 A 1 0.47  
3  TYR 103 B  . ? TYR 102 B PRO 104 B  ? PRO 103 B 1 3.07  
4  GLY 181 B  . ? GLY 180 B PRO 182 B  ? PRO 181 B 1 -0.01 
5  TYR 103 C  . ? TYR 102 C PRO 104 C  ? PRO 103 C 1 2.08  
6  GLY 181 C  . ? GLY 180 C PRO 182 C  ? PRO 181 C 1 -0.48 
7  TYR 103 D  . ? TYR 102 D PRO 104 D  ? PRO 103 D 1 2.24  
8  GLY 181 D  . ? GLY 180 D PRO 182 D  ? PRO 181 D 1 -0.23 
9  TYR 103 E  . ? TYR 102 E PRO 104 E  ? PRO 103 E 1 2.99  
10 GLY 181 E  . ? GLY 180 E PRO 182 E  ? PRO 181 E 1 1.10  
11 TYR 103 F  . ? TYR 102 F PRO 104 F  ? PRO 103 F 1 2.94  
12 GLY 181 F  . ? GLY 180 F PRO 182 F  ? PRO 181 F 1 -0.03 
13 TYR 103 G  . ? TYR 102 G PRO 104 G  ? PRO 103 G 1 2.80  
14 GLY 181 G  . ? GLY 180 G PRO 182 G  ? PRO 181 G 1 0.35  
15 TYR 103 H  . ? TYR 102 H PRO 104 H  ? PRO 103 H 1 2.20  
16 GLY 181 H  . ? GLY 180 H PRO 182 H  ? PRO 181 H 1 0.26  
17 TYR 103 I  . ? TYR 102 I PRO 104 I  ? PRO 103 I 1 2.61  
18 GLY 181 I  . ? GLY 180 I PRO 182 I  ? PRO 181 I 1 -0.64 
19 TYR 103 J  . ? TYR 102 J PRO 104 J  ? PRO 103 J 1 1.81  
20 GLY 181 J  . ? GLY 180 J PRO 182 J  ? PRO 181 J 1 1.41  
21 TYR 103 K  . ? TYR 102 K PRO 104 K  ? PRO 103 K 1 1.15  
22 GLY 181 K  . ? GLY 180 K PRO 182 K  ? PRO 181 K 1 -0.19 
23 TYR 103 L  . ? TYR 102 L PRO 104 L  ? PRO 103 L 1 1.10  
24 GLY 181 L  . ? GLY 180 L PRO 182 L  ? PRO 181 L 1 1.21  
25 TYR 103 M  . ? TYR 102 M PRO 104 M  ? PRO 103 M 1 1.90  
26 GLY 181 M  . ? GLY 180 M PRO 182 M  ? PRO 181 M 1 0.67  
27 TYR 103 N  . ? TYR 102 N PRO 104 N  ? PRO 103 N 1 3.16  
28 GLY 181 N  . ? GLY 180 N PRO 182 N  ? PRO 181 N 1 0.13  
29 TYR 103 O  . ? TYR 102 O PRO 104 O  ? PRO 103 O 1 2.57  
30 GLY 181 O  . ? GLY 180 O PRO 182 O  ? PRO 181 O 1 0.08  
31 TYR 103 P  . ? TYR 102 P PRO 104 P  ? PRO 103 P 1 3.34  
32 GLY 181 P  . ? GLY 180 P PRO 182 P  ? PRO 181 P 1 -0.20 
33 TYR 103 Q  . ? TYR 102 Q PRO 104 Q  ? PRO 103 Q 1 3.03  
34 GLY 181 Q  . ? GLY 180 Q PRO 182 Q  ? PRO 181 Q 1 0.63  
35 TYR 103 R  . ? TYR 102 R PRO 104 R  ? PRO 103 R 1 2.67  
36 GLY 181 R  . ? GLY 180 R PRO 182 R  ? PRO 181 R 1 0.63  
37 TYR 103 S  . ? TYR 102 S PRO 104 S  ? PRO 103 S 1 2.15  
38 GLY 181 S  . ? GLY 180 S PRO 182 S  ? PRO 181 S 1 0.86  
39 ILE 15  T  . ? ILE 14  T GLY 16  T  ? GLY 15  T 1 -3.50 
40 TYR 103 T  . ? TYR 102 T PRO 104 T  ? PRO 103 T 1 1.54  
41 GLY 181 T  . ? GLY 180 T PRO 182 T  ? PRO 181 T 1 -0.38 
42 TYR 103 U  . ? TYR 102 U PRO 104 U  ? PRO 103 U 1 2.44  
43 GLY 181 U  . ? GLY 180 U PRO 182 U  ? PRO 181 U 1 -0.10 
44 TYR 103 V  . ? TYR 102 V PRO 104 V  ? PRO 103 V 1 2.20  
45 GLY 181 V  . ? GLY 180 V PRO 182 V  ? PRO 181 V 1 -0.22 
46 TYR 103 W  . ? TYR 102 W PRO 104 W  ? PRO 103 W 1 2.07  
47 GLY 181 W  . ? GLY 180 W PRO 182 W  ? PRO 181 W 1 0.19  
48 TYR 103 X  . ? TYR 102 X PRO 104 X  ? PRO 103 X 1 2.38  
49 GLY 181 X  . ? GLY 180 X PRO 182 X  ? PRO 181 X 1 -0.41 
50 TYR 103 Y  . ? TYR 102 Y PRO 104 Y  ? PRO 103 Y 1 2.53  
51 GLY 181 Y  . ? GLY 180 Y PRO 182 Y  ? PRO 181 Y 1 0.07  
52 TYR 103 Z  . ? TYR 102 Z PRO 104 Z  ? PRO 103 Z 1 1.90  
53 GLY 181 Z  . ? GLY 180 Z PRO 182 Z  ? PRO 181 Z 1 0.88  
54 TYR 103 AA . ? TYR 102 a PRO 104 AA ? PRO 103 a 1 2.26  
55 GLY 181 AA . ? GLY 180 a PRO 182 AA ? PRO 181 a 1 0.59  
56 TYR 103 BA . ? TYR 102 b PRO 104 BA ? PRO 103 b 1 3.15  
57 GLY 181 BA . ? GLY 180 b PRO 182 BA ? PRO 181 b 1 1.12  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 5  ? 
B  ? 4  ? 
C  ? 5  ? 
D  ? 15 ? 
E  ? 2  ? 
F  ? 5  ? 
G  ? 4  ? 
H  ? 5  ? 
I  ? 2  ? 
J  ? 5  ? 
K  ? 4  ? 
L  ? 5  ? 
M  ? 2  ? 
N  ? 5  ? 
O  ? 4  ? 
P  ? 5  ? 
Q  ? 2  ? 
R  ? 5  ? 
S  ? 4  ? 
T  ? 5  ? 
U  ? 2  ? 
V  ? 5  ? 
W  ? 4  ? 
X  ? 5  ? 
Y  ? 2  ? 
Z  ? 5  ? 
AA ? 4  ? 
AB ? 5  ? 
AC ? 2  ? 
AD ? 5  ? 
AE ? 4  ? 
AF ? 5  ? 
AG ? 15 ? 
AH ? 2  ? 
AI ? 5  ? 
AJ ? 4  ? 
AK ? 5  ? 
AL ? 2  ? 
AM ? 5  ? 
AN ? 4  ? 
AO ? 5  ? 
AP ? 2  ? 
AQ ? 5  ? 
AR ? 4  ? 
AS ? 5  ? 
AT ? 2  ? 
AU ? 5  ? 
AV ? 4  ? 
AW ? 5  ? 
AX ? 2  ? 
AY ? 5  ? 
AZ ? 4  ? 
BA ? 5  ? 
BB ? 2  ? 
BC ? 5  ? 
BD ? 4  ? 
BE ? 5  ? 
BF ? 2  ? 
BG ? 5  ? 
BH ? 4  ? 
BI ? 5  ? 
BJ ? 15 ? 
BK ? 2  ? 
BL ? 5  ? 
BM ? 4  ? 
BN ? 5  ? 
BO ? 2  ? 
BP ? 5  ? 
BQ ? 4  ? 
BR ? 5  ? 
BS ? 2  ? 
BT ? 5  ? 
BU ? 4  ? 
BV ? 5  ? 
BW ? 2  ? 
BX ? 5  ? 
BY ? 4  ? 
BZ ? 5  ? 
CA ? 2  ? 
CB ? 5  ? 
CC ? 4  ? 
CD ? 5  ? 
CE ? 2  ? 
CF ? 5  ? 
CG ? 4  ? 
CH ? 5  ? 
CI ? 2  ? 
CJ ? 5  ? 
CK ? 4  ? 
CL ? 5  ? 
CM ? 15 ? 
CN ? 2  ? 
CO ? 5  ? 
CP ? 4  ? 
CQ ? 5  ? 
CR ? 2  ? 
CS ? 5  ? 
CT ? 4  ? 
CU ? 5  ? 
CV ? 2  ? 
CW ? 5  ? 
CX ? 4  ? 
CY ? 5  ? 
CZ ? 2  ? 
DA ? 5  ? 
DB ? 4  ? 
DC ? 5  ? 
DD ? 2  ? 
DE ? 5  ? 
DF ? 4  ? 
DG ? 5  ? 
DH ? 2  ? 
DI ? 5  ? 
DJ ? 4  ? 
DK ? 5  ? 
DL ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1  2  ? anti-parallel 
A  2  3  ? anti-parallel 
A  3  4  ? anti-parallel 
A  4  5  ? anti-parallel 
B  1  2  ? anti-parallel 
B  2  3  ? anti-parallel 
B  3  4  ? anti-parallel 
C  1  2  ? anti-parallel 
C  2  3  ? anti-parallel 
C  3  4  ? anti-parallel 
C  4  5  ? anti-parallel 
D  1  2  ? anti-parallel 
D  2  3  ? anti-parallel 
D  3  4  ? anti-parallel 
D  4  5  ? anti-parallel 
D  5  6  ? anti-parallel 
D  6  7  ? anti-parallel 
D  7  8  ? anti-parallel 
D  8  9  ? anti-parallel 
D  9  10 ? anti-parallel 
D  10 11 ? anti-parallel 
D  11 12 ? anti-parallel 
D  12 13 ? anti-parallel 
D  13 14 ? anti-parallel 
D  14 15 ? anti-parallel 
E  1  2  ? anti-parallel 
F  1  2  ? anti-parallel 
F  2  3  ? anti-parallel 
F  3  4  ? anti-parallel 
F  4  5  ? anti-parallel 
G  1  2  ? anti-parallel 
G  2  3  ? anti-parallel 
G  3  4  ? anti-parallel 
H  1  2  ? anti-parallel 
H  2  3  ? anti-parallel 
H  3  4  ? anti-parallel 
H  4  5  ? anti-parallel 
I  1  2  ? anti-parallel 
J  1  2  ? anti-parallel 
J  2  3  ? anti-parallel 
J  3  4  ? anti-parallel 
J  4  5  ? anti-parallel 
K  1  2  ? anti-parallel 
K  2  3  ? anti-parallel 
K  3  4  ? anti-parallel 
L  1  2  ? anti-parallel 
L  2  3  ? anti-parallel 
L  3  4  ? anti-parallel 
L  4  5  ? anti-parallel 
M  1  2  ? anti-parallel 
N  1  2  ? anti-parallel 
N  2  3  ? anti-parallel 
N  3  4  ? anti-parallel 
N  4  5  ? anti-parallel 
O  1  2  ? anti-parallel 
O  2  3  ? anti-parallel 
O  3  4  ? anti-parallel 
P  1  2  ? anti-parallel 
P  2  3  ? anti-parallel 
P  3  4  ? anti-parallel 
P  4  5  ? anti-parallel 
Q  1  2  ? anti-parallel 
R  1  2  ? anti-parallel 
R  2  3  ? anti-parallel 
R  3  4  ? anti-parallel 
R  4  5  ? anti-parallel 
S  1  2  ? anti-parallel 
S  2  3  ? anti-parallel 
S  3  4  ? anti-parallel 
T  1  2  ? anti-parallel 
T  2  3  ? anti-parallel 
T  3  4  ? anti-parallel 
T  4  5  ? anti-parallel 
U  1  2  ? anti-parallel 
V  1  2  ? anti-parallel 
V  2  3  ? anti-parallel 
V  3  4  ? anti-parallel 
V  4  5  ? anti-parallel 
W  1  2  ? anti-parallel 
W  2  3  ? anti-parallel 
W  3  4  ? anti-parallel 
X  1  2  ? anti-parallel 
X  2  3  ? anti-parallel 
X  3  4  ? anti-parallel 
X  4  5  ? anti-parallel 
Y  1  2  ? anti-parallel 
Z  1  2  ? anti-parallel 
Z  2  3  ? anti-parallel 
Z  3  4  ? anti-parallel 
Z  4  5  ? anti-parallel 
AA 1  2  ? anti-parallel 
AA 2  3  ? anti-parallel 
AA 3  4  ? anti-parallel 
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? anti-parallel 
AC 1  2  ? anti-parallel 
AD 1  2  ? anti-parallel 
AD 2  3  ? anti-parallel 
AD 3  4  ? anti-parallel 
AD 4  5  ? anti-parallel 
AE 1  2  ? anti-parallel 
AE 2  3  ? anti-parallel 
AE 3  4  ? anti-parallel 
AF 1  2  ? anti-parallel 
AF 2  3  ? anti-parallel 
AF 3  4  ? anti-parallel 
AF 4  5  ? anti-parallel 
AG 1  2  ? anti-parallel 
AG 2  3  ? anti-parallel 
AG 3  4  ? anti-parallel 
AG 4  5  ? anti-parallel 
AG 5  6  ? anti-parallel 
AG 6  7  ? anti-parallel 
AG 7  8  ? anti-parallel 
AG 8  9  ? anti-parallel 
AG 9  10 ? anti-parallel 
AG 10 11 ? anti-parallel 
AG 11 12 ? anti-parallel 
AG 12 13 ? anti-parallel 
AG 13 14 ? anti-parallel 
AG 14 15 ? anti-parallel 
AH 1  2  ? anti-parallel 
AI 1  2  ? anti-parallel 
AI 2  3  ? anti-parallel 
AI 3  4  ? anti-parallel 
AI 4  5  ? anti-parallel 
AJ 1  2  ? anti-parallel 
AJ 2  3  ? anti-parallel 
AJ 3  4  ? anti-parallel 
AK 1  2  ? anti-parallel 
AK 2  3  ? anti-parallel 
AK 3  4  ? anti-parallel 
AK 4  5  ? anti-parallel 
AL 1  2  ? anti-parallel 
AM 1  2  ? anti-parallel 
AM 2  3  ? anti-parallel 
AM 3  4  ? anti-parallel 
AM 4  5  ? anti-parallel 
AN 1  2  ? anti-parallel 
AN 2  3  ? anti-parallel 
AN 3  4  ? anti-parallel 
AO 1  2  ? anti-parallel 
AO 2  3  ? anti-parallel 
AO 3  4  ? anti-parallel 
AO 4  5  ? anti-parallel 
AP 1  2  ? anti-parallel 
AQ 1  2  ? anti-parallel 
AQ 2  3  ? anti-parallel 
AQ 3  4  ? anti-parallel 
AQ 4  5  ? anti-parallel 
AR 1  2  ? anti-parallel 
AR 2  3  ? anti-parallel 
AR 3  4  ? anti-parallel 
AS 1  2  ? anti-parallel 
AS 2  3  ? anti-parallel 
AS 3  4  ? anti-parallel 
AS 4  5  ? anti-parallel 
AT 1  2  ? anti-parallel 
AU 1  2  ? anti-parallel 
AU 2  3  ? anti-parallel 
AU 3  4  ? anti-parallel 
AU 4  5  ? anti-parallel 
AV 1  2  ? anti-parallel 
AV 2  3  ? anti-parallel 
AV 3  4  ? anti-parallel 
AW 1  2  ? anti-parallel 
AW 2  3  ? anti-parallel 
AW 3  4  ? anti-parallel 
AW 4  5  ? anti-parallel 
AX 1  2  ? anti-parallel 
AY 1  2  ? anti-parallel 
AY 2  3  ? anti-parallel 
AY 3  4  ? anti-parallel 
AY 4  5  ? anti-parallel 
AZ 1  2  ? anti-parallel 
AZ 2  3  ? anti-parallel 
AZ 3  4  ? anti-parallel 
BA 1  2  ? anti-parallel 
BA 2  3  ? anti-parallel 
BA 3  4  ? anti-parallel 
BA 4  5  ? anti-parallel 
BB 1  2  ? anti-parallel 
BC 1  2  ? anti-parallel 
BC 2  3  ? anti-parallel 
BC 3  4  ? anti-parallel 
BC 4  5  ? anti-parallel 
BD 1  2  ? anti-parallel 
BD 2  3  ? anti-parallel 
BD 3  4  ? anti-parallel 
BE 1  2  ? anti-parallel 
BE 2  3  ? anti-parallel 
BE 3  4  ? anti-parallel 
BE 4  5  ? anti-parallel 
BF 1  2  ? anti-parallel 
BG 1  2  ? anti-parallel 
BG 2  3  ? anti-parallel 
BG 3  4  ? anti-parallel 
BG 4  5  ? anti-parallel 
BH 1  2  ? anti-parallel 
BH 2  3  ? anti-parallel 
BH 3  4  ? anti-parallel 
BI 1  2  ? anti-parallel 
BI 2  3  ? anti-parallel 
BI 3  4  ? anti-parallel 
BI 4  5  ? anti-parallel 
BJ 1  2  ? anti-parallel 
BJ 2  3  ? anti-parallel 
BJ 3  4  ? anti-parallel 
BJ 4  5  ? anti-parallel 
BJ 5  6  ? anti-parallel 
BJ 6  7  ? anti-parallel 
BJ 7  8  ? anti-parallel 
BJ 8  9  ? anti-parallel 
BJ 9  10 ? anti-parallel 
BJ 10 11 ? anti-parallel 
BJ 11 12 ? anti-parallel 
BJ 12 13 ? anti-parallel 
BJ 13 14 ? anti-parallel 
BJ 14 15 ? anti-parallel 
BK 1  2  ? anti-parallel 
BL 1  2  ? anti-parallel 
BL 2  3  ? anti-parallel 
BL 3  4  ? anti-parallel 
BL 4  5  ? anti-parallel 
BM 1  2  ? anti-parallel 
BM 2  3  ? anti-parallel 
BM 3  4  ? anti-parallel 
BN 1  2  ? anti-parallel 
BN 2  3  ? anti-parallel 
BN 3  4  ? anti-parallel 
BN 4  5  ? anti-parallel 
BO 1  2  ? anti-parallel 
BP 1  2  ? anti-parallel 
BP 2  3  ? anti-parallel 
BP 3  4  ? anti-parallel 
BP 4  5  ? anti-parallel 
BQ 1  2  ? anti-parallel 
BQ 2  3  ? anti-parallel 
BQ 3  4  ? anti-parallel 
BR 1  2  ? anti-parallel 
BR 2  3  ? anti-parallel 
BR 3  4  ? anti-parallel 
BR 4  5  ? anti-parallel 
BS 1  2  ? anti-parallel 
BT 1  2  ? anti-parallel 
BT 2  3  ? anti-parallel 
BT 3  4  ? anti-parallel 
BT 4  5  ? anti-parallel 
BU 1  2  ? anti-parallel 
BU 2  3  ? anti-parallel 
BU 3  4  ? anti-parallel 
BV 1  2  ? anti-parallel 
BV 2  3  ? anti-parallel 
BV 3  4  ? anti-parallel 
BV 4  5  ? anti-parallel 
BW 1  2  ? anti-parallel 
BX 1  2  ? anti-parallel 
BX 2  3  ? anti-parallel 
BX 3  4  ? anti-parallel 
BX 4  5  ? anti-parallel 
BY 1  2  ? anti-parallel 
BY 2  3  ? anti-parallel 
BY 3  4  ? anti-parallel 
BZ 1  2  ? anti-parallel 
BZ 2  3  ? anti-parallel 
BZ 3  4  ? anti-parallel 
BZ 4  5  ? anti-parallel 
CA 1  2  ? anti-parallel 
CB 1  2  ? anti-parallel 
CB 2  3  ? anti-parallel 
CB 3  4  ? anti-parallel 
CB 4  5  ? anti-parallel 
CC 1  2  ? anti-parallel 
CC 2  3  ? anti-parallel 
CC 3  4  ? anti-parallel 
CD 1  2  ? anti-parallel 
CD 2  3  ? anti-parallel 
CD 3  4  ? anti-parallel 
CD 4  5  ? anti-parallel 
CE 1  2  ? anti-parallel 
CF 1  2  ? anti-parallel 
CF 2  3  ? anti-parallel 
CF 3  4  ? anti-parallel 
CF 4  5  ? anti-parallel 
CG 1  2  ? anti-parallel 
CG 2  3  ? anti-parallel 
CG 3  4  ? anti-parallel 
CH 1  2  ? anti-parallel 
CH 2  3  ? anti-parallel 
CH 3  4  ? anti-parallel 
CH 4  5  ? anti-parallel 
CI 1  2  ? anti-parallel 
CJ 1  2  ? anti-parallel 
CJ 2  3  ? anti-parallel 
CJ 3  4  ? anti-parallel 
CJ 4  5  ? anti-parallel 
CK 1  2  ? anti-parallel 
CK 2  3  ? anti-parallel 
CK 3  4  ? anti-parallel 
CL 1  2  ? anti-parallel 
CL 2  3  ? anti-parallel 
CL 3  4  ? anti-parallel 
CL 4  5  ? anti-parallel 
CM 1  2  ? anti-parallel 
CM 2  3  ? anti-parallel 
CM 3  4  ? anti-parallel 
CM 4  5  ? anti-parallel 
CM 5  6  ? anti-parallel 
CM 6  7  ? anti-parallel 
CM 7  8  ? anti-parallel 
CM 8  9  ? anti-parallel 
CM 9  10 ? anti-parallel 
CM 10 11 ? anti-parallel 
CM 11 12 ? anti-parallel 
CM 12 13 ? anti-parallel 
CM 13 14 ? anti-parallel 
CM 14 15 ? anti-parallel 
CN 1  2  ? anti-parallel 
CO 1  2  ? anti-parallel 
CO 2  3  ? anti-parallel 
CO 3  4  ? anti-parallel 
CO 4  5  ? anti-parallel 
CP 1  2  ? anti-parallel 
CP 2  3  ? anti-parallel 
CP 3  4  ? anti-parallel 
CQ 1  2  ? anti-parallel 
CQ 2  3  ? anti-parallel 
CQ 3  4  ? anti-parallel 
CQ 4  5  ? anti-parallel 
CR 1  2  ? anti-parallel 
CS 1  2  ? anti-parallel 
CS 2  3  ? anti-parallel 
CS 3  4  ? anti-parallel 
CS 4  5  ? anti-parallel 
CT 1  2  ? anti-parallel 
CT 2  3  ? anti-parallel 
CT 3  4  ? anti-parallel 
CU 1  2  ? anti-parallel 
CU 2  3  ? anti-parallel 
CU 3  4  ? anti-parallel 
CU 4  5  ? anti-parallel 
CV 1  2  ? anti-parallel 
CW 1  2  ? anti-parallel 
CW 2  3  ? anti-parallel 
CW 3  4  ? anti-parallel 
CW 4  5  ? anti-parallel 
CX 1  2  ? anti-parallel 
CX 2  3  ? anti-parallel 
CX 3  4  ? anti-parallel 
CY 1  2  ? anti-parallel 
CY 2  3  ? anti-parallel 
CY 3  4  ? anti-parallel 
CY 4  5  ? anti-parallel 
CZ 1  2  ? anti-parallel 
DA 1  2  ? anti-parallel 
DA 2  3  ? anti-parallel 
DA 3  4  ? anti-parallel 
DA 4  5  ? anti-parallel 
DB 1  2  ? anti-parallel 
DB 2  3  ? anti-parallel 
DB 3  4  ? anti-parallel 
DC 1  2  ? anti-parallel 
DC 2  3  ? anti-parallel 
DC 3  4  ? anti-parallel 
DC 4  5  ? anti-parallel 
DD 1  2  ? anti-parallel 
DE 1  2  ? anti-parallel 
DE 2  3  ? anti-parallel 
DE 3  4  ? anti-parallel 
DE 4  5  ? anti-parallel 
DF 1  2  ? anti-parallel 
DF 2  3  ? anti-parallel 
DF 3  4  ? anti-parallel 
DG 1  2  ? anti-parallel 
DG 2  3  ? anti-parallel 
DG 3  4  ? anti-parallel 
DG 4  5  ? anti-parallel 
DH 1  2  ? anti-parallel 
DI 1  2  ? anti-parallel 
DI 2  3  ? anti-parallel 
DI 3  4  ? anti-parallel 
DI 4  5  ? anti-parallel 
DJ 1  2  ? anti-parallel 
DJ 2  3  ? anti-parallel 
DJ 3  4  ? anti-parallel 
DK 1  2  ? anti-parallel 
DK 2  3  ? anti-parallel 
DK 3  4  ? anti-parallel 
DK 4  5  ? anti-parallel 
DL 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1  LYS A  22  ? ASP A  30  ? LYS A 21  ASP A 29  
A  2  MET A  35  ? ILE A  44  ? MET A 34  ILE A 43  
A  3  LYS A  52  ? ILE A  62  ? LYS A 51  ILE A 61  
A  4  PHE A  229 ? MET A  235 ? PHE A 228 MET A 234 
A  5  GLN A  98  ? TYR A  103 ? GLN A 97  TYR A 102 
B  1  ARG A  67  ? GLU A  71  ? ARG A 66  GLU A 70  
B  2  LYS A  76  ? GLN A  90  ? LYS A 75  GLN A 89  
B  3  LYS A  165 ? PHE A  172 ? LYS A 164 PHE A 171 
B  4  PHE A  154 ? LEU A  158 ? PHE A 153 LEU A 157 
C  1  ARG A  67  ? GLU A  71  ? ARG A 66  GLU A 70  
C  2  LYS A  76  ? GLN A  90  ? LYS A 75  GLN A 89  
C  3  GLN A  243 ? TRP A  261 ? GLN A 242 TRP A 260 
C  4  TRP A  266 ? ASP A  286 ? TRP A 265 ASP A 285 
C  5  GLU A  291 ? ASN A  294 ? GLU A 290 ASN A 293 
D  1  THR A  110 ? ASP A  128 ? THR A 109 ASP A 127 
D  2  ILE A  133 ? PRO A  152 ? ILE A 132 PRO A 151 
D  3  THR G  110 ? GLY G  127 ? THR G 109 GLY G 126 
D  4  ILE G  133 ? PRO G  152 ? ILE G 132 PRO G 151 
D  5  THR F  110 ? ASP F  128 ? THR F 109 ASP F 127 
D  6  ILE F  133 ? PRO F  152 ? ILE F 132 PRO F 151 
D  7  THR E  110 ? ASP E  128 ? THR E 109 ASP E 127 
D  8  ILE E  133 ? PRO E  152 ? ILE E 132 PRO E 151 
D  9  THR D  110 ? ASP D  128 ? THR D 109 ASP D 127 
D  10 ILE D  133 ? PRO D  152 ? ILE D 132 PRO D 151 
D  11 THR C  110 ? ASP C  128 ? THR C 109 ASP C 127 
D  12 ILE C  133 ? PRO C  152 ? ILE C 132 PRO C 151 
D  13 THR B  110 ? ASP B  128 ? THR B 109 ASP B 127 
D  14 ILE B  133 ? PRO B  152 ? ILE B 132 PRO B 151 
D  15 THR A  110 ? ASP A  128 ? THR A 109 ASP A 127 
E  1  MET A  175 ? ASN A  177 ? MET A 174 ASN A 176 
E  2  TRP A  180 ? TYR A  183 ? TRP A 179 TYR A 182 
F  1  LYS B  22  ? ASP B  30  ? LYS B 21  ASP B 29  
F  2  MET B  35  ? ILE B  44  ? MET B 34  ILE B 43  
F  3  LYS B  52  ? ILE B  62  ? LYS B 51  ILE B 61  
F  4  PHE B  229 ? MET B  235 ? PHE B 228 MET B 234 
F  5  GLN B  98  ? TYR B  103 ? GLN B 97  TYR B 102 
G  1  ARG B  67  ? GLU B  71  ? ARG B 66  GLU B 70  
G  2  LYS B  76  ? GLN B  90  ? LYS B 75  GLN B 89  
G  3  LYS B  165 ? PHE B  172 ? LYS B 164 PHE B 171 
G  4  PHE B  154 ? LEU B  158 ? PHE B 153 LEU B 157 
H  1  ARG B  67  ? GLU B  71  ? ARG B 66  GLU B 70  
H  2  LYS B  76  ? GLN B  90  ? LYS B 75  GLN B 89  
H  3  GLN B  243 ? TRP B  261 ? GLN B 242 TRP B 260 
H  4  TRP B  266 ? ASP B  286 ? TRP B 265 ASP B 285 
H  5  GLU B  291 ? ASN B  294 ? GLU B 290 ASN B 293 
I  1  MET B  175 ? ASN B  177 ? MET B 174 ASN B 176 
I  2  TRP B  180 ? TYR B  183 ? TRP B 179 TYR B 182 
J  1  LYS C  22  ? ASP C  30  ? LYS C 21  ASP C 29  
J  2  MET C  35  ? ILE C  44  ? MET C 34  ILE C 43  
J  3  LYS C  52  ? ILE C  62  ? LYS C 51  ILE C 61  
J  4  PHE C  229 ? MET C  235 ? PHE C 228 MET C 234 
J  5  GLN C  98  ? TYR C  103 ? GLN C 97  TYR C 102 
K  1  ARG C  67  ? GLU C  71  ? ARG C 66  GLU C 70  
K  2  LYS C  76  ? GLN C  90  ? LYS C 75  GLN C 89  
K  3  LYS C  165 ? PHE C  172 ? LYS C 164 PHE C 171 
K  4  PHE C  154 ? LEU C  158 ? PHE C 153 LEU C 157 
L  1  ARG C  67  ? GLU C  71  ? ARG C 66  GLU C 70  
L  2  LYS C  76  ? GLN C  90  ? LYS C 75  GLN C 89  
L  3  GLN C  243 ? TRP C  261 ? GLN C 242 TRP C 260 
L  4  TRP C  266 ? ASP C  286 ? TRP C 265 ASP C 285 
L  5  GLU C  291 ? ASN C  294 ? GLU C 290 ASN C 293 
M  1  MET C  175 ? ASN C  177 ? MET C 174 ASN C 176 
M  2  TRP C  180 ? TYR C  183 ? TRP C 179 TYR C 182 
N  1  LYS D  22  ? ASP D  30  ? LYS D 21  ASP D 29  
N  2  MET D  35  ? ILE D  44  ? MET D 34  ILE D 43  
N  3  LYS D  52  ? ILE D  62  ? LYS D 51  ILE D 61  
N  4  PHE D  229 ? MET D  235 ? PHE D 228 MET D 234 
N  5  GLN D  98  ? TYR D  103 ? GLN D 97  TYR D 102 
O  1  ARG D  67  ? SER D  70  ? ARG D 66  SER D 69  
O  2  LYS D  76  ? GLN D  90  ? LYS D 75  GLN D 89  
O  3  LYS D  165 ? PHE D  172 ? LYS D 164 PHE D 171 
O  4  PHE D  154 ? LEU D  158 ? PHE D 153 LEU D 157 
P  1  ARG D  67  ? SER D  70  ? ARG D 66  SER D 69  
P  2  LYS D  76  ? GLN D  90  ? LYS D 75  GLN D 89  
P  3  GLN D  243 ? TRP D  261 ? GLN D 242 TRP D 260 
P  4  TRP D  266 ? ASP D  286 ? TRP D 265 ASP D 285 
P  5  GLU D  291 ? ASN D  294 ? GLU D 290 ASN D 293 
Q  1  MET D  175 ? ASN D  177 ? MET D 174 ASN D 176 
Q  2  TRP D  180 ? TYR D  183 ? TRP D 179 TYR D 182 
R  1  LYS E  22  ? ASP E  30  ? LYS E 21  ASP E 29  
R  2  MET E  35  ? ILE E  44  ? MET E 34  ILE E 43  
R  3  LYS E  52  ? ILE E  62  ? LYS E 51  ILE E 61  
R  4  PHE E  229 ? MET E  235 ? PHE E 228 MET E 234 
R  5  GLN E  98  ? TYR E  103 ? GLN E 97  TYR E 102 
S  1  ARG E  67  ? GLY E  73  ? ARG E 66  GLY E 72  
S  2  LYS E  76  ? GLN E  90  ? LYS E 75  GLN E 89  
S  3  LYS E  165 ? PHE E  172 ? LYS E 164 PHE E 171 
S  4  PHE E  154 ? LEU E  158 ? PHE E 153 LEU E 157 
T  1  ARG E  67  ? GLY E  73  ? ARG E 66  GLY E 72  
T  2  LYS E  76  ? GLN E  90  ? LYS E 75  GLN E 89  
T  3  GLN E  243 ? TRP E  261 ? GLN E 242 TRP E 260 
T  4  TRP E  266 ? ASP E  286 ? TRP E 265 ASP E 285 
T  5  GLU E  291 ? ASN E  294 ? GLU E 290 ASN E 293 
U  1  MET E  175 ? ASN E  177 ? MET E 174 ASN E 176 
U  2  TRP E  180 ? TYR E  183 ? TRP E 179 TYR E 182 
V  1  LYS F  22  ? ASP F  30  ? LYS F 21  ASP F 29  
V  2  MET F  35  ? ILE F  44  ? MET F 34  ILE F 43  
V  3  LYS F  52  ? ILE F  62  ? LYS F 51  ILE F 61  
V  4  PHE F  229 ? MET F  235 ? PHE F 228 MET F 234 
V  5  GLN F  98  ? TYR F  103 ? GLN F 97  TYR F 102 
W  1  ARG F  67  ? GLU F  71  ? ARG F 66  GLU F 70  
W  2  LYS F  76  ? GLN F  90  ? LYS F 75  GLN F 89  
W  3  LYS F  165 ? PHE F  172 ? LYS F 164 PHE F 171 
W  4  PHE F  154 ? LEU F  158 ? PHE F 153 LEU F 157 
X  1  ARG F  67  ? GLU F  71  ? ARG F 66  GLU F 70  
X  2  LYS F  76  ? GLN F  90  ? LYS F 75  GLN F 89  
X  3  GLN F  243 ? TRP F  261 ? GLN F 242 TRP F 260 
X  4  TRP F  266 ? ASP F  286 ? TRP F 265 ASP F 285 
X  5  GLU F  291 ? ASN F  294 ? GLU F 290 ASN F 293 
Y  1  MET F  175 ? ASN F  177 ? MET F 174 ASN F 176 
Y  2  TRP F  180 ? TYR F  183 ? TRP F 179 TYR F 182 
Z  1  LYS G  22  ? ASP G  30  ? LYS G 21  ASP G 29  
Z  2  MET G  35  ? ILE G  44  ? MET G 34  ILE G 43  
Z  3  LYS G  52  ? ILE G  62  ? LYS G 51  ILE G 61  
Z  4  PHE G  229 ? MET G  235 ? PHE G 228 MET G 234 
Z  5  GLN G  98  ? TYR G  103 ? GLN G 97  TYR G 102 
AA 1  ARG G  67  ? GLU G  71  ? ARG G 66  GLU G 70  
AA 2  LYS G  76  ? GLN G  90  ? LYS G 75  GLN G 89  
AA 3  LYS G  165 ? PHE G  172 ? LYS G 164 PHE G 171 
AA 4  PHE G  154 ? LEU G  158 ? PHE G 153 LEU G 157 
AB 1  ARG G  67  ? GLU G  71  ? ARG G 66  GLU G 70  
AB 2  LYS G  76  ? GLN G  90  ? LYS G 75  GLN G 89  
AB 3  GLN G  243 ? TRP G  261 ? GLN G 242 TRP G 260 
AB 4  TRP G  266 ? ASP G  286 ? TRP G 265 ASP G 285 
AB 5  GLU G  291 ? ASN G  294 ? GLU G 290 ASN G 293 
AC 1  MET G  175 ? ASN G  177 ? MET G 174 ASN G 176 
AC 2  TRP G  180 ? TYR G  183 ? TRP G 179 TYR G 182 
AD 1  LYS H  22  ? ASP H  30  ? LYS H 21  ASP H 29  
AD 2  MET H  35  ? ILE H  44  ? MET H 34  ILE H 43  
AD 3  LYS H  52  ? ILE H  62  ? LYS H 51  ILE H 61  
AD 4  PHE H  229 ? MET H  235 ? PHE H 228 MET H 234 
AD 5  GLN H  98  ? TYR H  103 ? GLN H 97  TYR H 102 
AE 1  ARG H  67  ? GLU H  71  ? ARG H 66  GLU H 70  
AE 2  LYS H  76  ? GLN H  90  ? LYS H 75  GLN H 89  
AE 3  LYS H  165 ? PHE H  172 ? LYS H 164 PHE H 171 
AE 4  PHE H  154 ? LEU H  158 ? PHE H 153 LEU H 157 
AF 1  ARG H  67  ? GLU H  71  ? ARG H 66  GLU H 70  
AF 2  LYS H  76  ? GLN H  90  ? LYS H 75  GLN H 89  
AF 3  GLN H  243 ? TRP H  261 ? GLN H 242 TRP H 260 
AF 4  TRP H  266 ? ASP H  286 ? TRP H 265 ASP H 285 
AF 5  GLU H  291 ? ASN H  294 ? GLU H 290 ASN H 293 
AG 1  THR H  110 ? ASP H  128 ? THR H 109 ASP H 127 
AG 2  ILE H  133 ? PRO H  152 ? ILE H 132 PRO H 151 
AG 3  THR N  110 ? ASP N  128 ? THR N 109 ASP N 127 
AG 4  ILE N  133 ? PRO N  152 ? ILE N 132 PRO N 151 
AG 5  THR M  110 ? ASP M  128 ? THR M 109 ASP M 127 
AG 6  ILE M  133 ? PRO M  152 ? ILE M 132 PRO M 151 
AG 7  THR L  110 ? ASP L  128 ? THR L 109 ASP L 127 
AG 8  ILE L  133 ? PRO L  152 ? ILE L 132 PRO L 151 
AG 9  THR K  110 ? ASP K  128 ? THR K 109 ASP K 127 
AG 10 ILE K  133 ? PRO K  152 ? ILE K 132 PRO K 151 
AG 11 THR J  110 ? ASP J  128 ? THR J 109 ASP J 127 
AG 12 ILE J  133 ? PRO J  152 ? ILE J 132 PRO J 151 
AG 13 THR I  110 ? ASP I  128 ? THR I 109 ASP I 127 
AG 14 ILE I  133 ? PRO I  152 ? ILE I 132 PRO I 151 
AG 15 THR H  110 ? ASP H  128 ? THR H 109 ASP H 127 
AH 1  MET H  175 ? ASN H  177 ? MET H 174 ASN H 176 
AH 2  TRP H  180 ? TYR H  183 ? TRP H 179 TYR H 182 
AI 1  LYS I  22  ? ASP I  30  ? LYS I 21  ASP I 29  
AI 2  MET I  35  ? ILE I  44  ? MET I 34  ILE I 43  
AI 3  LYS I  52  ? ILE I  62  ? LYS I 51  ILE I 61  
AI 4  PHE I  229 ? MET I  235 ? PHE I 228 MET I 234 
AI 5  GLN I  98  ? TYR I  103 ? GLN I 97  TYR I 102 
AJ 1  ARG I  67  ? GLU I  71  ? ARG I 66  GLU I 70  
AJ 2  LYS I  76  ? GLN I  90  ? LYS I 75  GLN I 89  
AJ 3  LYS I  165 ? PHE I  172 ? LYS I 164 PHE I 171 
AJ 4  PHE I  154 ? LEU I  158 ? PHE I 153 LEU I 157 
AK 1  ARG I  67  ? GLU I  71  ? ARG I 66  GLU I 70  
AK 2  LYS I  76  ? GLN I  90  ? LYS I 75  GLN I 89  
AK 3  GLN I  243 ? TRP I  261 ? GLN I 242 TRP I 260 
AK 4  TRP I  266 ? ASP I  286 ? TRP I 265 ASP I 285 
AK 5  GLU I  291 ? ASN I  294 ? GLU I 290 ASN I 293 
AL 1  MET I  175 ? ASN I  177 ? MET I 174 ASN I 176 
AL 2  TRP I  180 ? TYR I  183 ? TRP I 179 TYR I 182 
AM 1  LYS J  22  ? ASP J  30  ? LYS J 21  ASP J 29  
AM 2  MET J  35  ? ILE J  44  ? MET J 34  ILE J 43  
AM 3  LYS J  52  ? ILE J  62  ? LYS J 51  ILE J 61  
AM 4  PHE J  229 ? MET J  235 ? PHE J 228 MET J 234 
AM 5  GLN J  98  ? TYR J  103 ? GLN J 97  TYR J 102 
AN 1  ARG J  67  ? GLU J  71  ? ARG J 66  GLU J 70  
AN 2  LYS J  76  ? GLN J  90  ? LYS J 75  GLN J 89  
AN 3  LYS J  165 ? PHE J  172 ? LYS J 164 PHE J 171 
AN 4  PHE J  154 ? LEU J  158 ? PHE J 153 LEU J 157 
AO 1  ARG J  67  ? GLU J  71  ? ARG J 66  GLU J 70  
AO 2  LYS J  76  ? GLN J  90  ? LYS J 75  GLN J 89  
AO 3  GLN J  243 ? TRP J  261 ? GLN J 242 TRP J 260 
AO 4  TRP J  266 ? ASP J  286 ? TRP J 265 ASP J 285 
AO 5  GLU J  291 ? ASN J  294 ? GLU J 290 ASN J 293 
AP 1  MET J  175 ? ASN J  177 ? MET J 174 ASN J 176 
AP 2  TRP J  180 ? TYR J  183 ? TRP J 179 TYR J 182 
AQ 1  LYS K  22  ? ASP K  30  ? LYS K 21  ASP K 29  
AQ 2  MET K  35  ? ILE K  44  ? MET K 34  ILE K 43  
AQ 3  LYS K  52  ? ILE K  62  ? LYS K 51  ILE K 61  
AQ 4  PHE K  229 ? MET K  235 ? PHE K 228 MET K 234 
AQ 5  GLN K  98  ? TYR K  103 ? GLN K 97  TYR K 102 
AR 1  ARG K  67  ? SER K  70  ? ARG K 66  SER K 69  
AR 2  LYS K  76  ? GLN K  90  ? LYS K 75  GLN K 89  
AR 3  LYS K  165 ? PHE K  172 ? LYS K 164 PHE K 171 
AR 4  PHE K  154 ? LEU K  158 ? PHE K 153 LEU K 157 
AS 1  ARG K  67  ? SER K  70  ? ARG K 66  SER K 69  
AS 2  LYS K  76  ? GLN K  90  ? LYS K 75  GLN K 89  
AS 3  GLN K  243 ? TRP K  261 ? GLN K 242 TRP K 260 
AS 4  TRP K  266 ? ASP K  286 ? TRP K 265 ASP K 285 
AS 5  GLU K  291 ? ASN K  294 ? GLU K 290 ASN K 293 
AT 1  MET K  175 ? ASN K  177 ? MET K 174 ASN K 176 
AT 2  TRP K  180 ? TYR K  183 ? TRP K 179 TYR K 182 
AU 1  LYS L  22  ? ASP L  30  ? LYS L 21  ASP L 29  
AU 2  MET L  35  ? ILE L  44  ? MET L 34  ILE L 43  
AU 3  LYS L  52  ? ILE L  62  ? LYS L 51  ILE L 61  
AU 4  PHE L  229 ? MET L  235 ? PHE L 228 MET L 234 
AU 5  GLN L  98  ? TYR L  103 ? GLN L 97  TYR L 102 
AV 1  ARG L  67  ? VAL L  68  ? ARG L 66  VAL L 67  
AV 2  LYS L  76  ? GLN L  90  ? LYS L 75  GLN L 89  
AV 3  LYS L  165 ? PHE L  172 ? LYS L 164 PHE L 171 
AV 4  PHE L  154 ? LEU L  158 ? PHE L 153 LEU L 157 
AW 1  ARG L  67  ? VAL L  68  ? ARG L 66  VAL L 67  
AW 2  LYS L  76  ? GLN L  90  ? LYS L 75  GLN L 89  
AW 3  GLN L  243 ? TRP L  261 ? GLN L 242 TRP L 260 
AW 4  TRP L  266 ? ASP L  286 ? TRP L 265 ASP L 285 
AW 5  GLU L  291 ? ASN L  294 ? GLU L 290 ASN L 293 
AX 1  MET L  175 ? ASN L  177 ? MET L 174 ASN L 176 
AX 2  TRP L  180 ? TYR L  183 ? TRP L 179 TYR L 182 
AY 1  LYS M  22  ? ASP M  30  ? LYS M 21  ASP M 29  
AY 2  MET M  35  ? ILE M  44  ? MET M 34  ILE M 43  
AY 3  LYS M  52  ? ILE M  62  ? LYS M 51  ILE M 61  
AY 4  PHE M  229 ? MET M  235 ? PHE M 228 MET M 234 
AY 5  GLN M  98  ? TYR M  103 ? GLN M 97  TYR M 102 
AZ 1  ARG M  67  ? SER M  70  ? ARG M 66  SER M 69  
AZ 2  LYS M  76  ? GLN M  90  ? LYS M 75  GLN M 89  
AZ 3  LYS M  165 ? PHE M  172 ? LYS M 164 PHE M 171 
AZ 4  PHE M  154 ? LEU M  158 ? PHE M 153 LEU M 157 
BA 1  ARG M  67  ? SER M  70  ? ARG M 66  SER M 69  
BA 2  LYS M  76  ? GLN M  90  ? LYS M 75  GLN M 89  
BA 3  GLN M  243 ? TRP M  261 ? GLN M 242 TRP M 260 
BA 4  TRP M  266 ? ASP M  286 ? TRP M 265 ASP M 285 
BA 5  GLU M  291 ? ASN M  294 ? GLU M 290 ASN M 293 
BB 1  MET M  175 ? ASN M  177 ? MET M 174 ASN M 176 
BB 2  TRP M  180 ? TYR M  183 ? TRP M 179 TYR M 182 
BC 1  LYS N  22  ? ASP N  30  ? LYS N 21  ASP N 29  
BC 2  MET N  35  ? ILE N  44  ? MET N 34  ILE N 43  
BC 3  LYS N  52  ? ILE N  62  ? LYS N 51  ILE N 61  
BC 4  PHE N  229 ? MET N  235 ? PHE N 228 MET N 234 
BC 5  GLN N  98  ? TYR N  103 ? GLN N 97  TYR N 102 
BD 1  ARG N  67  ? GLU N  71  ? ARG N 66  GLU N 70  
BD 2  LYS N  76  ? GLN N  90  ? LYS N 75  GLN N 89  
BD 3  LYS N  165 ? PHE N  172 ? LYS N 164 PHE N 171 
BD 4  PHE N  154 ? GLU N  159 ? PHE N 153 GLU N 158 
BE 1  ARG N  67  ? GLU N  71  ? ARG N 66  GLU N 70  
BE 2  LYS N  76  ? GLN N  90  ? LYS N 75  GLN N 89  
BE 3  GLN N  243 ? TRP N  261 ? GLN N 242 TRP N 260 
BE 4  TRP N  266 ? ASP N  286 ? TRP N 265 ASP N 285 
BE 5  GLU N  291 ? ASN N  294 ? GLU N 290 ASN N 293 
BF 1  MET N  175 ? ASN N  177 ? MET N 174 ASN N 176 
BF 2  TRP N  180 ? TYR N  183 ? TRP N 179 TYR N 182 
BG 1  LYS O  22  ? ASP O  30  ? LYS O 21  ASP O 29  
BG 2  MET O  35  ? ILE O  44  ? MET O 34  ILE O 43  
BG 3  LYS O  52  ? ILE O  62  ? LYS O 51  ILE O 61  
BG 4  PHE O  229 ? MET O  235 ? PHE O 228 MET O 234 
BG 5  GLN O  98  ? TYR O  103 ? GLN O 97  TYR O 102 
BH 1  ARG O  67  ? SER O  70  ? ARG O 66  SER O 69  
BH 2  LYS O  76  ? GLN O  90  ? LYS O 75  GLN O 89  
BH 3  LYS O  165 ? PHE O  172 ? LYS O 164 PHE O 171 
BH 4  PHE O  154 ? LEU O  158 ? PHE O 153 LEU O 157 
BI 1  ARG O  67  ? SER O  70  ? ARG O 66  SER O 69  
BI 2  LYS O  76  ? GLN O  90  ? LYS O 75  GLN O 89  
BI 3  GLN O  243 ? TRP O  261 ? GLN O 242 TRP O 260 
BI 4  TRP O  266 ? ASP O  286 ? TRP O 265 ASP O 285 
BI 5  GLU O  291 ? ASN O  294 ? GLU O 290 ASN O 293 
BJ 1  THR O  110 ? ASP O  128 ? THR O 109 ASP O 127 
BJ 2  ILE O  133 ? PRO O  152 ? ILE O 132 PRO O 151 
BJ 3  THR U  110 ? ASP U  128 ? THR U 109 ASP U 127 
BJ 4  ILE U  133 ? PRO U  152 ? ILE U 132 PRO U 151 
BJ 5  THR T  110 ? ASP T  128 ? THR T 109 ASP T 127 
BJ 6  ILE T  133 ? PRO T  152 ? ILE T 132 PRO T 151 
BJ 7  THR S  110 ? ASP S  128 ? THR S 109 ASP S 127 
BJ 8  GLY S  134 ? PRO S  152 ? GLY S 133 PRO S 151 
BJ 9  THR R  110 ? ASP R  128 ? THR R 109 ASP R 127 
BJ 10 ILE R  133 ? PRO R  152 ? ILE R 132 PRO R 151 
BJ 11 THR Q  110 ? GLY Q  127 ? THR Q 109 GLY Q 126 
BJ 12 ILE Q  133 ? PRO Q  152 ? ILE Q 132 PRO Q 151 
BJ 13 THR P  110 ? ASP P  128 ? THR P 109 ASP P 127 
BJ 14 ILE P  133 ? PRO P  152 ? ILE P 132 PRO P 151 
BJ 15 THR O  110 ? ASP O  128 ? THR O 109 ASP O 127 
BK 1  MET O  175 ? ASN O  177 ? MET O 174 ASN O 176 
BK 2  TRP O  180 ? TYR O  183 ? TRP O 179 TYR O 182 
BL 1  LYS P  22  ? ASP P  30  ? LYS P 21  ASP P 29  
BL 2  MET P  35  ? ILE P  44  ? MET P 34  ILE P 43  
BL 3  LYS P  52  ? ILE P  62  ? LYS P 51  ILE P 61  
BL 4  PHE P  229 ? MET P  235 ? PHE P 228 MET P 234 
BL 5  GLN P  98  ? TYR P  103 ? GLN P 97  TYR P 102 
BM 1  ARG P  67  ? SER P  70  ? ARG P 66  SER P 69  
BM 2  LYS P  76  ? GLN P  90  ? LYS P 75  GLN P 89  
BM 3  LYS P  165 ? PHE P  172 ? LYS P 164 PHE P 171 
BM 4  PHE P  154 ? LEU P  158 ? PHE P 153 LEU P 157 
BN 1  ARG P  67  ? SER P  70  ? ARG P 66  SER P 69  
BN 2  LYS P  76  ? GLN P  90  ? LYS P 75  GLN P 89  
BN 3  GLN P  243 ? TRP P  261 ? GLN P 242 TRP P 260 
BN 4  TRP P  266 ? ASP P  286 ? TRP P 265 ASP P 285 
BN 5  GLU P  291 ? ASN P  294 ? GLU P 290 ASN P 293 
BO 1  MET P  175 ? ASN P  177 ? MET P 174 ASN P 176 
BO 2  TRP P  180 ? TYR P  183 ? TRP P 179 TYR P 182 
BP 1  LYS Q  22  ? ASP Q  30  ? LYS Q 21  ASP Q 29  
BP 2  MET Q  35  ? ILE Q  44  ? MET Q 34  ILE Q 43  
BP 3  LYS Q  52  ? ILE Q  62  ? LYS Q 51  ILE Q 61  
BP 4  PHE Q  229 ? MET Q  235 ? PHE Q 228 MET Q 234 
BP 5  GLN Q  98  ? TYR Q  103 ? GLN Q 97  TYR Q 102 
BQ 1  ARG Q  67  ? SER Q  70  ? ARG Q 66  SER Q 69  
BQ 2  LYS Q  76  ? GLN Q  90  ? LYS Q 75  GLN Q 89  
BQ 3  LYS Q  165 ? PHE Q  172 ? LYS Q 164 PHE Q 171 
BQ 4  PHE Q  154 ? LEU Q  158 ? PHE Q 153 LEU Q 157 
BR 1  ARG Q  67  ? SER Q  70  ? ARG Q 66  SER Q 69  
BR 2  LYS Q  76  ? GLN Q  90  ? LYS Q 75  GLN Q 89  
BR 3  GLN Q  243 ? TRP Q  261 ? GLN Q 242 TRP Q 260 
BR 4  TRP Q  266 ? ASP Q  286 ? TRP Q 265 ASP Q 285 
BR 5  GLU Q  291 ? ASN Q  294 ? GLU Q 290 ASN Q 293 
BS 1  MET Q  175 ? ASN Q  177 ? MET Q 174 ASN Q 176 
BS 2  TRP Q  180 ? TYR Q  183 ? TRP Q 179 TYR Q 182 
BT 1  LYS R  22  ? ASP R  30  ? LYS R 21  ASP R 29  
BT 2  MET R  35  ? ILE R  44  ? MET R 34  ILE R 43  
BT 3  LYS R  52  ? ILE R  62  ? LYS R 51  ILE R 61  
BT 4  PHE R  229 ? MET R  235 ? PHE R 228 MET R 234 
BT 5  GLN R  98  ? TYR R  103 ? GLN R 97  TYR R 102 
BU 1  ARG R  67  ? GLU R  71  ? ARG R 66  GLU R 70  
BU 2  LYS R  76  ? GLN R  90  ? LYS R 75  GLN R 89  
BU 3  LYS R  165 ? PHE R  172 ? LYS R 164 PHE R 171 
BU 4  PHE R  154 ? GLU R  159 ? PHE R 153 GLU R 158 
BV 1  ARG R  67  ? GLU R  71  ? ARG R 66  GLU R 70  
BV 2  LYS R  76  ? GLN R  90  ? LYS R 75  GLN R 89  
BV 3  GLN R  243 ? TRP R  261 ? GLN R 242 TRP R 260 
BV 4  TRP R  266 ? ASP R  286 ? TRP R 265 ASP R 285 
BV 5  GLU R  291 ? ASN R  294 ? GLU R 290 ASN R 293 
BW 1  MET R  175 ? ASN R  177 ? MET R 174 ASN R 176 
BW 2  TRP R  180 ? TYR R  183 ? TRP R 179 TYR R 182 
BX 1  LYS S  22  ? ASP S  30  ? LYS S 21  ASP S 29  
BX 2  MET S  35  ? ILE S  44  ? MET S 34  ILE S 43  
BX 3  LYS S  52  ? ILE S  62  ? LYS S 51  ILE S 61  
BX 4  PHE S  229 ? MET S  235 ? PHE S 228 MET S 234 
BX 5  GLN S  98  ? TYR S  103 ? GLN S 97  TYR S 102 
BY 1  ARG S  67  ? GLU S  72  ? ARG S 66  GLU S 71  
BY 2  LYS S  76  ? GLN S  90  ? LYS S 75  GLN S 89  
BY 3  LYS S  165 ? PHE S  172 ? LYS S 164 PHE S 171 
BY 4  PHE S  154 ? LEU S  158 ? PHE S 153 LEU S 157 
BZ 1  ARG S  67  ? GLU S  72  ? ARG S 66  GLU S 71  
BZ 2  LYS S  76  ? GLN S  90  ? LYS S 75  GLN S 89  
BZ 3  GLN S  243 ? TRP S  261 ? GLN S 242 TRP S 260 
BZ 4  TRP S  266 ? ASP S  286 ? TRP S 265 ASP S 285 
BZ 5  GLU S  291 ? ASN S  294 ? GLU S 290 ASN S 293 
CA 1  MET S  175 ? ASN S  177 ? MET S 174 ASN S 176 
CA 2  TRP S  180 ? TYR S  183 ? TRP S 179 TYR S 182 
CB 1  LYS T  22  ? ASP T  30  ? LYS T 21  ASP T 29  
CB 2  MET T  35  ? ILE T  44  ? MET T 34  ILE T 43  
CB 3  LYS T  52  ? ILE T  62  ? LYS T 51  ILE T 61  
CB 4  PHE T  229 ? MET T  235 ? PHE T 228 MET T 234 
CB 5  GLN T  98  ? TYR T  103 ? GLN T 97  TYR T 102 
CC 1  ARG T  67  ? GLU T  71  ? ARG T 66  GLU T 70  
CC 2  LYS T  76  ? GLN T  90  ? LYS T 75  GLN T 89  
CC 3  LYS T  165 ? PHE T  172 ? LYS T 164 PHE T 171 
CC 4  PHE T  154 ? LEU T  158 ? PHE T 153 LEU T 157 
CD 1  ARG T  67  ? GLU T  71  ? ARG T 66  GLU T 70  
CD 2  LYS T  76  ? GLN T  90  ? LYS T 75  GLN T 89  
CD 3  GLN T  243 ? TRP T  261 ? GLN T 242 TRP T 260 
CD 4  TRP T  266 ? ASP T  286 ? TRP T 265 ASP T 285 
CD 5  GLU T  291 ? ASN T  294 ? GLU T 290 ASN T 293 
CE 1  MET T  175 ? ASN T  177 ? MET T 174 ASN T 176 
CE 2  TRP T  180 ? TYR T  183 ? TRP T 179 TYR T 182 
CF 1  LYS U  22  ? ASP U  30  ? LYS U 21  ASP U 29  
CF 2  MET U  35  ? ILE U  44  ? MET U 34  ILE U 43  
CF 3  LYS U  52  ? ILE U  62  ? LYS U 51  ILE U 61  
CF 4  PHE U  229 ? MET U  235 ? PHE U 228 MET U 234 
CF 5  GLN U  98  ? TYR U  103 ? GLN U 97  TYR U 102 
CG 1  ARG U  67  ? GLU U  71  ? ARG U 66  GLU U 70  
CG 2  LYS U  76  ? GLN U  90  ? LYS U 75  GLN U 89  
CG 3  LYS U  165 ? PHE U  172 ? LYS U 164 PHE U 171 
CG 4  PHE U  154 ? GLU U  159 ? PHE U 153 GLU U 158 
CH 1  ARG U  67  ? GLU U  71  ? ARG U 66  GLU U 70  
CH 2  LYS U  76  ? GLN U  90  ? LYS U 75  GLN U 89  
CH 3  GLN U  243 ? TRP U  261 ? GLN U 242 TRP U 260 
CH 4  TRP U  266 ? ASP U  286 ? TRP U 265 ASP U 285 
CH 5  GLU U  291 ? ASN U  294 ? GLU U 290 ASN U 293 
CI 1  MET U  175 ? ASN U  177 ? MET U 174 ASN U 176 
CI 2  TRP U  180 ? TYR U  183 ? TRP U 179 TYR U 182 
CJ 1  LYS V  22  ? ASP V  30  ? LYS V 21  ASP V 29  
CJ 2  MET V  35  ? ILE V  44  ? MET V 34  ILE V 43  
CJ 3  LYS V  52  ? ILE V  62  ? LYS V 51  ILE V 61  
CJ 4  PHE V  229 ? MET V  235 ? PHE V 228 MET V 234 
CJ 5  GLN V  98  ? TYR V  103 ? GLN V 97  TYR V 102 
CK 1  ARG V  67  ? GLU V  71  ? ARG V 66  GLU V 70  
CK 2  LYS V  76  ? GLN V  90  ? LYS V 75  GLN V 89  
CK 3  LYS V  165 ? PHE V  172 ? LYS V 164 PHE V 171 
CK 4  PHE V  154 ? GLU V  159 ? PHE V 153 GLU V 158 
CL 1  ARG V  67  ? GLU V  71  ? ARG V 66  GLU V 70  
CL 2  LYS V  76  ? GLN V  90  ? LYS V 75  GLN V 89  
CL 3  GLN V  243 ? TRP V  261 ? GLN V 242 TRP V 260 
CL 4  TRP V  266 ? ASP V  286 ? TRP V 265 ASP V 285 
CL 5  GLU V  291 ? ASN V  294 ? GLU V 290 ASN V 293 
CM 1  THR V  110 ? ASP V  128 ? THR V 109 ASP V 127 
CM 2  ILE V  133 ? PRO V  152 ? ILE V 132 PRO V 151 
CM 3  THR BA 110 ? ASP BA 128 ? THR b 109 ASP b 127 
CM 4  ILE BA 133 ? PRO BA 152 ? ILE b 132 PRO b 151 
CM 5  THR AA 110 ? ASP AA 128 ? THR a 109 ASP a 127 
CM 6  GLY AA 134 ? PRO AA 152 ? GLY a 133 PRO a 151 
CM 7  THR Z  110 ? ASP Z  128 ? THR Z 109 ASP Z 127 
CM 8  ILE Z  133 ? PRO Z  152 ? ILE Z 132 PRO Z 151 
CM 9  THR Y  110 ? GLY Y  127 ? THR Y 109 GLY Y 126 
CM 10 ILE Y  133 ? PRO Y  152 ? ILE Y 132 PRO Y 151 
CM 11 THR X  110 ? ASP X  128 ? THR X 109 ASP X 127 
CM 12 ILE X  133 ? PRO X  152 ? ILE X 132 PRO X 151 
CM 13 THR W  110 ? ASP W  128 ? THR W 109 ASP W 127 
CM 14 ILE W  133 ? PRO W  152 ? ILE W 132 PRO W 151 
CM 15 THR V  110 ? ASP V  128 ? THR V 109 ASP V 127 
CN 1  MET V  175 ? ASN V  177 ? MET V 174 ASN V 176 
CN 2  TRP V  180 ? TYR V  183 ? TRP V 179 TYR V 182 
CO 1  LYS W  22  ? ASP W  30  ? LYS W 21  ASP W 29  
CO 2  MET W  35  ? ILE W  44  ? MET W 34  ILE W 43  
CO 3  LYS W  52  ? ILE W  62  ? LYS W 51  ILE W 61  
CO 4  PHE W  229 ? MET W  235 ? PHE W 228 MET W 234 
CO 5  GLN W  98  ? TYR W  103 ? GLN W 97  TYR W 102 
CP 1  ARG W  67  ? GLU W  72  ? ARG W 66  GLU W 71  
CP 2  LYS W  76  ? GLN W  90  ? LYS W 75  GLN W 89  
CP 3  LYS W  165 ? PHE W  172 ? LYS W 164 PHE W 171 
CP 4  PHE W  154 ? LEU W  158 ? PHE W 153 LEU W 157 
CQ 1  ARG W  67  ? GLU W  72  ? ARG W 66  GLU W 71  
CQ 2  LYS W  76  ? GLN W  90  ? LYS W 75  GLN W 89  
CQ 3  GLN W  243 ? TRP W  261 ? GLN W 242 TRP W 260 
CQ 4  TRP W  266 ? ASP W  286 ? TRP W 265 ASP W 285 
CQ 5  GLU W  291 ? ASN W  294 ? GLU W 290 ASN W 293 
CR 1  MET W  175 ? ASN W  177 ? MET W 174 ASN W 176 
CR 2  TRP W  180 ? TYR W  183 ? TRP W 179 TYR W 182 
CS 1  LYS X  22  ? ASP X  30  ? LYS X 21  ASP X 29  
CS 2  MET X  35  ? ILE X  44  ? MET X 34  ILE X 43  
CS 3  LYS X  52  ? ILE X  62  ? LYS X 51  ILE X 61  
CS 4  PHE X  229 ? MET X  235 ? PHE X 228 MET X 234 
CS 5  GLN X  98  ? TYR X  103 ? GLN X 97  TYR X 102 
CT 1  ARG X  67  ? VAL X  68  ? ARG X 66  VAL X 67  
CT 2  LYS X  76  ? GLN X  90  ? LYS X 75  GLN X 89  
CT 3  LYS X  165 ? PHE X  172 ? LYS X 164 PHE X 171 
CT 4  PHE X  154 ? GLU X  159 ? PHE X 153 GLU X 158 
CU 1  ARG X  67  ? VAL X  68  ? ARG X 66  VAL X 67  
CU 2  LYS X  76  ? GLN X  90  ? LYS X 75  GLN X 89  
CU 3  GLN X  243 ? TRP X  261 ? GLN X 242 TRP X 260 
CU 4  TRP X  266 ? ASP X  286 ? TRP X 265 ASP X 285 
CU 5  GLU X  291 ? ASN X  294 ? GLU X 290 ASN X 293 
CV 1  MET X  175 ? ASN X  177 ? MET X 174 ASN X 176 
CV 2  TRP X  180 ? TYR X  183 ? TRP X 179 TYR X 182 
CW 1  LYS Y  22  ? ASP Y  30  ? LYS Y 21  ASP Y 29  
CW 2  MET Y  35  ? ILE Y  44  ? MET Y 34  ILE Y 43  
CW 3  LYS Y  52  ? ILE Y  62  ? LYS Y 51  ILE Y 61  
CW 4  PHE Y  229 ? MET Y  235 ? PHE Y 228 MET Y 234 
CW 5  GLN Y  98  ? TYR Y  103 ? GLN Y 97  TYR Y 102 
CX 1  ARG Y  67  ? SER Y  70  ? ARG Y 66  SER Y 69  
CX 2  LYS Y  76  ? GLN Y  90  ? LYS Y 75  GLN Y 89  
CX 3  LYS Y  165 ? PHE Y  172 ? LYS Y 164 PHE Y 171 
CX 4  PHE Y  154 ? LEU Y  158 ? PHE Y 153 LEU Y 157 
CY 1  ARG Y  67  ? SER Y  70  ? ARG Y 66  SER Y 69  
CY 2  LYS Y  76  ? GLN Y  90  ? LYS Y 75  GLN Y 89  
CY 3  GLN Y  243 ? TRP Y  261 ? GLN Y 242 TRP Y 260 
CY 4  TRP Y  266 ? ASP Y  286 ? TRP Y 265 ASP Y 285 
CY 5  GLU Y  291 ? ASN Y  294 ? GLU Y 290 ASN Y 293 
CZ 1  MET Y  175 ? ASN Y  177 ? MET Y 174 ASN Y 176 
CZ 2  TRP Y  180 ? TYR Y  183 ? TRP Y 179 TYR Y 182 
DA 1  LYS Z  22  ? ASP Z  30  ? LYS Z 21  ASP Z 29  
DA 2  MET Z  35  ? ILE Z  44  ? MET Z 34  ILE Z 43  
DA 3  LYS Z  52  ? ILE Z  62  ? LYS Z 51  ILE Z 61  
DA 4  PHE Z  229 ? MET Z  235 ? PHE Z 228 MET Z 234 
DA 5  GLN Z  98  ? TYR Z  103 ? GLN Z 97  TYR Z 102 
DB 1  ARG Z  67  ? GLU Z  71  ? ARG Z 66  GLU Z 70  
DB 2  LYS Z  76  ? GLN Z  90  ? LYS Z 75  GLN Z 89  
DB 3  LYS Z  165 ? PHE Z  172 ? LYS Z 164 PHE Z 171 
DB 4  PHE Z  154 ? LEU Z  158 ? PHE Z 153 LEU Z 157 
DC 1  ARG Z  67  ? GLU Z  71  ? ARG Z 66  GLU Z 70  
DC 2  LYS Z  76  ? GLN Z  90  ? LYS Z 75  GLN Z 89  
DC 3  GLN Z  243 ? TRP Z  261 ? GLN Z 242 TRP Z 260 
DC 4  TRP Z  266 ? ASP Z  286 ? TRP Z 265 ASP Z 285 
DC 5  GLU Z  291 ? ASN Z  294 ? GLU Z 290 ASN Z 293 
DD 1  MET Z  175 ? ASN Z  177 ? MET Z 174 ASN Z 176 
DD 2  TRP Z  180 ? TYR Z  183 ? TRP Z 179 TYR Z 182 
DE 1  LYS AA 22  ? ASP AA 30  ? LYS a 21  ASP a 29  
DE 2  MET AA 35  ? ILE AA 44  ? MET a 34  ILE a 43  
DE 3  LYS AA 52  ? ILE AA 62  ? LYS a 51  ILE a 61  
DE 4  PHE AA 229 ? MET AA 235 ? PHE a 228 MET a 234 
DE 5  GLN AA 98  ? TYR AA 103 ? GLN a 97  TYR a 102 
DF 1  ARG AA 67  ? GLU AA 71  ? ARG a 66  GLU a 70  
DF 2  LYS AA 76  ? GLN AA 90  ? LYS a 75  GLN a 89  
DF 3  LYS AA 165 ? PHE AA 172 ? LYS a 164 PHE a 171 
DF 4  PHE AA 154 ? LEU AA 158 ? PHE a 153 LEU a 157 
DG 1  ARG AA 67  ? GLU AA 71  ? ARG a 66  GLU a 70  
DG 2  LYS AA 76  ? GLN AA 90  ? LYS a 75  GLN a 89  
DG 3  GLN AA 243 ? TRP AA 261 ? GLN a 242 TRP a 260 
DG 4  TRP AA 266 ? ASP AA 286 ? TRP a 265 ASP a 285 
DG 5  GLU AA 291 ? ASN AA 294 ? GLU a 290 ASN a 293 
DH 1  MET AA 175 ? ASN AA 177 ? MET a 174 ASN a 176 
DH 2  TRP AA 180 ? TYR AA 183 ? TRP a 179 TYR a 182 
DI 1  LYS BA 22  ? ASP BA 30  ? LYS b 21  ASP b 29  
DI 2  MET BA 35  ? ILE BA 44  ? MET b 34  ILE b 43  
DI 3  LYS BA 52  ? ILE BA 62  ? LYS b 51  ILE b 61  
DI 4  PHE BA 229 ? MET BA 235 ? PHE b 228 MET b 234 
DI 5  GLN BA 98  ? TYR BA 103 ? GLN b 97  TYR b 102 
DJ 1  ARG BA 67  ? SER BA 70  ? ARG b 66  SER b 69  
DJ 2  LYS BA 76  ? GLN BA 90  ? LYS b 75  GLN b 89  
DJ 3  LYS BA 165 ? PHE BA 172 ? LYS b 164 PHE b 171 
DJ 4  PHE BA 154 ? LEU BA 158 ? PHE b 153 LEU b 157 
DK 1  ARG BA 67  ? SER BA 70  ? ARG b 66  SER b 69  
DK 2  LYS BA 76  ? GLN BA 90  ? LYS b 75  GLN b 89  
DK 3  GLN BA 243 ? TRP BA 261 ? GLN b 242 TRP b 260 
DK 4  TRP BA 266 ? ASP BA 286 ? TRP b 265 ASP b 285 
DK 5  GLU BA 291 ? ASN BA 294 ? GLU b 290 ASN b 293 
DL 1  MET BA 175 ? ASN BA 177 ? MET b 174 ASN b 176 
DL 2  TRP BA 180 ? TYR BA 183 ? TRP b 179 TYR b 182 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1  2  N LYS A  22  ? N LYS A 21  O PHE A  43  ? O PHE A 42  
A  2  3  N PHE A  40  ? N PHE A 39  O ARG A  57  ? O ARG A 56  
A  3  4  N ILE A  56  ? N ILE A 55  O THR A  231 ? O THR A 230 
A  4  5  O VAL A  232 ? O VAL A 231 N SER A  100 ? N SER A 99  
B  1  2  N ARG A  67  ? N ARG A 66  O ALA A  80  ? O ALA A 79  
B  2  3  N PHE A  85  ? N PHE A 84  O VAL A  170 ? O VAL A 169 
B  3  4  O ILE A  171 ? O ILE A 170 N LYS A  155 ? N LYS A 154 
C  1  2  N ARG A  67  ? N ARG A 66  O ALA A  80  ? O ALA A 79  
C  2  3  N LEU A  79  ? N LEU A 78  O TYR A  257 ? O TYR A 256 
C  3  4  N THR A  244 ? N THR A 243 O ILE A  285 ? O ILE A 284 
C  4  5  N LYS A  284 ? N LYS A 283 O THR A  293 ? O THR A 292 
D  1  2  N GLU A  112 ? N GLU A 111 O LYS A  148 ? O LYS A 147 
D  2  3  N GLN A  151 ? N GLN A 150 O LYS G  111 ? O LYS G 110 
D  3  4  N GLU G  112 ? N GLU G 111 O LYS G  148 ? O LYS G 147 
D  4  5  O ILE G  143 ? O ILE G 142 N TYR F  119 ? N TYR F 118 
D  5  6  N GLU F  112 ? N GLU F 111 O LYS F  148 ? O LYS F 147 
D  6  7  O GLN F  151 ? O GLN F 150 N LYS E  111 ? N LYS E 110 
D  7  8  N GLU E  112 ? N GLU E 111 O LYS E  148 ? O LYS E 147 
D  8  9  O GLN E  151 ? O GLN E 150 N LYS D  111 ? N LYS D 110 
D  9  10 N GLU D  112 ? N GLU D 111 O LYS D  148 ? O LYS D 147 
D  10 11 O GLN D  151 ? O GLN D 150 N LYS C  111 ? N LYS C 110 
D  11 12 N GLU C  112 ? N GLU C 111 O LYS C  148 ? O LYS C 147 
D  12 13 O GLN C  151 ? O GLN C 150 N LYS B  111 ? N LYS B 110 
D  13 14 N GLU B  112 ? N GLU B 111 O LYS B  148 ? O LYS B 147 
D  14 15 O GLN B  151 ? O GLN B 150 N LYS A  111 ? N LYS A 110 
E  1  2  N MET A  175 ? N MET A 174 O TYR A  183 ? O TYR A 182 
F  1  2  N LYS B  22  ? N LYS B 21  O PHE B  43  ? O PHE B 42  
F  2  3  N PHE B  40  ? N PHE B 39  O ARG B  57  ? O ARG B 56  
F  3  4  N ILE B  56  ? N ILE B 55  O THR B  231 ? O THR B 230 
F  4  5  O VAL B  232 ? O VAL B 231 N SER B  100 ? N SER B 99  
G  1  2  N ARG B  67  ? N ARG B 66  O ALA B  80  ? O ALA B 79  
G  2  3  N LEU B  89  ? N LEU B 88  O VAL B  166 ? O VAL B 165 
G  3  4  O LYS B  169 ? O LYS B 168 N ILE B  157 ? N ILE B 156 
H  1  2  N ARG B  67  ? N ARG B 66  O ALA B  80  ? O ALA B 79  
H  2  3  N LEU B  79  ? N LEU B 78  O TYR B  257 ? O TYR B 256 
H  3  4  N THR B  244 ? N THR B 243 O ILE B  285 ? O ILE B 284 
H  4  5  N LYS B  284 ? N LYS B 283 O THR B  293 ? O THR B 292 
I  1  2  N MET B  175 ? N MET B 174 O TYR B  183 ? O TYR B 182 
J  1  2  N LYS C  22  ? N LYS C 21  O PHE C  43  ? O PHE C 42  
J  2  3  N LYS C  38  ? N LYS C 37  O LYS C  59  ? O LYS C 58  
J  3  4  N ILE C  56  ? N ILE C 55  O THR C  231 ? O THR C 230 
J  4  5  O VAL C  232 ? O VAL C 231 N SER C  100 ? N SER C 99  
K  1  2  N SER C  70  ? N SER C 69  O GLY C  78  ? O GLY C 77  
K  2  3  N PHE C  85  ? N PHE C 84  O VAL C  170 ? O VAL C 169 
K  3  4  O LYS C  169 ? O LYS C 168 N ILE C  157 ? N ILE C 156 
L  1  2  N SER C  70  ? N SER C 69  O GLY C  78  ? O GLY C 77  
L  2  3  N GLN C  88  ? N GLN C 87  O ILE C  249 ? O ILE C 248 
L  3  4  N THR C  244 ? N THR C 243 O ILE C  285 ? O ILE C 284 
L  4  5  N LYS C  284 ? N LYS C 283 O THR C  293 ? O THR C 292 
M  1  2  N MET C  175 ? N MET C 174 O TYR C  183 ? O TYR C 182 
N  1  2  N LYS D  22  ? N LYS D 21  O PHE D  43  ? O PHE D 42  
N  2  3  N LYS D  38  ? N LYS D 37  O LYS D  59  ? O LYS D 58  
N  3  4  N ILE D  56  ? N ILE D 55  O THR D  231 ? O THR D 230 
N  4  5  O VAL D  232 ? O VAL D 231 N SER D  100 ? N SER D 99  
O  1  2  N ARG D  67  ? N ARG D 66  O ALA D  80  ? O ALA D 79  
O  2  3  N LEU D  89  ? N LEU D 88  O VAL D  166 ? O VAL D 165 
O  3  4  O LYS D  169 ? O LYS D 168 N ILE D  157 ? N ILE D 156 
P  1  2  N ARG D  67  ? N ARG D 66  O ALA D  80  ? O ALA D 79  
P  2  3  N TRP D  81  ? N TRP D 80  O ASP D  255 ? O ASP D 254 
P  3  4  N THR D  244 ? N THR D 243 O ILE D  285 ? O ILE D 284 
P  4  5  N LYS D  284 ? N LYS D 283 O THR D  293 ? O THR D 292 
Q  1  2  N MET D  175 ? N MET D 174 O TYR D  183 ? O TYR D 182 
R  1  2  N LYS E  22  ? N LYS E 21  O PHE E  43  ? O PHE E 42  
R  2  3  N LYS E  38  ? N LYS E 37  O LYS E  59  ? O LYS E 58  
R  3  4  N ILE E  56  ? N ILE E 55  O THR E  231 ? O THR E 230 
R  4  5  O VAL E  232 ? O VAL E 231 N SER E  100 ? N SER E 99  
S  1  2  N ARG E  67  ? N ARG E 66  O ALA E  80  ? O ALA E 79  
S  2  3  N LEU E  89  ? N LEU E 88  O VAL E  166 ? O VAL E 165 
S  3  4  O LYS E  169 ? O LYS E 168 N ILE E  157 ? N ILE E 156 
T  1  2  N ARG E  67  ? N ARG E 66  O ALA E  80  ? O ALA E 79  
T  2  3  N LEU E  79  ? N LEU E 78  O TYR E  257 ? O TYR E 256 
T  3  4  N GLN E  258 ? N GLN E 257 O THR E  269 ? O THR E 268 
T  4  5  N LYS E  284 ? N LYS E 283 O THR E  293 ? O THR E 292 
U  1  2  N MET E  175 ? N MET E 174 O TYR E  183 ? O TYR E 182 
V  1  2  N LYS F  22  ? N LYS F 21  O PHE F  43  ? O PHE F 42  
V  2  3  N PHE F  40  ? N PHE F 39  O ARG F  57  ? O ARG F 56  
V  3  4  N ILE F  56  ? N ILE F 55  O THR F  231 ? O THR F 230 
V  4  5  O VAL F  232 ? O VAL F 231 N SER F  100 ? N SER F 99  
W  1  2  N ARG F  67  ? N ARG F 66  O ALA F  80  ? O ALA F 79  
W  2  3  N LEU F  89  ? N LEU F 88  O VAL F  166 ? O VAL F 165 
W  3  4  O ILE F  171 ? O ILE F 170 N LYS F  155 ? N LYS F 154 
X  1  2  N ARG F  67  ? N ARG F 66  O ALA F  80  ? O ALA F 79  
X  2  3  N TRP F  81  ? N TRP F 80  O ASP F  255 ? O ASP F 254 
X  3  4  N THR F  244 ? N THR F 243 O ILE F  285 ? O ILE F 284 
X  4  5  N LYS F  284 ? N LYS F 283 O THR F  293 ? O THR F 292 
Y  1  2  N MET F  175 ? N MET F 174 O TYR F  183 ? O TYR F 182 
Z  1  2  N LYS G  22  ? N LYS G 21  O PHE G  43  ? O PHE G 42  
Z  2  3  N LYS G  38  ? N LYS G 37  O LYS G  59  ? O LYS G 58  
Z  3  4  N ILE G  56  ? N ILE G 55  O THR G  231 ? O THR G 230 
Z  4  5  O VAL G  232 ? O VAL G 231 N SER G  100 ? N SER G 99  
AA 1  2  N ARG G  67  ? N ARG G 66  O ALA G  80  ? O ALA G 79  
AA 2  3  N PHE G  85  ? N PHE G 84  O VAL G  170 ? O VAL G 169 
AA 3  4  O LYS G  169 ? O LYS G 168 N ILE G  157 ? N ILE G 156 
AB 1  2  N ARG G  67  ? N ARG G 66  O ALA G  80  ? O ALA G 79  
AB 2  3  N LEU G  79  ? N LEU G 78  O TYR G  257 ? O TYR G 256 
AB 3  4  N THR G  244 ? N THR G 243 O ILE G  285 ? O ILE G 284 
AB 4  5  N ASP G  286 ? N ASP G 285 O GLU G  291 ? O GLU G 290 
AC 1  2  N MET G  175 ? N MET G 174 O TYR G  183 ? O TYR G 182 
AD 1  2  N LYS H  22  ? N LYS H 21  O PHE H  43  ? O PHE H 42  
AD 2  3  N PHE H  40  ? N PHE H 39  O ARG H  57  ? O ARG H 56  
AD 3  4  N ILE H  56  ? N ILE H 55  O THR H  231 ? O THR H 230 
AD 4  5  O VAL H  232 ? O VAL H 231 N SER H  100 ? N SER H 99  
AE 1  2  N ARG H  67  ? N ARG H 66  O ALA H  80  ? O ALA H 79  
AE 2  3  N LEU H  89  ? N LEU H 88  O VAL H  166 ? O VAL H 165 
AE 3  4  O LYS H  169 ? O LYS H 168 N ILE H  157 ? N ILE H 156 
AF 1  2  N ARG H  67  ? N ARG H 66  O ALA H  80  ? O ALA H 79  
AF 2  3  N LEU H  79  ? N LEU H 78  O TYR H  257 ? O TYR H 256 
AF 3  4  N THR H  244 ? N THR H 243 O ILE H  285 ? O ILE H 284 
AF 4  5  N LYS H  284 ? N LYS H 283 O THR H  293 ? O THR H 292 
AG 1  2  N GLU H  112 ? N GLU H 111 O LYS H  148 ? O LYS H 147 
AG 2  3  N ILE H  143 ? N ILE H 142 O TYR N  119 ? O TYR N 118 
AG 3  4  N GLU N  112 ? N GLU N 111 O LYS N  148 ? O LYS N 147 
AG 4  5  O ILE N  143 ? O ILE N 142 N TYR M  119 ? N TYR M 118 
AG 5  6  N GLU M  112 ? N GLU M 111 O LYS M  148 ? O LYS M 147 
AG 6  7  O GLN M  151 ? O GLN M 150 N LYS L  111 ? N LYS L 110 
AG 7  8  N GLU L  112 ? N GLU L 111 O LYS L  148 ? O LYS L 147 
AG 8  9  O GLN L  151 ? O GLN L 150 N LYS K  111 ? N LYS K 110 
AG 9  10 N GLU K  112 ? N GLU K 111 O LYS K  148 ? O LYS K 147 
AG 10 11 O GLN K  151 ? O GLN K 150 N LYS J  111 ? N LYS J 110 
AG 11 12 N GLU J  112 ? N GLU J 111 O LYS J  148 ? O LYS J 147 
AG 12 13 O ILE J  143 ? O ILE J 142 N TYR I  119 ? N TYR I 118 
AG 13 14 N GLU I  112 ? N GLU I 111 O LYS I  148 ? O LYS I 147 
AG 14 15 O GLN I  151 ? O GLN I 150 N LYS H  111 ? N LYS H 110 
AH 1  2  N MET H  175 ? N MET H 174 O TYR H  183 ? O TYR H 182 
AI 1  2  N LYS I  22  ? N LYS I 21  O PHE I  43  ? O PHE I 42  
AI 2  3  N PHE I  40  ? N PHE I 39  O ARG I  57  ? O ARG I 56  
AI 3  4  N ILE I  56  ? N ILE I 55  O THR I  231 ? O THR I 230 
AI 4  5  O VAL I  232 ? O VAL I 231 N SER I  100 ? N SER I 99  
AJ 1  2  N ARG I  67  ? N ARG I 66  O ALA I  80  ? O ALA I 79  
AJ 2  3  N PHE I  85  ? N PHE I 84  O VAL I  170 ? O VAL I 169 
AJ 3  4  O LYS I  169 ? O LYS I 168 N ILE I  157 ? N ILE I 156 
AK 1  2  N ARG I  67  ? N ARG I 66  O ALA I  80  ? O ALA I 79  
AK 2  3  N TRP I  81  ? N TRP I 80  O ASP I  255 ? O ASP I 254 
AK 3  4  N THR I  244 ? N THR I 243 O ILE I  285 ? O ILE I 284 
AK 4  5  N LYS I  284 ? N LYS I 283 O THR I  293 ? O THR I 292 
AL 1  2  N MET I  175 ? N MET I 174 O TYR I  183 ? O TYR I 182 
AM 1  2  N LYS J  22  ? N LYS J 21  O PHE J  43  ? O PHE J 42  
AM 2  3  N PHE J  40  ? N PHE J 39  O ARG J  57  ? O ARG J 56  
AM 3  4  N LEU J  54  ? N LEU J 53  O ILE J  233 ? O ILE J 232 
AM 4  5  O VAL J  232 ? O VAL J 231 N SER J  100 ? N SER J 99  
AN 1  2  N ARG J  67  ? N ARG J 66  O ALA J  80  ? O ALA J 79  
AN 2  3  N PHE J  85  ? N PHE J 84  O VAL J  170 ? O VAL J 169 
AN 3  4  O LYS J  169 ? O LYS J 168 N ILE J  157 ? N ILE J 156 
AO 1  2  N ARG J  67  ? N ARG J 66  O ALA J  80  ? O ALA J 79  
AO 2  3  N LEU J  79  ? N LEU J 78  O TYR J  257 ? O TYR J 256 
AO 3  4  N THR J  244 ? N THR J 243 O ILE J  285 ? O ILE J 284 
AO 4  5  N LYS J  284 ? N LYS J 283 O THR J  293 ? O THR J 292 
AP 1  2  N MET J  175 ? N MET J 174 O TYR J  183 ? O TYR J 182 
AQ 1  2  N LYS K  22  ? N LYS K 21  O PHE K  43  ? O PHE K 42  
AQ 2  3  N LYS K  38  ? N LYS K 37  O LYS K  59  ? O LYS K 58  
AQ 3  4  N ILE K  56  ? N ILE K 55  O THR K  231 ? O THR K 230 
AQ 4  5  O VAL K  232 ? O VAL K 231 N SER K  100 ? N SER K 99  
AR 1  2  N ARG K  67  ? N ARG K 66  O ALA K  80  ? O ALA K 79  
AR 2  3  N PHE K  85  ? N PHE K 84  O VAL K  170 ? O VAL K 169 
AR 3  4  O LYS K  169 ? O LYS K 168 N ILE K  157 ? N ILE K 156 
AS 1  2  N ARG K  67  ? N ARG K 66  O ALA K  80  ? O ALA K 79  
AS 2  3  N LEU K  79  ? N LEU K 78  O TYR K  257 ? O TYR K 256 
AS 3  4  N THR K  244 ? N THR K 243 O ILE K  285 ? O ILE K 284 
AS 4  5  N LYS K  284 ? N LYS K 283 O THR K  293 ? O THR K 292 
AT 1  2  N MET K  175 ? N MET K 174 O TYR K  183 ? O TYR K 182 
AU 1  2  N LYS L  22  ? N LYS L 21  O PHE L  43  ? O PHE L 42  
AU 2  3  N LYS L  38  ? N LYS L 37  O LYS L  59  ? O LYS L 58  
AU 3  4  N ILE L  56  ? N ILE L 55  O THR L  231 ? O THR L 230 
AU 4  5  O VAL L  232 ? O VAL L 231 N SER L  100 ? N SER L 99  
AV 1  2  N ARG L  67  ? N ARG L 66  O ALA L  80  ? O ALA L 79  
AV 2  3  N LEU L  89  ? N LEU L 88  O VAL L  166 ? O VAL L 165 
AV 3  4  O ILE L  171 ? O ILE L 170 N LYS L  155 ? N LYS L 154 
AW 1  2  N ARG L  67  ? N ARG L 66  O ALA L  80  ? O ALA L 79  
AW 2  3  N TRP L  81  ? N TRP L 80  O ASP L  255 ? O ASP L 254 
AW 3  4  N THR L  244 ? N THR L 243 O ILE L  285 ? O ILE L 284 
AW 4  5  N LYS L  284 ? N LYS L 283 O THR L  293 ? O THR L 292 
AX 1  2  N MET L  175 ? N MET L 174 O TYR L  183 ? O TYR L 182 
AY 1  2  N LYS M  22  ? N LYS M 21  O PHE M  43  ? O PHE M 42  
AY 2  3  N PHE M  40  ? N PHE M 39  O ARG M  57  ? O ARG M 56  
AY 3  4  N ILE M  56  ? N ILE M 55  O THR M  231 ? O THR M 230 
AY 4  5  O VAL M  232 ? O VAL M 231 N SER M  100 ? N SER M 99  
AZ 1  2  N ARG M  67  ? N ARG M 66  O ALA M  80  ? O ALA M 79  
AZ 2  3  N LEU M  89  ? N LEU M 88  O VAL M  166 ? O VAL M 165 
AZ 3  4  O LYS M  169 ? O LYS M 168 N ILE M  157 ? N ILE M 156 
BA 1  2  N ARG M  67  ? N ARG M 66  O ALA M  80  ? O ALA M 79  
BA 2  3  N LEU M  79  ? N LEU M 78  O TYR M  257 ? O TYR M 256 
BA 3  4  N THR M  244 ? N THR M 243 O ILE M  285 ? O ILE M 284 
BA 4  5  N ASP M  286 ? N ASP M 285 O GLU M  291 ? O GLU M 290 
BB 1  2  N MET M  175 ? N MET M 174 O TYR M  183 ? O TYR M 182 
BC 1  2  N LYS N  22  ? N LYS N 21  O PHE N  43  ? O PHE N 42  
BC 2  3  N PHE N  40  ? N PHE N 39  O ARG N  57  ? O ARG N 56  
BC 3  4  N ILE N  56  ? N ILE N 55  O THR N  231 ? O THR N 230 
BC 4  5  O VAL N  232 ? O VAL N 231 N SER N  100 ? N SER N 99  
BD 1  2  N ARG N  67  ? N ARG N 66  O ALA N  80  ? O ALA N 79  
BD 2  3  N LEU N  89  ? N LEU N 88  O VAL N  166 ? O VAL N 165 
BD 3  4  O LYS N  169 ? O LYS N 168 N ILE N  157 ? N ILE N 156 
BE 1  2  N ARG N  67  ? N ARG N 66  O ALA N  80  ? O ALA N 79  
BE 2  3  N LEU N  79  ? N LEU N 78  O TYR N  257 ? O TYR N 256 
BE 3  4  N THR N  244 ? N THR N 243 O ILE N  285 ? O ILE N 284 
BE 4  5  N LYS N  284 ? N LYS N 283 O THR N  293 ? O THR N 292 
BF 1  2  N MET N  175 ? N MET N 174 O TYR N  183 ? O TYR N 182 
BG 1  2  N LYS O  22  ? N LYS O 21  O PHE O  43  ? O PHE O 42  
BG 2  3  N LYS O  38  ? N LYS O 37  O LYS O  59  ? O LYS O 58  
BG 3  4  N ILE O  56  ? N ILE O 55  O THR O  231 ? O THR O 230 
BG 4  5  O VAL O  232 ? O VAL O 231 N SER O  100 ? N SER O 99  
BH 1  2  N ARG O  67  ? N ARG O 66  O ALA O  80  ? O ALA O 79  
BH 2  3  N LEU O  89  ? N LEU O 88  O VAL O  166 ? O VAL O 165 
BH 3  4  O LYS O  169 ? O LYS O 168 N ILE O  157 ? N ILE O 156 
BI 1  2  N ARG O  67  ? N ARG O 66  O ALA O  80  ? O ALA O 79  
BI 2  3  N LEU O  79  ? N LEU O 78  O TYR O  257 ? O TYR O 256 
BI 3  4  N THR O  244 ? N THR O 243 O ILE O  285 ? O ILE O 284 
BI 4  5  N ASP O  286 ? N ASP O 285 O GLU O  291 ? O GLU O 290 
BJ 1  2  N GLU O  112 ? N GLU O 111 O LYS O  148 ? O LYS O 147 
BJ 2  3  N GLN O  151 ? N GLN O 150 O LYS U  111 ? O LYS U 110 
BJ 3  4  N GLU U  112 ? N GLU U 111 O LYS U  148 ? O LYS U 147 
BJ 4  5  O ILE U  143 ? O ILE U 142 N TYR T  119 ? N TYR T 118 
BJ 5  6  N GLU T  112 ? N GLU T 111 O LYS T  148 ? O LYS T 147 
BJ 6  7  O GLN T  151 ? O GLN T 150 N LYS S  111 ? N LYS S 110 
BJ 7  8  N GLU S  112 ? N GLU S 111 O LYS S  148 ? O LYS S 147 
BJ 8  9  O ILE S  143 ? O ILE S 142 N TYR R  119 ? N TYR R 118 
BJ 9  10 N GLU R  112 ? N GLU R 111 O LYS R  148 ? O LYS R 147 
BJ 10 11 O GLN R  151 ? O GLN R 150 N LYS Q  111 ? N LYS Q 110 
BJ 11 12 N GLU Q  112 ? N GLU Q 111 O LYS Q  148 ? O LYS Q 147 
BJ 12 13 O GLN Q  151 ? O GLN Q 150 N LYS P  111 ? N LYS P 110 
BJ 13 14 N GLU P  112 ? N GLU P 111 O LYS P  148 ? O LYS P 147 
BJ 14 15 O GLN P  151 ? O GLN P 150 N LYS O  111 ? N LYS O 110 
BK 1  2  N MET O  175 ? N MET O 174 O TYR O  183 ? O TYR O 182 
BL 1  2  N LYS P  22  ? N LYS P 21  O PHE P  43  ? O PHE P 42  
BL 2  3  N PHE P  40  ? N PHE P 39  O ARG P  57  ? O ARG P 56  
BL 3  4  N ILE P  56  ? N ILE P 55  O THR P  231 ? O THR P 230 
BL 4  5  O VAL P  232 ? O VAL P 231 N SER P  100 ? N SER P 99  
BM 1  2  N ARG P  67  ? N ARG P 66  O ALA P  80  ? O ALA P 79  
BM 2  3  N LEU P  89  ? N LEU P 88  O VAL P  166 ? O VAL P 165 
BM 3  4  O LYS P  169 ? O LYS P 168 N ILE P  157 ? N ILE P 156 
BN 1  2  N ARG P  67  ? N ARG P 66  O ALA P  80  ? O ALA P 79  
BN 2  3  N LEU P  79  ? N LEU P 78  O TYR P  257 ? O TYR P 256 
BN 3  4  N GLN P  258 ? N GLN P 257 O THR P  269 ? O THR P 268 
BN 4  5  N LYS P  284 ? N LYS P 283 O THR P  293 ? O THR P 292 
BO 1  2  N MET P  175 ? N MET P 174 O TYR P  183 ? O TYR P 182 
BP 1  2  N LYS Q  22  ? N LYS Q 21  O PHE Q  43  ? O PHE Q 42  
BP 2  3  N LYS Q  38  ? N LYS Q 37  O LYS Q  59  ? O LYS Q 58  
BP 3  4  N ILE Q  56  ? N ILE Q 55  O THR Q  231 ? O THR Q 230 
BP 4  5  O VAL Q  232 ? O VAL Q 231 N SER Q  100 ? N SER Q 99  
BQ 1  2  N SER Q  70  ? N SER Q 69  O GLY Q  78  ? O GLY Q 77  
BQ 2  3  N LEU Q  89  ? N LEU Q 88  O VAL Q  166 ? O VAL Q 165 
BQ 3  4  O LYS Q  169 ? O LYS Q 168 N ILE Q  157 ? N ILE Q 156 
BR 1  2  N SER Q  70  ? N SER Q 69  O GLY Q  78  ? O GLY Q 77  
BR 2  3  N LEU Q  79  ? N LEU Q 78  O TYR Q  257 ? O TYR Q 256 
BR 3  4  N THR Q  244 ? N THR Q 243 O ILE Q  285 ? O ILE Q 284 
BR 4  5  N LYS Q  284 ? N LYS Q 283 O THR Q  293 ? O THR Q 292 
BS 1  2  N MET Q  175 ? N MET Q 174 O TYR Q  183 ? O TYR Q 182 
BT 1  2  N LYS R  22  ? N LYS R 21  O PHE R  43  ? O PHE R 42  
BT 2  3  N PHE R  40  ? N PHE R 39  O ARG R  57  ? O ARG R 56  
BT 3  4  N ILE R  56  ? N ILE R 55  O THR R  231 ? O THR R 230 
BT 4  5  O VAL R  232 ? O VAL R 231 N SER R  100 ? N SER R 99  
BU 1  2  N ARG R  67  ? N ARG R 66  O ALA R  80  ? O ALA R 79  
BU 2  3  N LEU R  89  ? N LEU R 88  O VAL R  166 ? O VAL R 165 
BU 3  4  O LYS R  169 ? O LYS R 168 N ILE R  157 ? N ILE R 156 
BV 1  2  N ARG R  67  ? N ARG R 66  O ALA R  80  ? O ALA R 79  
BV 2  3  N TRP R  81  ? N TRP R 80  O ASP R  255 ? O ASP R 254 
BV 3  4  N THR R  244 ? N THR R 243 O ILE R  285 ? O ILE R 284 
BV 4  5  N LYS R  284 ? N LYS R 283 O THR R  293 ? O THR R 292 
BW 1  2  N MET R  175 ? N MET R 174 O TYR R  183 ? O TYR R 182 
BX 1  2  N LYS S  22  ? N LYS S 21  O PHE S  43  ? O PHE S 42  
BX 2  3  N PHE S  40  ? N PHE S 39  O ARG S  57  ? O ARG S 56  
BX 3  4  N ILE S  56  ? N ILE S 55  O THR S  231 ? O THR S 230 
BX 4  5  O VAL S  232 ? O VAL S 231 N SER S  100 ? N SER S 99  
BY 1  2  N ARG S  67  ? N ARG S 66  O ALA S  80  ? O ALA S 79  
BY 2  3  N LEU S  89  ? N LEU S 88  O VAL S  166 ? O VAL S 165 
BY 3  4  O LYS S  169 ? O LYS S 168 N ILE S  157 ? N ILE S 156 
BZ 1  2  N ARG S  67  ? N ARG S 66  O ALA S  80  ? O ALA S 79  
BZ 2  3  N LEU S  79  ? N LEU S 78  O TYR S  257 ? O TYR S 256 
BZ 3  4  N THR S  244 ? N THR S 243 O ILE S  285 ? O ILE S 284 
BZ 4  5  N LYS S  284 ? N LYS S 283 O THR S  293 ? O THR S 292 
CA 1  2  N MET S  175 ? N MET S 174 O TYR S  183 ? O TYR S 182 
CB 1  2  N LYS T  22  ? N LYS T 21  O PHE T  43  ? O PHE T 42  
CB 2  3  N LYS T  38  ? N LYS T 37  O LYS T  59  ? O LYS T 58  
CB 3  4  N ILE T  56  ? N ILE T 55  O THR T  231 ? O THR T 230 
CB 4  5  O VAL T  232 ? O VAL T 231 N SER T  100 ? N SER T 99  
CC 1  2  N ARG T  67  ? N ARG T 66  O ALA T  80  ? O ALA T 79  
CC 2  3  N PHE T  85  ? N PHE T 84  O VAL T  170 ? O VAL T 169 
CC 3  4  O ILE T  171 ? O ILE T 170 N LYS T  155 ? N LYS T 154 
CD 1  2  N ARG T  67  ? N ARG T 66  O ALA T  80  ? O ALA T 79  
CD 2  3  N LEU T  79  ? N LEU T 78  O TYR T  257 ? O TYR T 256 
CD 3  4  N THR T  244 ? N THR T 243 O ILE T  285 ? O ILE T 284 
CD 4  5  N LYS T  284 ? N LYS T 283 O THR T  293 ? O THR T 292 
CE 1  2  N MET T  175 ? N MET T 174 O TYR T  183 ? O TYR T 182 
CF 1  2  N LYS U  22  ? N LYS U 21  O PHE U  43  ? O PHE U 42  
CF 2  3  N LYS U  38  ? N LYS U 37  O LYS U  59  ? O LYS U 58  
CF 3  4  N ILE U  56  ? N ILE U 55  O THR U  231 ? O THR U 230 
CF 4  5  O VAL U  232 ? O VAL U 231 N SER U  100 ? N SER U 99  
CG 1  2  N ARG U  67  ? N ARG U 66  O ALA U  80  ? O ALA U 79  
CG 2  3  N LEU U  89  ? N LEU U 88  O VAL U  166 ? O VAL U 165 
CG 3  4  O GLY U  167 ? O GLY U 166 N GLU U  159 ? N GLU U 158 
CH 1  2  N ARG U  67  ? N ARG U 66  O ALA U  80  ? O ALA U 79  
CH 2  3  N LEU U  79  ? N LEU U 78  O TYR U  257 ? O TYR U 256 
CH 3  4  N THR U  244 ? N THR U 243 O ILE U  285 ? O ILE U 284 
CH 4  5  N LYS U  284 ? N LYS U 283 O THR U  293 ? O THR U 292 
CI 1  2  N MET U  175 ? N MET U 174 O TYR U  183 ? O TYR U 182 
CJ 1  2  N LYS V  22  ? N LYS V 21  O PHE V  43  ? O PHE V 42  
CJ 2  3  N LYS V  38  ? N LYS V 37  O LYS V  59  ? O LYS V 58  
CJ 3  4  N ILE V  56  ? N ILE V 55  O THR V  231 ? O THR V 230 
CJ 4  5  O VAL V  232 ? O VAL V 231 N SER V  100 ? N SER V 99  
CK 1  2  N ARG V  67  ? N ARG V 66  O ALA V  80  ? O ALA V 79  
CK 2  3  N LEU V  89  ? N LEU V 88  O VAL V  166 ? O VAL V 165 
CK 3  4  O LYS V  169 ? O LYS V 168 N ILE V  157 ? N ILE V 156 
CL 1  2  N ARG V  67  ? N ARG V 66  O ALA V  80  ? O ALA V 79  
CL 2  3  N LEU V  79  ? N LEU V 78  O TYR V  257 ? O TYR V 256 
CL 3  4  N THR V  244 ? N THR V 243 O ILE V  285 ? O ILE V 284 
CL 4  5  N ASP V  286 ? N ASP V 285 O GLU V  291 ? O GLU V 290 
CM 1  2  N GLU V  112 ? N GLU V 111 O LYS V  148 ? O LYS V 147 
CM 2  3  N GLN V  151 ? N GLN V 150 O LYS BA 111 ? O LYS b 110 
CM 3  4  N GLU BA 112 ? N GLU b 111 O LYS BA 148 ? O LYS b 147 
CM 4  5  O ILE BA 143 ? O ILE b 142 N TYR AA 119 ? N TYR a 118 
CM 5  6  N GLU AA 112 ? N GLU a 111 O LYS AA 148 ? O LYS a 147 
CM 6  7  O GLN AA 151 ? O GLN a 150 N LYS Z  111 ? N LYS Z 110 
CM 7  8  N GLU Z  112 ? N GLU Z 111 O LYS Z  148 ? O LYS Z 147 
CM 8  9  O ILE Z  143 ? O ILE Z 142 N TYR Y  119 ? N TYR Y 118 
CM 9  10 N GLU Y  112 ? N GLU Y 111 O LYS Y  148 ? O LYS Y 147 
CM 10 11 O GLN Y  151 ? O GLN Y 150 N LYS X  111 ? N LYS X 110 
CM 11 12 N GLU X  112 ? N GLU X 111 O LYS X  148 ? O LYS X 147 
CM 12 13 O GLN X  151 ? O GLN X 150 N LYS W  111 ? N LYS W 110 
CM 13 14 N GLU W  112 ? N GLU W 111 O LYS W  148 ? O LYS W 147 
CM 14 15 O GLN W  151 ? O GLN W 150 N LYS V  111 ? N LYS V 110 
CN 1  2  N MET V  175 ? N MET V 174 O TYR V  183 ? O TYR V 182 
CO 1  2  N LYS W  22  ? N LYS W 21  O PHE W  43  ? O PHE W 42  
CO 2  3  N LYS W  38  ? N LYS W 37  O LYS W  59  ? O LYS W 58  
CO 3  4  N ILE W  56  ? N ILE W 55  O THR W  231 ? O THR W 230 
CO 4  5  O VAL W  232 ? O VAL W 231 N SER W  100 ? N SER W 99  
CP 1  2  N ARG W  67  ? N ARG W 66  O ALA W  80  ? O ALA W 79  
CP 2  3  N LEU W  89  ? N LEU W 88  O VAL W  166 ? O VAL W 165 
CP 3  4  O LYS W  169 ? O LYS W 168 N ILE W  157 ? N ILE W 156 
CQ 1  2  N ARG W  67  ? N ARG W 66  O ALA W  80  ? O ALA W 79  
CQ 2  3  N LEU W  79  ? N LEU W 78  O TYR W  257 ? O TYR W 256 
CQ 3  4  N GLN W  258 ? N GLN W 257 O THR W  269 ? O THR W 268 
CQ 4  5  N LYS W  284 ? N LYS W 283 O THR W  293 ? O THR W 292 
CR 1  2  N MET W  175 ? N MET W 174 O TYR W  183 ? O TYR W 182 
CS 1  2  N LYS X  22  ? N LYS X 21  O PHE X  43  ? O PHE X 42  
CS 2  3  N LYS X  38  ? N LYS X 37  O LYS X  59  ? O LYS X 58  
CS 3  4  N ILE X  56  ? N ILE X 55  O THR X  231 ? O THR X 230 
CS 4  5  O VAL X  232 ? O VAL X 231 N SER X  100 ? N SER X 99  
CT 1  2  N ARG X  67  ? N ARG X 66  O ALA X  80  ? O ALA X 79  
CT 2  3  N LEU X  89  ? N LEU X 88  O VAL X  166 ? O VAL X 165 
CT 3  4  O GLY X  167 ? O GLY X 166 N GLU X  159 ? N GLU X 158 
CU 1  2  N ARG X  67  ? N ARG X 66  O ALA X  80  ? O ALA X 79  
CU 2  3  N LEU X  79  ? N LEU X 78  O TYR X  257 ? O TYR X 256 
CU 3  4  N THR X  244 ? N THR X 243 O ILE X  285 ? O ILE X 284 
CU 4  5  N LYS X  284 ? N LYS X 283 O THR X  293 ? O THR X 292 
CV 1  2  N MET X  175 ? N MET X 174 O TYR X  183 ? O TYR X 182 
CW 1  2  N LYS Y  22  ? N LYS Y 21  O PHE Y  43  ? O PHE Y 42  
CW 2  3  N PHE Y  40  ? N PHE Y 39  O ARG Y  57  ? O ARG Y 56  
CW 3  4  N ILE Y  56  ? N ILE Y 55  O THR Y  231 ? O THR Y 230 
CW 4  5  O VAL Y  232 ? O VAL Y 231 N SER Y  100 ? N SER Y 99  
CX 1  2  N ARG Y  67  ? N ARG Y 66  O ALA Y  80  ? O ALA Y 79  
CX 2  3  N LEU Y  89  ? N LEU Y 88  O VAL Y  166 ? O VAL Y 165 
CX 3  4  O LYS Y  169 ? O LYS Y 168 N ILE Y  157 ? N ILE Y 156 
CY 1  2  N ARG Y  67  ? N ARG Y 66  O ALA Y  80  ? O ALA Y 79  
CY 2  3  N GLN Y  88  ? N GLN Y 87  O ILE Y  249 ? O ILE Y 248 
CY 3  4  N THR Y  244 ? N THR Y 243 O ILE Y  285 ? O ILE Y 284 
CY 4  5  N ASP Y  286 ? N ASP Y 285 O GLU Y  291 ? O GLU Y 290 
CZ 1  2  N MET Y  175 ? N MET Y 174 O TYR Y  183 ? O TYR Y 182 
DA 1  2  N LYS Z  22  ? N LYS Z 21  O PHE Z  43  ? O PHE Z 42  
DA 2  3  N PHE Z  40  ? N PHE Z 39  O ARG Z  57  ? O ARG Z 56  
DA 3  4  N ILE Z  56  ? N ILE Z 55  O THR Z  231 ? O THR Z 230 
DA 4  5  O VAL Z  232 ? O VAL Z 231 N SER Z  100 ? N SER Z 99  
DB 1  2  N ARG Z  67  ? N ARG Z 66  O ALA Z  80  ? O ALA Z 79  
DB 2  3  N PHE Z  85  ? N PHE Z 84  O VAL Z  170 ? O VAL Z 169 
DB 3  4  O ILE Z  171 ? O ILE Z 170 N LYS Z  155 ? N LYS Z 154 
DC 1  2  N ARG Z  67  ? N ARG Z 66  O ALA Z  80  ? O ALA Z 79  
DC 2  3  N LEU Z  79  ? N LEU Z 78  O TYR Z  257 ? O TYR Z 256 
DC 3  4  N THR Z  244 ? N THR Z 243 O ILE Z  285 ? O ILE Z 284 
DC 4  5  N LYS Z  284 ? N LYS Z 283 O THR Z  293 ? O THR Z 292 
DD 1  2  N MET Z  175 ? N MET Z 174 O TYR Z  183 ? O TYR Z 182 
DE 1  2  N LYS AA 22  ? N LYS a 21  O PHE AA 43  ? O PHE a 42  
DE 2  3  N LYS AA 38  ? N LYS a 37  O LYS AA 59  ? O LYS a 58  
DE 3  4  N ILE AA 56  ? N ILE a 55  O THR AA 231 ? O THR a 230 
DE 4  5  O VAL AA 232 ? O VAL a 231 N SER AA 100 ? N SER a 99  
DF 1  2  N ARG AA 67  ? N ARG a 66  O ALA AA 80  ? O ALA a 79  
DF 2  3  N PHE AA 85  ? N PHE a 84  O VAL AA 170 ? O VAL a 169 
DF 3  4  O ILE AA 171 ? O ILE a 170 N LYS AA 155 ? N LYS a 154 
DG 1  2  N ARG AA 67  ? N ARG a 66  O ALA AA 80  ? O ALA a 79  
DG 2  3  N LEU AA 79  ? N LEU a 78  O TYR AA 257 ? O TYR a 256 
DG 3  4  N THR AA 244 ? N THR a 243 O ILE AA 285 ? O ILE a 284 
DG 4  5  N ASP AA 286 ? N ASP a 285 O GLU AA 291 ? O GLU a 290 
DH 1  2  N MET AA 175 ? N MET a 174 O TYR AA 183 ? O TYR a 182 
DI 1  2  N LYS BA 22  ? N LYS b 21  O PHE BA 43  ? O PHE b 42  
DI 2  3  N PHE BA 40  ? N PHE b 39  O ARG BA 57  ? O ARG b 56  
DI 3  4  N ILE BA 56  ? N ILE b 55  O THR BA 231 ? O THR b 230 
DI 4  5  O VAL BA 232 ? O VAL b 231 N SER BA 100 ? N SER b 99  
DJ 1  2  N ARG BA 67  ? N ARG b 66  O ALA BA 80  ? O ALA b 79  
DJ 2  3  N LEU BA 89  ? N LEU b 88  O VAL BA 166 ? O VAL b 165 
DJ 3  4  O LYS BA 169 ? O LYS b 168 N ILE BA 157 ? N ILE b 156 
DK 1  2  N ARG BA 67  ? N ARG b 66  O ALA BA 80  ? O ALA b 79  
DK 2  3  N LEU BA 79  ? N LEU b 78  O TYR BA 257 ? O TYR b 256 
DK 3  4  N THR BA 244 ? N THR b 243 O ILE BA 285 ? O ILE b 284 
DK 4  5  N LYS BA 284 ? N LYS b 283 O THR BA 293 ? O THR b 292 
DL 1  2  N MET BA 175 ? N MET b 174 O TYR BA 183 ? O TYR b 182 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD A 302' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD A 303' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD B 302' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MPD B 303' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD C 302' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MPD C 303' 
AC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MPD D 302' 
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD D 303' 
AC9 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MPD E 302' 
BC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MPD E 303' 
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD F 302' 
BC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD F 303' 
BC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD G 302' 
BC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MPD G 303' 
BC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MPD H 302' 
BC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD H 303' 
BC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MPD I 302' 
BC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD I 303' 
CC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD J 302' 
CC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MPD J 303' 
CC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD K 302' 
CC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD K 303' 
CC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD L 302' 
CC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD L 303' 
CC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MPD M 302' 
CC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD M 303' 
CC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MPD N 302' 
DC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MPD N 303' 
DC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD O 302' 
DC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD O 303' 
DC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD P 302' 
DC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MPD P 303' 
DC6 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MPD Q 302' 
DC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MPD Q 303' 
DC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD R 302' 
DC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD R 303' 
EC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD S 302' 
EC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD S 303' 
EC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD T 302' 
EC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD T 303' 
EC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MPD U 302' 
EC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD U 303' 
EC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD V 302' 
EC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD V 303' 
EC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD W 302' 
FC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD W 303' 
FC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MPD X 302' 
FC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD X 303' 
FC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MPD Y 302' 
FC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MPD Y 303' 
FC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD Z 302' 
FC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MPD X 304' 
FC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD a 302' 
FC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD a 303' 
GC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD b 302' 
GC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD b 303' 
GC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ACY A 304' 
GC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ACY D 304' 
GC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE ACY F 304' 
GC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ACY J 304' 
GC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ACY K 304' 
GC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ACY O 304' 
GC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ACY P 304' 
HC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ACY S 304' 
HC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ACY S 305' 
HC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE ACY T 304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6 ASN A  177 ? ASN A 176  . ? 1_555 ? 
2   AC1 6 GLN A  178 ? GLN A 177  . ? 1_555 ? 
3   AC1 6 TRP A  180 ? TRP A 179  . ? 1_555 ? 
4   AC1 6 MET A  198 ? MET A 197  . ? 1_555 ? 
5   AC1 6 LYS A  199 ? LYS A 198  . ? 1_555 ? 
6   AC1 6 ARG A  201 ? ARG A 200  . ? 1_555 ? 
7   AC2 5 TRP A  180 ? TRP A 179  . ? 1_555 ? 
8   AC2 5 GLY A  181 ? GLY A 180  . ? 1_555 ? 
9   AC2 5 SER F  115 ? SER F 114  . ? 1_555 ? 
10  AC2 5 HIS G  145 ? HIS G 144  . ? 1_555 ? 
11  AC2 5 LEU G  147 ? LEU G 146  . ? 1_555 ? 
12  AC3 6 ASN B  177 ? ASN B 176  . ? 1_555 ? 
13  AC3 6 TRP B  180 ? TRP B 179  . ? 1_555 ? 
14  AC3 6 GLN B  195 ? GLN B 194  . ? 1_555 ? 
15  AC3 6 MET B  198 ? MET B 197  . ? 1_555 ? 
16  AC3 6 LYS B  199 ? LYS B 198  . ? 1_555 ? 
17  AC3 6 ARG B  201 ? ARG B 200  . ? 1_555 ? 
18  AC4 3 ASN B  179 ? ASN B 178  . ? 1_555 ? 
19  AC4 3 TRP B  180 ? TRP B 179  . ? 1_555 ? 
20  AC4 3 GLY B  181 ? GLY B 180  . ? 1_555 ? 
21  AC5 5 ASN C  177 ? ASN C 176  . ? 1_555 ? 
22  AC5 5 GLN C  178 ? GLN C 177  . ? 1_555 ? 
23  AC5 5 TRP C  180 ? TRP C 179  . ? 1_555 ? 
24  AC5 5 MET C  198 ? MET C 197  . ? 1_555 ? 
25  AC5 5 ARG C  201 ? ARG C 200  . ? 1_555 ? 
26  AC6 3 LEU B  147 ? LEU B 146  . ? 1_555 ? 
27  AC6 3 TRP C  180 ? TRP C 179  . ? 1_555 ? 
28  AC6 3 GLY C  181 ? GLY C 180  . ? 1_555 ? 
29  AC7 7 ASN D  177 ? ASN D 176  . ? 1_555 ? 
30  AC7 7 GLN D  178 ? GLN D 177  . ? 1_555 ? 
31  AC7 7 TRP D  180 ? TRP D 179  . ? 1_555 ? 
32  AC7 7 GLN D  195 ? GLN D 194  . ? 1_555 ? 
33  AC7 7 MET D  198 ? MET D 197  . ? 1_555 ? 
34  AC7 7 LYS D  199 ? LYS D 198  . ? 1_555 ? 
35  AC7 7 ARG D  201 ? ARG D 200  . ? 1_555 ? 
36  AC8 5 SER B  115 ? SER B 114  . ? 1_555 ? 
37  AC8 5 LEU C  147 ? LEU C 146  . ? 1_555 ? 
38  AC8 5 ASN D  179 ? ASN D 178  . ? 1_555 ? 
39  AC8 5 TRP D  180 ? TRP D 179  . ? 1_555 ? 
40  AC8 5 GLY D  181 ? GLY D 180  . ? 1_555 ? 
41  AC9 8 GLN E  178 ? GLN E 177  . ? 1_555 ? 
42  AC9 8 TRP E  180 ? TRP E 179  . ? 1_555 ? 
43  AC9 8 TYR E  183 ? TYR E 182  . ? 1_555 ? 
44  AC9 8 GLN E  195 ? GLN E 194  . ? 1_555 ? 
45  AC9 8 MET E  198 ? MET E 197  . ? 1_555 ? 
46  AC9 8 LYS E  199 ? LYS E 198  . ? 1_555 ? 
47  AC9 8 THR E  200 ? THR E 199  . ? 1_555 ? 
48  AC9 8 ARG E  201 ? ARG E 200  . ? 1_555 ? 
49  BC1 2 ASN E  179 ? ASN E 178  . ? 1_555 ? 
50  BC1 2 GLY E  181 ? GLY E 180  . ? 1_555 ? 
51  BC2 6 ASN F  177 ? ASN F 176  . ? 1_555 ? 
52  BC2 6 TRP F  180 ? TRP F 179  . ? 1_555 ? 
53  BC2 6 GLN F  195 ? GLN F 194  . ? 1_555 ? 
54  BC2 6 MET F  198 ? MET F 197  . ? 1_555 ? 
55  BC2 6 LYS F  199 ? LYS F 198  . ? 1_555 ? 
56  BC2 6 ARG F  201 ? ARG F 200  . ? 1_555 ? 
57  BC3 4 LEU D  117 ? LEU D 116  . ? 1_555 ? 
58  BC3 4 LEU E  147 ? LEU E 146  . ? 1_555 ? 
59  BC3 4 TRP F  180 ? TRP F 179  . ? 1_555 ? 
60  BC3 4 GLY F  181 ? GLY F 180  . ? 1_555 ? 
61  BC4 6 ASN G  177 ? ASN G 176  . ? 1_555 ? 
62  BC4 6 TRP G  180 ? TRP G 179  . ? 1_555 ? 
63  BC4 6 GLN G  195 ? GLN G 194  . ? 1_555 ? 
64  BC4 6 MET G  198 ? MET G 197  . ? 1_555 ? 
65  BC4 6 LYS G  199 ? LYS G 198  . ? 1_555 ? 
66  BC4 6 ARG G  201 ? ARG G 200  . ? 1_555 ? 
67  BC5 3 LEU F  147 ? LEU F 146  . ? 1_555 ? 
68  BC5 3 TRP G  180 ? TRP G 179  . ? 1_555 ? 
69  BC5 3 GLY G  181 ? GLY G 180  . ? 1_555 ? 
70  BC6 7 ASN H  177 ? ASN H 176  . ? 1_555 ? 
71  BC6 7 GLN H  178 ? GLN H 177  . ? 1_555 ? 
72  BC6 7 TRP H  180 ? TRP H 179  . ? 1_555 ? 
73  BC6 7 GLN H  195 ? GLN H 194  . ? 1_555 ? 
74  BC6 7 MET H  198 ? MET H 197  . ? 1_555 ? 
75  BC6 7 LYS H  199 ? LYS H 198  . ? 1_555 ? 
76  BC6 7 ARG H  201 ? ARG H 200  . ? 1_555 ? 
77  BC7 5 TRP H  180 ? TRP H 179  . ? 1_555 ? 
78  BC7 5 GLY H  181 ? GLY H 180  . ? 1_555 ? 
79  BC7 5 SER M  115 ? SER M 114  . ? 1_555 ? 
80  BC7 5 LEU M  117 ? LEU M 116  . ? 1_555 ? 
81  BC7 5 HIS N  145 ? HIS N 144  . ? 1_555 ? 
82  BC8 7 ASN I  177 ? ASN I 176  . ? 1_555 ? 
83  BC8 7 GLN I  178 ? GLN I 177  . ? 1_555 ? 
84  BC8 7 TRP I  180 ? TRP I 179  . ? 1_555 ? 
85  BC8 7 GLN I  195 ? GLN I 194  . ? 1_555 ? 
86  BC8 7 MET I  198 ? MET I 197  . ? 1_555 ? 
87  BC8 7 LYS I  199 ? LYS I 198  . ? 1_555 ? 
88  BC8 7 ARG I  201 ? ARG I 200  . ? 1_555 ? 
89  BC9 4 ASN I  179 ? ASN I 178  . ? 1_555 ? 
90  BC9 4 TRP I  180 ? TRP I 179  . ? 1_555 ? 
91  BC9 4 GLY I  181 ? GLY I 180  . ? 1_555 ? 
92  BC9 4 SER N  115 ? SER N 114  . ? 1_555 ? 
93  CC1 4 ASN J  177 ? ASN J 176  . ? 1_555 ? 
94  CC1 4 GLN J  178 ? GLN J 177  . ? 1_555 ? 
95  CC1 4 MET J  198 ? MET J 197  . ? 1_555 ? 
96  CC1 4 ARG J  201 ? ARG J 200  . ? 1_555 ? 
97  CC2 3 HIS I  145 ? HIS I 144  . ? 1_555 ? 
98  CC2 3 TRP J  180 ? TRP J 179  . ? 1_555 ? 
99  CC2 3 GLY J  181 ? GLY J 180  . ? 1_555 ? 
100 CC3 6 ASN K  177 ? ASN K 176  . ? 1_555 ? 
101 CC3 6 TRP K  180 ? TRP K 179  . ? 1_555 ? 
102 CC3 6 GLN K  195 ? GLN K 194  . ? 1_555 ? 
103 CC3 6 MET K  198 ? MET K 197  . ? 1_555 ? 
104 CC3 6 LYS K  199 ? LYS K 198  . ? 1_555 ? 
105 CC3 6 ARG K  201 ? ARG K 200  . ? 1_555 ? 
106 CC4 4 SER I  115 ? SER I 114  . ? 1_555 ? 
107 CC4 4 ASN K  179 ? ASN K 178  . ? 1_555 ? 
108 CC4 4 TRP K  180 ? TRP K 179  . ? 1_555 ? 
109 CC4 4 GLY K  181 ? GLY K 180  . ? 1_555 ? 
110 CC5 6 ASN L  177 ? ASN L 176  . ? 1_555 ? 
111 CC5 6 GLN L  178 ? GLN L 177  . ? 1_555 ? 
112 CC5 6 GLN L  195 ? GLN L 194  . ? 1_555 ? 
113 CC5 6 MET L  198 ? MET L 197  . ? 1_555 ? 
114 CC5 6 LYS L  199 ? LYS L 198  . ? 1_555 ? 
115 CC5 6 ARG L  201 ? ARG L 200  . ? 1_555 ? 
116 CC6 4 SER J  115 ? SER J 114  . ? 1_555 ? 
117 CC6 4 LEU J  117 ? LEU J 116  . ? 1_555 ? 
118 CC6 4 TYR K  113 ? TYR K 112  . ? 1_555 ? 
119 CC6 4 GLY L  181 ? GLY L 180  . ? 1_555 ? 
120 CC7 7 ASN M  177 ? ASN M 176  . ? 1_555 ? 
121 CC7 7 TRP M  180 ? TRP M 179  . ? 1_555 ? 
122 CC7 7 GLN M  195 ? GLN M 194  . ? 1_555 ? 
123 CC7 7 MET M  198 ? MET M 197  . ? 1_555 ? 
124 CC7 7 LYS M  199 ? LYS M 198  . ? 1_555 ? 
125 CC7 7 THR M  200 ? THR M 199  . ? 1_555 ? 
126 CC7 7 ARG M  201 ? ARG M 200  . ? 1_555 ? 
127 CC8 5 SER K  115 ? SER K 114  . ? 1_555 ? 
128 CC8 5 LEU L  147 ? LEU L 146  . ? 1_555 ? 
129 CC8 5 ASN M  179 ? ASN M 178  . ? 1_555 ? 
130 CC8 5 TRP M  180 ? TRP M 179  . ? 1_555 ? 
131 CC8 5 GLY M  181 ? GLY M 180  . ? 1_555 ? 
132 CC9 7 ASN N  177 ? ASN N 176  . ? 1_555 ? 
133 CC9 7 GLN N  178 ? GLN N 177  . ? 1_555 ? 
134 CC9 7 TRP N  180 ? TRP N 179  . ? 1_555 ? 
135 CC9 7 GLN N  195 ? GLN N 194  . ? 1_555 ? 
136 CC9 7 MET N  198 ? MET N 197  . ? 1_555 ? 
137 CC9 7 LYS N  199 ? LYS N 198  . ? 1_555 ? 
138 CC9 7 ARG N  201 ? ARG N 200  . ? 1_555 ? 
139 DC1 3 LEU M  147 ? LEU M 146  . ? 1_555 ? 
140 DC1 3 TRP N  180 ? TRP N 179  . ? 1_555 ? 
141 DC1 3 GLY N  181 ? GLY N 180  . ? 1_555 ? 
142 DC2 5 ASN O  177 ? ASN O 176  . ? 1_555 ? 
143 DC2 5 GLN O  178 ? GLN O 177  . ? 1_555 ? 
144 DC2 5 MET O  198 ? MET O 197  . ? 1_555 ? 
145 DC2 5 LYS O  199 ? LYS O 198  . ? 1_555 ? 
146 DC2 5 ARG O  201 ? ARG O 200  . ? 1_555 ? 
147 DC3 4 ASN O  179 ? ASN O 178  . ? 1_555 ? 
148 DC3 4 TRP O  180 ? TRP O 179  . ? 1_555 ? 
149 DC3 4 GLY O  181 ? GLY O 180  . ? 1_555 ? 
150 DC3 4 LEU U  147 ? LEU U 146  . ? 1_555 ? 
151 DC4 6 ASN P  177 ? ASN P 176  . ? 1_555 ? 
152 DC4 6 GLN P  178 ? GLN P 177  . ? 1_555 ? 
153 DC4 6 TRP P  180 ? TRP P 179  . ? 1_555 ? 
154 DC4 6 MET P  198 ? MET P 197  . ? 1_555 ? 
155 DC4 6 LYS P  199 ? LYS P 198  . ? 1_555 ? 
156 DC4 6 ARG P  201 ? ARG P 200  . ? 1_555 ? 
157 DC5 3 TRP P  180 ? TRP P 179  . ? 1_555 ? 
158 DC5 3 GLY P  181 ? GLY P 180  . ? 1_555 ? 
159 DC5 3 SER U  115 ? SER U 114  . ? 1_555 ? 
160 DC6 8 ASN Q  177 ? ASN Q 176  . ? 1_555 ? 
161 DC6 8 TRP Q  180 ? TRP Q 179  . ? 1_555 ? 
162 DC6 8 TYR Q  183 ? TYR Q 182  . ? 1_555 ? 
163 DC6 8 GLN Q  195 ? GLN Q 194  . ? 1_555 ? 
164 DC6 8 MET Q  198 ? MET Q 197  . ? 1_555 ? 
165 DC6 8 LYS Q  199 ? LYS Q 198  . ? 1_555 ? 
166 DC6 8 THR Q  200 ? THR Q 199  . ? 1_555 ? 
167 DC6 8 ARG Q  201 ? ARG Q 200  . ? 1_555 ? 
168 DC7 3 ASN Q  179 ? ASN Q 178  . ? 1_555 ? 
169 DC7 3 TRP Q  180 ? TRP Q 179  . ? 1_555 ? 
170 DC7 3 GLY Q  181 ? GLY Q 180  . ? 1_555 ? 
171 DC8 6 ASN R  177 ? ASN R 176  . ? 1_555 ? 
172 DC8 6 TRP R  180 ? TRP R 179  . ? 1_555 ? 
173 DC8 6 GLN R  195 ? GLN R 194  . ? 1_555 ? 
174 DC8 6 MET R  198 ? MET R 197  . ? 1_555 ? 
175 DC8 6 LYS R  199 ? LYS R 198  . ? 1_555 ? 
176 DC8 6 ARG R  201 ? ARG R 200  . ? 1_555 ? 
177 DC9 4 LEU P  117 ? LEU P 116  . ? 1_555 ? 
178 DC9 4 ASN R  179 ? ASN R 178  . ? 1_555 ? 
179 DC9 4 TRP R  180 ? TRP R 179  . ? 1_555 ? 
180 DC9 4 GLY R  181 ? GLY R 180  . ? 1_555 ? 
181 EC1 5 ASN S  177 ? ASN S 176  . ? 1_555 ? 
182 EC1 5 TRP S  180 ? TRP S 179  . ? 1_555 ? 
183 EC1 5 MET S  198 ? MET S 197  . ? 1_555 ? 
184 EC1 5 LYS S  199 ? LYS S 198  . ? 1_555 ? 
185 EC1 5 ARG S  201 ? ARG S 200  . ? 1_555 ? 
186 EC2 5 SER Q  115 ? SER Q 114  . ? 1_555 ? 
187 EC2 5 LEU R  147 ? LEU R 146  . ? 1_555 ? 
188 EC2 5 ASN S  179 ? ASN S 178  . ? 1_555 ? 
189 EC2 5 TRP S  180 ? TRP S 179  . ? 1_555 ? 
190 EC2 5 GLY S  181 ? GLY S 180  . ? 1_555 ? 
191 EC3 6 ASN T  177 ? ASN T 176  . ? 1_555 ? 
192 EC3 6 GLN T  178 ? GLN T 177  . ? 1_555 ? 
193 EC3 6 GLN T  195 ? GLN T 194  . ? 1_555 ? 
194 EC3 6 MET T  198 ? MET T 197  . ? 1_555 ? 
195 EC3 6 LYS T  199 ? LYS T 198  . ? 1_555 ? 
196 EC3 6 ARG T  201 ? ARG T 200  . ? 1_555 ? 
197 EC4 6 SER R  115 ? SER R 114  . ? 1_555 ? 
198 EC4 6 HIS S  145 ? HIS S 144  . ? 1_555 ? 
199 EC4 6 LEU S  147 ? LEU S 146  . ? 1_555 ? 
200 EC4 6 ASN T  179 ? ASN T 178  . ? 1_555 ? 
201 EC4 6 TRP T  180 ? TRP T 179  . ? 1_555 ? 
202 EC4 6 GLY T  181 ? GLY T 180  . ? 1_555 ? 
203 EC5 7 ASN U  177 ? ASN U 176  . ? 1_555 ? 
204 EC5 7 GLN U  178 ? GLN U 177  . ? 1_555 ? 
205 EC5 7 TRP U  180 ? TRP U 179  . ? 1_555 ? 
206 EC5 7 MET U  198 ? MET U 197  . ? 1_555 ? 
207 EC5 7 LYS U  199 ? LYS U 198  . ? 1_555 ? 
208 EC5 7 THR U  200 ? THR U 199  . ? 1_555 ? 
209 EC5 7 ARG U  201 ? ARG U 200  . ? 1_555 ? 
210 EC6 5 SER S  115 ? SER S 114  . ? 1_555 ? 
211 EC6 5 LEU T  147 ? LEU T 146  . ? 1_555 ? 
212 EC6 5 ASN U  179 ? ASN U 178  . ? 1_555 ? 
213 EC6 5 TRP U  180 ? TRP U 179  . ? 1_555 ? 
214 EC6 5 GLY U  181 ? GLY U 180  . ? 1_555 ? 
215 EC7 6 ASN V  177 ? ASN V 176  . ? 1_555 ? 
216 EC7 6 GLN V  195 ? GLN V 194  . ? 1_555 ? 
217 EC7 6 MET V  198 ? MET V 197  . ? 1_555 ? 
218 EC7 6 LYS V  199 ? LYS V 198  . ? 1_555 ? 
219 EC7 6 THR V  200 ? THR V 199  . ? 1_555 ? 
220 EC7 6 ARG V  201 ? ARG V 200  . ? 1_555 ? 
221 EC8 4 TRP V  180 ? TRP V 179  . ? 1_555 ? 
222 EC8 4 GLY V  181 ? GLY V 180  . ? 1_555 ? 
223 EC8 4 LEU AA 117 ? LEU a 116  . ? 1_555 ? 
224 EC8 4 HIS BA 145 ? HIS b 144  . ? 1_555 ? 
225 EC9 6 ASN W  177 ? ASN W 176  . ? 1_555 ? 
226 EC9 6 TRP W  180 ? TRP W 179  . ? 1_555 ? 
227 EC9 6 MET W  198 ? MET W 197  . ? 1_555 ? 
228 EC9 6 LYS W  199 ? LYS W 198  . ? 1_555 ? 
229 EC9 6 THR W  200 ? THR W 199  . ? 1_555 ? 
230 EC9 6 ARG W  201 ? ARG W 200  . ? 1_555 ? 
231 FC1 4 ASN W  179 ? ASN W 178  . ? 1_555 ? 
232 FC1 4 TRP W  180 ? TRP W 179  . ? 1_555 ? 
233 FC1 4 GLY W  181 ? GLY W 180  . ? 1_555 ? 
234 FC1 4 SER BA 115 ? SER b 114  . ? 1_555 ? 
235 FC2 7 GLN X  178 ? GLN X 177  . ? 1_555 ? 
236 FC2 7 TRP X  180 ? TRP X 179  . ? 1_555 ? 
237 FC2 7 GLN X  195 ? GLN X 194  . ? 1_555 ? 
238 FC2 7 MET X  198 ? MET X 197  . ? 1_555 ? 
239 FC2 7 LYS X  199 ? LYS X 198  . ? 1_555 ? 
240 FC2 7 THR X  200 ? THR X 199  . ? 1_555 ? 
241 FC2 7 ARG X  201 ? ARG X 200  . ? 1_555 ? 
242 FC3 4 ILE V  143 ? ILE V 142  . ? 1_555 ? 
243 FC3 4 ASN X  179 ? ASN X 178  . ? 1_555 ? 
244 FC3 4 TRP X  180 ? TRP X 179  . ? 1_555 ? 
245 FC3 4 GLY X  181 ? GLY X 180  . ? 1_555 ? 
246 FC4 7 ASN Y  177 ? ASN Y 176  . ? 1_555 ? 
247 FC4 7 GLN Y  178 ? GLN Y 177  . ? 1_555 ? 
248 FC4 7 TRP Y  180 ? TRP Y 179  . ? 1_555 ? 
249 FC4 7 GLN Y  195 ? GLN Y 194  . ? 1_555 ? 
250 FC4 7 MET Y  198 ? MET Y 197  . ? 1_555 ? 
251 FC4 7 LYS Y  199 ? LYS Y 198  . ? 1_555 ? 
252 FC4 7 ARG Y  201 ? ARG Y 200  . ? 1_555 ? 
253 FC5 3 SER W  115 ? SER W 114  . ? 1_555 ? 
254 FC5 3 TRP Y  180 ? TRP Y 179  . ? 1_555 ? 
255 FC5 3 GLY Y  181 ? GLY Y 180  . ? 1_555 ? 
256 FC6 6 ASN Z  177 ? ASN Z 176  . ? 1_555 ? 
257 FC6 6 GLN Z  178 ? GLN Z 177  . ? 1_555 ? 
258 FC6 6 TRP Z  180 ? TRP Z 179  . ? 1_555 ? 
259 FC6 6 MET Z  198 ? MET Z 197  . ? 1_555 ? 
260 FC6 6 LYS Z  199 ? LYS Z 198  . ? 1_555 ? 
261 FC6 6 ARG Z  201 ? ARG Z 200  . ? 1_555 ? 
262 FC7 7 SER X  115 ? SER X 114  . ? 1_555 ? 
263 FC7 7 THR X  116 ? THR X 115  . ? 1_555 ? 
264 FC7 7 LEU X  117 ? LEU X 116  . ? 1_555 ? 
265 FC7 7 LEU Y  147 ? LEU Y 146  . ? 1_555 ? 
266 FC7 7 ASN Z  179 ? ASN Z 178  . ? 1_555 ? 
267 FC7 7 TRP Z  180 ? TRP Z 179  . ? 1_555 ? 
268 FC7 7 GLY Z  181 ? GLY Z 180  . ? 1_555 ? 
269 FC8 6 ASN AA 177 ? ASN a 176  . ? 1_555 ? 
270 FC8 6 TRP AA 180 ? TRP a 179  . ? 1_555 ? 
271 FC8 6 GLN AA 195 ? GLN a 194  . ? 1_555 ? 
272 FC8 6 MET AA 198 ? MET a 197  . ? 1_555 ? 
273 FC8 6 LYS AA 199 ? LYS a 198  . ? 1_555 ? 
274 FC8 6 ARG AA 201 ? ARG a 200  . ? 1_555 ? 
275 FC9 5 SER Y  115 ? SER Y 114  . ? 1_555 ? 
276 FC9 5 LEU Y  117 ? LEU Y 116  . ? 1_555 ? 
277 FC9 5 TRP AA 180 ? TRP a 179  . ? 1_555 ? 
278 FC9 5 GLY AA 181 ? GLY a 180  . ? 1_555 ? 
279 FC9 5 HOH IE .   ? HOH a 1865 . ? 1_555 ? 
280 GC1 5 TRP BA 180 ? TRP b 179  . ? 1_555 ? 
281 GC1 5 TYR BA 183 ? TYR b 182  . ? 1_555 ? 
282 GC1 5 GLN BA 195 ? GLN b 194  . ? 1_555 ? 
283 GC1 5 MET BA 198 ? MET b 197  . ? 1_555 ? 
284 GC1 5 ARG BA 201 ? ARG b 200  . ? 1_555 ? 
285 GC2 4 LEU AA 147 ? LEU a 146  . ? 1_555 ? 
286 GC2 4 ASN BA 179 ? ASN b 178  . ? 1_555 ? 
287 GC2 4 TRP BA 180 ? TRP b 179  . ? 1_555 ? 
288 GC2 4 GLY BA 181 ? GLY b 180  . ? 1_555 ? 
289 GC3 1 ALA A  139 ? ALA A 138  . ? 1_555 ? 
290 GC4 1 ALA D  139 ? ALA D 138  . ? 1_555 ? 
291 GC5 2 GLY F  123 ? GLY F 122  . ? 1_555 ? 
292 GC5 2 ALA G  139 ? ALA G 138  . ? 1_555 ? 
293 GC6 1 ALA J  139 ? ALA J 138  . ? 1_555 ? 
294 GC7 1 ALA K  139 ? ALA K 138  . ? 1_555 ? 
295 GC8 1 ALA O  139 ? ALA O 138  . ? 1_555 ? 
296 GC9 1 HOH XD .   ? HOH P 1597 . ? 1_555 ? 
297 HC1 1 ALA S  139 ? ALA S 138  . ? 1_555 ? 
298 HC2 1 ASN S  122 ? ASN S 121  . ? 1_555 ? 
299 HC3 2 ASN T  122 ? ASN T 121  . ? 1_555 ? 
300 HC3 2 GLY T  123 ? GLY T 122  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3ANZ 
_atom_sites.fract_transf_matrix[1][1]   0.009726 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000411 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003403 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005869 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ALA A  1 2   ? 7.261   -14.501 71.992  1.00 63.55  ? 1    ALA A N   1 
ATOM   2     C CA  . ALA A  1 2   ? 6.061   -15.385 71.890  1.00 69.95  ? 1    ALA A CA  1 
ATOM   3     C C   . ALA A  1 2   ? 6.465   -16.856 71.821  1.00 69.98  ? 1    ALA A C   1 
ATOM   4     O O   . ALA A  1 2   ? 7.580   -17.184 71.420  1.00 67.44  ? 1    ALA A O   1 
ATOM   5     C CB  . ALA A  1 2   ? 5.237   -15.013 70.668  1.00 71.71  ? 1    ALA A CB  1 
ATOM   6     N N   . ASP A  1 3   ? 5.550   -17.742 72.203  1.00 58.70  ? 2    ASP A N   1 
ATOM   7     C CA  . ASP A  1 3   ? 5.844   -19.172 72.233  1.00 63.34  ? 2    ASP A CA  1 
ATOM   8     C C   . ASP A  1 3   ? 6.350   -19.645 70.875  1.00 48.77  ? 2    ASP A C   1 
ATOM   9     O O   . ASP A  1 3   ? 7.228   -20.494 70.798  1.00 47.02  ? 2    ASP A O   1 
ATOM   10    C CB  . ASP A  1 3   ? 4.606   -19.985 72.642  1.00 64.49  ? 2    ASP A CB  1 
ATOM   11    C CG  . ASP A  1 3   ? 4.151   -19.692 74.067  1.00 85.65  ? 2    ASP A CG  1 
ATOM   12    O OD1 . ASP A  1 3   ? 4.320   -18.541 74.527  1.00 101.81 ? 2    ASP A OD1 1 
ATOM   13    O OD2 . ASP A  1 3   ? 3.618   -20.612 74.729  1.00 71.13  ? 2    ASP A OD2 1 
ATOM   14    N N   . SER A  1 4   ? 5.796   -19.083 69.808  1.00 45.41  ? 3    SER A N   1 
ATOM   15    C CA  . SER A  1 4   ? 6.164   -19.475 68.453  1.00 55.16  ? 3    SER A CA  1 
ATOM   16    C C   . SER A  1 4   ? 7.639   -19.192 68.144  1.00 54.25  ? 3    SER A C   1 
ATOM   17    O O   . SER A  1 4   ? 8.269   -19.927 67.386  1.00 56.89  ? 3    SER A O   1 
ATOM   18    C CB  . SER A  1 4   ? 5.267   -18.761 67.444  1.00 57.35  ? 3    SER A CB  1 
ATOM   19    O OG  . SER A  1 4   ? 5.298   -17.358 67.645  1.00 68.70  ? 3    SER A OG  1 
ATOM   20    N N   . ASP A  1 5   ? 8.183   -18.131 68.737  1.00 55.11  ? 4    ASP A N   1 
ATOM   21    C CA  . ASP A  1 5   ? 9.588   -17.773 68.546  1.00 46.63  ? 4    ASP A CA  1 
ATOM   22    C C   . ASP A  1 5   ? 10.535  -18.780 69.191  1.00 54.88  ? 4    ASP A C   1 
ATOM   23    O O   . ASP A  1 5   ? 11.708  -18.842 68.838  1.00 44.93  ? 4    ASP A O   1 
ATOM   24    C CB  . ASP A  1 5   ? 9.862   -16.384 69.119  1.00 57.99  ? 4    ASP A CB  1 
ATOM   25    C CG  . ASP A  1 5   ? 9.050   -15.304 68.432  1.00 64.04  ? 4    ASP A CG  1 
ATOM   26    O OD1 . ASP A  1 5   ? 9.349   -14.996 67.258  1.00 70.17  ? 4    ASP A OD1 1 
ATOM   27    O OD2 . ASP A  1 5   ? 8.117   -14.763 69.063  1.00 68.16  ? 4    ASP A OD2 1 
ATOM   28    N N   . ILE A  1 6   ? 10.030  -19.561 70.140  1.00 41.43  ? 5    ILE A N   1 
ATOM   29    C CA  . ILE A  1 6   ? 10.841  -20.586 70.776  1.00 42.63  ? 5    ILE A CA  1 
ATOM   30    C C   . ILE A  1 6   ? 10.276  -21.984 70.505  1.00 40.64  ? 5    ILE A C   1 
ATOM   31    O O   . ILE A  1 6   ? 10.426  -22.893 71.320  1.00 43.46  ? 5    ILE A O   1 
ATOM   32    C CB  . ILE A  1 6   ? 10.977  -20.329 72.290  1.00 45.89  ? 5    ILE A CB  1 
ATOM   33    C CG1 . ILE A  1 6   ? 9.595   -20.199 72.938  1.00 47.85  ? 5    ILE A CG1 1 
ATOM   34    C CG2 . ILE A  1 6   ? 11.790  -19.069 72.529  1.00 42.95  ? 5    ILE A CG2 1 
ATOM   35    C CD1 . ILE A  1 6   ? 9.631   -20.000 74.446  1.00 41.71  ? 5    ILE A CD1 1 
ATOM   36    N N   . ASN A  1 7   ? 9.621   -22.140 69.358  1.00 40.65  ? 6    ASN A N   1 
ATOM   37    C CA  . ASN A  1 7   ? 9.205   -23.458 68.856  1.00 41.97  ? 6    ASN A CA  1 
ATOM   38    C C   . ASN A  1 7   ? 8.210   -24.175 69.757  1.00 50.37  ? 6    ASN A C   1 
ATOM   39    O O   . ASN A  1 7   ? 8.204   -25.400 69.840  1.00 51.59  ? 6    ASN A O   1 
ATOM   40    C CB  . ASN A  1 7   ? 10.419  -24.362 68.626  1.00 50.28  ? 6    ASN A CB  1 
ATOM   41    C CG  . ASN A  1 7   ? 11.424  -23.752 67.678  1.00 61.03  ? 6    ASN A CG  1 
ATOM   42    O OD1 . ASN A  1 7   ? 12.565  -23.483 68.058  1.00 60.57  ? 6    ASN A OD1 1 
ATOM   43    N ND2 . ASN A  1 7   ? 11.002  -23.517 66.440  1.00 49.14  ? 6    ASN A ND2 1 
ATOM   44    N N   . ILE A  1 8   ? 7.354   -23.406 70.415  1.00 46.12  ? 7    ILE A N   1 
ATOM   45    C CA  . ILE A  1 8   ? 6.340   -23.965 71.289  1.00 51.45  ? 7    ILE A CA  1 
ATOM   46    C C   . ILE A  1 8   ? 4.957   -23.551 70.793  1.00 49.32  ? 7    ILE A C   1 
ATOM   47    O O   . ILE A  1 8   ? 4.737   -22.400 70.422  1.00 52.37  ? 7    ILE A O   1 
ATOM   48    C CB  . ILE A  1 8   ? 6.550   -23.496 72.748  1.00 59.27  ? 7    ILE A CB  1 
ATOM   49    C CG1 . ILE A  1 8   ? 7.852   -24.075 73.311  1.00 47.18  ? 7    ILE A CG1 1 
ATOM   50    C CG2 . ILE A  1 8   ? 5.394   -23.927 73.612  1.00 47.82  ? 7    ILE A CG2 1 
ATOM   51    C CD1 . ILE A  1 8   ? 8.246   -23.491 74.641  1.00 49.45  ? 7    ILE A CD1 1 
ATOM   52    N N   . LYS A  1 9   ? 4.034   -24.505 70.769  1.00 47.29  ? 8    LYS A N   1 
ATOM   53    C CA  . LYS A  1 9   ? 2.657   -24.249 70.361  1.00 48.65  ? 8    LYS A CA  1 
ATOM   54    C C   . LYS A  1 9   ? 2.122   -23.031 71.091  1.00 44.06  ? 8    LYS A C   1 
ATOM   55    O O   . LYS A  1 9   ? 2.268   -22.916 72.307  1.00 38.96  ? 8    LYS A O   1 
ATOM   56    C CB  . LYS A  1 9   ? 1.769   -25.447 70.702  1.00 51.79  ? 8    LYS A CB  1 
ATOM   57    C CG  . LYS A  1 9   ? 1.122   -26.110 69.507  1.00 75.23  ? 8    LYS A CG  1 
ATOM   58    C CD  . LYS A  1 9   ? 1.831   -27.411 69.151  1.00 81.13  ? 8    LYS A CD  1 
ATOM   59    C CE  . LYS A  1 9   ? 1.126   -28.139 68.016  1.00 84.23  ? 8    LYS A CE  1 
ATOM   60    N NZ  . LYS A  1 9   ? 1.787   -29.440 67.682  1.00 84.02  ? 8    LYS A NZ  1 
ATOM   61    N N   . THR A  1 10  ? 1.492   -22.132 70.347  1.00 43.12  ? 9    THR A N   1 
ATOM   62    C CA  . THR A  1 10  ? 0.972   -20.894 70.920  1.00 50.63  ? 9    THR A CA  1 
ATOM   63    C C   . THR A  1 10  ? -0.016  -21.178 72.053  1.00 56.43  ? 9    THR A C   1 
ATOM   64    O O   . THR A  1 10  ? -0.871  -22.055 71.933  1.00 50.16  ? 9    THR A O   1 
ATOM   65    C CB  . THR A  1 10  ? 0.271   -20.037 69.842  1.00 57.46  ? 9    THR A CB  1 
ATOM   66    O OG1 . THR A  1 10  ? 1.195   -19.745 68.784  1.00 74.81  ? 9    THR A OG1 1 
ATOM   67    C CG2 . THR A  1 10  ? -0.239  -18.733 70.440  1.00 57.28  ? 9    THR A CG2 1 
ATOM   68    N N   . GLY A  1 11  ? 0.114   -20.436 73.152  1.00 55.84  ? 10   GLY A N   1 
ATOM   69    C CA  . GLY A  1 11  ? -0.788  -20.563 74.285  1.00 53.37  ? 10   GLY A CA  1 
ATOM   70    C C   . GLY A  1 11  ? -0.439  -21.665 75.275  1.00 60.26  ? 10   GLY A C   1 
ATOM   71    O O   . GLY A  1 11  ? -1.045  -21.749 76.345  1.00 62.98  ? 10   GLY A O   1 
ATOM   72    N N   . THR A  1 12  ? 0.537   -22.503 74.928  1.00 49.81  ? 11   THR A N   1 
ATOM   73    C CA  . THR A  1 12  ? 0.929   -23.640 75.762  1.00 51.28  ? 11   THR A CA  1 
ATOM   74    C C   . THR A  1 12  ? 1.323   -23.246 77.193  1.00 42.33  ? 11   THR A C   1 
ATOM   75    O O   . THR A  1 12  ? 1.020   -23.967 78.132  1.00 54.73  ? 11   THR A O   1 
ATOM   76    C CB  . THR A  1 12  ? 2.107   -24.421 75.124  1.00 41.63  ? 11   THR A CB  1 
ATOM   77    O OG1 . THR A  1 12  ? 1.680   -25.012 73.898  1.00 61.12  ? 11   THR A OG1 1 
ATOM   78    C CG2 . THR A  1 12  ? 2.600   -25.526 76.046  1.00 44.58  ? 11   THR A CG2 1 
ATOM   79    N N   . THR A  1 13  ? 2.005   -22.119 77.357  1.00 45.54  ? 12   THR A N   1 
ATOM   80    C CA  . THR A  1 13  ? 2.528   -21.740 78.667  1.00 49.23  ? 12   THR A CA  1 
ATOM   81    C C   . THR A  1 13  ? 1.636   -20.743 79.401  1.00 49.89  ? 12   THR A C   1 
ATOM   82    O O   . THR A  1 13  ? 1.990   -20.281 80.478  1.00 58.97  ? 12   THR A O   1 
ATOM   83    C CB  . THR A  1 13  ? 3.926   -21.111 78.552  1.00 55.76  ? 12   THR A CB  1 
ATOM   84    O OG1 . THR A  1 13  ? 3.840   -19.862 77.850  1.00 55.58  ? 12   THR A OG1 1 
ATOM   85    C CG2 . THR A  1 13  ? 4.877   -22.057 77.826  1.00 51.64  ? 12   THR A CG2 1 
ATOM   86    N N   . ASP A  1 14  ? 0.487   -20.404 78.824  1.00 51.66  ? 13   ASP A N   1 
ATOM   87    C CA  . ASP A  1 14  ? -0.447  -19.480 79.467  1.00 53.10  ? 13   ASP A CA  1 
ATOM   88    C C   . ASP A  1 14  ? -1.319  -20.190 80.501  1.00 52.63  ? 13   ASP A C   1 
ATOM   89    O O   . ASP A  1 14  ? -1.660  -21.362 80.341  1.00 47.93  ? 13   ASP A O   1 
ATOM   90    C CB  . ASP A  1 14  ? -1.332  -18.801 78.418  1.00 59.54  ? 13   ASP A CB  1 
ATOM   91    C CG  . ASP A  1 14  ? -0.566  -17.802 77.569  1.00 80.88  ? 13   ASP A CG  1 
ATOM   92    O OD1 . ASP A  1 14  ? 0.568   -18.122 77.143  1.00 103.35 ? 13   ASP A OD1 1 
ATOM   93    O OD2 . ASP A  1 14  ? -1.096  -16.693 77.330  1.00 88.59  ? 13   ASP A OD2 1 
ATOM   94    N N   . ILE A  1 15  ? -1.690  -19.483 81.564  1.00 44.25  ? 14   ILE A N   1 
ATOM   95    C CA  . ILE A  1 15  ? -2.477  -20.111 82.609  1.00 56.53  ? 14   ILE A CA  1 
ATOM   96    C C   . ILE A  1 15  ? -3.954  -19.947 82.296  1.00 56.96  ? 14   ILE A C   1 
ATOM   97    O O   . ILE A  1 15  ? -4.333  -19.075 81.510  1.00 45.30  ? 14   ILE A O   1 
ATOM   98    C CB  . ILE A  1 15  ? -2.169  -19.518 83.992  1.00 56.73  ? 14   ILE A CB  1 
ATOM   99    C CG1 . ILE A  1 15  ? -3.175  -18.434 84.356  1.00 59.02  ? 14   ILE A CG1 1 
ATOM   100   C CG2 . ILE A  1 15  ? -0.758  -18.965 84.035  1.00 58.56  ? 14   ILE A CG2 1 
ATOM   101   C CD1 . ILE A  1 15  ? -3.252  -18.196 85.835  1.00 70.16  ? 14   ILE A CD1 1 
ATOM   102   N N   . GLY A  1 16  ? -4.783  -20.805 82.890  1.00 46.91  ? 15   GLY A N   1 
ATOM   103   C CA  . GLY A  1 16  ? -6.221  -20.585 82.896  1.00 69.19  ? 15   GLY A CA  1 
ATOM   104   C C   . GLY A  1 16  ? -7.092  -21.558 82.121  1.00 69.59  ? 15   GLY A C   1 
ATOM   105   O O   . GLY A  1 16  ? -8.319  -21.473 82.191  1.00 74.09  ? 15   GLY A O   1 
ATOM   106   N N   . SER A  1 17  ? -6.483  -22.479 81.384  1.00 67.55  ? 16   SER A N   1 
ATOM   107   C CA  . SER A  1 17  ? -7.259  -23.434 80.596  1.00 83.69  ? 16   SER A CA  1 
ATOM   108   C C   . SER A  1 17  ? -7.983  -24.449 81.491  1.00 67.71  ? 16   SER A C   1 
ATOM   109   O O   . SER A  1 17  ? -7.429  -24.930 82.482  1.00 61.61  ? 16   SER A O   1 
ATOM   110   C CB  . SER A  1 17  ? -6.362  -24.154 79.580  1.00 81.59  ? 16   SER A CB  1 
ATOM   111   O OG  . SER A  1 17  ? -5.382  -24.952 80.225  1.00 82.98  ? 16   SER A OG  1 
ATOM   112   N N   . ASN A  1 18  ? -9.227  -24.758 81.133  1.00 73.02  ? 17   ASN A N   1 
ATOM   113   C CA  . ASN A  1 18  ? -10.034 -25.735 81.865  1.00 94.34  ? 17   ASN A CA  1 
ATOM   114   C C   . ASN A  1 18  ? -10.190 -25.383 83.348  1.00 92.81  ? 17   ASN A C   1 
ATOM   115   O O   . ASN A  1 18  ? -10.071 -26.242 84.229  1.00 85.77  ? 17   ASN A O   1 
ATOM   116   C CB  . ASN A  1 18  ? -9.445  -27.143 81.704  1.00 95.66  ? 17   ASN A CB  1 
ATOM   117   C CG  . ASN A  1 18  ? -10.493 -28.239 81.854  1.00 108.63 ? 17   ASN A CG  1 
ATOM   118   O OD1 . ASN A  1 18  ? -10.480 -29.009 82.822  1.00 92.54  ? 17   ASN A OD1 1 
ATOM   119   N ND2 . ASN A  1 18  ? -11.414 -28.309 80.893  1.00 96.35  ? 17   ASN A ND2 1 
ATOM   120   N N   . THR A  1 19  ? -10.463 -24.112 83.614  1.00 77.15  ? 18   THR A N   1 
ATOM   121   C CA  . THR A  1 19  ? -10.685 -23.636 84.973  1.00 80.82  ? 18   THR A CA  1 
ATOM   122   C C   . THR A  1 19  ? -11.972 -22.826 84.996  1.00 63.07  ? 18   THR A C   1 
ATOM   123   O O   . THR A  1 19  ? -12.220 -22.037 84.079  1.00 54.88  ? 18   THR A O   1 
ATOM   124   C CB  . THR A  1 19  ? -9.538  -22.710 85.445  1.00 84.06  ? 18   THR A CB  1 
ATOM   125   O OG1 . THR A  1 19  ? -8.271  -23.250 85.048  1.00 58.89  ? 18   THR A OG1 1 
ATOM   126   C CG2 . THR A  1 19  ? -9.577  -22.531 86.962  1.00 70.19  ? 18   THR A CG2 1 
ATOM   127   N N   . THR A  1 20  ? -12.790 -23.003 86.030  1.00 53.25  ? 19   THR A N   1 
ATOM   128   C CA  . THR A  1 20  ? -13.932 -22.113 86.213  1.00 52.37  ? 19   THR A CA  1 
ATOM   129   C C   . THR A  1 20  ? -13.413 -20.820 86.828  1.00 39.23  ? 19   THR A C   1 
ATOM   130   O O   . THR A  1 20  ? -12.702 -20.847 87.830  1.00 48.72  ? 19   THR A O   1 
ATOM   131   C CB  . THR A  1 20  ? -15.034 -22.733 87.101  1.00 42.49  ? 19   THR A CB  1 
ATOM   132   O OG1 . THR A  1 20  ? -15.548 -23.907 86.466  1.00 57.13  ? 19   THR A OG1 1 
ATOM   133   C CG2 . THR A  1 20  ? -16.176 -21.744 87.311  1.00 35.33  ? 19   THR A CG2 1 
ATOM   134   N N   . VAL A  1 21  ? -13.749 -19.697 86.204  1.00 39.52  ? 20   VAL A N   1 
ATOM   135   C CA  . VAL A  1 21  ? -13.284 -18.390 86.651  1.00 33.33  ? 20   VAL A CA  1 
ATOM   136   C C   . VAL A  1 21  ? -14.431 -17.594 87.250  1.00 34.58  ? 20   VAL A C   1 
ATOM   137   O O   . VAL A  1 21  ? -15.478 -17.444 86.626  1.00 38.63  ? 20   VAL A O   1 
ATOM   138   C CB  . VAL A  1 21  ? -12.682 -17.607 85.460  1.00 39.46  ? 20   VAL A CB  1 
ATOM   139   C CG1 . VAL A  1 21  ? -12.315 -16.184 85.847  1.00 31.34  ? 20   VAL A CG1 1 
ATOM   140   C CG2 . VAL A  1 21  ? -11.461 -18.341 84.928  1.00 39.75  ? 20   VAL A CG2 1 
ATOM   141   N N   . LYS A  1 22  ? -14.228 -17.081 88.459  1.00 37.46  ? 21   LYS A N   1 
ATOM   142   C CA  . LYS A  1 22  ? -15.229 -16.243 89.120  1.00 39.52  ? 21   LYS A CA  1 
ATOM   143   C C   . LYS A  1 22  ? -14.883 -14.768 88.927  1.00 42.09  ? 21   LYS A C   1 
ATOM   144   O O   . LYS A  1 22  ? -13.761 -14.350 89.181  1.00 35.05  ? 21   LYS A O   1 
ATOM   145   C CB  . LYS A  1 22  ? -15.293 -16.556 90.613  1.00 38.52  ? 21   LYS A CB  1 
ATOM   146   C CG  . LYS A  1 22  ? -15.666 -17.986 90.929  1.00 38.60  ? 21   LYS A CG  1 
ATOM   147   C CD  . LYS A  1 22  ? -17.100 -18.268 90.578  1.00 56.31  ? 21   LYS A CD  1 
ATOM   148   C CE  . LYS A  1 22  ? -17.534 -19.620 91.122  1.00 69.19  ? 21   LYS A CE  1 
ATOM   149   N NZ  . LYS A  1 22  ? -18.990 -19.830 90.947  1.00 71.49  ? 21   LYS A NZ  1 
ATOM   150   N N   . THR A  1 23  ? -15.851 -13.981 88.480  1.00 29.73  ? 22   THR A N   1 
ATOM   151   C CA  . THR A  1 23  ? -15.617 -12.579 88.199  1.00 34.11  ? 22   THR A CA  1 
ATOM   152   C C   . THR A  1 23  ? -16.646 -11.706 88.894  1.00 35.01  ? 22   THR A C   1 
ATOM   153   O O   . THR A  1 23  ? -17.668 -12.200 89.358  1.00 34.82  ? 22   THR A O   1 
ATOM   154   C CB  . THR A  1 23  ? -15.706 -12.312 86.691  1.00 43.66  ? 22   THR A CB  1 
ATOM   155   O OG1 . THR A  1 23  ? -17.019 -12.653 86.232  1.00 36.50  ? 22   THR A OG1 1 
ATOM   156   C CG2 . THR A  1 23  ? -14.659 -13.144 85.925  1.00 34.43  ? 22   THR A CG2 1 
ATOM   157   N N   . GLY A  1 24  ? -16.380 -10.404 88.949  1.00 33.69  ? 23   GLY A N   1 
ATOM   158   C CA  . GLY A  1 24  ? -17.292 -9.484  89.590  1.00 31.60  ? 23   GLY A CA  1 
ATOM   159   C C   . GLY A  1 24  ? -17.031 -8.037  89.243  1.00 36.43  ? 23   GLY A C   1 
ATOM   160   O O   . GLY A  1 24  ? -15.933 -7.674  88.798  1.00 35.64  ? 23   GLY A O   1 
ATOM   161   N N   . ASP A  1 25  ? -18.064 -7.219  89.430  1.00 37.12  ? 24   ASP A N   1 
ATOM   162   C CA  . ASP A  1 25  ? -17.989 -5.770  89.255  1.00 31.76  ? 24   ASP A CA  1 
ATOM   163   C C   . ASP A  1 25  ? -18.333 -5.090  90.575  1.00 38.21  ? 24   ASP A C   1 
ATOM   164   O O   . ASP A  1 25  ? -19.322 -5.440  91.218  1.00 32.18  ? 24   ASP A O   1 
ATOM   165   C CB  . ASP A  1 25  ? -18.999 -5.310  88.200  1.00 39.99  ? 24   ASP A CB  1 
ATOM   166   C CG  . ASP A  1 25  ? -18.490 -5.483  86.782  1.00 81.06  ? 24   ASP A CG  1 
ATOM   167   O OD1 . ASP A  1 25  ? -17.354 -5.036  86.514  1.00 86.81  ? 24   ASP A OD1 1 
ATOM   168   O OD2 . ASP A  1 25  ? -19.221 -6.060  85.936  1.00 78.84  ? 24   ASP A OD2 1 
ATOM   169   N N   . LEU A  1 26  ? -17.512 -4.128  90.979  1.00 31.79  ? 25   LEU A N   1 
ATOM   170   C CA  . LEU A  1 26  ? -17.807 -3.288  92.132  1.00 31.12  ? 25   LEU A CA  1 
ATOM   171   C C   . LEU A  1 26  ? -17.742 -1.831  91.681  1.00 42.09  ? 25   LEU A C   1 
ATOM   172   O O   . LEU A  1 26  ? -16.708 -1.356  91.216  1.00 33.61  ? 25   LEU A O   1 
ATOM   173   C CB  . LEU A  1 26  ? -16.814 -3.550  93.263  1.00 31.17  ? 25   LEU A CB  1 
ATOM   174   C CG  . LEU A  1 26  ? -16.740 -5.016  93.709  1.00 36.39  ? 25   LEU A CG  1 
ATOM   175   C CD1 . LEU A  1 26  ? -15.604 -5.208  94.690  1.00 34.43  ? 25   LEU A CD1 1 
ATOM   176   C CD2 . LEU A  1 26  ? -18.077 -5.465  94.321  1.00 29.56  ? 25   LEU A CD2 1 
ATOM   177   N N   . VAL A  1 27  ? -18.862 -1.134  91.806  1.00 32.21  ? 26   VAL A N   1 
ATOM   178   C CA  . VAL A  1 27  ? -18.976 0.233   91.328  1.00 34.90  ? 26   VAL A CA  1 
ATOM   179   C C   . VAL A  1 27  ? -19.315 1.193   92.453  1.00 38.63  ? 26   VAL A C   1 
ATOM   180   O O   . VAL A  1 27  ? -20.218 0.943   93.251  1.00 31.56  ? 26   VAL A O   1 
ATOM   181   C CB  . VAL A  1 27  ? -20.086 0.349   90.280  1.00 35.05  ? 26   VAL A CB  1 
ATOM   182   C CG1 . VAL A  1 27  ? -20.274 1.793   89.858  1.00 34.32  ? 26   VAL A CG1 1 
ATOM   183   C CG2 . VAL A  1 27  ? -19.766 -0.510  89.088  1.00 46.07  ? 26   VAL A CG2 1 
ATOM   184   N N   . THR A  1 28  ? -18.600 2.308   92.503  1.00 30.68  ? 27   THR A N   1 
ATOM   185   C CA  . THR A  1 28  ? -18.917 3.356   93.459  1.00 38.68  ? 27   THR A CA  1 
ATOM   186   C C   . THR A  1 28  ? -18.685 4.723   92.824  1.00 37.07  ? 27   THR A C   1 
ATOM   187   O O   . THR A  1 28  ? -17.757 4.903   92.047  1.00 39.55  ? 27   THR A O   1 
ATOM   188   C CB  . THR A  1 28  ? -18.081 3.223   94.761  1.00 35.91  ? 27   THR A CB  1 
ATOM   189   O OG1 . THR A  1 28  ? -18.368 4.328   95.628  1.00 72.68  ? 27   THR A OG1 1 
ATOM   190   C CG2 . THR A  1 28  ? -16.608 3.222   94.464  1.00 41.80  ? 27   THR A CG2 1 
ATOM   191   N N   . TYR A  1 29  ? -19.542 5.684   93.142  1.00 38.19  ? 28   TYR A N   1 
ATOM   192   C CA  . TYR A  1 29  ? -19.377 7.035   92.632  1.00 32.05  ? 28   TYR A CA  1 
ATOM   193   C C   . TYR A  1 29  ? -19.093 8.015   93.763  1.00 40.60  ? 28   TYR A C   1 
ATOM   194   O O   . TYR A  1 29  ? -19.883 8.152   94.685  1.00 39.28  ? 28   TYR A O   1 
ATOM   195   C CB  . TYR A  1 29  ? -20.603 7.497   91.847  1.00 29.39  ? 28   TYR A CB  1 
ATOM   196   C CG  . TYR A  1 29  ? -20.438 8.910   91.326  1.00 43.22  ? 28   TYR A CG  1 
ATOM   197   C CD1 . TYR A  1 29  ? -19.479 9.204   90.360  1.00 44.58  ? 28   TYR A CD1 1 
ATOM   198   C CD2 . TYR A  1 29  ? -21.219 9.949   91.806  1.00 32.81  ? 28   TYR A CD2 1 
ATOM   199   C CE1 . TYR A  1 29  ? -19.311 10.493  89.882  1.00 40.53  ? 28   TYR A CE1 1 
ATOM   200   C CE2 . TYR A  1 29  ? -21.059 11.244  91.330  1.00 41.04  ? 28   TYR A CE2 1 
ATOM   201   C CZ  . TYR A  1 29  ? -20.103 11.509  90.373  1.00 41.52  ? 28   TYR A CZ  1 
ATOM   202   O OH  . TYR A  1 29  ? -19.932 12.791  89.898  1.00 41.00  ? 28   TYR A OH  1 
ATOM   203   N N   . ASP A  1 30  ? -17.950 8.687   93.683  1.00 37.15  ? 29   ASP A N   1 
ATOM   204   C CA  . ASP A  1 30  ? -17.577 9.693   94.663  1.00 38.48  ? 29   ASP A CA  1 
ATOM   205   C C   . ASP A  1 30  ? -17.999 11.067  94.147  1.00 45.29  ? 29   ASP A C   1 
ATOM   206   O O   . ASP A  1 30  ? -17.355 11.643  93.265  1.00 37.95  ? 29   ASP A O   1 
ATOM   207   C CB  . ASP A  1 30  ? -16.071 9.653   94.912  1.00 36.34  ? 29   ASP A CB  1 
ATOM   208   C CG  . ASP A  1 30  ? -15.628 10.658  95.955  1.00 51.49  ? 29   ASP A CG  1 
ATOM   209   O OD1 . ASP A  1 30  ? -14.555 10.447  96.554  1.00 44.00  ? 29   ASP A OD1 1 
ATOM   210   O OD2 . ASP A  1 30  ? -16.345 11.658  96.173  1.00 46.63  ? 29   ASP A OD2 1 
ATOM   211   N N   . LYS A  1 31  ? -19.087 11.580  94.706  1.00 45.80  ? 30   LYS A N   1 
ATOM   212   C CA  . LYS A  1 31  ? -19.689 12.830  94.260  1.00 53.25  ? 30   LYS A CA  1 
ATOM   213   C C   . LYS A  1 31  ? -18.767 14.024  94.501  1.00 52.28  ? 30   LYS A C   1 
ATOM   214   O O   . LYS A  1 31  ? -18.571 14.853  93.613  1.00 48.88  ? 30   LYS A O   1 
ATOM   215   C CB  . LYS A  1 31  ? -21.021 13.040  94.985  1.00 64.42  ? 30   LYS A CB  1 
ATOM   216   C CG  . LYS A  1 31  ? -21.981 13.975  94.274  1.00 74.10  ? 30   LYS A CG  1 
ATOM   217   C CD  . LYS A  1 31  ? -23.362 13.928  94.920  1.00 102.00 ? 30   LYS A CD  1 
ATOM   218   C CE  . LYS A  1 31  ? -24.399 14.667  94.088  1.00 107.58 ? 30   LYS A CE  1 
ATOM   219   N NZ  . LYS A  1 31  ? -24.045 16.098  93.897  1.00 97.03  ? 30   LYS A NZ  1 
ATOM   220   N N   . GLU A  1 32  ? -18.192 14.099  95.698  1.00 45.40  ? 31   GLU A N   1 
ATOM   221   C CA  . GLU A  1 32  ? -17.337 15.223  96.074  1.00 48.07  ? 31   GLU A CA  1 
ATOM   222   C C   . GLU A  1 32  ? -16.153 15.374  95.138  1.00 55.03  ? 31   GLU A C   1 
ATOM   223   O O   . GLU A  1 32  ? -15.759 16.486  94.797  1.00 45.96  ? 31   GLU A O   1 
ATOM   224   C CB  . GLU A  1 32  ? -16.806 15.049  97.498  1.00 58.40  ? 31   GLU A CB  1 
ATOM   225   C CG  . GLU A  1 32  ? -17.658 15.705  98.574  1.00 96.15  ? 31   GLU A CG  1 
ATOM   226   C CD  . GLU A  1 32  ? -18.863 14.869  98.969  1.00 117.42 ? 31   GLU A CD  1 
ATOM   227   O OE1 . GLU A  1 32  ? -19.040 13.763  98.408  1.00 98.68  ? 31   GLU A OE1 1 
ATOM   228   O OE2 . GLU A  1 32  ? -19.630 15.319  99.849  1.00 128.82 ? 31   GLU A OE2 1 
ATOM   229   N N   . ASN A  1 33  ? -15.576 14.251  94.729  1.00 46.94  ? 32   ASN A N   1 
ATOM   230   C CA  . ASN A  1 33  ? -14.370 14.279  93.917  1.00 37.04  ? 32   ASN A CA  1 
ATOM   231   C C   . ASN A  1 33  ? -14.618 14.048  92.431  1.00 26.84  ? 32   ASN A C   1 
ATOM   232   O O   . ASN A  1 33  ? -13.684 14.079  91.646  1.00 34.96  ? 32   ASN A O   1 
ATOM   233   C CB  . ASN A  1 33  ? -13.363 13.258  94.444  1.00 42.78  ? 32   ASN A CB  1 
ATOM   234   C CG  . ASN A  1 33  ? -12.774 13.663  95.780  1.00 49.56  ? 32   ASN A CG  1 
ATOM   235   O OD1 . ASN A  1 33  ? -12.274 14.773  95.932  1.00 48.62  ? 32   ASN A OD1 1 
ATOM   236   N ND2 . ASN A  1 33  ? -12.840 12.766  96.762  1.00 42.62  ? 32   ASN A ND2 1 
ATOM   237   N N   . GLY A  1 34  ? -15.871 13.817  92.053  1.00 33.83  ? 33   GLY A N   1 
ATOM   238   C CA  . GLY A  1 34  ? -16.221 13.571  90.665  1.00 36.79  ? 33   GLY A CA  1 
ATOM   239   C C   . GLY A  1 34  ? -15.498 12.376  90.062  1.00 43.48  ? 33   GLY A C   1 
ATOM   240   O O   . GLY A  1 34  ? -14.874 12.485  88.999  1.00 40.28  ? 33   GLY A O   1 
ATOM   241   N N   . MET A  1 35  ? -15.590 11.228  90.727  1.00 31.16  ? 34   MET A N   1 
ATOM   242   C CA  . MET A  1 35  ? -14.914 10.025  90.252  1.00 35.48  ? 34   MET A CA  1 
ATOM   243   C C   . MET A  1 35  ? -15.833 8.811   90.227  1.00 35.41  ? 34   MET A C   1 
ATOM   244   O O   . MET A  1 35  ? -16.339 8.381   91.255  1.00 31.99  ? 34   MET A O   1 
ATOM   245   C CB  . MET A  1 35  ? -13.702 9.729   91.124  1.00 27.14  ? 34   MET A CB  1 
ATOM   246   C CG  . MET A  1 35  ? -12.665 10.808  91.071  1.00 31.36  ? 34   MET A CG  1 
ATOM   247   S SD  . MET A  1 35  ? -11.291 10.451  92.153  1.00 38.04  ? 34   MET A SD  1 
ATOM   248   C CE  . MET A  1 35  ? -10.267 11.895  91.922  1.00 33.52  ? 34   MET A CE  1 
ATOM   249   N N   . HIS A  1 36  ? -16.059 8.282   89.031  1.00 30.15  ? 35   HIS A N   1 
ATOM   250   C CA  . HIS A  1 36  ? -16.760 7.031   88.863  1.00 30.69  ? 35   HIS A CA  1 
ATOM   251   C C   . HIS A  1 36  ? -15.713 5.922   88.940  1.00 34.76  ? 35   HIS A C   1 
ATOM   252   O O   . HIS A  1 36  ? -14.794 5.866   88.134  1.00 33.10  ? 35   HIS A O   1 
ATOM   253   C CB  . HIS A  1 36  ? -17.487 7.011   87.522  1.00 32.11  ? 35   HIS A CB  1 
ATOM   254   C CG  . HIS A  1 36  ? -18.275 5.765   87.281  1.00 37.86  ? 35   HIS A CG  1 
ATOM   255   N ND1 . HIS A  1 36  ? -18.030 4.920   86.220  1.00 44.88  ? 35   HIS A ND1 1 
ATOM   256   C CD2 . HIS A  1 36  ? -19.310 5.217   87.965  1.00 32.76  ? 35   HIS A CD2 1 
ATOM   257   C CE1 . HIS A  1 36  ? -18.873 3.905   86.263  1.00 36.12  ? 35   HIS A CE1 1 
ATOM   258   N NE2 . HIS A  1 36  ? -19.661 4.063   87.306  1.00 39.97  ? 35   HIS A NE2 1 
ATOM   259   N N   . LYS A  1 37  ? -15.832 5.058   89.938  1.00 33.06  ? 36   LYS A N   1 
ATOM   260   C CA  . LYS A  1 37  ? -14.817 4.046   90.181  1.00 29.71  ? 36   LYS A CA  1 
ATOM   261   C C   . LYS A  1 37  ? -15.396 2.653   89.984  1.00 37.63  ? 36   LYS A C   1 
ATOM   262   O O   . LYS A  1 37  ? -16.449 2.316   90.523  1.00 39.07  ? 36   LYS A O   1 
ATOM   263   C CB  . LYS A  1 37  ? -14.230 4.211   91.581  1.00 33.82  ? 36   LYS A CB  1 
ATOM   264   C CG  . LYS A  1 37  ? -13.658 5.604   91.803  1.00 41.93  ? 36   LYS A CG  1 
ATOM   265   C CD  . LYS A  1 37  ? -12.865 5.711   93.088  1.00 36.56  ? 36   LYS A CD  1 
ATOM   266   C CE  . LYS A  1 37  ? -13.761 5.609   94.290  1.00 36.57  ? 36   LYS A CE  1 
ATOM   267   N NZ  . LYS A  1 37  ? -12.977 5.814   95.525  1.00 47.57  ? 36   LYS A NZ  1 
ATOM   268   N N   . LYS A  1 38  ? -14.708 1.851   89.183  1.00 31.91  ? 37   LYS A N   1 
ATOM   269   C CA  . LYS A  1 38  ? -15.185 0.521   88.873  1.00 34.25  ? 37   LYS A CA  1 
ATOM   270   C C   . LYS A  1 38  ? -14.026 -0.455  88.981  1.00 34.49  ? 37   LYS A C   1 
ATOM   271   O O   . LYS A  1 38  ? -12.962 -0.242  88.400  1.00 28.45  ? 37   LYS A O   1 
ATOM   272   C CB  . LYS A  1 38  ? -15.794 0.477   87.467  1.00 35.35  ? 37   LYS A CB  1 
ATOM   273   C CG  . LYS A  1 38  ? -16.678 -0.738  87.211  1.00 41.98  ? 37   LYS A CG  1 
ATOM   274   C CD  . LYS A  1 38  ? -15.871 -1.972  86.901  1.00 38.31  ? 37   LYS A CD  1 
ATOM   275   C CE  . LYS A  1 38  ? -15.788 -2.217  85.408  1.00 45.48  ? 37   LYS A CE  1 
ATOM   276   N NZ  . LYS A  1 38  ? -17.115 -2.556  84.824  1.00 37.26  ? 37   LYS A NZ  1 
ATOM   277   N N   . VAL A  1 39  ? -14.233 -1.509  89.756  1.00 37.15  ? 38   VAL A N   1 
ATOM   278   C CA  . VAL A  1 39  ? -13.291 -2.619  89.822  1.00 29.35  ? 38   VAL A CA  1 
ATOM   279   C C   . VAL A  1 39  ? -13.929 -3.795  89.110  1.00 36.98  ? 38   VAL A C   1 
ATOM   280   O O   . VAL A  1 39  ? -15.075 -4.164  89.395  1.00 34.66  ? 38   VAL A O   1 
ATOM   281   C CB  . VAL A  1 39  ? -12.976 -3.021  91.277  1.00 43.03  ? 38   VAL A CB  1 
ATOM   282   C CG1 . VAL A  1 39  ? -12.249 -4.357  91.317  1.00 36.59  ? 38   VAL A CG1 1 
ATOM   283   C CG2 . VAL A  1 39  ? -12.146 -1.944  91.954  1.00 38.58  ? 38   VAL A CG2 1 
ATOM   284   N N   . PHE A  1 40  ? -13.205 -4.362  88.153  1.00 29.90  ? 39   PHE A N   1 
ATOM   285   C CA  . PHE A  1 40  ? -13.601 -5.621  87.563  1.00 28.67  ? 39   PHE A CA  1 
ATOM   286   C C   . PHE A  1 40  ? -12.568 -6.664  87.972  1.00 30.68  ? 39   PHE A C   1 
ATOM   287   O O   . PHE A  1 40  ? -11.391 -6.539  87.652  1.00 30.77  ? 39   PHE A O   1 
ATOM   288   C CB  . PHE A  1 40  ? -13.694 -5.516  86.040  1.00 28.50  ? 39   PHE A CB  1 
ATOM   289   C CG  . PHE A  1 40  ? -14.006 -6.820  85.373  1.00 38.72  ? 39   PHE A CG  1 
ATOM   290   C CD1 . PHE A  1 40  ? -15.309 -7.277  85.298  1.00 38.38  ? 39   PHE A CD1 1 
ATOM   291   C CD2 . PHE A  1 40  ? -12.993 -7.604  84.843  1.00 44.51  ? 39   PHE A CD2 1 
ATOM   292   C CE1 . PHE A  1 40  ? -15.604 -8.490  84.694  1.00 45.18  ? 39   PHE A CE1 1 
ATOM   293   C CE2 . PHE A  1 40  ? -13.282 -8.816  84.232  1.00 47.91  ? 39   PHE A CE2 1 
ATOM   294   C CZ  . PHE A  1 40  ? -14.589 -9.260  84.158  1.00 31.81  ? 39   PHE A CZ  1 
ATOM   295   N N   . TYR A  1 41  ? -12.998 -7.694  88.684  1.00 23.80  ? 40   TYR A N   1 
ATOM   296   C CA  . TYR A  1 41  ? -12.039 -8.665  89.200  1.00 28.46  ? 40   TYR A CA  1 
ATOM   297   C C   . TYR A  1 41  ? -12.299 -10.071 88.666  1.00 31.62  ? 40   TYR A C   1 
ATOM   298   O O   . TYR A  1 41  ? -13.425 -10.411 88.291  1.00 33.89  ? 40   TYR A O   1 
ATOM   299   C CB  . TYR A  1 41  ? -12.043 -8.664  90.735  1.00 30.75  ? 40   TYR A CB  1 
ATOM   300   C CG  . TYR A  1 41  ? -13.310 -9.218  91.374  1.00 34.62  ? 40   TYR A CG  1 
ATOM   301   C CD1 . TYR A  1 41  ? -13.493 -10.588 91.530  1.00 34.35  ? 40   TYR A CD1 1 
ATOM   302   C CD2 . TYR A  1 41  ? -14.304 -8.366  91.845  1.00 31.03  ? 40   TYR A CD2 1 
ATOM   303   C CE1 . TYR A  1 41  ? -14.648 -11.099 92.132  1.00 32.01  ? 40   TYR A CE1 1 
ATOM   304   C CE2 . TYR A  1 41  ? -15.449 -8.855  92.436  1.00 32.25  ? 40   TYR A CE2 1 
ATOM   305   C CZ  . TYR A  1 41  ? -15.622 -10.232 92.573  1.00 40.34  ? 40   TYR A CZ  1 
ATOM   306   O OH  . TYR A  1 41  ? -16.768 -10.722 93.164  1.00 36.15  ? 40   TYR A OH  1 
ATOM   307   N N   . SER A  1 42  ? -11.242 -10.880 88.630  1.00 28.52  ? 41   SER A N   1 
ATOM   308   C CA  . SER A  1 42  ? -11.336 -12.262 88.159  1.00 31.33  ? 41   SER A CA  1 
ATOM   309   C C   . SER A  1 42  ? -10.434 -13.157 88.989  1.00 29.46  ? 41   SER A C   1 
ATOM   310   O O   . SER A  1 42  ? -9.222  -12.958 89.020  1.00 29.61  ? 41   SER A O   1 
ATOM   311   C CB  . SER A  1 42  ? -10.912 -12.368 86.685  1.00 30.16  ? 41   SER A CB  1 
ATOM   312   O OG  . SER A  1 42  ? -11.634 -11.457 85.872  1.00 38.51  ? 41   SER A OG  1 
ATOM   313   N N   . PHE A  1 43  ? -11.026 -14.146 89.651  1.00 25.75  ? 42   PHE A N   1 
ATOM   314   C CA  . PHE A  1 43  ? -10.266 -15.157 90.376  1.00 29.26  ? 42   PHE A CA  1 
ATOM   315   C C   . PHE A  1 43  ? -9.963  -16.333 89.459  1.00 34.07  ? 42   PHE A C   1 
ATOM   316   O O   . PHE A  1 43  ? -10.865 -16.953 88.900  1.00 34.07  ? 42   PHE A O   1 
ATOM   317   C CB  . PHE A  1 43  ? -11.045 -15.658 91.599  1.00 27.23  ? 42   PHE A CB  1 
ATOM   318   C CG  . PHE A  1 43  ? -11.081 -14.681 92.743  1.00 26.05  ? 42   PHE A CG  1 
ATOM   319   C CD1 . PHE A  1 43  ? -12.143 -13.800 92.890  1.00 23.79  ? 42   PHE A CD1 1 
ATOM   320   C CD2 . PHE A  1 43  ? -10.054 -14.645 93.668  1.00 26.58  ? 42   PHE A CD2 1 
ATOM   321   C CE1 . PHE A  1 43  ? -12.183 -12.901 93.957  1.00 26.88  ? 42   PHE A CE1 1 
ATOM   322   C CE2 . PHE A  1 43  ? -10.082 -13.757 94.735  1.00 32.97  ? 42   PHE A CE2 1 
ATOM   323   C CZ  . PHE A  1 43  ? -11.154 -12.878 94.877  1.00 31.53  ? 42   PHE A CZ  1 
ATOM   324   N N   . ILE A  1 44  ? -8.682  -16.630 89.302  1.00 29.25  ? 43   ILE A N   1 
ATOM   325   C CA  . ILE A  1 44  ? -8.261  -17.764 88.507  1.00 34.31  ? 43   ILE A CA  1 
ATOM   326   C C   . ILE A  1 44  ? -7.530  -18.738 89.411  1.00 34.61  ? 43   ILE A C   1 
ATOM   327   O O   . ILE A  1 44  ? -6.443  -18.446 89.900  1.00 33.70  ? 43   ILE A O   1 
ATOM   328   C CB  . ILE A  1 44  ? -7.316  -17.333 87.371  1.00 32.39  ? 43   ILE A CB  1 
ATOM   329   C CG1 . ILE A  1 44  ? -7.969  -16.248 86.527  1.00 27.47  ? 43   ILE A CG1 1 
ATOM   330   C CG2 . ILE A  1 44  ? -6.956  -18.538 86.501  1.00 37.51  ? 43   ILE A CG2 1 
ATOM   331   C CD1 . ILE A  1 44  ? -7.093  -15.759 85.405  1.00 38.47  ? 43   ILE A CD1 1 
ATOM   332   N N   . ASP A  1 45  ? -8.138  -19.892 89.648  1.00 34.41  ? 44   ASP A N   1 
ATOM   333   C CA  . ASP A  1 45  ? -7.511  -20.914 90.458  1.00 37.34  ? 44   ASP A CA  1 
ATOM   334   C C   . ASP A  1 45  ? -7.183  -22.108 89.559  1.00 45.12  ? 44   ASP A C   1 
ATOM   335   O O   . ASP A  1 45  ? -7.934  -23.079 89.492  1.00 39.39  ? 44   ASP A O   1 
ATOM   336   C CB  . ASP A  1 45  ? -8.432  -21.330 91.605  1.00 45.43  ? 44   ASP A CB  1 
ATOM   337   C CG  . ASP A  1 45  ? -7.766  -22.309 92.577  1.00 58.80  ? 44   ASP A CG  1 
ATOM   338   O OD1 . ASP A  1 45  ? -8.456  -22.803 93.497  1.00 55.02  ? 44   ASP A OD1 1 
ATOM   339   O OD2 . ASP A  1 45  ? -6.558  -22.585 92.422  1.00 50.82  ? 44   ASP A OD2 1 
ATOM   340   N N   . ASP A  1 46  ? -6.065  -22.001 88.849  1.00 38.07  ? 45   ASP A N   1 
ATOM   341   C CA  . ASP A  1 46  ? -5.587  -23.042 87.952  1.00 32.26  ? 45   ASP A CA  1 
ATOM   342   C C   . ASP A  1 46  ? -4.759  -24.045 88.749  1.00 36.96  ? 45   ASP A C   1 
ATOM   343   O O   . ASP A  1 46  ? -3.691  -23.705 89.252  1.00 35.01  ? 45   ASP A O   1 
ATOM   344   C CB  . ASP A  1 46  ? -4.726  -22.397 86.869  1.00 40.70  ? 45   ASP A CB  1 
ATOM   345   C CG  . ASP A  1 46  ? -4.205  -23.396 85.849  1.00 47.93  ? 45   ASP A CG  1 
ATOM   346   O OD1 . ASP A  1 46  ? -3.678  -22.939 84.819  1.00 48.60  ? 45   ASP A OD1 1 
ATOM   347   O OD2 . ASP A  1 46  ? -4.317  -24.623 86.065  1.00 50.06  ? 45   ASP A OD2 1 
ATOM   348   N N   . LYS A  1 47  ? -5.247  -25.278 88.862  1.00 27.63  ? 46   LYS A N   1 
ATOM   349   C CA  . LYS A  1 47  ? -4.587  -26.291 89.693  1.00 37.74  ? 46   LYS A CA  1 
ATOM   350   C C   . LYS A  1 47  ? -3.180  -26.644 89.210  1.00 34.18  ? 46   LYS A C   1 
ATOM   351   O O   . LYS A  1 47  ? -2.389  -27.190 89.972  1.00 41.59  ? 46   LYS A O   1 
ATOM   352   C CB  . LYS A  1 47  ? -5.429  -27.565 89.765  1.00 42.42  ? 46   LYS A CB  1 
ATOM   353   C CG  . LYS A  1 47  ? -6.797  -27.378 90.395  1.00 46.93  ? 46   LYS A CG  1 
ATOM   354   C CD  . LYS A  1 47  ? -6.696  -26.792 91.785  1.00 56.88  ? 46   LYS A CD  1 
ATOM   355   C CE  . LYS A  1 47  ? -8.073  -26.663 92.421  1.00 65.96  ? 46   LYS A CE  1 
ATOM   356   N NZ  . LYS A  1 47  ? -7.994  -26.040 93.762  1.00 59.07  ? 46   LYS A NZ  1 
ATOM   357   N N   . ASN A  1 48  ? -2.880  -26.331 87.953  1.00 31.85  ? 47   ASN A N   1 
ATOM   358   C CA  . ASN A  1 48  ? -1.548  -26.556 87.395  1.00 35.32  ? 47   ASN A CA  1 
ATOM   359   C C   . ASN A  1 48  ? -0.634  -25.341 87.555  1.00 39.44  ? 47   ASN A C   1 
ATOM   360   O O   . ASN A  1 48  ? 0.471   -25.320 87.018  1.00 41.41  ? 47   ASN A O   1 
ATOM   361   C CB  . ASN A  1 48  ? -1.654  -26.946 85.912  1.00 37.96  ? 47   ASN A CB  1 
ATOM   362   C CG  . ASN A  1 48  ? -2.332  -28.292 85.711  1.00 49.98  ? 47   ASN A CG  1 
ATOM   363   O OD1 . ASN A  1 48  ? -2.088  -29.232 86.457  1.00 39.96  ? 47   ASN A OD1 1 
ATOM   364   N ND2 . ASN A  1 48  ? -3.191  -28.385 84.706  1.00 44.82  ? 47   ASN A ND2 1 
ATOM   365   N N   . HIS A  1 49  ? -1.105  -24.328 88.281  1.00 29.58  ? 48   HIS A N   1 
ATOM   366   C CA  . HIS A  1 49  ? -0.299  -23.144 88.584  1.00 30.64  ? 48   HIS A CA  1 
ATOM   367   C C   . HIS A  1 49  ? 0.003   -23.156 90.076  1.00 31.63  ? 48   HIS A C   1 
ATOM   368   O O   . HIS A  1 49  ? -0.843  -23.561 90.868  1.00 33.24  ? 48   HIS A O   1 
ATOM   369   C CB  . HIS A  1 49  ? -1.072  -21.875 88.204  1.00 25.90  ? 48   HIS A CB  1 
ATOM   370   C CG  . HIS A  1 49  ? -0.236  -20.639 88.189  1.00 31.52  ? 48   HIS A CG  1 
ATOM   371   N ND1 . HIS A  1 49  ? 0.880   -20.506 87.396  1.00 35.17  ? 48   HIS A ND1 1 
ATOM   372   C CD2 . HIS A  1 49  ? -0.353  -19.472 88.869  1.00 31.38  ? 48   HIS A CD2 1 
ATOM   373   C CE1 . HIS A  1 49  ? 1.415   -19.315 87.587  1.00 35.00  ? 48   HIS A CE1 1 
ATOM   374   N NE2 . HIS A  1 49  ? 0.687   -18.669 88.479  1.00 34.08  ? 48   HIS A NE2 1 
ATOM   375   N N   . ASN A  1 50  ? 1.195   -22.720 90.467  1.00 32.97  ? 49   ASN A N   1 
ATOM   376   C CA  . ASN A  1 50  ? 1.616   -22.817 91.869  1.00 31.53  ? 49   ASN A CA  1 
ATOM   377   C C   . ASN A  1 50  ? 0.931   -21.834 92.828  1.00 37.04  ? 49   ASN A C   1 
ATOM   378   O O   . ASN A  1 50  ? 1.141   -21.920 94.040  1.00 46.16  ? 49   ASN A O   1 
ATOM   379   C CB  . ASN A  1 50  ? 3.130   -22.637 91.985  1.00 33.46  ? 49   ASN A CB  1 
ATOM   380   C CG  . ASN A  1 50  ? 3.561   -21.180 91.837  1.00 34.38  ? 49   ASN A CG  1 
ATOM   381   O OD1 . ASN A  1 50  ? 2.816   -20.346 91.327  1.00 30.09  ? 49   ASN A OD1 1 
ATOM   382   N ND2 . ASN A  1 50  ? 4.767   -20.875 92.281  1.00 34.92  ? 49   ASN A ND2 1 
ATOM   383   N N   . LYS A  1 51  ? 0.123   -20.910 92.306  1.00 35.11  ? 50   LYS A N   1 
ATOM   384   C CA  . LYS A  1 51  ? -0.559  -19.919 93.157  1.00 32.34  ? 50   LYS A CA  1 
ATOM   385   C C   . LYS A  1 51  ? -1.987  -19.681 92.685  1.00 35.28  ? 50   LYS A C   1 
ATOM   386   O O   . LYS A  1 51  ? -2.305  -19.876 91.508  1.00 31.45  ? 50   LYS A O   1 
ATOM   387   C CB  . LYS A  1 51  ? 0.156   -18.557 93.085  1.00 42.80  ? 50   LYS A CB  1 
ATOM   388   C CG  . LYS A  1 51  ? 1.626   -18.551 93.442  1.00 36.95  ? 50   LYS A CG  1 
ATOM   389   C CD  . LYS A  1 51  ? 1.841   -18.356 94.906  1.00 48.84  ? 50   LYS A CD  1 
ATOM   390   C CE  . LYS A  1 51  ? 3.314   -18.321 95.246  1.00 44.08  ? 50   LYS A CE  1 
ATOM   391   N NZ  . LYS A  1 51  ? 4.000   -17.182 94.619  1.00 47.14  ? 50   LYS A NZ  1 
ATOM   392   N N   . LYS A  1 52  ? -2.836  -19.211 93.592  1.00 27.73  ? 51   LYS A N   1 
ATOM   393   C CA  . LYS A  1 52  ? -4.113  -18.629 93.208  1.00 30.15  ? 51   LYS A CA  1 
ATOM   394   C C   . LYS A  1 52  ? -3.843  -17.246 92.639  1.00 32.00  ? 51   LYS A C   1 
ATOM   395   O O   . LYS A  1 52  ? -2.931  -16.557 93.086  1.00 29.93  ? 51   LYS A O   1 
ATOM   396   C CB  . LYS A  1 52  ? -5.046  -18.478 94.413  1.00 33.06  ? 51   LYS A CB  1 
ATOM   397   C CG  . LYS A  1 52  ? -5.592  -19.768 94.990  1.00 52.97  ? 51   LYS A CG  1 
ATOM   398   C CD  . LYS A  1 52  ? -6.453  -19.459 96.225  1.00 55.32  ? 51   LYS A CD  1 
ATOM   399   C CE  . LYS A  1 52  ? -7.011  -20.712 96.865  1.00 68.63  ? 51   LYS A CE  1 
ATOM   400   N NZ  . LYS A  1 52  ? -7.752  -20.393 98.121  1.00 60.09  ? 51   LYS A NZ  1 
ATOM   401   N N   . LEU A  1 53  ? -4.652  -16.830 91.677  1.00 33.08  ? 52   LEU A N   1 
ATOM   402   C CA  . LEU A  1 53  ? -4.461  -15.532 91.024  1.00 38.56  ? 52   LEU A CA  1 
ATOM   403   C C   . LEU A  1 53  ? -5.728  -14.697 91.097  1.00 35.57  ? 52   LEU A C   1 
ATOM   404   O O   . LEU A  1 53  ? -6.831  -15.218 90.957  1.00 30.92  ? 52   LEU A O   1 
ATOM   405   C CB  . LEU A  1 53  ? -4.087  -15.724 89.554  1.00 28.89  ? 52   LEU A CB  1 
ATOM   406   C CG  . LEU A  1 53  ? -2.607  -15.580 89.202  1.00 52.46  ? 52   LEU A CG  1 
ATOM   407   C CD1 . LEU A  1 53  ? -1.797  -16.618 89.934  1.00 60.21  ? 52   LEU A CD1 1 
ATOM   408   C CD2 . LEU A  1 53  ? -2.408  -15.695 87.700  1.00 47.48  ? 52   LEU A CD2 1 
ATOM   409   N N   . LEU A  1 54  ? -5.555  -13.398 91.311  1.00 32.44  ? 53   LEU A N   1 
ATOM   410   C CA  . LEU A  1 54  ? -6.642  -12.441 91.212  1.00 32.41  ? 53   LEU A CA  1 
ATOM   411   C C   . LEU A  1 54  ? -6.238  -11.344 90.232  1.00 37.20  ? 53   LEU A C   1 
ATOM   412   O O   . LEU A  1 54  ? -5.207  -10.700 90.412  1.00 34.00  ? 53   LEU A O   1 
ATOM   413   C CB  . LEU A  1 54  ? -6.930  -11.822 92.579  1.00 32.08  ? 53   LEU A CB  1 
ATOM   414   C CG  . LEU A  1 54  ? -7.941  -10.672 92.589  1.00 39.36  ? 53   LEU A CG  1 
ATOM   415   C CD1 . LEU A  1 54  ? -9.311  -11.154 92.153  1.00 29.18  ? 53   LEU A CD1 1 
ATOM   416   C CD2 . LEU A  1 54  ? -8.027  -10.035 93.974  1.00 34.11  ? 53   LEU A CD2 1 
ATOM   417   N N   . VAL A  1 55  ? -7.033  -11.145 89.186  1.00 26.52  ? 54   VAL A N   1 
ATOM   418   C CA  . VAL A  1 55  ? -6.789  -10.051 88.263  1.00 23.48  ? 54   VAL A CA  1 
ATOM   419   C C   . VAL A  1 55  ? -7.756  -8.916  88.581  1.00 32.02  ? 54   VAL A C   1 
ATOM   420   O O   . VAL A  1 55  ? -8.973  -9.095  88.529  1.00 27.94  ? 54   VAL A O   1 
ATOM   421   C CB  . VAL A  1 55  ? -6.960  -10.480 86.798  1.00 32.57  ? 54   VAL A CB  1 
ATOM   422   C CG1 . VAL A  1 55  ? -6.602  -9.326  85.861  1.00 28.40  ? 54   VAL A CG1 1 
ATOM   423   C CG2 . VAL A  1 55  ? -6.086  -11.677 86.502  1.00 27.82  ? 54   VAL A CG2 1 
ATOM   424   N N   . ILE A  1 56  ? -7.207  -7.757  88.934  1.00 27.86  ? 55   ILE A N   1 
ATOM   425   C CA  . ILE A  1 56  ? -8.018  -6.577  89.228  1.00 28.78  ? 55   ILE A CA  1 
ATOM   426   C C   . ILE A  1 56  ? -7.860  -5.532  88.140  1.00 28.44  ? 55   ILE A C   1 
ATOM   427   O O   . ILE A  1 56  ? -6.758  -5.026  87.902  1.00 29.95  ? 55   ILE A O   1 
ATOM   428   C CB  . ILE A  1 56  ? -7.599  -5.936  90.560  1.00 31.79  ? 55   ILE A CB  1 
ATOM   429   C CG1 . ILE A  1 56  ? -7.827  -6.921  91.704  1.00 31.44  ? 55   ILE A CG1 1 
ATOM   430   C CG2 . ILE A  1 56  ? -8.368  -4.632  90.795  1.00 29.38  ? 55   ILE A CG2 1 
ATOM   431   C CD1 . ILE A  1 56  ? -7.333  -6.422  93.038  1.00 43.75  ? 55   ILE A CD1 1 
ATOM   432   N N   . ARG A  1 57  ? -8.961  -5.207  87.479  1.00 31.82  ? 56   ARG A N   1 
ATOM   433   C CA  . ARG A  1 57  ? -8.958  -4.132  86.495  1.00 29.49  ? 56   ARG A CA  1 
ATOM   434   C C   . ARG A  1 57  ? -9.617  -2.890  87.088  1.00 37.33  ? 56   ARG A C   1 
ATOM   435   O O   . ARG A  1 57  ? -10.780 -2.915  87.485  1.00 32.98  ? 56   ARG A O   1 
ATOM   436   C CB  . ARG A  1 57  ? -9.664  -4.572  85.213  1.00 35.78  ? 56   ARG A CB  1 
ATOM   437   C CG  . ARG A  1 57  ? -8.906  -5.667  84.453  1.00 40.08  ? 56   ARG A CG  1 
ATOM   438   C CD  . ARG A  1 57  ? -9.466  -5.903  83.058  1.00 60.78  ? 56   ARG A CD  1 
ATOM   439   N NE  . ARG A  1 57  ? -8.579  -6.752  82.263  1.00 71.45  ? 56   ARG A NE  1 
ATOM   440   C CZ  . ARG A  1 57  ? -8.583  -8.083  82.296  1.00 59.07  ? 56   ARG A CZ  1 
ATOM   441   N NH1 . ARG A  1 57  ? -7.734  -8.770  81.547  1.00 75.47  ? 56   ARG A NH1 1 
ATOM   442   N NH2 . ARG A  1 57  ? -9.427  -8.734  83.082  1.00 55.31  ? 56   ARG A NH2 1 
ATOM   443   N N   . THR A  1 58  ? -8.857  -1.807  87.173  1.00 36.76  ? 57   THR A N   1 
ATOM   444   C CA  . THR A  1 58  ? -9.384  -0.541  87.670  1.00 32.93  ? 57   THR A CA  1 
ATOM   445   C C   . THR A  1 58  ? -9.823  0.312   86.489  1.00 36.61  ? 57   THR A C   1 
ATOM   446   O O   . THR A  1 58  ? -9.002  0.702   85.662  1.00 35.24  ? 57   THR A O   1 
ATOM   447   C CB  . THR A  1 58  ? -8.327  0.205   88.485  1.00 29.44  ? 57   THR A CB  1 
ATOM   448   O OG1 . THR A  1 58  ? -7.095  0.249   87.750  1.00 32.76  ? 57   THR A OG1 1 
ATOM   449   C CG2 . THR A  1 58  ? -8.079  -0.507  89.799  1.00 31.05  ? 57   THR A CG2 1 
ATOM   450   N N   . LYS A  1 59  ? -11.124 0.578   86.410  1.00 27.98  ? 58   LYS A N   1 
ATOM   451   C CA  . LYS A  1 59  ? -11.711 1.322   85.302  1.00 28.52  ? 58   LYS A CA  1 
ATOM   452   C C   . LYS A  1 59  ? -12.506 2.496   85.859  1.00 30.74  ? 58   LYS A C   1 
ATOM   453   O O   . LYS A  1 59  ? -12.144 3.047   86.890  1.00 32.26  ? 58   LYS A O   1 
ATOM   454   C CB  . LYS A  1 59  ? -12.598 0.410   84.443  1.00 30.31  ? 58   LYS A CB  1 
ATOM   455   C CG  . LYS A  1 59  ? -11.918 -0.895  84.040  1.00 34.64  ? 58   LYS A CG  1 
ATOM   456   C CD  . LYS A  1 59  ? -12.788 -1.746  83.124  1.00 43.95  ? 58   LYS A CD  1 
ATOM   457   C CE  . LYS A  1 59  ? -12.833 -1.174  81.724  1.00 53.46  ? 58   LYS A CE  1 
ATOM   458   N NZ  . LYS A  1 59  ? -13.570 -2.047  80.777  1.00 51.52  ? 58   LYS A NZ  1 
ATOM   459   N N   . GLY A  1 60  ? -13.592 2.868   85.193  1.00 26.63  ? 59   GLY A N   1 
ATOM   460   C CA  . GLY A  1 60  ? -14.359 4.037   85.586  1.00 31.70  ? 59   GLY A CA  1 
ATOM   461   C C   . GLY A  1 60  ? -13.878 5.299   84.885  1.00 35.21  ? 59   GLY A C   1 
ATOM   462   O O   . GLY A  1 60  ? -13.266 5.227   83.817  1.00 33.53  ? 59   GLY A O   1 
ATOM   463   N N   . THR A  1 61  ? -14.173 6.461   85.469  1.00 33.11  ? 60   THR A N   1 
ATOM   464   C CA  . THR A  1 61  ? -13.779 7.735   84.883  1.00 27.41  ? 60   THR A CA  1 
ATOM   465   C C   . THR A  1 61  ? -13.517 8.790   85.951  1.00 35.67  ? 60   THR A C   1 
ATOM   466   O O   . THR A  1 61  ? -14.345 9.019   86.823  1.00 31.82  ? 60   THR A O   1 
ATOM   467   C CB  . THR A  1 61  ? -14.858 8.295   83.928  1.00 37.70  ? 60   THR A CB  1 
ATOM   468   O OG1 . THR A  1 61  ? -15.078 7.381   82.847  1.00 40.87  ? 60   THR A OG1 1 
ATOM   469   C CG2 . THR A  1 61  ? -14.409 9.651   83.341  1.00 34.47  ? 60   THR A CG2 1 
ATOM   470   N N   . ILE A  1 62  ? -12.353 9.425   85.871  1.00 28.67  ? 61   ILE A N   1 
ATOM   471   C CA  . ILE A  1 62  ? -12.039 10.579  86.699  1.00 31.69  ? 61   ILE A CA  1 
ATOM   472   C C   . ILE A  1 62  ? -12.360 11.830  85.892  1.00 33.40  ? 61   ILE A C   1 
ATOM   473   O O   . ILE A  1 62  ? -11.700 12.099  84.887  1.00 25.48  ? 61   ILE A O   1 
ATOM   474   C CB  . ILE A  1 62  ? -10.553 10.581  87.090  1.00 30.26  ? 61   ILE A CB  1 
ATOM   475   C CG1 . ILE A  1 62  ? -10.219 9.308   87.875  1.00 27.84  ? 61   ILE A CG1 1 
ATOM   476   C CG2 . ILE A  1 62  ? -10.206 11.819  87.902  1.00 25.67  ? 61   ILE A CG2 1 
ATOM   477   C CD1 . ILE A  1 62  ? -8.736  9.096   88.082  1.00 27.80  ? 61   ILE A CD1 1 
ATOM   478   N N   . ALA A  1 63  ? -13.384 12.577  86.311  1.00 23.74  ? 62   ALA A N   1 
ATOM   479   C CA  . ALA A  1 63  ? -13.784 13.783  85.593  1.00 30.50  ? 62   ALA A CA  1 
ATOM   480   C C   . ALA A  1 63  ? -12.590 14.718  85.538  1.00 26.93  ? 62   ALA A C   1 
ATOM   481   O O   . ALA A  1 63  ? -11.761 14.697  86.437  1.00 28.02  ? 62   ALA A O   1 
ATOM   482   C CB  . ALA A  1 63  ? -14.969 14.444  86.268  1.00 26.33  ? 62   ALA A CB  1 
ATOM   483   N N   . GLY A  1 64  ? -12.476 15.495  84.465  1.00 38.63  ? 63   GLY A N   1 
ATOM   484   C CA  . GLY A  1 64  ? -11.391 16.457  84.333  1.00 32.60  ? 63   GLY A CA  1 
ATOM   485   C C   . GLY A  1 64  ? -11.601 17.689  85.209  1.00 35.96  ? 63   GLY A C   1 
ATOM   486   O O   . GLY A  1 64  ? -10.719 18.068  85.978  1.00 32.43  ? 63   GLY A O   1 
ATOM   487   N N   . GLN A  1 65  ? -12.767 18.316  85.074  1.00 30.54  ? 64   GLN A N   1 
ATOM   488   C CA  . GLN A  1 65  ? -13.151 19.462  85.909  1.00 52.22  ? 64   GLN A CA  1 
ATOM   489   C C   . GLN A  1 65  ? -12.325 20.724  85.626  1.00 43.56  ? 64   GLN A C   1 
ATOM   490   O O   . GLN A  1 65  ? -11.898 21.417  86.534  1.00 44.51  ? 64   GLN A O   1 
ATOM   491   C CB  . GLN A  1 65  ? -13.078 19.080  87.389  1.00 35.72  ? 64   GLN A CB  1 
ATOM   492   C CG  . GLN A  1 65  ? -14.058 17.977  87.751  1.00 41.23  ? 64   GLN A CG  1 
ATOM   493   C CD  . GLN A  1 65  ? -14.160 17.731  89.239  1.00 37.94  ? 64   GLN A CD  1 
ATOM   494   O OE1 . GLN A  1 65  ? -13.256 18.065  90.003  1.00 57.02  ? 64   GLN A OE1 1 
ATOM   495   N NE2 . GLN A  1 65  ? -15.266 17.136  89.657  1.00 42.58  ? 64   GLN A NE2 1 
ATOM   496   N N   . TYR A  1 66  ? -12.107 20.985  84.346  1.00 47.11  ? 65   TYR A N   1 
ATOM   497   C CA  . TYR A  1 66  ? -11.485 22.208  83.853  1.00 44.94  ? 65   TYR A CA  1 
ATOM   498   C C   . TYR A  1 66  ? -12.487 23.336  84.062  1.00 38.68  ? 65   TYR A C   1 
ATOM   499   O O   . TYR A  1 66  ? -13.525 23.374  83.415  1.00 48.70  ? 65   TYR A O   1 
ATOM   500   C CB  . TYR A  1 66  ? -11.190 21.963  82.367  1.00 31.59  ? 65   TYR A CB  1 
ATOM   501   C CG  . TYR A  1 66  ? -10.685 23.076  81.489  1.00 39.95  ? 65   TYR A CG  1 
ATOM   502   C CD1 . TYR A  1 66  ? -11.565 23.904  80.805  1.00 42.30  ? 65   TYR A CD1 1 
ATOM   503   C CD2 . TYR A  1 66  ? -9.326  23.228  81.252  1.00 45.14  ? 65   TYR A CD2 1 
ATOM   504   C CE1 . TYR A  1 66  ? -11.100 24.886  79.951  1.00 37.81  ? 65   TYR A CE1 1 
ATOM   505   C CE2 . TYR A  1 66  ? -8.852  24.206  80.407  1.00 34.65  ? 65   TYR A CE2 1 
ATOM   506   C CZ  . TYR A  1 66  ? -9.737  25.030  79.755  1.00 47.30  ? 65   TYR A CZ  1 
ATOM   507   O OH  . TYR A  1 66  ? -9.247  26.008  78.915  1.00 46.25  ? 65   TYR A OH  1 
ATOM   508   N N   . ARG A  1 67  ? -12.206 24.239  84.992  1.00 31.33  ? 66   ARG A N   1 
ATOM   509   C CA  . ARG A  1 67  ? -13.173 25.282  85.306  1.00 48.99  ? 66   ARG A CA  1 
ATOM   510   C C   . ARG A  1 67  ? -12.529 26.572  85.775  1.00 36.48  ? 66   ARG A C   1 
ATOM   511   O O   . ARG A  1 67  ? -11.488 26.575  86.424  1.00 41.26  ? 66   ARG A O   1 
ATOM   512   C CB  . ARG A  1 67  ? -14.155 24.793  86.378  1.00 39.30  ? 66   ARG A CB  1 
ATOM   513   C CG  . ARG A  1 67  ? -13.495 24.428  87.702  1.00 59.69  ? 66   ARG A CG  1 
ATOM   514   C CD  . ARG A  1 67  ? -14.518 23.924  88.719  1.00 62.84  ? 66   ARG A CD  1 
ATOM   515   N NE  . ARG A  1 67  ? -15.458 24.972  89.110  1.00 84.24  ? 66   ARG A NE  1 
ATOM   516   C CZ  . ARG A  1 67  ? -15.451 25.601  90.285  1.00 82.09  ? 66   ARG A CZ  1 
ATOM   517   N NH1 . ARG A  1 67  ? -16.355 26.539  90.525  1.00 60.38  ? 66   ARG A NH1 1 
ATOM   518   N NH2 . ARG A  1 67  ? -14.557 25.294  91.225  1.00 65.59  ? 66   ARG A NH2 1 
ATOM   519   N N   . VAL A  1 68  ? -13.168 27.677  85.434  1.00 39.08  ? 67   VAL A N   1 
ATOM   520   C CA  . VAL A  1 68  ? -12.787 28.956  85.980  1.00 42.23  ? 67   VAL A CA  1 
ATOM   521   C C   . VAL A  1 68  ? -13.313 28.971  87.396  1.00 46.18  ? 67   VAL A C   1 
ATOM   522   O O   . VAL A  1 68  ? -14.519 28.907  87.605  1.00 49.57  ? 67   VAL A O   1 
ATOM   523   C CB  . VAL A  1 68  ? -13.418 30.100  85.193  1.00 59.09  ? 67   VAL A CB  1 
ATOM   524   C CG1 . VAL A  1 68  ? -12.974 31.440  85.765  1.00 55.66  ? 67   VAL A CG1 1 
ATOM   525   C CG2 . VAL A  1 68  ? -13.057 29.985  83.719  1.00 42.16  ? 67   VAL A CG2 1 
ATOM   526   N N   . TYR A  1 69  ? -12.413 29.029  88.369  1.00 43.42  ? 68   TYR A N   1 
ATOM   527   C CA  . TYR A  1 69  ? -12.821 28.967  89.765  1.00 45.24  ? 68   TYR A CA  1 
ATOM   528   C C   . TYR A  1 69  ? -12.915 30.352  90.403  1.00 51.28  ? 68   TYR A C   1 
ATOM   529   O O   . TYR A  1 69  ? -13.600 30.539  91.407  1.00 57.00  ? 68   TYR A O   1 
ATOM   530   C CB  . TYR A  1 69  ? -11.844 28.110  90.568  1.00 37.73  ? 68   TYR A CB  1 
ATOM   531   C CG  . TYR A  1 69  ? -10.464 28.708  90.669  1.00 58.80  ? 68   TYR A CG  1 
ATOM   532   C CD1 . TYR A  1 69  ? -10.127 29.553  91.717  1.00 53.17  ? 68   TYR A CD1 1 
ATOM   533   C CD2 . TYR A  1 69  ? -9.498  28.427  89.711  1.00 42.00  ? 68   TYR A CD2 1 
ATOM   534   C CE1 . TYR A  1 69  ? -8.865  30.099  91.807  1.00 60.83  ? 68   TYR A CE1 1 
ATOM   535   C CE2 . TYR A  1 69  ? -8.239  28.963  89.793  1.00 45.11  ? 68   TYR A CE2 1 
ATOM   536   C CZ  . TYR A  1 69  ? -7.926  29.801  90.834  1.00 51.92  ? 68   TYR A CZ  1 
ATOM   537   O OH  . TYR A  1 69  ? -6.665  30.331  90.901  1.00 53.99  ? 68   TYR A OH  1 
ATOM   538   N N   . SER A  1 70  ? -12.226 31.325  89.829  1.00 54.67  ? 69   SER A N   1 
ATOM   539   C CA  . SER A  1 70  ? -12.183 32.643  90.439  1.00 57.02  ? 69   SER A CA  1 
ATOM   540   C C   . SER A  1 70  ? -12.005 33.740  89.418  1.00 62.48  ? 69   SER A C   1 
ATOM   541   O O   . SER A  1 70  ? -11.417 33.528  88.365  1.00 64.93  ? 69   SER A O   1 
ATOM   542   C CB  . SER A  1 70  ? -11.039 32.710  91.447  1.00 67.54  ? 69   SER A CB  1 
ATOM   543   O OG  . SER A  1 70  ? -10.917 34.012  91.983  1.00 82.87  ? 69   SER A OG  1 
ATOM   544   N N   . GLU A  1 71  ? -12.533 34.912  89.744  1.00 64.00  ? 70   GLU A N   1 
ATOM   545   C CA  . GLU A  1 71  ? -12.254 36.130  88.998  1.00 64.32  ? 70   GLU A CA  1 
ATOM   546   C C   . GLU A  1 71  ? -12.177 37.284  89.992  1.00 75.76  ? 70   GLU A C   1 
ATOM   547   O O   . GLU A  1 71  ? -12.997 37.379  90.911  1.00 68.05  ? 70   GLU A O   1 
ATOM   548   C CB  . GLU A  1 71  ? -13.343 36.394  87.957  1.00 61.20  ? 70   GLU A CB  1 
ATOM   549   C CG  . GLU A  1 71  ? -14.699 36.734  88.551  1.00 77.16  ? 70   GLU A CG  1 
ATOM   550   C CD  . GLU A  1 71  ? -15.746 37.003  87.489  1.00 102.07 ? 70   GLU A CD  1 
ATOM   551   O OE1 . GLU A  1 71  ? -16.320 38.113  87.483  1.00 107.50 ? 70   GLU A OE1 1 
ATOM   552   O OE2 . GLU A  1 71  ? -15.999 36.102  86.663  1.00 101.70 ? 70   GLU A OE2 1 
ATOM   553   N N   . GLU A  1 72  ? -11.175 38.142  89.828  1.00 71.84  ? 71   GLU A N   1 
ATOM   554   C CA  . GLU A  1 72  ? -11.040 39.322  90.672  1.00 72.96  ? 71   GLU A CA  1 
ATOM   555   C C   . GLU A  1 72  ? -11.127 40.564  89.801  1.00 76.69  ? 71   GLU A C   1 
ATOM   556   O O   . GLU A  1 72  ? -10.116 41.197  89.499  1.00 82.91  ? 71   GLU A O   1 
ATOM   557   C CB  . GLU A  1 72  ? -9.716  39.294  91.438  1.00 80.68  ? 71   GLU A CB  1 
ATOM   558   C CG  . GLU A  1 72  ? -9.658  40.292  92.586  1.00 109.73 ? 71   GLU A CG  1 
ATOM   559   C CD  . GLU A  1 72  ? -8.393  40.169  93.415  1.00 112.82 ? 71   GLU A CD  1 
ATOM   560   O OE1 . GLU A  1 72  ? -7.381  39.659  92.887  1.00 109.95 ? 71   GLU A OE1 1 
ATOM   561   O OE2 . GLU A  1 72  ? -8.414  40.583  94.596  1.00 96.08  ? 71   GLU A OE2 1 
ATOM   562   N N   . GLY A  1 73  ? -12.345 40.911  89.396  1.00 62.78  ? 72   GLY A N   1 
ATOM   563   C CA  . GLY A  1 73  ? -12.541 41.970  88.423  1.00 51.35  ? 72   GLY A CA  1 
ATOM   564   C C   . GLY A  1 73  ? -12.332 41.432  87.018  1.00 69.69  ? 72   GLY A C   1 
ATOM   565   O O   . GLY A  1 73  ? -12.087 40.243  86.834  1.00 61.46  ? 72   GLY A O   1 
ATOM   566   N N   . ALA A  1 74  ? -12.420 42.297  86.017  1.00 52.09  ? 73   ALA A N   1 
ATOM   567   C CA  . ALA A  1 74  ? -12.297 41.848  84.636  1.00 62.35  ? 73   ALA A CA  1 
ATOM   568   C C   . ALA A  1 74  ? -10.847 41.618  84.226  1.00 53.21  ? 73   ALA A C   1 
ATOM   569   O O   . ALA A  1 74  ? -10.596 41.130  83.134  1.00 52.58  ? 73   ALA A O   1 
ATOM   570   C CB  . ALA A  1 74  ? -12.949 42.855  83.693  1.00 59.25  ? 73   ALA A CB  1 
ATOM   571   N N   . ASN A  1 75  ? -9.898  41.964  85.092  1.00 51.74  ? 74   ASN A N   1 
ATOM   572   C CA  . ASN A  1 75  ? -8.484  41.948  84.715  1.00 47.24  ? 74   ASN A CA  1 
ATOM   573   C C   . ASN A  1 75  ? -7.712  40.740  85.210  1.00 51.67  ? 74   ASN A C   1 
ATOM   574   O O   . ASN A  1 75  ? -6.567  40.528  84.822  1.00 41.39  ? 74   ASN A O   1 
ATOM   575   C CB  . ASN A  1 75  ? -7.790  43.220  85.208  1.00 53.23  ? 74   ASN A CB  1 
ATOM   576   C CG  . ASN A  1 75  ? -8.169  44.433  84.390  1.00 64.71  ? 74   ASN A CG  1 
ATOM   577   O OD1 . ASN A  1 75  ? -9.299  44.538  83.908  1.00 74.39  ? 74   ASN A OD1 1 
ATOM   578   N ND2 . ASN A  1 75  ? -7.224  45.349  84.209  1.00 81.97  ? 74   ASN A ND2 1 
ATOM   579   N N   . LYS A  1 76  ? -8.336  39.948  86.068  1.00 40.29  ? 75   LYS A N   1 
ATOM   580   C CA  . LYS A  1 76  ? -7.664  38.800  86.656  1.00 43.62  ? 75   LYS A CA  1 
ATOM   581   C C   . LYS A  1 76  ? -8.649  37.636  86.733  1.00 57.23  ? 75   LYS A C   1 
ATOM   582   O O   . LYS A  1 76  ? -9.817  37.835  87.060  1.00 45.83  ? 75   LYS A O   1 
ATOM   583   C CB  . LYS A  1 76  ? -7.167  39.177  88.053  1.00 58.07  ? 75   LYS A CB  1 
ATOM   584   C CG  . LYS A  1 76  ? -6.627  38.030  88.866  1.00 56.42  ? 75   LYS A CG  1 
ATOM   585   C CD  . LYS A  1 76  ? -5.270  37.601  88.371  1.00 60.60  ? 75   LYS A CD  1 
ATOM   586   C CE  . LYS A  1 76  ? -4.654  36.572  89.306  1.00 77.94  ? 75   LYS A CE  1 
ATOM   587   N NZ  . LYS A  1 76  ? -5.493  35.348  89.423  1.00 83.29  ? 75   LYS A NZ  1 
ATOM   588   N N   . SER A  1 77  ? -8.194  36.427  86.417  1.00 51.64  ? 76   SER A N   1 
ATOM   589   C CA  . SER A  1 77  ? -9.045  35.251  86.553  1.00 53.45  ? 76   SER A CA  1 
ATOM   590   C C   . SER A  1 77  ? -8.217  33.969  86.638  1.00 48.81  ? 76   SER A C   1 
ATOM   591   O O   . SER A  1 77  ? -7.098  33.900  86.142  1.00 38.00  ? 76   SER A O   1 
ATOM   592   C CB  . SER A  1 77  ? -10.041 35.170  85.396  1.00 49.51  ? 76   SER A CB  1 
ATOM   593   O OG  . SER A  1 77  ? -11.038 34.197  85.648  1.00 44.62  ? 76   SER A OG  1 
ATOM   594   N N   . GLY A  1 78  ? -8.779  32.955  87.280  1.00 34.56  ? 77   GLY A N   1 
ATOM   595   C CA  . GLY A  1 78  ? -8.069  31.713  87.509  1.00 42.12  ? 77   GLY A CA  1 
ATOM   596   C C   . GLY A  1 78  ? -8.814  30.515  86.942  1.00 50.09  ? 77   GLY A C   1 
ATOM   597   O O   . GLY A  1 78  ? -10.049 30.460  86.952  1.00 39.21  ? 77   GLY A O   1 
ATOM   598   N N   . LEU A  1 79  ? -8.048  29.544  86.461  1.00 45.25  ? 78   LEU A N   1 
ATOM   599   C CA  . LEU A  1 79  ? -8.588  28.343  85.842  1.00 42.93  ? 78   LEU A CA  1 
ATOM   600   C C   . LEU A  1 79  ? -7.957  27.111  86.485  1.00 44.71  ? 78   LEU A C   1 
ATOM   601   O O   . LEU A  1 79  ? -6.740  26.978  86.514  1.00 38.33  ? 78   LEU A O   1 
ATOM   602   C CB  . LEU A  1 79  ? -8.286  28.347  84.340  1.00 41.20  ? 78   LEU A CB  1 
ATOM   603   C CG  . LEU A  1 79  ? -8.598  27.039  83.596  1.00 43.74  ? 78   LEU A CG  1 
ATOM   604   C CD1 . LEU A  1 79  ? -10.081 26.907  83.371  1.00 47.74  ? 78   LEU A CD1 1 
ATOM   605   C CD2 . LEU A  1 79  ? -7.880  26.979  82.271  1.00 54.95  ? 78   LEU A CD2 1 
ATOM   606   N N   . ALA A  1 80  ? -8.782  26.217  87.020  1.00 33.86  ? 79   ALA A N   1 
ATOM   607   C CA  . ALA A  1 80  ? -8.286  24.970  87.585  1.00 45.72  ? 79   ALA A CA  1 
ATOM   608   C C   . ALA A  1 80  ? -8.403  23.857  86.545  1.00 37.36  ? 79   ALA A C   1 
ATOM   609   O O   . ALA A  1 80  ? -9.461  23.655  85.955  1.00 31.30  ? 79   ALA A O   1 
ATOM   610   C CB  . ALA A  1 80  ? -9.067  24.606  88.834  1.00 42.70  ? 79   ALA A CB  1 
ATOM   611   N N   . TRP A  1 81  ? -7.314  23.138  86.316  1.00 29.95  ? 80   TRP A N   1 
ATOM   612   C CA  . TRP A  1 81  ? -7.296  22.118  85.274  1.00 30.00  ? 80   TRP A CA  1 
ATOM   613   C C   . TRP A  1 81  ? -6.441  20.933  85.690  1.00 31.67  ? 80   TRP A C   1 
ATOM   614   O O   . TRP A  1 81  ? -5.488  21.083  86.443  1.00 33.32  ? 80   TRP A O   1 
ATOM   615   C CB  . TRP A  1 81  ? -6.790  22.710  83.949  1.00 28.55  ? 80   TRP A CB  1 
ATOM   616   C CG  . TRP A  1 81  ? -5.364  23.153  83.985  1.00 31.11  ? 80   TRP A CG  1 
ATOM   617   C CD1 . TRP A  1 81  ? -4.885  24.340  84.470  1.00 40.67  ? 80   TRP A CD1 1 
ATOM   618   C CD2 . TRP A  1 81  ? -4.224  22.419  83.519  1.00 36.48  ? 80   TRP A CD2 1 
ATOM   619   N NE1 . TRP A  1 81  ? -3.518  24.392  84.327  1.00 36.99  ? 80   TRP A NE1 1 
ATOM   620   C CE2 . TRP A  1 81  ? -3.084  23.227  83.745  1.00 31.83  ? 80   TRP A CE2 1 
ATOM   621   C CE3 . TRP A  1 81  ? -4.051  21.161  82.926  1.00 27.88  ? 80   TRP A CE3 1 
ATOM   622   C CZ2 . TRP A  1 81  ? -1.789  22.818  83.399  1.00 29.70  ? 80   TRP A CZ2 1 
ATOM   623   C CZ3 . TRP A  1 81  ? -2.761  20.752  82.585  1.00 32.16  ? 80   TRP A CZ3 1 
ATOM   624   C CH2 . TRP A  1 81  ? -1.649  21.581  82.822  1.00 37.41  ? 80   TRP A CH2 1 
ATOM   625   N N   . PRO A  1 82  ? -6.782  19.739  85.191  1.00 31.46  ? 81   PRO A N   1 
ATOM   626   C CA  . PRO A  1 82  ? -6.136  18.491  85.622  1.00 36.88  ? 81   PRO A CA  1 
ATOM   627   C C   . PRO A  1 82  ? -4.806  18.226  84.931  1.00 35.87  ? 81   PRO A C   1 
ATOM   628   O O   . PRO A  1 82  ? -4.780  17.981  83.730  1.00 34.41  ? 81   PRO A O   1 
ATOM   629   C CB  . PRO A  1 82  ? -7.149  17.419  85.210  1.00 27.92  ? 81   PRO A CB  1 
ATOM   630   C CG  . PRO A  1 82  ? -7.851  18.004  84.036  1.00 33.11  ? 81   PRO A CG  1 
ATOM   631   C CD  . PRO A  1 82  ? -7.892  19.494  84.253  1.00 31.93  ? 81   PRO A CD  1 
ATOM   632   N N   . SER A  1 83  ? -3.719  18.261  85.689  1.00 28.27  ? 82   SER A N   1 
ATOM   633   C CA  . SER A  1 83  ? -2.402  18.019  85.129  1.00 34.30  ? 82   SER A CA  1 
ATOM   634   C C   . SER A  1 83  ? -1.954  16.571  85.345  1.00 34.65  ? 82   SER A C   1 
ATOM   635   O O   . SER A  1 83  ? -0.955  16.138  84.772  1.00 28.36  ? 82   SER A O   1 
ATOM   636   C CB  . SER A  1 83  ? -1.385  18.979  85.744  1.00 31.81  ? 82   SER A CB  1 
ATOM   637   O OG  . SER A  1 83  ? -1.392  18.880  87.157  1.00 38.41  ? 82   SER A OG  1 
ATOM   638   N N   . ALA A  1 84  ? -2.677  15.828  86.177  1.00 28.57  ? 83   ALA A N   1 
ATOM   639   C CA  . ALA A  1 84  ? -2.388  14.400  86.349  1.00 34.78  ? 83   ALA A CA  1 
ATOM   640   C C   . ALA A  1 84  ? -3.587  13.634  86.855  1.00 35.43  ? 83   ALA A C   1 
ATOM   641   O O   . ALA A  1 84  ? -4.376  14.150  87.644  1.00 34.22  ? 83   ALA A O   1 
ATOM   642   C CB  . ALA A  1 84  ? -1.214  14.191  87.290  1.00 27.14  ? 83   ALA A CB  1 
ATOM   643   N N   . PHE A  1 85  ? -3.725  12.404  86.373  1.00 30.90  ? 84   PHE A N   1 
ATOM   644   C CA  . PHE A  1 85  ? -4.682  11.459  86.916  1.00 31.75  ? 84   PHE A CA  1 
ATOM   645   C C   . PHE A  1 85  ? -3.874  10.291  87.456  1.00 37.30  ? 84   PHE A C   1 
ATOM   646   O O   . PHE A  1 85  ? -2.877  9.900   86.853  1.00 38.97  ? 84   PHE A O   1 
ATOM   647   C CB  . PHE A  1 85  ? -5.629  10.961  85.833  1.00 30.77  ? 84   PHE A CB  1 
ATOM   648   C CG  . PHE A  1 85  ? -6.370  12.048  85.121  1.00 29.22  ? 84   PHE A CG  1 
ATOM   649   C CD1 . PHE A  1 85  ? -7.587  12.508  85.604  1.00 23.37  ? 84   PHE A CD1 1 
ATOM   650   C CD2 . PHE A  1 85  ? -5.865  12.595  83.953  1.00 30.16  ? 84   PHE A CD2 1 
ATOM   651   C CE1 . PHE A  1 85  ? -8.284  13.502  84.935  1.00 31.17  ? 84   PHE A CE1 1 
ATOM   652   C CE2 . PHE A  1 85  ? -6.549  13.592  83.285  1.00 33.04  ? 84   PHE A CE2 1 
ATOM   653   C CZ  . PHE A  1 85  ? -7.761  14.047  83.772  1.00 26.60  ? 84   PHE A CZ  1 
ATOM   654   N N   . LYS A  1 86  ? -4.275  9.731   88.589  1.00 31.99  ? 85   LYS A N   1 
ATOM   655   C CA  . LYS A  1 86  ? -3.514  8.627   89.169  1.00 31.95  ? 85   LYS A CA  1 
ATOM   656   C C   . LYS A  1 86  ? -4.408  7.517   89.687  1.00 32.58  ? 85   LYS A C   1 
ATOM   657   O O   . LYS A  1 86  ? -5.514  7.764   90.160  1.00 25.41  ? 85   LYS A O   1 
ATOM   658   C CB  . LYS A  1 86  ? -2.631  9.130   90.303  1.00 34.89  ? 85   LYS A CB  1 
ATOM   659   C CG  . LYS A  1 86  ? -1.601  10.146  89.867  1.00 42.26  ? 85   LYS A CG  1 
ATOM   660   C CD  . LYS A  1 86  ? -0.779  10.617  91.045  1.00 48.03  ? 85   LYS A CD  1 
ATOM   661   C CE  . LYS A  1 86  ? 0.221   11.683  90.633  1.00 50.65  ? 85   LYS A CE  1 
ATOM   662   N NZ  . LYS A  1 86  ? 0.975   12.197  91.810  1.00 75.07  ? 85   LYS A NZ  1 
ATOM   663   N N   . VAL A  1 87  ? -3.914  6.287   89.585  1.00 33.43  ? 86   VAL A N   1 
ATOM   664   C CA  . VAL A  1 87  ? -4.580  5.142   90.178  1.00 23.51  ? 86   VAL A CA  1 
ATOM   665   C C   . VAL A  1 87  ? -3.505  4.350   90.904  1.00 34.86  ? 86   VAL A C   1 
ATOM   666   O O   . VAL A  1 87  ? -2.419  4.129   90.369  1.00 32.38  ? 86   VAL A O   1 
ATOM   667   C CB  . VAL A  1 87  ? -5.275  4.261   89.116  1.00 38.16  ? 86   VAL A CB  1 
ATOM   668   C CG1 . VAL A  1 87  ? -5.811  2.974   89.741  1.00 36.16  ? 86   VAL A CG1 1 
ATOM   669   C CG2 . VAL A  1 87  ? -6.397  5.016   88.440  1.00 30.10  ? 86   VAL A CG2 1 
ATOM   670   N N   . GLN A  1 88  ? -3.797  3.943   92.131  1.00 30.03  ? 87   GLN A N   1 
ATOM   671   C CA  . GLN A  1 88  ? -2.843  3.193   92.933  1.00 34.82  ? 87   GLN A CA  1 
ATOM   672   C C   . GLN A  1 88  ? -3.547  2.091   93.703  1.00 30.98  ? 87   GLN A C   1 
ATOM   673   O O   . GLN A  1 88  ? -4.690  2.241   94.127  1.00 36.27  ? 87   GLN A O   1 
ATOM   674   C CB  . GLN A  1 88  ? -2.125  4.124   93.907  1.00 28.22  ? 87   GLN A CB  1 
ATOM   675   C CG  . GLN A  1 88  ? -1.431  5.294   93.221  1.00 53.43  ? 87   GLN A CG  1 
ATOM   676   C CD  . GLN A  1 88  ? -1.037  6.406   94.185  1.00 68.48  ? 87   GLN A CD  1 
ATOM   677   O OE1 . GLN A  1 88  ? -1.317  6.342   95.385  1.00 71.25  ? 87   GLN A OE1 1 
ATOM   678   N NE2 . GLN A  1 88  ? -0.386  7.434   93.658  1.00 62.22  ? 87   GLN A NE2 1 
ATOM   679   N N   . LEU A  1 89  ? -2.867  0.974   93.879  1.00 29.10  ? 88   LEU A N   1 
ATOM   680   C CA  . LEU A  1 89  ? -3.412  -0.120  94.658  1.00 28.59  ? 88   LEU A CA  1 
ATOM   681   C C   . LEU A  1 89  ? -2.354  -0.486  95.667  1.00 37.42  ? 88   LEU A C   1 
ATOM   682   O O   . LEU A  1 89  ? -1.163  -0.430  95.364  1.00 33.02  ? 88   LEU A O   1 
ATOM   683   C CB  . LEU A  1 89  ? -3.726  -1.328  93.775  1.00 30.96  ? 88   LEU A CB  1 
ATOM   684   C CG  . LEU A  1 89  ? -4.854  -1.185  92.760  1.00 36.94  ? 88   LEU A CG  1 
ATOM   685   C CD1 . LEU A  1 89  ? -4.343  -0.501  91.519  1.00 38.68  ? 88   LEU A CD1 1 
ATOM   686   C CD2 . LEU A  1 89  ? -5.438  -2.558  92.416  1.00 34.71  ? 88   LEU A CD2 1 
ATOM   687   N N   . GLN A  1 90  ? -2.782  -0.860  96.866  1.00 32.54  ? 89   GLN A N   1 
ATOM   688   C CA  . GLN A  1 90  ? -1.841  -1.155  97.928  1.00 39.42  ? 89   GLN A CA  1 
ATOM   689   C C   . GLN A  1 90  ? -2.324  -2.308  98.793  1.00 34.71  ? 89   GLN A C   1 
ATOM   690   O O   . GLN A  1 90  ? -3.454  -2.298  99.278  1.00 32.58  ? 89   GLN A O   1 
ATOM   691   C CB  . GLN A  1 90  ? -1.631  0.097   98.775  1.00 37.26  ? 89   GLN A CB  1 
ATOM   692   C CG  . GLN A  1 90  ? -0.582  -0.060  99.849  1.00 49.95  ? 89   GLN A CG  1 
ATOM   693   C CD  . GLN A  1 90  ? -0.184  1.268   100.444 1.00 77.39  ? 89   GLN A CD  1 
ATOM   694   O OE1 . GLN A  1 90  ? -0.789  2.303   100.147 1.00 78.38  ? 89   GLN A OE1 1 
ATOM   695   N NE2 . GLN A  1 90  ? 0.841   1.252   101.287 1.00 72.32  ? 89   GLN A NE2 1 
ATOM   696   N N   . LEU A  1 91  ? -1.454  -3.298  98.975  1.00 34.01  ? 90   LEU A N   1 
ATOM   697   C CA  . LEU A  1 91  ? -1.725  -4.443  99.841  1.00 36.20  ? 90   LEU A CA  1 
ATOM   698   C C   . LEU A  1 91  ? -1.099  -4.256  101.224 1.00 48.72  ? 90   LEU A C   1 
ATOM   699   O O   . LEU A  1 91  ? -0.154  -3.493  101.383 1.00 40.09  ? 90   LEU A O   1 
ATOM   700   C CB  . LEU A  1 91  ? -1.158  -5.712  99.220  1.00 23.35  ? 90   LEU A CB  1 
ATOM   701   C CG  . LEU A  1 91  ? -1.853  -6.217  97.956  1.00 45.76  ? 90   LEU A CG  1 
ATOM   702   C CD1 . LEU A  1 91  ? -0.940  -7.168  97.192  1.00 38.91  ? 90   LEU A CD1 1 
ATOM   703   C CD2 . LEU A  1 91  ? -3.172  -6.902  98.312  1.00 40.64  ? 90   LEU A CD2 1 
ATOM   704   N N   . PRO A  1 92  ? -1.611  -4.980  102.231 1.00 58.61  ? 91   PRO A N   1 
ATOM   705   C CA  . PRO A  1 92  ? -1.008  -4.907  103.565 1.00 47.52  ? 91   PRO A CA  1 
ATOM   706   C C   . PRO A  1 92  ? 0.468   -5.286  103.519 1.00 37.30  ? 91   PRO A C   1 
ATOM   707   O O   . PRO A  1 92  ? 0.854   -6.258  102.863 1.00 46.07  ? 91   PRO A O   1 
ATOM   708   C CB  . PRO A  1 92  ? -1.792  -5.954  104.373 1.00 56.28  ? 91   PRO A CB  1 
ATOM   709   C CG  . PRO A  1 92  ? -3.060  -6.183  103.610 1.00 47.54  ? 91   PRO A CG  1 
ATOM   710   C CD  . PRO A  1 92  ? -2.696  -5.974  102.165 1.00 49.15  ? 91   PRO A CD  1 
ATOM   711   N N   . ASP A  1 93  ? 1.279   -4.530  104.240 1.00 46.45  ? 92   ASP A N   1 
ATOM   712   C CA  . ASP A  1 93  ? 2.710   -4.774  104.299 1.00 54.81  ? 92   ASP A CA  1 
ATOM   713   C C   . ASP A  1 93  ? 3.031   -6.140  104.914 1.00 60.04  ? 92   ASP A C   1 
ATOM   714   O O   . ASP A  1 93  ? 3.974   -6.811  104.498 1.00 57.59  ? 92   ASP A O   1 
ATOM   715   C CB  . ASP A  1 93  ? 3.369   -3.661  105.117 1.00 77.83  ? 92   ASP A CB  1 
ATOM   716   C CG  . ASP A  1 93  ? 4.870   -3.621  104.943 1.00 96.16  ? 92   ASP A CG  1 
ATOM   717   O OD1 . ASP A  1 93  ? 5.336   -3.714  103.786 1.00 83.09  ? 92   ASP A OD1 1 
ATOM   718   O OD2 . ASP A  1 93  ? 5.581   -3.493  105.964 1.00 115.87 ? 92   ASP A OD2 1 
ATOM   719   N N   . ASN A  1 94  ? 2.235   -6.556  105.894 1.00 47.35  ? 93   ASN A N   1 
ATOM   720   C CA  . ASN A  1 94  ? 2.533   -7.760  106.658 1.00 52.46  ? 93   ASN A CA  1 
ATOM   721   C C   . ASN A  1 94  ? 1.729   -8.994  106.243 1.00 64.12  ? 93   ASN A C   1 
ATOM   722   O O   . ASN A  1 94  ? 1.679   -9.980  106.985 1.00 68.87  ? 93   ASN A O   1 
ATOM   723   C CB  . ASN A  1 94  ? 2.307   -7.498  108.151 1.00 54.78  ? 93   ASN A CB  1 
ATOM   724   C CG  . ASN A  1 94  ? 0.837   -7.348  108.502 1.00 75.14  ? 93   ASN A CG  1 
ATOM   725   O OD1 . ASN A  1 94  ? 0.008   -7.026  107.648 1.00 79.03  ? 93   ASN A OD1 1 
ATOM   726   N ND2 . ASN A  1 94  ? 0.506   -7.581  109.766 1.00 90.41  ? 93   ASN A ND2 1 
ATOM   727   N N   . GLU A  1 95  ? 1.095   -8.953  105.077 1.00 56.26  ? 94   GLU A N   1 
ATOM   728   C CA  . GLU A  1 95  ? 0.425   -10.149 104.557 1.00 47.96  ? 94   GLU A CA  1 
ATOM   729   C C   . GLU A  1 95  ? 1.168   -10.737 103.355 1.00 37.43  ? 94   GLU A C   1 
ATOM   730   O O   . GLU A  1 95  ? 2.141   -10.161 102.869 1.00 46.73  ? 94   GLU A O   1 
ATOM   731   C CB  . GLU A  1 95  ? -1.037  -9.856  104.224 1.00 41.33  ? 94   GLU A CB  1 
ATOM   732   C CG  . GLU A  1 95  ? -1.890  -9.633  105.474 1.00 60.69  ? 94   GLU A CG  1 
ATOM   733   C CD  . GLU A  1 95  ? -3.331  -9.282  105.152 1.00 78.46  ? 94   GLU A CD  1 
ATOM   734   O OE1 . GLU A  1 95  ? -4.034  -8.770  106.049 1.00 76.80  ? 94   GLU A OE1 1 
ATOM   735   O OE2 . GLU A  1 95  ? -3.761  -9.511  104.000 1.00 85.48  ? 94   GLU A OE2 1 
ATOM   736   N N   . VAL A  1 96  ? 0.708   -11.891 102.888 1.00 40.82  ? 95   VAL A N   1 
ATOM   737   C CA  . VAL A  1 96  ? 1.480   -12.691 101.943 1.00 42.02  ? 95   VAL A CA  1 
ATOM   738   C C   . VAL A  1 96  ? 0.977   -12.593 100.511 1.00 32.60  ? 95   VAL A C   1 
ATOM   739   O O   . VAL A  1 96  ? 1.636   -13.087 99.599  1.00 38.61  ? 95   VAL A O   1 
ATOM   740   C CB  . VAL A  1 96  ? 1.498   -14.191 102.344 1.00 50.43  ? 95   VAL A CB  1 
ATOM   741   C CG1 . VAL A  1 96  ? 2.421   -14.419 103.521 1.00 50.10  ? 95   VAL A CG1 1 
ATOM   742   C CG2 . VAL A  1 96  ? 0.098   -14.672 102.664 1.00 54.55  ? 95   VAL A CG2 1 
ATOM   743   N N   . ALA A  1 97  ? -0.194  -11.998 100.304 1.00 34.53  ? 96   ALA A N   1 
ATOM   744   C CA  . ALA A  1 97  ? -0.626  -11.700 98.944  1.00 35.97  ? 96   ALA A CA  1 
ATOM   745   C C   . ALA A  1 97  ? 0.447   -10.800 98.351  1.00 35.95  ? 96   ALA A C   1 
ATOM   746   O O   . ALA A  1 97  ? 0.930   -9.896  99.041  1.00 35.19  ? 96   ALA A O   1 
ATOM   747   C CB  . ALA A  1 97  ? -1.982  -11.001 98.941  1.00 28.87  ? 96   ALA A CB  1 
ATOM   748   N N   . GLN A  1 98  ? 0.838   -11.057 97.101  1.00 28.71  ? 97   GLN A N   1 
ATOM   749   C CA  . GLN A  1 98  ? 1.815   -10.215 96.403  1.00 34.85  ? 97   GLN A CA  1 
ATOM   750   C C   . GLN A  1 98  ? 1.321   -9.705  95.050  1.00 35.73  ? 97   GLN A C   1 
ATOM   751   O O   . GLN A  1 98  ? 0.571   -10.385 94.352  1.00 34.42  ? 97   GLN A O   1 
ATOM   752   C CB  . GLN A  1 98  ? 3.104   -10.986 96.163  1.00 32.98  ? 97   GLN A CB  1 
ATOM   753   C CG  . GLN A  1 98  ? 3.873   -11.335 97.403  1.00 40.38  ? 97   GLN A CG  1 
ATOM   754   C CD  . GLN A  1 98  ? 5.087   -12.172 97.075  1.00 37.97  ? 97   GLN A CD  1 
ATOM   755   O OE1 . GLN A  1 98  ? 4.961   -13.301 96.610  1.00 37.03  ? 97   GLN A OE1 1 
ATOM   756   N NE2 . GLN A  1 98  ? 6.270   -11.613 97.279  1.00 34.41  ? 97   GLN A NE2 1 
ATOM   757   N N   . ILE A  1 99  ? 1.756   -8.505  94.685  1.00 33.42  ? 98   ILE A N   1 
ATOM   758   C CA  . ILE A  1 99  ? 1.596   -8.012  93.328  1.00 25.09  ? 98   ILE A CA  1 
ATOM   759   C C   . ILE A  1 99  ? 2.596   -8.741  92.428  1.00 36.01  ? 98   ILE A C   1 
ATOM   760   O O   . ILE A  1 99  ? 3.797   -8.765  92.686  1.00 35.46  ? 98   ILE A O   1 
ATOM   761   C CB  . ILE A  1 99  ? 1.802   -6.492  93.264  1.00 40.93  ? 98   ILE A CB  1 
ATOM   762   C CG1 . ILE A  1 99  ? 0.625   -5.801  93.966  1.00 28.77  ? 98   ILE A CG1 1 
ATOM   763   C CG2 . ILE A  1 99  ? 1.943   -6.030  91.812  1.00 25.22  ? 98   ILE A CG2 1 
ATOM   764   C CD1 . ILE A  1 99  ? 0.765   -4.333  94.098  1.00 42.12  ? 98   ILE A CD1 1 
ATOM   765   N N   . SER A  1 100 ? 2.077   -9.358  91.378  1.00 31.01  ? 99   SER A N   1 
ATOM   766   C CA  . SER A  1 100 ? 2.847   -10.255 90.545  1.00 29.71  ? 99   SER A CA  1 
ATOM   767   C C   . SER A  1 100 ? 3.072   -9.647  89.162  1.00 35.21  ? 99   SER A C   1 
ATOM   768   O O   . SER A  1 100 ? 4.116   -9.845  88.539  1.00 37.18  ? 99   SER A O   1 
ATOM   769   C CB  . SER A  1 100 ? 2.088   -11.574 90.413  1.00 24.90  ? 99   SER A CB  1 
ATOM   770   O OG  . SER A  1 100 ? 2.615   -12.378 89.381  1.00 53.95  ? 99   SER A OG  1 
ATOM   771   N N   . ASP A  1 101 ? 2.080   -8.918  88.672  1.00 25.06  ? 100  ASP A N   1 
ATOM   772   C CA  . ASP A  1 101 ? 2.168   -8.345  87.332  1.00 40.46  ? 100  ASP A CA  1 
ATOM   773   C C   . ASP A  1 101 ? 1.210   -7.158  87.194  1.00 29.82  ? 100  ASP A C   1 
ATOM   774   O O   . ASP A  1 101 ? 0.378   -6.903  88.067  1.00 28.67  ? 100  ASP A O   1 
ATOM   775   C CB  . ASP A  1 101 ? 1.890   -9.418  86.260  1.00 24.46  ? 100  ASP A CB  1 
ATOM   776   C CG  . ASP A  1 101 ? 2.644   -9.150  84.937  1.00 54.81  ? 100  ASP A CG  1 
ATOM   777   O OD1 . ASP A  1 101 ? 2.604   -10.028 84.051  1.00 47.83  ? 100  ASP A OD1 1 
ATOM   778   O OD2 . ASP A  1 101 ? 3.283   -8.078  84.778  1.00 44.70  ? 100  ASP A OD2 1 
ATOM   779   N N   . TYR A  1 102 ? 1.335   -6.432  86.095  1.00 23.19  ? 101  TYR A N   1 
ATOM   780   C CA  . TYR A  1 102 ? 0.580   -5.197  85.901  1.00 25.27  ? 101  TYR A CA  1 
ATOM   781   C C   . TYR A  1 102 ? 0.683   -4.830  84.436  1.00 33.77  ? 101  TYR A C   1 
ATOM   782   O O   . TYR A  1 102 ? 1.664   -5.172  83.764  1.00 28.23  ? 101  TYR A O   1 
ATOM   783   C CB  . TYR A  1 102 ? 1.164   -4.063  86.771  1.00 21.71  ? 101  TYR A CB  1 
ATOM   784   C CG  . TYR A  1 102 ? 2.610   -4.312  87.121  1.00 26.51  ? 101  TYR A CG  1 
ATOM   785   C CD1 . TYR A  1 102 ? 2.971   -4.779  88.384  1.00 24.49  ? 101  TYR A CD1 1 
ATOM   786   C CD2 . TYR A  1 102 ? 3.612   -4.144  86.170  1.00 25.27  ? 101  TYR A CD2 1 
ATOM   787   C CE1 . TYR A  1 102 ? 4.295   -5.048  88.698  1.00 27.53  ? 101  TYR A CE1 1 
ATOM   788   C CE2 . TYR A  1 102 ? 4.943   -4.407  86.472  1.00 24.95  ? 101  TYR A CE2 1 
ATOM   789   C CZ  . TYR A  1 102 ? 5.277   -4.863  87.739  1.00 34.01  ? 101  TYR A CZ  1 
ATOM   790   O OH  . TYR A  1 102 ? 6.585   -5.142  88.063  1.00 28.70  ? 101  TYR A OH  1 
ATOM   791   N N   . TYR A  1 103 ? -0.328  -4.135  83.942  1.00 30.27  ? 102  TYR A N   1 
ATOM   792   C CA  . TYR A  1 103 ? -0.344  -3.694  82.557  1.00 28.89  ? 102  TYR A CA  1 
ATOM   793   C C   . TYR A  1 103 ? -1.242  -2.467  82.477  1.00 24.09  ? 102  TYR A C   1 
ATOM   794   O O   . TYR A  1 103 ? -2.293  -2.440  83.124  1.00 30.46  ? 102  TYR A O   1 
ATOM   795   C CB  . TYR A  1 103 ? -0.869  -4.820  81.648  1.00 27.35  ? 102  TYR A CB  1 
ATOM   796   C CG  . TYR A  1 103 ? -0.653  -4.529  80.186  1.00 32.95  ? 102  TYR A CG  1 
ATOM   797   C CD1 . TYR A  1 103 ? 0.580   -4.765  79.591  1.00 38.56  ? 102  TYR A CD1 1 
ATOM   798   C CD2 . TYR A  1 103 ? -1.666  -3.987  79.406  1.00 40.23  ? 102  TYR A CD2 1 
ATOM   799   C CE1 . TYR A  1 103 ? 0.798   -4.480  78.252  1.00 47.64  ? 102  TYR A CE1 1 
ATOM   800   C CE2 . TYR A  1 103 ? -1.461  -3.697  78.071  1.00 43.63  ? 102  TYR A CE2 1 
ATOM   801   C CZ  . TYR A  1 103 ? -0.225  -3.947  77.498  1.00 52.17  ? 102  TYR A CZ  1 
ATOM   802   O OH  . TYR A  1 103 ? -0.012  -3.666  76.168  1.00 69.81  ? 102  TYR A OH  1 
ATOM   803   N N   . PRO A  1 104 ? -0.842  -1.441  81.700  1.00 28.83  ? 103  PRO A N   1 
ATOM   804   C CA  . PRO A  1 104 ? 0.345   -1.357  80.840  1.00 29.42  ? 103  PRO A CA  1 
ATOM   805   C C   . PRO A  1 104 ? 1.619   -1.020  81.597  1.00 29.13  ? 103  PRO A C   1 
ATOM   806   O O   . PRO A  1 104 ? 1.583   -0.717  82.787  1.00 29.57  ? 103  PRO A O   1 
ATOM   807   C CB  . PRO A  1 104 ? 0.002   -0.195  79.909  1.00 30.29  ? 103  PRO A CB  1 
ATOM   808   C CG  . PRO A  1 104 ? -0.813  0.723   80.774  1.00 25.38  ? 103  PRO A CG  1 
ATOM   809   C CD  . PRO A  1 104 ? -1.642  -0.200  81.642  1.00 26.39  ? 103  PRO A CD  1 
ATOM   810   N N   . ARG A  1 105 ? 2.736   -1.048  80.881  1.00 33.50  ? 104  ARG A N   1 
ATOM   811   C CA  . ARG A  1 105 ? 4.039   -0.742  81.453  1.00 34.34  ? 104  ARG A CA  1 
ATOM   812   C C   . ARG A  1 105 ? 4.682   0.381   80.647  1.00 36.20  ? 104  ARG A C   1 
ATOM   813   O O   . ARG A  1 105 ? 4.075   0.911   79.716  1.00 42.58  ? 104  ARG A O   1 
ATOM   814   C CB  . ARG A  1 105 ? 4.912   -1.996  81.438  1.00 34.63  ? 104  ARG A CB  1 
ATOM   815   C CG  . ARG A  1 105 ? 4.129   -3.228  81.840  1.00 38.62  ? 104  ARG A CG  1 
ATOM   816   C CD  . ARG A  1 105 ? 4.972   -4.472  81.863  1.00 33.37  ? 104  ARG A CD  1 
ATOM   817   N NE  . ARG A  1 105 ? 4.163   -5.636  82.199  1.00 44.16  ? 104  ARG A NE  1 
ATOM   818   C CZ  . ARG A  1 105 ? 3.675   -6.505  81.318  1.00 48.20  ? 104  ARG A CZ  1 
ATOM   819   N NH1 . ARG A  1 105 ? 2.951   -7.533  81.744  1.00 34.71  ? 104  ARG A NH1 1 
ATOM   820   N NH2 . ARG A  1 105 ? 3.915   -6.363  80.018  1.00 38.78  ? 104  ARG A NH2 1 
ATOM   821   N N   . ASN A  1 106 ? 5.902   0.764   80.997  1.00 29.58  ? 105  ASN A N   1 
ATOM   822   C CA  . ASN A  1 106 ? 6.555   1.861   80.286  1.00 38.45  ? 105  ASN A CA  1 
ATOM   823   C C   . ASN A  1 106 ? 7.203   1.387   78.998  1.00 35.29  ? 105  ASN A C   1 
ATOM   824   O O   . ASN A  1 106 ? 8.031   0.481   79.010  1.00 40.86  ? 105  ASN A O   1 
ATOM   825   C CB  . ASN A  1 106 ? 7.594   2.529   81.176  1.00 23.26  ? 105  ASN A CB  1 
ATOM   826   C CG  . ASN A  1 106 ? 6.973   3.171   82.394  1.00 36.48  ? 105  ASN A CG  1 
ATOM   827   O OD1 . ASN A  1 106 ? 5.879   3.735   82.319  1.00 31.59  ? 105  ASN A OD1 1 
ATOM   828   N ND2 . ASN A  1 106 ? 7.663   3.086   83.529  1.00 28.45  ? 105  ASN A ND2 1 
ATOM   829   N N   . SER A  1 107 ? 6.820   1.995   77.885  1.00 39.58  ? 106  SER A N   1 
ATOM   830   C CA  . SER A  1 107 ? 7.378   1.608   76.597  1.00 44.90  ? 106  SER A CA  1 
ATOM   831   C C   . SER A  1 107 ? 8.554   2.509   76.232  1.00 39.78  ? 106  SER A C   1 
ATOM   832   O O   . SER A  1 107 ? 8.640   3.655   76.674  1.00 41.35  ? 106  SER A O   1 
ATOM   833   C CB  . SER A  1 107 ? 6.303   1.652   75.511  1.00 48.59  ? 106  SER A CB  1 
ATOM   834   O OG  . SER A  1 107 ? 5.703   2.933   75.453  1.00 80.30  ? 106  SER A OG  1 
ATOM   835   N N   . ILE A  1 108 ? 9.471   1.972   75.440  1.00 36.65  ? 107  ILE A N   1 
ATOM   836   C CA  . ILE A  1 108 ? 10.612  2.733   74.978  1.00 38.00  ? 107  ILE A CA  1 
ATOM   837   C C   . ILE A  1 108 ? 10.162  3.640   73.830  1.00 32.65  ? 107  ILE A C   1 
ATOM   838   O O   . ILE A  1 108 ? 9.575   3.180   72.851  1.00 44.73  ? 107  ILE A O   1 
ATOM   839   C CB  . ILE A  1 108 ? 11.747  1.788   74.540  1.00 37.08  ? 107  ILE A CB  1 
ATOM   840   C CG1 . ILE A  1 108 ? 12.192  0.936   75.735  1.00 40.15  ? 107  ILE A CG1 1 
ATOM   841   C CG2 . ILE A  1 108 ? 12.919  2.576   73.974  1.00 37.69  ? 107  ILE A CG2 1 
ATOM   842   C CD1 . ILE A  1 108 ? 13.208  -0.134  75.389  1.00 38.57  ? 107  ILE A CD1 1 
ATOM   843   N N   . ASP A  1 109 ? 10.429  4.930   73.959  1.00 35.36  ? 108  ASP A N   1 
ATOM   844   C CA  . ASP A  1 109 ? 10.063  5.888   72.923  1.00 36.31  ? 108  ASP A CA  1 
ATOM   845   C C   . ASP A  1 109 ? 11.104  5.920   71.796  1.00 40.23  ? 108  ASP A C   1 
ATOM   846   O O   . ASP A  1 109 ? 12.256  5.533   71.987  1.00 33.82  ? 108  ASP A O   1 
ATOM   847   C CB  . ASP A  1 109 ? 9.899   7.277   73.535  1.00 48.84  ? 108  ASP A CB  1 
ATOM   848   C CG  . ASP A  1 109 ? 8.727   8.036   72.945  1.00 82.81  ? 108  ASP A CG  1 
ATOM   849   O OD1 . ASP A  1 109 ? 8.309   7.717   71.806  1.00 73.56  ? 108  ASP A OD1 1 
ATOM   850   O OD2 . ASP A  1 109 ? 8.222   8.954   73.625  1.00 105.49 ? 108  ASP A OD2 1 
ATOM   851   N N   . THR A  1 110 ? 10.688  6.369   70.618  1.00 36.73  ? 109  THR A N   1 
ATOM   852   C CA  . THR A  1 110 ? 11.589  6.456   69.476  1.00 44.60  ? 109  THR A CA  1 
ATOM   853   C C   . THR A  1 110 ? 11.451  7.791   68.766  1.00 41.46  ? 109  THR A C   1 
ATOM   854   O O   . THR A  1 110 ? 10.514  8.544   69.013  1.00 43.23  ? 109  THR A O   1 
ATOM   855   C CB  . THR A  1 110 ? 11.311  5.347   68.439  1.00 53.27  ? 109  THR A CB  1 
ATOM   856   O OG1 . THR A  1 110 ? 10.025  5.556   67.843  1.00 56.66  ? 109  THR A OG1 1 
ATOM   857   C CG2 . THR A  1 110 ? 11.349  3.971   69.089  1.00 55.12  ? 109  THR A CG2 1 
ATOM   858   N N   . LYS A  1 111 ? 12.401  8.068   67.882  1.00 35.31  ? 110  LYS A N   1 
ATOM   859   C CA  . LYS A  1 111 ? 12.389  9.276   67.075  1.00 40.36  ? 110  LYS A CA  1 
ATOM   860   C C   . LYS A  1 111 ? 13.047  8.973   65.741  1.00 35.01  ? 110  LYS A C   1 
ATOM   861   O O   . LYS A  1 111 ? 13.820  8.022   65.622  1.00 39.95  ? 110  LYS A O   1 
ATOM   862   C CB  . LYS A  1 111 ? 13.137  10.405  67.785  1.00 35.65  ? 110  LYS A CB  1 
ATOM   863   C CG  . LYS A  1 111 ? 14.540  10.014  68.215  1.00 35.14  ? 110  LYS A CG  1 
ATOM   864   C CD  . LYS A  1 111 ? 14.854  10.610  69.560  1.00 59.29  ? 110  LYS A CD  1 
ATOM   865   C CE  . LYS A  1 111 ? 16.081  9.977   70.175  1.00 55.20  ? 110  LYS A CE  1 
ATOM   866   N NZ  . LYS A  1 111 ? 15.849  8.556   70.550  1.00 45.69  ? 110  LYS A NZ  1 
ATOM   867   N N   . GLU A  1 112 ? 12.731  9.782   64.739  1.00 38.67  ? 111  GLU A N   1 
ATOM   868   C CA  . GLU A  1 112 ? 13.287  9.624   63.403  1.00 44.86  ? 111  GLU A CA  1 
ATOM   869   C C   . GLU A  1 112 ? 14.307  10.726  63.161  1.00 41.49  ? 111  GLU A C   1 
ATOM   870   O O   . GLU A  1 112 ? 14.052  11.886  63.463  1.00 37.51  ? 111  GLU A O   1 
ATOM   871   C CB  . GLU A  1 112 ? 12.167  9.697   62.369  1.00 47.89  ? 111  GLU A CB  1 
ATOM   872   C CG  . GLU A  1 112 ? 12.604  9.479   60.932  1.00 62.10  ? 111  GLU A CG  1 
ATOM   873   C CD  . GLU A  1 112 ? 11.419  9.428   59.976  1.00 90.55  ? 111  GLU A CD  1 
ATOM   874   O OE1 . GLU A  1 112 ? 11.360  10.265  59.048  1.00 100.92 ? 111  GLU A OE1 1 
ATOM   875   O OE2 . GLU A  1 112 ? 10.543  8.551   60.154  1.00 92.39  ? 111  GLU A OE2 1 
ATOM   876   N N   . TYR A  1 113 ? 15.468  10.351  62.636  1.00 38.10  ? 112  TYR A N   1 
ATOM   877   C CA  . TYR A  1 113 ? 16.518  11.312  62.340  1.00 43.30  ? 112  TYR A CA  1 
ATOM   878   C C   . TYR A  1 113 ? 16.849  11.276  60.852  1.00 46.52  ? 112  TYR A C   1 
ATOM   879   O O   . TYR A  1 113 ? 16.891  10.199  60.250  1.00 39.33  ? 112  TYR A O   1 
ATOM   880   C CB  . TYR A  1 113 ? 17.772  10.996  63.157  1.00 44.24  ? 112  TYR A CB  1 
ATOM   881   C CG  . TYR A  1 113 ? 18.717  12.171  63.275  1.00 57.65  ? 112  TYR A CG  1 
ATOM   882   C CD1 . TYR A  1 113 ? 18.457  13.200  64.167  1.00 64.89  ? 112  TYR A CD1 1 
ATOM   883   C CD2 . TYR A  1 113 ? 19.865  12.254  62.493  1.00 64.54  ? 112  TYR A CD2 1 
ATOM   884   C CE1 . TYR A  1 113 ? 19.311  14.283  64.283  1.00 78.10  ? 112  TYR A CE1 1 
ATOM   885   C CE2 . TYR A  1 113 ? 20.730  13.336  62.603  1.00 63.04  ? 112  TYR A CE2 1 
ATOM   886   C CZ  . TYR A  1 113 ? 20.446  14.348  63.501  1.00 77.26  ? 112  TYR A CZ  1 
ATOM   887   O OH  . TYR A  1 113 ? 21.291  15.432  63.628  1.00 91.08  ? 112  TYR A OH  1 
ATOM   888   N N   . MET A  1 114 ? 17.072  12.452  60.269  1.00 30.99  ? 113  MET A N   1 
ATOM   889   C CA  . MET A  1 114 ? 17.447  12.578  58.867  1.00 39.55  ? 113  MET A CA  1 
ATOM   890   C C   . MET A  1 114 ? 18.623  13.529  58.729  1.00 46.52  ? 113  MET A C   1 
ATOM   891   O O   . MET A  1 114 ? 18.634  14.602  59.333  1.00 45.88  ? 113  MET A O   1 
ATOM   892   C CB  . MET A  1 114 ? 16.293  13.141  58.045  1.00 45.60  ? 113  MET A CB  1 
ATOM   893   C CG  . MET A  1 114 ? 15.050  12.294  58.034  1.00 66.16  ? 113  MET A CG  1 
ATOM   894   S SD  . MET A  1 114 ? 13.777  13.050  57.013  1.00 105.56 ? 113  MET A SD  1 
ATOM   895   C CE  . MET A  1 114 ? 14.619  13.140  55.432  1.00 56.71  ? 113  MET A CE  1 
ATOM   896   N N   . SER A  1 115 ? 19.604  13.132  57.926  1.00 47.51  ? 114  SER A N   1 
ATOM   897   C CA  . SER A  1 115 ? 20.717  14.001  57.570  1.00 52.18  ? 114  SER A CA  1 
ATOM   898   C C   . SER A  1 115 ? 20.732  14.207  56.060  1.00 45.98  ? 114  SER A C   1 
ATOM   899   O O   . SER A  1 115 ? 20.451  13.286  55.300  1.00 53.38  ? 114  SER A O   1 
ATOM   900   C CB  . SER A  1 115 ? 22.041  13.393  58.032  1.00 49.46  ? 114  SER A CB  1 
ATOM   901   O OG  . SER A  1 115 ? 22.115  13.373  59.447  1.00 74.87  ? 114  SER A OG  1 
ATOM   902   N N   . THR A  1 116 ? 21.061  15.418  55.630  1.00 46.17  ? 115  THR A N   1 
ATOM   903   C CA  . THR A  1 116 ? 21.059  15.756  54.213  1.00 46.90  ? 115  THR A CA  1 
ATOM   904   C C   . THR A  1 116 ? 22.312  16.538  53.833  1.00 49.08  ? 115  THR A C   1 
ATOM   905   O O   . THR A  1 116 ? 22.734  17.456  54.542  1.00 47.98  ? 115  THR A O   1 
ATOM   906   C CB  . THR A  1 116 ? 19.822  16.590  53.832  1.00 53.09  ? 115  THR A CB  1 
ATOM   907   O OG1 . THR A  1 116 ? 18.638  15.816  54.055  1.00 57.14  ? 115  THR A OG1 1 
ATOM   908   C CG2 . THR A  1 116 ? 19.882  16.997  52.368  1.00 55.02  ? 115  THR A CG2 1 
ATOM   909   N N   . LEU A  1 117 ? 22.902  16.156  52.707  1.00 42.43  ? 116  LEU A N   1 
ATOM   910   C CA  . LEU A  1 117 ? 24.061  16.838  52.162  1.00 45.05  ? 116  LEU A CA  1 
ATOM   911   C C   . LEU A  1 117 ? 23.738  17.188  50.719  1.00 50.51  ? 116  LEU A C   1 
ATOM   912   O O   . LEU A  1 117 ? 23.364  16.320  49.932  1.00 47.77  ? 116  LEU A O   1 
ATOM   913   C CB  . LEU A  1 117 ? 25.297  15.938  52.243  1.00 47.06  ? 116  LEU A CB  1 
ATOM   914   C CG  . LEU A  1 117 ? 26.628  16.486  51.715  1.00 53.85  ? 116  LEU A CG  1 
ATOM   915   C CD1 . LEU A  1 117 ? 26.709  16.358  50.211  1.00 69.27  ? 116  LEU A CD1 1 
ATOM   916   C CD2 . LEU A  1 117 ? 26.840  17.928  52.145  1.00 49.82  ? 116  LEU A CD2 1 
ATOM   917   N N   . THR A  1 118 ? 23.847  18.466  50.387  1.00 43.65  ? 117  THR A N   1 
ATOM   918   C CA  . THR A  1 118 ? 23.558  18.930  49.042  1.00 45.03  ? 117  THR A CA  1 
ATOM   919   C C   . THR A  1 118 ? 24.699  19.806  48.553  1.00 47.82  ? 117  THR A C   1 
ATOM   920   O O   . THR A  1 118 ? 25.289  20.562  49.318  1.00 45.26  ? 117  THR A O   1 
ATOM   921   C CB  . THR A  1 118 ? 22.259  19.758  49.005  1.00 55.70  ? 117  THR A CB  1 
ATOM   922   O OG1 . THR A  1 118 ? 21.183  18.992  49.557  1.00 63.32  ? 117  THR A OG1 1 
ATOM   923   C CG2 . THR A  1 118 ? 21.912  20.155  47.581  1.00 56.60  ? 117  THR A CG2 1 
ATOM   924   N N   . TYR A  1 119 ? 25.023  19.701  47.276  1.00 47.32  ? 118  TYR A N   1 
ATOM   925   C CA  . TYR A  1 119 ? 25.933  20.655  46.675  1.00 49.77  ? 118  TYR A CA  1 
ATOM   926   C C   . TYR A  1 119 ? 25.492  20.915  45.246  1.00 48.13  ? 118  TYR A C   1 
ATOM   927   O O   . TYR A  1 119 ? 24.866  20.070  44.612  1.00 51.09  ? 118  TYR A O   1 
ATOM   928   C CB  . TYR A  1 119 ? 27.388  20.170  46.757  1.00 45.02  ? 118  TYR A CB  1 
ATOM   929   C CG  . TYR A  1 119 ? 27.624  18.800  46.196  1.00 47.19  ? 118  TYR A CG  1 
ATOM   930   C CD1 . TYR A  1 119 ? 28.020  18.625  44.875  1.00 67.28  ? 118  TYR A CD1 1 
ATOM   931   C CD2 . TYR A  1 119 ? 27.462  17.669  46.988  1.00 65.40  ? 118  TYR A CD2 1 
ATOM   932   C CE1 . TYR A  1 119 ? 28.243  17.355  44.353  1.00 70.90  ? 118  TYR A CE1 1 
ATOM   933   C CE2 . TYR A  1 119 ? 27.681  16.397  46.478  1.00 70.50  ? 118  TYR A CE2 1 
ATOM   934   C CZ  . TYR A  1 119 ? 28.070  16.247  45.159  1.00 77.77  ? 118  TYR A CZ  1 
ATOM   935   O OH  . TYR A  1 119 ? 28.288  14.985  44.650  1.00 95.31  ? 118  TYR A OH  1 
ATOM   936   N N   . GLY A  1 120 ? 25.795  22.102  44.748  1.00 42.40  ? 119  GLY A N   1 
ATOM   937   C CA  . GLY A  1 120 ? 25.367  22.476  43.417  1.00 51.35  ? 119  GLY A CA  1 
ATOM   938   C C   . GLY A  1 120 ? 26.333  23.434  42.758  1.00 51.80  ? 119  GLY A C   1 
ATOM   939   O O   . GLY A  1 120 ? 27.227  23.982  43.400  1.00 45.66  ? 119  GLY A O   1 
ATOM   940   N N   . PHE A  1 121 ? 26.149  23.613  41.458  1.00 53.12  ? 120  PHE A N   1 
ATOM   941   C CA  . PHE A  1 121 ? 26.940  24.540  40.679  1.00 51.69  ? 120  PHE A CA  1 
ATOM   942   C C   . PHE A  1 121 ? 25.985  25.291  39.788  1.00 52.10  ? 120  PHE A C   1 
ATOM   943   O O   . PHE A  1 121 ? 24.963  24.758  39.364  1.00 50.01  ? 120  PHE A O   1 
ATOM   944   C CB  . PHE A  1 121 ? 27.977  23.789  39.846  1.00 48.25  ? 120  PHE A CB  1 
ATOM   945   C CG  . PHE A  1 121 ? 28.894  22.932  40.668  1.00 58.66  ? 120  PHE A CG  1 
ATOM   946   C CD1 . PHE A  1 121 ? 30.060  23.455  41.200  1.00 61.29  ? 120  PHE A CD1 1 
ATOM   947   C CD2 . PHE A  1 121 ? 28.582  21.607  40.925  1.00 58.71  ? 120  PHE A CD2 1 
ATOM   948   C CE1 . PHE A  1 121 ? 30.906  22.668  41.962  1.00 63.60  ? 120  PHE A CE1 1 
ATOM   949   C CE2 . PHE A  1 121 ? 29.423  20.815  41.687  1.00 66.30  ? 120  PHE A CE2 1 
ATOM   950   C CZ  . PHE A  1 121 ? 30.586  21.346  42.208  1.00 59.25  ? 120  PHE A CZ  1 
ATOM   951   N N   . ASN A  1 122 ? 26.302  26.546  39.521  1.00 48.97  ? 121  ASN A N   1 
ATOM   952   C CA  . ASN A  1 122 ? 25.483  27.332  38.623  1.00 56.38  ? 121  ASN A CA  1 
ATOM   953   C C   . ASN A  1 122 ? 26.342  28.297  37.828  1.00 62.78  ? 121  ASN A C   1 
ATOM   954   O O   . ASN A  1 122 ? 27.494  28.548  38.170  1.00 56.00  ? 121  ASN A O   1 
ATOM   955   C CB  . ASN A  1 122 ? 24.419  28.087  39.411  1.00 46.87  ? 121  ASN A CB  1 
ATOM   956   C CG  . ASN A  1 122 ? 25.007  29.155  40.302  1.00 58.69  ? 121  ASN A CG  1 
ATOM   957   O OD1 . ASN A  1 122 ? 25.699  28.858  41.277  1.00 66.33  ? 121  ASN A OD1 1 
ATOM   958   N ND2 . ASN A  1 122 ? 24.734  30.411  39.973  1.00 60.28  ? 121  ASN A ND2 1 
ATOM   959   N N   . GLY A  1 123 ? 25.776  28.827  36.755  1.00 58.56  ? 122  GLY A N   1 
ATOM   960   C CA  . GLY A  1 123 ? 26.461  29.802  35.939  1.00 56.66  ? 122  GLY A CA  1 
ATOM   961   C C   . GLY A  1 123 ? 25.450  30.607  35.160  1.00 63.63  ? 122  GLY A C   1 
ATOM   962   O O   . GLY A  1 123 ? 24.306  30.185  34.987  1.00 56.27  ? 122  GLY A O   1 
ATOM   963   N N   . ASN A  1 124 ? 25.860  31.782  34.701  1.00 68.07  ? 123  ASN A N   1 
ATOM   964   C CA  . ASN A  1 124 ? 25.021  32.560  33.807  1.00 70.35  ? 123  ASN A CA  1 
ATOM   965   C C   . ASN A  1 124 ? 25.850  33.461  32.905  1.00 73.69  ? 123  ASN A C   1 
ATOM   966   O O   . ASN A  1 124 ? 27.034  33.691  33.151  1.00 75.56  ? 123  ASN A O   1 
ATOM   967   C CB  . ASN A  1 124 ? 24.007  33.379  34.600  1.00 59.17  ? 123  ASN A CB  1 
ATOM   968   C CG  . ASN A  1 124 ? 24.641  34.541  35.335  1.00 80.12  ? 123  ASN A CG  1 
ATOM   969   O OD1 . ASN A  1 124 ? 25.593  35.152  34.845  1.00 82.48  ? 123  ASN A OD1 1 
ATOM   970   N ND2 . ASN A  1 124 ? 24.116  34.856  36.517  1.00 70.59  ? 123  ASN A ND2 1 
ATOM   971   N N   . VAL A  1 125 ? 25.223  33.942  31.841  1.00 60.44  ? 124  VAL A N   1 
ATOM   972   C CA  . VAL A  1 125 ? 25.827  34.946  30.983  1.00 65.85  ? 124  VAL A CA  1 
ATOM   973   C C   . VAL A  1 125 ? 24.828  36.081  30.872  1.00 65.11  ? 124  VAL A C   1 
ATOM   974   O O   . VAL A  1 125 ? 23.633  35.853  30.682  1.00 67.04  ? 124  VAL A O   1 
ATOM   975   C CB  . VAL A  1 125 ? 26.171  34.390  29.594  1.00 66.79  ? 124  VAL A CB  1 
ATOM   976   C CG1 . VAL A  1 125 ? 27.291  33.372  29.702  1.00 54.70  ? 124  VAL A CG1 1 
ATOM   977   C CG2 . VAL A  1 125 ? 24.941  33.772  28.945  1.00 69.63  ? 124  VAL A CG2 1 
ATOM   978   N N   . THR A  1 126 ? 25.323  37.302  31.030  1.00 76.90  ? 125  THR A N   1 
ATOM   979   C CA  . THR A  1 126 ? 24.475  38.480  31.057  1.00 77.20  ? 125  THR A CA  1 
ATOM   980   C C   . THR A  1 126 ? 24.916  39.468  29.979  1.00 88.79  ? 125  THR A C   1 
ATOM   981   O O   . THR A  1 126 ? 26.024  39.373  29.448  1.00 77.08  ? 125  THR A O   1 
ATOM   982   C CB  . THR A  1 126 ? 24.534  39.152  32.439  1.00 87.88  ? 125  THR A CB  1 
ATOM   983   O OG1 . THR A  1 126 ? 23.643  40.273  32.475  1.00 105.22 ? 125  THR A OG1 1 
ATOM   984   C CG2 . THR A  1 126 ? 25.953  39.614  32.751  1.00 72.01  ? 125  THR A CG2 1 
ATOM   985   N N   . GLY A  1 127 ? 24.039  40.409  29.646  1.00 78.46  ? 126  GLY A N   1 
ATOM   986   C CA  . GLY A  1 127 ? 24.355  41.412  28.648  1.00 86.83  ? 126  GLY A CA  1 
ATOM   987   C C   . GLY A  1 127 ? 23.256  42.436  28.440  1.00 79.03  ? 126  GLY A C   1 
ATOM   988   O O   . GLY A  1 127 ? 22.092  42.197  28.749  1.00 72.16  ? 126  GLY A O   1 
ATOM   989   N N   . ASP A  1 128 ? 23.642  43.590  27.910  1.00 92.66  ? 127  ASP A N   1 
ATOM   990   C CA  . ASP A  1 128 ? 22.693  44.637  27.556  1.00 89.06  ? 127  ASP A CA  1 
ATOM   991   C C   . ASP A  1 128 ? 22.891  45.029  26.096  1.00 100.26 ? 127  ASP A C   1 
ATOM   992   O O   . ASP A  1 128 ? 23.731  44.455  25.400  1.00 78.23  ? 127  ASP A O   1 
ATOM   993   C CB  . ASP A  1 128 ? 22.873  45.855  28.459  1.00 93.72  ? 127  ASP A CB  1 
ATOM   994   C CG  . ASP A  1 128 ? 24.311  46.341  28.504  1.00 102.54 ? 127  ASP A CG  1 
ATOM   995   O OD1 . ASP A  1 128 ? 25.117  45.909  27.651  1.00 89.70  ? 127  ASP A OD1 1 
ATOM   996   O OD2 . ASP A  1 128 ? 24.633  47.162  29.391  1.00 100.81 ? 127  ASP A OD2 1 
ATOM   997   N N   . ASP A  1 129 ? 22.120  46.008  25.637  1.00 110.25 ? 128  ASP A N   1 
ATOM   998   C CA  . ASP A  1 129 ? 22.167  46.422  24.237  1.00 115.50 ? 128  ASP A CA  1 
ATOM   999   C C   . ASP A  1 129 ? 23.474  47.136  23.888  1.00 113.64 ? 128  ASP A C   1 
ATOM   1000  O O   . ASP A  1 129 ? 23.867  47.182  22.721  1.00 107.84 ? 128  ASP A O   1 
ATOM   1001  C CB  . ASP A  1 129 ? 20.966  47.311  23.898  1.00 90.65  ? 128  ASP A CB  1 
ATOM   1002  C CG  . ASP A  1 129 ? 20.802  48.467  24.863  1.00 108.38 ? 128  ASP A CG  1 
ATOM   1003  O OD1 . ASP A  1 129 ? 19.678  49.006  24.957  1.00 103.84 ? 128  ASP A OD1 1 
ATOM   1004  O OD2 . ASP A  1 129 ? 21.793  48.835  25.531  1.00 116.56 ? 128  ASP A OD2 1 
ATOM   1005  N N   . THR A  1 130 ? 24.156  47.670  24.897  1.00 91.72  ? 129  THR A N   1 
ATOM   1006  C CA  . THR A  1 130 ? 25.404  48.389  24.667  1.00 64.48  ? 129  THR A CA  1 
ATOM   1007  C C   . THR A  1 130 ? 26.579  47.441  24.428  1.00 75.10  ? 129  THR A C   1 
ATOM   1008  O O   . THR A  1 130 ? 27.734  47.821  24.620  1.00 98.56  ? 129  THR A O   1 
ATOM   1009  C CB  . THR A  1 130 ? 25.749  49.340  25.843  1.00 81.79  ? 129  THR A CB  1 
ATOM   1010  O OG1 . THR A  1 130 ? 26.307  48.599  26.932  1.00 88.03  ? 129  THR A OG1 1 
ATOM   1011  C CG2 . THR A  1 130 ? 24.512  50.091  26.318  1.00 85.77  ? 129  THR A CG2 1 
ATOM   1012  N N   . GLY A  1 131 ? 26.284  46.211  24.013  1.00 88.93  ? 130  GLY A N   1 
ATOM   1013  C CA  . GLY A  1 131 ? 27.313  45.249  23.647  1.00 92.01  ? 130  GLY A CA  1 
ATOM   1014  C C   . GLY A  1 131 ? 28.188  44.770  24.797  1.00 85.38  ? 130  GLY A C   1 
ATOM   1015  O O   . GLY A  1 131 ? 29.197  44.100  24.579  1.00 91.67  ? 130  GLY A O   1 
ATOM   1016  N N   . LYS A  1 132 ? 27.797  45.106  26.021  1.00 84.04  ? 131  LYS A N   1 
ATOM   1017  C CA  . LYS A  1 132 ? 28.561  44.738  27.211  1.00 96.44  ? 131  LYS A CA  1 
ATOM   1018  C C   . LYS A  1 132 ? 28.089  43.395  27.787  1.00 104.64 ? 131  LYS A C   1 
ATOM   1019  O O   . LYS A  1 132 ? 26.908  43.235  28.095  1.00 92.52  ? 131  LYS A O   1 
ATOM   1020  C CB  . LYS A  1 132 ? 28.414  45.843  28.261  1.00 83.95  ? 131  LYS A CB  1 
ATOM   1021  C CG  . LYS A  1 132 ? 29.089  45.553  29.584  1.00 85.98  ? 131  LYS A CG  1 
ATOM   1022  C CD  . LYS A  1 132 ? 28.801  46.657  30.593  1.00 91.21  ? 131  LYS A CD  1 
ATOM   1023  C CE  . LYS A  1 132 ? 29.330  46.305  31.976  1.00 86.23  ? 131  LYS A CE  1 
ATOM   1024  N NZ  . LYS A  1 132 ? 30.792  46.015  31.958  1.00 93.72  ? 131  LYS A NZ  1 
ATOM   1025  N N   . ILE A  1 133 ? 29.008  42.437  27.935  1.00 86.08  ? 132  ILE A N   1 
ATOM   1026  C CA  . ILE A  1 133 ? 28.662  41.111  28.452  1.00 89.18  ? 132  ILE A CA  1 
ATOM   1027  C C   . ILE A  1 133 ? 29.342  40.814  29.796  1.00 99.42  ? 132  ILE A C   1 
ATOM   1028  O O   . ILE A  1 133 ? 30.407  41.354  30.096  1.00 100.47 ? 132  ILE A O   1 
ATOM   1029  C CB  . ILE A  1 133 ? 29.020  39.993  27.445  1.00 85.59  ? 132  ILE A CB  1 
ATOM   1030  C CG1 . ILE A  1 133 ? 30.495  39.601  27.565  1.00 97.72  ? 132  ILE A CG1 1 
ATOM   1031  C CG2 . ILE A  1 133 ? 28.684  40.419  26.023  1.00 69.19  ? 132  ILE A CG2 1 
ATOM   1032  C CD1 . ILE A  1 133 ? 30.732  38.355  28.412  1.00 86.37  ? 132  ILE A CD1 1 
ATOM   1033  N N   . GLY A  1 134 ? 28.712  39.951  30.594  1.00 92.48  ? 133  GLY A N   1 
ATOM   1034  C CA  . GLY A  1 134 ? 29.221  39.575  31.904  1.00 79.40  ? 133  GLY A CA  1 
ATOM   1035  C C   . GLY A  1 134 ? 28.979  38.103  32.209  1.00 80.91  ? 133  GLY A C   1 
ATOM   1036  O O   . GLY A  1 134 ? 28.210  37.433  31.519  1.00 62.42  ? 133  GLY A O   1 
ATOM   1037  N N   . GLY A  1 135 ? 29.629  37.591  33.249  1.00 78.71  ? 134  GLY A N   1 
ATOM   1038  C CA  . GLY A  1 135 ? 29.567  36.171  33.544  1.00 83.25  ? 134  GLY A CA  1 
ATOM   1039  C C   . GLY A  1 135 ? 29.624  35.852  35.023  1.00 76.30  ? 134  GLY A C   1 
ATOM   1040  O O   . GLY A  1 135 ? 30.182  36.615  35.817  1.00 60.95  ? 134  GLY A O   1 
ATOM   1041  N N   . LEU A  1 136 ? 29.055  34.704  35.382  1.00 68.13  ? 135  LEU A N   1 
ATOM   1042  C CA  . LEU A  1 136 ? 28.930  34.284  36.774  1.00 48.46  ? 135  LEU A CA  1 
ATOM   1043  C C   . LEU A  1 136 ? 29.085  32.764  36.862  1.00 67.90  ? 135  LEU A C   1 
ATOM   1044  O O   . LEU A  1 136 ? 28.357  32.032  36.197  1.00 52.37  ? 135  LEU A O   1 
ATOM   1045  C CB  . LEU A  1 136 ? 27.558  34.710  37.309  1.00 56.59  ? 135  LEU A CB  1 
ATOM   1046  C CG  . LEU A  1 136 ? 27.144  34.401  38.756  1.00 73.19  ? 135  LEU A CG  1 
ATOM   1047  C CD1 . LEU A  1 136 ? 27.022  32.901  38.991  1.00 53.92  ? 135  LEU A CD1 1 
ATOM   1048  C CD2 . LEU A  1 136 ? 28.095  35.035  39.765  1.00 62.75  ? 135  LEU A CD2 1 
ATOM   1049  N N   . ILE A  1 137 ? 30.048  32.301  37.662  1.00 61.87  ? 136  ILE A N   1 
ATOM   1050  C CA  . ILE A  1 137 ? 30.167  30.888  38.016  1.00 58.81  ? 136  ILE A CA  1 
ATOM   1051  C C   . ILE A  1 137 ? 30.046  30.758  39.537  1.00 67.79  ? 136  ILE A C   1 
ATOM   1052  O O   . ILE A  1 137 ? 30.709  31.476  40.282  1.00 66.54  ? 136  ILE A O   1 
ATOM   1053  C CB  . ILE A  1 137 ? 31.507  30.277  37.537  1.00 60.71  ? 136  ILE A CB  1 
ATOM   1054  C CG1 . ILE A  1 137 ? 31.600  30.327  36.014  1.00 75.83  ? 136  ILE A CG1 1 
ATOM   1055  C CG2 . ILE A  1 137 ? 31.640  28.832  38.004  1.00 70.55  ? 136  ILE A CG2 1 
ATOM   1056  C CD1 . ILE A  1 137 ? 32.887  29.751  35.460  1.00 92.47  ? 136  ILE A CD1 1 
ATOM   1057  N N   . GLY A  1 138 ? 29.193  29.850  39.996  1.00 58.15  ? 137  GLY A N   1 
ATOM   1058  C CA  . GLY A  1 138 ? 28.927  29.710  41.418  1.00 56.56  ? 137  GLY A CA  1 
ATOM   1059  C C   . GLY A  1 138 ? 28.840  28.264  41.884  1.00 56.60  ? 137  GLY A C   1 
ATOM   1060  O O   . GLY A  1 138 ? 28.633  27.337  41.097  1.00 55.58  ? 137  GLY A O   1 
ATOM   1061  N N   . ALA A  1 139 ? 29.015  28.075  43.184  1.00 43.20  ? 138  ALA A N   1 
ATOM   1062  C CA  . ALA A  1 139 ? 28.924  26.758  43.790  1.00 50.20  ? 138  ALA A CA  1 
ATOM   1063  C C   . ALA A  1 139 ? 28.372  26.901  45.195  1.00 55.96  ? 138  ALA A C   1 
ATOM   1064  O O   . ALA A  1 139 ? 28.497  27.953  45.823  1.00 45.59  ? 138  ALA A O   1 
ATOM   1065  C CB  . ALA A  1 139 ? 30.281  26.098  43.831  1.00 43.78  ? 138  ALA A CB  1 
ATOM   1066  N N   . ASN A  1 140 ? 27.756  25.841  45.695  1.00 52.10  ? 139  ASN A N   1 
ATOM   1067  C CA  . ASN A  1 140 ? 27.228  25.866  47.050  1.00 50.21  ? 139  ASN A CA  1 
ATOM   1068  C C   . ASN A  1 140 ? 27.185  24.473  47.658  1.00 50.82  ? 139  ASN A C   1 
ATOM   1069  O O   . ASN A  1 140 ? 27.209  23.460  46.958  1.00 47.99  ? 139  ASN A O   1 
ATOM   1070  C CB  . ASN A  1 140 ? 25.832  26.485  47.063  1.00 49.21  ? 139  ASN A CB  1 
ATOM   1071  C CG  . ASN A  1 140 ? 24.899  25.817  46.071  1.00 62.55  ? 139  ASN A CG  1 
ATOM   1072  O OD1 . ASN A  1 140 ? 24.323  24.769  46.352  1.00 71.30  ? 139  ASN A OD1 1 
ATOM   1073  N ND2 . ASN A  1 140 ? 24.756  26.418  44.895  1.00 86.94  ? 139  ASN A ND2 1 
ATOM   1074  N N   . VAL A  1 141 ? 27.143  24.437  48.979  1.00 41.64  ? 140  VAL A N   1 
ATOM   1075  C CA  . VAL A  1 141 ? 27.007  23.193  49.704  1.00 45.65  ? 140  VAL A CA  1 
ATOM   1076  C C   . VAL A  1 141 ? 26.158  23.476  50.930  1.00 49.95  ? 140  VAL A C   1 
ATOM   1077  O O   . VAL A  1 141 ? 26.231  24.559  51.510  1.00 43.95  ? 140  VAL A O   1 
ATOM   1078  C CB  . VAL A  1 141 ? 28.380  22.627  50.112  1.00 49.71  ? 140  VAL A CB  1 
ATOM   1079  C CG1 . VAL A  1 141 ? 29.130  23.621  50.970  1.00 45.87  ? 140  VAL A CG1 1 
ATOM   1080  C CG2 . VAL A  1 141 ? 28.214  21.300  50.843  1.00 43.67  ? 140  VAL A CG2 1 
ATOM   1081  N N   . SER A  1 142 ? 25.328  22.516  51.314  1.00 52.43  ? 141  SER A N   1 
ATOM   1082  C CA  . SER A  1 142 ? 24.487  22.685  52.490  1.00 52.51  ? 141  SER A CA  1 
ATOM   1083  C C   . SER A  1 142 ? 24.313  21.361  53.209  1.00 60.08  ? 141  SER A C   1 
ATOM   1084  O O   . SER A  1 142 ? 24.231  20.299  52.589  1.00 58.13  ? 141  SER A O   1 
ATOM   1085  C CB  . SER A  1 142 ? 23.123  23.268  52.110  1.00 58.19  ? 141  SER A CB  1 
ATOM   1086  O OG  . SER A  1 142 ? 22.438  22.414  51.212  1.00 88.04  ? 141  SER A OG  1 
ATOM   1087  N N   . ILE A  1 143 ? 24.292  21.443  54.530  1.00 42.71  ? 142  ILE A N   1 
ATOM   1088  C CA  . ILE A  1 143 ? 24.041  20.301  55.377  1.00 38.52  ? 142  ILE A CA  1 
ATOM   1089  C C   . ILE A  1 143 ? 22.788  20.573  56.192  1.00 52.74  ? 142  ILE A C   1 
ATOM   1090  O O   . ILE A  1 143 ? 22.572  21.692  56.661  1.00 49.92  ? 142  ILE A O   1 
ATOM   1091  C CB  . ILE A  1 143 ? 25.204  20.063  56.338  1.00 45.93  ? 142  ILE A CB  1 
ATOM   1092  C CG1 . ILE A  1 143 ? 26.474  19.773  55.551  1.00 52.24  ? 142  ILE A CG1 1 
ATOM   1093  C CG2 . ILE A  1 143 ? 24.886  18.909  57.269  1.00 59.28  ? 142  ILE A CG2 1 
ATOM   1094  C CD1 . ILE A  1 143 ? 27.669  19.484  56.419  1.00 73.33  ? 142  ILE A CD1 1 
ATOM   1095  N N   . GLY A  1 144 ? 21.961  19.550  56.356  1.00 49.99  ? 143  GLY A N   1 
ATOM   1096  C CA  . GLY A  1 144 ? 20.732  19.682  57.110  1.00 36.79  ? 143  GLY A CA  1 
ATOM   1097  C C   . GLY A  1 144 ? 20.532  18.506  58.048  1.00 52.45  ? 143  GLY A C   1 
ATOM   1098  O O   . GLY A  1 144 ? 20.988  17.394  57.786  1.00 37.90  ? 143  GLY A O   1 
ATOM   1099  N N   . HIS A  1 145 ? 19.844  18.761  59.152  1.00 45.66  ? 144  HIS A N   1 
ATOM   1100  C CA  . HIS A  1 145 ? 19.514  17.727  60.112  1.00 44.50  ? 144  HIS A CA  1 
ATOM   1101  C C   . HIS A  1 145 ? 18.064  17.928  60.506  1.00 50.26  ? 144  HIS A C   1 
ATOM   1102  O O   . HIS A  1 145 ? 17.632  19.050  60.775  1.00 44.10  ? 144  HIS A O   1 
ATOM   1103  C CB  . HIS A  1 145 ? 20.410  17.821  61.348  1.00 50.58  ? 144  HIS A CB  1 
ATOM   1104  C CG  . HIS A  1 145 ? 21.875  17.737  61.043  1.00 78.18  ? 144  HIS A CG  1 
ATOM   1105  N ND1 . HIS A  1 145 ? 22.512  16.546  60.764  1.00 74.06  ? 144  HIS A ND1 1 
ATOM   1106  C CD2 . HIS A  1 145 ? 22.829  18.698  60.979  1.00 66.20  ? 144  HIS A CD2 1 
ATOM   1107  C CE1 . HIS A  1 145 ? 23.795  16.777  60.541  1.00 73.41  ? 144  HIS A CE1 1 
ATOM   1108  N NE2 . HIS A  1 145 ? 24.014  18.075  60.666  1.00 74.14  ? 144  HIS A NE2 1 
ATOM   1109  N N   . THR A  1 146 ? 17.311  16.839  60.533  1.00 40.09  ? 145  THR A N   1 
ATOM   1110  C CA  . THR A  1 146 ? 15.906  16.907  60.874  1.00 39.01  ? 145  THR A CA  1 
ATOM   1111  C C   . THR A  1 146 ? 15.595  15.865  61.933  1.00 45.15  ? 145  THR A C   1 
ATOM   1112  O O   . THR A  1 146 ? 16.114  14.744  61.906  1.00 38.88  ? 145  THR A O   1 
ATOM   1113  C CB  . THR A  1 146 ? 15.014  16.692  59.639  1.00 48.11  ? 145  THR A CB  1 
ATOM   1114  O OG1 . THR A  1 146 ? 15.230  17.756  58.708  1.00 60.83  ? 145  THR A OG1 1 
ATOM   1115  C CG2 . THR A  1 146 ? 13.550  16.677  60.024  1.00 45.00  ? 145  THR A CG2 1 
ATOM   1116  N N   . LEU A  1 147 ? 14.751  16.257  62.876  1.00 42.58  ? 146  LEU A N   1 
ATOM   1117  C CA  . LEU A  1 147 ? 14.342  15.399  63.963  1.00 33.26  ? 146  LEU A CA  1 
ATOM   1118  C C   . LEU A  1 147 ? 12.822  15.356  63.975  1.00 44.33  ? 146  LEU A C   1 
ATOM   1119  O O   . LEU A  1 147 ? 12.172  16.398  63.954  1.00 42.84  ? 146  LEU A O   1 
ATOM   1120  C CB  . LEU A  1 147 ? 14.871  15.967  65.272  1.00 38.93  ? 146  LEU A CB  1 
ATOM   1121  C CG  . LEU A  1 147 ? 14.381  15.316  66.552  1.00 52.67  ? 146  LEU A CG  1 
ATOM   1122  C CD1 . LEU A  1 147 ? 14.889  13.884  66.633  1.00 48.88  ? 146  LEU A CD1 1 
ATOM   1123  C CD2 . LEU A  1 147 ? 14.847  16.134  67.739  1.00 56.12  ? 146  LEU A CD2 1 
ATOM   1124  N N   . LYS A  1 148 ? 12.256  14.152  63.989  1.00 32.09  ? 147  LYS A N   1 
ATOM   1125  C CA  . LYS A  1 148 ? 10.808  13.990  63.978  1.00 39.21  ? 147  LYS A CA  1 
ATOM   1126  C C   . LYS A  1 148 ? 10.373  12.983  65.050  1.00 42.75  ? 147  LYS A C   1 
ATOM   1127  O O   . LYS A  1 148 ? 10.994  11.940  65.205  1.00 35.72  ? 147  LYS A O   1 
ATOM   1128  C CB  . LYS A  1 148 ? 10.345  13.519  62.596  1.00 35.28  ? 147  LYS A CB  1 
ATOM   1129  C CG  . LYS A  1 148 ? 8.860   13.201  62.520  1.00 64.23  ? 147  LYS A CG  1 
ATOM   1130  C CD  . LYS A  1 148 ? 8.508   12.414  61.266  1.00 78.00  ? 147  LYS A CD  1 
ATOM   1131  C CE  . LYS A  1 148 ? 8.817   13.201  60.006  1.00 91.68  ? 147  LYS A CE  1 
ATOM   1132  N NZ  . LYS A  1 148 ? 8.395   12.471  58.775  1.00 102.66 ? 147  LYS A NZ  1 
ATOM   1133  N N   . TYR A  1 149 ? 9.309   13.295  65.785  1.00 39.04  ? 148  TYR A N   1 
ATOM   1134  C CA  . TYR A  1 149 ? 8.761   12.356  66.765  1.00 46.36  ? 148  TYR A CA  1 
ATOM   1135  C C   . TYR A  1 149 ? 7.333   12.726  67.117  1.00 44.42  ? 148  TYR A C   1 
ATOM   1136  O O   . TYR A  1 149 ? 6.884   13.831  66.844  1.00 39.26  ? 148  TYR A O   1 
ATOM   1137  C CB  . TYR A  1 149 ? 9.615   12.327  68.036  1.00 38.74  ? 148  TYR A CB  1 
ATOM   1138  C CG  . TYR A  1 149 ? 9.866   13.705  68.591  1.00 46.91  ? 148  TYR A CG  1 
ATOM   1139  C CD1 . TYR A  1 149 ? 9.102   14.201  69.636  1.00 58.66  ? 148  TYR A CD1 1 
ATOM   1140  C CD2 . TYR A  1 149 ? 10.851  14.521  68.053  1.00 51.24  ? 148  TYR A CD2 1 
ATOM   1141  C CE1 . TYR A  1 149 ? 9.322   15.463  70.140  1.00 59.27  ? 148  TYR A CE1 1 
ATOM   1142  C CE2 . TYR A  1 149 ? 11.078  15.782  68.548  1.00 64.04  ? 148  TYR A CE2 1 
ATOM   1143  C CZ  . TYR A  1 149 ? 10.311  16.249  69.591  1.00 69.98  ? 148  TYR A CZ  1 
ATOM   1144  O OH  . TYR A  1 149 ? 10.538  17.511  70.077  1.00 83.25  ? 148  TYR A OH  1 
ATOM   1145  N N   . VAL A  1 150 ? 6.631   11.786  67.733  1.00 40.24  ? 149  VAL A N   1 
ATOM   1146  C CA  . VAL A  1 150 ? 5.235   11.958  68.087  1.00 40.21  ? 149  VAL A CA  1 
ATOM   1147  C C   . VAL A  1 150 ? 5.123   12.295  69.562  1.00 37.76  ? 149  VAL A C   1 
ATOM   1148  O O   . VAL A  1 150 ? 5.865   11.761  70.381  1.00 50.50  ? 149  VAL A O   1 
ATOM   1149  C CB  . VAL A  1 150 ? 4.437   10.665  67.801  1.00 42.55  ? 149  VAL A CB  1 
ATOM   1150  C CG1 . VAL A  1 150 ? 3.004   10.805  68.277  1.00 48.06  ? 149  VAL A CG1 1 
ATOM   1151  C CG2 . VAL A  1 150 ? 4.483   10.353  66.318  1.00 46.60  ? 149  VAL A CG2 1 
ATOM   1152  N N   . GLN A  1 151 ? 4.191   13.181  69.894  1.00 34.58  ? 150  GLN A N   1 
ATOM   1153  C CA  . GLN A  1 151 ? 3.956   13.583  71.277  1.00 42.06  ? 150  GLN A CA  1 
ATOM   1154  C C   . GLN A  1 151 ? 2.477   13.513  71.618  1.00 34.76  ? 150  GLN A C   1 
ATOM   1155  O O   . GLN A  1 151 ? 1.665   14.229  71.035  1.00 36.62  ? 150  GLN A O   1 
ATOM   1156  C CB  . GLN A  1 151 ? 4.452   15.007  71.502  1.00 48.10  ? 150  GLN A CB  1 
ATOM   1157  C CG  . GLN A  1 151 ? 5.944   15.145  71.402  1.00 67.65  ? 150  GLN A CG  1 
ATOM   1158  C CD  . GLN A  1 151 ? 6.418   16.507  71.847  1.00 83.61  ? 150  GLN A CD  1 
ATOM   1159  O OE1 . GLN A  1 151 ? 6.991   16.647  72.928  1.00 86.04  ? 150  GLN A OE1 1 
ATOM   1160  N NE2 . GLN A  1 151 ? 6.177   17.526  71.019  1.00 63.40  ? 150  GLN A NE2 1 
ATOM   1161  N N   . PRO A  1 152 ? 2.113   12.640  72.561  1.00 41.93  ? 151  PRO A N   1 
ATOM   1162  C CA  . PRO A  1 152 ? 0.718   12.601  73.012  1.00 40.06  ? 151  PRO A CA  1 
ATOM   1163  C C   . PRO A  1 152 ? 0.418   13.779  73.942  1.00 29.85  ? 151  PRO A C   1 
ATOM   1164  O O   . PRO A  1 152 ? 1.349   14.327  74.536  1.00 33.11  ? 151  PRO A O   1 
ATOM   1165  C CB  . PRO A  1 152 ? 0.644   11.279  73.767  1.00 35.49  ? 151  PRO A CB  1 
ATOM   1166  C CG  . PRO A  1 152 ? 2.031   11.083  74.294  1.00 35.43  ? 151  PRO A CG  1 
ATOM   1167  C CD  . PRO A  1 152 ? 2.943   11.627  73.239  1.00 35.88  ? 151  PRO A CD  1 
ATOM   1168  N N   . ASP A  1 153 ? -0.849  14.168  74.053  1.00 30.80  ? 152  ASP A N   1 
ATOM   1169  C CA  . ASP A  1 153 ? -1.244  15.258  74.951  1.00 27.16  ? 152  ASP A CA  1 
ATOM   1170  C C   . ASP A  1 153 ? -0.977  14.864  76.410  1.00 43.49  ? 152  ASP A C   1 
ATOM   1171  O O   . ASP A  1 153 ? -0.575  15.694  77.223  1.00 33.84  ? 152  ASP A O   1 
ATOM   1172  C CB  . ASP A  1 153 ? -2.730  15.594  74.772  1.00 35.48  ? 152  ASP A CB  1 
ATOM   1173  C CG  . ASP A  1 153 ? -3.019  16.361  73.483  1.00 55.47  ? 152  ASP A CG  1 
ATOM   1174  O OD1 . ASP A  1 153 ? -4.213  16.644  73.226  1.00 50.87  ? 152  ASP A OD1 1 
ATOM   1175  O OD2 . ASP A  1 153 ? -2.064  16.692  72.739  1.00 41.30  ? 152  ASP A OD2 1 
ATOM   1176  N N   . PHE A  1 154 ? -1.219  13.593  76.733  1.00 30.97  ? 153  PHE A N   1 
ATOM   1177  C CA  . PHE A  1 154 ? -0.937  13.048  78.059  1.00 32.93  ? 153  PHE A CA  1 
ATOM   1178  C C   . PHE A  1 154 ? -0.085  11.791  77.901  1.00 32.16  ? 153  PHE A C   1 
ATOM   1179  O O   . PHE A  1 154 ? -0.266  11.033  76.954  1.00 37.51  ? 153  PHE A O   1 
ATOM   1180  C CB  . PHE A  1 154 ? -2.235  12.666  78.792  1.00 27.01  ? 153  PHE A CB  1 
ATOM   1181  C CG  . PHE A  1 154 ? -3.011  13.832  79.344  1.00 31.88  ? 153  PHE A CG  1 
ATOM   1182  C CD1 . PHE A  1 154 ? -3.019  14.086  80.710  1.00 33.01  ? 153  PHE A CD1 1 
ATOM   1183  C CD2 . PHE A  1 154 ? -3.756  14.653  78.511  1.00 33.87  ? 153  PHE A CD2 1 
ATOM   1184  C CE1 . PHE A  1 154 ? -3.748  15.151  81.230  1.00 30.67  ? 153  PHE A CE1 1 
ATOM   1185  C CE2 . PHE A  1 154 ? -4.480  15.716  79.023  1.00 36.71  ? 153  PHE A CE2 1 
ATOM   1186  C CZ  . PHE A  1 154 ? -4.474  15.967  80.382  1.00 36.29  ? 153  PHE A CZ  1 
ATOM   1187  N N   . LYS A  1 155 ? 0.828   11.563  78.836  1.00 30.65  ? 154  LYS A N   1 
ATOM   1188  C CA  . LYS A  1 155 ? 1.620   10.340  78.847  1.00 31.85  ? 154  LYS A CA  1 
ATOM   1189  C C   . LYS A  1 155 ? 1.087   9.389   79.915  1.00 34.56  ? 154  LYS A C   1 
ATOM   1190  O O   . LYS A  1 155 ? 0.727   9.816   81.008  1.00 37.65  ? 154  LYS A O   1 
ATOM   1191  C CB  . LYS A  1 155 ? 3.088   10.654  79.139  1.00 36.83  ? 154  LYS A CB  1 
ATOM   1192  C CG  . LYS A  1 155 ? 3.743   11.548  78.101  1.00 54.36  ? 154  LYS A CG  1 
ATOM   1193  C CD  . LYS A  1 155 ? 5.095   12.067  78.560  1.00 52.56  ? 154  LYS A CD  1 
ATOM   1194  C CE  . LYS A  1 155 ? 6.067   10.939  78.824  1.00 66.10  ? 154  LYS A CE  1 
ATOM   1195  N NZ  . LYS A  1 155 ? 7.427   11.461  79.126  1.00 72.07  ? 154  LYS A NZ  1 
ATOM   1196  N N   . THR A  1 156 ? 1.037   8.103   79.593  1.00 34.94  ? 155  THR A N   1 
ATOM   1197  C CA  . THR A  1 156 ? 0.624   7.085   80.547  1.00 30.76  ? 155  THR A CA  1 
ATOM   1198  C C   . THR A  1 156 ? 1.867   6.381   81.083  1.00 38.82  ? 155  THR A C   1 
ATOM   1199  O O   . THR A  1 156 ? 2.660   5.831   80.315  1.00 38.45  ? 155  THR A O   1 
ATOM   1200  C CB  . THR A  1 156 ? -0.300  6.053   79.894  1.00 41.95  ? 155  THR A CB  1 
ATOM   1201  O OG1 . THR A  1 156 ? -1.429  6.723   79.323  1.00 42.45  ? 155  THR A OG1 1 
ATOM   1202  C CG2 . THR A  1 156 ? -0.771  5.013   80.923  1.00 31.57  ? 155  THR A CG2 1 
ATOM   1203  N N   . ILE A  1 157 ? 2.024   6.383   82.399  1.00 33.06  ? 156  ILE A N   1 
ATOM   1204  C CA  . ILE A  1 157 ? 3.257   5.937   83.017  1.00 30.11  ? 156  ILE A CA  1 
ATOM   1205  C C   . ILE A  1 157 ? 2.980   4.975   84.157  1.00 33.31  ? 156  ILE A C   1 
ATOM   1206  O O   . ILE A  1 157 ? 2.138   5.241   85.005  1.00 27.86  ? 156  ILE A O   1 
ATOM   1207  C CB  . ILE A  1 157 ? 4.050   7.125   83.583  1.00 40.00  ? 156  ILE A CB  1 
ATOM   1208  C CG1 . ILE A  1 157 ? 4.475   8.064   82.446  1.00 39.41  ? 156  ILE A CG1 1 
ATOM   1209  C CG2 . ILE A  1 157 ? 5.262   6.636   84.359  1.00 31.60  ? 156  ILE A CG2 1 
ATOM   1210  C CD1 . ILE A  1 157 ? 5.183   9.329   82.929  1.00 40.17  ? 156  ILE A CD1 1 
ATOM   1211  N N   . LEU A  1 158 ? 3.692   3.853   84.156  1.00 29.05  ? 157  LEU A N   1 
ATOM   1212  C CA  . LEU A  1 158 ? 3.663   2.907   85.262  1.00 31.25  ? 157  LEU A CA  1 
ATOM   1213  C C   . LEU A  1 158 ? 4.687   3.342   86.288  1.00 33.30  ? 157  LEU A C   1 
ATOM   1214  O O   . LEU A  1 158 ? 5.879   3.404   85.994  1.00 33.06  ? 157  LEU A O   1 
ATOM   1215  C CB  . LEU A  1 158 ? 4.014   1.499   84.779  1.00 31.19  ? 157  LEU A CB  1 
ATOM   1216  C CG  . LEU A  1 158 ? 4.202   0.438   85.876  1.00 30.33  ? 157  LEU A CG  1 
ATOM   1217  C CD1 . LEU A  1 158 ? 2.875   0.038   86.490  1.00 23.18  ? 157  LEU A CD1 1 
ATOM   1218  C CD2 . LEU A  1 158 ? 4.920   -0.782  85.320  1.00 28.12  ? 157  LEU A CD2 1 
ATOM   1219  N N   . GLU A  1 159 ? 4.222   3.649   87.492  1.00 30.41  ? 158  GLU A N   1 
ATOM   1220  C CA  . GLU A  1 159 ? 5.108   4.045   88.579  1.00 38.38  ? 158  GLU A CA  1 
ATOM   1221  C C   . GLU A  1 159 ? 5.865   2.828   89.089  1.00 45.11  ? 158  GLU A C   1 
ATOM   1222  O O   . GLU A  1 159 ? 5.371   1.703   89.012  1.00 45.53  ? 158  GLU A O   1 
ATOM   1223  C CB  . GLU A  1 159 ? 4.294   4.664   89.714  1.00 36.95  ? 158  GLU A CB  1 
ATOM   1224  C CG  . GLU A  1 159 ? 3.378   5.801   89.260  1.00 47.77  ? 158  GLU A CG  1 
ATOM   1225  C CD  . GLU A  1 159 ? 3.717   7.130   89.907  1.00 67.25  ? 158  GLU A CD  1 
ATOM   1226  O OE1 . GLU A  1 159 ? 2.779   7.838   90.345  1.00 63.68  ? 158  GLU A OE1 1 
ATOM   1227  O OE2 . GLU A  1 159 ? 4.920   7.469   89.972  1.00 75.69  ? 158  GLU A OE2 1 
ATOM   1228  N N   . SER A  1 160 ? 7.066   3.055   89.607  1.00 41.60  ? 159  SER A N   1 
ATOM   1229  C CA  . SER A  1 160 ? 7.901   1.969   90.114  1.00 47.66  ? 159  SER A CA  1 
ATOM   1230  C C   . SER A  1 160 ? 7.130   1.099   91.116  1.00 43.87  ? 159  SER A C   1 
ATOM   1231  O O   . SER A  1 160 ? 6.852   1.532   92.228  1.00 41.59  ? 159  SER A O   1 
ATOM   1232  C CB  . SER A  1 160 ? 9.141   2.548   90.795  1.00 48.28  ? 159  SER A CB  1 
ATOM   1233  O OG  . SER A  1 160 ? 9.801   3.477   89.959  1.00 52.69  ? 159  SER A OG  1 
ATOM   1234  N N   . PRO A  1 161 ? 6.785   -0.135  90.722  1.00 33.46  ? 160  PRO A N   1 
ATOM   1235  C CA  . PRO A  1 161 ? 5.992   -1.004  91.595  1.00 40.46  ? 160  PRO A CA  1 
ATOM   1236  C C   . PRO A  1 161 ? 6.836   -1.776  92.600  1.00 32.03  ? 160  PRO A C   1 
ATOM   1237  O O   . PRO A  1 161 ? 8.034   -1.951  92.404  1.00 30.68  ? 160  PRO A O   1 
ATOM   1238  C CB  . PRO A  1 161 ? 5.331   -1.968  90.605  1.00 37.43  ? 160  PRO A CB  1 
ATOM   1239  C CG  . PRO A  1 161 ? 6.293   -2.062  89.485  1.00 37.73  ? 160  PRO A CG  1 
ATOM   1240  C CD  . PRO A  1 161 ? 6.991   -0.731  89.393  1.00 30.82  ? 160  PRO A CD  1 
ATOM   1241  N N   . THR A  1 162 ? 6.204   -2.213  93.681  1.00 25.63  ? 161  THR A N   1 
ATOM   1242  C CA  . THR A  1 162 ? 6.806   -3.173  94.600  1.00 32.53  ? 161  THR A CA  1 
ATOM   1243  C C   . THR A  1 162 ? 5.905   -4.406  94.609  1.00 35.38  ? 161  THR A C   1 
ATOM   1244  O O   . THR A  1 162 ? 4.959   -4.485  93.834  1.00 36.24  ? 161  THR A O   1 
ATOM   1245  C CB  . THR A  1 162 ? 6.898   -2.601  96.025  1.00 31.32  ? 161  THR A CB  1 
ATOM   1246  O OG1 . THR A  1 162 ? 5.590   -2.581  96.614  1.00 32.75  ? 161  THR A OG1 1 
ATOM   1247  C CG2 . THR A  1 162 ? 7.481   -1.173  96.007  1.00 30.00  ? 161  THR A CG2 1 
ATOM   1248  N N   . ASP A  1 163 ? 6.179   -5.367  95.481  1.00 33.50  ? 162  ASP A N   1 
ATOM   1249  C CA  . ASP A  1 163 ? 5.294   -6.526  95.607  1.00 35.95  ? 162  ASP A CA  1 
ATOM   1250  C C   . ASP A  1 163 ? 4.063   -6.216  96.472  1.00 35.84  ? 162  ASP A C   1 
ATOM   1251  O O   . ASP A  1 163 ? 3.219   -7.081  96.684  1.00 37.03  ? 162  ASP A O   1 
ATOM   1252  C CB  . ASP A  1 163 ? 6.050   -7.735  96.163  1.00 34.93  ? 162  ASP A CB  1 
ATOM   1253  C CG  . ASP A  1 163 ? 6.518   -7.535  97.592  1.00 49.08  ? 162  ASP A CG  1 
ATOM   1254  O OD1 . ASP A  1 163 ? 6.637   -6.370  98.042  1.00 54.88  ? 162  ASP A OD1 1 
ATOM   1255  O OD2 . ASP A  1 163 ? 6.775   -8.557  98.267  1.00 64.51  ? 162  ASP A OD2 1 
ATOM   1256  N N   . LYS A  1 164 ? 3.955   -4.983  96.959  1.00 30.51  ? 163  LYS A N   1 
ATOM   1257  C CA  . LYS A  1 164 ? 2.805   -4.592  97.765  1.00 37.01  ? 163  LYS A CA  1 
ATOM   1258  C C   . LYS A  1 164 ? 2.075   -3.372  97.218  1.00 36.28  ? 163  LYS A C   1 
ATOM   1259  O O   . LYS A  1 164 ? 0.946   -3.112  97.618  1.00 32.17  ? 163  LYS A O   1 
ATOM   1260  C CB  . LYS A  1 164 ? 3.226   -4.336  99.219  1.00 32.69  ? 163  LYS A CB  1 
ATOM   1261  C CG  . LYS A  1 164 ? 3.755   -5.595  99.924  1.00 41.86  ? 163  LYS A CG  1 
ATOM   1262  C CD  . LYS A  1 164 ? 2.702   -6.695  99.966  1.00 38.38  ? 163  LYS A CD  1 
ATOM   1263  C CE  . LYS A  1 164 ? 3.297   -8.052  100.350 1.00 43.89  ? 163  LYS A CE  1 
ATOM   1264  N NZ  . LYS A  1 164 ? 3.856   -8.062  101.723 1.00 59.81  ? 163  LYS A NZ  1 
ATOM   1265  N N   . LYS A  1 165 ? 2.713   -2.628  96.312  1.00 31.33  ? 164  LYS A N   1 
ATOM   1266  C CA  . LYS A  1 165 ? 2.140   -1.373  95.807  1.00 37.44  ? 164  LYS A CA  1 
ATOM   1267  C C   . LYS A  1 165 ? 2.373   -1.233  94.315  1.00 31.21  ? 164  LYS A C   1 
ATOM   1268  O O   . LYS A  1 165 ? 3.443   -1.553  93.816  1.00 35.86  ? 164  LYS A O   1 
ATOM   1269  C CB  . LYS A  1 165 ? 2.765   -0.168  96.519  1.00 33.11  ? 164  LYS A CB  1 
ATOM   1270  C CG  . LYS A  1 165 ? 2.511   -0.132  98.008  1.00 63.25  ? 164  LYS A CG  1 
ATOM   1271  C CD  . LYS A  1 165 ? 3.417   0.871   98.714  1.00 83.70  ? 164  LYS A CD  1 
ATOM   1272  C CE  . LYS A  1 165 ? 3.259   2.274   98.153  1.00 91.98  ? 164  LYS A CE  1 
ATOM   1273  N NZ  . LYS A  1 165 ? 4.139   3.260   98.850  1.00 109.43 ? 164  LYS A NZ  1 
ATOM   1274  N N   . VAL A  1 166 ? 1.366   -0.755  93.605  1.00 25.58  ? 165  VAL A N   1 
ATOM   1275  C CA  . VAL A  1 166 ? 1.517   -0.450  92.195  1.00 30.12  ? 165  VAL A CA  1 
ATOM   1276  C C   . VAL A  1 166 ? 0.639   0.749   91.846  1.00 31.49  ? 165  VAL A C   1 
ATOM   1277  O O   . VAL A  1 166 ? -0.386  0.978   92.468  1.00 32.19  ? 165  VAL A O   1 
ATOM   1278  C CB  . VAL A  1 166 ? 1.143   -1.672  91.311  1.00 37.08  ? 165  VAL A CB  1 
ATOM   1279  C CG1 . VAL A  1 166 ? -0.327  -2.043  91.484  1.00 29.06  ? 165  VAL A CG1 1 
ATOM   1280  C CG2 . VAL A  1 166 ? 1.450   -1.383  89.861  1.00 28.97  ? 165  VAL A CG2 1 
ATOM   1281  N N   . GLY A  1 167 ? 1.046   1.528   90.857  1.00 27.39  ? 166  GLY A N   1 
ATOM   1282  C CA  . GLY A  1 167 ? 0.231   2.646   90.435  1.00 29.13  ? 166  GLY A CA  1 
ATOM   1283  C C   . GLY A  1 167 ? 0.587   3.139   89.053  1.00 37.80  ? 166  GLY A C   1 
ATOM   1284  O O   . GLY A  1 167 ? 1.646   2.810   88.522  1.00 32.73  ? 166  GLY A O   1 
ATOM   1285  N N   . TRP A  1 168 ? -0.318  3.922   88.474  1.00 28.42  ? 167  TRP A N   1 
ATOM   1286  C CA  . TRP A  1 168 ? -0.099  4.552   87.189  1.00 29.50  ? 167  TRP A CA  1 
ATOM   1287  C C   . TRP A  1 168 ? -0.368  6.046   87.328  1.00 36.79  ? 167  TRP A C   1 
ATOM   1288  O O   . TRP A  1 168 ? -1.133  6.471   88.187  1.00 32.42  ? 167  TRP A O   1 
ATOM   1289  C CB  . TRP A  1 168 ? -1.041  3.967   86.129  1.00 25.82  ? 167  TRP A CB  1 
ATOM   1290  C CG  . TRP A  1 168 ? -0.779  2.545   85.776  1.00 33.55  ? 167  TRP A CG  1 
ATOM   1291  C CD1 . TRP A  1 168 ? -0.052  2.080   84.716  1.00 27.24  ? 167  TRP A CD1 1 
ATOM   1292  C CD2 . TRP A  1 168 ? -1.248  1.390   86.480  1.00 24.52  ? 167  TRP A CD2 1 
ATOM   1293  N NE1 . TRP A  1 168 ? -0.042  0.704   84.719  1.00 32.66  ? 167  TRP A NE1 1 
ATOM   1294  C CE2 . TRP A  1 168 ? -0.769  0.256   85.791  1.00 33.59  ? 167  TRP A CE2 1 
ATOM   1295  C CE3 . TRP A  1 168 ? -2.032  1.203   87.625  1.00 26.23  ? 167  TRP A CE3 1 
ATOM   1296  C CZ2 . TRP A  1 168 ? -1.045  -1.049  86.212  1.00 33.40  ? 167  TRP A CZ2 1 
ATOM   1297  C CZ3 . TRP A  1 168 ? -2.309  -0.090  88.043  1.00 30.05  ? 167  TRP A CZ3 1 
ATOM   1298  C CH2 . TRP A  1 168 ? -1.818  -1.202  87.340  1.00 27.95  ? 167  TRP A CH2 1 
ATOM   1299  N N   . LYS A  1 169 ? 0.264   6.846   86.482  1.00 31.45  ? 168  LYS A N   1 
ATOM   1300  C CA  . LYS A  1 169 ? -0.086  8.248   86.397  1.00 32.93  ? 168  LYS A CA  1 
ATOM   1301  C C   . LYS A  1 169 ? -0.186  8.643   84.936  1.00 30.66  ? 168  LYS A C   1 
ATOM   1302  O O   . LYS A  1 169 ? 0.654   8.272   84.113  1.00 33.13  ? 168  LYS A O   1 
ATOM   1303  C CB  . LYS A  1 169 ? 0.920   9.114   87.145  1.00 32.95  ? 168  LYS A CB  1 
ATOM   1304  C CG  . LYS A  1 169 ? 2.331   9.001   86.643  1.00 35.89  ? 168  LYS A CG  1 
ATOM   1305  C CD  . LYS A  1 169 ? 3.269   9.871   87.463  1.00 41.61  ? 168  LYS A CD  1 
ATOM   1306  C CE  . LYS A  1 169 ? 4.700   9.725   86.990  1.00 45.20  ? 168  LYS A CE  1 
ATOM   1307  N NZ  . LYS A  1 169 ? 5.625   10.614  87.738  1.00 68.93  ? 168  LYS A NZ  1 
ATOM   1308  N N   . VAL A  1 170 ? -1.254  9.354   84.612  1.00 29.60  ? 169  VAL A N   1 
ATOM   1309  C CA  . VAL A  1 170 ? -1.458  9.884   83.279  1.00 32.17  ? 169  VAL A CA  1 
ATOM   1310  C C   . VAL A  1 170 ? -1.253  11.384  83.400  1.00 37.36  ? 169  VAL A C   1 
ATOM   1311  O O   . VAL A  1 170 ? -2.098  12.079  83.946  1.00 34.90  ? 169  VAL A O   1 
ATOM   1312  C CB  . VAL A  1 170 ? -2.870  9.558   82.778  1.00 33.51  ? 169  VAL A CB  1 
ATOM   1313  C CG1 . VAL A  1 170 ? -3.115  10.162  81.418  1.00 30.48  ? 169  VAL A CG1 1 
ATOM   1314  C CG2 . VAL A  1 170 ? -3.063  8.048   82.730  1.00 34.57  ? 169  VAL A CG2 1 
ATOM   1315  N N   . ILE A  1 171 ? -0.118  11.875  82.912  1.00 31.89  ? 170  ILE A N   1 
ATOM   1316  C CA  . ILE A  1 171 ? 0.282   13.259  83.156  1.00 38.20  ? 170  ILE A CA  1 
ATOM   1317  C C   . ILE A  1 171 ? 0.234   14.120  81.904  1.00 35.27  ? 170  ILE A C   1 
ATOM   1318  O O   . ILE A  1 171 ? 0.583   13.671  80.805  1.00 39.15  ? 170  ILE A O   1 
ATOM   1319  C CB  . ILE A  1 171 ? 1.712   13.326  83.711  1.00 36.96  ? 170  ILE A CB  1 
ATOM   1320  C CG1 . ILE A  1 171 ? 2.700   12.762  82.687  1.00 42.43  ? 170  ILE A CG1 1 
ATOM   1321  C CG2 . ILE A  1 171 ? 1.806   12.555  85.022  1.00 36.02  ? 170  ILE A CG2 1 
ATOM   1322  C CD1 . ILE A  1 171 ? 4.140   12.817  83.136  1.00 56.08  ? 170  ILE A CD1 1 
ATOM   1323  N N   . PHE A  1 172 ? -0.201  15.362  82.074  1.00 32.18  ? 171  PHE A N   1 
ATOM   1324  C CA  . PHE A  1 172 ? -0.211  16.319  80.983  1.00 33.23  ? 171  PHE A CA  1 
ATOM   1325  C C   . PHE A  1 172 ? 1.196   16.486  80.452  1.00 32.85  ? 171  PHE A C   1 
ATOM   1326  O O   . PHE A  1 172 ? 2.146   16.645  81.220  1.00 29.37  ? 171  PHE A O   1 
ATOM   1327  C CB  . PHE A  1 172 ? -0.742  17.673  81.440  1.00 34.51  ? 171  PHE A CB  1 
ATOM   1328  C CG  . PHE A  1 172 ? -0.787  18.699  80.345  1.00 36.03  ? 171  PHE A CG  1 
ATOM   1329  C CD1 . PHE A  1 172 ? -1.885  18.781  79.501  1.00 36.74  ? 171  PHE A CD1 1 
ATOM   1330  C CD2 . PHE A  1 172 ? 0.258   19.582  80.162  1.00 33.62  ? 171  PHE A CD2 1 
ATOM   1331  C CE1 . PHE A  1 172 ? -1.940  19.728  78.499  1.00 37.31  ? 171  PHE A CE1 1 
ATOM   1332  C CE2 . PHE A  1 172 ? 0.212   20.531  79.154  1.00 42.22  ? 171  PHE A CE2 1 
ATOM   1333  C CZ  . PHE A  1 172 ? -0.887  20.601  78.321  1.00 34.88  ? 171  PHE A CZ  1 
ATOM   1334  N N   . ASN A  1 173 ? 1.311   16.430  79.130  1.00 27.59  ? 172  ASN A N   1 
ATOM   1335  C CA  . ASN A  1 173 ? 2.587   16.521  78.442  1.00 36.13  ? 172  ASN A CA  1 
ATOM   1336  C C   . ASN A  1 173 ? 2.691   17.892  77.767  1.00 37.62  ? 172  ASN A C   1 
ATOM   1337  O O   . ASN A  1 173 ? 3.379   18.786  78.253  1.00 36.94  ? 172  ASN A O   1 
ATOM   1338  C CB  . ASN A  1 173 ? 2.687   15.393  77.413  1.00 40.31  ? 172  ASN A CB  1 
ATOM   1339  C CG  . ASN A  1 173 ? 4.054   15.295  76.786  1.00 41.06  ? 172  ASN A CG  1 
ATOM   1340  O OD1 . ASN A  1 173 ? 5.061   15.612  77.412  1.00 48.05  ? 172  ASN A OD1 1 
ATOM   1341  N ND2 . ASN A  1 173 ? 4.098   14.845  75.544  1.00 44.90  ? 172  ASN A ND2 1 
ATOM   1342  N N   . ASN A  1 174 ? 1.986   18.055  76.652  1.00 28.44  ? 173  ASN A N   1 
ATOM   1343  C CA  . ASN A  1 174 ? 1.840   19.361  76.016  1.00 43.68  ? 173  ASN A CA  1 
ATOM   1344  C C   . ASN A  1 174 ? 0.625   19.363  75.101  1.00 37.97  ? 173  ASN A C   1 
ATOM   1345  O O   . ASN A  1 174 ? 0.038   18.322  74.834  1.00 38.13  ? 173  ASN A O   1 
ATOM   1346  C CB  . ASN A  1 174 ? 3.109   19.766  75.246  1.00 38.99  ? 173  ASN A CB  1 
ATOM   1347  C CG  . ASN A  1 174 ? 3.483   18.774  74.153  1.00 44.64  ? 173  ASN A CG  1 
ATOM   1348  O OD1 . ASN A  1 174 ? 2.627   18.243  73.456  1.00 41.32  ? 173  ASN A OD1 1 
ATOM   1349  N ND2 . ASN A  1 174 ? 4.773   18.519  74.008  1.00 41.12  ? 173  ASN A ND2 1 
ATOM   1350  N N   . MET A  1 175 ? 0.238   20.532  74.619  1.00 35.51  ? 174  MET A N   1 
ATOM   1351  C CA  . MET A  1 175 ? -1.006  20.636  73.883  1.00 43.35  ? 174  MET A CA  1 
ATOM   1352  C C   . MET A  1 175 ? -0.964  21.768  72.876  1.00 49.18  ? 174  MET A C   1 
ATOM   1353  O O   . MET A  1 175 ? -0.357  22.811  73.119  1.00 35.15  ? 174  MET A O   1 
ATOM   1354  C CB  . MET A  1 175 ? -2.161  20.876  74.848  1.00 28.79  ? 174  MET A CB  1 
ATOM   1355  C CG  . MET A  1 175 ? -3.525  20.618  74.244  1.00 41.71  ? 174  MET A CG  1 
ATOM   1356  S SD  . MET A  1 175 ? -4.883  21.115  75.340  1.00 51.60  ? 174  MET A SD  1 
ATOM   1357  C CE  . MET A  1 175 ? -4.691  22.892  75.314  1.00 46.67  ? 174  MET A CE  1 
ATOM   1358  N N   . VAL A  1 176 ? -1.626  21.551  71.746  1.00 35.87  ? 175  VAL A N   1 
ATOM   1359  C CA  . VAL A  1 176 ? -1.777  22.586  70.742  1.00 39.34  ? 175  VAL A CA  1 
ATOM   1360  C C   . VAL A  1 176 ? -2.914  23.516  71.128  1.00 43.02  ? 175  VAL A C   1 
ATOM   1361  O O   . VAL A  1 176 ? -4.025  23.078  71.432  1.00 39.34  ? 175  VAL A O   1 
ATOM   1362  C CB  . VAL A  1 176 ? -2.070  21.992  69.360  1.00 45.71  ? 175  VAL A CB  1 
ATOM   1363  C CG1 . VAL A  1 176 ? -2.314  23.109  68.344  1.00 46.55  ? 175  VAL A CG1 1 
ATOM   1364  C CG2 . VAL A  1 176 ? -0.922  21.094  68.922  1.00 43.46  ? 175  VAL A CG2 1 
ATOM   1365  N N   . ASN A  1 177 ? -2.625  24.808  71.127  1.00 37.57  ? 176  ASN A N   1 
ATOM   1366  C CA  . ASN A  1 177 ? -3.641  25.817  71.381  1.00 32.52  ? 176  ASN A CA  1 
ATOM   1367  C C   . ASN A  1 177 ? -3.937  26.564  70.093  1.00 48.75  ? 176  ASN A C   1 
ATOM   1368  O O   . ASN A  1 177 ? -3.173  27.445  69.685  1.00 44.11  ? 176  ASN A O   1 
ATOM   1369  C CB  . ASN A  1 177 ? -3.147  26.788  72.460  1.00 34.20  ? 176  ASN A CB  1 
ATOM   1370  C CG  . ASN A  1 177 ? -4.112  27.922  72.718  1.00 44.97  ? 176  ASN A CG  1 
ATOM   1371  O OD1 . ASN A  1 177 ? -5.065  28.134  71.968  1.00 38.82  ? 176  ASN A OD1 1 
ATOM   1372  N ND2 . ASN A  1 177 ? -3.857  28.673  73.783  1.00 39.97  ? 176  ASN A ND2 1 
ATOM   1373  N N   . GLN A  1 178 ? -5.039  26.198  69.445  1.00 27.53  ? 177  GLN A N   1 
ATOM   1374  C CA  . GLN A  1 178 ? -5.480  26.881  68.228  1.00 54.50  ? 177  GLN A CA  1 
ATOM   1375  C C   . GLN A  1 178 ? -4.373  26.977  67.179  1.00 52.11  ? 177  GLN A C   1 
ATOM   1376  O O   . GLN A  1 178 ? -4.073  28.066  66.686  1.00 53.73  ? 177  GLN A O   1 
ATOM   1377  C CB  . GLN A  1 178 ? -5.981  28.294  68.564  1.00 46.67  ? 177  GLN A CB  1 
ATOM   1378  C CG  . GLN A  1 178 ? -7.176  28.307  69.502  1.00 57.22  ? 177  GLN A CG  1 
ATOM   1379  C CD  . GLN A  1 178 ? -7.634  29.704  69.867  1.00 59.63  ? 177  GLN A CD  1 
ATOM   1380  O OE1 . GLN A  1 178 ? -8.497  30.276  69.207  1.00 65.84  ? 177  GLN A OE1 1 
ATOM   1381  N NE2 . GLN A  1 178 ? -7.073  30.251  70.935  1.00 34.63  ? 177  GLN A NE2 1 
ATOM   1382  N N   . ASN A  1 179 ? -3.773  25.839  66.846  1.00 47.93  ? 178  ASN A N   1 
ATOM   1383  C CA  . ASN A  1 179 ? -2.718  25.767  65.821  1.00 60.44  ? 178  ASN A CA  1 
ATOM   1384  C C   . ASN A  1 179 ? -1.356  26.290  66.289  1.00 47.26  ? 178  ASN A C   1 
ATOM   1385  O O   . ASN A  1 179 ? -0.361  26.147  65.583  1.00 57.47  ? 178  ASN A O   1 
ATOM   1386  C CB  . ASN A  1 179 ? -3.126  26.513  64.543  1.00 70.68  ? 178  ASN A CB  1 
ATOM   1387  C CG  . ASN A  1 179 ? -4.535  26.169  64.075  1.00 73.64  ? 178  ASN A CG  1 
ATOM   1388  O OD1 . ASN A  1 179 ? -5.245  27.023  63.547  1.00 92.16  ? 178  ASN A OD1 1 
ATOM   1389  N ND2 . ASN A  1 179 ? -4.946  24.926  64.271  1.00 63.88  ? 178  ASN A ND2 1 
ATOM   1390  N N   . TRP A  1 180 ? -1.316  26.889  67.475  1.00 53.22  ? 179  TRP A N   1 
ATOM   1391  C CA  . TRP A  1 180 ? -0.073  27.399  68.052  1.00 57.47  ? 179  TRP A CA  1 
ATOM   1392  C C   . TRP A  1 180 ? 0.526   26.423  69.068  1.00 60.63  ? 179  TRP A C   1 
ATOM   1393  O O   . TRP A  1 180 ? -0.168  25.560  69.607  1.00 51.37  ? 179  TRP A O   1 
ATOM   1394  C CB  . TRP A  1 180 ? -0.326  28.740  68.744  1.00 59.47  ? 179  TRP A CB  1 
ATOM   1395  C CG  . TRP A  1 180 ? -0.565  29.869  67.804  1.00 82.97  ? 179  TRP A CG  1 
ATOM   1396  C CD1 . TRP A  1 180 ? -1.715  30.139  67.122  1.00 76.96  ? 179  TRP A CD1 1 
ATOM   1397  C CD2 . TRP A  1 180 ? 0.369   30.893  67.442  1.00 99.30  ? 179  TRP A CD2 1 
ATOM   1398  N NE1 . TRP A  1 180 ? -1.553  31.267  66.353  1.00 93.90  ? 179  TRP A NE1 1 
ATOM   1399  C CE2 . TRP A  1 180 ? -0.283  31.749  66.532  1.00 103.17 ? 179  TRP A CE2 1 
ATOM   1400  C CE3 . TRP A  1 180 ? 1.695   31.167  67.798  1.00 96.89  ? 179  TRP A CE3 1 
ATOM   1401  C CZ2 . TRP A  1 180 ? 0.345   32.862  65.971  1.00 102.07 ? 179  TRP A CZ2 1 
ATOM   1402  C CZ3 . TRP A  1 180 ? 2.317   32.273  67.241  1.00 100.61 ? 179  TRP A CZ3 1 
ATOM   1403  C CH2 . TRP A  1 180 ? 1.641   33.106  66.338  1.00 98.32  ? 179  TRP A CH2 1 
ATOM   1404  N N   . GLY A  1 181 ? 1.818   26.578  69.337  1.00 68.49  ? 180  GLY A N   1 
ATOM   1405  C CA  . GLY A  1 181 ? 2.495   25.771  70.331  1.00 51.71  ? 180  GLY A CA  1 
ATOM   1406  C C   . GLY A  1 181 ? 3.261   24.614  69.717  1.00 49.85  ? 180  GLY A C   1 
ATOM   1407  O O   . GLY A  1 181 ? 3.944   24.781  68.718  1.00 63.11  ? 180  GLY A O   1 
ATOM   1408  N N   . PRO A  1 182 ? 3.154   23.426  70.324  1.00 57.33  ? 181  PRO A N   1 
ATOM   1409  C CA  . PRO A  1 182 ? 2.340   23.198  71.522  1.00 41.56  ? 181  PRO A CA  1 
ATOM   1410  C C   . PRO A  1 182 ? 2.914   23.910  72.742  1.00 44.93  ? 181  PRO A C   1 
ATOM   1411  O O   . PRO A  1 182 ? 4.074   24.310  72.732  1.00 42.06  ? 181  PRO A O   1 
ATOM   1412  C CB  . PRO A  1 182 ? 2.410   21.675  71.701  1.00 52.77  ? 181  PRO A CB  1 
ATOM   1413  C CG  . PRO A  1 182 ? 3.693   21.278  71.070  1.00 46.42  ? 181  PRO A CG  1 
ATOM   1414  C CD  . PRO A  1 182 ? 3.890   22.218  69.914  1.00 52.65  ? 181  PRO A CD  1 
ATOM   1415  N N   . TYR A  1 183 ? 2.104   24.063  73.784  1.00 45.91  ? 182  TYR A N   1 
ATOM   1416  C CA  . TYR A  1 183 ? 2.563   24.634  75.040  1.00 36.45  ? 182  TYR A CA  1 
ATOM   1417  C C   . TYR A  1 183 ? 2.512   23.579  76.138  1.00 46.17  ? 182  TYR A C   1 
ATOM   1418  O O   . TYR A  1 183 ? 1.786   22.592  76.035  1.00 33.93  ? 182  TYR A O   1 
ATOM   1419  C CB  . TYR A  1 183 ? 1.696   25.833  75.424  1.00 34.29  ? 182  TYR A CB  1 
ATOM   1420  C CG  . TYR A  1 183 ? 1.697   26.928  74.386  1.00 42.32  ? 182  TYR A CG  1 
ATOM   1421  C CD1 . TYR A  1 183 ? 0.632   27.080  73.508  1.00 36.62  ? 182  TYR A CD1 1 
ATOM   1422  C CD2 . TYR A  1 183 ? 2.776   27.798  74.268  1.00 40.23  ? 182  TYR A CD2 1 
ATOM   1423  C CE1 . TYR A  1 183 ? 0.636   28.077  72.543  1.00 54.59  ? 182  TYR A CE1 1 
ATOM   1424  C CE2 . TYR A  1 183 ? 2.788   28.799  73.307  1.00 46.33  ? 182  TYR A CE2 1 
ATOM   1425  C CZ  . TYR A  1 183 ? 1.714   28.932  72.450  1.00 45.38  ? 182  TYR A CZ  1 
ATOM   1426  O OH  . TYR A  1 183 ? 1.711   29.915  71.496  1.00 46.17  ? 182  TYR A OH  1 
ATOM   1427  N N   . ASP A  1 184 ? 3.295   23.788  77.187  1.00 40.48  ? 183  ASP A N   1 
ATOM   1428  C CA  . ASP A  1 184 ? 3.260   22.906  78.334  1.00 44.74  ? 183  ASP A CA  1 
ATOM   1429  C C   . ASP A  1 184 ? 3.269   23.734  79.612  1.00 40.56  ? 183  ASP A C   1 
ATOM   1430  O O   . ASP A  1 184 ? 3.127   24.958  79.568  1.00 43.19  ? 183  ASP A O   1 
ATOM   1431  C CB  . ASP A  1 184 ? 4.419   21.901  78.290  1.00 35.00  ? 183  ASP A CB  1 
ATOM   1432  C CG  . ASP A  1 184 ? 5.782   22.556  78.387  1.00 52.44  ? 183  ASP A CG  1 
ATOM   1433  O OD1 . ASP A  1 184 ? 5.873   23.706  78.867  1.00 66.98  ? 183  ASP A OD1 1 
ATOM   1434  O OD2 . ASP A  1 184 ? 6.774   21.904  77.995  1.00 67.68  ? 183  ASP A OD2 1 
ATOM   1435  N N   . ARG A  1 185 ? 3.437   23.066  80.747  1.00 42.16  ? 184  ARG A N   1 
ATOM   1436  C CA  . ARG A  1 185 ? 3.302   23.707  82.049  1.00 50.39  ? 184  ARG A CA  1 
ATOM   1437  C C   . ARG A  1 185 ? 4.414   24.714  82.330  1.00 43.88  ? 184  ARG A C   1 
ATOM   1438  O O   . ARG A  1 185 ? 4.302   25.515  83.252  1.00 48.48  ? 184  ARG A O   1 
ATOM   1439  C CB  . ARG A  1 185 ? 3.298   22.637  83.139  1.00 29.13  ? 184  ARG A CB  1 
ATOM   1440  C CG  . ARG A  1 185 ? 2.223   21.589  82.958  1.00 37.53  ? 184  ARG A CG  1 
ATOM   1441  C CD  . ARG A  1 185 ? 2.536   20.359  83.803  1.00 38.72  ? 184  ARG A CD  1 
ATOM   1442  N NE  . ARG A  1 185 ? 2.045   20.499  85.166  1.00 32.40  ? 184  ARG A NE  1 
ATOM   1443  C CZ  . ARG A  1 185 ? 2.571   19.891  86.223  1.00 41.12  ? 184  ARG A CZ  1 
ATOM   1444  N NH1 . ARG A  1 185 ? 2.042   20.076  87.424  1.00 32.53  ? 184  ARG A NH1 1 
ATOM   1445  N NH2 . ARG A  1 185 ? 3.626   19.101  86.086  1.00 35.07  ? 184  ARG A NH2 1 
ATOM   1446  N N   . ASP A  1 186 ? 5.481   24.659  81.536  1.00 44.14  ? 185  ASP A N   1 
ATOM   1447  C CA  . ASP A  1 186 ? 6.654   25.502  81.742  1.00 46.61  ? 185  ASP A CA  1 
ATOM   1448  C C   . ASP A  1 186 ? 6.877   26.501  80.610  1.00 51.80  ? 185  ASP A C   1 
ATOM   1449  O O   . ASP A  1 186 ? 7.850   27.250  80.621  1.00 49.33  ? 185  ASP A O   1 
ATOM   1450  C CB  . ASP A  1 186 ? 7.901   24.628  81.868  1.00 59.26  ? 185  ASP A CB  1 
ATOM   1451  C CG  . ASP A  1 186 ? 7.906   23.800  83.137  1.00 75.79  ? 185  ASP A CG  1 
ATOM   1452  O OD1 . ASP A  1 186 ? 7.420   24.307  84.167  1.00 68.72  ? 185  ASP A OD1 1 
ATOM   1453  O OD2 . ASP A  1 186 ? 8.396   22.649  83.105  1.00 76.99  ? 185  ASP A OD2 1 
ATOM   1454  N N   . SER A  1 187 ? 5.995   26.503  79.619  1.00 37.83  ? 186  SER A N   1 
ATOM   1455  C CA  . SER A  1 187 ? 6.118   27.450  78.520  1.00 39.54  ? 186  SER A CA  1 
ATOM   1456  C C   . SER A  1 187 ? 6.146   28.878  79.052  1.00 48.41  ? 186  SER A C   1 
ATOM   1457  O O   . SER A  1 187 ? 5.349   29.253  79.916  1.00 36.17  ? 186  SER A O   1 
ATOM   1458  C CB  . SER A  1 187 ? 4.961   27.297  77.537  1.00 36.21  ? 186  SER A CB  1 
ATOM   1459  O OG  . SER A  1 187 ? 5.121   26.125  76.765  1.00 47.38  ? 186  SER A OG  1 
ATOM   1460  N N   . TRP A  1 188 ? 7.074   29.672  78.538  1.00 43.60  ? 187  TRP A N   1 
ATOM   1461  C CA  . TRP A  1 188 ? 7.179   31.056  78.954  1.00 50.43  ? 187  TRP A CA  1 
ATOM   1462  C C   . TRP A  1 188 ? 7.638   31.959  77.825  1.00 47.55  ? 187  TRP A C   1 
ATOM   1463  O O   . TRP A  1 188 ? 8.707   31.773  77.241  1.00 49.43  ? 187  TRP A O   1 
ATOM   1464  C CB  . TRP A  1 188 ? 8.119   31.206  80.147  1.00 41.30  ? 187  TRP A CB  1 
ATOM   1465  C CG  . TRP A  1 188 ? 8.063   32.579  80.725  1.00 62.22  ? 187  TRP A CG  1 
ATOM   1466  C CD1 . TRP A  1 188 ? 8.954   33.595  80.523  1.00 60.00  ? 187  TRP A CD1 1 
ATOM   1467  C CD2 . TRP A  1 188 ? 7.044   33.104  81.584  1.00 64.05  ? 187  TRP A CD2 1 
ATOM   1468  N NE1 . TRP A  1 188 ? 8.556   34.717  81.210  1.00 52.65  ? 187  TRP A NE1 1 
ATOM   1469  C CE2 . TRP A  1 188 ? 7.388   34.442  81.870  1.00 53.61  ? 187  TRP A CE2 1 
ATOM   1470  C CE3 . TRP A  1 188 ? 5.877   32.572  82.143  1.00 41.33  ? 187  TRP A CE3 1 
ATOM   1471  C CZ2 . TRP A  1 188 ? 6.612   35.249  82.693  1.00 46.20  ? 187  TRP A CZ2 1 
ATOM   1472  C CZ3 . TRP A  1 188 ? 5.107   33.378  82.959  1.00 52.54  ? 187  TRP A CZ3 1 
ATOM   1473  C CH2 . TRP A  1 188 ? 5.477   34.703  83.224  1.00 58.94  ? 187  TRP A CH2 1 
ATOM   1474  N N   . ASN A  1 189 ? 6.799   32.940  77.530  1.00 53.72  ? 188  ASN A N   1 
ATOM   1475  C CA  . ASN A  1 189 ? 7.117   34.003  76.592  1.00 56.44  ? 188  ASN A CA  1 
ATOM   1476  C C   . ASN A  1 189 ? 7.248   35.295  77.392  1.00 54.34  ? 188  ASN A C   1 
ATOM   1477  O O   . ASN A  1 189 ? 6.400   35.586  78.229  1.00 41.35  ? 188  ASN A O   1 
ATOM   1478  C CB  . ASN A  1 189 ? 6.003   34.116  75.553  1.00 42.69  ? 188  ASN A CB  1 
ATOM   1479  C CG  . ASN A  1 189 ? 6.238   35.228  74.565  1.00 60.78  ? 188  ASN A CG  1 
ATOM   1480  O OD1 . ASN A  1 189 ? 5.973   36.392  74.852  1.00 60.89  ? 188  ASN A OD1 1 
ATOM   1481  N ND2 . ASN A  1 189 ? 6.727   34.876  73.387  1.00 57.11  ? 188  ASN A ND2 1 
ATOM   1482  N N   . PRO A  1 190 ? 8.320   36.064  77.161  1.00 62.87  ? 189  PRO A N   1 
ATOM   1483  C CA  . PRO A  1 190 ? 8.572   37.261  77.974  1.00 63.86  ? 189  PRO A CA  1 
ATOM   1484  C C   . PRO A  1 190 ? 7.368   38.217  78.009  1.00 61.58  ? 189  PRO A C   1 
ATOM   1485  O O   . PRO A  1 190 ? 7.125   38.886  79.017  1.00 40.53  ? 189  PRO A O   1 
ATOM   1486  C CB  . PRO A  1 190 ? 9.777   37.909  77.284  1.00 59.07  ? 189  PRO A CB  1 
ATOM   1487  C CG  . PRO A  1 190 ? 9.828   37.299  75.923  1.00 69.94  ? 189  PRO A CG  1 
ATOM   1488  C CD  . PRO A  1 190 ? 9.302   35.917  76.078  1.00 68.86  ? 189  PRO A CD  1 
ATOM   1489  N N   . VAL A  1 191 ? 6.599   38.233  76.920  1.00 45.80  ? 190  VAL A N   1 
ATOM   1490  C CA  . VAL A  1 191 ? 5.447   39.123  76.769  1.00 36.63  ? 190  VAL A CA  1 
ATOM   1491  C C   . VAL A  1 191 ? 4.083   38.538  77.198  1.00 44.32  ? 190  VAL A C   1 
ATOM   1492  O O   . VAL A  1 191 ? 3.352   39.166  77.954  1.00 43.22  ? 190  VAL A O   1 
ATOM   1493  C CB  . VAL A  1 191 ? 5.331   39.607  75.290  1.00 58.71  ? 190  VAL A CB  1 
ATOM   1494  C CG1 . VAL A  1 191 ? 4.017   40.360  75.045  1.00 49.79  ? 190  VAL A CG1 1 
ATOM   1495  C CG2 . VAL A  1 191 ? 6.516   40.488  74.924  1.00 53.93  ? 190  VAL A CG2 1 
ATOM   1496  N N   . TYR A  1 192 ? 3.721   37.366  76.689  1.00 43.36  ? 191  TYR A N   1 
ATOM   1497  C CA  . TYR A  1 192 ? 2.407   36.784  76.974  1.00 40.50  ? 191  TYR A CA  1 
ATOM   1498  C C   . TYR A  1 192 ? 2.422   35.728  78.096  1.00 42.52  ? 191  TYR A C   1 
ATOM   1499  O O   . TYR A  1 192 ? 1.390   35.126  78.399  1.00 34.85  ? 191  TYR A O   1 
ATOM   1500  C CB  . TYR A  1 192 ? 1.822   36.164  75.701  1.00 38.40  ? 191  TYR A CB  1 
ATOM   1501  C CG  . TYR A  1 192 ? 1.647   37.154  74.573  1.00 42.33  ? 191  TYR A CG  1 
ATOM   1502  C CD1 . TYR A  1 192 ? 2.519   37.169  73.493  1.00 42.30  ? 191  TYR A CD1 1 
ATOM   1503  C CD2 . TYR A  1 192 ? 0.613   38.079  74.592  1.00 37.98  ? 191  TYR A CD2 1 
ATOM   1504  C CE1 . TYR A  1 192 ? 2.363   38.080  72.456  1.00 46.59  ? 191  TYR A CE1 1 
ATOM   1505  C CE2 . TYR A  1 192 ? 0.450   38.993  73.563  1.00 45.49  ? 191  TYR A CE2 1 
ATOM   1506  C CZ  . TYR A  1 192 ? 1.328   38.994  72.499  1.00 52.36  ? 191  TYR A CZ  1 
ATOM   1507  O OH  . TYR A  1 192 ? 1.162   39.908  71.474  1.00 56.10  ? 191  TYR A OH  1 
ATOM   1508  N N   . GLY A  1 193 ? 3.584   35.508  78.707  1.00 39.69  ? 192  GLY A N   1 
ATOM   1509  C CA  . GLY A  1 193 ? 3.728   34.487  79.732  1.00 40.80  ? 192  GLY A CA  1 
ATOM   1510  C C   . GLY A  1 193 ? 3.446   33.102  79.184  1.00 42.33  ? 192  GLY A C   1 
ATOM   1511  O O   . GLY A  1 193 ? 3.828   32.783  78.063  1.00 34.51  ? 192  GLY A O   1 
ATOM   1512  N N   . ASN A  1 194 ? 2.778   32.269  79.976  1.00 42.21  ? 193  ASN A N   1 
ATOM   1513  C CA  . ASN A  1 194 ? 2.364   30.953  79.518  1.00 38.23  ? 193  ASN A CA  1 
ATOM   1514  C C   . ASN A  1 194 ? 1.024   31.058  78.800  1.00 30.43  ? 193  ASN A C   1 
ATOM   1515  O O   . ASN A  1 194 ? 0.028   31.470  79.387  1.00 43.24  ? 193  ASN A O   1 
ATOM   1516  C CB  . ASN A  1 194 ? 2.271   29.980  80.703  1.00 40.25  ? 193  ASN A CB  1 
ATOM   1517  C CG  . ASN A  1 194 ? 2.170   28.521  80.263  1.00 45.24  ? 193  ASN A CG  1 
ATOM   1518  O OD1 . ASN A  1 194 ? 1.549   28.207  79.250  1.00 41.21  ? 193  ASN A OD1 1 
ATOM   1519  N ND2 . ASN A  1 194 ? 2.784   27.625  81.032  1.00 42.75  ? 193  ASN A ND2 1 
ATOM   1520  N N   . GLN A  1 195 ? 0.987   30.661  77.534  1.00 26.59  ? 194  GLN A N   1 
ATOM   1521  C CA  . GLN A  1 195 ? -0.227  30.815  76.734  1.00 39.69  ? 194  GLN A CA  1 
ATOM   1522  C C   . GLN A  1 195 ? -1.094  29.548  76.650  1.00 34.64  ? 194  GLN A C   1 
ATOM   1523  O O   . GLN A  1 195 ? -2.080  29.516  75.914  1.00 37.22  ? 194  GLN A O   1 
ATOM   1524  C CB  . GLN A  1 195 ? 0.158   31.274  75.326  1.00 36.75  ? 194  GLN A CB  1 
ATOM   1525  C CG  . GLN A  1 195 ? 0.915   32.608  75.311  1.00 42.07  ? 194  GLN A CG  1 
ATOM   1526  C CD  . GLN A  1 195 ? 1.536   32.912  73.958  1.00 39.11  ? 194  GLN A CD  1 
ATOM   1527  O OE1 . GLN A  1 195 ? 0.918   33.569  73.127  1.00 46.56  ? 194  GLN A OE1 1 
ATOM   1528  N NE2 . GLN A  1 195 ? 2.756   32.417  73.725  1.00 33.40  ? 194  GLN A NE2 1 
ATOM   1529  N N   . LEU A  1 196 ? -0.725  28.517  77.405  1.00 37.64  ? 195  LEU A N   1 
ATOM   1530  C CA  . LEU A  1 196 ? -1.386  27.208  77.342  1.00 38.43  ? 195  LEU A CA  1 
ATOM   1531  C C   . LEU A  1 196 ? -2.892  27.297  77.069  1.00 34.64  ? 195  LEU A C   1 
ATOM   1532  O O   . LEU A  1 196 ? -3.380  26.773  76.075  1.00 35.72  ? 195  LEU A O   1 
ATOM   1533  C CB  . LEU A  1 196 ? -1.137  26.432  78.642  1.00 37.57  ? 195  LEU A CB  1 
ATOM   1534  C CG  . LEU A  1 196 ? -1.687  25.003  78.744  1.00 41.16  ? 195  LEU A CG  1 
ATOM   1535  C CD1 . LEU A  1 196 ? -1.286  24.124  77.546  1.00 34.05  ? 195  LEU A CD1 1 
ATOM   1536  C CD2 . LEU A  1 196 ? -1.194  24.384  80.034  1.00 43.85  ? 195  LEU A CD2 1 
ATOM   1537  N N   . PHE A  1 197 ? -3.625  27.972  77.943  1.00 30.56  ? 196  PHE A N   1 
ATOM   1538  C CA  . PHE A  1 197 ? -5.080  28.035  77.821  1.00 35.59  ? 196  PHE A CA  1 
ATOM   1539  C C   . PHE A  1 197 ? -5.606  29.448  77.552  1.00 39.35  ? 196  PHE A C   1 
ATOM   1540  O O   . PHE A  1 197 ? -6.742  29.755  77.876  1.00 33.86  ? 196  PHE A O   1 
ATOM   1541  C CB  . PHE A  1 197 ? -5.727  27.483  79.088  1.00 31.01  ? 196  PHE A CB  1 
ATOM   1542  C CG  . PHE A  1 197 ? -5.376  26.049  79.368  1.00 38.07  ? 196  PHE A CG  1 
ATOM   1543  C CD1 . PHE A  1 197 ? -4.810  25.684  80.575  1.00 39.71  ? 196  PHE A CD1 1 
ATOM   1544  C CD2 . PHE A  1 197 ? -5.606  25.068  78.415  1.00 37.58  ? 196  PHE A CD2 1 
ATOM   1545  C CE1 . PHE A  1 197 ? -4.486  24.365  80.833  1.00 41.05  ? 196  PHE A CE1 1 
ATOM   1546  C CE2 . PHE A  1 197 ? -5.277  23.750  78.658  1.00 35.22  ? 196  PHE A CE2 1 
ATOM   1547  C CZ  . PHE A  1 197 ? -4.717  23.394  79.872  1.00 40.31  ? 196  PHE A CZ  1 
ATOM   1548  N N   . MET A  1 198 ? -4.774  30.293  76.951  1.00 35.84  ? 197  MET A N   1 
ATOM   1549  C CA  . MET A  1 198 ? -5.150  31.667  76.606  1.00 43.23  ? 197  MET A CA  1 
ATOM   1550  C C   . MET A  1 198 ? -5.938  31.696  75.300  1.00 33.26  ? 197  MET A C   1 
ATOM   1551  O O   . MET A  1 198 ? -5.449  31.235  74.279  1.00 35.89  ? 197  MET A O   1 
ATOM   1552  C CB  . MET A  1 198 ? -3.884  32.517  76.455  1.00 37.32  ? 197  MET A CB  1 
ATOM   1553  C CG  . MET A  1 198 ? -4.129  33.980  76.092  1.00 44.33  ? 197  MET A CG  1 
ATOM   1554  S SD  . MET A  1 198 ? -2.583  34.880  75.811  1.00 43.00  ? 197  MET A SD  1 
ATOM   1555  C CE  . MET A  1 198 ? -1.900  34.877  77.475  1.00 26.89  ? 197  MET A CE  1 
ATOM   1556  N N   . LYS A  1 199 ? -7.153  32.235  75.325  1.00 42.15  ? 198  LYS A N   1 
ATOM   1557  C CA  . LYS A  1 199 ? -7.987  32.252  74.125  1.00 42.41  ? 198  LYS A CA  1 
ATOM   1558  C C   . LYS A  1 199 ? -7.539  33.312  73.104  1.00 47.91  ? 198  LYS A C   1 
ATOM   1559  O O   . LYS A  1 199 ? -7.410  33.014  71.918  1.00 50.65  ? 198  LYS A O   1 
ATOM   1560  C CB  . LYS A  1 199 ? -9.472  32.430  74.474  1.00 43.08  ? 198  LYS A CB  1 
ATOM   1561  C CG  . LYS A  1 199 ? -10.366 32.426  73.230  1.00 46.69  ? 198  LYS A CG  1 
ATOM   1562  C CD  . LYS A  1 199 ? -11.702 33.098  73.477  1.00 50.23  ? 198  LYS A CD  1 
ATOM   1563  C CE  . LYS A  1 199 ? -12.615 32.226  74.304  1.00 79.48  ? 198  LYS A CE  1 
ATOM   1564  N NZ  . LYS A  1 199 ? -13.957 32.847  74.457  1.00 74.50  ? 198  LYS A NZ  1 
ATOM   1565  N N   . THR A  1 200 ? -7.303  34.546  73.547  1.00 54.16  ? 199  THR A N   1 
ATOM   1566  C CA  . THR A  1 200 ? -6.782  35.581  72.644  1.00 45.61  ? 199  THR A CA  1 
ATOM   1567  C C   . THR A  1 200 ? -5.693  36.392  73.324  1.00 42.41  ? 199  THR A C   1 
ATOM   1568  O O   . THR A  1 200 ? -5.694  36.548  74.539  1.00 49.27  ? 199  THR A O   1 
ATOM   1569  C CB  . THR A  1 200 ? -7.861  36.555  72.221  1.00 41.11  ? 199  THR A CB  1 
ATOM   1570  O OG1 . THR A  1 200 ? -8.292  37.295  73.370  1.00 44.30  ? 199  THR A OG1 1 
ATOM   1571  C CG2 . THR A  1 200 ? -9.040  35.826  71.603  1.00 42.09  ? 199  THR A CG2 1 
ATOM   1572  N N   . ARG A  1 201 ? -4.764  36.917  72.537  1.00 44.87  ? 200  ARG A N   1 
ATOM   1573  C CA  . ARG A  1 201 ? -3.657  37.680  73.101  1.00 41.69  ? 200  ARG A CA  1 
ATOM   1574  C C   . ARG A  1 201 ? -4.064  39.089  73.542  1.00 42.26  ? 200  ARG A C   1 
ATOM   1575  O O   . ARG A  1 201 ? -3.406  39.689  74.394  1.00 46.17  ? 200  ARG A O   1 
ATOM   1576  C CB  . ARG A  1 201 ? -2.502  37.745  72.114  1.00 40.36  ? 200  ARG A CB  1 
ATOM   1577  C CG  . ARG A  1 201 ? -1.877  36.377  71.813  1.00 42.57  ? 200  ARG A CG  1 
ATOM   1578  C CD  . ARG A  1 201 ? -0.616  36.531  70.972  1.00 51.46  ? 200  ARG A CD  1 
ATOM   1579  N NE  . ARG A  1 201 ? 0.245   35.351  71.017  1.00 70.16  ? 200  ARG A NE  1 
ATOM   1580  C CZ  . ARG A  1 201 ? 0.350   34.451  70.043  1.00 74.09  ? 200  ARG A CZ  1 
ATOM   1581  N NH1 . ARG A  1 201 ? 1.164   33.417  70.189  1.00 70.04  ? 200  ARG A NH1 1 
ATOM   1582  N NH2 . ARG A  1 201 ? -0.353  34.578  68.923  1.00 72.00  ? 200  ARG A NH2 1 
ATOM   1583  N N   . ASN A  1 202 ? -5.154  39.621  73.002  1.00 31.39  ? 201  ASN A N   1 
ATOM   1584  C CA  . ASN A  1 202 ? -5.596  40.947  73.454  1.00 62.27  ? 201  ASN A CA  1 
ATOM   1585  C C   . ASN A  1 202 ? -7.079  41.271  73.252  1.00 52.68  ? 201  ASN A C   1 
ATOM   1586  O O   . ASN A  1 202 ? -7.447  42.433  73.164  1.00 49.70  ? 201  ASN A O   1 
ATOM   1587  C CB  . ASN A  1 202 ? -4.719  42.056  72.840  1.00 45.64  ? 201  ASN A CB  1 
ATOM   1588  C CG  . ASN A  1 202 ? -4.654  41.988  71.332  1.00 67.09  ? 201  ASN A CG  1 
ATOM   1589  O OD1 . ASN A  1 202 ? -5.499  41.369  70.688  1.00 82.94  ? 201  ASN A OD1 1 
ATOM   1590  N ND2 . ASN A  1 202 ? -3.641  42.629  70.756  1.00 94.59  ? 201  ASN A ND2 1 
ATOM   1591  N N   . GLY A  1 203 ? -7.929  40.252  73.209  1.00 50.07  ? 202  GLY A N   1 
ATOM   1592  C CA  . GLY A  1 203 ? -9.365  40.469  73.109  1.00 40.42  ? 202  GLY A CA  1 
ATOM   1593  C C   . GLY A  1 203 ? -9.870  41.364  74.230  1.00 51.74  ? 202  GLY A C   1 
ATOM   1594  O O   . GLY A  1 203 ? -9.242  41.455  75.283  1.00 54.34  ? 202  GLY A O   1 
ATOM   1595  N N   . SER A  1 204 ? -11.013 42.012  74.018  1.00 56.74  ? 203  SER A N   1 
ATOM   1596  C CA  . SER A  1 204 ? -11.494 43.037  74.945  1.00 74.01  ? 203  SER A CA  1 
ATOM   1597  C C   . SER A  1 204 ? -12.484 42.510  75.982  1.00 58.79  ? 203  SER A C   1 
ATOM   1598  O O   . SER A  1 204 ? -13.039 43.283  76.759  1.00 83.35  ? 203  SER A O   1 
ATOM   1599  C CB  . SER A  1 204 ? -12.128 44.203  74.172  1.00 70.03  ? 203  SER A CB  1 
ATOM   1600  O OG  . SER A  1 204 ? -13.162 43.754  73.312  1.00 84.96  ? 203  SER A OG  1 
ATOM   1601  N N   . MET A  1 205 ? -12.703 41.199  75.996  1.00 72.58  ? 204  MET A N   1 
ATOM   1602  C CA  . MET A  1 205 ? -13.615 40.589  76.959  1.00 52.68  ? 204  MET A CA  1 
ATOM   1603  C C   . MET A  1 205 ? -12.975 40.572  78.342  1.00 52.28  ? 204  MET A C   1 
ATOM   1604  O O   . MET A  1 205 ? -11.815 40.946  78.496  1.00 49.23  ? 204  MET A O   1 
ATOM   1605  C CB  . MET A  1 205 ? -13.976 39.161  76.531  1.00 66.15  ? 204  MET A CB  1 
ATOM   1606  C CG  . MET A  1 205 ? -12.909 38.104  76.841  1.00 67.84  ? 204  MET A CG  1 
ATOM   1607  S SD  . MET A  1 205 ? -11.528 38.046  75.683  1.00 66.71  ? 204  MET A SD  1 
ATOM   1608  C CE  . MET A  1 205 ? -12.328 37.408  74.209  1.00 51.05  ? 204  MET A CE  1 
ATOM   1609  N N   . LYS A  1 206 ? -13.721 40.140  79.352  1.00 43.76  ? 205  LYS A N   1 
ATOM   1610  C CA  . LYS A  1 206 ? -13.146 40.021  80.685  1.00 53.76  ? 205  LYS A CA  1 
ATOM   1611  C C   . LYS A  1 206 ? -12.342 38.726  80.813  1.00 53.97  ? 205  LYS A C   1 
ATOM   1612  O O   . LYS A  1 206 ? -12.459 37.820  79.989  1.00 48.05  ? 205  LYS A O   1 
ATOM   1613  C CB  . LYS A  1 206 ? -14.220 40.113  81.770  1.00 56.31  ? 205  LYS A CB  1 
ATOM   1614  C CG  . LYS A  1 206 ? -15.169 38.940  81.850  1.00 69.03  ? 205  LYS A CG  1 
ATOM   1615  C CD  . LYS A  1 206 ? -16.173 39.156  82.992  1.00 89.51  ? 205  LYS A CD  1 
ATOM   1616  C CE  . LYS A  1 206 ? -16.889 37.869  83.406  1.00 94.42  ? 205  LYS A CE  1 
ATOM   1617  N NZ  . LYS A  1 206 ? -17.717 37.291  82.310  1.00 87.06  ? 205  LYS A NZ  1 
ATOM   1618  N N   . ALA A  1 207 ? -11.519 38.657  81.850  1.00 35.02  ? 206  ALA A N   1 
ATOM   1619  C CA  . ALA A  1 207 ? -10.512 37.621  81.966  1.00 41.01  ? 206  ALA A CA  1 
ATOM   1620  C C   . ALA A  1 207 ? -11.160 36.247  81.965  1.00 44.42  ? 206  ALA A C   1 
ATOM   1621  O O   . ALA A  1 207 ? -10.700 35.336  81.288  1.00 41.48  ? 206  ALA A O   1 
ATOM   1622  C CB  . ALA A  1 207 ? -9.710  37.825  83.239  1.00 37.11  ? 206  ALA A CB  1 
ATOM   1623  N N   . ALA A  1 208 ? -12.245 36.118  82.717  1.00 38.73  ? 207  ALA A N   1 
ATOM   1624  C CA  . ALA A  1 208 ? -12.901 34.839  82.902  1.00 44.56  ? 207  ALA A CA  1 
ATOM   1625  C C   . ALA A  1 208 ? -13.434 34.317  81.582  1.00 53.59  ? 207  ALA A C   1 
ATOM   1626  O O   . ALA A  1 208 ? -13.768 33.145  81.464  1.00 44.01  ? 207  ALA A O   1 
ATOM   1627  C CB  . ALA A  1 208 ? -14.026 34.978  83.892  1.00 44.50  ? 207  ALA A CB  1 
ATOM   1628  N N   . GLU A  1 209 ? -13.525 35.194  80.593  1.00 49.94  ? 208  GLU A N   1 
ATOM   1629  C CA  . GLU A  1 209 ? -14.049 34.811  79.296  1.00 44.58  ? 208  GLU A CA  1 
ATOM   1630  C C   . GLU A  1 209 ? -12.944 34.597  78.280  1.00 41.44  ? 208  GLU A C   1 
ATOM   1631  O O   . GLU A  1 209 ? -13.224 34.331  77.111  1.00 42.39  ? 208  GLU A O   1 
ATOM   1632  C CB  . GLU A  1 209 ? -14.993 35.891  78.776  1.00 46.57  ? 208  GLU A CB  1 
ATOM   1633  C CG  . GLU A  1 209 ? -16.312 35.941  79.501  1.00 48.73  ? 208  GLU A CG  1 
ATOM   1634  C CD  . GLU A  1 209 ? -17.121 37.191  79.161  1.00 84.93  ? 208  GLU A CD  1 
ATOM   1635  O OE1 . GLU A  1 209 ? -16.617 38.066  78.420  1.00 91.95  ? 208  GLU A OE1 1 
ATOM   1636  O OE2 . GLU A  1 209 ? -18.267 37.305  79.648  1.00 84.68  ? 208  GLU A OE2 1 
ATOM   1637  N N   . ASN A  1 210 ? -11.691 34.727  78.713  1.00 31.93  ? 209  ASN A N   1 
ATOM   1638  C CA  . ASN A  1 210 ? -10.567 34.628  77.785  1.00 43.39  ? 209  ASN A CA  1 
ATOM   1639  C C   . ASN A  1 210 ? -9.772  33.330  77.929  1.00 45.58  ? 209  ASN A C   1 
ATOM   1640  O O   . ASN A  1 210 ? -8.598  33.249  77.566  1.00 39.15  ? 209  ASN A O   1 
ATOM   1641  C CB  . ASN A  1 210 ? -9.619  35.810  77.935  1.00 30.15  ? 209  ASN A CB  1 
ATOM   1642  C CG  . ASN A  1 210 ? -8.675  35.920  76.768  1.00 35.12  ? 209  ASN A CG  1 
ATOM   1643  O OD1 . ASN A  1 210 ? -9.070  35.695  75.625  1.00 38.88  ? 209  ASN A OD1 1 
ATOM   1644  N ND2 . ASN A  1 210 ? -7.419  36.232  77.044  1.00 35.02  ? 209  ASN A ND2 1 
ATOM   1645  N N   . PHE A  1 211 ? -10.415 32.306  78.457  1.00 43.16  ? 210  PHE A N   1 
ATOM   1646  C CA  . PHE A  1 211 ? -9.789  30.995  78.531  1.00 45.25  ? 210  PHE A CA  1 
ATOM   1647  C C   . PHE A  1 211 ? -10.210 30.150  77.332  1.00 35.78  ? 210  PHE A C   1 
ATOM   1648  O O   . PHE A  1 211 ? -11.333 30.252  76.837  1.00 34.10  ? 210  PHE A O   1 
ATOM   1649  C CB  . PHE A  1 211 ? -10.161 30.293  79.837  1.00 36.53  ? 210  PHE A CB  1 
ATOM   1650  C CG  . PHE A  1 211 ? -9.542  30.912  81.059  1.00 38.84  ? 210  PHE A CG  1 
ATOM   1651  C CD1 . PHE A  1 211 ? -8.188  30.779  81.309  1.00 33.60  ? 210  PHE A CD1 1 
ATOM   1652  C CD2 . PHE A  1 211 ? -10.316 31.616  81.966  1.00 39.42  ? 210  PHE A CD2 1 
ATOM   1653  C CE1 . PHE A  1 211 ? -7.613  31.348  82.440  1.00 32.24  ? 210  PHE A CE1 1 
ATOM   1654  C CE2 . PHE A  1 211 ? -9.747  32.177  83.089  1.00 38.58  ? 210  PHE A CE2 1 
ATOM   1655  C CZ  . PHE A  1 211 ? -8.395  32.039  83.326  1.00 38.97  ? 210  PHE A CZ  1 
ATOM   1656  N N   . LEU A  1 212 ? -9.290  29.333  76.847  1.00 42.77  ? 211  LEU A N   1 
ATOM   1657  C CA  . LEU A  1 212 ? -9.578  28.435  75.743  1.00 41.92  ? 211  LEU A CA  1 
ATOM   1658  C C   . LEU A  1 212 ? -10.827 27.605  76.046  1.00 48.05  ? 211  LEU A C   1 
ATOM   1659  O O   . LEU A  1 212 ? -11.007 27.109  77.158  1.00 38.71  ? 211  LEU A O   1 
ATOM   1660  C CB  . LEU A  1 212 ? -8.379  27.521  75.515  1.00 43.26  ? 211  LEU A CB  1 
ATOM   1661  C CG  . LEU A  1 212 ? -8.432  26.632  74.281  1.00 52.78  ? 211  LEU A CG  1 
ATOM   1662  C CD1 . LEU A  1 212 ? -8.513  27.492  73.025  1.00 44.05  ? 211  LEU A CD1 1 
ATOM   1663  C CD2 . LEU A  1 212 ? -7.216  25.700  74.254  1.00 42.14  ? 211  LEU A CD2 1 
ATOM   1664  N N   . ASP A  1 213 ? -11.699 27.475  75.057  1.00 39.00  ? 212  ASP A N   1 
ATOM   1665  C CA  . ASP A  1 213 ? -12.916 26.689  75.210  1.00 38.99  ? 212  ASP A CA  1 
ATOM   1666  C C   . ASP A  1 213 ? -12.539 25.211  75.369  1.00 47.82  ? 212  ASP A C   1 
ATOM   1667  O O   . ASP A  1 213 ? -11.716 24.694  74.609  1.00 40.25  ? 212  ASP A O   1 
ATOM   1668  C CB  . ASP A  1 213 ? -13.812 26.898  73.983  1.00 52.14  ? 212  ASP A CB  1 
ATOM   1669  C CG  . ASP A  1 213 ? -14.968 25.912  73.911  1.00 78.17  ? 212  ASP A CG  1 
ATOM   1670  O OD1 . ASP A  1 213 ? -15.316 25.298  74.940  1.00 79.21  ? 212  ASP A OD1 1 
ATOM   1671  O OD2 . ASP A  1 213 ? -15.543 25.758  72.811  1.00 82.11  ? 212  ASP A OD2 1 
ATOM   1672  N N   . PRO A  1 214 ? -13.121 24.531  76.371  1.00 48.38  ? 213  PRO A N   1 
ATOM   1673  C CA  . PRO A  1 214 ? -12.827 23.107  76.605  1.00 40.87  ? 213  PRO A CA  1 
ATOM   1674  C C   . PRO A  1 214 ? -12.990 22.226  75.354  1.00 45.95  ? 213  PRO A C   1 
ATOM   1675  O O   . PRO A  1 214 ? -12.201 21.306  75.147  1.00 34.22  ? 213  PRO A O   1 
ATOM   1676  C CB  . PRO A  1 214 ? -13.830 22.706  77.706  1.00 44.31  ? 213  PRO A CB  1 
ATOM   1677  C CG  . PRO A  1 214 ? -14.798 23.867  77.823  1.00 52.99  ? 213  PRO A CG  1 
ATOM   1678  C CD  . PRO A  1 214 ? -14.024 25.077  77.400  1.00 48.51  ? 213  PRO A CD  1 
ATOM   1679  N N   . ASN A  1 215 ? -13.982 22.517  74.524  1.00 40.37  ? 214  ASN A N   1 
ATOM   1680  C CA  . ASN A  1 215 ? -14.164 21.791  73.274  1.00 33.62  ? 214  ASN A CA  1 
ATOM   1681  C C   . ASN A  1 215 ? -12.971 21.880  72.324  1.00 43.82  ? 214  ASN A C   1 
ATOM   1682  O O   . ASN A  1 215 ? -12.822 21.045  71.445  1.00 46.50  ? 214  ASN A O   1 
ATOM   1683  C CB  . ASN A  1 215 ? -15.413 22.300  72.553  1.00 48.78  ? 214  ASN A CB  1 
ATOM   1684  C CG  . ASN A  1 215 ? -16.693 21.988  73.309  1.00 63.74  ? 214  ASN A CG  1 
ATOM   1685  O OD1 . ASN A  1 215 ? -16.728 21.095  74.165  1.00 51.89  ? 214  ASN A OD1 1 
ATOM   1686  N ND2 . ASN A  1 215 ? -17.758 22.718  72.989  1.00 64.49  ? 214  ASN A ND2 1 
ATOM   1687  N N   . LYS A  1 216 ? -12.140 22.904  72.481  1.00 39.44  ? 215  LYS A N   1 
ATOM   1688  C CA  . LYS A  1 216 ? -10.979 23.083  71.618  1.00 53.02  ? 215  LYS A CA  1 
ATOM   1689  C C   . LYS A  1 216 ? -9.695  22.592  72.279  1.00 48.77  ? 215  LYS A C   1 
ATOM   1690  O O   . LYS A  1 216 ? -8.601  22.795  71.755  1.00 47.49  ? 215  LYS A O   1 
ATOM   1691  C CB  . LYS A  1 216 ? -10.827 24.551  71.231  1.00 49.74  ? 215  LYS A CB  1 
ATOM   1692  C CG  . LYS A  1 216 ? -11.943 25.071  70.349  1.00 55.93  ? 215  LYS A CG  1 
ATOM   1693  C CD  . LYS A  1 216 ? -11.658 26.498  69.901  1.00 70.45  ? 215  LYS A CD  1 
ATOM   1694  C CE  . LYS A  1 216 ? -12.730 27.010  68.960  1.00 84.32  ? 215  LYS A CE  1 
ATOM   1695  N NZ  . LYS A  1 216 ? -12.439 28.387  68.497  1.00 87.77  ? 215  LYS A NZ  1 
ATOM   1696  N N   . ALA A  1 217 ? -9.834  21.944  73.428  1.00 46.00  ? 216  ALA A N   1 
ATOM   1697  C CA  . ALA A  1 217 ? -8.693  21.371  74.129  1.00 45.13  ? 216  ALA A CA  1 
ATOM   1698  C C   . ALA A  1 217 ? -8.886  19.866  74.302  1.00 44.60  ? 216  ALA A C   1 
ATOM   1699  O O   . ALA A  1 217 ? -9.957  19.329  74.014  1.00 46.58  ? 216  ALA A O   1 
ATOM   1700  C CB  . ALA A  1 217 ? -8.525  22.035  75.477  1.00 37.85  ? 216  ALA A CB  1 
ATOM   1701  N N   . SER A  1 218 ? -7.846  19.181  74.768  1.00 45.41  ? 217  SER A N   1 
ATOM   1702  C CA  . SER A  1 218 ? -7.945  17.746  75.036  1.00 31.75  ? 217  SER A CA  1 
ATOM   1703  C C   . SER A  1 218 ? -9.174  17.445  75.886  1.00 34.27  ? 217  SER A C   1 
ATOM   1704  O O   . SER A  1 218 ? -9.386  18.061  76.940  1.00 32.59  ? 217  SER A O   1 
ATOM   1705  C CB  . SER A  1 218 ? -6.699  17.253  75.760  1.00 34.24  ? 217  SER A CB  1 
ATOM   1706  O OG  . SER A  1 218 ? -6.902  15.947  76.271  1.00 46.08  ? 217  SER A OG  1 
ATOM   1707  N N   . SER A  1 219 ? -9.978  16.490  75.438  1.00 30.19  ? 218  SER A N   1 
ATOM   1708  C CA  . SER A  1 219 ? -11.204 16.136  76.148  1.00 41.05  ? 218  SER A CA  1 
ATOM   1709  C C   . SER A  1 219 ? -10.933 15.591  77.565  1.00 41.91  ? 218  SER A C   1 
ATOM   1710  O O   . SER A  1 219 ? -11.826 15.596  78.411  1.00 40.19  ? 218  SER A O   1 
ATOM   1711  C CB  . SER A  1 219 ? -12.006 15.118  75.339  1.00 33.53  ? 218  SER A CB  1 
ATOM   1712  O OG  . SER A  1 219 ? -11.284 13.907  75.213  1.00 54.56  ? 218  SER A OG  1 
ATOM   1713  N N   . LEU A  1 220 ? -9.711  15.129  77.827  1.00 33.41  ? 219  LEU A N   1 
ATOM   1714  C CA  . LEU A  1 220 ? -9.352  14.694  79.175  1.00 37.15  ? 219  LEU A CA  1 
ATOM   1715  C C   . LEU A  1 220 ? -9.421  15.839  80.177  1.00 40.40  ? 219  LEU A C   1 
ATOM   1716  O O   . LEU A  1 220 ? -9.658  15.601  81.356  1.00 38.45  ? 219  LEU A O   1 
ATOM   1717  C CB  . LEU A  1 220 ? -7.941  14.099  79.235  1.00 33.27  ? 219  LEU A CB  1 
ATOM   1718  C CG  . LEU A  1 220 ? -7.602  12.836  78.442  1.00 45.28  ? 219  LEU A CG  1 
ATOM   1719  C CD1 . LEU A  1 220 ? -6.575  11.998  79.212  1.00 29.93  ? 219  LEU A CD1 1 
ATOM   1720  C CD2 . LEU A  1 220 ? -8.836  12.022  78.147  1.00 48.35  ? 219  LEU A CD2 1 
ATOM   1721  N N   . LEU A  1 221 ? -9.185  17.066  79.717  1.00 32.35  ? 220  LEU A N   1 
ATOM   1722  C CA  . LEU A  1 221 ? -9.153  18.226  80.610  1.00 35.31  ? 220  LEU A CA  1 
ATOM   1723  C C   . LEU A  1 221 ? -10.515 18.504  81.238  1.00 34.63  ? 220  LEU A C   1 
ATOM   1724  O O   . LEU A  1 221 ? -10.596 18.901  82.398  1.00 40.08  ? 220  LEU A O   1 
ATOM   1725  C CB  . LEU A  1 221 ? -8.660  19.474  79.864  1.00 29.73  ? 220  LEU A CB  1 
ATOM   1726  C CG  . LEU A  1 221 ? -7.210  19.401  79.381  1.00 35.78  ? 220  LEU A CG  1 
ATOM   1727  C CD1 . LEU A  1 221 ? -6.890  20.549  78.436  1.00 35.24  ? 220  LEU A CD1 1 
ATOM   1728  C CD2 . LEU A  1 221 ? -6.252  19.386  80.564  1.00 32.44  ? 220  LEU A CD2 1 
ATOM   1729  N N   . SER A  1 222 ? -11.584 18.296  80.476  1.00 36.76  ? 221  SER A N   1 
ATOM   1730  C CA  . SER A  1 222 ? -12.924 18.605  80.959  1.00 38.82  ? 221  SER A CA  1 
ATOM   1731  C C   . SER A  1 222 ? -13.709 17.328  81.287  1.00 36.63  ? 221  SER A C   1 
ATOM   1732  O O   . SER A  1 222 ? -13.988 17.044  82.448  1.00 38.69  ? 221  SER A O   1 
ATOM   1733  C CB  . SER A  1 222 ? -13.678 19.455  79.929  1.00 32.98  ? 221  SER A CB  1 
ATOM   1734  O OG  . SER A  1 222 ? -13.601 18.857  78.638  1.00 56.02  ? 221  SER A OG  1 
ATOM   1735  N N   . SER A  1 223 ? -14.064 16.563  80.263  1.00 37.58  ? 222  SER A N   1 
ATOM   1736  C CA  . SER A  1 223 ? -14.855 15.350  80.455  1.00 47.25  ? 222  SER A CA  1 
ATOM   1737  C C   . SER A  1 223 ? -14.116 14.274  81.267  1.00 42.54  ? 222  SER A C   1 
ATOM   1738  O O   . SER A  1 223 ? -14.723 13.594  82.084  1.00 45.53  ? 222  SER A O   1 
ATOM   1739  C CB  . SER A  1 223 ? -15.294 14.796  79.107  1.00 45.69  ? 222  SER A CB  1 
ATOM   1740  O OG  . SER A  1 223 ? -16.213 15.682  78.496  1.00 43.92  ? 222  SER A OG  1 
ATOM   1741  N N   . GLY A  1 224 ? -12.818 14.112  81.040  1.00 32.30  ? 223  GLY A N   1 
ATOM   1742  C CA  . GLY A  1 224 ? -12.010 13.315  81.940  1.00 33.31  ? 223  GLY A CA  1 
ATOM   1743  C C   . GLY A  1 224 ? -11.411 12.058  81.349  1.00 38.28  ? 223  GLY A C   1 
ATOM   1744  O O   . GLY A  1 224 ? -11.612 11.726  80.177  1.00 37.64  ? 223  GLY A O   1 
ATOM   1745  N N   . PHE A  1 225 ? -10.689 11.342  82.202  1.00 31.21  ? 224  PHE A N   1 
ATOM   1746  C CA  . PHE A  1 225 ? -9.918  10.186  81.813  1.00 29.10  ? 224  PHE A CA  1 
ATOM   1747  C C   . PHE A  1 225 ? -10.517 8.894   82.362  1.00 35.68  ? 224  PHE A C   1 
ATOM   1748  O O   . PHE A  1 225 ? -10.892 8.837   83.521  1.00 33.08  ? 224  PHE A O   1 
ATOM   1749  C CB  . PHE A  1 225 ? -8.498  10.352  82.342  1.00 29.56  ? 224  PHE A CB  1 
ATOM   1750  C CG  . PHE A  1 225 ? -7.656  9.119   82.193  1.00 39.25  ? 224  PHE A CG  1 
ATOM   1751  C CD1 . PHE A  1 225 ? -7.266  8.673   80.942  1.00 38.16  ? 224  PHE A CD1 1 
ATOM   1752  C CD2 . PHE A  1 225 ? -7.264  8.402   83.308  1.00 33.10  ? 224  PHE A CD2 1 
ATOM   1753  C CE1 . PHE A  1 225 ? -6.490  7.523   80.808  1.00 38.56  ? 224  PHE A CE1 1 
ATOM   1754  C CE2 . PHE A  1 225 ? -6.502  7.268   83.184  1.00 36.42  ? 224  PHE A CE2 1 
ATOM   1755  C CZ  . PHE A  1 225 ? -6.106  6.827   81.929  1.00 31.12  ? 224  PHE A CZ  1 
ATOM   1756  N N   . SER A  1 226 ? -10.588 7.857   81.530  1.00 32.42  ? 225  SER A N   1 
ATOM   1757  C CA  . SER A  1 226 ? -11.095 6.544   81.956  1.00 40.61  ? 225  SER A CA  1 
ATOM   1758  C C   . SER A  1 226 ? -9.952  5.556   82.103  1.00 31.32  ? 225  SER A C   1 
ATOM   1759  O O   . SER A  1 226 ? -9.427  5.072   81.121  1.00 30.41  ? 225  SER A O   1 
ATOM   1760  C CB  . SER A  1 226 ? -12.091 5.993   80.936  1.00 25.57  ? 225  SER A CB  1 
ATOM   1761  O OG  . SER A  1 226 ? -13.216 6.843   80.854  1.00 34.01  ? 225  SER A OG  1 
ATOM   1762  N N   . PRO A  1 227 ? -9.552  5.267   83.338  1.00 31.12  ? 226  PRO A N   1 
ATOM   1763  C CA  . PRO A  1 227 ? -8.477  4.293   83.563  1.00 38.04  ? 226  PRO A CA  1 
ATOM   1764  C C   . PRO A  1 227 ? -8.827  2.934   82.971  1.00 37.41  ? 226  PRO A C   1 
ATOM   1765  O O   . PRO A  1 227 ? -10.007 2.570   82.929  1.00 34.03  ? 226  PRO A O   1 
ATOM   1766  C CB  . PRO A  1 227 ? -8.410  4.185   85.095  1.00 30.08  ? 226  PRO A CB  1 
ATOM   1767  C CG  . PRO A  1 227 ? -9.050  5.444   85.595  1.00 39.76  ? 226  PRO A CG  1 
ATOM   1768  C CD  . PRO A  1 227 ? -10.100 5.798   84.592  1.00 28.28  ? 226  PRO A CD  1 
ATOM   1769  N N   . ASP A  1 228 ? -7.814  2.205   82.514  1.00 39.72  ? 227  ASP A N   1 
ATOM   1770  C CA  . ASP A  1 228 ? -7.987  0.820   82.113  1.00 42.00  ? 227  ASP A CA  1 
ATOM   1771  C C   . ASP A  1 228 ? -6.708  0.066   82.447  1.00 47.36  ? 227  ASP A C   1 
ATOM   1772  O O   . ASP A  1 228 ? -5.923  -0.265  81.565  1.00 43.41  ? 227  ASP A O   1 
ATOM   1773  C CB  . ASP A  1 228 ? -8.289  0.718   80.620  1.00 43.26  ? 227  ASP A CB  1 
ATOM   1774  C CG  . ASP A  1 228 ? -8.890  -0.632  80.235  1.00 76.15  ? 227  ASP A CG  1 
ATOM   1775  O OD1 . ASP A  1 228 ? -8.931  -1.543  81.098  1.00 68.36  ? 227  ASP A OD1 1 
ATOM   1776  O OD2 . ASP A  1 228 ? -9.318  -0.786  79.068  1.00 78.62  ? 227  ASP A OD2 1 
ATOM   1777  N N   . PHE A  1 229 ? -6.499  -0.182  83.733  1.00 32.71  ? 228  PHE A N   1 
ATOM   1778  C CA  . PHE A  1 229 ? -5.253  -0.751  84.210  1.00 26.22  ? 228  PHE A CA  1 
ATOM   1779  C C   . PHE A  1 229 ? -5.516  -2.107  84.838  1.00 31.55  ? 228  PHE A C   1 
ATOM   1780  O O   . PHE A  1 229 ? -6.565  -2.328  85.442  1.00 32.54  ? 228  PHE A O   1 
ATOM   1781  C CB  . PHE A  1 229 ? -4.622  0.173   85.250  1.00 25.78  ? 228  PHE A CB  1 
ATOM   1782  C CG  . PHE A  1 229 ? -4.450  1.599   84.779  1.00 32.86  ? 228  PHE A CG  1 
ATOM   1783  C CD1 . PHE A  1 229 ? -3.952  1.875   83.513  1.00 30.49  ? 228  PHE A CD1 1 
ATOM   1784  C CD2 . PHE A  1 229 ? -4.793  2.660   85.604  1.00 29.32  ? 228  PHE A CD2 1 
ATOM   1785  C CE1 . PHE A  1 229 ? -3.787  3.184   83.079  1.00 26.97  ? 228  PHE A CE1 1 
ATOM   1786  C CE2 . PHE A  1 229 ? -4.630  3.979   85.181  1.00 34.48  ? 228  PHE A CE2 1 
ATOM   1787  C CZ  . PHE A  1 229 ? -4.123  4.242   83.922  1.00 29.75  ? 228  PHE A CZ  1 
ATOM   1788  N N   . ALA A  1 230 ? -4.550  -3.008  84.710  1.00 28.94  ? 229  ALA A N   1 
ATOM   1789  C CA  . ALA A  1 230 ? -4.690  -4.361  85.223  1.00 28.53  ? 229  ALA A CA  1 
ATOM   1790  C C   . ALA A  1 230 ? -3.590  -4.650  86.231  1.00 27.45  ? 229  ALA A C   1 
ATOM   1791  O O   . ALA A  1 230 ? -2.425  -4.341  86.006  1.00 26.75  ? 229  ALA A O   1 
ATOM   1792  C CB  . ALA A  1 230 ? -4.626  -5.375  84.069  1.00 22.21  ? 229  ALA A CB  1 
ATOM   1793  N N   . THR A  1 231 ? -3.975  -5.250  87.346  1.00 24.09  ? 230  THR A N   1 
ATOM   1794  C CA  . THR A  1 231 ? -3.028  -5.670  88.360  1.00 29.29  ? 230  THR A CA  1 
ATOM   1795  C C   . THR A  1 231 ? -3.266  -7.154  88.641  1.00 29.93  ? 230  THR A C   1 
ATOM   1796  O O   . THR A  1 231 ? -4.403  -7.578  88.833  1.00 30.65  ? 230  THR A O   1 
ATOM   1797  C CB  . THR A  1 231 ? -3.225  -4.876  89.661  1.00 27.40  ? 230  THR A CB  1 
ATOM   1798  O OG1 . THR A  1 231 ? -3.116  -3.475  89.389  1.00 47.19  ? 230  THR A OG1 1 
ATOM   1799  C CG2 . THR A  1 231 ? -2.171  -5.273  90.696  1.00 29.80  ? 230  THR A CG2 1 
ATOM   1800  N N   . VAL A  1 232 ? -2.200  -7.940  88.662  1.00 29.86  ? 231  VAL A N   1 
ATOM   1801  C CA  . VAL A  1 232 ? -2.320  -9.344  89.033  1.00 29.92  ? 231  VAL A CA  1 
ATOM   1802  C C   . VAL A  1 232 ? -1.767  -9.565  90.435  1.00 32.03  ? 231  VAL A C   1 
ATOM   1803  O O   . VAL A  1 232 ? -0.637  -9.187  90.734  1.00 36.17  ? 231  VAL A O   1 
ATOM   1804  C CB  . VAL A  1 232 ? -1.577  -10.246 88.040  1.00 32.28  ? 231  VAL A CB  1 
ATOM   1805  C CG1 . VAL A  1 232 ? -1.809  -11.719 88.386  1.00 28.70  ? 231  VAL A CG1 1 
ATOM   1806  C CG2 . VAL A  1 232 ? -2.036  -9.946  86.624  1.00 24.14  ? 231  VAL A CG2 1 
ATOM   1807  N N   . ILE A  1 233 ? -2.575  -10.178 91.290  1.00 27.38  ? 232  ILE A N   1 
ATOM   1808  C CA  . ILE A  1 233 ? -2.165  -10.504 92.648  1.00 23.59  ? 232  ILE A CA  1 
ATOM   1809  C C   . ILE A  1 233 ? -2.132  -12.023 92.839  1.00 29.31  ? 232  ILE A C   1 
ATOM   1810  O O   . ILE A  1 233 ? -3.079  -12.720 92.491  1.00 29.86  ? 232  ILE A O   1 
ATOM   1811  C CB  . ILE A  1 233 ? -3.120  -9.854  93.647  1.00 36.64  ? 232  ILE A CB  1 
ATOM   1812  C CG1 . ILE A  1 233 ? -3.065  -8.318  93.479  1.00 32.14  ? 232  ILE A CG1 1 
ATOM   1813  C CG2 . ILE A  1 233 ? -2.771  -10.288 95.067  1.00 27.62  ? 232  ILE A CG2 1 
ATOM   1814  C CD1 . ILE A  1 233 ? -4.152  -7.581  94.188  1.00 38.55  ? 232  ILE A CD1 1 
ATOM   1815  N N   . THR A  1 234 ? -1.027  -12.542 93.364  1.00 26.93  ? 233  THR A N   1 
ATOM   1816  C CA  . THR A  1 234 ? -0.898  -13.979 93.606  1.00 35.22  ? 233  THR A CA  1 
ATOM   1817  C C   . THR A  1 234 ? -0.956  -14.289 95.099  1.00 40.71  ? 233  THR A C   1 
ATOM   1818  O O   . THR A  1 234 ? -0.576  -13.469 95.932  1.00 32.52  ? 233  THR A O   1 
ATOM   1819  C CB  . THR A  1 234 ? 0.419   -14.552 93.031  1.00 32.28  ? 233  THR A CB  1 
ATOM   1820  O OG1 . THR A  1 234 ? 1.538   -13.836 93.564  1.00 50.87  ? 233  THR A OG1 1 
ATOM   1821  C CG2 . THR A  1 234 ? 0.436   -14.443 91.524  1.00 33.38  ? 233  THR A CG2 1 
ATOM   1822  N N   . MET A  1 235 ? -1.427  -15.487 95.423  1.00 35.10  ? 234  MET A N   1 
ATOM   1823  C CA  . MET A  1 235 ? -1.620  -15.914 96.808  1.00 31.68  ? 234  MET A CA  1 
ATOM   1824  C C   . MET A  1 235 ? -1.293  -17.397 96.957  1.00 31.86  ? 234  MET A C   1 
ATOM   1825  O O   . MET A  1 235 ? -1.832  -18.236 96.237  1.00 31.02  ? 234  MET A O   1 
ATOM   1826  C CB  . MET A  1 235 ? -3.068  -15.678 97.220  1.00 28.71  ? 234  MET A CB  1 
ATOM   1827  C CG  . MET A  1 235 ? -3.379  -16.002 98.681  1.00 43.05  ? 234  MET A CG  1 
ATOM   1828  S SD  . MET A  1 235 ? -2.420  -14.998 99.832  1.00 49.41  ? 234  MET A SD  1 
ATOM   1829  C CE  . MET A  1 235 ? -3.440  -15.083 101.291 1.00 47.11  ? 234  MET A CE  1 
ATOM   1830  N N   . ASP A  1 236 ? -0.410  -17.716 97.892  1.00 35.44  ? 235  ASP A N   1 
ATOM   1831  C CA  . ASP A  1 236 ? -0.082  -19.101 98.193  1.00 39.20  ? 235  ASP A CA  1 
ATOM   1832  C C   . ASP A  1 236 ? -1.314  -19.806 98.787  1.00 32.84  ? 235  ASP A C   1 
ATOM   1833  O O   . ASP A  1 236 ? -1.983  -19.282 99.671  1.00 35.93  ? 235  ASP A O   1 
ATOM   1834  C CB  . ASP A  1 236 ? 1.100   -19.152 99.167  1.00 43.29  ? 235  ASP A CB  1 
ATOM   1835  C CG  . ASP A  1 236 ? 1.761   -20.524 99.230  1.00 73.87  ? 235  ASP A CG  1 
ATOM   1836  O OD1 . ASP A  1 236 ? 1.044   -21.548 99.306  1.00 69.26  ? 235  ASP A OD1 1 
ATOM   1837  O OD2 . ASP A  1 236 ? 3.010   -20.576 99.203  1.00 86.44  ? 235  ASP A OD2 1 
ATOM   1838  N N   . ARG A  1 237 ? -1.624  -20.994 98.291  1.00 39.40  ? 236  ARG A N   1 
ATOM   1839  C CA  . ARG A  1 237 ? -2.794  -21.721 98.765  1.00 38.92  ? 236  ARG A CA  1 
ATOM   1840  C C   . ARG A  1 237 ? -2.651  -22.175 100.221 1.00 50.68  ? 236  ARG A C   1 
ATOM   1841  O O   . ARG A  1 237 ? -3.654  -22.408 100.902 1.00 39.33  ? 236  ARG A O   1 
ATOM   1842  C CB  . ARG A  1 237 ? -3.060  -22.931 97.881  1.00 44.92  ? 236  ARG A CB  1 
ATOM   1843  C CG  . ARG A  1 237 ? -3.495  -22.575 96.481  1.00 51.01  ? 236  ARG A CG  1 
ATOM   1844  C CD  . ARG A  1 237 ? -3.856  -23.813 95.672  1.00 44.57  ? 236  ARG A CD  1 
ATOM   1845  N NE  . ARG A  1 237 ? -4.229  -23.461 94.307  1.00 48.25  ? 236  ARG A NE  1 
ATOM   1846  C CZ  . ARG A  1 237 ? -3.360  -23.343 93.309  1.00 42.11  ? 236  ARG A CZ  1 
ATOM   1847  N NH1 . ARG A  1 237 ? -3.775  -23.014 92.096  1.00 36.89  ? 236  ARG A NH1 1 
ATOM   1848  N NH2 . ARG A  1 237 ? -2.072  -23.554 93.531  1.00 38.29  ? 236  ARG A NH2 1 
ATOM   1849  N N   . LYS A  1 238 ? -1.410  -22.288 100.688 1.00 43.81  ? 237  LYS A N   1 
ATOM   1850  C CA  . LYS A  1 238 ? -1.115  -22.726 102.051 1.00 42.45  ? 237  LYS A CA  1 
ATOM   1851  C C   . LYS A  1 238 ? -1.057  -21.583 103.061 1.00 51.30  ? 237  LYS A C   1 
ATOM   1852  O O   . LYS A  1 238 ? -0.892  -21.832 104.255 1.00 55.18  ? 237  LYS A O   1 
ATOM   1853  C CB  . LYS A  1 238 ? 0.224   -23.467 102.082 1.00 54.05  ? 237  LYS A CB  1 
ATOM   1854  C CG  . LYS A  1 238 ? 0.217   -24.792 101.341 1.00 64.06  ? 237  LYS A CG  1 
ATOM   1855  C CD  . LYS A  1 238 ? -0.628  -25.825 102.073 1.00 69.99  ? 237  LYS A CD  1 
ATOM   1856  C CE  . LYS A  1 238 ? -0.004  -26.210 103.403 1.00 75.81  ? 237  LYS A CE  1 
ATOM   1857  N NZ  . LYS A  1 238 ? -0.828  -27.204 104.129 1.00 82.06  ? 237  LYS A NZ  1 
ATOM   1858  N N   . ALA A  1 239 ? -1.164  -20.337 102.603 1.00 40.94  ? 238  ALA A N   1 
ATOM   1859  C CA  . ALA A  1 239 ? -1.151  -19.206 103.528 1.00 37.45  ? 238  ALA A CA  1 
ATOM   1860  C C   . ALA A  1 239 ? -2.232  -19.401 104.579 1.00 42.24  ? 238  ALA A C   1 
ATOM   1861  O O   . ALA A  1 239 ? -3.341  -19.817 104.257 1.00 45.02  ? 238  ALA A O   1 
ATOM   1862  C CB  . ALA A  1 239 ? -1.373  -17.901 102.781 1.00 38.99  ? 238  ALA A CB  1 
ATOM   1863  N N   . SER A  1 240 ? -1.914  -19.104 105.836 1.00 51.27  ? 239  SER A N   1 
ATOM   1864  C CA  . SER A  1 240 ? -2.859  -19.337 106.930 1.00 58.99  ? 239  SER A CA  1 
ATOM   1865  C C   . SER A  1 240 ? -4.051  -18.379 106.861 1.00 56.77  ? 239  SER A C   1 
ATOM   1866  O O   . SER A  1 240 ? -5.188  -18.766 107.125 1.00 49.79  ? 239  SER A O   1 
ATOM   1867  C CB  . SER A  1 240 ? -2.156  -19.212 108.284 1.00 58.51  ? 239  SER A CB  1 
ATOM   1868  O OG  . SER A  1 240 ? -1.471  -17.977 108.385 1.00 83.68  ? 239  SER A OG  1 
ATOM   1869  N N   . LYS A  1 241 ? -3.786  -17.131 106.494 1.00 47.03  ? 240  LYS A N   1 
ATOM   1870  C CA  . LYS A  1 241 ? -4.837  -16.128 106.397 1.00 43.11  ? 240  LYS A CA  1 
ATOM   1871  C C   . LYS A  1 241 ? -5.250  -15.966 104.934 1.00 48.21  ? 240  LYS A C   1 
ATOM   1872  O O   . LYS A  1 241 ? -4.496  -15.427 104.124 1.00 51.10  ? 240  LYS A O   1 
ATOM   1873  C CB  . LYS A  1 241 ? -4.338  -14.801 106.972 1.00 41.23  ? 240  LYS A CB  1 
ATOM   1874  C CG  . LYS A  1 241 ? -5.340  -13.662 106.917 1.00 50.96  ? 240  LYS A CG  1 
ATOM   1875  C CD  . LYS A  1 241 ? -4.813  -12.436 107.671 1.00 66.46  ? 240  LYS A CD  1 
ATOM   1876  C CE  . LYS A  1 241 ? -5.489  -11.148 107.220 1.00 66.94  ? 240  LYS A CE  1 
ATOM   1877  N NZ  . LYS A  1 241 ? -6.963  -11.202 107.374 1.00 81.45  ? 240  LYS A NZ  1 
ATOM   1878  N N   . GLN A  1 242 ? -6.446  -16.437 104.598 1.00 41.72  ? 241  GLN A N   1 
ATOM   1879  C CA  . GLN A  1 242 ? -6.918  -16.440 103.212 1.00 45.07  ? 241  GLN A CA  1 
ATOM   1880  C C   . GLN A  1 242 ? -7.898  -15.294 102.925 1.00 39.89  ? 241  GLN A C   1 
ATOM   1881  O O   . GLN A  1 242 ? -8.719  -15.377 102.007 1.00 40.97  ? 241  GLN A O   1 
ATOM   1882  C CB  . GLN A  1 242 ? -7.574  -17.784 102.874 1.00 37.11  ? 241  GLN A CB  1 
ATOM   1883  C CG  . GLN A  1 242 ? -6.595  -18.947 102.742 1.00 40.66  ? 241  GLN A CG  1 
ATOM   1884  C CD  . GLN A  1 242 ? -5.770  -18.865 101.471 1.00 42.46  ? 241  GLN A CD  1 
ATOM   1885  O OE1 . GLN A  1 242 ? -6.259  -18.426 100.434 1.00 51.65  ? 241  GLN A OE1 1 
ATOM   1886  N NE2 . GLN A  1 242 ? -4.512  -19.277 101.547 1.00 39.86  ? 241  GLN A NE2 1 
ATOM   1887  N N   . GLN A  1 243 ? -7.809  -14.231 103.715 1.00 38.09  ? 242  GLN A N   1 
ATOM   1888  C CA  . GLN A  1 243 ? -8.502  -12.982 103.416 1.00 42.44  ? 242  GLN A CA  1 
ATOM   1889  C C   . GLN A  1 243 ? -7.461  -11.868 103.379 1.00 53.25  ? 242  GLN A C   1 
ATOM   1890  O O   . GLN A  1 243 ? -6.514  -11.871 104.163 1.00 52.02  ? 242  GLN A O   1 
ATOM   1891  C CB  . GLN A  1 243 ? -9.581  -12.677 104.453 1.00 41.48  ? 242  GLN A CB  1 
ATOM   1892  C CG  . GLN A  1 243 ? -10.767 -13.645 104.427 1.00 56.12  ? 242  GLN A CG  1 
ATOM   1893  C CD  . GLN A  1 243 ? -10.420 -15.029 104.975 1.00 86.91  ? 242  GLN A CD  1 
ATOM   1894  O OE1 . GLN A  1 243 ? -9.667  -15.159 105.949 1.00 70.55  ? 242  GLN A OE1 1 
ATOM   1895  N NE2 . GLN A  1 243 ? -10.967 -16.071 104.345 1.00 70.34  ? 242  GLN A NE2 1 
ATOM   1896  N N   . THR A  1 244 ? -7.628  -10.931 102.451 1.00 37.93  ? 243  THR A N   1 
ATOM   1897  C CA  . THR A  1 244 ? -6.664  -9.862  102.258 1.00 35.95  ? 243  THR A CA  1 
ATOM   1898  C C   . THR A  1 244 ? -7.406  -8.570  101.991 1.00 38.18  ? 243  THR A C   1 
ATOM   1899  O O   . THR A  1 244 ? -8.306  -8.542  101.163 1.00 40.28  ? 243  THR A O   1 
ATOM   1900  C CB  . THR A  1 244 ? -5.753  -10.135 101.027 1.00 47.61  ? 243  THR A CB  1 
ATOM   1901  O OG1 . THR A  1 244 ? -5.125  -11.416 101.145 1.00 45.78  ? 243  THR A OG1 1 
ATOM   1902  C CG2 . THR A  1 244 ? -4.682  -9.073  100.906 1.00 44.84  ? 243  THR A CG2 1 
ATOM   1903  N N   . ASN A  1 245 ? -7.035  -7.501  102.685 1.00 40.71  ? 244  ASN A N   1 
ATOM   1904  C CA  . ASN A  1 245 ? -7.564  -6.179  102.365 1.00 41.72  ? 244  ASN A CA  1 
ATOM   1905  C C   . ASN A  1 245 ? -6.699  -5.523  101.298 1.00 42.16  ? 244  ASN A C   1 
ATOM   1906  O O   . ASN A  1 245 ? -5.495  -5.775  101.219 1.00 37.34  ? 244  ASN A O   1 
ATOM   1907  C CB  . ASN A  1 245 ? -7.621  -5.292  103.610 1.00 39.03  ? 244  ASN A CB  1 
ATOM   1908  C CG  . ASN A  1 245 ? -8.705  -5.718  104.581 1.00 51.29  ? 244  ASN A CG  1 
ATOM   1909  O OD1 . ASN A  1 245 ? -9.745  -6.238  104.185 1.00 51.86  ? 244  ASN A OD1 1 
ATOM   1910  N ND2 . ASN A  1 245 ? -8.463  -5.500  105.862 1.00 60.85  ? 244  ASN A ND2 1 
ATOM   1911  N N   . ILE A  1 246 ? -7.313  -4.697  100.464 1.00 36.58  ? 245  ILE A N   1 
ATOM   1912  C CA  . ILE A  1 246 ? -6.555  -3.951  99.466  1.00 37.69  ? 245  ILE A CA  1 
ATOM   1913  C C   . ILE A  1 246 ? -7.158  -2.559  99.310  1.00 35.35  ? 245  ILE A C   1 
ATOM   1914  O O   . ILE A  1 246 ? -8.373  -2.405  99.286  1.00 39.36  ? 245  ILE A O   1 
ATOM   1915  C CB  . ILE A  1 246 ? -6.531  -4.685  98.109  1.00 36.49  ? 245  ILE A CB  1 
ATOM   1916  C CG1 . ILE A  1 246 ? -5.563  -3.998  97.152  1.00 41.97  ? 245  ILE A CG1 1 
ATOM   1917  C CG2 . ILE A  1 246 ? -7.920  -4.747  97.498  1.00 30.33  ? 245  ILE A CG2 1 
ATOM   1918  C CD1 . ILE A  1 246 ? -5.425  -4.716  95.821  1.00 46.54  ? 245  ILE A CD1 1 
ATOM   1919  N N   . ASP A  1 247 ? -6.301  -1.546  99.243  1.00 32.49  ? 246  ASP A N   1 
ATOM   1920  C CA  . ASP A  1 247 ? -6.740  -0.171  99.011  1.00 32.68  ? 246  ASP A CA  1 
ATOM   1921  C C   . ASP A  1 247 ? -6.541  0.249   97.559  1.00 37.08  ? 246  ASP A C   1 
ATOM   1922  O O   . ASP A  1 247 ? -5.497  -0.010  96.957  1.00 31.04  ? 246  ASP A O   1 
ATOM   1923  C CB  . ASP A  1 247 ? -5.965  0.789   99.903  1.00 34.58  ? 246  ASP A CB  1 
ATOM   1924  C CG  . ASP A  1 247 ? -6.349  0.657   101.366 1.00 66.13  ? 246  ASP A CG  1 
ATOM   1925  O OD1 . ASP A  1 247 ? -7.554  0.477   101.647 1.00 64.84  ? 246  ASP A OD1 1 
ATOM   1926  O OD2 . ASP A  1 247 ? -5.448  0.729   102.231 1.00 65.68  ? 246  ASP A OD2 1 
ATOM   1927  N N   . VAL A  1 248 ? -7.554  0.901   97.010  1.00 33.91  ? 247  VAL A N   1 
ATOM   1928  C CA  . VAL A  1 248 ? -7.488  1.457   95.679  1.00 30.77  ? 247  VAL A CA  1 
ATOM   1929  C C   . VAL A  1 248 ? -7.723  2.966   95.772  1.00 41.27  ? 247  VAL A C   1 
ATOM   1930  O O   . VAL A  1 248 ? -8.735  3.412   96.303  1.00 30.25  ? 247  VAL A O   1 
ATOM   1931  C CB  . VAL A  1 248 ? -8.543  0.820   94.757  1.00 34.57  ? 247  VAL A CB  1 
ATOM   1932  C CG1 . VAL A  1 248 ? -8.437  1.405   93.345  1.00 28.66  ? 247  VAL A CG1 1 
ATOM   1933  C CG2 . VAL A  1 248 ? -8.381  -0.699  94.734  1.00 25.29  ? 247  VAL A CG2 1 
ATOM   1934  N N   . ILE A  1 249 ? -6.781  3.748   95.261  1.00 33.67  ? 248  ILE A N   1 
ATOM   1935  C CA  . ILE A  1 249 ? -6.872  5.201   95.322  1.00 33.28  ? 248  ILE A CA  1 
ATOM   1936  C C   . ILE A  1 249 ? -6.910  5.810   93.917  1.00 35.92  ? 248  ILE A C   1 
ATOM   1937  O O   . ILE A  1 249 ? -6.041  5.545   93.092  1.00 30.55  ? 248  ILE A O   1 
ATOM   1938  C CB  . ILE A  1 249 ? -5.676  5.811   96.079  1.00 38.92  ? 248  ILE A CB  1 
ATOM   1939  C CG1 . ILE A  1 249 ? -5.543  5.201   97.478  1.00 40.71  ? 248  ILE A CG1 1 
ATOM   1940  C CG2 . ILE A  1 249 ? -5.825  7.323   96.176  1.00 39.70  ? 248  ILE A CG2 1 
ATOM   1941  C CD1 . ILE A  1 249 ? -4.797  3.876   97.506  1.00 55.63  ? 248  ILE A CD1 1 
ATOM   1942  N N   . TYR A  1 250 ? -7.932  6.618   93.655  1.00 31.97  ? 249  TYR A N   1 
ATOM   1943  C CA  . TYR A  1 250 ? -7.995  7.436   92.453  1.00 29.98  ? 249  TYR A CA  1 
ATOM   1944  C C   . TYR A  1 250 ? -7.633  8.866   92.841  1.00 41.42  ? 249  TYR A C   1 
ATOM   1945  O O   . TYR A  1 250 ? -8.057  9.361   93.886  1.00 34.41  ? 249  TYR A O   1 
ATOM   1946  C CB  . TYR A  1 250 ? -9.395  7.421   91.853  1.00 26.59  ? 249  TYR A CB  1 
ATOM   1947  C CG  . TYR A  1 250 ? -9.731  6.178   91.069  1.00 26.15  ? 249  TYR A CG  1 
ATOM   1948  C CD1 . TYR A  1 250 ? -10.517 6.250   89.929  1.00 31.11  ? 249  TYR A CD1 1 
ATOM   1949  C CD2 . TYR A  1 250 ? -9.274  4.925   91.471  1.00 43.34  ? 249  TYR A CD2 1 
ATOM   1950  C CE1 . TYR A  1 250 ? -10.831 5.119   89.202  1.00 31.65  ? 249  TYR A CE1 1 
ATOM   1951  C CE2 . TYR A  1 250 ? -9.584  3.784   90.749  1.00 29.69  ? 249  TYR A CE2 1 
ATOM   1952  C CZ  . TYR A  1 250 ? -10.364 3.889   89.617  1.00 31.28  ? 249  TYR A CZ  1 
ATOM   1953  O OH  . TYR A  1 250 ? -10.691 2.769   88.897  1.00 30.65  ? 249  TYR A OH  1 
ATOM   1954  N N   . GLU A  1 251 ? -6.868  9.540   91.994  1.00 29.68  ? 250  GLU A N   1 
ATOM   1955  C CA  . GLU A  1 251 ? -6.385  10.868  92.336  1.00 40.45  ? 250  GLU A CA  1 
ATOM   1956  C C   . GLU A  1 251 ? -6.409  11.813  91.130  1.00 35.95  ? 250  GLU A C   1 
ATOM   1957  O O   . GLU A  1 251 ? -6.141  11.400  90.002  1.00 36.59  ? 250  GLU A O   1 
ATOM   1958  C CB  . GLU A  1 251 ? -4.976  10.739  92.912  1.00 38.29  ? 250  GLU A CB  1 
ATOM   1959  C CG  . GLU A  1 251 ? -4.366  12.016  93.430  1.00 55.49  ? 250  GLU A CG  1 
ATOM   1960  C CD  . GLU A  1 251 ? -3.093  11.754  94.225  1.00 82.61  ? 250  GLU A CD  1 
ATOM   1961  O OE1 . GLU A  1 251 ? -3.101  10.831  95.071  1.00 75.10  ? 250  GLU A OE1 1 
ATOM   1962  O OE2 . GLU A  1 251 ? -2.084  12.460  93.998  1.00 90.61  ? 250  GLU A OE2 1 
ATOM   1963  N N   . ARG A  1 252 ? -6.773  13.066  91.380  1.00 31.18  ? 251  ARG A N   1 
ATOM   1964  C CA  . ARG A  1 252 ? -6.688  14.129  90.388  1.00 32.84  ? 251  ARG A CA  1 
ATOM   1965  C C   . ARG A  1 252 ? -5.799  15.242  90.926  1.00 37.88  ? 251  ARG A C   1 
ATOM   1966  O O   . ARG A  1 252 ? -6.058  15.789  91.988  1.00 36.36  ? 251  ARG A O   1 
ATOM   1967  C CB  . ARG A  1 252 ? -8.072  14.693  90.076  1.00 32.58  ? 251  ARG A CB  1 
ATOM   1968  C CG  . ARG A  1 252 ? -8.044  15.796  89.032  1.00 30.27  ? 251  ARG A CG  1 
ATOM   1969  C CD  . ARG A  1 252 ? -9.309  16.637  89.044  1.00 32.00  ? 251  ARG A CD  1 
ATOM   1970  N NE  . ARG A  1 252 ? -10.487 15.844  88.711  1.00 31.89  ? 251  ARG A NE  1 
ATOM   1971  C CZ  . ARG A  1 252 ? -11.348 15.366  89.602  1.00 37.50  ? 251  ARG A CZ  1 
ATOM   1972  N NH1 . ARG A  1 252 ? -12.393 14.648  89.202  1.00 30.80  ? 251  ARG A NH1 1 
ATOM   1973  N NH2 . ARG A  1 252 ? -11.172 15.615  90.891  1.00 29.49  ? 251  ARG A NH2 1 
ATOM   1974  N N   . VAL A  1 253 ? -4.737  15.566  90.204  1.00 38.79  ? 252  VAL A N   1 
ATOM   1975  C CA  . VAL A  1 253 ? -3.909  16.715  90.552  1.00 35.31  ? 252  VAL A CA  1 
ATOM   1976  C C   . VAL A  1 253 ? -4.259  17.863  89.621  1.00 36.37  ? 252  VAL A C   1 
ATOM   1977  O O   . VAL A  1 253 ? -4.257  17.698  88.405  1.00 35.86  ? 252  VAL A O   1 
ATOM   1978  C CB  . VAL A  1 253 ? -2.416  16.391  90.422  1.00 39.06  ? 252  VAL A CB  1 
ATOM   1979  C CG1 . VAL A  1 253 ? -1.579  17.621  90.749  1.00 37.92  ? 252  VAL A CG1 1 
ATOM   1980  C CG2 . VAL A  1 253 ? -2.052  15.229  91.331  1.00 34.05  ? 252  VAL A CG2 1 
ATOM   1981  N N   . ARG A  1 254 ? -4.571  19.019  90.192  1.00 33.89  ? 253  ARG A N   1 
ATOM   1982  C CA  . ARG A  1 254 ? -4.964  20.181  89.400  1.00 35.50  ? 253  ARG A CA  1 
ATOM   1983  C C   . ARG A  1 254 ? -3.935  21.302  89.489  1.00 36.72  ? 253  ARG A C   1 
ATOM   1984  O O   . ARG A  1 254 ? -3.423  21.613  90.558  1.00 30.94  ? 253  ARG A O   1 
ATOM   1985  C CB  . ARG A  1 254 ? -6.339  20.690  89.840  1.00 36.82  ? 253  ARG A CB  1 
ATOM   1986  C CG  . ARG A  1 254 ? -7.500  19.860  89.314  1.00 39.09  ? 253  ARG A CG  1 
ATOM   1987  C CD  . ARG A  1 254 ? -8.836  20.342  89.863  1.00 33.83  ? 253  ARG A CD  1 
ATOM   1988  N NE  . ARG A  1 254 ? -8.895  20.179  91.313  1.00 53.77  ? 253  ARG A NE  1 
ATOM   1989  C CZ  . ARG A  1 254 ? -9.593  20.960  92.134  1.00 76.23  ? 253  ARG A CZ  1 
ATOM   1990  N NH1 . ARG A  1 254 ? -9.576  20.726  93.441  1.00 53.57  ? 253  ARG A NH1 1 
ATOM   1991  N NH2 . ARG A  1 254 ? -10.304 21.976  91.658  1.00 67.06  ? 253  ARG A NH2 1 
ATOM   1992  N N   . ASP A  1 255 ? -3.623  21.885  88.337  1.00 38.54  ? 254  ASP A N   1 
ATOM   1993  C CA  . ASP A  1 255 ? -2.801  23.080  88.263  1.00 36.95  ? 254  ASP A CA  1 
ATOM   1994  C C   . ASP A  1 255 ? -3.694  24.301  88.271  1.00 37.19  ? 254  ASP A C   1 
ATOM   1995  O O   . ASP A  1 255 ? -4.900  24.185  88.073  1.00 31.27  ? 254  ASP A O   1 
ATOM   1996  C CB  . ASP A  1 255 ? -1.961  23.064  86.984  1.00 32.31  ? 254  ASP A CB  1 
ATOM   1997  C CG  . ASP A  1 255 ? -0.730  22.200  87.115  1.00 37.29  ? 254  ASP A CG  1 
ATOM   1998  O OD1 . ASP A  1 255 ? 0.178   22.328  86.290  1.00 31.56  ? 254  ASP A OD1 1 
ATOM   1999  O OD2 . ASP A  1 255 ? -0.657  21.392  88.057  1.00 32.85  ? 254  ASP A OD2 1 
ATOM   2000  N N   . ASP A  1 256 ? -3.082  25.464  88.481  1.00 28.97  ? 255  ASP A N   1 
ATOM   2001  C CA  . ASP A  1 256 ? -3.787  26.750  88.575  1.00 28.39  ? 255  ASP A CA  1 
ATOM   2002  C C   . ASP A  1 256 ? -3.267  27.643  87.450  1.00 39.45  ? 255  ASP A C   1 
ATOM   2003  O O   . ASP A  1 256 ? -2.137  28.115  87.500  1.00 36.16  ? 255  ASP A O   1 
ATOM   2004  C CB  . ASP A  1 256 ? -3.483  27.391  89.946  1.00 35.82  ? 255  ASP A CB  1 
ATOM   2005  C CG  . ASP A  1 256 ? -4.177  28.736  90.155  1.00 49.15  ? 255  ASP A CG  1 
ATOM   2006  O OD1 . ASP A  1 256 ? -3.842  29.419  91.151  1.00 45.00  ? 255  ASP A OD1 1 
ATOM   2007  O OD2 . ASP A  1 256 ? -5.048  29.118  89.342  1.00 43.26  ? 255  ASP A OD2 1 
ATOM   2008  N N   . TYR A  1 257 ? -4.071  27.835  86.413  1.00 39.31  ? 256  TYR A N   1 
ATOM   2009  C CA  . TYR A  1 257 ? -3.673  28.661  85.284  1.00 39.06  ? 256  TYR A CA  1 
ATOM   2010  C C   . TYR A  1 257 ? -4.381  29.998  85.390  1.00 34.26  ? 256  TYR A C   1 
ATOM   2011  O O   . TYR A  1 257 ? -5.599  30.050  85.459  1.00 32.85  ? 256  TYR A O   1 
ATOM   2012  C CB  . TYR A  1 257 ? -4.029  27.964  83.968  1.00 25.06  ? 256  TYR A CB  1 
ATOM   2013  C CG  . TYR A  1 257 ? -3.681  28.754  82.738  1.00 39.34  ? 256  TYR A CG  1 
ATOM   2014  C CD1 . TYR A  1 257 ? -4.652  29.475  82.053  1.00 35.91  ? 256  TYR A CD1 1 
ATOM   2015  C CD2 . TYR A  1 257 ? -2.377  28.780  82.254  1.00 37.97  ? 256  TYR A CD2 1 
ATOM   2016  C CE1 . TYR A  1 257 ? -4.328  30.208  80.911  1.00 36.06  ? 256  TYR A CE1 1 
ATOM   2017  C CE2 . TYR A  1 257 ? -2.046  29.511  81.115  1.00 39.92  ? 256  TYR A CE2 1 
ATOM   2018  C CZ  . TYR A  1 257 ? -3.021  30.219  80.455  1.00 39.50  ? 256  TYR A CZ  1 
ATOM   2019  O OH  . TYR A  1 257 ? -2.684  30.940  79.333  1.00 36.43  ? 256  TYR A OH  1 
ATOM   2020  N N   . GLN A  1 258 ? -3.616  31.082  85.386  1.00 44.63  ? 257  GLN A N   1 
ATOM   2021  C CA  . GLN A  1 258 ? -4.185  32.404  85.607  1.00 44.39  ? 257  GLN A CA  1 
ATOM   2022  C C   . GLN A  1 258 ? -3.876  33.377  84.473  1.00 45.48  ? 257  GLN A C   1 
ATOM   2023  O O   . GLN A  1 258 ? -2.756  33.422  83.960  1.00 46.68  ? 257  GLN A O   1 
ATOM   2024  C CB  . GLN A  1 258 ? -3.689  32.960  86.945  1.00 38.25  ? 257  GLN A CB  1 
ATOM   2025  C CG  . GLN A  1 258 ? -4.261  32.210  88.139  1.00 51.43  ? 257  GLN A CG  1 
ATOM   2026  C CD  . GLN A  1 258 ? -3.659  32.638  89.467  1.00 57.61  ? 257  GLN A CD  1 
ATOM   2027  O OE1 . GLN A  1 258 ? -4.377  32.900  90.432  1.00 71.58  ? 257  GLN A OE1 1 
ATOM   2028  N NE2 . GLN A  1 258 ? -2.339  32.689  89.528  1.00 71.30  ? 257  GLN A NE2 1 
ATOM   2029  N N   . LEU A  1 259 ? -4.890  34.144  84.080  1.00 35.87  ? 258  LEU A N   1 
ATOM   2030  C CA  . LEU A  1 259 ? -4.730  35.214  83.099  1.00 48.14  ? 258  LEU A CA  1 
ATOM   2031  C C   . LEU A  1 259 ? -4.718  36.589  83.781  1.00 43.64  ? 258  LEU A C   1 
ATOM   2032  O O   . LEU A  1 259 ? -5.528  36.853  84.672  1.00 35.12  ? 258  LEU A O   1 
ATOM   2033  C CB  . LEU A  1 259 ? -5.865  35.157  82.081  1.00 34.69  ? 258  LEU A CB  1 
ATOM   2034  C CG  . LEU A  1 259 ? -5.718  34.052  81.040  1.00 45.34  ? 258  LEU A CG  1 
ATOM   2035  C CD1 . LEU A  1 259 ? -6.972  33.942  80.179  1.00 32.99  ? 258  LEU A CD1 1 
ATOM   2036  C CD2 . LEU A  1 259 ? -4.490  34.325  80.192  1.00 31.52  ? 258  LEU A CD2 1 
ATOM   2037  N N   . HIS A  1 260 ? -3.796  37.460  83.376  1.00 40.90  ? 259  HIS A N   1 
ATOM   2038  C CA  . HIS A  1 260 ? -3.781  38.839  83.886  1.00 51.57  ? 259  HIS A CA  1 
ATOM   2039  C C   . HIS A  1 260 ? -3.793  39.811  82.723  1.00 51.93  ? 259  HIS A C   1 
ATOM   2040  O O   . HIS A  1 260 ? -2.979  39.694  81.803  1.00 46.52  ? 259  HIS A O   1 
ATOM   2041  C CB  . HIS A  1 260 ? -2.536  39.115  84.736  1.00 38.72  ? 259  HIS A CB  1 
ATOM   2042  C CG  . HIS A  1 260 ? -2.242  38.053  85.750  1.00 52.44  ? 259  HIS A CG  1 
ATOM   2043  N ND1 . HIS A  1 260 ? -1.827  36.785  85.401  1.00 61.41  ? 259  HIS A ND1 1 
ATOM   2044  C CD2 . HIS A  1 260 ? -2.292  38.076  87.103  1.00 52.60  ? 259  HIS A CD2 1 
ATOM   2045  C CE1 . HIS A  1 260 ? -1.638  36.070  86.497  1.00 66.27  ? 259  HIS A CE1 1 
ATOM   2046  N NE2 . HIS A  1 260 ? -1.913  36.830  87.542  1.00 68.49  ? 259  HIS A NE2 1 
ATOM   2047  N N   . TRP A  1 261 ? -4.715  40.767  82.747  1.00 36.19  ? 260  TRP A N   1 
ATOM   2048  C CA  . TRP A  1 261 ? -4.659  41.852  81.783  1.00 55.23  ? 260  TRP A CA  1 
ATOM   2049  C C   . TRP A  1 261 ? -3.541  42.789  82.199  1.00 29.34  ? 260  TRP A C   1 
ATOM   2050  O O   . TRP A  1 261 ? -3.629  43.462  83.212  1.00 43.08  ? 260  TRP A O   1 
ATOM   2051  C CB  . TRP A  1 261 ? -5.980  42.611  81.688  1.00 32.95  ? 260  TRP A CB  1 
ATOM   2052  C CG  . TRP A  1 261 ? -5.920  43.779  80.718  1.00 42.58  ? 260  TRP A CG  1 
ATOM   2053  C CD1 . TRP A  1 261 ? -5.972  45.119  81.034  1.00 38.85  ? 260  TRP A CD1 1 
ATOM   2054  C CD2 . TRP A  1 261 ? -5.803  43.715  79.286  1.00 41.04  ? 260  TRP A CD2 1 
ATOM   2055  N NE1 . TRP A  1 261 ? -5.895  45.878  79.889  1.00 43.12  ? 260  TRP A NE1 1 
ATOM   2056  C CE2 . TRP A  1 261 ? -5.786  45.047  78.806  1.00 42.99  ? 260  TRP A CE2 1 
ATOM   2057  C CE3 . TRP A  1 261 ? -5.706  42.666  78.365  1.00 46.70  ? 260  TRP A CE3 1 
ATOM   2058  C CZ2 . TRP A  1 261 ? -5.681  45.353  77.448  1.00 39.92  ? 260  TRP A CZ2 1 
ATOM   2059  C CZ3 . TRP A  1 261 ? -5.599  42.974  77.020  1.00 46.45  ? 260  TRP A CZ3 1 
ATOM   2060  C CH2 . TRP A  1 261 ? -5.589  44.310  76.575  1.00 48.42  ? 260  TRP A CH2 1 
ATOM   2061  N N   . THR A  1 262 ? -2.449  42.753  81.453  1.00 42.09  ? 261  THR A N   1 
ATOM   2062  C CA  . THR A  1 262 ? -1.438  43.771  81.585  1.00 64.48  ? 261  THR A CA  1 
ATOM   2063  C C   . THR A  1 262 ? -2.177  44.856  80.864  1.00 73.35  ? 261  THR A C   1 
ATOM   2064  O O   . THR A  1 262 ? -3.098  44.577  80.098  1.00 98.15  ? 261  THR A O   1 
ATOM   2065  C CB  . THR A  1 262 ? -0.113  43.432  80.851  1.00 49.72  ? 261  THR A CB  1 
ATOM   2066  O OG1 . THR A  1 262 ? -0.186  43.879  79.495  1.00 41.47  ? 261  THR A OG1 1 
ATOM   2067  C CG2 . THR A  1 262 ? 0.180   41.924  80.879  1.00 43.74  ? 261  THR A CG2 1 
ATOM   2068  N N   . SER A  1 263 ? -1.822  46.092  81.109  1.00 34.64  ? 262  SER A N   1 
ATOM   2069  C CA  . SER A  1 263 ? -2.490  47.179  80.405  1.00 53.44  ? 262  SER A CA  1 
ATOM   2070  C C   . SER A  1 263 ? -2.530  47.055  78.858  1.00 58.89  ? 262  SER A C   1 
ATOM   2071  O O   . SER A  1 263 ? -3.281  47.772  78.206  1.00 50.27  ? 262  SER A O   1 
ATOM   2072  C CB  . SER A  1 263 ? -1.786  48.464  80.773  1.00 26.52  ? 262  SER A CB  1 
ATOM   2073  O OG  . SER A  1 263 ? -0.417  48.363  80.419  1.00 49.04  ? 262  SER A OG  1 
ATOM   2074  N N   . THR A  1 264 ? -1.734  46.173  78.255  1.00 51.02  ? 263  THR A N   1 
ATOM   2075  C CA  . THR A  1 264 ? -1.697  46.101  76.786  1.00 41.28  ? 263  THR A CA  1 
ATOM   2076  C C   . THR A  1 264 ? -2.073  44.739  76.189  1.00 60.74  ? 263  THR A C   1 
ATOM   2077  O O   . THR A  1 264 ? -2.358  44.643  74.993  1.00 55.99  ? 263  THR A O   1 
ATOM   2078  C CB  . THR A  1 264 ? -0.297  46.464  76.224  1.00 46.61  ? 263  THR A CB  1 
ATOM   2079  O OG1 . THR A  1 264 ? 0.682   45.587  76.789  1.00 54.17  ? 263  THR A OG1 1 
ATOM   2080  C CG2 . THR A  1 264 ? 0.083   47.913  76.537  1.00 49.96  ? 263  THR A CG2 1 
ATOM   2081  N N   . ASN A  1 265 ? -2.050  43.686  76.999  1.00 52.09  ? 264  ASN A N   1 
ATOM   2082  C CA  . ASN A  1 265 ? -2.318  42.345  76.488  1.00 41.23  ? 264  ASN A CA  1 
ATOM   2083  C C   . ASN A  1 265 ? -2.488  41.339  77.616  1.00 49.63  ? 264  ASN A C   1 
ATOM   2084  O O   . ASN A  1 265 ? -2.277  41.662  78.784  1.00 40.90  ? 264  ASN A O   1 
ATOM   2085  C CB  . ASN A  1 265 ? -1.181  41.887  75.567  1.00 45.58  ? 264  ASN A CB  1 
ATOM   2086  C CG  . ASN A  1 265 ? 0.159   41.830  76.281  1.00 51.42  ? 264  ASN A CG  1 
ATOM   2087  O OD1 . ASN A  1 265 ? 0.973   42.744  76.169  1.00 56.13  ? 264  ASN A OD1 1 
ATOM   2088  N ND2 . ASN A  1 265 ? 0.391   40.754  77.028  1.00 45.43  ? 264  ASN A ND2 1 
ATOM   2089  N N   . TRP A  1 266 ? -2.853  40.111  77.266  1.00 48.83  ? 265  TRP A N   1 
ATOM   2090  C CA  . TRP A  1 266 ? -3.034  39.074  78.270  1.00 40.47  ? 265  TRP A CA  1 
ATOM   2091  C C   . TRP A  1 266 ? -1.706  38.363  78.553  1.00 36.50  ? 265  TRP A C   1 
ATOM   2092  O O   . TRP A  1 266 ? -0.933  38.077  77.642  1.00 39.93  ? 265  TRP A O   1 
ATOM   2093  C CB  . TRP A  1 266 ? -4.116  38.089  77.816  1.00 42.81  ? 265  TRP A CB  1 
ATOM   2094  C CG  . TRP A  1 266 ? -5.475  38.726  77.718  1.00 34.05  ? 265  TRP A CG  1 
ATOM   2095  C CD1 . TRP A  1 266 ? -6.110  39.125  76.581  1.00 34.05  ? 265  TRP A CD1 1 
ATOM   2096  C CD2 . TRP A  1 266 ? -6.365  39.036  78.804  1.00 35.06  ? 265  TRP A CD2 1 
ATOM   2097  N NE1 . TRP A  1 266 ? -7.338  39.660  76.886  1.00 34.82  ? 265  TRP A NE1 1 
ATOM   2098  C CE2 . TRP A  1 266 ? -7.515  39.631  78.244  1.00 34.49  ? 265  TRP A CE2 1 
ATOM   2099  C CE3 . TRP A  1 266 ? -6.293  38.876  80.191  1.00 36.38  ? 265  TRP A CE3 1 
ATOM   2100  C CZ2 . TRP A  1 266 ? -8.590  40.071  79.021  1.00 28.68  ? 265  TRP A CZ2 1 
ATOM   2101  C CZ3 . TRP A  1 266 ? -7.369  39.311  80.970  1.00 40.18  ? 265  TRP A CZ3 1 
ATOM   2102  C CH2 . TRP A  1 266 ? -8.502  39.898  80.379  1.00 37.91  ? 265  TRP A CH2 1 
ATOM   2103  N N   . LYS A  1 267 ? -1.429  38.127  79.827  1.00 37.02  ? 266  LYS A N   1 
ATOM   2104  C CA  . LYS A  1 267 ? -0.257  37.372  80.239  1.00 47.22  ? 266  LYS A CA  1 
ATOM   2105  C C   . LYS A  1 267 ? -0.726  36.206  81.119  1.00 47.86  ? 266  LYS A C   1 
ATOM   2106  O O   . LYS A  1 267 ? -1.546  36.385  82.017  1.00 40.40  ? 266  LYS A O   1 
ATOM   2107  C CB  . LYS A  1 267 ? 0.719   38.271  80.995  1.00 29.06  ? 266  LYS A CB  1 
ATOM   2108  C CG  . LYS A  1 267 ? 2.092   37.662  81.203  1.00 52.38  ? 266  LYS A CG  1 
ATOM   2109  C CD  . LYS A  1 267 ? 3.067   38.667  81.782  1.00 45.07  ? 266  LYS A CD  1 
ATOM   2110  C CE  . LYS A  1 267 ? 4.472   38.112  81.823  1.00 55.32  ? 266  LYS A CE  1 
ATOM   2111  N NZ  . LYS A  1 267 ? 5.438   39.089  82.374  1.00 60.47  ? 266  LYS A NZ  1 
ATOM   2112  N N   . GLY A  1 268 ? -0.217  35.009  80.852  1.00 50.40  ? 267  GLY A N   1 
ATOM   2113  C CA  . GLY A  1 268 ? -0.638  33.825  81.584  1.00 39.19  ? 267  GLY A CA  1 
ATOM   2114  C C   . GLY A  1 268 ? 0.449   33.255  82.473  1.00 37.14  ? 267  GLY A C   1 
ATOM   2115  O O   . GLY A  1 268 ? 1.633   33.362  82.165  1.00 38.63  ? 267  GLY A O   1 
ATOM   2116  N N   . THR A  1 269 ? 0.046   32.663  83.593  1.00 38.75  ? 268  THR A N   1 
ATOM   2117  C CA  . THR A  1 269 ? 0.977   31.963  84.463  1.00 46.26  ? 268  THR A CA  1 
ATOM   2118  C C   . THR A  1 269 ? 0.361   30.638  84.889  1.00 49.37  ? 268  THR A C   1 
ATOM   2119  O O   . THR A  1 269 ? -0.859  30.494  84.954  1.00 42.08  ? 268  THR A O   1 
ATOM   2120  C CB  . THR A  1 269 ? 1.330   32.781  85.717  1.00 41.95  ? 268  THR A CB  1 
ATOM   2121  O OG1 . THR A  1 269 ? 0.141   33.038  86.469  1.00 58.53  ? 268  THR A OG1 1 
ATOM   2122  C CG2 . THR A  1 269 ? 1.981   34.097  85.333  1.00 47.09  ? 268  THR A CG2 1 
ATOM   2123  N N   . ASN A  1 270 ? 1.208   29.665  85.184  1.00 44.14  ? 269  ASN A N   1 
ATOM   2124  C CA  . ASN A  1 270 ? 0.722   28.379  85.637  1.00 40.36  ? 269  ASN A CA  1 
ATOM   2125  C C   . ASN A  1 270 ? 1.459   27.909  86.872  1.00 37.45  ? 269  ASN A C   1 
ATOM   2126  O O   . ASN A  1 270 ? 2.687   27.799  86.873  1.00 38.37  ? 269  ASN A O   1 
ATOM   2127  C CB  . ASN A  1 270 ? 0.858   27.340  84.520  1.00 40.71  ? 269  ASN A CB  1 
ATOM   2128  C CG  . ASN A  1 270 ? 0.255   25.993  84.902  1.00 47.08  ? 269  ASN A CG  1 
ATOM   2129  O OD1 . ASN A  1 270 ? -0.966  25.815  84.879  1.00 34.88  ? 269  ASN A OD1 1 
ATOM   2130  N ND2 . ASN A  1 270 ? 1.111   25.042  85.256  1.00 28.79  ? 269  ASN A ND2 1 
ATOM   2131  N N   . THR A  1 271 ? 0.698   27.628  87.924  1.00 36.69  ? 270  THR A N   1 
ATOM   2132  C CA  . THR A  1 271 ? 1.252   27.083  89.151  1.00 47.03  ? 270  THR A CA  1 
ATOM   2133  C C   . THR A  1 271 ? 0.990   25.574  89.196  1.00 46.56  ? 270  THR A C   1 
ATOM   2134  O O   . THR A  1 271 ? -0.150  25.124  89.063  1.00 37.33  ? 270  THR A O   1 
ATOM   2135  C CB  . THR A  1 271 ? 0.619   27.748  90.371  1.00 44.40  ? 270  THR A CB  1 
ATOM   2136  O OG1 . THR A  1 271 ? 0.719   29.168  90.234  1.00 57.46  ? 270  THR A OG1 1 
ATOM   2137  C CG2 . THR A  1 271 ? 1.314   27.297  91.651  1.00 46.36  ? 270  THR A CG2 1 
ATOM   2138  N N   . LYS A  1 272 ? 2.052   24.804  89.390  1.00 37.75  ? 271  LYS A N   1 
ATOM   2139  C CA  . LYS A  1 272 ? 1.963   23.351  89.373  1.00 43.44  ? 271  LYS A CA  1 
ATOM   2140  C C   . LYS A  1 272 ? 1.443   22.759  90.680  1.00 40.58  ? 271  LYS A C   1 
ATOM   2141  O O   . LYS A  1 272 ? 1.760   23.249  91.760  1.00 50.57  ? 271  LYS A O   1 
ATOM   2142  C CB  . LYS A  1 272 ? 3.337   22.759  89.083  1.00 36.38  ? 271  LYS A CB  1 
ATOM   2143  C CG  . LYS A  1 272 ? 3.898   23.126  87.737  1.00 33.82  ? 271  LYS A CG  1 
ATOM   2144  C CD  . LYS A  1 272 ? 5.272   22.507  87.574  1.00 50.06  ? 271  LYS A CD  1 
ATOM   2145  C CE  . LYS A  1 272 ? 5.919   22.875  86.265  1.00 46.45  ? 271  LYS A CE  1 
ATOM   2146  N NZ  . LYS A  1 272 ? 7.238   22.196  86.125  1.00 73.14  ? 271  LYS A NZ  1 
ATOM   2147  N N   . ASP A  1 273 ? 0.647   21.701  90.556  1.00 44.31  ? 272  ASP A N   1 
ATOM   2148  C CA  . ASP A  1 273 ? 0.213   20.889  91.693  1.00 45.13  ? 272  ASP A CA  1 
ATOM   2149  C C   . ASP A  1 273 ? -0.379  21.717  92.822  1.00 43.14  ? 272  ASP A C   1 
ATOM   2150  O O   . ASP A  1 273 ? -0.015  21.541  93.982  1.00 51.16  ? 272  ASP A O   1 
ATOM   2151  C CB  . ASP A  1 273 ? 1.390   20.063  92.222  1.00 43.25  ? 272  ASP A CB  1 
ATOM   2152  C CG  . ASP A  1 273 ? 2.123   19.315  91.114  1.00 58.25  ? 272  ASP A CG  1 
ATOM   2153  O OD1 . ASP A  1 273 ? 1.536   19.132  90.028  1.00 54.27  ? 272  ASP A OD1 1 
ATOM   2154  O OD2 . ASP A  1 273 ? 3.283   18.904  91.328  1.00 65.29  ? 272  ASP A OD2 1 
ATOM   2155  N N   . LYS A  1 274 ? -1.296  22.611  92.473  1.00 45.96  ? 273  LYS A N   1 
ATOM   2156  C CA  . LYS A  1 274 ? -1.948  23.476  93.439  1.00 48.81  ? 273  LYS A CA  1 
ATOM   2157  C C   . LYS A  1 274 ? -2.885  22.668  94.338  1.00 44.27  ? 273  LYS A C   1 
ATOM   2158  O O   . LYS A  1 274 ? -2.773  22.710  95.559  1.00 52.82  ? 273  LYS A O   1 
ATOM   2159  C CB  . LYS A  1 274 ? -2.733  24.568  92.706  1.00 48.76  ? 273  LYS A CB  1 
ATOM   2160  C CG  . LYS A  1 274 ? -3.368  25.610  93.611  1.00 58.90  ? 273  LYS A CG  1 
ATOM   2161  C CD  . LYS A  1 274 ? -2.406  26.733  93.916  1.00 59.43  ? 273  LYS A CD  1 
ATOM   2162  C CE  . LYS A  1 274 ? -3.115  27.890  94.598  1.00 72.86  ? 273  LYS A CE  1 
ATOM   2163  N NZ  . LYS A  1 274 ? -2.231  29.082  94.747  1.00 83.30  ? 273  LYS A NZ  1 
ATOM   2164  N N   . TRP A  1 275 ? -3.809  21.936  93.727  1.00 44.70  ? 274  TRP A N   1 
ATOM   2165  C CA  . TRP A  1 275 ? -4.772  21.135  94.477  1.00 40.08  ? 274  TRP A CA  1 
ATOM   2166  C C   . TRP A  1 275 ? -4.648  19.648  94.158  1.00 50.35  ? 274  TRP A C   1 
ATOM   2167  O O   . TRP A  1 275 ? -4.169  19.262  93.090  1.00 52.92  ? 274  TRP A O   1 
ATOM   2168  C CB  . TRP A  1 275 ? -6.191  21.598  94.162  1.00 39.72  ? 274  TRP A CB  1 
ATOM   2169  C CG  . TRP A  1 275 ? -6.406  23.050  94.407  1.00 61.07  ? 274  TRP A CG  1 
ATOM   2170  C CD1 . TRP A  1 275 ? -6.645  23.647  95.603  1.00 53.84  ? 274  TRP A CD1 1 
ATOM   2171  C CD2 . TRP A  1 275 ? -6.404  24.098  93.428  1.00 61.85  ? 274  TRP A CD2 1 
ATOM   2172  N NE1 . TRP A  1 275 ? -6.790  25.000  95.435  1.00 51.17  ? 274  TRP A NE1 1 
ATOM   2173  C CE2 . TRP A  1 275 ? -6.653  25.304  94.110  1.00 53.42  ? 274  TRP A CE2 1 
ATOM   2174  C CE3 . TRP A  1 275 ? -6.217  24.134  92.041  1.00 48.57  ? 274  TRP A CE3 1 
ATOM   2175  C CZ2 . TRP A  1 275 ? -6.716  26.535  93.458  1.00 51.86  ? 274  TRP A CZ2 1 
ATOM   2176  C CZ3 . TRP A  1 275 ? -6.285  25.357  91.392  1.00 49.38  ? 274  TRP A CZ3 1 
ATOM   2177  C CH2 . TRP A  1 275 ? -6.531  26.541  92.103  1.00 55.84  ? 274  TRP A CH2 1 
ATOM   2178  N N   . THR A  1 276 ? -5.087  18.819  95.096  1.00 50.64  ? 275  THR A N   1 
ATOM   2179  C CA  . THR A  1 276 ? -5.112  17.377  94.901  1.00 39.95  ? 275  THR A CA  1 
ATOM   2180  C C   . THR A  1 276 ? -6.415  16.813  95.443  1.00 44.66  ? 275  THR A C   1 
ATOM   2181  O O   . THR A  1 276 ? -6.796  17.092  96.581  1.00 44.80  ? 275  THR A O   1 
ATOM   2182  C CB  . THR A  1 276 ? -3.929  16.688  95.606  1.00 50.24  ? 275  THR A CB  1 
ATOM   2183  O OG1 . THR A  1 276 ? -2.701  17.091  94.986  1.00 47.72  ? 275  THR A OG1 1 
ATOM   2184  C CG2 . THR A  1 276 ? -4.057  15.172  95.513  1.00 46.57  ? 275  THR A CG2 1 
ATOM   2185  N N   . ASP A  1 277 ? -7.096  16.025  94.617  1.00 37.14  ? 276  ASP A N   1 
ATOM   2186  C CA  . ASP A  1 277 ? -8.319  15.348  95.024  1.00 39.63  ? 276  ASP A CA  1 
ATOM   2187  C C   . ASP A  1 277 ? -8.037  13.853  95.113  1.00 45.25  ? 276  ASP A C   1 
ATOM   2188  O O   . ASP A  1 277 ? -7.553  13.245  94.162  1.00 42.26  ? 276  ASP A O   1 
ATOM   2189  C CB  . ASP A  1 277 ? -9.436  15.632  94.020  1.00 37.96  ? 276  ASP A CB  1 
ATOM   2190  C CG  . ASP A  1 277 ? -9.619  17.118  93.757  1.00 63.98  ? 276  ASP A CG  1 
ATOM   2191  O OD1 . ASP A  1 277 ? -9.492  17.905  94.718  1.00 58.62  ? 276  ASP A OD1 1 
ATOM   2192  O OD2 . ASP A  1 277 ? -9.877  17.503  92.594  1.00 51.40  ? 276  ASP A OD2 1 
ATOM   2193  N N   . ARG A  1 278 ? -8.348  13.261  96.255  1.00 42.86  ? 277  ARG A N   1 
ATOM   2194  C CA  . ARG A  1 278 ? -7.972  11.880  96.524  1.00 47.06  ? 277  ARG A CA  1 
ATOM   2195  C C   . ARG A  1 278 ? -9.189  11.096  96.989  1.00 48.39  ? 277  ARG A C   1 
ATOM   2196  O O   . ARG A  1 278 ? -9.865  11.500  97.927  1.00 49.44  ? 277  ARG A O   1 
ATOM   2197  C CB  . ARG A  1 278 ? -6.886  11.852  97.593  1.00 50.52  ? 277  ARG A CB  1 
ATOM   2198  C CG  . ARG A  1 278 ? -5.888  10.746  97.453  1.00 66.45  ? 277  ARG A CG  1 
ATOM   2199  C CD  . ARG A  1 278 ? -4.655  11.020  98.300  1.00 76.46  ? 277  ARG A CD  1 
ATOM   2200  N NE  . ARG A  1 278 ? -3.592  10.052  98.040  1.00 89.98  ? 277  ARG A NE  1 
ATOM   2201  C CZ  . ARG A  1 278 ? -3.455  8.896   98.682  1.00 91.12  ? 277  ARG A CZ  1 
ATOM   2202  N NH1 . ARG A  1 278 ? -2.456  8.083   98.371  1.00 89.03  ? 277  ARG A NH1 1 
ATOM   2203  N NH2 . ARG A  1 278 ? -4.311  8.551   99.639  1.00 100.27 ? 277  ARG A NH2 1 
ATOM   2204  N N   . SER A  1 279 ? -9.471  9.985   96.318  1.00 36.75  ? 278  SER A N   1 
ATOM   2205  C CA  . SER A  1 279 ? -10.625 9.156   96.645  1.00 33.91  ? 278  SER A CA  1 
ATOM   2206  C C   . SER A  1 279 ? -10.169 7.716   96.871  1.00 41.58  ? 278  SER A C   1 
ATOM   2207  O O   . SER A  1 279 ? -9.562  7.102   95.994  1.00 46.60  ? 278  SER A O   1 
ATOM   2208  C CB  . SER A  1 279 ? -11.653 9.222   95.517  1.00 36.87  ? 278  SER A CB  1 
ATOM   2209  O OG  . SER A  1 279 ? -12.875 8.609   95.886  1.00 42.47  ? 278  SER A OG  1 
ATOM   2210  N N   . SER A  1 280 ? -10.453 7.182   98.051  1.00 45.07  ? 279  SER A N   1 
ATOM   2211  C CA  . SER A  1 280 ? -9.972  5.852   98.426  1.00 50.54  ? 279  SER A CA  1 
ATOM   2212  C C   . SER A  1 280 ? -11.108 4.886   98.706  1.00 43.24  ? 279  SER A C   1 
ATOM   2213  O O   . SER A  1 280 ? -12.157 5.282   99.194  1.00 44.13  ? 279  SER A O   1 
ATOM   2214  C CB  . SER A  1 280 ? -9.085  5.936   99.674  1.00 47.05  ? 279  SER A CB  1 
ATOM   2215  O OG  . SER A  1 280 ? -7.949  6.749   99.432  1.00 85.71  ? 279  SER A OG  1 
ATOM   2216  N N   . GLU A  1 281 ? -10.881 3.615   98.389  1.00 40.03  ? 280  GLU A N   1 
ATOM   2217  C CA  . GLU A  1 281 ? -11.779 2.542   98.780  1.00 41.98  ? 280  GLU A CA  1 
ATOM   2218  C C   . GLU A  1 281 ? -10.935 1.418   99.343  1.00 42.66  ? 280  GLU A C   1 
ATOM   2219  O O   . GLU A  1 281 ? -9.794  1.229   98.936  1.00 39.90  ? 280  GLU A O   1 
ATOM   2220  C CB  . GLU A  1 281 ? -12.584 2.023   97.591  1.00 42.94  ? 280  GLU A CB  1 
ATOM   2221  C CG  . GLU A  1 281 ? -13.399 3.077   96.880  1.00 54.21  ? 280  GLU A CG  1 
ATOM   2222  C CD  . GLU A  1 281 ? -14.545 3.618   97.720  1.00 75.88  ? 280  GLU A CD  1 
ATOM   2223  O OE1 . GLU A  1 281 ? -14.973 4.764   97.459  1.00 75.35  ? 280  GLU A OE1 1 
ATOM   2224  O OE2 . GLU A  1 281 ? -15.022 2.904   98.632  1.00 57.21  ? 280  GLU A OE2 1 
ATOM   2225  N N   . ARG A  1 282 ? -11.492 0.684   100.292 1.00 38.89  ? 281  ARG A N   1 
ATOM   2226  C CA  . ARG A  1 282 ? -10.841 -0.511  100.792 1.00 44.72  ? 281  ARG A CA  1 
ATOM   2227  C C   . ARG A  1 282 ? -11.720 -1.699  100.455 1.00 31.75  ? 281  ARG A C   1 
ATOM   2228  O O   . ARG A  1 282 ? -12.932 -1.686  100.686 1.00 34.33  ? 281  ARG A O   1 
ATOM   2229  C CB  . ARG A  1 282 ? -10.605 -0.416  102.300 1.00 42.03  ? 281  ARG A CB  1 
ATOM   2230  C CG  . ARG A  1 282 ? -10.046 -1.699  102.890 1.00 56.33  ? 281  ARG A CG  1 
ATOM   2231  C CD  . ARG A  1 282 ? -9.462  -1.490  104.273 1.00 63.46  ? 281  ARG A CD  1 
ATOM   2232  N NE  . ARG A  1 282 ? -8.286  -0.626  104.231 1.00 73.92  ? 281  ARG A NE  1 
ATOM   2233  C CZ  . ARG A  1 282 ? -7.484  -0.397  105.266 1.00 89.82  ? 281  ARG A CZ  1 
ATOM   2234  N NH1 . ARG A  1 282 ? -6.436  0.405   105.129 1.00 80.00  ? 281  ARG A NH1 1 
ATOM   2235  N NH2 . ARG A  1 282 ? -7.729  -0.971  106.436 1.00 89.28  ? 281  ARG A NH2 1 
ATOM   2236  N N   . TYR A  1 283 ? -11.117 -2.724  99.890  1.00 27.19  ? 282  TYR A N   1 
ATOM   2237  C CA  . TYR A  1 283 ? -11.867 -3.916  99.523  1.00 36.23  ? 282  TYR A CA  1 
ATOM   2238  C C   . TYR A  1 283 ? -11.362 -5.110  100.299 1.00 38.91  ? 282  TYR A C   1 
ATOM   2239  O O   . TYR A  1 283 ? -10.204 -5.140  100.724 1.00 37.17  ? 282  TYR A O   1 
ATOM   2240  C CB  . TYR A  1 283 ? -11.730 -4.193  98.026  1.00 35.85  ? 282  TYR A CB  1 
ATOM   2241  C CG  . TYR A  1 283 ? -12.239 -3.075  97.140  1.00 36.70  ? 282  TYR A CG  1 
ATOM   2242  C CD1 . TYR A  1 283 ? -11.382 -2.073  96.690  1.00 32.75  ? 282  TYR A CD1 1 
ATOM   2243  C CD2 . TYR A  1 283 ? -13.570 -3.022  96.751  1.00 34.12  ? 282  TYR A CD2 1 
ATOM   2244  C CE1 . TYR A  1 283 ? -11.839 -1.053  95.880  1.00 34.22  ? 282  TYR A CE1 1 
ATOM   2245  C CE2 . TYR A  1 283 ? -14.036 -2.004  95.947  1.00 36.47  ? 282  TYR A CE2 1 
ATOM   2246  C CZ  . TYR A  1 283 ? -13.163 -1.021  95.510  1.00 37.85  ? 282  TYR A CZ  1 
ATOM   2247  O OH  . TYR A  1 283 ? -13.619 -0.005  94.699  1.00 41.46  ? 282  TYR A OH  1 
ATOM   2248  N N   . LYS A  1 284 ? -12.234 -6.099  100.462 1.00 30.85  ? 283  LYS A N   1 
ATOM   2249  C CA  . LYS A  1 284 ? -11.852 -7.363  101.058 1.00 33.13  ? 283  LYS A CA  1 
ATOM   2250  C C   . LYS A  1 284 ? -11.781 -8.408  99.956  1.00 34.73  ? 283  LYS A C   1 
ATOM   2251  O O   . LYS A  1 284 ? -12.737 -8.616  99.216  1.00 30.77  ? 283  LYS A O   1 
ATOM   2252  C CB  . LYS A  1 284 ? -12.873 -7.785  102.122 1.00 40.70  ? 283  LYS A CB  1 
ATOM   2253  C CG  . LYS A  1 284 ? -12.571 -9.125  102.788 1.00 47.99  ? 283  LYS A CG  1 
ATOM   2254  C CD  . LYS A  1 284 ? -13.669 -9.504  103.779 1.00 55.33  ? 283  LYS A CD  1 
ATOM   2255  C CE  . LYS A  1 284 ? -13.398 -10.849 104.432 1.00 77.62  ? 283  LYS A CE  1 
ATOM   2256  N NZ  . LYS A  1 284 ? -14.481 -11.239 105.381 1.00 82.15  ? 283  LYS A NZ  1 
ATOM   2257  N N   . ILE A  1 285 ? -10.625 -9.042  99.840  1.00 29.82  ? 284  ILE A N   1 
ATOM   2258  C CA  . ILE A  1 285 ? -10.444 -10.169 98.952  1.00 35.51  ? 284  ILE A CA  1 
ATOM   2259  C C   . ILE A  1 285 ? -10.585 -11.451 99.751  1.00 36.18  ? 284  ILE A C   1 
ATOM   2260  O O   . ILE A  1 285 ? -9.774  -11.730 100.628 1.00 37.57  ? 284  ILE A O   1 
ATOM   2261  C CB  . ILE A  1 285 ? -9.044  -10.157 98.328  1.00 39.02  ? 284  ILE A CB  1 
ATOM   2262  C CG1 . ILE A  1 285 ? -8.831  -8.871  97.530  1.00 33.86  ? 284  ILE A CG1 1 
ATOM   2263  C CG2 . ILE A  1 285 ? -8.844  -11.381 97.452  1.00 31.58  ? 284  ILE A CG2 1 
ATOM   2264  C CD1 . ILE A  1 285 ? -7.382  -8.649  97.125  1.00 32.45  ? 284  ILE A CD1 1 
ATOM   2265  N N   . ASP A  1 286 ? -11.628 -12.216 99.466  1.00 37.54  ? 285  ASP A N   1 
ATOM   2266  C CA  . ASP A  1 286 ? -11.809 -13.519 100.099 1.00 38.34  ? 285  ASP A CA  1 
ATOM   2267  C C   . ASP A  1 286 ? -11.350 -14.602 99.128  1.00 33.30  ? 285  ASP A C   1 
ATOM   2268  O O   . ASP A  1 286 ? -12.087 -14.958 98.212  1.00 36.53  ? 285  ASP A O   1 
ATOM   2269  C CB  . ASP A  1 286 ? -13.275 -13.740 100.454 1.00 37.96  ? 285  ASP A CB  1 
ATOM   2270  C CG  . ASP A  1 286 ? -13.487 -14.968 101.326 1.00 62.83  ? 285  ASP A CG  1 
ATOM   2271  O OD1 . ASP A  1 286 ? -12.621 -15.871 101.312 1.00 50.72  ? 285  ASP A OD1 1 
ATOM   2272  O OD2 . ASP A  1 286 ? -14.519 -15.025 102.032 1.00 74.14  ? 285  ASP A OD2 1 
ATOM   2273  N N   . TRP A  1 287 ? -10.138 -15.112 99.333  1.00 33.23  ? 286  TRP A N   1 
ATOM   2274  C CA  . TRP A  1 287 ? -9.539  -16.087 98.425  1.00 34.38  ? 286  TRP A CA  1 
ATOM   2275  C C   . TRP A  1 287 ? -10.228 -17.443 98.451  1.00 43.52  ? 286  TRP A C   1 
ATOM   2276  O O   . TRP A  1 287 ? -10.107 -18.209 97.498  1.00 38.28  ? 286  TRP A O   1 
ATOM   2277  C CB  . TRP A  1 287 ? -8.063  -16.290 98.758  1.00 29.96  ? 286  TRP A CB  1 
ATOM   2278  C CG  . TRP A  1 287 ? -7.221  -15.084 98.536  1.00 33.23  ? 286  TRP A CG  1 
ATOM   2279  C CD1 . TRP A  1 287 ? -6.851  -14.168 99.467  1.00 29.14  ? 286  TRP A CD1 1 
ATOM   2280  C CD2 . TRP A  1 287 ? -6.621  -14.667 97.300  1.00 35.28  ? 286  TRP A CD2 1 
ATOM   2281  N NE1 . TRP A  1 287 ? -6.057  -13.199 98.892  1.00 38.02  ? 286  TRP A NE1 1 
ATOM   2282  C CE2 . TRP A  1 287 ? -5.905  -13.480 97.562  1.00 32.67  ? 286  TRP A CE2 1 
ATOM   2283  C CE3 . TRP A  1 287 ? -6.625  -15.180 95.999  1.00 30.57  ? 286  TRP A CE3 1 
ATOM   2284  C CZ2 . TRP A  1 287 ? -5.203  -12.793 96.576  1.00 37.11  ? 286  TRP A CZ2 1 
ATOM   2285  C CZ3 . TRP A  1 287 ? -5.917  -14.499 95.013  1.00 24.79  ? 286  TRP A CZ3 1 
ATOM   2286  C CH2 . TRP A  1 287 ? -5.215  -13.320 95.311  1.00 35.09  ? 286  TRP A CH2 1 
ATOM   2287  N N   . GLU A  1 288 ? -10.936 -17.747 99.535  1.00 36.64  ? 287  GLU A N   1 
ATOM   2288  C CA  . GLU A  1 288 ? -11.594 -19.046 99.669  1.00 43.57  ? 287  GLU A CA  1 
ATOM   2289  C C   . GLU A  1 288 ? -12.959 -19.052 98.978  1.00 38.67  ? 287  GLU A C   1 
ATOM   2290  O O   . GLU A  1 288 ? -13.296 -20.004 98.279  1.00 46.44  ? 287  GLU A O   1 
ATOM   2291  C CB  . GLU A  1 288 ? -11.719 -19.444 101.152 1.00 48.78  ? 287  GLU A CB  1 
ATOM   2292  C CG  . GLU A  1 288 ? -10.385 -19.861 101.770 1.00 49.51  ? 287  GLU A CG  1 
ATOM   2293  C CD  . GLU A  1 288 ? -10.402 -19.899 103.295 1.00 76.95  ? 287  GLU A CD  1 
ATOM   2294  O OE1 . GLU A  1 288 ? -11.188 -19.141 103.914 1.00 61.19  ? 287  GLU A OE1 1 
ATOM   2295  O OE2 . GLU A  1 288 ? -9.615  -20.692 103.871 1.00 70.39  ? 287  GLU A OE2 1 
ATOM   2296  N N   . LYS A  1 289 ? -13.735 -17.987 99.158  1.00 39.37  ? 288  LYS A N   1 
ATOM   2297  C CA  . LYS A  1 289 ? -15.012 -17.859 98.468  1.00 35.97  ? 288  LYS A CA  1 
ATOM   2298  C C   . LYS A  1 289 ? -14.824 -17.310 97.062  1.00 45.23  ? 288  LYS A C   1 
ATOM   2299  O O   . LYS A  1 289 ? -15.745 -17.341 96.242  1.00 39.79  ? 288  LYS A O   1 
ATOM   2300  C CB  . LYS A  1 289 ? -15.959 -16.946 99.243  1.00 50.96  ? 288  LYS A CB  1 
ATOM   2301  C CG  . LYS A  1 289 ? -16.356 -17.490 100.599 1.00 75.03  ? 288  LYS A CG  1 
ATOM   2302  C CD  . LYS A  1 289 ? -17.244 -16.521 101.365 1.00 84.38  ? 288  LYS A CD  1 
ATOM   2303  C CE  . LYS A  1 289 ? -18.553 -16.272 100.637 1.00 95.87  ? 288  LYS A CE  1 
ATOM   2304  N NZ  . LYS A  1 289 ? -19.436 -15.333 101.391 1.00 101.24 ? 288  LYS A NZ  1 
ATOM   2305  N N   . GLU A  1 290 ? -13.616 -16.833 96.778  1.00 47.15  ? 289  GLU A N   1 
ATOM   2306  C CA  . GLU A  1 290 ? -13.322 -16.173 95.509  1.00 42.92  ? 289  GLU A CA  1 
ATOM   2307  C C   . GLU A  1 290 ? -14.326 -15.057 95.241  1.00 44.33  ? 289  GLU A C   1 
ATOM   2308  O O   . GLU A  1 290 ? -15.019 -15.048 94.222  1.00 36.11  ? 289  GLU A O   1 
ATOM   2309  C CB  . GLU A  1 290 ? -13.296 -17.175 94.358  1.00 34.28  ? 289  GLU A CB  1 
ATOM   2310  C CG  . GLU A  1 290 ? -12.126 -18.148 94.457  1.00 44.25  ? 289  GLU A CG  1 
ATOM   2311  C CD  . GLU A  1 290 ? -12.041 -19.108 93.275  1.00 62.76  ? 289  GLU A CD  1 
ATOM   2312  O OE1 . GLU A  1 290 ? -13.038 -19.249 92.531  1.00 71.48  ? 289  GLU A OE1 1 
ATOM   2313  O OE2 . GLU A  1 290 ? -10.967 -19.720 93.090  1.00 76.40  ? 289  GLU A OE2 1 
ATOM   2314  N N   . GLU A  1 291 ? -14.406 -14.121 96.178  1.00 34.05  ? 290  GLU A N   1 
ATOM   2315  C CA  . GLU A  1 291 ? -15.201 -12.923 95.970  1.00 38.21  ? 290  GLU A CA  1 
ATOM   2316  C C   . GLU A  1 291 ? -14.472 -11.708 96.530  1.00 41.56  ? 290  GLU A C   1 
ATOM   2317  O O   . GLU A  1 291 ? -13.560 -11.804 97.356  1.00 32.30  ? 290  GLU A O   1 
ATOM   2318  C CB  . GLU A  1 291 ? -16.594 -13.059 96.592  1.00 49.11  ? 290  GLU A CB  1 
ATOM   2319  C CG  . GLU A  1 291 ? -16.603 -13.107 98.103  1.00 67.01  ? 290  GLU A CG  1 
ATOM   2320  C CD  . GLU A  1 291 ? -17.992 -13.375 98.670  1.00 92.83  ? 290  GLU A CD  1 
ATOM   2321  O OE1 . GLU A  1 291 ? -18.765 -14.131 98.037  1.00 85.58  ? 290  GLU A OE1 1 
ATOM   2322  O OE2 . GLU A  1 291 ? -18.312 -12.826 99.747  1.00 85.36  ? 290  GLU A OE2 1 
ATOM   2323  N N   . MET A  1 292 ? -14.877 -10.552 96.043  1.00 34.16  ? 291  MET A N   1 
ATOM   2324  C CA  . MET A  1 292 ? -14.279 -9.300  96.454  1.00 40.11  ? 291  MET A CA  1 
ATOM   2325  C C   . MET A  1 292 ? -15.431 -8.367  96.805  1.00 39.40  ? 291  MET A C   1 
ATOM   2326  O O   . MET A  1 292 ? -16.422 -8.298  96.084  1.00 42.00  ? 291  MET A O   1 
ATOM   2327  C CB  . MET A  1 292 ? -13.451 -8.754  95.294  1.00 40.33  ? 291  MET A CB  1 
ATOM   2328  C CG  . MET A  1 292 ? -12.452 -7.716  95.673  1.00 51.61  ? 291  MET A CG  1 
ATOM   2329  S SD  . MET A  1 292 ? -11.374 -7.318  94.279  1.00 40.53  ? 291  MET A SD  1 
ATOM   2330  C CE  . MET A  1 292 ? -10.486 -5.949  95.002  1.00 37.39  ? 291  MET A CE  1 
ATOM   2331  N N   . THR A  1 293 ? -15.330 -7.685  97.933  1.00 31.56  ? 292  THR A N   1 
ATOM   2332  C CA  . THR A  1 293 ? -16.407 -6.812  98.378  1.00 45.39  ? 292  THR A CA  1 
ATOM   2333  C C   . THR A  1 293 ? -15.854 -5.495  98.917  1.00 41.41  ? 292  THR A C   1 
ATOM   2334  O O   . THR A  1 293 ? -14.719 -5.420  99.398  1.00 43.59  ? 292  THR A O   1 
ATOM   2335  C CB  . THR A  1 293 ? -17.243 -7.476  99.485  1.00 46.36  ? 292  THR A CB  1 
ATOM   2336  O OG1 . THR A  1 293 ? -16.377 -7.890  100.549 1.00 45.33  ? 292  THR A OG1 1 
ATOM   2337  C CG2 . THR A  1 293 ? -18.002 -8.684  98.954  1.00 42.69  ? 292  THR A CG2 1 
ATOM   2338  N N   . ASN A  1 294 ? -16.655 -4.447  98.818  1.00 40.28  ? 293  ASN A N   1 
ATOM   2339  C CA  . ASN A  1 294 ? -16.267 -3.161  99.373  1.00 43.62  ? 293  ASN A CA  1 
ATOM   2340  C C   . ASN A  1 294 ? -16.538 -3.155  100.878 1.00 52.76  ? 293  ASN A C   1 
ATOM   2341  O O   . ASN A  1 294 ? -17.649 -3.458  101.310 1.00 49.49  ? 293  ASN A O   1 
ATOM   2342  C CB  . ASN A  1 294 ? -17.041 -2.046  98.676  1.00 42.05  ? 293  ASN A CB  1 
ATOM   2343  C CG  . ASN A  1 294 ? -16.456 -0.669  98.942  1.00 66.16  ? 293  ASN A CG  1 
ATOM   2344  O OD1 . ASN A  1 294 ? -15.901 -0.411  100.013 1.00 51.58  ? 293  ASN A OD1 1 
ATOM   2345  N ND2 . ASN A  1 294 ? -16.577 0.228   97.961  1.00 55.97  ? 293  ASN A ND2 1 
ATOM   2346  N N   . LEU A  1 295 ? -15.517 -2.862  101.680 1.00 41.19  ? 294  LEU A N   1 
ATOM   2347  C CA  . LEU A  1 295 ? -15.708 -2.766  103.125 1.00 54.79  ? 294  LEU A CA  1 
ATOM   2348  C C   . LEU A  1 295 ? -16.689 -1.643  103.484 1.00 63.28  ? 294  LEU A C   1 
ATOM   2349  O O   . LEU A  1 295 ? -17.716 -1.896  104.111 1.00 86.71  ? 294  LEU A O   1 
ATOM   2350  C CB  . LEU A  1 295 ? -14.374 -2.578  103.853 1.00 44.08  ? 294  LEU A CB  1 
ATOM   2351  C CG  . LEU A  1 295 ? -13.495 -3.829  103.917 1.00 57.13  ? 294  LEU A CG  1 
ATOM   2352  C CD1 . LEU A  1 295 ? -12.344 -3.596  104.870 1.00 61.30  ? 294  LEU A CD1 1 
ATOM   2353  C CD2 . LEU A  1 295 ? -14.303 -5.054  104.352 1.00 50.60  ? 294  LEU A CD2 1 
ATOM   2354  N N   . GLU A  1 296 ? -16.391 -0.412  103.082 1.00 70.83  ? 295  GLU A N   1 
ATOM   2355  C CA  . GLU A  1 296 ? -17.275 0.708   103.401 1.00 93.77  ? 295  GLU A CA  1 
ATOM   2356  C C   . GLU A  1 296 ? -18.673 0.458   102.840 1.00 101.43 ? 295  GLU A C   1 
ATOM   2357  O O   . GLU A  1 296 ? -19.609 1.206   103.122 1.00 119.55 ? 295  GLU A O   1 
ATOM   2358  C CB  . GLU A  1 296 ? -16.718 2.019   102.848 1.00 95.90  ? 295  GLU A CB  1 
ATOM   2359  C CG  . GLU A  1 296 ? -15.304 2.342   103.311 1.00 121.45 ? 295  GLU A CG  1 
ATOM   2360  C CD  . GLU A  1 296 ? -14.346 2.564   102.148 1.00 116.86 ? 295  GLU A CD  1 
ATOM   2361  O OE1 . GLU A  1 296 ? -13.829 3.698   102.011 1.00 109.53 ? 295  GLU A OE1 1 
ATOM   2362  O OE2 . GLU A  1 296 ? -14.112 1.604   101.373 1.00 64.83  ? 295  GLU A OE2 1 
ATOM   2363  N N   . ALA B  1 2   ? 8.546   -20.065 58.270  1.00 56.31  ? 1    ALA B N   1 
ATOM   2364  C CA  . ALA B  1 2   ? 7.326   -20.704 58.847  1.00 75.47  ? 1    ALA B CA  1 
ATOM   2365  C C   . ALA B  1 2   ? 7.010   -22.032 58.154  1.00 64.88  ? 1    ALA B C   1 
ATOM   2366  O O   . ALA B  1 2   ? 7.419   -22.258 57.014  1.00 64.04  ? 1    ALA B O   1 
ATOM   2367  C CB  . ALA B  1 2   ? 6.144   -19.758 58.730  1.00 65.42  ? 1    ALA B CB  1 
ATOM   2368  N N   . ASP B  1 3   ? 6.274   -22.899 58.845  1.00 62.67  ? 2    ASP B N   1 
ATOM   2369  C CA  . ASP B  1 3   ? 5.945   -24.221 58.316  1.00 67.56  ? 2    ASP B CA  1 
ATOM   2370  C C   . ASP B  1 3   ? 5.278   -24.102 56.952  1.00 58.42  ? 2    ASP B C   1 
ATOM   2371  O O   . ASP B  1 3   ? 5.535   -24.903 56.059  1.00 54.28  ? 2    ASP B O   1 
ATOM   2372  C CB  . ASP B  1 3   ? 5.027   -24.988 59.274  1.00 66.81  ? 2    ASP B CB  1 
ATOM   2373  C CG  . ASP B  1 3   ? 5.698   -25.319 60.599  1.00 93.19  ? 2    ASP B CG  1 
ATOM   2374  O OD1 . ASP B  1 3   ? 6.539   -24.515 61.058  1.00 102.07 ? 2    ASP B OD1 1 
ATOM   2375  O OD2 . ASP B  1 3   ? 5.375   -26.382 61.187  1.00 76.34  ? 2    ASP B OD2 1 
ATOM   2376  N N   . SER B  1 4   ? 4.430   -23.091 56.793  1.00 44.98  ? 3    SER B N   1 
ATOM   2377  C CA  . SER B  1 4   ? 3.727   -22.873 55.531  1.00 54.04  ? 3    SER B CA  1 
ATOM   2378  C C   . SER B  1 4   ? 4.682   -22.627 54.352  1.00 52.16  ? 3    SER B C   1 
ATOM   2379  O O   . SER B  1 4   ? 4.385   -23.006 53.221  1.00 59.52  ? 3    SER B O   1 
ATOM   2380  C CB  . SER B  1 4   ? 2.758   -21.699 55.674  1.00 56.32  ? 3    SER B CB  1 
ATOM   2381  O OG  . SER B  1 4   ? 3.434   -20.540 56.126  1.00 67.61  ? 3    SER B OG  1 
ATOM   2382  N N   . ASP B  1 5   ? 5.824   -21.998 54.615  1.00 43.88  ? 4    ASP B N   1 
ATOM   2383  C CA  . ASP B  1 5   ? 6.813   -21.741 53.561  1.00 52.87  ? 4    ASP B CA  1 
ATOM   2384  C C   . ASP B  1 5   ? 7.484   -23.020 53.058  1.00 55.52  ? 4    ASP B C   1 
ATOM   2385  O O   . ASP B  1 5   ? 8.074   -23.031 51.980  1.00 46.42  ? 4    ASP B O   1 
ATOM   2386  C CB  . ASP B  1 5   ? 7.886   -20.775 54.059  1.00 52.10  ? 4    ASP B CB  1 
ATOM   2387  C CG  . ASP B  1 5   ? 7.313   -19.432 54.459  1.00 66.45  ? 4    ASP B CG  1 
ATOM   2388  O OD1 . ASP B  1 5   ? 6.944   -18.662 53.543  1.00 63.94  ? 4    ASP B OD1 1 
ATOM   2389  O OD2 . ASP B  1 5   ? 7.234   -19.152 55.677  1.00 56.82  ? 4    ASP B OD2 1 
ATOM   2390  N N   . ILE B  1 6   ? 7.399   -24.091 53.843  1.00 34.29  ? 5    ILE B N   1 
ATOM   2391  C CA  . ILE B  1 6   ? 7.968   -25.369 53.436  1.00 39.28  ? 5    ILE B CA  1 
ATOM   2392  C C   . ILE B  1 6   ? 6.878   -26.435 53.331  1.00 40.97  ? 5    ILE B C   1 
ATOM   2393  O O   . ILE B  1 6   ? 7.121   -27.610 53.575  1.00 47.21  ? 5    ILE B O   1 
ATOM   2394  C CB  . ILE B  1 6   ? 9.091   -25.821 54.392  1.00 40.98  ? 5    ILE B CB  1 
ATOM   2395  C CG1 . ILE B  1 6   ? 8.586   -25.851 55.837  1.00 42.51  ? 5    ILE B CG1 1 
ATOM   2396  C CG2 . ILE B  1 6   ? 10.289  -24.880 54.274  1.00 40.12  ? 5    ILE B CG2 1 
ATOM   2397  C CD1 . ILE B  1 6   ? 9.622   -26.286 56.849  1.00 37.18  ? 5    ILE B CD1 1 
ATOM   2398  N N   . ASN B  1 7   ? 5.674   -26.002 52.965  1.00 40.17  ? 6    ASN B N   1 
ATOM   2399  C CA  . ASN B  1 7   ? 4.573   -26.902 52.630  1.00 43.03  ? 6    ASN B CA  1 
ATOM   2400  C C   . ASN B  1 7   ? 4.154   -27.831 53.775  1.00 45.19  ? 6    ASN B C   1 
ATOM   2401  O O   . ASN B  1 7   ? 3.717   -28.954 53.550  1.00 42.85  ? 6    ASN B O   1 
ATOM   2402  C CB  . ASN B  1 7   ? 4.937   -27.729 51.393  1.00 38.64  ? 6    ASN B CB  1 
ATOM   2403  C CG  . ASN B  1 7   ? 5.286   -26.858 50.193  1.00 58.99  ? 6    ASN B CG  1 
ATOM   2404  O OD1 . ASN B  1 7   ? 6.424   -26.852 49.718  1.00 40.46  ? 6    ASN B OD1 1 
ATOM   2405  N ND2 . ASN B  1 7   ? 4.309   -26.107 49.707  1.00 49.24  ? 6    ASN B ND2 1 
ATOM   2406  N N   . ILE B  1 8   ? 4.284   -27.358 55.003  1.00 42.25  ? 7    ILE B N   1 
ATOM   2407  C CA  . ILE B  1 8   ? 3.900   -28.154 56.162  1.00 43.06  ? 7    ILE B CA  1 
ATOM   2408  C C   . ILE B  1 8   ? 2.794   -27.434 56.928  1.00 44.42  ? 7    ILE B C   1 
ATOM   2409  O O   . ILE B  1 8   ? 2.853   -26.217 57.120  1.00 36.45  ? 7    ILE B O   1 
ATOM   2410  C CB  . ILE B  1 8   ? 5.110   -28.405 57.081  1.00 45.82  ? 7    ILE B CB  1 
ATOM   2411  C CG1 . ILE B  1 8   ? 6.132   -29.299 56.371  1.00 42.28  ? 7    ILE B CG1 1 
ATOM   2412  C CG2 . ILE B  1 8   ? 4.682   -29.063 58.387  1.00 39.30  ? 7    ILE B CG2 1 
ATOM   2413  C CD1 . ILE B  1 8   ? 7.446   -29.416 57.118  1.00 47.70  ? 7    ILE B CD1 1 
ATOM   2414  N N   . LYS B  1 9   ? 1.777   -28.186 57.339  1.00 44.60  ? 8    LYS B N   1 
ATOM   2415  C CA  . LYS B  1 9   ? 0.684   -27.645 58.144  1.00 46.92  ? 8    LYS B CA  1 
ATOM   2416  C C   . LYS B  1 9   ? 1.218   -26.800 59.300  1.00 41.38  ? 8    LYS B C   1 
ATOM   2417  O O   . LYS B  1 9   ? 2.105   -27.222 60.041  1.00 42.87  ? 8    LYS B O   1 
ATOM   2418  C CB  . LYS B  1 9   ? -0.175  -28.782 58.704  1.00 47.05  ? 8    LYS B CB  1 
ATOM   2419  C CG  . LYS B  1 9   ? -1.613  -28.780 58.216  1.00 71.65  ? 8    LYS B CG  1 
ATOM   2420  C CD  . LYS B  1 9   ? -1.836  -29.825 57.137  1.00 79.37  ? 8    LYS B CD  1 
ATOM   2421  C CE  . LYS B  1 9   ? -3.302  -29.909 56.730  1.00 83.31  ? 8    LYS B CE  1 
ATOM   2422  N NZ  . LYS B  1 9   ? -3.553  -30.989 55.730  1.00 70.44  ? 8    LYS B NZ  1 
ATOM   2423  N N   . THR B  1 10  ? 0.674   -25.603 59.458  1.00 40.15  ? 9    THR B N   1 
ATOM   2424  C CA  . THR B  1 10  ? 1.115   -24.703 60.519  1.00 41.70  ? 9    THR B CA  1 
ATOM   2425  C C   . THR B  1 10  ? 1.012   -25.365 61.898  1.00 56.77  ? 9    THR B C   1 
ATOM   2426  O O   . THR B  1 10  ? 0.016   -26.020 62.216  1.00 47.30  ? 9    THR B O   1 
ATOM   2427  C CB  . THR B  1 10  ? 0.292   -23.404 60.517  1.00 55.36  ? 9    THR B CB  1 
ATOM   2428  O OG1 . THR B  1 10  ? 0.399   -22.774 59.231  1.00 71.93  ? 9    THR B OG1 1 
ATOM   2429  C CG2 . THR B  1 10  ? 0.793   -22.448 61.597  1.00 48.84  ? 9    THR B CG2 1 
ATOM   2430  N N   . GLY B  1 11  ? 2.051   -25.195 62.712  1.00 50.18  ? 10   GLY B N   1 
ATOM   2431  C CA  . GLY B  1 11  ? 2.062   -25.729 64.062  1.00 37.70  ? 10   GLY B CA  1 
ATOM   2432  C C   . GLY B  1 11  ? 2.518   -27.176 64.186  1.00 52.31  ? 10   GLY B C   1 
ATOM   2433  O O   . GLY B  1 11  ? 2.732   -27.659 65.289  1.00 59.08  ? 10   GLY B O   1 
ATOM   2434  N N   . THR B  1 12  ? 2.679   -27.860 63.057  1.00 49.26  ? 11   THR B N   1 
ATOM   2435  C CA  . THR B  1 12  ? 3.023   -29.278 63.042  1.00 53.17  ? 11   THR B CA  1 
ATOM   2436  C C   . THR B  1 12  ? 4.316   -29.599 63.792  1.00 49.32  ? 11   THR B C   1 
ATOM   2437  O O   . THR B  1 12  ? 4.411   -30.626 64.457  1.00 48.90  ? 11   THR B O   1 
ATOM   2438  C CB  . THR B  1 12  ? 3.162   -29.802 61.592  1.00 46.94  ? 11   THR B CB  1 
ATOM   2439  O OG1 . THR B  1 12  ? 1.891   -29.749 60.933  1.00 57.58  ? 11   THR B OG1 1 
ATOM   2440  C CG2 . THR B  1 12  ? 3.666   -31.238 61.580  1.00 49.62  ? 11   THR B CG2 1 
ATOM   2441  N N   . THR B  1 13  ? 5.312   -28.732 63.683  1.00 42.66  ? 12   THR B N   1 
ATOM   2442  C CA  . THR B  1 13  ? 6.619   -29.020 64.272  1.00 48.47  ? 12   THR B CA  1 
ATOM   2443  C C   . THR B  1 13  ? 6.829   -28.387 65.655  1.00 54.43  ? 12   THR B C   1 
ATOM   2444  O O   . THR B  1 13  ? 7.912   -28.505 66.224  1.00 60.01  ? 12   THR B O   1 
ATOM   2445  C CB  . THR B  1 13  ? 7.754   -28.541 63.357  1.00 45.75  ? 12   THR B CB  1 
ATOM   2446  O OG1 . THR B  1 13  ? 7.713   -27.110 63.247  1.00 51.78  ? 12   THR B OG1 1 
ATOM   2447  C CG2 . THR B  1 13  ? 7.628   -29.175 61.977  1.00 42.36  ? 12   THR B CG2 1 
ATOM   2448  N N   . ASP B  1 14  ? 5.808   -27.726 66.198  1.00 35.85  ? 13   ASP B N   1 
ATOM   2449  C CA  . ASP B  1 14  ? 5.924   -27.083 67.505  1.00 59.07  ? 13   ASP B CA  1 
ATOM   2450  C C   . ASP B  1 14  ? 5.787   -28.086 68.652  1.00 47.59  ? 13   ASP B C   1 
ATOM   2451  O O   . ASP B  1 14  ? 5.163   -29.132 68.502  1.00 47.04  ? 13   ASP B O   1 
ATOM   2452  C CB  . ASP B  1 14  ? 4.867   -25.979 67.652  1.00 56.81  ? 13   ASP B CB  1 
ATOM   2453  C CG  . ASP B  1 14  ? 5.120   -24.803 66.724  1.00 80.03  ? 13   ASP B CG  1 
ATOM   2454  O OD1 . ASP B  1 14  ? 6.215   -24.758 66.119  1.00 70.69  ? 13   ASP B OD1 1 
ATOM   2455  O OD2 . ASP B  1 14  ? 4.235   -23.921 66.610  1.00 81.88  ? 13   ASP B OD2 1 
ATOM   2456  N N   . ILE B  1 15  ? 6.373   -27.748 69.798  1.00 49.02  ? 14   ILE B N   1 
ATOM   2457  C CA  . ILE B  1 15  ? 6.331   -28.593 70.987  1.00 52.39  ? 14   ILE B CA  1 
ATOM   2458  C C   . ILE B  1 15  ? 5.083   -28.276 71.796  1.00 47.92  ? 14   ILE B C   1 
ATOM   2459  O O   . ILE B  1 15  ? 4.601   -27.146 71.762  1.00 43.01  ? 14   ILE B O   1 
ATOM   2460  C CB  . ILE B  1 15  ? 7.542   -28.317 71.890  1.00 57.32  ? 14   ILE B CB  1 
ATOM   2461  C CG1 . ILE B  1 15  ? 8.836   -28.752 71.205  1.00 64.26  ? 14   ILE B CG1 1 
ATOM   2462  C CG2 . ILE B  1 15  ? 7.400   -29.031 73.219  1.00 47.85  ? 14   ILE B CG2 1 
ATOM   2463  C CD1 . ILE B  1 15  ? 10.087  -28.302 71.950  1.00 64.16  ? 14   ILE B CD1 1 
ATOM   2464  N N   . GLY B  1 16  ? 4.555   -29.267 72.513  1.00 54.71  ? 15   GLY B N   1 
ATOM   2465  C CA  . GLY B  1 16  ? 3.516   -29.015 73.502  1.00 57.61  ? 15   GLY B CA  1 
ATOM   2466  C C   . GLY B  1 16  ? 2.175   -29.684 73.258  1.00 65.93  ? 15   GLY B C   1 
ATOM   2467  O O   . GLY B  1 16  ? 1.270   -29.591 74.086  1.00 67.85  ? 15   GLY B O   1 
ATOM   2468  N N   . SER B  1 17  ? 2.031   -30.359 72.127  1.00 74.26  ? 16   SER B N   1 
ATOM   2469  C CA  . SER B  1 17  ? 0.770   -31.015 71.814  1.00 80.47  ? 16   SER B CA  1 
ATOM   2470  C C   . SER B  1 17  ? 0.438   -32.056 72.887  1.00 77.66  ? 16   SER B C   1 
ATOM   2471  O O   . SER B  1 17  ? 1.305   -32.829 73.302  1.00 67.07  ? 16   SER B O   1 
ATOM   2472  C CB  . SER B  1 17  ? 0.846   -31.671 70.434  1.00 91.26  ? 16   SER B CB  1 
ATOM   2473  O OG  . SER B  1 17  ? -0.422  -32.135 70.014  1.00 101.10 ? 16   SER B OG  1 
ATOM   2474  N N   . ASN B  1 18  ? -0.814  -32.050 73.342  1.00 64.64  ? 17   ASN B N   1 
ATOM   2475  C CA  . ASN B  1 18  ? -1.324  -33.047 74.288  1.00 78.82  ? 17   ASN B CA  1 
ATOM   2476  C C   . ASN B  1 18  ? -0.427  -33.253 75.519  1.00 78.99  ? 17   ASN B C   1 
ATOM   2477  O O   . ASN B  1 18  ? 0.036   -34.366 75.791  1.00 73.52  ? 17   ASN B O   1 
ATOM   2478  C CB  . ASN B  1 18  ? -1.569  -34.384 73.570  1.00 60.26  ? 17   ASN B CB  1 
ATOM   2479  C CG  . ASN B  1 18  ? -2.468  -35.315 74.369  1.00 98.19  ? 17   ASN B CG  1 
ATOM   2480  O OD1 . ASN B  1 18  ? -3.689  -35.141 74.403  1.00 99.89  ? 17   ASN B OD1 1 
ATOM   2481  N ND2 . ASN B  1 18  ? -1.868  -36.305 75.024  1.00 90.50  ? 17   ASN B ND2 1 
ATOM   2482  N N   . THR B  1 19  ? -0.210  -32.178 76.271  1.00 68.90  ? 18   THR B N   1 
ATOM   2483  C CA  . THR B  1 19  ? 0.692   -32.198 77.418  1.00 63.38  ? 18   THR B CA  1 
ATOM   2484  C C   . THR B  1 19  ? 0.133   -31.325 78.535  1.00 59.42  ? 18   THR B C   1 
ATOM   2485  O O   . THR B  1 19  ? -0.240  -30.180 78.293  1.00 56.61  ? 18   THR B O   1 
ATOM   2486  C CB  . THR B  1 19  ? 2.084   -31.616 77.051  1.00 76.38  ? 18   THR B CB  1 
ATOM   2487  O OG1 . THR B  1 19  ? 2.542   -32.164 75.806  1.00 60.59  ? 18   THR B OG1 1 
ATOM   2488  C CG2 . THR B  1 19  ? 3.103   -31.896 78.163  1.00 49.67  ? 18   THR B CG2 1 
ATOM   2489  N N   . THR B  1 20  ? 0.075   -31.852 79.754  1.00 59.76  ? 19   THR B N   1 
ATOM   2490  C CA  . THR B  1 20  ? -0.275  -31.020 80.895  1.00 54.54  ? 19   THR B CA  1 
ATOM   2491  C C   . THR B  1 20  ? 0.947   -30.179 81.249  1.00 44.66  ? 19   THR B C   1 
ATOM   2492  O O   . THR B  1 20  ? 2.042   -30.708 81.416  1.00 54.96  ? 19   THR B O   1 
ATOM   2493  C CB  . THR B  1 20  ? -0.727  -31.855 82.116  1.00 41.84  ? 19   THR B CB  1 
ATOM   2494  O OG1 . THR B  1 20  ? -1.909  -32.590 81.783  1.00 56.97  ? 19   THR B OG1 1 
ATOM   2495  C CG2 . THR B  1 20  ? -1.029  -30.947 83.299  1.00 38.56  ? 19   THR B CG2 1 
ATOM   2496  N N   . VAL B  1 21  ? 0.757   -28.870 81.356  1.00 41.41  ? 20   VAL B N   1 
ATOM   2497  C CA  . VAL B  1 21  ? 1.852   -27.959 81.640  1.00 24.10  ? 20   VAL B CA  1 
ATOM   2498  C C   . VAL B  1 21  ? 1.724   -27.405 83.050  1.00 31.21  ? 20   VAL B C   1 
ATOM   2499  O O   . VAL B  1 21  ? 0.668   -26.912 83.438  1.00 41.49  ? 20   VAL B O   1 
ATOM   2500  C CB  . VAL B  1 21  ? 1.847   -26.806 80.634  1.00 34.29  ? 20   VAL B CB  1 
ATOM   2501  C CG1 . VAL B  1 21  ? 2.904   -25.762 80.991  1.00 29.20  ? 20   VAL B CG1 1 
ATOM   2502  C CG2 . VAL B  1 21  ? 2.074   -27.350 79.234  1.00 32.36  ? 20   VAL B CG2 1 
ATOM   2503  N N   . LYS B  1 22  ? 2.803   -27.495 83.818  1.00 31.68  ? 21   LYS B N   1 
ATOM   2504  C CA  . LYS B  1 22  ? 2.839   -26.946 85.173  1.00 39.08  ? 21   LYS B CA  1 
ATOM   2505  C C   . LYS B  1 22  ? 3.523   -25.590 85.162  1.00 41.15  ? 21   LYS B C   1 
ATOM   2506  O O   . LYS B  1 22  ? 4.615   -25.458 84.611  1.00 34.79  ? 21   LYS B O   1 
ATOM   2507  C CB  . LYS B  1 22  ? 3.615   -27.878 86.101  1.00 41.39  ? 21   LYS B CB  1 
ATOM   2508  C CG  . LYS B  1 22  ? 3.019   -29.252 86.241  1.00 42.31  ? 21   LYS B CG  1 
ATOM   2509  C CD  . LYS B  1 22  ? 1.709   -29.199 86.995  1.00 59.98  ? 21   LYS B CD  1 
ATOM   2510  C CE  . LYS B  1 22  ? 1.207   -30.602 87.304  1.00 71.32  ? 21   LYS B CE  1 
ATOM   2511  N NZ  . LYS B  1 22  ? 0.007   -30.572 88.176  1.00 85.30  ? 21   LYS B NZ  1 
ATOM   2512  N N   . THR B  1 23  ? 2.894   -24.590 85.778  1.00 29.68  ? 22   THR B N   1 
ATOM   2513  C CA  . THR B  1 23  ? 3.408   -23.226 85.732  1.00 32.32  ? 22   THR B CA  1 
ATOM   2514  C C   . THR B  1 23  ? 3.464   -22.645 87.133  1.00 32.78  ? 22   THR B C   1 
ATOM   2515  O O   . THR B  1 23  ? 2.869   -23.179 88.053  1.00 27.36  ? 22   THR B O   1 
ATOM   2516  C CB  . THR B  1 23  ? 2.523   -22.327 84.861  1.00 36.68  ? 22   THR B CB  1 
ATOM   2517  O OG1 . THR B  1 23  ? 1.194   -22.304 85.394  1.00 37.56  ? 22   THR B OG1 1 
ATOM   2518  C CG2 . THR B  1 23  ? 2.470   -22.848 83.428  1.00 32.04  ? 22   THR B CG2 1 
ATOM   2519  N N   . GLY B  1 24  ? 4.184   -21.546 87.295  1.00 33.17  ? 23   GLY B N   1 
ATOM   2520  C CA  . GLY B  1 24  ? 4.270   -20.901 88.587  1.00 34.43  ? 23   GLY B CA  1 
ATOM   2521  C C   . GLY B  1 24  ? 4.763   -19.468 88.514  1.00 40.19  ? 23   GLY B C   1 
ATOM   2522  O O   . GLY B  1 24  ? 5.371   -19.038 87.523  1.00 33.58  ? 23   GLY B O   1 
ATOM   2523  N N   . ASP B  1 25  ? 4.498   -18.729 89.587  1.00 33.37  ? 24   ASP B N   1 
ATOM   2524  C CA  . ASP B  1 25  ? 4.979   -17.366 89.752  1.00 32.71  ? 24   ASP B CA  1 
ATOM   2525  C C   . ASP B  1 25  ? 5.807   -17.308 91.024  1.00 35.95  ? 24   ASP B C   1 
ATOM   2526  O O   . ASP B  1 25  ? 5.380   -17.806 92.063  1.00 30.82  ? 24   ASP B O   1 
ATOM   2527  C CB  . ASP B  1 25  ? 3.799   -16.402 89.894  1.00 41.12  ? 24   ASP B CB  1 
ATOM   2528  C CG  . ASP B  1 25  ? 3.230   -15.978 88.564  1.00 67.84  ? 24   ASP B CG  1 
ATOM   2529  O OD1 . ASP B  1 25  ? 4.028   -15.599 87.682  1.00 74.15  ? 24   ASP B OD1 1 
ATOM   2530  O OD2 . ASP B  1 25  ? 1.988   -16.023 88.400  1.00 65.24  ? 24   ASP B OD2 1 
ATOM   2531  N N   . LEU B  1 26  ? 6.983   -16.699 90.938  1.00 31.23  ? 25   LEU B N   1 
ATOM   2532  C CA  . LEU B  1 26  ? 7.806   -16.434 92.109  1.00 29.60  ? 25   LEU B CA  1 
ATOM   2533  C C   . LEU B  1 26  ? 8.129   -14.941 92.130  1.00 37.24  ? 25   LEU B C   1 
ATOM   2534  O O   . LEU B  1 26  ? 8.732   -14.417 91.211  1.00 32.97  ? 25   LEU B O   1 
ATOM   2535  C CB  . LEU B  1 26  ? 9.091   -17.259 92.060  1.00 28.51  ? 25   LEU B CB  1 
ATOM   2536  C CG  . LEU B  1 26  ? 8.869   -18.773 91.970  1.00 33.94  ? 25   LEU B CG  1 
ATOM   2537  C CD1 . LEU B  1 26  ? 10.185  -19.483 91.769  1.00 41.53  ? 25   LEU B CD1 1 
ATOM   2538  C CD2 . LEU B  1 26  ? 8.161   -19.311 93.211  1.00 36.67  ? 25   LEU B CD2 1 
ATOM   2539  N N   . VAL B  1 27  ? 7.717   -14.262 93.187  1.00 36.05  ? 26   VAL B N   1 
ATOM   2540  C CA  . VAL B  1 27  ? 7.856   -12.823 93.269  1.00 36.12  ? 26   VAL B CA  1 
ATOM   2541  C C   . VAL B  1 27  ? 8.676   -12.449 94.485  1.00 40.53  ? 26   VAL B C   1 
ATOM   2542  O O   . VAL B  1 27  ? 8.446   -12.967 95.578  1.00 33.75  ? 26   VAL B O   1 
ATOM   2543  C CB  . VAL B  1 27  ? 6.475   -12.151 93.397  1.00 39.38  ? 26   VAL B CB  1 
ATOM   2544  C CG1 . VAL B  1 27  ? 6.619   -10.641 93.637  1.00 28.65  ? 26   VAL B CG1 1 
ATOM   2545  C CG2 . VAL B  1 27  ? 5.645   -12.429 92.159  1.00 36.64  ? 26   VAL B CG2 1 
ATOM   2546  N N   . THR B  1 28  ? 9.622   -11.537 94.291  1.00 30.46  ? 27   THR B N   1 
ATOM   2547  C CA  . THR B  1 28  ? 10.381  -10.973 95.395  1.00 37.70  ? 27   THR B CA  1 
ATOM   2548  C C   . THR B  1 28  ? 10.652  -9.491  95.135  1.00 40.09  ? 27   THR B C   1 
ATOM   2549  O O   . THR B  1 28  ? 10.837  -9.074  93.996  1.00 45.24  ? 27   THR B O   1 
ATOM   2550  C CB  . THR B  1 28  ? 11.707  -11.745 95.618  1.00 42.92  ? 27   THR B CB  1 
ATOM   2551  O OG1 . THR B  1 28  ? 12.457  -11.124 96.667  1.00 72.63  ? 27   THR B OG1 1 
ATOM   2552  C CG2 . THR B  1 28  ? 12.539  -11.761 94.364  1.00 43.03  ? 27   THR B CG2 1 
ATOM   2553  N N   . TYR B  1 29  ? 10.648  -8.687  96.189  1.00 39.99  ? 28   TYR B N   1 
ATOM   2554  C CA  . TYR B  1 29  ? 10.967  -7.278  96.056  1.00 30.01  ? 28   TYR B CA  1 
ATOM   2555  C C   . TYR B  1 29  ? 12.225  -6.945  96.844  1.00 38.90  ? 28   TYR B C   1 
ATOM   2556  O O   . TYR B  1 29  ? 12.296  -7.173  98.049  1.00 35.18  ? 28   TYR B O   1 
ATOM   2557  C CB  . TYR B  1 29  ? 9.809   -6.392  96.529  1.00 33.76  ? 28   TYR B CB  1 
ATOM   2558  C CG  . TYR B  1 29  ? 10.135  -4.918  96.419  1.00 39.69  ? 28   TYR B CG  1 
ATOM   2559  C CD1 . TYR B  1 29  ? 10.299  -4.320  95.176  1.00 39.56  ? 28   TYR B CD1 1 
ATOM   2560  C CD2 . TYR B  1 29  ? 10.292  -4.125  97.551  1.00 37.69  ? 28   TYR B CD2 1 
ATOM   2561  C CE1 . TYR B  1 29  ? 10.612  -2.973  95.056  1.00 32.96  ? 28   TYR B CE1 1 
ATOM   2562  C CE2 . TYR B  1 29  ? 10.599  -2.775  97.440  1.00 38.74  ? 28   TYR B CE2 1 
ATOM   2563  C CZ  . TYR B  1 29  ? 10.763  -2.211  96.189  1.00 39.62  ? 28   TYR B CZ  1 
ATOM   2564  O OH  . TYR B  1 29  ? 11.066  -0.877  96.068  1.00 43.20  ? 28   TYR B OH  1 
ATOM   2565  N N   . ASP B  1 30  ? 13.218  -6.409  96.145  1.00 34.43  ? 29   ASP B N   1 
ATOM   2566  C CA  . ASP B  1 30  ? 14.457  -5.976  96.767  1.00 39.02  ? 29   ASP B CA  1 
ATOM   2567  C C   . ASP B  1 30  ? 14.373  -4.482  97.078  1.00 45.49  ? 29   ASP B C   1 
ATOM   2568  O O   . ASP B  1 30  ? 14.496  -3.642  96.187  1.00 37.34  ? 29   ASP B O   1 
ATOM   2569  C CB  . ASP B  1 30  ? 15.638  -6.255  95.832  1.00 34.38  ? 29   ASP B CB  1 
ATOM   2570  C CG  . ASP B  1 30  ? 16.972  -5.874  96.444  1.00 55.58  ? 29   ASP B CG  1 
ATOM   2571  O OD1 . ASP B  1 30  ? 17.996  -6.458  96.028  1.00 47.42  ? 29   ASP B OD1 1 
ATOM   2572  O OD2 . ASP B  1 30  ? 16.996  -4.997  97.342  1.00 58.09  ? 29   ASP B OD2 1 
ATOM   2573  N N   . LYS B  1 31  ? 14.172  -4.164  98.350  1.00 42.94  ? 30   LYS B N   1 
ATOM   2574  C CA  . LYS B  1 31  ? 13.935  -2.792  98.779  1.00 46.54  ? 30   LYS B CA  1 
ATOM   2575  C C   . LYS B  1 31  ? 15.171  -1.914  98.581  1.00 48.84  ? 30   LYS B C   1 
ATOM   2576  O O   . LYS B  1 31  ? 15.075  -0.791  98.081  1.00 42.20  ? 30   LYS B O   1 
ATOM   2577  C CB  . LYS B  1 31  ? 13.527  -2.788  100.252 1.00 55.72  ? 30   LYS B CB  1 
ATOM   2578  C CG  . LYS B  1 31  ? 12.782  -1.543  100.694 1.00 71.47  ? 30   LYS B CG  1 
ATOM   2579  C CD  . LYS B  1 31  ? 12.215  -1.726  102.096 1.00 95.30  ? 30   LYS B CD  1 
ATOM   2580  C CE  . LYS B  1 31  ? 11.270  -0.597  102.473 1.00 101.66 ? 30   LYS B CE  1 
ATOM   2581  N NZ  . LYS B  1 31  ? 11.947  0.726   102.460 1.00 90.34  ? 30   LYS B NZ  1 
ATOM   2582  N N   . GLU B  1 32  ? 16.331  -2.434  98.972  1.00 46.78  ? 31   GLU B N   1 
ATOM   2583  C CA  . GLU B  1 32  ? 17.582  -1.692  98.871  1.00 53.83  ? 31   GLU B CA  1 
ATOM   2584  C C   . GLU B  1 32  ? 17.871  -1.257  97.444  1.00 56.01  ? 31   GLU B C   1 
ATOM   2585  O O   . GLU B  1 32  ? 18.334  -0.144  97.216  1.00 51.41  ? 31   GLU B O   1 
ATOM   2586  C CB  . GLU B  1 32  ? 18.760  -2.527  99.376  1.00 55.96  ? 31   GLU B CB  1 
ATOM   2587  C CG  . GLU B  1 32  ? 19.088  -2.325  100.850 1.00 101.03 ? 31   GLU B CG  1 
ATOM   2588  C CD  . GLU B  1 32  ? 18.185  -3.125  101.776 1.00 121.04 ? 31   GLU B CD  1 
ATOM   2589  O OE1 . GLU B  1 32  ? 17.301  -3.857  101.274 1.00 103.04 ? 31   GLU B OE1 1 
ATOM   2590  O OE2 . GLU B  1 32  ? 18.367  -3.026  103.010 1.00 128.53 ? 31   GLU B OE2 1 
ATOM   2591  N N   . ASN B  1 33  ? 17.604  -2.140  96.488  1.00 40.93  ? 32   ASN B N   1 
ATOM   2592  C CA  . ASN B  1 33  ? 17.955  -1.874  95.104  1.00 35.53  ? 32   ASN B CA  1 
ATOM   2593  C C   . ASN B  1 33  ? 16.781  -1.394  94.253  1.00 32.91  ? 32   ASN B C   1 
ATOM   2594  O O   . ASN B  1 33  ? 16.964  -1.064  93.087  1.00 41.36  ? 32   ASN B O   1 
ATOM   2595  C CB  . ASN B  1 33  ? 18.592  -3.114  94.484  1.00 43.13  ? 32   ASN B CB  1 
ATOM   2596  C CG  . ASN B  1 33  ? 19.967  -3.394  95.045  1.00 49.82  ? 32   ASN B CG  1 
ATOM   2597  O OD1 . ASN B  1 33  ? 20.821  -2.510  95.082  1.00 51.02  ? 32   ASN B OD1 1 
ATOM   2598  N ND2 . ASN B  1 33  ? 20.185  -4.623  95.502  1.00 49.83  ? 32   ASN B ND2 1 
ATOM   2599  N N   . GLY B  1 34  ? 15.583  -1.349  94.836  1.00 38.51  ? 33   GLY B N   1 
ATOM   2600  C CA  . GLY B  1 34  ? 14.399  -0.896  94.117  1.00 39.92  ? 33   GLY B CA  1 
ATOM   2601  C C   . GLY B  1 34  ? 14.063  -1.766  92.917  1.00 39.59  ? 33   GLY B C   1 
ATOM   2602  O O   . GLY B  1 34  ? 13.894  -1.278  91.803  1.00 36.73  ? 33   GLY B O   1 
ATOM   2603  N N   . MET B  1 35  ? 13.957  -3.068  93.145  1.00 31.36  ? 34   MET B N   1 
ATOM   2604  C CA  . MET B  1 35  ? 13.696  -4.002  92.059  1.00 36.19  ? 34   MET B CA  1 
ATOM   2605  C C   . MET B  1 35  ? 12.583  -4.966  92.403  1.00 36.97  ? 34   MET B C   1 
ATOM   2606  O O   . MET B  1 35  ? 12.695  -5.763  93.334  1.00 34.94  ? 34   MET B O   1 
ATOM   2607  C CB  . MET B  1 35  ? 14.962  -4.774  91.704  1.00 30.20  ? 34   MET B CB  1 
ATOM   2608  C CG  . MET B  1 35  ? 16.071  -3.880  91.173  1.00 30.95  ? 34   MET B CG  1 
ATOM   2609  S SD  . MET B  1 35  ? 17.579  -4.799  90.910  1.00 41.76  ? 34   MET B SD  1 
ATOM   2610  C CE  . MET B  1 35  ? 18.686  -3.540  90.277  1.00 31.88  ? 34   MET B CE  1 
ATOM   2611  N N   . HIS B  1 36  ? 11.494  -4.875  91.653  1.00 33.60  ? 35   HIS B N   1 
ATOM   2612  C CA  . HIS B  1 36  ? 10.441  -5.874  91.725  1.00 30.52  ? 35   HIS B CA  1 
ATOM   2613  C C   . HIS B  1 36  ? 10.800  -7.003  90.770  1.00 31.90  ? 35   HIS B C   1 
ATOM   2614  O O   . HIS B  1 36  ? 10.934  -6.787  89.566  1.00 38.19  ? 35   HIS B O   1 
ATOM   2615  C CB  . HIS B  1 36  ? 9.116   -5.239  91.336  1.00 31.98  ? 35   HIS B CB  1 
ATOM   2616  C CG  . HIS B  1 36  ? 7.949   -6.163  91.447  1.00 30.61  ? 35   HIS B CG  1 
ATOM   2617  N ND1 . HIS B  1 36  ? 7.145   -6.470  90.372  1.00 37.27  ? 35   HIS B ND1 1 
ATOM   2618  C CD2 . HIS B  1 36  ? 7.441   -6.836  92.501  1.00 32.29  ? 35   HIS B CD2 1 
ATOM   2619  C CE1 . HIS B  1 36  ? 6.196   -7.301  90.760  1.00 36.27  ? 35   HIS B CE1 1 
ATOM   2620  N NE2 . HIS B  1 36  ? 6.353   -7.539  92.046  1.00 37.87  ? 35   HIS B NE2 1 
ATOM   2621  N N   . LYS B  1 37  ? 10.990  -8.202  91.303  1.00 34.05  ? 36   LYS B N   1 
ATOM   2622  C CA  . LYS B  1 37  ? 11.468  -9.321  90.493  1.00 39.48  ? 36   LYS B CA  1 
ATOM   2623  C C   . LYS B  1 37  ? 10.433  -10.432 90.437  1.00 39.41  ? 36   LYS B C   1 
ATOM   2624  O O   . LYS B  1 37  ? 9.936   -10.876 91.458  1.00 41.42  ? 36   LYS B O   1 
ATOM   2625  C CB  . LYS B  1 37  ? 12.799  -9.841  91.039  1.00 39.38  ? 36   LYS B CB  1 
ATOM   2626  C CG  . LYS B  1 37  ? 13.860  -8.748  91.100  1.00 41.47  ? 36   LYS B CG  1 
ATOM   2627  C CD  . LYS B  1 37  ? 15.234  -9.290  91.410  1.00 46.13  ? 36   LYS B CD  1 
ATOM   2628  C CE  . LYS B  1 37  ? 15.324  -9.802  92.828  1.00 44.20  ? 36   LYS B CE  1 
ATOM   2629  N NZ  . LYS B  1 37  ? 16.705  -10.269 93.120  1.00 51.74  ? 36   LYS B NZ  1 
ATOM   2630  N N   . LYS B  1 38  ? 10.097  -10.861 89.228  1.00 35.44  ? 37   LYS B N   1 
ATOM   2631  C CA  . LYS B  1 38  ? 9.073   -11.866 89.041  1.00 29.72  ? 37   LYS B CA  1 
ATOM   2632  C C   . LYS B  1 38  ? 9.567   -12.906 88.054  1.00 32.29  ? 37   LYS B C   1 
ATOM   2633  O O   . LYS B  1 38  ? 10.025  -12.575 86.973  1.00 32.46  ? 37   LYS B O   1 
ATOM   2634  C CB  . LYS B  1 38  ? 7.776   -11.226 88.539  1.00 34.66  ? 37   LYS B CB  1 
ATOM   2635  C CG  . LYS B  1 38  ? 6.552   -12.109 88.715  1.00 39.22  ? 37   LYS B CG  1 
ATOM   2636  C CD  . LYS B  1 38  ? 6.448   -13.152 87.644  1.00 32.36  ? 37   LYS B CD  1 
ATOM   2637  C CE  . LYS B  1 38  ? 5.519   -12.707 86.532  1.00 45.43  ? 37   LYS B CE  1 
ATOM   2638  N NZ  . LYS B  1 38  ? 4.106   -12.642 86.982  1.00 37.71  ? 37   LYS B NZ  1 
ATOM   2639  N N   . VAL B  1 39  ? 9.510   -14.167 88.457  1.00 34.47  ? 38   VAL B N   1 
ATOM   2640  C CA  . VAL B  1 39  ? 9.779   -15.272 87.562  1.00 30.44  ? 38   VAL B CA  1 
ATOM   2641  C C   . VAL B  1 39  ? 8.454   -15.945 87.254  1.00 36.65  ? 38   VAL B C   1 
ATOM   2642  O O   . VAL B  1 39  ? 7.689   -16.270 88.166  1.00 34.98  ? 38   VAL B O   1 
ATOM   2643  C CB  . VAL B  1 39  ? 10.729  -16.294 88.208  1.00 43.86  ? 38   VAL B CB  1 
ATOM   2644  C CG1 . VAL B  1 39  ? 10.727  -17.598 87.428  1.00 34.61  ? 38   VAL B CG1 1 
ATOM   2645  C CG2 . VAL B  1 39  ? 12.138  -15.713 88.311  1.00 38.16  ? 38   VAL B CG2 1 
ATOM   2646  N N   . PHE B  1 40  ? 8.168   -16.120 85.969  1.00 30.12  ? 39   PHE B N   1 
ATOM   2647  C CA  . PHE B  1 40  ? 7.049   -16.940 85.551  1.00 27.10  ? 39   PHE B CA  1 
ATOM   2648  C C   . PHE B  1 40  ? 7.618   -18.145 84.835  1.00 25.34  ? 39   PHE B C   1 
ATOM   2649  O O   . PHE B  1 40  ? 8.296   -18.003 83.834  1.00 29.48  ? 39   PHE B O   1 
ATOM   2650  C CB  . PHE B  1 40  ? 6.103   -16.177 84.629  1.00 30.69  ? 39   PHE B CB  1 
ATOM   2651  C CG  . PHE B  1 40  ? 4.973   -17.018 84.105  1.00 34.32  ? 39   PHE B CG  1 
ATOM   2652  C CD1 . PHE B  1 40  ? 3.854   -17.257 84.881  1.00 38.44  ? 39   PHE B CD1 1 
ATOM   2653  C CD2 . PHE B  1 40  ? 5.037   -17.577 82.847  1.00 42.31  ? 39   PHE B CD2 1 
ATOM   2654  C CE1 . PHE B  1 40  ? 2.821   -18.035 84.407  1.00 38.43  ? 39   PHE B CE1 1 
ATOM   2655  C CE2 . PHE B  1 40  ? 4.005   -18.353 82.368  1.00 43.40  ? 39   PHE B CE2 1 
ATOM   2656  C CZ  . PHE B  1 40  ? 2.897   -18.583 83.153  1.00 34.64  ? 39   PHE B CZ  1 
ATOM   2657  N N   . TYR B  1 41  ? 7.357   -19.341 85.345  1.00 29.55  ? 40   TYR B N   1 
ATOM   2658  C CA  . TYR B  1 41  ? 7.968   -20.531 84.766  1.00 30.32  ? 40   TYR B CA  1 
ATOM   2659  C C   . TYR B  1 41  ? 6.921   -21.520 84.259  1.00 31.92  ? 40   TYR B C   1 
ATOM   2660  O O   . TYR B  1 41  ? 5.782   -21.530 84.731  1.00 35.30  ? 40   TYR B O   1 
ATOM   2661  C CB  . TYR B  1 41  ? 8.900   -21.201 85.781  1.00 32.82  ? 40   TYR B CB  1 
ATOM   2662  C CG  . TYR B  1 41  ? 8.206   -21.848 86.969  1.00 33.33  ? 40   TYR B CG  1 
ATOM   2663  C CD1 . TYR B  1 41  ? 7.655   -23.125 86.867  1.00 35.26  ? 40   TYR B CD1 1 
ATOM   2664  C CD2 . TYR B  1 41  ? 8.121   -21.193 88.193  1.00 29.12  ? 40   TYR B CD2 1 
ATOM   2665  C CE1 . TYR B  1 41  ? 7.030   -23.732 87.954  1.00 37.66  ? 40   TYR B CE1 1 
ATOM   2666  C CE2 . TYR B  1 41  ? 7.501   -21.782 89.286  1.00 32.45  ? 40   TYR B CE2 1 
ATOM   2667  C CZ  . TYR B  1 41  ? 6.956   -23.057 89.161  1.00 41.76  ? 40   TYR B CZ  1 
ATOM   2668  O OH  . TYR B  1 41  ? 6.336   -23.662 90.233  1.00 41.35  ? 40   TYR B OH  1 
ATOM   2669  N N   . SER B  1 42  ? 7.320   -22.347 83.295  1.00 27.34  ? 41   SER B N   1 
ATOM   2670  C CA  . SER B  1 42  ? 6.438   -23.352 82.705  1.00 29.73  ? 41   SER B CA  1 
ATOM   2671  C C   . SER B  1 42  ? 7.230   -24.616 82.372  1.00 33.02  ? 41   SER B C   1 
ATOM   2672  O O   . SER B  1 42  ? 8.141   -24.587 81.552  1.00 36.32  ? 41   SER B O   1 
ATOM   2673  C CB  . SER B  1 42  ? 5.793   -22.829 81.418  1.00 29.52  ? 41   SER B CB  1 
ATOM   2674  O OG  . SER B  1 42  ? 5.129   -21.590 81.623  1.00 42.68  ? 41   SER B OG  1 
ATOM   2675  N N   . PHE B  1 43  ? 6.889   -25.721 83.023  1.00 30.36  ? 42   PHE B N   1 
ATOM   2676  C CA  . PHE B  1 43  ? 7.468   -27.018 82.700  1.00 30.26  ? 42   PHE B CA  1 
ATOM   2677  C C   . PHE B  1 43  ? 6.645   -27.685 81.613  1.00 33.60  ? 42   PHE B C   1 
ATOM   2678  O O   . PHE B  1 43  ? 5.444   -27.912 81.781  1.00 35.34  ? 42   PHE B O   1 
ATOM   2679  C CB  . PHE B  1 43  ? 7.485   -27.923 83.931  1.00 30.16  ? 42   PHE B CB  1 
ATOM   2680  C CG  . PHE B  1 43  ? 8.523   -27.551 84.948  1.00 36.41  ? 42   PHE B CG  1 
ATOM   2681  C CD1 . PHE B  1 43  ? 8.202   -26.735 86.029  1.00 24.94  ? 42   PHE B CD1 1 
ATOM   2682  C CD2 . PHE B  1 43  ? 9.816   -28.030 84.832  1.00 27.83  ? 42   PHE B CD2 1 
ATOM   2683  C CE1 . PHE B  1 43  ? 9.162   -26.399 86.965  1.00 28.75  ? 42   PHE B CE1 1 
ATOM   2684  C CE2 . PHE B  1 43  ? 10.779  -27.697 85.770  1.00 31.31  ? 42   PHE B CE2 1 
ATOM   2685  C CZ  . PHE B  1 43  ? 10.452  -26.886 86.835  1.00 29.15  ? 42   PHE B CZ  1 
ATOM   2686  N N   . ILE B  1 44  ? 7.299   -27.990 80.500  1.00 31.05  ? 43   ILE B N   1 
ATOM   2687  C CA  . ILE B  1 44  ? 6.676   -28.704 79.409  1.00 37.10  ? 43   ILE B CA  1 
ATOM   2688  C C   . ILE B  1 44  ? 7.382   -30.037 79.218  1.00 39.24  ? 43   ILE B C   1 
ATOM   2689  O O   . ILE B  1 44  ? 8.536   -30.081 78.779  1.00 37.44  ? 43   ILE B O   1 
ATOM   2690  C CB  . ILE B  1 44  ? 6.792   -27.919 78.104  1.00 34.94  ? 43   ILE B CB  1 
ATOM   2691  C CG1 . ILE B  1 44  ? 6.245   -26.505 78.284  1.00 39.87  ? 43   ILE B CG1 1 
ATOM   2692  C CG2 . ILE B  1 44  ? 6.058   -28.642 77.002  1.00 33.57  ? 43   ILE B CG2 1 
ATOM   2693  C CD1 . ILE B  1 44  ? 6.414   -25.630 77.053  1.00 39.34  ? 43   ILE B CD1 1 
ATOM   2694  N N   . ASP B  1 45  ? 6.691   -31.119 79.551  1.00 40.71  ? 44   ASP B N   1 
ATOM   2695  C CA  . ASP B  1 45  ? 7.232   -32.463 79.370  1.00 31.99  ? 44   ASP B CA  1 
ATOM   2696  C C   . ASP B  1 45  ? 6.445   -33.154 78.269  1.00 34.98  ? 44   ASP B C   1 
ATOM   2697  O O   . ASP B  1 45  ? 5.506   -33.904 78.528  1.00 40.31  ? 44   ASP B O   1 
ATOM   2698  C CB  . ASP B  1 45  ? 7.142   -33.257 80.678  1.00 40.43  ? 44   ASP B CB  1 
ATOM   2699  C CG  . ASP B  1 45  ? 7.831   -34.613 80.598  1.00 57.32  ? 44   ASP B CG  1 
ATOM   2700  O OD1 . ASP B  1 45  ? 7.702   -35.396 81.564  1.00 54.43  ? 44   ASP B OD1 1 
ATOM   2701  O OD2 . ASP B  1 45  ? 8.498   -34.902 79.578  1.00 43.17  ? 44   ASP B OD2 1 
ATOM   2702  N N   . ASP B  1 46  ? 6.831   -32.867 77.032  1.00 38.70  ? 45   ASP B N   1 
ATOM   2703  C CA  . ASP B  1 46  ? 6.213   -33.454 75.850  1.00 31.20  ? 45   ASP B CA  1 
ATOM   2704  C C   . ASP B  1 46  ? 6.897   -34.790 75.533  1.00 40.05  ? 45   ASP B C   1 
ATOM   2705  O O   . ASP B  1 46  ? 8.077   -34.822 75.201  1.00 35.80  ? 45   ASP B O   1 
ATOM   2706  C CB  . ASP B  1 46  ? 6.355   -32.475 74.685  1.00 33.77  ? 45   ASP B CB  1 
ATOM   2707  C CG  . ASP B  1 46  ? 5.729   -32.981 73.393  1.00 51.45  ? 45   ASP B CG  1 
ATOM   2708  O OD1 . ASP B  1 46  ? 5.621   -32.182 72.434  1.00 48.59  ? 45   ASP B OD1 1 
ATOM   2709  O OD2 . ASP B  1 46  ? 5.347   -34.165 73.321  1.00 48.24  ? 45   ASP B OD2 1 
ATOM   2710  N N   . LYS B  1 47  ? 6.157   -35.890 75.631  1.00 24.72  ? 46   LYS B N   1 
ATOM   2711  C CA  . LYS B  1 47  ? 6.742   -37.220 75.469  1.00 33.23  ? 46   LYS B CA  1 
ATOM   2712  C C   . LYS B  1 47  ? 7.286   -37.451 74.056  1.00 33.81  ? 46   LYS B C   1 
ATOM   2713  O O   . LYS B  1 47  ? 8.077   -38.354 73.836  1.00 40.36  ? 46   LYS B O   1 
ATOM   2714  C CB  . LYS B  1 47  ? 5.721   -38.313 75.807  1.00 32.56  ? 46   LYS B CB  1 
ATOM   2715  C CG  . LYS B  1 47  ? 5.229   -38.300 77.250  1.00 48.51  ? 46   LYS B CG  1 
ATOM   2716  C CD  . LYS B  1 47  ? 6.371   -38.421 78.239  1.00 50.92  ? 46   LYS B CD  1 
ATOM   2717  C CE  . LYS B  1 47  ? 5.849   -38.441 79.666  1.00 63.92  ? 46   LYS B CE  1 
ATOM   2718  N NZ  . LYS B  1 47  ? 6.957   -38.480 80.655  1.00 64.94  ? 46   LYS B NZ  1 
ATOM   2719  N N   . ASN B  1 48  ? 6.851   -36.643 73.101  1.00 33.34  ? 47   ASN B N   1 
ATOM   2720  C CA  . ASN B  1 48  ? 7.338   -36.739 71.729  1.00 34.82  ? 47   ASN B CA  1 
ATOM   2721  C C   . ASN B  1 48  ? 8.529   -35.820 71.474  1.00 35.50  ? 47   ASN B C   1 
ATOM   2722  O O   . ASN B  1 48  ? 8.971   -35.678 70.342  1.00 37.11  ? 47   ASN B O   1 
ATOM   2723  C CB  . ASN B  1 48  ? 6.209   -36.427 70.741  1.00 33.58  ? 47   ASN B CB  1 
ATOM   2724  C CG  . ASN B  1 48  ? 5.093   -37.468 70.779  1.00 51.02  ? 47   ASN B CG  1 
ATOM   2725  O OD1 . ASN B  1 48  ? 5.344   -38.670 70.903  1.00 42.37  ? 47   ASN B OD1 1 
ATOM   2726  N ND2 . ASN B  1 48  ? 3.856   -37.007 70.677  1.00 43.74  ? 47   ASN B ND2 1 
ATOM   2727  N N   . HIS B  1 49  ? 9.036   -35.201 72.535  1.00 31.28  ? 48   HIS B N   1 
ATOM   2728  C CA  . HIS B  1 49  ? 10.231  -34.372 72.467  1.00 34.64  ? 48   HIS B CA  1 
ATOM   2729  C C   . HIS B  1 49  ? 11.343  -35.076 73.235  1.00 34.61  ? 48   HIS B C   1 
ATOM   2730  O O   . HIS B  1 49  ? 11.087  -35.705 74.254  1.00 35.95  ? 48   HIS B O   1 
ATOM   2731  C CB  . HIS B  1 49  ? 9.953   -33.000 73.087  1.00 28.93  ? 48   HIS B CB  1 
ATOM   2732  C CG  . HIS B  1 49  ? 10.985  -31.964 72.768  1.00 32.24  ? 48   HIS B CG  1 
ATOM   2733  N ND1 . HIS B  1 49  ? 11.279  -31.577 71.479  1.00 38.33  ? 48   HIS B ND1 1 
ATOM   2734  C CD2 . HIS B  1 49  ? 11.779  -31.219 73.573  1.00 35.57  ? 48   HIS B CD2 1 
ATOM   2735  C CE1 . HIS B  1 49  ? 12.216  -30.644 71.502  1.00 36.80  ? 48   HIS B CE1 1 
ATOM   2736  N NE2 . HIS B  1 49  ? 12.538  -30.410 72.762  1.00 32.74  ? 48   HIS B NE2 1 
ATOM   2737  N N   . ASN B  1 50  ? 12.576  -34.971 72.755  1.00 30.42  ? 49   ASN B N   1 
ATOM   2738  C CA  . ASN B  1 50  ? 13.693  -35.719 73.338  1.00 28.92  ? 49   ASN B CA  1 
ATOM   2739  C C   . ASN B  1 50  ? 14.200  -35.161 74.681  1.00 35.41  ? 49   ASN B C   1 
ATOM   2740  O O   . ASN B  1 50  ? 15.113  -35.727 75.267  1.00 39.37  ? 49   ASN B O   1 
ATOM   2741  C CB  . ASN B  1 50  ? 14.868  -35.761 72.343  1.00 27.78  ? 49   ASN B CB  1 
ATOM   2742  C CG  . ASN B  1 50  ? 15.627  -34.429 72.276  1.00 37.23  ? 49   ASN B CG  1 
ATOM   2743  O OD1 . ASN B  1 50  ? 15.110  -33.375 72.661  1.00 31.52  ? 49   ASN B OD1 1 
ATOM   2744  N ND2 . ASN B  1 50  ? 16.857  -34.480 71.807  1.00 37.44  ? 49   ASN B ND2 1 
ATOM   2745  N N   . LYS B  1 51  ? 13.636  -34.051 75.154  1.00 32.70  ? 50   LYS B N   1 
ATOM   2746  C CA  . LYS B  1 51  ? 14.067  -33.447 76.422  1.00 30.83  ? 50   LYS B CA  1 
ATOM   2747  C C   . LYS B  1 51  ? 12.882  -32.897 77.201  1.00 28.13  ? 50   LYS B C   1 
ATOM   2748  O O   . LYS B  1 51  ? 11.867  -32.540 76.617  1.00 28.07  ? 50   LYS B O   1 
ATOM   2749  C CB  . LYS B  1 51  ? 15.015  -32.261 76.168  1.00 37.98  ? 50   LYS B CB  1 
ATOM   2750  C CG  . LYS B  1 51  ? 16.273  -32.553 75.369  1.00 40.27  ? 50   LYS B CG  1 
ATOM   2751  C CD  . LYS B  1 51  ? 17.399  -33.049 76.254  1.00 51.14  ? 50   LYS B CD  1 
ATOM   2752  C CE  . LYS B  1 51  ? 18.651  -33.331 75.447  1.00 40.47  ? 50   LYS B CE  1 
ATOM   2753  N NZ  . LYS B  1 51  ? 19.163  -32.123 74.782  1.00 46.03  ? 50   LYS B NZ  1 
ATOM   2754  N N   . LYS B  1 52  ? 13.029  -32.790 78.518  1.00 30.95  ? 51   LYS B N   1 
ATOM   2755  C CA  . LYS B  1 52  ? 12.132  -31.970 79.325  1.00 36.55  ? 51   LYS B CA  1 
ATOM   2756  C C   . LYS B  1 52  ? 12.506  -30.515 79.079  1.00 34.63  ? 51   LYS B C   1 
ATOM   2757  O O   . LYS B  1 52  ? 13.675  -30.205 78.888  1.00 37.24  ? 51   LYS B O   1 
ATOM   2758  C CB  . LYS B  1 52  ? 12.288  -32.267 80.817  1.00 31.16  ? 51   LYS B CB  1 
ATOM   2759  C CG  . LYS B  1 52  ? 11.789  -33.625 81.266  1.00 58.81  ? 51   LYS B CG  1 
ATOM   2760  C CD  . LYS B  1 52  ? 12.059  -33.816 82.755  1.00 66.70  ? 51   LYS B CD  1 
ATOM   2761  C CE  . LYS B  1 52  ? 11.593  -35.168 83.263  1.00 66.74  ? 51   LYS B CE  1 
ATOM   2762  N NZ  . LYS B  1 52  ? 11.945  -35.365 84.701  1.00 59.58  ? 51   LYS B NZ  1 
ATOM   2763  N N   . LEU B  1 53  ? 11.514  -29.630 79.100  1.00 38.56  ? 52   LEU B N   1 
ATOM   2764  C CA  . LEU B  1 53  ? 11.736  -28.206 78.873  1.00 37.12  ? 52   LEU B CA  1 
ATOM   2765  C C   . LEU B  1 53  ? 11.220  -27.377 80.032  1.00 38.53  ? 52   LEU B C   1 
ATOM   2766  O O   . LEU B  1 53  ? 10.197  -27.706 80.635  1.00 35.49  ? 52   LEU B O   1 
ATOM   2767  C CB  . LEU B  1 53  ? 11.021  -27.754 77.601  1.00 37.21  ? 52   LEU B CB  1 
ATOM   2768  C CG  . LEU B  1 53  ? 11.875  -27.643 76.341  1.00 51.86  ? 52   LEU B CG  1 
ATOM   2769  C CD1 . LEU B  1 53  ? 12.471  -28.980 75.993  1.00 60.63  ? 52   LEU B CD1 1 
ATOM   2770  C CD2 . LEU B  1 53  ? 11.043  -27.107 75.192  1.00 51.52  ? 52   LEU B CD2 1 
ATOM   2771  N N   . LEU B  1 54  ? 11.931  -26.291 80.326  1.00 40.60  ? 53   LEU B N   1 
ATOM   2772  C CA  . LEU B  1 54  ? 11.494  -25.307 81.298  1.00 29.06  ? 53   LEU B CA  1 
ATOM   2773  C C   . LEU B  1 54  ? 11.595  -23.941 80.635  1.00 37.41  ? 53   LEU B C   1 
ATOM   2774  O O   . LEU B  1 54  ? 12.661  -23.560 80.144  1.00 28.29  ? 53   LEU B O   1 
ATOM   2775  C CB  . LEU B  1 54  ? 12.380  -25.338 82.548  1.00 34.23  ? 53   LEU B CB  1 
ATOM   2776  C CG  . LEU B  1 54  ? 12.119  -24.210 83.562  1.00 36.49  ? 53   LEU B CG  1 
ATOM   2777  C CD1 . LEU B  1 54  ? 10.722  -24.341 84.150  1.00 34.68  ? 53   LEU B CD1 1 
ATOM   2778  C CD2 . LEU B  1 54  ? 13.150  -24.210 84.673  1.00 37.08  ? 53   LEU B CD2 1 
ATOM   2779  N N   . VAL B  1 55  ? 10.491  -23.205 80.604  1.00 32.02  ? 54   VAL B N   1 
ATOM   2780  C CA  . VAL B  1 55  ? 10.516  -21.852 80.071  1.00 24.80  ? 54   VAL B CA  1 
ATOM   2781  C C   . VAL B  1 55  ? 10.465  -20.877 81.228  1.00 25.41  ? 54   VAL B C   1 
ATOM   2782  O O   . VAL B  1 55  ? 9.504   -20.854 81.996  1.00 32.17  ? 54   VAL B O   1 
ATOM   2783  C CB  . VAL B  1 55  ? 9.332   -21.583 79.133  1.00 30.89  ? 54   VAL B CB  1 
ATOM   2784  C CG1 . VAL B  1 55  ? 9.433   -20.168 78.552  1.00 28.91  ? 54   VAL B CG1 1 
ATOM   2785  C CG2 . VAL B  1 55  ? 9.287   -22.621 78.016  1.00 24.71  ? 54   VAL B CG2 1 
ATOM   2786  N N   . ILE B  1 56  ? 11.515  -20.084 81.369  1.00 30.30  ? 55   ILE B N   1 
ATOM   2787  C CA  . ILE B  1 56  ? 11.567  -19.075 82.419  1.00 29.33  ? 55   ILE B CA  1 
ATOM   2788  C C   . ILE B  1 56  ? 11.402  -17.686 81.836  1.00 29.85  ? 55   ILE B C   1 
ATOM   2789  O O   . ILE B  1 56  ? 12.198  -17.255 80.994  1.00 27.63  ? 55   ILE B O   1 
ATOM   2790  C CB  . ILE B  1 56  ? 12.902  -19.128 83.157  1.00 29.47  ? 55   ILE B CB  1 
ATOM   2791  C CG1 . ILE B  1 56  ? 13.066  -20.494 83.827  1.00 34.03  ? 55   ILE B CG1 1 
ATOM   2792  C CG2 . ILE B  1 56  ? 12.982  -17.990 84.171  1.00 27.36  ? 55   ILE B CG2 1 
ATOM   2793  C CD1 . ILE B  1 56  ? 14.411  -20.696 84.467  1.00 41.53  ? 55   ILE B CD1 1 
ATOM   2794  N N   . ARG B  1 57  ? 10.372  -16.981 82.284  1.00 32.99  ? 56   ARG B N   1 
ATOM   2795  C CA  . ARG B  1 57  ? 10.170  -15.592 81.878  1.00 27.75  ? 56   ARG B CA  1 
ATOM   2796  C C   . ARG B  1 57  ? 10.541  -14.688 83.035  1.00 33.30  ? 56   ARG B C   1 
ATOM   2797  O O   . ARG B  1 57  ? 9.974   -14.796 84.121  1.00 26.91  ? 56   ARG B O   1 
ATOM   2798  C CB  . ARG B  1 57  ? 8.726   -15.358 81.440  1.00 30.64  ? 56   ARG B CB  1 
ATOM   2799  C CG  . ARG B  1 57  ? 8.367   -16.083 80.139  1.00 33.56  ? 56   ARG B CG  1 
ATOM   2800  C CD  . ARG B  1 57  ? 7.045   -15.610 79.564  1.00 57.91  ? 56   ARG B CD  1 
ATOM   2801  N NE  . ARG B  1 57  ? 6.852   -16.106 78.205  1.00 68.25  ? 56   ARG B NE  1 
ATOM   2802  C CZ  . ARG B  1 57  ? 6.362   -17.308 77.910  1.00 68.26  ? 56   ARG B CZ  1 
ATOM   2803  N NH1 . ARG B  1 57  ? 6.227   -17.678 76.641  1.00 61.62  ? 56   ARG B NH1 1 
ATOM   2804  N NH2 . ARG B  1 57  ? 6.005   -18.143 78.881  1.00 51.37  ? 56   ARG B NH2 1 
ATOM   2805  N N   . THR B  1 58  ? 11.521  -13.817 82.810  1.00 33.74  ? 57   THR B N   1 
ATOM   2806  C CA  . THR B  1 58  ? 11.943  -12.865 83.829  1.00 32.64  ? 57   THR B CA  1 
ATOM   2807  C C   . THR B  1 58  ? 11.247  -11.543 83.573  1.00 33.05  ? 57   THR B C   1 
ATOM   2808  O O   . THR B  1 58  ? 11.464  -10.914 82.537  1.00 28.91  ? 57   THR B O   1 
ATOM   2809  C CB  . THR B  1 58  ? 13.466  -12.668 83.802  1.00 33.22  ? 57   THR B CB  1 
ATOM   2810  O OG1 . THR B  1 58  ? 13.891  -12.426 82.455  1.00 33.91  ? 57   THR B OG1 1 
ATOM   2811  C CG2 . THR B  1 58  ? 14.171  -13.918 84.314  1.00 27.80  ? 57   THR B CG2 1 
ATOM   2812  N N   . LYS B  1 59  ? 10.394  -11.146 84.511  1.00 27.85  ? 58   LYS B N   1 
ATOM   2813  C CA  . LYS B  1 59  ? 9.596   -9.930  84.392  1.00 37.89  ? 58   LYS B CA  1 
ATOM   2814  C C   . LYS B  1 59  ? 9.826   -9.049  85.620  1.00 33.41  ? 58   LYS B C   1 
ATOM   2815  O O   . LYS B  1 59  ? 10.902  -9.069  86.206  1.00 39.99  ? 58   LYS B O   1 
ATOM   2816  C CB  . LYS B  1 59  ? 8.110   -10.285 84.252  1.00 29.74  ? 58   LYS B CB  1 
ATOM   2817  C CG  . LYS B  1 59  ? 7.846   -11.329 83.161  1.00 38.84  ? 58   LYS B CG  1 
ATOM   2818  C CD  . LYS B  1 59  ? 6.360   -11.611 82.967  1.00 46.32  ? 58   LYS B CD  1 
ATOM   2819  C CE  . LYS B  1 59  ? 5.677   -10.473 82.225  1.00 57.34  ? 58   LYS B CE  1 
ATOM   2820  N NZ  . LYS B  1 59  ? 4.249   -10.773 81.928  1.00 51.28  ? 58   LYS B NZ  1 
ATOM   2821  N N   . GLY B  1 60  ? 8.821   -8.278  86.012  1.00 37.36  ? 59   GLY B N   1 
ATOM   2822  C CA  . GLY B  1 60  ? 8.966   -7.368  87.137  1.00 41.16  ? 59   GLY B CA  1 
ATOM   2823  C C   . GLY B  1 60  ? 9.357   -5.990  86.644  1.00 34.80  ? 59   GLY B C   1 
ATOM   2824  O O   . GLY B  1 60  ? 9.136   -5.679  85.480  1.00 36.71  ? 59   GLY B O   1 
ATOM   2825  N N   . THR B  1 61  ? 9.928   -5.170  87.521  1.00 33.22  ? 60   THR B N   1 
ATOM   2826  C CA  . THR B  1 61  ? 10.348  -3.822  87.153  1.00 34.06  ? 60   THR B CA  1 
ATOM   2827  C C   . THR B  1 61  ? 11.591  -3.383  87.919  1.00 33.08  ? 60   THR B C   1 
ATOM   2828  O O   . THR B  1 61  ? 11.644  -3.478  89.147  1.00 39.50  ? 60   THR B O   1 
ATOM   2829  C CB  . THR B  1 61  ? 9.240   -2.791  87.441  1.00 41.15  ? 60   THR B CB  1 
ATOM   2830  O OG1 . THR B  1 61  ? 8.052   -3.155  86.731  1.00 38.62  ? 60   THR B OG1 1 
ATOM   2831  C CG2 . THR B  1 61  ? 9.692   -1.370  87.017  1.00 30.92  ? 60   THR B CG2 1 
ATOM   2832  N N   . ILE B  1 62  ? 12.579  -2.890  87.183  1.00 29.78  ? 61   ILE B N   1 
ATOM   2833  C CA  . ILE B  1 62  ? 13.738  -2.227  87.776  1.00 34.06  ? 61   ILE B CA  1 
ATOM   2834  C C   . ILE B  1 62  ? 13.494  -0.718  87.781  1.00 32.06  ? 61   ILE B C   1 
ATOM   2835  O O   . ILE B  1 62  ? 13.445  -0.089  86.726  1.00 30.59  ? 61   ILE B O   1 
ATOM   2836  C CB  . ILE B  1 62  ? 15.018  -2.552  86.992  1.00 26.98  ? 61   ILE B CB  1 
ATOM   2837  C CG1 . ILE B  1 62  ? 15.254  -4.074  86.985  1.00 32.24  ? 61   ILE B CG1 1 
ATOM   2838  C CG2 . ILE B  1 62  ? 16.216  -1.828  87.590  1.00 30.36  ? 61   ILE B CG2 1 
ATOM   2839  C CD1 . ILE B  1 62  ? 16.328  -4.525  85.975  1.00 31.13  ? 61   ILE B CD1 1 
ATOM   2840  N N   . ALA B  1 63  ? 13.311  -0.141  88.965  1.00 24.76  ? 62   ALA B N   1 
ATOM   2841  C CA  . ALA B  1 63  ? 13.084  1.297   89.080  1.00 33.79  ? 62   ALA B CA  1 
ATOM   2842  C C   . ALA B  1 63  ? 14.230  2.057   88.431  1.00 28.55  ? 62   ALA B C   1 
ATOM   2843  O O   . ALA B  1 63  ? 15.366  1.597   88.443  1.00 33.14  ? 62   ALA B O   1 
ATOM   2844  C CB  . ALA B  1 63  ? 12.936  1.704   90.547  1.00 27.44  ? 62   ALA B CB  1 
ATOM   2845  N N   . GLY B  1 64  ? 13.931  3.214   87.851  1.00 33.87  ? 63   GLY B N   1 
ATOM   2846  C CA  . GLY B  1 64  ? 14.949  4.026   87.207  1.00 28.54  ? 63   GLY B CA  1 
ATOM   2847  C C   . GLY B  1 64  ? 15.820  4.751   88.221  1.00 41.17  ? 63   GLY B C   1 
ATOM   2848  O O   . GLY B  1 64  ? 17.052  4.643   88.186  1.00 40.68  ? 63   GLY B O   1 
ATOM   2849  N N   . GLN B  1 65  ? 15.175  5.499   89.114  1.00 37.01  ? 64   GLN B N   1 
ATOM   2850  C CA  . GLN B  1 65  ? 15.859  6.171   90.223  1.00 57.78  ? 64   GLN B CA  1 
ATOM   2851  C C   . GLN B  1 65  ? 16.710  7.356   89.752  1.00 48.71  ? 64   GLN B C   1 
ATOM   2852  O O   . GLN B  1 65  ? 17.817  7.585   90.247  1.00 58.42  ? 64   GLN B O   1 
ATOM   2853  C CB  . GLN B  1 65  ? 16.683  5.165   91.044  1.00 44.02  ? 64   GLN B CB  1 
ATOM   2854  C CG  . GLN B  1 65  ? 15.810  4.120   91.732  1.00 47.35  ? 64   GLN B CG  1 
ATOM   2855  C CD  . GLN B  1 65  ? 16.574  3.245   92.711  1.00 50.22  ? 64   GLN B CD  1 
ATOM   2856  O OE1 . GLN B  1 65  ? 17.800  3.124   92.637  1.00 58.95  ? 64   GLN B OE1 1 
ATOM   2857  N NE2 . GLN B  1 65  ? 15.846  2.628   93.640  1.00 55.55  ? 64   GLN B NE2 1 
ATOM   2858  N N   . TYR B  1 66  ? 16.164  8.086   88.781  1.00 55.50  ? 65   TYR B N   1 
ATOM   2859  C CA  . TYR B  1 66  ? 16.681  9.377   88.311  1.00 49.10  ? 65   TYR B CA  1 
ATOM   2860  C C   . TYR B  1 66  ? 16.497  10.437  89.389  1.00 55.53  ? 65   TYR B C   1 
ATOM   2861  O O   . TYR B  1 66  ? 15.379  10.868  89.642  1.00 54.83  ? 65   TYR B O   1 
ATOM   2862  C CB  . TYR B  1 66  ? 15.873  9.779   87.079  1.00 42.97  ? 65   TYR B CB  1 
ATOM   2863  C CG  . TYR B  1 66  ? 16.172  11.125  86.445  1.00 49.48  ? 65   TYR B CG  1 
ATOM   2864  C CD1 . TYR B  1 66  ? 17.035  11.217  85.363  1.00 43.50  ? 65   TYR B CD1 1 
ATOM   2865  C CD2 . TYR B  1 66  ? 15.542  12.287  86.877  1.00 48.71  ? 65   TYR B CD2 1 
ATOM   2866  C CE1 . TYR B  1 66  ? 17.292  12.416  84.753  1.00 44.53  ? 65   TYR B CE1 1 
ATOM   2867  C CE2 . TYR B  1 66  ? 15.795  13.509  86.262  1.00 44.22  ? 65   TYR B CE2 1 
ATOM   2868  C CZ  . TYR B  1 66  ? 16.671  13.557  85.200  1.00 46.34  ? 65   TYR B CZ  1 
ATOM   2869  O OH  . TYR B  1 66  ? 16.949  14.736  84.566  1.00 55.53  ? 65   TYR B OH  1 
ATOM   2870  N N   . ARG B  1 67  ? 17.580  10.856  90.032  1.00 40.02  ? 66   ARG B N   1 
ATOM   2871  C CA  . ARG B  1 67  ? 17.460  11.827  91.114  1.00 58.73  ? 66   ARG B CA  1 
ATOM   2872  C C   . ARG B  1 67  ? 18.705  12.685  91.310  1.00 37.09  ? 66   ARG B C   1 
ATOM   2873  O O   . ARG B  1 67  ? 19.830  12.271  91.020  1.00 43.94  ? 66   ARG B O   1 
ATOM   2874  C CB  . ARG B  1 67  ? 17.126  11.113  92.425  1.00 54.29  ? 66   ARG B CB  1 
ATOM   2875  C CG  . ARG B  1 67  ? 18.114  10.022  92.794  1.00 64.79  ? 66   ARG B CG  1 
ATOM   2876  C CD  . ARG B  1 67  ? 17.738  9.360   94.105  1.00 82.05  ? 66   ARG B CD  1 
ATOM   2877  N NE  . ARG B  1 67  ? 17.862  10.283  95.230  1.00 77.62  ? 66   ARG B NE  1 
ATOM   2878  C CZ  . ARG B  1 67  ? 18.916  10.348  96.040  1.00 80.79  ? 66   ARG B CZ  1 
ATOM   2879  N NH1 . ARG B  1 67  ? 18.928  11.222  97.035  1.00 96.86  ? 66   ARG B NH1 1 
ATOM   2880  N NH2 . ARG B  1 67  ? 19.956  9.541   95.866  1.00 73.00  ? 66   ARG B NH2 1 
ATOM   2881  N N   . VAL B  1 68  ? 18.478  13.894  91.807  1.00 50.08  ? 67   VAL B N   1 
ATOM   2882  C CA  . VAL B  1 68  ? 19.549  14.792  92.202  1.00 44.81  ? 67   VAL B CA  1 
ATOM   2883  C C   . VAL B  1 68  ? 20.132  14.305  93.516  1.00 42.37  ? 67   VAL B C   1 
ATOM   2884  O O   . VAL B  1 68  ? 19.465  14.343  94.543  1.00 58.25  ? 67   VAL B O   1 
ATOM   2885  C CB  . VAL B  1 68  ? 19.008  16.207  92.387  1.00 47.83  ? 67   VAL B CB  1 
ATOM   2886  C CG1 . VAL B  1 68  ? 20.092  17.131  92.913  1.00 53.65  ? 67   VAL B CG1 1 
ATOM   2887  C CG2 . VAL B  1 68  ? 18.446  16.714  91.072  1.00 36.08  ? 67   VAL B CG2 1 
ATOM   2888  N N   . TYR B  1 69  ? 21.377  13.847  93.485  1.00 48.83  ? 68   TYR B N   1 
ATOM   2889  C CA  . TYR B  1 69  ? 21.987  13.256  94.668  1.00 57.87  ? 68   TYR B CA  1 
ATOM   2890  C C   . TYR B  1 69  ? 22.930  14.185  95.431  1.00 70.93  ? 68   TYR B C   1 
ATOM   2891  O O   . TYR B  1 69  ? 23.092  14.040  96.644  1.00 64.68  ? 68   TYR B O   1 
ATOM   2892  C CB  . TYR B  1 69  ? 22.753  11.998  94.279  1.00 46.68  ? 68   TYR B CB  1 
ATOM   2893  C CG  . TYR B  1 69  ? 24.074  12.257  93.589  1.00 58.24  ? 68   TYR B CG  1 
ATOM   2894  C CD1 . TYR B  1 69  ? 24.132  12.467  92.219  1.00 55.47  ? 68   TYR B CD1 1 
ATOM   2895  C CD2 . TYR B  1 69  ? 25.265  12.266  94.303  1.00 59.18  ? 68   TYR B CD2 1 
ATOM   2896  C CE1 . TYR B  1 69  ? 25.342  12.691  91.575  1.00 61.54  ? 68   TYR B CE1 1 
ATOM   2897  C CE2 . TYR B  1 69  ? 26.479  12.486  93.671  1.00 66.56  ? 68   TYR B CE2 1 
ATOM   2898  C CZ  . TYR B  1 69  ? 26.513  12.700  92.303  1.00 61.77  ? 68   TYR B CZ  1 
ATOM   2899  O OH  . TYR B  1 69  ? 27.713  12.925  91.654  1.00 53.49  ? 68   TYR B OH  1 
ATOM   2900  N N   . SER B  1 70  ? 23.562  15.122  94.730  1.00 72.82  ? 69   SER B N   1 
ATOM   2901  C CA  . SER B  1 70  ? 24.615  15.932  95.341  1.00 64.42  ? 69   SER B CA  1 
ATOM   2902  C C   . SER B  1 70  ? 24.399  17.422  95.149  1.00 74.08  ? 69   SER B C   1 
ATOM   2903  O O   . SER B  1 70  ? 23.628  17.849  94.296  1.00 71.23  ? 69   SER B O   1 
ATOM   2904  C CB  . SER B  1 70  ? 25.980  15.542  94.769  1.00 79.68  ? 69   SER B CB  1 
ATOM   2905  O OG  . SER B  1 70  ? 27.022  16.231  95.435  1.00 91.12  ? 69   SER B OG  1 
ATOM   2906  N N   . GLU B  1 71  ? 25.102  18.208  95.955  1.00 98.03  ? 70   GLU B N   1 
ATOM   2907  C CA  . GLU B  1 71  ? 24.973  19.655  95.940  1.00 74.22  ? 70   GLU B CA  1 
ATOM   2908  C C   . GLU B  1 71  ? 26.263  20.263  96.463  1.00 101.00 ? 70   GLU B C   1 
ATOM   2909  O O   . GLU B  1 71  ? 26.828  19.785  97.445  1.00 105.91 ? 70   GLU B O   1 
ATOM   2910  C CB  . GLU B  1 71  ? 23.810  20.084  96.831  1.00 94.96  ? 70   GLU B CB  1 
ATOM   2911  C CG  . GLU B  1 71  ? 23.488  21.557  96.763  1.00 94.36  ? 70   GLU B CG  1 
ATOM   2912  C CD  . GLU B  1 71  ? 22.950  21.949  95.413  1.00 111.85 ? 70   GLU B CD  1 
ATOM   2913  O OE1 . GLU B  1 71  ? 22.856  21.058  94.542  1.00 112.41 ? 70   GLU B OE1 1 
ATOM   2914  O OE2 . GLU B  1 71  ? 22.618  23.138  95.220  1.00 121.39 ? 70   GLU B OE2 1 
ATOM   2915  N N   . GLU B  1 72  ? 26.735  21.308  95.796  1.00 97.25  ? 71   GLU B N   1 
ATOM   2916  C CA  . GLU B  1 72  ? 27.912  22.036  96.248  1.00 100.50 ? 71   GLU B CA  1 
ATOM   2917  C C   . GLU B  1 72  ? 27.689  23.516  95.990  1.00 87.47  ? 71   GLU B C   1 
ATOM   2918  O O   . GLU B  1 72  ? 28.324  24.111  95.121  1.00 115.31 ? 71   GLU B O   1 
ATOM   2919  C CB  . GLU B  1 72  ? 29.165  21.554  95.517  1.00 101.94 ? 71   GLU B CB  1 
ATOM   2920  C CG  . GLU B  1 72  ? 29.493  20.089  95.746  1.00 124.28 ? 71   GLU B CG  1 
ATOM   2921  C CD  . GLU B  1 72  ? 30.745  19.652  95.011  1.00 144.61 ? 71   GLU B CD  1 
ATOM   2922  O OE1 . GLU B  1 72  ? 31.427  20.522  94.427  1.00 151.18 ? 71   GLU B OE1 1 
ATOM   2923  O OE2 . GLU B  1 72  ? 31.047  18.439  95.016  1.00 144.01 ? 71   GLU B OE2 1 
ATOM   2924  N N   . GLY B  1 73  ? 26.780  24.104  96.755  1.00 55.78  ? 72   GLY B N   1 
ATOM   2925  C CA  . GLY B  1 73  ? 26.347  25.462  96.510  1.00 66.49  ? 72   GLY B CA  1 
ATOM   2926  C C   . GLY B  1 73  ? 25.422  25.490  95.311  1.00 70.91  ? 72   GLY B C   1 
ATOM   2927  O O   . GLY B  1 73  ? 25.146  24.449  94.709  1.00 65.56  ? 72   GLY B O   1 
ATOM   2928  N N   . ALA B  1 74  ? 24.951  26.683  94.961  1.00 82.79  ? 73   ALA B N   1 
ATOM   2929  C CA  . ALA B  1 74  ? 24.062  26.865  93.818  1.00 81.37  ? 73   ALA B CA  1 
ATOM   2930  C C   . ALA B  1 74  ? 24.823  26.758  92.503  1.00 79.32  ? 73   ALA B C   1 
ATOM   2931  O O   . ALA B  1 74  ? 24.255  26.978  91.431  1.00 57.51  ? 73   ALA B O   1 
ATOM   2932  C CB  . ALA B  1 74  ? 23.380  28.220  93.905  1.00 50.94  ? 73   ALA B CB  1 
ATOM   2933  N N   . ASN B  1 75  ? 26.108  26.424  92.587  1.00 72.67  ? 74   ASN B N   1 
ATOM   2934  C CA  . ASN B  1 75  ? 26.977  26.421  91.416  1.00 80.18  ? 74   ASN B CA  1 
ATOM   2935  C C   . ASN B  1 75  ? 27.195  25.029  90.835  1.00 79.50  ? 74   ASN B C   1 
ATOM   2936  O O   . ASN B  1 75  ? 27.471  24.877  89.645  1.00 61.79  ? 74   ASN B O   1 
ATOM   2937  C CB  . ASN B  1 75  ? 28.324  27.061  91.760  1.00 66.77  ? 74   ASN B CB  1 
ATOM   2938  C CG  . ASN B  1 75  ? 28.204  28.549  92.026  1.00 91.29  ? 74   ASN B CG  1 
ATOM   2939  O OD1 . ASN B  1 75  ? 28.123  29.350  91.093  1.00 80.13  ? 74   ASN B OD1 1 
ATOM   2940  N ND2 . ASN B  1 75  ? 28.185  28.928  93.303  1.00 76.76  ? 74   ASN B ND2 1 
ATOM   2941  N N   . LYS B  1 76  ? 27.066  24.011  91.671  1.00 58.43  ? 75   LYS B N   1 
ATOM   2942  C CA  . LYS B  1 76  ? 27.249  22.649  91.204  1.00 69.16  ? 75   LYS B CA  1 
ATOM   2943  C C   . LYS B  1 76  ? 26.168  21.730  91.754  1.00 58.72  ? 75   LYS B C   1 
ATOM   2944  O O   . LYS B  1 76  ? 25.457  22.072  92.698  1.00 62.36  ? 75   LYS B O   1 
ATOM   2945  C CB  . LYS B  1 76  ? 28.645  22.145  91.578  1.00 67.14  ? 75   LYS B CB  1 
ATOM   2946  C CG  . LYS B  1 76  ? 29.756  23.067  91.101  1.00 73.40  ? 75   LYS B CG  1 
ATOM   2947  C CD  . LYS B  1 76  ? 31.139  22.479  91.334  1.00 93.64  ? 75   LYS B CD  1 
ATOM   2948  C CE  . LYS B  1 76  ? 32.241  23.494  91.016  1.00 111.50 ? 75   LYS B CE  1 
ATOM   2949  N NZ  . LYS B  1 76  ? 32.132  24.085  89.644  1.00 76.82  ? 75   LYS B NZ  1 
ATOM   2950  N N   . SER B  1 77  ? 26.041  20.566  91.134  1.00 67.36  ? 76   SER B N   1 
ATOM   2951  C CA  . SER B  1 77  ? 25.091  19.556  91.569  1.00 62.59  ? 76   SER B CA  1 
ATOM   2952  C C   . SER B  1 77  ? 25.253  18.299  90.719  1.00 62.05  ? 76   SER B C   1 
ATOM   2953  O O   . SER B  1 77  ? 25.708  18.362  89.572  1.00 56.76  ? 76   SER B O   1 
ATOM   2954  C CB  . SER B  1 77  ? 23.660  20.085  91.470  1.00 56.46  ? 76   SER B CB  1 
ATOM   2955  O OG  . SER B  1 77  ? 22.747  19.196  92.089  1.00 59.49  ? 76   SER B OG  1 
ATOM   2956  N N   . GLY B  1 78  ? 24.884  17.158  91.291  1.00 58.76  ? 77   GLY B N   1 
ATOM   2957  C CA  . GLY B  1 78  ? 25.026  15.882  90.618  1.00 46.97  ? 77   GLY B CA  1 
ATOM   2958  C C   . GLY B  1 78  ? 23.706  15.150  90.479  1.00 54.92  ? 77   GLY B C   1 
ATOM   2959  O O   . GLY B  1 78  ? 22.842  15.234  91.353  1.00 45.55  ? 77   GLY B O   1 
ATOM   2960  N N   . LEU B  1 79  ? 23.569  14.415  89.378  1.00 51.61  ? 78   LEU B N   1 
ATOM   2961  C CA  . LEU B  1 79  ? 22.359  13.666  89.073  1.00 43.24  ? 78   LEU B CA  1 
ATOM   2962  C C   . LEU B  1 79  ? 22.718  12.222  88.748  1.00 40.89  ? 78   LEU B C   1 
ATOM   2963  O O   . LEU B  1 79  ? 23.508  11.974  87.847  1.00 41.85  ? 78   LEU B O   1 
ATOM   2964  C CB  . LEU B  1 79  ? 21.643  14.295  87.880  1.00 38.67  ? 78   LEU B CB  1 
ATOM   2965  C CG  . LEU B  1 79  ? 20.480  13.488  87.297  1.00 47.60  ? 78   LEU B CG  1 
ATOM   2966  C CD1 . LEU B  1 79  ? 19.256  13.618  88.170  1.00 39.26  ? 78   LEU B CD1 1 
ATOM   2967  C CD2 . LEU B  1 79  ? 20.160  13.946  85.892  1.00 53.72  ? 78   LEU B CD2 1 
ATOM   2968  N N   . ALA B  1 80  ? 22.155  11.272  89.490  1.00 39.76  ? 79   ALA B N   1 
ATOM   2969  C CA  . ALA B  1 80  ? 22.357  9.859   89.195  1.00 44.72  ? 79   ALA B CA  1 
ATOM   2970  C C   . ALA B  1 80  ? 21.213  9.365   88.320  1.00 42.99  ? 79   ALA B C   1 
ATOM   2971  O O   . ALA B  1 80  ? 20.047  9.597   88.638  1.00 45.85  ? 79   ALA B O   1 
ATOM   2972  C CB  . ALA B  1 80  ? 22.426  9.054   90.476  1.00 43.81  ? 79   ALA B CB  1 
ATOM   2973  N N   . TRP B  1 81  ? 21.542  8.694   87.220  1.00 37.66  ? 80   TRP B N   1 
ATOM   2974  C CA  . TRP B  1 81  ? 20.526  8.225   86.284  1.00 32.42  ? 80   TRP B CA  1 
ATOM   2975  C C   . TRP B  1 81  ? 20.929  6.892   85.661  1.00 36.51  ? 80   TRP B C   1 
ATOM   2976  O O   . TRP B  1 81  ? 22.116  6.592   85.536  1.00 39.64  ? 80   TRP B O   1 
ATOM   2977  C CB  . TRP B  1 81  ? 20.289  9.270   85.201  1.00 28.84  ? 80   TRP B CB  1 
ATOM   2978  C CG  . TRP B  1 81  ? 21.482  9.499   84.313  1.00 36.57  ? 80   TRP B CG  1 
ATOM   2979  C CD1 . TRP B  1 81  ? 22.557  10.296  84.576  1.00 39.31  ? 80   TRP B CD1 1 
ATOM   2980  C CD2 . TRP B  1 81  ? 21.715  8.928   83.012  1.00 38.97  ? 80   TRP B CD2 1 
ATOM   2981  N NE1 . TRP B  1 81  ? 23.444  10.265  83.514  1.00 42.18  ? 80   TRP B NE1 1 
ATOM   2982  C CE2 . TRP B  1 81  ? 22.950  9.433   82.545  1.00 36.27  ? 80   TRP B CE2 1 
ATOM   2983  C CE3 . TRP B  1 81  ? 20.997  8.055   82.194  1.00 29.40  ? 80   TRP B CE3 1 
ATOM   2984  C CZ2 . TRP B  1 81  ? 23.482  9.083   81.304  1.00 36.62  ? 80   TRP B CZ2 1 
ATOM   2985  C CZ3 . TRP B  1 81  ? 21.526  7.709   80.956  1.00 33.80  ? 80   TRP B CZ3 1 
ATOM   2986  C CH2 . TRP B  1 81  ? 22.755  8.223   80.525  1.00 37.77  ? 80   TRP B CH2 1 
ATOM   2987  N N   . PRO B  1 82  ? 19.934  6.081   85.274  1.00 37.89  ? 81   PRO B N   1 
ATOM   2988  C CA  . PRO B  1 82  ? 20.173  4.711   84.794  1.00 32.30  ? 81   PRO B CA  1 
ATOM   2989  C C   . PRO B  1 82  ? 20.562  4.660   83.332  1.00 29.79  ? 81   PRO B C   1 
ATOM   2990  O O   . PRO B  1 82  ? 19.747  4.988   82.473  1.00 36.84  ? 81   PRO B O   1 
ATOM   2991  C CB  . PRO B  1 82  ? 18.812  4.032   84.994  1.00 23.59  ? 81   PRO B CB  1 
ATOM   2992  C CG  . PRO B  1 82  ? 17.820  5.129   84.860  1.00 31.94  ? 81   PRO B CG  1 
ATOM   2993  C CD  . PRO B  1 82  ? 18.494  6.379   85.400  1.00 33.70  ? 81   PRO B CD  1 
ATOM   2994  N N   . SER B  1 83  ? 21.793  4.246   83.055  1.00 32.57  ? 82   SER B N   1 
ATOM   2995  C CA  . SER B  1 83  ? 22.273  4.140   81.687  1.00 33.94  ? 82   SER B CA  1 
ATOM   2996  C C   . SER B  1 83  ? 22.144  2.711   81.165  1.00 36.13  ? 82   SER B C   1 
ATOM   2997  O O   . SER B  1 83  ? 22.289  2.474   79.981  1.00 33.49  ? 82   SER B O   1 
ATOM   2998  C CB  . SER B  1 83  ? 23.728  4.596   81.598  1.00 36.40  ? 82   SER B CB  1 
ATOM   2999  O OG  . SER B  1 83  ? 24.537  3.868   82.502  1.00 41.75  ? 82   SER B OG  1 
ATOM   3000  N N   . ALA B  1 84  ? 21.871  1.758   82.045  1.00 32.52  ? 83   ALA B N   1 
ATOM   3001  C CA  . ALA B  1 84  ? 21.648  0.381   81.600  1.00 39.93  ? 83   ALA B CA  1 
ATOM   3002  C C   . ALA B  1 84  ? 20.839  -0.422  82.614  1.00 32.86  ? 83   ALA B C   1 
ATOM   3003  O O   . ALA B  1 84  ? 20.973  -0.235  83.818  1.00 31.69  ? 83   ALA B O   1 
ATOM   3004  C CB  . ALA B  1 84  ? 22.975  -0.311  81.323  1.00 32.02  ? 83   ALA B CB  1 
ATOM   3005  N N   . PHE B  1 85  ? 19.983  -1.300  82.103  1.00 32.80  ? 84   PHE B N   1 
ATOM   3006  C CA  . PHE B  1 85  ? 19.291  -2.291  82.914  1.00 34.22  ? 84   PHE B CA  1 
ATOM   3007  C C   . PHE B  1 85  ? 19.736  -3.651  82.403  1.00 38.17  ? 84   PHE B C   1 
ATOM   3008  O O   . PHE B  1 85  ? 19.901  -3.837  81.201  1.00 33.61  ? 84   PHE B O   1 
ATOM   3009  C CB  . PHE B  1 85  ? 17.777  -2.165  82.767  1.00 31.40  ? 84   PHE B CB  1 
ATOM   3010  C CG  . PHE B  1 85  ? 17.241  -0.797  83.088  1.00 32.01  ? 84   PHE B CG  1 
ATOM   3011  C CD1 . PHE B  1 85  ? 16.863  -0.471  84.377  1.00 31.61  ? 84   PHE B CD1 1 
ATOM   3012  C CD2 . PHE B  1 85  ? 17.089  0.153   82.096  1.00 29.64  ? 84   PHE B CD2 1 
ATOM   3013  C CE1 . PHE B  1 85  ? 16.360  0.781   84.671  1.00 32.37  ? 84   PHE B CE1 1 
ATOM   3014  C CE2 . PHE B  1 85  ? 16.587  1.401   82.382  1.00 28.45  ? 84   PHE B CE2 1 
ATOM   3015  C CZ  . PHE B  1 85  ? 16.219  1.714   83.674  1.00 29.99  ? 84   PHE B CZ  1 
ATOM   3016  N N   . LYS B  1 86  ? 19.935  -4.608  83.298  1.00 35.32  ? 85   LYS B N   1 
ATOM   3017  C CA  . LYS B  1 86  ? 20.420  -5.910  82.872  1.00 34.83  ? 85   LYS B CA  1 
ATOM   3018  C C   . LYS B  1 86  ? 19.698  -7.036  83.565  1.00 30.40  ? 85   LYS B C   1 
ATOM   3019  O O   . LYS B  1 86  ? 19.323  -6.917  84.725  1.00 37.19  ? 85   LYS B O   1 
ATOM   3020  C CB  . LYS B  1 86  ? 21.914  -6.024  83.142  1.00 34.77  ? 85   LYS B CB  1 
ATOM   3021  C CG  . LYS B  1 86  ? 22.750  -5.036  82.364  1.00 39.49  ? 85   LYS B CG  1 
ATOM   3022  C CD  . LYS B  1 86  ? 24.226  -5.238  82.657  1.00 49.79  ? 85   LYS B CD  1 
ATOM   3023  C CE  . LYS B  1 86  ? 25.080  -4.231  81.916  1.00 60.07  ? 85   LYS B CE  1 
ATOM   3024  N NZ  . LYS B  1 86  ? 26.518  -4.357  82.274  1.00 72.58  ? 85   LYS B NZ  1 
ATOM   3025  N N   . VAL B  1 87  ? 19.507  -8.135  82.842  1.00 37.42  ? 86   VAL B N   1 
ATOM   3026  C CA  . VAL B  1 87  ? 18.987  -9.364  83.431  1.00 30.46  ? 86   VAL B CA  1 
ATOM   3027  C C   . VAL B  1 87  ? 19.866  -10.508 82.953  1.00 32.57  ? 86   VAL B C   1 
ATOM   3028  O O   . VAL B  1 87  ? 20.191  -10.594 81.775  1.00 35.95  ? 86   VAL B O   1 
ATOM   3029  C CB  . VAL B  1 87  ? 17.521  -9.616  83.034  1.00 39.21  ? 86   VAL B CB  1 
ATOM   3030  C CG1 . VAL B  1 87  ? 17.049  -10.981 83.536  1.00 36.19  ? 86   VAL B CG1 1 
ATOM   3031  C CG2 . VAL B  1 87  ? 16.637  -8.510  83.570  1.00 23.91  ? 86   VAL B CG2 1 
ATOM   3032  N N   . GLN B  1 88  ? 20.267  -11.374 83.877  1.00 30.69  ? 87   GLN B N   1 
ATOM   3033  C CA  . GLN B  1 88  ? 21.128  -12.492 83.537  1.00 39.89  ? 87   GLN B CA  1 
ATOM   3034  C C   . GLN B  1 88  ? 20.672  -13.742 84.266  1.00 34.43  ? 87   GLN B C   1 
ATOM   3035  O O   . GLN B  1 88  ? 20.203  -13.675 85.393  1.00 40.13  ? 87   GLN B O   1 
ATOM   3036  C CB  . GLN B  1 88  ? 22.572  -12.162 83.902  1.00 35.92  ? 87   GLN B CB  1 
ATOM   3037  C CG  . GLN B  1 88  ? 23.071  -10.880 83.242  1.00 57.68  ? 87   GLN B CG  1 
ATOM   3038  C CD  . GLN B  1 88  ? 24.359  -10.350 83.857  1.00 71.04  ? 87   GLN B CD  1 
ATOM   3039  O OE1 . GLN B  1 88  ? 24.860  -10.889 84.847  1.00 76.20  ? 87   GLN B OE1 1 
ATOM   3040  N NE2 . GLN B  1 88  ? 24.899  -9.286  83.272  1.00 65.22  ? 87   GLN B NE2 1 
ATOM   3041  N N   . LEU B  1 89  ? 20.785  -14.882 83.607  1.00 33.27  ? 88   LEU B N   1 
ATOM   3042  C CA  . LEU B  1 89  ? 20.524  -16.162 84.253  1.00 33.80  ? 88   LEU B CA  1 
ATOM   3043  C C   . LEU B  1 89  ? 21.749  -17.038 84.077  1.00 37.69  ? 88   LEU B C   1 
ATOM   3044  O O   . LEU B  1 89  ? 22.409  -16.991 83.033  1.00 36.54  ? 88   LEU B O   1 
ATOM   3045  C CB  . LEU B  1 89  ? 19.307  -16.845 83.636  1.00 33.79  ? 88   LEU B CB  1 
ATOM   3046  C CG  . LEU B  1 89  ? 17.970  -16.129 83.804  1.00 44.14  ? 88   LEU B CG  1 
ATOM   3047  C CD1 . LEU B  1 89  ? 17.838  -15.040 82.765  1.00 34.87  ? 88   LEU B CD1 1 
ATOM   3048  C CD2 . LEU B  1 89  ? 16.816  -17.122 83.701  1.00 34.17  ? 88   LEU B CD2 1 
ATOM   3049  N N   . GLN B  1 90  ? 22.050  -17.842 85.091  1.00 37.26  ? 89   GLN B N   1 
ATOM   3050  C CA  . GLN B  1 90  ? 23.233  -18.685 85.057  1.00 42.44  ? 89   GLN B CA  1 
ATOM   3051  C C   . GLN B  1 90  ? 22.992  -20.059 85.693  1.00 43.99  ? 89   GLN B C   1 
ATOM   3052  O O   . GLN B  1 90  ? 22.478  -20.144 86.810  1.00 38.70  ? 89   GLN B O   1 
ATOM   3053  C CB  . GLN B  1 90  ? 24.365  -17.969 85.778  1.00 42.98  ? 89   GLN B CB  1 
ATOM   3054  C CG  . GLN B  1 90  ? 25.699  -18.681 85.692  1.00 65.62  ? 89   GLN B CG  1 
ATOM   3055  C CD  . GLN B  1 90  ? 26.847  -17.779 86.101  1.00 90.98  ? 89   GLN B CD  1 
ATOM   3056  O OE1 . GLN B  1 90  ? 26.634  -16.659 86.582  1.00 81.71  ? 89   GLN B OE1 1 
ATOM   3057  N NE2 . GLN B  1 90  ? 28.073  -18.259 85.909  1.00 84.10  ? 89   GLN B NE2 1 
ATOM   3058  N N   . LEU B  1 91  ? 23.361  -21.118 84.969  1.00 33.59  ? 90   LEU B N   1 
ATOM   3059  C CA  . LEU B  1 91  ? 23.303  -22.500 85.457  1.00 40.66  ? 90   LEU B CA  1 
ATOM   3060  C C   . LEU B  1 91  ? 24.679  -22.948 85.955  1.00 47.18  ? 90   LEU B C   1 
ATOM   3061  O O   . LEU B  1 91  ? 25.700  -22.407 85.530  1.00 46.39  ? 90   LEU B O   1 
ATOM   3062  C CB  . LEU B  1 91  ? 22.876  -23.459 84.336  1.00 29.40  ? 90   LEU B CB  1 
ATOM   3063  C CG  . LEU B  1 91  ? 21.451  -23.345 83.789  1.00 47.18  ? 90   LEU B CG  1 
ATOM   3064  C CD1 . LEU B  1 91  ? 21.284  -24.210 82.548  1.00 30.76  ? 90   LEU B CD1 1 
ATOM   3065  C CD2 . LEU B  1 91  ? 20.428  -23.733 84.844  1.00 41.73  ? 90   LEU B CD2 1 
ATOM   3066  N N   . PRO B  1 92  ? 24.713  -23.966 86.835  1.00 60.90  ? 91   PRO B N   1 
ATOM   3067  C CA  . PRO B  1 92  ? 25.990  -24.511 87.317  1.00 62.90  ? 91   PRO B CA  1 
ATOM   3068  C C   . PRO B  1 92  ? 26.785  -25.139 86.173  1.00 54.61  ? 91   PRO B C   1 
ATOM   3069  O O   . PRO B  1 92  ? 26.224  -25.881 85.366  1.00 53.46  ? 91   PRO B O   1 
ATOM   3070  C CB  . PRO B  1 92  ? 25.562  -25.594 88.325  1.00 57.10  ? 91   PRO B CB  1 
ATOM   3071  C CG  . PRO B  1 92  ? 24.114  -25.322 88.622  1.00 49.40  ? 91   PRO B CG  1 
ATOM   3072  C CD  . PRO B  1 92  ? 23.567  -24.727 87.360  1.00 57.22  ? 91   PRO B CD  1 
ATOM   3073  N N   . ASP B  1 93  ? 28.079  -24.852 86.106  1.00 59.88  ? 92   ASP B N   1 
ATOM   3074  C CA  . ASP B  1 93  ? 28.887  -25.294 84.978  1.00 55.36  ? 92   ASP B CA  1 
ATOM   3075  C C   . ASP B  1 93  ? 28.979  -26.814 84.905  1.00 75.20  ? 92   ASP B C   1 
ATOM   3076  O O   . ASP B  1 93  ? 29.265  -27.372 83.845  1.00 79.47  ? 92   ASP B O   1 
ATOM   3077  C CB  . ASP B  1 93  ? 30.286  -24.694 85.074  1.00 73.60  ? 92   ASP B CB  1 
ATOM   3078  C CG  . ASP B  1 93  ? 30.850  -24.331 83.722  1.00 92.29  ? 92   ASP B CG  1 
ATOM   3079  O OD1 . ASP B  1 93  ? 30.597  -23.195 83.262  1.00 101.84 ? 92   ASP B OD1 1 
ATOM   3080  O OD2 . ASP B  1 93  ? 31.539  -25.181 83.117  1.00 82.69  ? 92   ASP B OD2 1 
ATOM   3081  N N   . ASN B  1 94  ? 28.723  -27.479 86.028  1.00 61.90  ? 93   ASN B N   1 
ATOM   3082  C CA  . ASN B  1 94  ? 28.894  -28.928 86.113  1.00 72.40  ? 93   ASN B CA  1 
ATOM   3083  C C   . ASN B  1 94  ? 27.596  -29.743 86.068  1.00 71.31  ? 93   ASN B C   1 
ATOM   3084  O O   . ASN B  1 94  ? 27.640  -30.971 86.139  1.00 74.84  ? 93   ASN B O   1 
ATOM   3085  C CB  . ASN B  1 94  ? 29.685  -29.294 87.374  1.00 66.88  ? 93   ASN B CB  1 
ATOM   3086  C CG  . ASN B  1 94  ? 29.122  -28.650 88.624  1.00 88.74  ? 93   ASN B CG  1 
ATOM   3087  O OD1 . ASN B  1 94  ? 28.010  -28.124 88.618  1.00 90.32  ? 93   ASN B OD1 1 
ATOM   3088  N ND2 . ASN B  1 94  ? 29.889  -28.693 89.710  1.00 100.82 ? 93   ASN B ND2 1 
ATOM   3089  N N   . GLU B  1 95  ? 26.450  -29.079 85.948  1.00 70.31  ? 94   GLU B N   1 
ATOM   3090  C CA  . GLU B  1 95  ? 25.179  -29.784 85.777  1.00 59.15  ? 94   GLU B CA  1 
ATOM   3091  C C   . GLU B  1 95  ? 24.941  -29.987 84.289  1.00 56.16  ? 94   GLU B C   1 
ATOM   3092  O O   . GLU B  1 95  ? 25.613  -29.358 83.475  1.00 49.00  ? 94   GLU B O   1 
ATOM   3093  C CB  . GLU B  1 95  ? 24.038  -28.975 86.365  1.00 69.45  ? 94   GLU B CB  1 
ATOM   3094  C CG  . GLU B  1 95  ? 24.327  -28.443 87.745  1.00 105.27 ? 94   GLU B CG  1 
ATOM   3095  C CD  . GLU B  1 95  ? 23.675  -29.249 88.849  1.00 98.22  ? 94   GLU B CD  1 
ATOM   3096  O OE1 . GLU B  1 95  ? 24.143  -29.151 90.006  1.00 93.60  ? 94   GLU B OE1 1 
ATOM   3097  O OE2 . GLU B  1 95  ? 22.687  -29.962 88.568  1.00 105.38 ? 94   GLU B OE2 1 
ATOM   3098  N N   . VAL B  1 96  ? 23.992  -30.844 83.921  1.00 40.61  ? 95   VAL B N   1 
ATOM   3099  C CA  . VAL B  1 96  ? 23.791  -31.143 82.500  1.00 43.77  ? 95   VAL B CA  1 
ATOM   3100  C C   . VAL B  1 96  ? 22.601  -30.395 81.894  1.00 43.31  ? 95   VAL B C   1 
ATOM   3101  O O   . VAL B  1 96  ? 22.355  -30.495 80.691  1.00 44.41  ? 95   VAL B O   1 
ATOM   3102  C CB  . VAL B  1 96  ? 23.647  -32.672 82.225  1.00 51.00  ? 95   VAL B CB  1 
ATOM   3103  C CG1 . VAL B  1 96  ? 24.878  -33.418 82.712  1.00 61.40  ? 95   VAL B CG1 1 
ATOM   3104  C CG2 . VAL B  1 96  ? 22.397  -33.235 82.866  1.00 34.71  ? 95   VAL B CG2 1 
ATOM   3105  N N   . ALA B  1 97  ? 21.860  -29.657 82.717  1.00 38.32  ? 96   ALA B N   1 
ATOM   3106  C CA  . ALA B  1 97  ? 20.833  -28.757 82.192  1.00 45.60  ? 96   ALA B CA  1 
ATOM   3107  C C   . ALA B  1 97  ? 21.479  -27.699 81.281  1.00 40.32  ? 96   ALA B C   1 
ATOM   3108  O O   . ALA B  1 97  ? 22.537  -27.165 81.597  1.00 28.94  ? 96   ALA B O   1 
ATOM   3109  C CB  . ALA B  1 97  ? 20.087  -28.090 83.323  1.00 31.61  ? 96   ALA B CB  1 
ATOM   3110  N N   . GLN B  1 98  ? 20.840  -27.399 80.155  1.00 30.02  ? 97   GLN B N   1 
ATOM   3111  C CA  . GLN B  1 98  ? 21.394  -26.445 79.199  1.00 35.09  ? 97   GLN B CA  1 
ATOM   3112  C C   . GLN B  1 98  ? 20.414  -25.354 78.797  1.00 40.75  ? 97   GLN B C   1 
ATOM   3113  O O   . GLN B  1 98  ? 19.207  -25.579 78.713  1.00 32.99  ? 97   GLN B O   1 
ATOM   3114  C CB  . GLN B  1 98  ? 21.839  -27.168 77.931  1.00 38.20  ? 97   GLN B CB  1 
ATOM   3115  C CG  . GLN B  1 98  ? 22.984  -28.138 78.125  1.00 37.50  ? 97   GLN B CG  1 
ATOM   3116  C CD  . GLN B  1 98  ? 23.333  -28.841 76.845  1.00 41.54  ? 97   GLN B CD  1 
ATOM   3117  O OE1 . GLN B  1 98  ? 22.539  -29.630 76.323  1.00 35.32  ? 97   GLN B OE1 1 
ATOM   3118  N NE2 . GLN B  1 98  ? 24.510  -28.538 76.302  1.00 35.45  ? 97   GLN B NE2 1 
ATOM   3119  N N   . ILE B  1 99  ? 20.952  -24.166 78.540  1.00 38.71  ? 98   ILE B N   1 
ATOM   3120  C CA  . ILE B  1 99  ? 20.192  -23.110 77.896  1.00 30.39  ? 98   ILE B CA  1 
ATOM   3121  C C   . ILE B  1 99  ? 20.055  -23.470 76.423  1.00 29.50  ? 98   ILE B C   1 
ATOM   3122  O O   . ILE B  1 99  ? 21.031  -23.747 75.748  1.00 35.23  ? 98   ILE B O   1 
ATOM   3123  C CB  . ILE B  1 99  ? 20.867  -21.750 78.080  1.00 38.08  ? 98   ILE B CB  1 
ATOM   3124  C CG1 . ILE B  1 99  ? 20.735  -21.325 79.548  1.00 30.47  ? 98   ILE B CG1 1 
ATOM   3125  C CG2 . ILE B  1 99  ? 20.236  -20.711 77.158  1.00 22.92  ? 98   ILE B CG2 1 
ATOM   3126  C CD1 . ILE B  1 99  ? 21.464  -20.069 79.886  1.00 45.23  ? 98   ILE B CD1 1 
ATOM   3127  N N   . SER B  1 100 ? 18.823  -23.473 75.944  1.00 34.37  ? 99   SER B N   1 
ATOM   3128  C CA  . SER B  1 100 ? 18.487  -24.012 74.636  1.00 37.11  ? 99   SER B CA  1 
ATOM   3129  C C   . SER B  1 100 ? 18.019  -22.903 73.696  1.00 31.94  ? 99   SER B C   1 
ATOM   3130  O O   . SER B  1 100 ? 18.293  -22.927 72.500  1.00 44.89  ? 99   SER B O   1 
ATOM   3131  C CB  . SER B  1 100 ? 17.369  -25.060 74.798  1.00 32.24  ? 99   SER B CB  1 
ATOM   3132  O OG  . SER B  1 100 ? 16.758  -25.352 73.552  1.00 57.02  ? 99   SER B OG  1 
ATOM   3133  N N   . ASP B  1 101 ? 17.289  -21.939 74.245  1.00 34.07  ? 100  ASP B N   1 
ATOM   3134  C CA  . ASP B  1 101 ? 16.770  -20.836 73.455  1.00 32.91  ? 100  ASP B CA  1 
ATOM   3135  C C   . ASP B  1 101 ? 16.476  -19.633 74.352  1.00 29.42  ? 100  ASP B C   1 
ATOM   3136  O O   . ASP B  1 101 ? 16.544  -19.720 75.576  1.00 31.75  ? 100  ASP B O   1 
ATOM   3137  C CB  . ASP B  1 101 ? 15.513  -21.266 72.693  1.00 27.45  ? 100  ASP B CB  1 
ATOM   3138  C CG  . ASP B  1 101 ? 15.343  -20.529 71.363  1.00 51.68  ? 100  ASP B CG  1 
ATOM   3139  O OD1 . ASP B  1 101 ? 14.455  -20.932 70.583  1.00 44.90  ? 100  ASP B OD1 1 
ATOM   3140  O OD2 . ASP B  1 101 ? 16.099  -19.563 71.084  1.00 43.92  ? 100  ASP B OD2 1 
ATOM   3141  N N   . TYR B  1 102 ? 16.159  -18.509 73.728  1.00 28.85  ? 101  TYR B N   1 
ATOM   3142  C CA  . TYR B  1 102 ? 15.991  -17.248 74.434  1.00 22.85  ? 101  TYR B CA  1 
ATOM   3143  C C   . TYR B  1 102 ? 15.312  -16.271 73.487  1.00 37.27  ? 101  TYR B C   1 
ATOM   3144  O O   . TYR B  1 102 ? 15.463  -16.366 72.257  1.00 30.40  ? 101  TYR B O   1 
ATOM   3145  C CB  . TYR B  1 102 ? 17.354  -16.716 74.875  1.00 26.07  ? 101  TYR B CB  1 
ATOM   3146  C CG  . TYR B  1 102 ? 18.468  -17.223 73.992  1.00 29.55  ? 101  TYR B CG  1 
ATOM   3147  C CD1 . TYR B  1 102 ? 19.323  -18.217 74.434  1.00 26.75  ? 101  TYR B CD1 1 
ATOM   3148  C CD2 . TYR B  1 102 ? 18.639  -16.736 72.699  1.00 33.71  ? 101  TYR B CD2 1 
ATOM   3149  C CE1 . TYR B  1 102 ? 20.332  -18.715 73.622  1.00 31.09  ? 101  TYR B CE1 1 
ATOM   3150  C CE2 . TYR B  1 102 ? 19.655  -17.226 71.870  1.00 34.76  ? 101  TYR B CE2 1 
ATOM   3151  C CZ  . TYR B  1 102 ? 20.497  -18.208 72.343  1.00 35.97  ? 101  TYR B CZ  1 
ATOM   3152  O OH  . TYR B  1 102 ? 21.493  -18.703 71.535  1.00 38.25  ? 101  TYR B OH  1 
ATOM   3153  N N   . TYR B  1 103 ? 14.555  -15.342 74.057  1.00 33.74  ? 102  TYR B N   1 
ATOM   3154  C CA  . TYR B  1 103 ? 13.865  -14.331 73.268  1.00 34.14  ? 102  TYR B CA  1 
ATOM   3155  C C   . TYR B  1 103 ? 13.648  -13.102 74.147  1.00 32.65  ? 102  TYR B C   1 
ATOM   3156  O O   . TYR B  1 103 ? 13.314  -13.246 75.320  1.00 39.35  ? 102  TYR B O   1 
ATOM   3157  C CB  . TYR B  1 103 ? 12.524  -14.880 72.764  1.00 28.58  ? 102  TYR B CB  1 
ATOM   3158  C CG  . TYR B  1 103 ? 11.886  -13.993 71.727  1.00 33.37  ? 102  TYR B CG  1 
ATOM   3159  C CD1 . TYR B  1 103 ? 12.273  -14.064 70.401  1.00 41.13  ? 102  TYR B CD1 1 
ATOM   3160  C CD2 . TYR B  1 103 ? 10.919  -13.062 72.080  1.00 47.06  ? 102  TYR B CD2 1 
ATOM   3161  C CE1 . TYR B  1 103 ? 11.710  -13.248 69.450  1.00 48.17  ? 102  TYR B CE1 1 
ATOM   3162  C CE2 . TYR B  1 103 ? 10.346  -12.235 71.134  1.00 41.98  ? 102  TYR B CE2 1 
ATOM   3163  C CZ  . TYR B  1 103 ? 10.746  -12.333 69.822  1.00 53.78  ? 102  TYR B CZ  1 
ATOM   3164  O OH  . TYR B  1 103 ? 10.178  -11.509 68.877  1.00 61.44  ? 102  TYR B OH  1 
ATOM   3165  N N   . PRO B  1 104 ? 13.836  -11.887 73.594  1.00 30.99  ? 103  PRO B N   1 
ATOM   3166  C CA  . PRO B  1 104 ? 14.175  -11.548 72.202  1.00 31.22  ? 103  PRO B CA  1 
ATOM   3167  C C   . PRO B  1 104 ? 15.658  -11.707 71.868  1.00 35.43  ? 103  PRO B C   1 
ATOM   3168  O O   . PRO B  1 104 ? 16.475  -11.971 72.743  1.00 33.65  ? 103  PRO B O   1 
ATOM   3169  C CB  . PRO B  1 104 ? 13.807  -10.074 72.110  1.00 33.56  ? 103  PRO B CB  1 
ATOM   3170  C CG  . PRO B  1 104 ? 14.098  -9.538  73.497  1.00 30.20  ? 103  PRO B CG  1 
ATOM   3171  C CD  . PRO B  1 104 ? 13.739  -10.685 74.442  1.00 28.78  ? 103  PRO B CD  1 
ATOM   3172  N N   . ARG B  1 105 ? 15.986  -11.534 70.593  1.00 32.59  ? 104  ARG B N   1 
ATOM   3173  C CA  . ARG B  1 105 ? 17.358  -11.644 70.115  1.00 39.25  ? 104  ARG B CA  1 
ATOM   3174  C C   . ARG B  1 105 ? 17.735  -10.353 69.399  1.00 33.06  ? 104  ARG B C   1 
ATOM   3175  O O   . ARG B  1 105 ? 16.949  -9.410  69.358  1.00 39.73  ? 104  ARG B O   1 
ATOM   3176  C CB  . ARG B  1 105 ? 17.484  -12.846 69.183  1.00 29.42  ? 104  ARG B CB  1 
ATOM   3177  C CG  . ARG B  1 105 ? 16.735  -14.050 69.722  1.00 42.11  ? 104  ARG B CG  1 
ATOM   3178  C CD  . ARG B  1 105 ? 16.826  -15.235 68.806  1.00 41.49  ? 104  ARG B CD  1 
ATOM   3179  N NE  . ARG B  1 105 ? 16.051  -16.361 69.319  1.00 44.98  ? 104  ARG B NE  1 
ATOM   3180  C CZ  . ARG B  1 105 ? 14.845  -16.712 68.880  1.00 43.38  ? 104  ARG B CZ  1 
ATOM   3181  N NH1 . ARG B  1 105 ? 14.232  -17.752 69.413  1.00 31.98  ? 104  ARG B NH1 1 
ATOM   3182  N NH2 . ARG B  1 105 ? 14.253  -16.034 67.906  1.00 42.66  ? 104  ARG B NH2 1 
ATOM   3183  N N   . ASN B  1 106 ? 18.933  -10.289 68.837  1.00 37.44  ? 105  ASN B N   1 
ATOM   3184  C CA  . ASN B  1 106 ? 19.368  -9.057  68.180  1.00 39.60  ? 105  ASN B CA  1 
ATOM   3185  C C   . ASN B  1 106 ? 18.849  -8.992  66.762  1.00 29.65  ? 105  ASN B C   1 
ATOM   3186  O O   . ASN B  1 106 ? 19.072  -9.899  65.978  1.00 44.92  ? 105  ASN B O   1 
ATOM   3187  C CB  . ASN B  1 106 ? 20.887  -8.943  68.194  1.00 26.07  ? 105  ASN B CB  1 
ATOM   3188  C CG  . ASN B  1 106 ? 21.434  -8.884  69.595  1.00 35.68  ? 105  ASN B CG  1 
ATOM   3189  O OD1 . ASN B  1 106 ? 20.838  -8.261  70.470  1.00 33.84  ? 105  ASN B OD1 1 
ATOM   3190  N ND2 . ASN B  1 106 ? 22.558  -9.544  69.827  1.00 37.94  ? 105  ASN B ND2 1 
ATOM   3191  N N   . SER B  1 107 ? 18.141  -7.918  66.440  1.00 39.27  ? 106  SER B N   1 
ATOM   3192  C CA  . SER B  1 107 ? 17.588  -7.759  65.107  1.00 43.67  ? 106  SER B CA  1 
ATOM   3193  C C   . SER B  1 107 ? 18.529  -6.914  64.265  1.00 41.16  ? 106  SER B C   1 
ATOM   3194  O O   . SER B  1 107 ? 19.298  -6.096  64.786  1.00 34.94  ? 106  SER B O   1 
ATOM   3195  C CB  . SER B  1 107 ? 16.197  -7.124  65.165  1.00 48.10  ? 106  SER B CB  1 
ATOM   3196  O OG  . SER B  1 107 ? 16.239  -5.889  65.852  1.00 74.71  ? 106  SER B OG  1 
ATOM   3197  N N   . ILE B  1 108 ? 18.479  -7.137  62.960  1.00 42.83  ? 107  ILE B N   1 
ATOM   3198  C CA  . ILE B  1 108 ? 19.269  -6.358  62.027  1.00 43.39  ? 107  ILE B CA  1 
ATOM   3199  C C   . ILE B  1 108 ? 18.591  -5.007  61.802  1.00 40.77  ? 107  ILE B C   1 
ATOM   3200  O O   . ILE B  1 108 ? 17.418  -4.942  61.435  1.00 43.74  ? 107  ILE B O   1 
ATOM   3201  C CB  . ILE B  1 108 ? 19.417  -7.107  60.705  1.00 37.67  ? 107  ILE B CB  1 
ATOM   3202  C CG1 . ILE B  1 108 ? 20.130  -8.442  60.947  1.00 41.05  ? 107  ILE B CG1 1 
ATOM   3203  C CG2 . ILE B  1 108 ? 20.181  -6.258  59.698  1.00 40.07  ? 107  ILE B CG2 1 
ATOM   3204  C CD1 . ILE B  1 108 ? 20.218  -9.330  59.716  1.00 47.31  ? 107  ILE B CD1 1 
ATOM   3205  N N   . ASP B  1 109 ? 19.335  -3.931  62.029  1.00 44.84  ? 108  ASP B N   1 
ATOM   3206  C CA  . ASP B  1 109 ? 18.813  -2.581  61.832  1.00 34.57  ? 108  ASP B CA  1 
ATOM   3207  C C   . ASP B  1 109 ? 18.860  -2.150  60.366  1.00 49.37  ? 108  ASP B C   1 
ATOM   3208  O O   . ASP B  1 109 ? 19.638  -2.691  59.568  1.00 41.19  ? 108  ASP B O   1 
ATOM   3209  C CB  . ASP B  1 109 ? 19.605  -1.592  62.677  1.00 49.21  ? 108  ASP B CB  1 
ATOM   3210  C CG  . ASP B  1 109 ? 18.721  -0.545  63.319  1.00 86.13  ? 108  ASP B CG  1 
ATOM   3211  O OD1 . ASP B  1 109 ? 17.615  -0.282  62.787  1.00 76.12  ? 108  ASP B OD1 1 
ATOM   3212  O OD2 . ASP B  1 109 ? 19.133  0.014   64.358  1.00 104.40 ? 108  ASP B OD2 1 
ATOM   3213  N N   . THR B  1 110 ? 18.025  -1.179  60.007  1.00 33.54  ? 109  THR B N   1 
ATOM   3214  C CA  . THR B  1 110 ? 17.971  -0.708  58.628  1.00 49.02  ? 109  THR B CA  1 
ATOM   3215  C C   . THR B  1 110 ? 17.967  0.809   58.569  1.00 49.02  ? 109  THR B C   1 
ATOM   3216  O O   . THR B  1 110 ? 17.777  1.484   59.577  1.00 43.37  ? 109  THR B O   1 
ATOM   3217  C CB  . THR B  1 110 ? 16.715  -1.218  57.891  1.00 56.88  ? 109  THR B CB  1 
ATOM   3218  O OG1 . THR B  1 110 ? 15.547  -0.639  58.486  1.00 54.39  ? 109  THR B OG1 1 
ATOM   3219  C CG2 . THR B  1 110 ? 16.622  -2.740  57.961  1.00 58.65  ? 109  THR B CG2 1 
ATOM   3220  N N   . LYS B  1 111 ? 18.189  1.338   57.373  1.00 37.41  ? 110  LYS B N   1 
ATOM   3221  C CA  . LYS B  1 111 ? 18.130  2.771   57.146  1.00 41.35  ? 110  LYS B CA  1 
ATOM   3222  C C   . LYS B  1 111 ? 17.650  3.026   55.727  1.00 40.14  ? 110  LYS B C   1 
ATOM   3223  O O   . LYS B  1 111 ? 17.729  2.153   54.865  1.00 43.52  ? 110  LYS B O   1 
ATOM   3224  C CB  . LYS B  1 111 ? 19.502  3.403   57.371  1.00 42.25  ? 110  LYS B CB  1 
ATOM   3225  C CG  . LYS B  1 111 ? 20.613  2.753   56.557  1.00 49.48  ? 110  LYS B CG  1 
ATOM   3226  C CD  . LYS B  1 111 ? 21.883  2.642   57.375  1.00 56.96  ? 110  LYS B CD  1 
ATOM   3227  C CE  . LYS B  1 111 ? 22.873  1.677   56.750  1.00 61.09  ? 110  LYS B CE  1 
ATOM   3228  N NZ  . LYS B  1 111 ? 22.395  0.262   56.747  1.00 48.54  ? 110  LYS B NZ  1 
ATOM   3229  N N   . GLU B  1 112 ? 17.138  4.224   55.494  1.00 37.02  ? 111  GLU B N   1 
ATOM   3230  C CA  . GLU B  1 112 ? 16.641  4.615   54.188  1.00 37.41  ? 111  GLU B CA  1 
ATOM   3231  C C   . GLU B  1 112 ? 17.613  5.614   53.569  1.00 42.17  ? 111  GLU B C   1 
ATOM   3232  O O   . GLU B  1 112 ? 18.061  6.558   54.229  1.00 33.42  ? 111  GLU B O   1 
ATOM   3233  C CB  . GLU B  1 112 ? 15.245  5.225   54.329  1.00 44.31  ? 111  GLU B CB  1 
ATOM   3234  C CG  . GLU B  1 112 ? 14.575  5.617   53.027  1.00 60.69  ? 111  GLU B CG  1 
ATOM   3235  C CD  . GLU B  1 112 ? 13.152  6.116   53.239  1.00 84.84  ? 111  GLU B CD  1 
ATOM   3236  O OE1 . GLU B  1 112 ? 12.864  7.278   52.877  1.00 86.41  ? 111  GLU B OE1 1 
ATOM   3237  O OE2 . GLU B  1 112 ? 12.321  5.345   53.768  1.00 90.12  ? 111  GLU B OE2 1 
ATOM   3238  N N   . TYR B  1 113 ? 17.945  5.395   52.301  1.00 38.36  ? 112  TYR B N   1 
ATOM   3239  C CA  . TYR B  1 113 ? 18.863  6.260   51.585  1.00 42.54  ? 112  TYR B CA  1 
ATOM   3240  C C   . TYR B  1 113 ? 18.157  6.861   50.377  1.00 49.66  ? 112  TYR B C   1 
ATOM   3241  O O   . TYR B  1 113 ? 17.396  6.174   49.696  1.00 40.90  ? 112  TYR B O   1 
ATOM   3242  C CB  . TYR B  1 113 ? 20.104  5.483   51.144  1.00 43.01  ? 112  TYR B CB  1 
ATOM   3243  C CG  . TYR B  1 113 ? 21.280  6.383   50.838  1.00 63.49  ? 112  TYR B CG  1 
ATOM   3244  C CD1 . TYR B  1 113 ? 22.042  6.932   51.866  1.00 73.40  ? 112  TYR B CD1 1 
ATOM   3245  C CD2 . TYR B  1 113 ? 21.621  6.699   49.528  1.00 68.51  ? 112  TYR B CD2 1 
ATOM   3246  C CE1 . TYR B  1 113 ? 23.117  7.768   51.598  1.00 81.13  ? 112  TYR B CE1 1 
ATOM   3247  C CE2 . TYR B  1 113 ? 22.695  7.533   49.248  1.00 68.73  ? 112  TYR B CE2 1 
ATOM   3248  C CZ  . TYR B  1 113 ? 23.441  8.064   50.288  1.00 87.75  ? 112  TYR B CZ  1 
ATOM   3249  O OH  . TYR B  1 113 ? 24.514  8.892   50.021  1.00 98.31  ? 112  TYR B OH  1 
ATOM   3250  N N   . MET B  1 114 ? 18.395  8.151   50.137  1.00 40.88  ? 113  MET B N   1 
ATOM   3251  C CA  . MET B  1 114 ? 17.845  8.843   48.978  1.00 45.51  ? 113  MET B CA  1 
ATOM   3252  C C   . MET B  1 114 ? 18.922  9.646   48.273  1.00 50.32  ? 113  MET B C   1 
ATOM   3253  O O   . MET B  1 114 ? 19.688  10.352  48.919  1.00 46.17  ? 113  MET B O   1 
ATOM   3254  C CB  . MET B  1 114 ? 16.753  9.815   49.394  1.00 43.25  ? 113  MET B CB  1 
ATOM   3255  C CG  . MET B  1 114 ? 15.555  9.178   50.037  1.00 67.85  ? 113  MET B CG  1 
ATOM   3256  S SD  . MET B  1 114 ? 14.338  10.428  50.477  1.00 106.43 ? 113  MET B SD  1 
ATOM   3257  C CE  . MET B  1 114 ? 13.978  11.115  48.862  1.00 62.24  ? 113  MET B CE  1 
ATOM   3258  N N   . SER B  1 115 ? 18.967  9.542   46.948  1.00 59.73  ? 114  SER B N   1 
ATOM   3259  C CA  . SER B  1 115 ? 19.857  10.358  46.127  1.00 61.75  ? 114  SER B CA  1 
ATOM   3260  C C   . SER B  1 115 ? 19.013  11.198  45.174  1.00 55.72  ? 114  SER B C   1 
ATOM   3261  O O   . SER B  1 115 ? 18.011  10.729  44.635  1.00 54.80  ? 114  SER B O   1 
ATOM   3262  C CB  . SER B  1 115 ? 20.827  9.474   45.331  1.00 57.14  ? 114  SER B CB  1 
ATOM   3263  O OG  . SER B  1 115 ? 21.725  8.796   46.193  1.00 86.46  ? 114  SER B OG  1 
ATOM   3264  N N   . THR B  1 116 ? 19.421  12.441  44.966  1.00 49.08  ? 115  THR B N   1 
ATOM   3265  C CA  . THR B  1 116 ? 18.683  13.354  44.105  1.00 44.45  ? 115  THR B CA  1 
ATOM   3266  C C   . THR B  1 116 ? 19.617  14.079  43.147  1.00 45.15  ? 115  THR B C   1 
ATOM   3267  O O   . THR B  1 116 ? 20.687  14.539  43.535  1.00 50.22  ? 115  THR B O   1 
ATOM   3268  C CB  . THR B  1 116 ? 17.918  14.389  44.936  1.00 50.79  ? 115  THR B CB  1 
ATOM   3269  O OG1 . THR B  1 116 ? 16.944  13.716  45.743  1.00 65.23  ? 115  THR B OG1 1 
ATOM   3270  C CG2 . THR B  1 116 ? 17.217  15.393  44.041  1.00 50.70  ? 115  THR B CG2 1 
ATOM   3271  N N   . LEU B  1 117 ? 19.197  14.171  41.892  1.00 56.62  ? 116  LEU B N   1 
ATOM   3272  C CA  . LEU B  1 117 ? 19.924  14.913  40.872  1.00 54.33  ? 116  LEU B CA  1 
ATOM   3273  C C   . LEU B  1 117 ? 18.954  15.902  40.241  1.00 55.81  ? 116  LEU B C   1 
ATOM   3274  O O   . LEU B  1 117 ? 17.891  15.526  39.755  1.00 54.82  ? 116  LEU B O   1 
ATOM   3275  C CB  . LEU B  1 117 ? 20.494  13.950  39.825  1.00 54.76  ? 116  LEU B CB  1 
ATOM   3276  C CG  . LEU B  1 117 ? 21.305  14.530  38.662  1.00 66.00  ? 116  LEU B CG  1 
ATOM   3277  C CD1 . LEU B  1 117 ? 20.385  15.062  37.581  1.00 77.91  ? 116  LEU B CD1 1 
ATOM   3278  C CD2 . LEU B  1 117 ? 22.260  15.612  39.147  1.00 64.02  ? 116  LEU B CD2 1 
ATOM   3279  N N   . THR B  1 118 ? 19.311  17.175  40.269  1.00 46.16  ? 117  THR B N   1 
ATOM   3280  C CA  . THR B  1 118 ? 18.462  18.204  39.695  1.00 45.25  ? 117  THR B CA  1 
ATOM   3281  C C   . THR B  1 118 ? 19.280  19.095  38.779  1.00 50.11  ? 117  THR B C   1 
ATOM   3282  O O   . THR B  1 118 ? 20.436  19.392  39.056  1.00 57.60  ? 117  THR B O   1 
ATOM   3283  C CB  . THR B  1 118 ? 17.848  19.086  40.785  1.00 55.37  ? 117  THR B CB  1 
ATOM   3284  O OG1 . THR B  1 118 ? 17.149  18.264  41.724  1.00 69.99  ? 117  THR B OG1 1 
ATOM   3285  C CG2 . THR B  1 118 ? 16.883  20.092  40.183  1.00 48.57  ? 117  THR B CG2 1 
ATOM   3286  N N   . TYR B  1 119 ? 18.688  19.515  37.674  1.00 54.69  ? 118  TYR B N   1 
ATOM   3287  C CA  . TYR B  1 119 ? 19.308  20.544  36.852  1.00 57.57  ? 118  TYR B CA  1 
ATOM   3288  C C   . TYR B  1 119 ? 18.227  21.447  36.301  1.00 49.09  ? 118  TYR B C   1 
ATOM   3289  O O   . TYR B  1 119 ? 17.088  21.031  36.114  1.00 48.53  ? 118  TYR B O   1 
ATOM   3290  C CB  . TYR B  1 119 ? 20.170  19.937  35.738  1.00 50.42  ? 118  TYR B CB  1 
ATOM   3291  C CG  . TYR B  1 119 ? 19.468  18.923  34.870  1.00 56.85  ? 118  TYR B CG  1 
ATOM   3292  C CD1 . TYR B  1 119 ? 18.869  19.301  33.679  1.00 67.50  ? 118  TYR B CD1 1 
ATOM   3293  C CD2 . TYR B  1 119 ? 19.414  17.585  35.235  1.00 63.24  ? 118  TYR B CD2 1 
ATOM   3294  C CE1 . TYR B  1 119 ? 18.225  18.378  32.876  1.00 74.56  ? 118  TYR B CE1 1 
ATOM   3295  C CE2 . TYR B  1 119 ? 18.774  16.652  34.441  1.00 77.91  ? 118  TYR B CE2 1 
ATOM   3296  C CZ  . TYR B  1 119 ? 18.180  17.054  33.261  1.00 85.84  ? 118  TYR B CZ  1 
ATOM   3297  O OH  . TYR B  1 119 ? 17.540  16.130  32.463  1.00 96.07  ? 118  TYR B OH  1 
ATOM   3298  N N   . GLY B  1 120 ? 18.579  22.700  36.066  1.00 49.87  ? 119  GLY B N   1 
ATOM   3299  C CA  . GLY B  1 120 ? 17.617  23.656  35.564  1.00 53.92  ? 119  GLY B CA  1 
ATOM   3300  C C   . GLY B  1 120 ? 18.251  24.698  34.672  1.00 54.38  ? 119  GLY B C   1 
ATOM   3301  O O   . GLY B  1 120 ? 19.472  24.829  34.606  1.00 48.40  ? 119  GLY B O   1 
ATOM   3302  N N   . PHE B  1 121 ? 17.394  25.437  33.982  1.00 53.55  ? 120  PHE B N   1 
ATOM   3303  C CA  . PHE B  1 121 ? 17.812  26.536  33.139  1.00 54.98  ? 120  PHE B CA  1 
ATOM   3304  C C   . PHE B  1 121 ? 16.882  27.696  33.418  1.00 57.52  ? 120  PHE B C   1 
ATOM   3305  O O   . PHE B  1 121 ? 15.712  27.505  33.746  1.00 50.56  ? 120  PHE B O   1 
ATOM   3306  C CB  . PHE B  1 121 ? 17.736  26.133  31.667  1.00 54.43  ? 120  PHE B CB  1 
ATOM   3307  C CG  . PHE B  1 121 ? 18.542  24.917  31.339  1.00 59.57  ? 120  PHE B CG  1 
ATOM   3308  C CD1 . PHE B  1 121 ? 19.872  25.032  30.976  1.00 61.10  ? 120  PHE B CD1 1 
ATOM   3309  C CD2 . PHE B  1 121 ? 17.973  23.654  31.403  1.00 65.38  ? 120  PHE B CD2 1 
ATOM   3310  C CE1 . PHE B  1 121 ? 20.619  23.911  30.674  1.00 69.17  ? 120  PHE B CE1 1 
ATOM   3311  C CE2 . PHE B  1 121 ? 18.716  22.530  31.103  1.00 64.22  ? 120  PHE B CE2 1 
ATOM   3312  C CZ  . PHE B  1 121 ? 20.042  22.658  30.739  1.00 66.15  ? 120  PHE B CZ  1 
ATOM   3313  N N   . ASN B  1 122 ? 17.406  28.905  33.314  1.00 55.50  ? 121  ASN B N   1 
ATOM   3314  C CA  . ASN B  1 122 ? 16.586  30.084  33.501  1.00 56.47  ? 121  ASN B CA  1 
ATOM   3315  C C   . ASN B  1 122 ? 17.066  31.199  32.595  1.00 64.84  ? 121  ASN B C   1 
ATOM   3316  O O   . ASN B  1 122 ? 18.155  31.134  32.031  1.00 56.34  ? 121  ASN B O   1 
ATOM   3317  C CB  . ASN B  1 122 ? 16.624  30.538  34.957  1.00 51.83  ? 121  ASN B CB  1 
ATOM   3318  C CG  . ASN B  1 122 ? 17.994  31.027  35.378  1.00 53.73  ? 121  ASN B CG  1 
ATOM   3319  O OD1 . ASN B  1 122 ? 18.950  30.254  35.457  1.00 66.33  ? 121  ASN B OD1 1 
ATOM   3320  N ND2 . ASN B  1 122 ? 18.096  32.316  35.655  1.00 66.06  ? 121  ASN B ND2 1 
ATOM   3321  N N   . GLY B  1 123 ? 16.234  32.217  32.448  1.00 57.08  ? 122  GLY B N   1 
ATOM   3322  C CA  . GLY B  1 123 ? 16.590  33.375  31.664  1.00 60.14  ? 122  GLY B CA  1 
ATOM   3323  C C   . GLY B  1 123 ? 15.704  34.534  32.050  1.00 59.93  ? 122  GLY B C   1 
ATOM   3324  O O   . GLY B  1 123 ? 14.644  34.344  32.640  1.00 60.80  ? 122  GLY B O   1 
ATOM   3325  N N   . ASN B  1 124 ? 16.145  35.743  31.738  1.00 57.96  ? 123  ASN B N   1 
ATOM   3326  C CA  . ASN B  1 124 ? 15.308  36.915  31.940  1.00 68.16  ? 123  ASN B CA  1 
ATOM   3327  C C   . ASN B  1 124 ? 15.682  38.034  30.977  1.00 72.09  ? 123  ASN B C   1 
ATOM   3328  O O   . ASN B  1 124 ? 16.744  38.011  30.355  1.00 71.10  ? 123  ASN B O   1 
ATOM   3329  C CB  . ASN B  1 124 ? 15.396  37.407  33.390  1.00 59.09  ? 123  ASN B CB  1 
ATOM   3330  C CG  . ASN B  1 124 ? 16.727  38.065  33.712  1.00 74.21  ? 123  ASN B CG  1 
ATOM   3331  O OD1 . ASN B  1 124 ? 17.325  38.730  32.866  1.00 83.57  ? 123  ASN B OD1 1 
ATOM   3332  N ND2 . ASN B  1 124 ? 17.199  37.879  34.942  1.00 72.21  ? 123  ASN B ND2 1 
ATOM   3333  N N   . VAL B  1 125 ? 14.785  39.003  30.848  1.00 63.86  ? 124  VAL B N   1 
ATOM   3334  C CA  . VAL B  1 125 ? 15.052  40.214  30.095  1.00 65.51  ? 124  VAL B CA  1 
ATOM   3335  C C   . VAL B  1 125 ? 14.686  41.382  30.986  1.00 64.16  ? 124  VAL B C   1 
ATOM   3336  O O   . VAL B  1 125 ? 13.672  41.347  31.677  1.00 62.45  ? 124  VAL B O   1 
ATOM   3337  C CB  . VAL B  1 125 ? 14.223  40.283  28.802  1.00 66.71  ? 124  VAL B CB  1 
ATOM   3338  C CG1 . VAL B  1 125 ? 14.669  39.204  27.832  1.00 62.50  ? 124  VAL B CG1 1 
ATOM   3339  C CG2 . VAL B  1 125 ? 12.740  40.144  29.114  1.00 70.52  ? 124  VAL B CG2 1 
ATOM   3340  N N   . THR B  1 126 ? 15.512  42.418  30.969  1.00 59.65  ? 125  THR B N   1 
ATOM   3341  C CA  . THR B  1 126 ? 15.317  43.560  31.850  1.00 66.50  ? 125  THR B CA  1 
ATOM   3342  C C   . THR B  1 126 ? 15.317  44.876  31.070  1.00 75.84  ? 125  THR B C   1 
ATOM   3343  O O   . THR B  1 126 ? 15.616  44.900  29.877  1.00 71.78  ? 125  THR B O   1 
ATOM   3344  C CB  . THR B  1 126 ? 16.418  43.602  32.922  1.00 72.35  ? 125  THR B CB  1 
ATOM   3345  O OG1 . THR B  1 126 ? 17.687  43.316  32.316  1.00 74.10  ? 125  THR B OG1 1 
ATOM   3346  C CG2 . THR B  1 126 ? 16.146  42.570  34.004  1.00 74.40  ? 125  THR B CG2 1 
ATOM   3347  N N   . GLY B  1 127 ? 14.982  45.965  31.755  1.00 76.20  ? 126  GLY B N   1 
ATOM   3348  C CA  . GLY B  1 127 ? 14.917  47.281  31.143  1.00 72.89  ? 126  GLY B CA  1 
ATOM   3349  C C   . GLY B  1 127 ? 14.700  48.370  32.176  1.00 85.21  ? 126  GLY B C   1 
ATOM   3350  O O   . GLY B  1 127 ? 14.408  48.078  33.335  1.00 75.30  ? 126  GLY B O   1 
ATOM   3351  N N   . ASP B  1 128 ? 14.840  49.626  31.759  1.00 88.69  ? 127  ASP B N   1 
ATOM   3352  C CA  . ASP B  1 128 ? 14.688  50.764  32.665  1.00 76.43  ? 127  ASP B CA  1 
ATOM   3353  C C   . ASP B  1 128 ? 14.058  51.956  31.946  1.00 90.57  ? 127  ASP B C   1 
ATOM   3354  O O   . ASP B  1 128 ? 13.371  51.785  30.939  1.00 91.62  ? 127  ASP B O   1 
ATOM   3355  C CB  . ASP B  1 128 ? 16.050  51.162  33.243  1.00 90.22  ? 127  ASP B CB  1 
ATOM   3356  C CG  . ASP B  1 128 ? 17.078  51.476  32.162  1.00 101.90 ? 127  ASP B CG  1 
ATOM   3357  O OD1 . ASP B  1 128 ? 16.681  51.668  30.994  1.00 90.86  ? 127  ASP B OD1 1 
ATOM   3358  O OD2 . ASP B  1 128 ? 18.286  51.535  32.480  1.00 102.00 ? 127  ASP B OD2 1 
ATOM   3359  N N   . ASP B  1 129 ? 14.289  53.159  32.469  1.00 115.11 ? 128  ASP B N   1 
ATOM   3360  C CA  . ASP B  1 129 ? 13.813  54.389  31.837  1.00 107.50 ? 128  ASP B CA  1 
ATOM   3361  C C   . ASP B  1 129 ? 14.741  54.819  30.707  1.00 107.22 ? 128  ASP B C   1 
ATOM   3362  O O   . ASP B  1 129 ? 14.292  55.305  29.671  1.00 118.08 ? 128  ASP B O   1 
ATOM   3363  C CB  . ASP B  1 129 ? 13.712  55.516  32.865  1.00 112.82 ? 128  ASP B CB  1 
ATOM   3364  C CG  . ASP B  1 129 ? 12.320  55.655  33.442  1.00 114.14 ? 128  ASP B CG  1 
ATOM   3365  O OD1 . ASP B  1 129 ? 11.359  55.201  32.789  1.00 121.87 ? 128  ASP B OD1 1 
ATOM   3366  O OD2 . ASP B  1 129 ? 12.184  56.228  34.543  1.00 126.36 ? 128  ASP B OD2 1 
ATOM   3367  N N   . THR B  1 130 ? 16.040  54.646  30.922  1.00 84.30  ? 129  THR B N   1 
ATOM   3368  C CA  . THR B  1 130 ? 17.041  54.931  29.903  1.00 90.50  ? 129  THR B CA  1 
ATOM   3369  C C   . THR B  1 130 ? 16.650  54.367  28.541  1.00 94.28  ? 129  THR B C   1 
ATOM   3370  O O   . THR B  1 130 ? 16.943  54.961  27.505  1.00 94.00  ? 129  THR B O   1 
ATOM   3371  C CB  . THR B  1 130 ? 18.396  54.306  30.285  1.00 106.72 ? 129  THR B CB  1 
ATOM   3372  O OG1 . THR B  1 130 ? 18.829  54.830  31.547  1.00 108.71 ? 129  THR B OG1 1 
ATOM   3373  C CG2 . THR B  1 130 ? 19.448  54.591  29.215  1.00 97.36  ? 129  THR B CG2 1 
ATOM   3374  N N   . GLY B  1 131 ? 15.995  53.211  28.551  1.00 96.30  ? 130  GLY B N   1 
ATOM   3375  C CA  . GLY B  1 131 ? 15.696  52.492  27.327  1.00 83.77  ? 130  GLY B CA  1 
ATOM   3376  C C   . GLY B  1 131 ? 16.669  51.348  27.125  1.00 79.98  ? 130  GLY B C   1 
ATOM   3377  O O   . GLY B  1 131 ? 16.550  50.580  26.170  1.00 69.82  ? 130  GLY B O   1 
ATOM   3378  N N   . LYS B  1 132 ? 17.636  51.235  28.032  1.00 83.18  ? 131  LYS B N   1 
ATOM   3379  C CA  . LYS B  1 132 ? 18.610  50.150  27.996  1.00 95.50  ? 131  LYS B CA  1 
ATOM   3380  C C   . LYS B  1 132 ? 17.932  48.820  28.307  1.00 89.28  ? 131  LYS B C   1 
ATOM   3381  O O   . LYS B  1 132 ? 17.238  48.690  29.311  1.00 73.95  ? 131  LYS B O   1 
ATOM   3382  C CB  . LYS B  1 132 ? 19.717  50.415  29.014  1.00 95.98  ? 131  LYS B CB  1 
ATOM   3383  C CG  . LYS B  1 132 ? 20.917  49.498  28.886  1.00 93.18  ? 131  LYS B CG  1 
ATOM   3384  C CD  . LYS B  1 132 ? 22.014  49.891  29.867  1.00 100.50 ? 131  LYS B CD  1 
ATOM   3385  C CE  . LYS B  1 132 ? 22.327  51.382  29.797  1.00 119.47 ? 131  LYS B CE  1 
ATOM   3386  N NZ  . LYS B  1 132 ? 22.631  51.839  28.410  1.00 107.13 ? 131  LYS B NZ  1 
ATOM   3387  N N   . ILE B  1 133 ? 18.128  47.834  27.441  1.00 79.81  ? 132  ILE B N   1 
ATOM   3388  C CA  . ILE B  1 133 ? 17.505  46.533  27.631  1.00 76.56  ? 132  ILE B CA  1 
ATOM   3389  C C   . ILE B  1 133 ? 18.563  45.429  27.761  1.00 96.54  ? 132  ILE B C   1 
ATOM   3390  O O   . ILE B  1 133 ? 19.407  45.251  26.880  1.00 86.90  ? 132  ILE B O   1 
ATOM   3391  C CB  . ILE B  1 133 ? 16.500  46.217  26.494  1.00 66.76  ? 132  ILE B CB  1 
ATOM   3392  C CG1 . ILE B  1 133 ? 15.921  44.808  26.670  1.00 81.22  ? 132  ILE B CG1 1 
ATOM   3393  C CG2 . ILE B  1 133 ? 17.166  46.352  25.137  1.00 85.26  ? 132  ILE B CG2 1 
ATOM   3394  C CD1 . ILE B  1 133 ? 14.887  44.429  25.624  1.00 81.86  ? 132  ILE B CD1 1 
ATOM   3395  N N   . GLY B  1 134 ? 18.512  44.705  28.879  1.00 95.67  ? 133  GLY B N   1 
ATOM   3396  C CA  . GLY B  1 134 ? 19.465  43.647  29.161  1.00 92.96  ? 133  GLY B CA  1 
ATOM   3397  C C   . GLY B  1 134 ? 18.835  42.267  29.150  1.00 74.83  ? 133  GLY B C   1 
ATOM   3398  O O   . GLY B  1 134 ? 17.660  42.109  28.824  1.00 83.50  ? 133  GLY B O   1 
ATOM   3399  N N   . GLY B  1 135 ? 19.622  41.263  29.518  1.00 66.34  ? 134  GLY B N   1 
ATOM   3400  C CA  . GLY B  1 135 ? 19.172  39.882  29.477  1.00 87.10  ? 134  GLY B CA  1 
ATOM   3401  C C   . GLY B  1 135 ? 20.143  38.943  30.170  1.00 82.51  ? 134  GLY B C   1 
ATOM   3402  O O   . GLY B  1 135 ? 21.310  39.280  30.364  1.00 77.73  ? 134  GLY B O   1 
ATOM   3403  N N   . LEU B  1 136 ? 19.663  37.757  30.537  1.00 78.27  ? 135  LEU B N   1 
ATOM   3404  C CA  . LEU B  1 136 ? 20.480  36.792  31.266  1.00 60.28  ? 135  LEU B CA  1 
ATOM   3405  C C   . LEU B  1 136 ? 20.081  35.365  30.888  1.00 56.44  ? 135  LEU B C   1 
ATOM   3406  O O   . LEU B  1 136 ? 18.911  35.093  30.631  1.00 66.74  ? 135  LEU B O   1 
ATOM   3407  C CB  . LEU B  1 136 ? 20.324  37.031  32.775  1.00 63.99  ? 135  LEU B CB  1 
ATOM   3408  C CG  . LEU B  1 136 ? 21.037  36.096  33.766  1.00 79.63  ? 135  LEU B CG  1 
ATOM   3409  C CD1 . LEU B  1 136 ? 21.266  36.804  35.102  1.00 54.68  ? 135  LEU B CD1 1 
ATOM   3410  C CD2 . LEU B  1 136 ? 20.261  34.799  33.984  1.00 50.70  ? 135  LEU B CD2 1 
ATOM   3411  N N   . ILE B  1 137 ? 21.061  34.466  30.834  1.00 61.96  ? 136  ILE B N   1 
ATOM   3412  C CA  . ILE B  1 137 ? 20.808  33.042  30.631  1.00 64.10  ? 136  ILE B CA  1 
ATOM   3413  C C   . ILE B  1 137 ? 21.607  32.269  31.674  1.00 73.63  ? 136  ILE B C   1 
ATOM   3414  O O   . ILE B  1 137 ? 22.804  32.500  31.833  1.00 67.83  ? 136  ILE B O   1 
ATOM   3415  C CB  . ILE B  1 137 ? 21.219  32.578  29.218  1.00 71.13  ? 136  ILE B CB  1 
ATOM   3416  C CG1 . ILE B  1 137 ? 20.372  33.287  28.162  1.00 84.31  ? 136  ILE B CG1 1 
ATOM   3417  C CG2 . ILE B  1 137 ? 21.055  31.077  29.081  1.00 71.06  ? 136  ILE B CG2 1 
ATOM   3418  C CD1 . ILE B  1 137 ? 20.693  32.873  26.736  1.00 97.16  ? 136  ILE B CD1 1 
ATOM   3419  N N   . GLY B  1 138 ? 20.942  31.367  32.393  1.00 63.24  ? 137  GLY B N   1 
ATOM   3420  C CA  . GLY B  1 138 ? 21.573  30.638  33.481  1.00 49.50  ? 137  GLY B CA  1 
ATOM   3421  C C   . GLY B  1 138 ? 21.272  29.148  33.463  1.00 56.23  ? 137  GLY B C   1 
ATOM   3422  O O   . GLY B  1 138 ? 20.301  28.695  32.858  1.00 53.04  ? 137  GLY B O   1 
ATOM   3423  N N   . ALA B  1 139 ? 22.126  28.383  34.129  1.00 59.34  ? 138  ALA B N   1 
ATOM   3424  C CA  . ALA B  1 139 ? 21.924  26.952  34.282  1.00 62.57  ? 138  ALA B CA  1 
ATOM   3425  C C   . ALA B  1 139 ? 22.457  26.525  35.647  1.00 70.09  ? 138  ALA B C   1 
ATOM   3426  O O   . ALA B  1 139 ? 23.319  27.191  36.227  1.00 62.90  ? 138  ALA B O   1 
ATOM   3427  C CB  . ALA B  1 139 ? 22.627  26.201  33.175  1.00 49.18  ? 138  ALA B CB  1 
ATOM   3428  N N   . ASN B  1 140 ? 21.933  25.425  36.171  1.00 56.30  ? 139  ASN B N   1 
ATOM   3429  C CA  . ASN B  1 140 ? 22.412  24.907  37.441  1.00 46.02  ? 139  ASN B CA  1 
ATOM   3430  C C   . ASN B  1 140 ? 22.225  23.402  37.533  1.00 52.26  ? 139  ASN B C   1 
ATOM   3431  O O   . ASN B  1 140 ? 21.403  22.811  36.835  1.00 47.65  ? 139  ASN B O   1 
ATOM   3432  C CB  . ASN B  1 140 ? 21.694  25.590  38.593  1.00 49.19  ? 139  ASN B CB  1 
ATOM   3433  C CG  . ASN B  1 140 ? 20.188  25.521  38.455  1.00 60.74  ? 139  ASN B CG  1 
ATOM   3434  O OD1 . ASN B  1 140 ? 19.571  24.510  38.782  1.00 73.92  ? 139  ASN B OD1 1 
ATOM   3435  N ND2 . ASN B  1 140 ? 19.589  26.593  37.951  1.00 78.71  ? 139  ASN B ND2 1 
ATOM   3436  N N   . VAL B  1 141 ? 23.016  22.787  38.396  1.00 46.84  ? 140  VAL B N   1 
ATOM   3437  C CA  . VAL B  1 141 ? 22.880  21.375  38.680  1.00 58.23  ? 140  VAL B CA  1 
ATOM   3438  C C   . VAL B  1 141 ? 23.135  21.185  40.174  1.00 58.10  ? 140  VAL B C   1 
ATOM   3439  O O   . VAL B  1 141 ? 23.923  21.913  40.776  1.00 50.27  ? 140  VAL B O   1 
ATOM   3440  C CB  . VAL B  1 141 ? 23.856  20.543  37.833  1.00 54.65  ? 140  VAL B CB  1 
ATOM   3441  C CG1 . VAL B  1 141 ? 25.285  20.984  38.093  1.00 51.33  ? 140  VAL B CG1 1 
ATOM   3442  C CG2 . VAL B  1 141 ? 23.679  19.056  38.120  1.00 48.77  ? 140  VAL B CG2 1 
ATOM   3443  N N   . SER B  1 142 ? 22.437  20.239  40.784  1.00 53.31  ? 141  SER B N   1 
ATOM   3444  C CA  . SER B  1 142 ? 22.638  19.959  42.197  1.00 55.25  ? 141  SER B CA  1 
ATOM   3445  C C   . SER B  1 142 ? 22.452  18.475  42.484  1.00 57.81  ? 141  SER B C   1 
ATOM   3446  O O   . SER B  1 142 ? 21.598  17.811  41.895  1.00 57.74  ? 141  SER B O   1 
ATOM   3447  C CB  . SER B  1 142 ? 21.681  20.787  43.050  1.00 53.91  ? 141  SER B CB  1 
ATOM   3448  O OG  . SER B  1 142 ? 20.337  20.488  42.726  1.00 74.50  ? 141  SER B OG  1 
ATOM   3449  N N   . ILE B  1 143 ? 23.282  17.965  43.383  1.00 46.53  ? 142  ILE B N   1 
ATOM   3450  C CA  . ILE B  1 143 ? 23.187  16.593  43.833  1.00 52.21  ? 142  ILE B CA  1 
ATOM   3451  C C   . ILE B  1 143 ? 22.904  16.604  45.328  1.00 56.94  ? 142  ILE B C   1 
ATOM   3452  O O   . ILE B  1 143 ? 23.450  17.425  46.065  1.00 50.07  ? 142  ILE B O   1 
ATOM   3453  C CB  . ILE B  1 143 ? 24.488  15.834  43.570  1.00 49.31  ? 142  ILE B CB  1 
ATOM   3454  C CG1 . ILE B  1 143 ? 24.771  15.796  42.070  1.00 49.19  ? 142  ILE B CG1 1 
ATOM   3455  C CG2 . ILE B  1 143 ? 24.396  14.433  44.137  1.00 58.57  ? 142  ILE B CG2 1 
ATOM   3456  C CD1 . ILE B  1 143 ? 26.039  15.043  41.708  1.00 76.16  ? 142  ILE B CD1 1 
ATOM   3457  N N   . GLY B  1 144 ? 22.046  15.694  45.768  1.00 66.72  ? 143  GLY B N   1 
ATOM   3458  C CA  . GLY B  1 144 ? 21.680  15.601  47.169  1.00 66.39  ? 143  GLY B CA  1 
ATOM   3459  C C   . GLY B  1 144 ? 21.698  14.162  47.647  1.00 73.96  ? 143  GLY B C   1 
ATOM   3460  O O   . GLY B  1 144 ? 21.447  13.236  46.878  1.00 65.15  ? 143  GLY B O   1 
ATOM   3461  N N   . HIS B  1 145 ? 22.017  13.977  48.920  1.00 53.11  ? 144  HIS B N   1 
ATOM   3462  C CA  . HIS B  1 145 ? 21.990  12.664  49.537  1.00 45.52  ? 144  HIS B CA  1 
ATOM   3463  C C   . HIS B  1 145 ? 21.300  12.824  50.874  1.00 52.13  ? 144  HIS B C   1 
ATOM   3464  O O   . HIS B  1 145 ? 21.594  13.756  51.623  1.00 47.27  ? 144  HIS B O   1 
ATOM   3465  C CB  . HIS B  1 145 ? 23.405  12.122  49.735  1.00 55.90  ? 144  HIS B CB  1 
ATOM   3466  C CG  . HIS B  1 145 ? 24.200  12.026  48.470  1.00 76.82  ? 144  HIS B CG  1 
ATOM   3467  N ND1 . HIS B  1 145 ? 24.016  11.018  47.546  1.00 82.13  ? 144  HIS B ND1 1 
ATOM   3468  C CD2 . HIS B  1 145 ? 25.185  12.812  47.977  1.00 69.59  ? 144  HIS B CD2 1 
ATOM   3469  C CE1 . HIS B  1 145 ? 24.852  11.190  46.538  1.00 76.58  ? 144  HIS B CE1 1 
ATOM   3470  N NE2 . HIS B  1 145 ? 25.574  12.271  46.775  1.00 80.41  ? 144  HIS B NE2 1 
ATOM   3471  N N   . THR B  1 146 ? 20.372  11.927  51.169  1.00 47.35  ? 145  THR B N   1 
ATOM   3472  C CA  . THR B  1 146 ? 19.648  11.974  52.434  1.00 42.57  ? 145  THR B CA  1 
ATOM   3473  C C   . THR B  1 146 ? 19.689  10.604  53.097  1.00 45.52  ? 145  THR B C   1 
ATOM   3474  O O   . THR B  1 146 ? 19.605  9.568   52.438  1.00 42.22  ? 145  THR B O   1 
ATOM   3475  C CB  . THR B  1 146 ? 18.191  12.411  52.225  1.00 51.16  ? 145  THR B CB  1 
ATOM   3476  O OG1 . THR B  1 146 ? 18.162  13.748  51.707  1.00 60.81  ? 145  THR B OG1 1 
ATOM   3477  C CG2 . THR B  1 146 ? 17.425  12.379  53.528  1.00 48.39  ? 145  THR B CG2 1 
ATOM   3478  N N   . LEU B  1 147 ? 19.841  10.619  54.410  1.00 47.21  ? 146  LEU B N   1 
ATOM   3479  C CA  . LEU B  1 147 ? 19.895  9.415   55.208  1.00 44.54  ? 146  LEU B CA  1 
ATOM   3480  C C   . LEU B  1 147 ? 18.829  9.524   56.300  1.00 47.14  ? 146  LEU B C   1 
ATOM   3481  O O   . LEU B  1 147 ? 18.749  10.534  56.997  1.00 43.88  ? 146  LEU B O   1 
ATOM   3482  C CB  . LEU B  1 147 ? 21.283  9.296   55.826  1.00 46.49  ? 146  LEU B CB  1 
ATOM   3483  C CG  . LEU B  1 147 ? 21.468  8.188   56.854  1.00 58.10  ? 146  LEU B CG  1 
ATOM   3484  C CD1 . LEU B  1 147 ? 21.335  6.841   56.176  1.00 52.36  ? 146  LEU B CD1 1 
ATOM   3485  C CD2 . LEU B  1 147 ? 22.822  8.329   57.528  1.00 64.34  ? 146  LEU B CD2 1 
ATOM   3486  N N   . LYS B  1 148 ? 18.002  8.495   56.434  1.00 36.69  ? 147  LYS B N   1 
ATOM   3487  C CA  . LYS B  1 148 ? 16.918  8.499   57.409  1.00 38.09  ? 147  LYS B CA  1 
ATOM   3488  C C   . LYS B  1 148 ? 16.915  7.183   58.164  1.00 45.53  ? 147  LYS B C   1 
ATOM   3489  O O   . LYS B  1 148 ? 17.095  6.133   57.565  1.00 38.24  ? 147  LYS B O   1 
ATOM   3490  C CB  . LYS B  1 148 ? 15.575  8.694   56.707  1.00 41.51  ? 147  LYS B CB  1 
ATOM   3491  C CG  . LYS B  1 148 ? 14.383  8.633   57.641  1.00 66.26  ? 147  LYS B CG  1 
ATOM   3492  C CD  . LYS B  1 148 ? 13.069  8.527   56.876  1.00 83.02  ? 147  LYS B CD  1 
ATOM   3493  C CE  . LYS B  1 148 ? 12.811  9.758   56.019  1.00 92.30  ? 147  LYS B CE  1 
ATOM   3494  N NZ  . LYS B  1 148 ? 11.481  9.691   55.348  1.00 101.71 ? 147  LYS B NZ  1 
ATOM   3495  N N   . TYR B  1 149 ? 16.720  7.241   59.479  1.00 38.34  ? 148  TYR B N   1 
ATOM   3496  C CA  . TYR B  1 149 ? 16.600  6.034   60.289  1.00 45.13  ? 148  TYR B CA  1 
ATOM   3497  C C   . TYR B  1 149 ? 15.976  6.347   61.644  1.00 42.89  ? 148  TYR B C   1 
ATOM   3498  O O   . TYR B  1 149 ? 15.941  7.497   62.077  1.00 36.01  ? 148  TYR B O   1 
ATOM   3499  C CB  . TYR B  1 149 ? 17.964  5.373   60.483  1.00 41.16  ? 148  TYR B CB  1 
ATOM   3500  C CG  . TYR B  1 149 ? 18.998  6.329   61.010  1.00 41.88  ? 148  TYR B CG  1 
ATOM   3501  C CD1 . TYR B  1 149 ? 19.301  6.379   62.361  1.00 60.49  ? 148  TYR B CD1 1 
ATOM   3502  C CD2 . TYR B  1 149 ? 19.658  7.197   60.157  1.00 55.44  ? 148  TYR B CD2 1 
ATOM   3503  C CE1 . TYR B  1 149 ? 20.240  7.262   62.847  1.00 65.26  ? 148  TYR B CE1 1 
ATOM   3504  C CE2 . TYR B  1 149 ? 20.598  8.084   60.631  1.00 60.48  ? 148  TYR B CE2 1 
ATOM   3505  C CZ  . TYR B  1 149 ? 20.886  8.112   61.974  1.00 67.84  ? 148  TYR B CZ  1 
ATOM   3506  O OH  . TYR B  1 149 ? 21.823  8.999   62.434  1.00 67.85  ? 148  TYR B OH  1 
ATOM   3507  N N   . VAL B  1 150 ? 15.482  5.305   62.302  1.00 37.86  ? 149  VAL B N   1 
ATOM   3508  C CA  . VAL B  1 150 ? 14.800  5.435   63.581  1.00 37.18  ? 149  VAL B CA  1 
ATOM   3509  C C   . VAL B  1 150 ? 15.746  5.089   64.716  1.00 38.99  ? 149  VAL B C   1 
ATOM   3510  O O   . VAL B  1 150 ? 16.549  4.174   64.602  1.00 44.74  ? 149  VAL B O   1 
ATOM   3511  C CB  . VAL B  1 150 ? 13.584  4.501   63.646  1.00 42.16  ? 149  VAL B CB  1 
ATOM   3512  C CG1 . VAL B  1 150 ? 12.946  4.542   65.024  1.00 49.43  ? 149  VAL B CG1 1 
ATOM   3513  C CG2 . VAL B  1 150 ? 12.579  4.896   62.582  1.00 45.23  ? 149  VAL B CG2 1 
ATOM   3514  N N   . GLN B  1 151 ? 15.648  5.831   65.812  1.00 43.08  ? 150  GLN B N   1 
ATOM   3515  C CA  . GLN B  1 151 ? 16.491  5.591   66.976  1.00 45.87  ? 150  GLN B CA  1 
ATOM   3516  C C   . GLN B  1 151 ? 15.655  5.544   68.243  1.00 45.68  ? 150  GLN B C   1 
ATOM   3517  O O   . GLN B  1 151 ? 15.028  6.534   68.614  1.00 46.64  ? 150  GLN B O   1 
ATOM   3518  C CB  . GLN B  1 151 ? 17.528  6.700   67.116  1.00 52.90  ? 150  GLN B CB  1 
ATOM   3519  C CG  . GLN B  1 151 ? 18.547  6.739   65.999  1.00 71.09  ? 150  GLN B CG  1 
ATOM   3520  C CD  . GLN B  1 151 ? 19.660  7.719   66.280  1.00 76.55  ? 150  GLN B CD  1 
ATOM   3521  O OE1 . GLN B  1 151 ? 20.780  7.322   66.605  1.00 88.46  ? 150  GLN B OE1 1 
ATOM   3522  N NE2 . GLN B  1 151 ? 19.357  9.010   66.169  1.00 69.31  ? 150  GLN B NE2 1 
ATOM   3523  N N   . PRO B  1 152 ? 15.652  4.396   68.922  1.00 41.61  ? 151  PRO B N   1 
ATOM   3524  C CA  . PRO B  1 152 ? 14.944  4.301   70.204  1.00 39.62  ? 151  PRO B CA  1 
ATOM   3525  C C   . PRO B  1 152 ? 15.754  4.951   71.319  1.00 37.21  ? 151  PRO B C   1 
ATOM   3526  O O   . PRO B  1 152 ? 16.973  5.053   71.190  1.00 42.69  ? 151  PRO B O   1 
ATOM   3527  C CB  . PRO B  1 152 ? 14.843  2.799   70.424  1.00 37.17  ? 151  PRO B CB  1 
ATOM   3528  C CG  . PRO B  1 152 ? 16.065  2.245   69.728  1.00 40.15  ? 151  PRO B CG  1 
ATOM   3529  C CD  . PRO B  1 152 ? 16.291  3.124   68.539  1.00 41.56  ? 151  PRO B CD  1 
ATOM   3530  N N   . ASP B  1 153 ? 15.091  5.381   72.389  1.00 30.14  ? 152  ASP B N   1 
ATOM   3531  C CA  . ASP B  1 153 ? 15.776  5.994   73.522  1.00 34.35  ? 152  ASP B CA  1 
ATOM   3532  C C   . ASP B  1 153 ? 16.708  4.992   74.190  1.00 38.63  ? 152  ASP B C   1 
ATOM   3533  O O   . ASP B  1 153 ? 17.789  5.353   74.644  1.00 38.63  ? 152  ASP B O   1 
ATOM   3534  C CB  . ASP B  1 153 ? 14.763  6.515   74.544  1.00 40.42  ? 152  ASP B CB  1 
ATOM   3535  C CG  . ASP B  1 153 ? 14.059  7.788   74.086  1.00 52.49  ? 152  ASP B CG  1 
ATOM   3536  O OD1 . ASP B  1 153 ? 13.163  8.262   74.824  1.00 48.20  ? 152  ASP B OD1 1 
ATOM   3537  O OD2 . ASP B  1 153 ? 14.403  8.312   73.003  1.00 36.63  ? 152  ASP B OD2 1 
ATOM   3538  N N   . PHE B  1 154 ? 16.265  3.740   74.264  1.00 31.02  ? 153  PHE B N   1 
ATOM   3539  C CA  . PHE B  1 154 ? 17.070  2.650   74.803  1.00 31.12  ? 153  PHE B CA  1 
ATOM   3540  C C   . PHE B  1 154 ? 17.080  1.512   73.795  1.00 36.00  ? 153  PHE B C   1 
ATOM   3541  O O   . PHE B  1 154 ? 16.090  1.292   73.103  1.00 37.84  ? 153  PHE B O   1 
ATOM   3542  C CB  . PHE B  1 154 ? 16.471  2.122   76.110  1.00 31.16  ? 153  PHE B CB  1 
ATOM   3543  C CG  . PHE B  1 154 ? 16.720  2.996   77.305  1.00 35.24  ? 153  PHE B CG  1 
ATOM   3544  C CD1 . PHE B  1 154 ? 17.638  2.615   78.276  1.00 34.88  ? 153  PHE B CD1 1 
ATOM   3545  C CD2 . PHE B  1 154 ? 16.026  4.184   77.474  1.00 34.74  ? 153  PHE B CD2 1 
ATOM   3546  C CE1 . PHE B  1 154 ? 17.861  3.406   79.397  1.00 32.72  ? 153  PHE B CE1 1 
ATOM   3547  C CE2 . PHE B  1 154 ? 16.245  4.980   78.591  1.00 40.35  ? 153  PHE B CE2 1 
ATOM   3548  C CZ  . PHE B  1 154 ? 17.167  4.592   79.551  1.00 36.89  ? 153  PHE B CZ  1 
ATOM   3549  N N   . LYS B  1 155 ? 18.194  0.788   73.719  1.00 28.46  ? 154  LYS B N   1 
ATOM   3550  C CA  . LYS B  1 155 ? 18.299  -0.377  72.849  1.00 34.22  ? 154  LYS B CA  1 
ATOM   3551  C C   . LYS B  1 155 ? 18.215  -1.646  73.686  1.00 28.89  ? 154  LYS B C   1 
ATOM   3552  O O   . LYS B  1 155 ? 18.794  -1.729  74.759  1.00 35.33  ? 154  LYS B O   1 
ATOM   3553  C CB  . LYS B  1 155 ? 19.623  -0.355  72.072  1.00 27.67  ? 154  LYS B CB  1 
ATOM   3554  C CG  . LYS B  1 155 ? 19.754  0.788   71.098  1.00 44.88  ? 154  LYS B CG  1 
ATOM   3555  C CD  . LYS B  1 155 ? 21.175  0.933   70.577  1.00 51.30  ? 154  LYS B CD  1 
ATOM   3556  C CE  . LYS B  1 155 ? 21.595  -0.265  69.764  1.00 70.25  ? 154  LYS B CE  1 
ATOM   3557  N NZ  . LYS B  1 155 ? 22.928  -0.064  69.124  1.00 70.46  ? 154  LYS B NZ  1 
ATOM   3558  N N   . THR B  1 156 ? 17.493  -2.637  73.186  1.00 30.18  ? 155  THR B N   1 
ATOM   3559  C CA  . THR B  1 156 ? 17.402  -3.923  73.857  1.00 31.46  ? 155  THR B CA  1 
ATOM   3560  C C   . THR B  1 156 ? 18.339  -4.918  73.177  1.00 36.70  ? 155  THR B C   1 
ATOM   3561  O O   . THR B  1 156 ? 18.227  -5.173  71.982  1.00 34.87  ? 155  THR B O   1 
ATOM   3562  C CB  . THR B  1 156 ? 15.962  -4.467  73.840  1.00 34.60  ? 155  THR B CB  1 
ATOM   3563  O OG1 . THR B  1 156 ? 15.080  -3.504  74.428  1.00 39.98  ? 155  THR B OG1 1 
ATOM   3564  C CG2 . THR B  1 156 ? 15.869  -5.786  74.624  1.00 30.26  ? 155  THR B CG2 1 
ATOM   3565  N N   . ILE B  1 157 ? 19.265  -5.479  73.942  1.00 31.28  ? 156  ILE B N   1 
ATOM   3566  C CA  . ILE B  1 157 ? 20.323  -6.287  73.362  1.00 35.02  ? 156  ILE B CA  1 
ATOM   3567  C C   . ILE B  1 157 ? 20.458  -7.637  74.046  1.00 26.79  ? 156  ILE B C   1 
ATOM   3568  O O   . ILE B  1 157 ? 20.496  -7.725  75.267  1.00 32.28  ? 156  ILE B O   1 
ATOM   3569  C CB  . ILE B  1 157 ? 21.674  -5.568  73.458  1.00 39.21  ? 156  ILE B CB  1 
ATOM   3570  C CG1 . ILE B  1 157 ? 21.634  -4.272  72.662  1.00 37.45  ? 156  ILE B CG1 1 
ATOM   3571  C CG2 . ILE B  1 157 ? 22.797  -6.474  72.947  1.00 32.68  ? 156  ILE B CG2 1 
ATOM   3572  C CD1 . ILE B  1 157 ? 22.899  -3.472  72.768  1.00 37.10  ? 156  ILE B CD1 1 
ATOM   3573  N N   . LEU B  1 158 ? 20.522  -8.689  73.247  1.00 33.40  ? 157  LEU B N   1 
ATOM   3574  C CA  . LEU B  1 158 ? 20.818  -10.015 73.766  1.00 33.02  ? 157  LEU B CA  1 
ATOM   3575  C C   . LEU B  1 158 ? 22.326  -10.156 73.831  1.00 34.32  ? 157  LEU B C   1 
ATOM   3576  O O   . LEU B  1 158 ? 22.994  -10.067 72.807  1.00 32.60  ? 157  LEU B O   1 
ATOM   3577  C CB  . LEU B  1 158 ? 20.240  -11.092 72.852  1.00 24.69  ? 157  LEU B CB  1 
ATOM   3578  C CG  . LEU B  1 158 ? 20.639  -12.537 73.200  1.00 25.83  ? 157  LEU B CG  1 
ATOM   3579  C CD1 . LEU B  1 158 ? 19.929  -13.021 74.464  1.00 21.33  ? 157  LEU B CD1 1 
ATOM   3580  C CD2 . LEU B  1 158 ? 20.297  -13.428 72.045  1.00 25.04  ? 157  LEU B CD2 1 
ATOM   3581  N N   . GLU B  1 159 ? 22.859  -10.358 75.032  1.00 31.81  ? 158  GLU B N   1 
ATOM   3582  C CA  . GLU B  1 159 ? 24.283  -10.600 75.204  1.00 39.81  ? 158  GLU B CA  1 
ATOM   3583  C C   . GLU B  1 159 ? 24.648  -11.995 74.712  1.00 40.26  ? 158  GLU B C   1 
ATOM   3584  O O   . GLU B  1 159 ? 23.817  -12.907 74.731  1.00 47.75  ? 158  GLU B O   1 
ATOM   3585  C CB  . GLU B  1 159 ? 24.656  -10.463 76.671  1.00 38.80  ? 158  GLU B CB  1 
ATOM   3586  C CG  . GLU B  1 159 ? 24.176  -9.172  77.297  1.00 47.82  ? 158  GLU B CG  1 
ATOM   3587  C CD  . GLU B  1 159 ? 25.314  -8.322  77.820  1.00 66.34  ? 158  GLU B CD  1 
ATOM   3588  O OE1 . GLU B  1 159 ? 25.194  -7.812  78.956  1.00 64.03  ? 158  GLU B OE1 1 
ATOM   3589  O OE2 . GLU B  1 159 ? 26.322  -8.166  77.098  1.00 66.85  ? 158  GLU B OE2 1 
ATOM   3590  N N   . SER B  1 160 ? 25.893  -12.155 74.285  1.00 37.81  ? 159  SER B N   1 
ATOM   3591  C CA  . SER B  1 160 ? 26.370  -13.425 73.742  1.00 43.95  ? 159  SER B CA  1 
ATOM   3592  C C   . SER B  1 160 ? 26.115  -14.567 74.724  1.00 38.04  ? 159  SER B C   1 
ATOM   3593  O O   . SER B  1 160 ? 26.740  -14.629 75.777  1.00 41.52  ? 159  SER B O   1 
ATOM   3594  C CB  . SER B  1 160 ? 27.859  -13.321 73.439  1.00 36.99  ? 159  SER B CB  1 
ATOM   3595  O OG  . SER B  1 160 ? 28.117  -12.201 72.608  1.00 51.13  ? 159  SER B OG  1 
ATOM   3596  N N   . PRO B  1 161 ? 25.179  -15.464 74.389  1.00 36.13  ? 160  PRO B N   1 
ATOM   3597  C CA  . PRO B  1 161 ? 24.831  -16.544 75.310  1.00 39.54  ? 160  PRO B CA  1 
ATOM   3598  C C   . PRO B  1 161 ? 25.728  -17.770 75.183  1.00 43.23  ? 160  PRO B C   1 
ATOM   3599  O O   . PRO B  1 161 ? 26.373  -17.971 74.153  1.00 38.89  ? 160  PRO B O   1 
ATOM   3600  C CB  . PRO B  1 161 ? 23.404  -16.898 74.891  1.00 42.92  ? 160  PRO B CB  1 
ATOM   3601  C CG  . PRO B  1 161 ? 23.359  -16.615 73.452  1.00 38.78  ? 160  PRO B CG  1 
ATOM   3602  C CD  . PRO B  1 161 ? 24.281  -15.433 73.221  1.00 42.32  ? 160  PRO B CD  1 
ATOM   3603  N N   . THR B  1 162 ? 25.777  -18.572 76.244  1.00 35.20  ? 161  THR B N   1 
ATOM   3604  C CA  . THR B  1 162 ? 26.411  -19.885 76.191  1.00 36.89  ? 161  THR B CA  1 
ATOM   3605  C C   . THR B  1 162 ? 25.338  -20.894 76.569  1.00 40.15  ? 161  THR B C   1 
ATOM   3606  O O   . THR B  1 162 ? 24.185  -20.532 76.731  1.00 37.83  ? 161  THR B O   1 
ATOM   3607  C CB  . THR B  1 162 ? 27.585  -19.998 77.185  1.00 38.24  ? 161  THR B CB  1 
ATOM   3608  O OG1 . THR B  1 162 ? 27.076  -20.099 78.521  1.00 41.61  ? 161  THR B OG1 1 
ATOM   3609  C CG2 . THR B  1 162 ? 28.509  -18.780 77.083  1.00 39.81  ? 161  THR B CG2 1 
ATOM   3610  N N   . ASP B  1 163 ? 25.703  -22.159 76.718  1.00 45.72  ? 162  ASP B N   1 
ATOM   3611  C CA  . ASP B  1 163 ? 24.721  -23.162 77.118  1.00 40.56  ? 162  ASP B CA  1 
ATOM   3612  C C   . ASP B  1 163 ? 24.514  -23.141 78.622  1.00 35.29  ? 162  ASP B C   1 
ATOM   3613  O O   . ASP B  1 163 ? 23.710  -23.898 79.144  1.00 41.47  ? 162  ASP B O   1 
ATOM   3614  C CB  . ASP B  1 163 ? 25.127  -24.567 76.641  1.00 43.81  ? 162  ASP B CB  1 
ATOM   3615  C CG  . ASP B  1 163 ? 26.393  -25.078 77.314  1.00 59.12  ? 162  ASP B CG  1 
ATOM   3616  O OD1 . ASP B  1 163 ? 27.182  -24.259 77.844  1.00 63.36  ? 162  ASP B OD1 1 
ATOM   3617  O OD2 . ASP B  1 163 ? 26.603  -26.310 77.304  1.00 68.41  ? 162  ASP B OD2 1 
ATOM   3618  N N   . LYS B  1 164 ? 25.211  -22.247 79.318  1.00 37.66  ? 163  LYS B N   1 
ATOM   3619  C CA  . LYS B  1 164 ? 25.042  -22.129 80.766  1.00 35.98  ? 163  LYS B CA  1 
ATOM   3620  C C   . LYS B  1 164 ? 24.673  -20.719 81.233  1.00 36.61  ? 163  LYS B C   1 
ATOM   3621  O O   . LYS B  1 164 ? 24.257  -20.539 82.372  1.00 39.94  ? 163  LYS B O   1 
ATOM   3622  C CB  . LYS B  1 164 ? 26.313  -22.596 81.487  1.00 37.75  ? 163  LYS B CB  1 
ATOM   3623  C CG  . LYS B  1 164 ? 26.639  -24.080 81.265  1.00 32.92  ? 163  LYS B CG  1 
ATOM   3624  C CD  . LYS B  1 164 ? 25.510  -24.975 81.764  1.00 43.93  ? 163  LYS B CD  1 
ATOM   3625  C CE  . LYS B  1 164 ? 25.657  -26.419 81.286  1.00 48.90  ? 163  LYS B CE  1 
ATOM   3626  N NZ  . LYS B  1 164 ? 26.902  -27.059 81.788  1.00 55.01  ? 163  LYS B NZ  1 
ATOM   3627  N N   . LYS B  1 165 ? 24.823  -19.724 80.364  1.00 35.12  ? 164  LYS B N   1 
ATOM   3628  C CA  . LYS B  1 165 ? 24.606  -18.331 80.749  1.00 42.46  ? 164  LYS B CA  1 
ATOM   3629  C C   . LYS B  1 165 ? 23.915  -17.572 79.631  1.00 40.40  ? 164  LYS B C   1 
ATOM   3630  O O   . LYS B  1 165 ? 24.242  -17.740 78.461  1.00 39.49  ? 164  LYS B O   1 
ATOM   3631  C CB  . LYS B  1 165 ? 25.939  -17.645 81.054  1.00 44.48  ? 164  LYS B CB  1 
ATOM   3632  C CG  . LYS B  1 165 ? 26.681  -18.225 82.241  1.00 74.53  ? 164  LYS B CG  1 
ATOM   3633  C CD  . LYS B  1 165 ? 28.125  -17.729 82.298  1.00 87.10  ? 164  LYS B CD  1 
ATOM   3634  C CE  . LYS B  1 165 ? 28.199  -16.211 82.371  1.00 89.23  ? 164  LYS B CE  1 
ATOM   3635  N NZ  . LYS B  1 165 ? 29.605  -15.724 82.442  1.00 107.17 ? 164  LYS B NZ  1 
ATOM   3636  N N   . VAL B  1 166 ? 22.960  -16.730 79.996  1.00 35.98  ? 165  VAL B N   1 
ATOM   3637  C CA  . VAL B  1 166 ? 22.309  -15.862 79.030  1.00 33.12  ? 165  VAL B CA  1 
ATOM   3638  C C   . VAL B  1 166 ? 21.927  -14.558 79.731  1.00 36.65  ? 165  VAL B C   1 
ATOM   3639  O O   . VAL B  1 166 ? 21.700  -14.536 80.933  1.00 42.02  ? 165  VAL B O   1 
ATOM   3640  C CB  . VAL B  1 166 ? 21.059  -16.538 78.423  1.00 38.72  ? 165  VAL B CB  1 
ATOM   3641  C CG1 . VAL B  1 166 ? 20.002  -16.805 79.514  1.00 33.85  ? 165  VAL B CG1 1 
ATOM   3642  C CG2 . VAL B  1 166 ? 20.489  -15.686 77.311  1.00 30.25  ? 165  VAL B CG2 1 
ATOM   3643  N N   . GLY B  1 167 ? 21.871  -13.468 78.986  1.00 30.24  ? 166  GLY B N   1 
ATOM   3644  C CA  . GLY B  1 167 ? 21.498  -12.201 79.566  1.00 35.02  ? 166  GLY B CA  1 
ATOM   3645  C C   . GLY B  1 167 ? 21.092  -11.186 78.520  1.00 38.17  ? 166  GLY B C   1 
ATOM   3646  O O   . GLY B  1 167 ? 21.379  -11.346 77.339  1.00 36.47  ? 166  GLY B O   1 
ATOM   3647  N N   . TRP B  1 168 ? 20.412  -10.140 78.974  1.00 27.26  ? 167  TRP B N   1 
ATOM   3648  C CA  . TRP B  1 168 ? 20.019  -9.033  78.119  1.00 31.77  ? 167  TRP B CA  1 
ATOM   3649  C C   . TRP B  1 168 ? 20.488  -7.754  78.780  1.00 28.86  ? 167  TRP B C   1 
ATOM   3650  O O   . TRP B  1 168 ? 20.615  -7.691  79.997  1.00 30.54  ? 167  TRP B O   1 
ATOM   3651  C CB  . TRP B  1 168 ? 18.497  -8.982  77.956  1.00 26.41  ? 167  TRP B CB  1 
ATOM   3652  C CG  . TRP B  1 168 ? 17.908  -10.136 77.199  1.00 31.09  ? 167  TRP B CG  1 
ATOM   3653  C CD1 . TRP B  1 168 ? 17.571  -10.162 75.876  1.00 29.35  ? 167  TRP B CD1 1 
ATOM   3654  C CD2 . TRP B  1 168 ? 17.579  -11.428 77.722  1.00 25.99  ? 167  TRP B CD2 1 
ATOM   3655  N NE1 . TRP B  1 168 ? 17.048  -11.388 75.545  1.00 29.02  ? 167  TRP B NE1 1 
ATOM   3656  C CE2 . TRP B  1 168 ? 17.047  -12.185 76.657  1.00 32.71  ? 167  TRP B CE2 1 
ATOM   3657  C CE3 . TRP B  1 168 ? 17.678  -12.017 78.989  1.00 23.70  ? 167  TRP B CE3 1 
ATOM   3658  C CZ2 . TRP B  1 168 ? 16.625  -13.510 76.817  1.00 27.29  ? 167  TRP B CZ2 1 
ATOM   3659  C CZ3 . TRP B  1 168 ? 17.256  -13.327 79.145  1.00 29.14  ? 167  TRP B CZ3 1 
ATOM   3660  C CH2 . TRP B  1 168 ? 16.735  -14.059 78.063  1.00 29.01  ? 167  TRP B CH2 1 
ATOM   3661  N N   . LYS B  1 169 ? 20.747  -6.732  77.983  1.00 33.15  ? 168  LYS B N   1 
ATOM   3662  C CA  . LYS B  1 169 ? 20.954  -5.402  78.523  1.00 27.88  ? 168  LYS B CA  1 
ATOM   3663  C C   . LYS B  1 169 ? 20.121  -4.415  77.722  1.00 32.93  ? 168  LYS B C   1 
ATOM   3664  O O   . LYS B  1 169 ? 20.043  -4.506  76.499  1.00 30.94  ? 168  LYS B O   1 
ATOM   3665  C CB  . LYS B  1 169 ? 22.432  -5.034  78.503  1.00 32.92  ? 168  LYS B CB  1 
ATOM   3666  C CG  . LYS B  1 169 ? 23.060  -5.068  77.126  1.00 29.75  ? 168  LYS B CG  1 
ATOM   3667  C CD  . LYS B  1 169 ? 24.538  -4.728  77.201  1.00 41.61  ? 168  LYS B CD  1 
ATOM   3668  C CE  . LYS B  1 169 ? 25.198  -4.810  75.825  1.00 51.19  ? 168  LYS B CE  1 
ATOM   3669  N NZ  . LYS B  1 169 ? 26.632  -4.436  75.877  1.00 62.12  ? 168  LYS B NZ  1 
ATOM   3670  N N   . VAL B  1 170 ? 19.466  -3.508  78.437  1.00 28.80  ? 169  VAL B N   1 
ATOM   3671  C CA  . VAL B  1 170 ? 18.714  -2.425  77.841  1.00 28.44  ? 169  VAL B CA  1 
ATOM   3672  C C   . VAL B  1 170 ? 19.505  -1.157  78.136  1.00 27.67  ? 169  VAL B C   1 
ATOM   3673  O O   . VAL B  1 170 ? 19.548  -0.696  79.266  1.00 30.42  ? 169  VAL B O   1 
ATOM   3674  C CB  . VAL B  1 170 ? 17.307  -2.356  78.452  1.00 32.36  ? 169  VAL B CB  1 
ATOM   3675  C CG1 . VAL B  1 170 ? 16.537  -1.128  77.961  1.00 27.60  ? 169  VAL B CG1 1 
ATOM   3676  C CG2 . VAL B  1 170 ? 16.556  -3.644  78.143  1.00 29.27  ? 169  VAL B CG2 1 
ATOM   3677  N N   . ILE B  1 171 ? 20.158  -0.609  77.118  1.00 32.62  ? 170  ILE B N   1 
ATOM   3678  C CA  . ILE B  1 171 ? 21.117  0.474   77.332  1.00 36.46  ? 170  ILE B CA  1 
ATOM   3679  C C   . ILE B  1 171 ? 20.632  1.804   76.762  1.00 34.54  ? 170  ILE B C   1 
ATOM   3680  O O   . ILE B  1 171 ? 19.994  1.851   75.709  1.00 29.48  ? 170  ILE B O   1 
ATOM   3681  C CB  . ILE B  1 171 ? 22.483  0.131   76.701  1.00 43.31  ? 170  ILE B CB  1 
ATOM   3682  C CG1 . ILE B  1 171 ? 22.347  -0.024  75.183  1.00 42.22  ? 170  ILE B CG1 1 
ATOM   3683  C CG2 . ILE B  1 171 ? 23.048  -1.144  77.320  1.00 35.70  ? 170  ILE B CG2 1 
ATOM   3684  C CD1 . ILE B  1 171 ? 23.645  -0.307  74.481  1.00 47.97  ? 170  ILE B CD1 1 
ATOM   3685  N N   . PHE B  1 172 ? 20.933  2.883   77.473  1.00 37.43  ? 171  PHE B N   1 
ATOM   3686  C CA  . PHE B  1 172 ? 20.617  4.216   76.997  1.00 29.64  ? 171  PHE B CA  1 
ATOM   3687  C C   . PHE B  1 172 ? 21.307  4.439   75.659  1.00 36.54  ? 171  PHE B C   1 
ATOM   3688  O O   . PHE B  1 172 ? 22.493  4.129   75.481  1.00 33.90  ? 171  PHE B O   1 
ATOM   3689  C CB  . PHE B  1 172 ? 21.057  5.273   78.003  1.00 32.62  ? 171  PHE B CB  1 
ATOM   3690  C CG  . PHE B  1 172 ? 20.736  6.672   77.574  1.00 36.53  ? 171  PHE B CG  1 
ATOM   3691  C CD1 . PHE B  1 172 ? 19.498  7.227   77.844  1.00 34.44  ? 171  PHE B CD1 1 
ATOM   3692  C CD2 . PHE B  1 172 ? 21.664  7.426   76.885  1.00 40.42  ? 171  PHE B CD2 1 
ATOM   3693  C CE1 . PHE B  1 172 ? 19.193  8.512   77.436  1.00 44.89  ? 171  PHE B CE1 1 
ATOM   3694  C CE2 . PHE B  1 172 ? 21.365  8.715   76.477  1.00 42.65  ? 171  PHE B CE2 1 
ATOM   3695  C CZ  . PHE B  1 172 ? 20.128  9.256   76.752  1.00 37.45  ? 171  PHE B CZ  1 
ATOM   3696  N N   . ASN B  1 173 ? 20.541  4.946   74.708  1.00 28.57  ? 172  ASN B N   1 
ATOM   3697  C CA  . ASN B  1 173 ? 21.039  5.197   73.374  1.00 34.40  ? 172  ASN B CA  1 
ATOM   3698  C C   . ASN B  1 173 ? 21.236  6.707   73.180  1.00 37.47  ? 172  ASN B C   1 
ATOM   3699  O O   . ASN B  1 173 ? 22.359  7.202   73.228  1.00 40.40  ? 172  ASN B O   1 
ATOM   3700  C CB  . ASN B  1 173 ? 20.068  4.614   72.345  1.00 35.48  ? 172  ASN B CB  1 
ATOM   3701  C CG  . ASN B  1 173 ? 20.614  4.663   70.926  1.00 37.96  ? 172  ASN B CG  1 
ATOM   3702  O OD1 . ASN B  1 173 ? 21.820  4.586   70.711  1.00 37.96  ? 172  ASN B OD1 1 
ATOM   3703  N ND2 . ASN B  1 173 ? 19.723  4.793   69.954  1.00 39.55  ? 172  ASN B ND2 1 
ATOM   3704  N N   . ASN B  1 174 ? 20.138  7.426   72.976  1.00 31.63  ? 173  ASN B N   1 
ATOM   3705  C CA  . ASN B  1 174 ? 20.154  8.889   73.001  1.00 41.01  ? 173  ASN B CA  1 
ATOM   3706  C C   . ASN B  1 174 ? 18.752  9.414   73.272  1.00 40.20  ? 173  ASN B C   1 
ATOM   3707  O O   . ASN B  1 174 ? 17.788  8.647   73.264  1.00 44.99  ? 173  ASN B O   1 
ATOM   3708  C CB  . ASN B  1 174 ? 20.708  9.450   71.693  1.00 43.40  ? 173  ASN B CB  1 
ATOM   3709  C CG  . ASN B  1 174 ? 19.929  8.986   70.476  1.00 46.30  ? 173  ASN B CG  1 
ATOM   3710  O OD1 . ASN B  1 174 ? 18.703  8.891   70.501  1.00 48.01  ? 173  ASN B OD1 1 
ATOM   3711  N ND2 . ASN B  1 174 ? 20.643  8.690   69.403  1.00 45.11  ? 173  ASN B ND2 1 
ATOM   3712  N N   . MET B  1 175 ? 18.630  10.711  73.519  1.00 39.08  ? 174  MET B N   1 
ATOM   3713  C CA  . MET B  1 175 ? 17.350  11.258  73.937  1.00 31.83  ? 174  MET B CA  1 
ATOM   3714  C C   . MET B  1 175 ? 17.194  12.705  73.500  1.00 45.05  ? 174  MET B C   1 
ATOM   3715  O O   . MET B  1 175 ? 18.159  13.464  73.466  1.00 34.44  ? 174  MET B O   1 
ATOM   3716  C CB  . MET B  1 175 ? 17.231  11.165  75.459  1.00 30.44  ? 174  MET B CB  1 
ATOM   3717  C CG  . MET B  1 175 ? 15.809  11.292  75.969  1.00 39.68  ? 174  MET B CG  1 
ATOM   3718  S SD  . MET B  1 175 ? 15.732  11.368  77.760  1.00 54.23  ? 174  MET B SD  1 
ATOM   3719  C CE  . MET B  1 175 ? 16.511  12.967  78.068  1.00 48.82  ? 174  MET B CE  1 
ATOM   3720  N N   . VAL B  1 176 ? 15.966  13.072  73.159  1.00 39.77  ? 175  VAL B N   1 
ATOM   3721  C CA  . VAL B  1 176 ? 15.629  14.456  72.878  1.00 48.35  ? 175  VAL B CA  1 
ATOM   3722  C C   . VAL B  1 176 ? 15.423  15.222  74.178  1.00 47.97  ? 175  VAL B C   1 
ATOM   3723  O O   . VAL B  1 176 ? 14.661  14.794  75.050  1.00 41.67  ? 175  VAL B O   1 
ATOM   3724  C CB  . VAL B  1 176 ? 14.342  14.563  72.049  1.00 50.51  ? 175  VAL B CB  1 
ATOM   3725  C CG1 . VAL B  1 176 ? 13.969  16.025  71.842  1.00 47.46  ? 175  VAL B CG1 1 
ATOM   3726  C CG2 . VAL B  1 176 ? 14.515  13.858  70.721  1.00 48.14  ? 175  VAL B CG2 1 
ATOM   3727  N N   . ASN B  1 177 ? 16.118  16.349  74.294  1.00 48.63  ? 176  ASN B N   1 
ATOM   3728  C CA  . ASN B  1 177 ? 15.978  17.249  75.427  1.00 38.38  ? 176  ASN B CA  1 
ATOM   3729  C C   . ASN B  1 177 ? 15.272  18.508  74.973  1.00 51.60  ? 176  ASN B C   1 
ATOM   3730  O O   . ASN B  1 177 ? 15.895  19.383  74.372  1.00 48.32  ? 176  ASN B O   1 
ATOM   3731  C CB  . ASN B  1 177 ? 17.355  17.604  75.991  1.00 37.88  ? 176  ASN B CB  1 
ATOM   3732  C CG  . ASN B  1 177 ? 17.283  18.617  77.120  1.00 45.88  ? 176  ASN B CG  1 
ATOM   3733  O OD1 . ASN B  1 177 ? 16.247  19.229  77.355  1.00 40.56  ? 176  ASN B OD1 1 
ATOM   3734  N ND2 . ASN B  1 177 ? 18.390  18.793  77.822  1.00 38.01  ? 176  ASN B ND2 1 
ATOM   3735  N N   . GLN B  1 178 ? 13.971  18.588  75.250  1.00 49.14  ? 177  GLN B N   1 
ATOM   3736  C CA  . GLN B  1 178 ? 13.171  19.773  74.937  1.00 57.09  ? 177  GLN B CA  1 
ATOM   3737  C C   . GLN B  1 178 ? 13.326  20.201  73.479  1.00 59.12  ? 177  GLN B C   1 
ATOM   3738  O O   . GLN B  1 178 ? 13.659  21.349  73.199  1.00 56.09  ? 177  GLN B O   1 
ATOM   3739  C CB  . GLN B  1 178 ? 13.560  20.934  75.854  1.00 45.88  ? 177  GLN B CB  1 
ATOM   3740  C CG  . GLN B  1 178 ? 13.293  20.679  77.322  1.00 58.13  ? 177  GLN B CG  1 
ATOM   3741  C CD  . GLN B  1 178 ? 13.750  21.824  78.202  1.00 62.97  ? 177  GLN B CD  1 
ATOM   3742  O OE1 . GLN B  1 178 ? 12.972  22.719  78.531  1.00 65.89  ? 177  GLN B OE1 1 
ATOM   3743  N NE2 . GLN B  1 178 ? 15.017  21.799  78.592  1.00 50.26  ? 177  GLN B NE2 1 
ATOM   3744  N N   . ASN B  1 179 ? 13.083  19.272  72.558  1.00 54.53  ? 178  ASN B N   1 
ATOM   3745  C CA  . ASN B  1 179 ? 13.159  19.544  71.117  1.00 64.23  ? 178  ASN B CA  1 
ATOM   3746  C C   . ASN B  1 179 ? 14.589  19.655  70.579  1.00 55.80  ? 178  ASN B C   1 
ATOM   3747  O O   . ASN B  1 179 ? 14.791  19.747  69.373  1.00 56.33  ? 178  ASN B O   1 
ATOM   3748  C CB  . ASN B  1 179 ? 12.385  20.816  70.753  1.00 78.30  ? 178  ASN B CB  1 
ATOM   3749  C CG  . ASN B  1 179 ? 10.995  20.855  71.362  1.00 88.06  ? 178  ASN B CG  1 
ATOM   3750  O OD1 . ASN B  1 179 ? 10.501  21.921  71.728  1.00 100.07 ? 178  ASN B OD1 1 
ATOM   3751  N ND2 . ASN B  1 179 ? 10.363  19.696  71.482  1.00 76.36  ? 178  ASN B ND2 1 
ATOM   3752  N N   . TRP B  1 180 ? 15.574  19.649  71.474  1.00 70.69  ? 179  TRP B N   1 
ATOM   3753  C CA  . TRP B  1 180 ? 16.982  19.746  71.083  1.00 71.69  ? 179  TRP B CA  1 
ATOM   3754  C C   . TRP B  1 180 ? 17.660  18.371  71.061  1.00 72.96  ? 179  TRP B C   1 
ATOM   3755  O O   . TRP B  1 180 ? 17.187  17.413  71.670  1.00 49.50  ? 179  TRP B O   1 
ATOM   3756  C CB  . TRP B  1 180 ? 17.744  20.674  72.041  1.00 75.58  ? 179  TRP B CB  1 
ATOM   3757  C CG  . TRP B  1 180 ? 17.426  22.129  71.865  1.00 101.00 ? 179  TRP B CG  1 
ATOM   3758  C CD1 . TRP B  1 180 ? 16.306  22.781  72.289  1.00 96.14  ? 179  TRP B CD1 1 
ATOM   3759  C CD2 . TRP B  1 180 ? 18.242  23.113  71.217  1.00 112.00 ? 179  TRP B CD2 1 
ATOM   3760  N NE1 . TRP B  1 180 ? 16.373  24.112  71.944  1.00 110.63 ? 179  TRP B NE1 1 
ATOM   3761  C CE2 . TRP B  1 180 ? 17.553  24.341  71.287  1.00 117.29 ? 179  TRP B CE2 1 
ATOM   3762  C CE3 . TRP B  1 180 ? 19.487  23.075  70.583  1.00 110.80 ? 179  TRP B CE3 1 
ATOM   3763  C CZ2 . TRP B  1 180 ? 18.068  25.518  70.746  1.00 114.12 ? 179  TRP B CZ2 1 
ATOM   3764  C CZ3 . TRP B  1 180 ? 19.995  24.243  70.046  1.00 115.16 ? 179  TRP B CZ3 1 
ATOM   3765  C CH2 . TRP B  1 180 ? 19.287  25.450  70.133  1.00 109.12 ? 179  TRP B CH2 1 
ATOM   3766  N N   . GLY B  1 181 ? 18.780  18.278  70.356  1.00 63.08  ? 180  GLY B N   1 
ATOM   3767  C CA  . GLY B  1 181 ? 19.553  17.051  70.341  1.00 55.14  ? 180  GLY B CA  1 
ATOM   3768  C C   . GLY B  1 181 ? 19.262  16.195  69.122  1.00 50.61  ? 180  GLY B C   1 
ATOM   3769  O O   . GLY B  1 181 ? 19.193  16.692  68.008  1.00 58.19  ? 180  GLY B O   1 
ATOM   3770  N N   . PRO B  1 182 ? 19.103  14.885  69.324  1.00 60.59  ? 181  PRO B N   1 
ATOM   3771  C CA  . PRO B  1 182 ? 19.191  14.234  70.629  1.00 55.79  ? 181  PRO B CA  1 
ATOM   3772  C C   . PRO B  1 182 ? 20.610  14.267  71.183  1.00 60.26  ? 181  PRO B C   1 
ATOM   3773  O O   . PRO B  1 182 ? 21.560  14.510  70.436  1.00 64.49  ? 181  PRO B O   1 
ATOM   3774  C CB  . PRO B  1 182 ? 18.776  12.792  70.320  1.00 63.90  ? 181  PRO B CB  1 
ATOM   3775  C CG  . PRO B  1 182 ? 19.128  12.598  68.891  1.00 57.79  ? 181  PRO B CG  1 
ATOM   3776  C CD  . PRO B  1 182 ? 18.896  13.913  68.233  1.00 61.88  ? 181  PRO B CD  1 
ATOM   3777  N N   . TYR B  1 183 ? 20.743  14.025  72.482  1.00 42.99  ? 182  TYR B N   1 
ATOM   3778  C CA  . TYR B  1 183 ? 22.046  13.939  73.117  1.00 37.12  ? 182  TYR B CA  1 
ATOM   3779  C C   . TYR B  1 183 ? 22.295  12.515  73.597  1.00 44.33  ? 182  TYR B C   1 
ATOM   3780  O O   . TYR B  1 183 ? 21.361  11.728  73.779  1.00 35.69  ? 182  TYR B O   1 
ATOM   3781  C CB  . TYR B  1 183 ? 22.126  14.931  74.282  1.00 42.38  ? 182  TYR B CB  1 
ATOM   3782  C CG  . TYR B  1 183 ? 21.913  16.377  73.849  1.00 49.78  ? 182  TYR B CG  1 
ATOM   3783  C CD1 . TYR B  1 183 ? 20.688  17.003  74.028  1.00 45.77  ? 182  TYR B CD1 1 
ATOM   3784  C CD2 . TYR B  1 183 ? 22.930  17.100  73.238  1.00 45.18  ? 182  TYR B CD2 1 
ATOM   3785  C CE1 . TYR B  1 183 ? 20.483  18.311  73.631  1.00 50.93  ? 182  TYR B CE1 1 
ATOM   3786  C CE2 . TYR B  1 183 ? 22.734  18.413  72.834  1.00 49.61  ? 182  TYR B CE2 1 
ATOM   3787  C CZ  . TYR B  1 183 ? 21.508  19.011  73.032  1.00 52.61  ? 182  TYR B CZ  1 
ATOM   3788  O OH  . TYR B  1 183 ? 21.313  20.309  72.627  1.00 56.34  ? 182  TYR B OH  1 
ATOM   3789  N N   . ASP B  1 184 ? 23.560  12.174  73.788  1.00 33.36  ? 183  ASP B N   1 
ATOM   3790  C CA  . ASP B  1 184 ? 23.905  10.888  74.366  1.00 33.03  ? 183  ASP B CA  1 
ATOM   3791  C C   . ASP B  1 184 ? 25.006  11.062  75.395  1.00 36.86  ? 183  ASP B C   1 
ATOM   3792  O O   . ASP B  1 184 ? 25.349  12.181  75.751  1.00 43.59  ? 183  ASP B O   1 
ATOM   3793  C CB  . ASP B  1 184 ? 24.305  9.880   73.284  1.00 33.36  ? 183  ASP B CB  1 
ATOM   3794  C CG  . ASP B  1 184 ? 25.549  10.293  72.521  1.00 52.89  ? 183  ASP B CG  1 
ATOM   3795  O OD1 . ASP B  1 184 ? 26.336  11.108  73.043  1.00 69.67  ? 183  ASP B OD1 1 
ATOM   3796  O OD2 . ASP B  1 184 ? 25.743  9.792   71.394  1.00 66.07  ? 183  ASP B OD2 1 
ATOM   3797  N N   . ARG B  1 185 ? 25.558  9.954   75.872  1.00 41.88  ? 184  ARG B N   1 
ATOM   3798  C CA  . ARG B  1 185 ? 26.498  9.990   76.986  1.00 55.88  ? 184  ARG B CA  1 
ATOM   3799  C C   . ARG B  1 185 ? 27.823  10.649  76.614  1.00 51.81  ? 184  ARG B C   1 
ATOM   3800  O O   . ARG B  1 185 ? 28.618  10.987  77.493  1.00 58.03  ? 184  ARG B O   1 
ATOM   3801  C CB  . ARG B  1 185 ? 26.759  8.572   77.486  1.00 39.80  ? 184  ARG B CB  1 
ATOM   3802  C CG  . ARG B  1 185 ? 25.498  7.807   77.854  1.00 44.42  ? 184  ARG B CG  1 
ATOM   3803  C CD  . ARG B  1 185 ? 25.771  6.309   77.881  1.00 39.68  ? 184  ARG B CD  1 
ATOM   3804  N NE  . ARG B  1 185 ? 26.327  5.885   79.158  1.00 33.06  ? 184  ARG B NE  1 
ATOM   3805  C CZ  . ARG B  1 185 ? 27.095  4.814   79.333  1.00 38.90  ? 184  ARG B CZ  1 
ATOM   3806  N NH1 . ARG B  1 185 ? 27.540  4.511   80.542  1.00 37.27  ? 184  ARG B NH1 1 
ATOM   3807  N NH2 . ARG B  1 185 ? 27.425  4.046   78.305  1.00 37.68  ? 184  ARG B NH2 1 
ATOM   3808  N N   . ASP B  1 186 ? 28.055  10.820  75.317  1.00 42.95  ? 185  ASP B N   1 
ATOM   3809  C CA  . ASP B  1 186 ? 29.315  11.372  74.814  1.00 55.33  ? 185  ASP B CA  1 
ATOM   3810  C C   . ASP B  1 186 ? 29.155  12.730  74.146  1.00 52.11  ? 185  ASP B C   1 
ATOM   3811  O O   . ASP B  1 186 ? 30.126  13.281  73.630  1.00 57.18  ? 185  ASP B O   1 
ATOM   3812  C CB  . ASP B  1 186 ? 29.939  10.416  73.796  1.00 60.59  ? 185  ASP B CB  1 
ATOM   3813  C CG  . ASP B  1 186 ? 30.393  9.119   74.422  1.00 75.09  ? 185  ASP B CG  1 
ATOM   3814  O OD1 . ASP B  1 186 ? 30.863  9.158   75.579  1.00 70.48  ? 185  ASP B OD1 1 
ATOM   3815  O OD2 . ASP B  1 186 ? 30.278  8.065   73.761  1.00 85.63  ? 185  ASP B OD2 1 
ATOM   3816  N N   . SER B  1 187 ? 27.937  13.260  74.130  1.00 46.47  ? 186  SER B N   1 
ATOM   3817  C CA  . SER B  1 187 ? 27.707  14.570  73.548  1.00 47.40  ? 186  SER B CA  1 
ATOM   3818  C C   . SER B  1 187 ? 28.614  15.597  74.214  1.00 48.87  ? 186  SER B C   1 
ATOM   3819  O O   . SER B  1 187 ? 28.755  15.612  75.435  1.00 50.65  ? 186  SER B O   1 
ATOM   3820  C CB  . SER B  1 187 ? 26.249  14.977  73.702  1.00 38.37  ? 186  SER B CB  1 
ATOM   3821  O OG  . SER B  1 187 ? 25.448  14.232  72.809  1.00 49.22  ? 186  SER B OG  1 
ATOM   3822  N N   . TRP B  1 188 ? 29.251  16.434  73.405  1.00 42.83  ? 187  TRP B N   1 
ATOM   3823  C CA  . TRP B  1 188 ? 30.095  17.485  73.946  1.00 65.15  ? 187  TRP B CA  1 
ATOM   3824  C C   . TRP B  1 188 ? 30.067  18.743  73.097  1.00 48.95  ? 187  TRP B C   1 
ATOM   3825  O O   . TRP B  1 188 ? 30.379  18.714  71.912  1.00 49.47  ? 187  TRP B O   1 
ATOM   3826  C CB  . TRP B  1 188 ? 31.534  17.000  74.103  1.00 48.60  ? 187  TRP B CB  1 
ATOM   3827  C CG  . TRP B  1 188 ? 32.372  17.978  74.856  1.00 68.35  ? 187  TRP B CG  1 
ATOM   3828  C CD1 . TRP B  1 188 ? 33.253  18.881  74.331  1.00 63.94  ? 187  TRP B CD1 1 
ATOM   3829  C CD2 . TRP B  1 188 ? 32.397  18.172  76.276  1.00 65.72  ? 187  TRP B CD2 1 
ATOM   3830  N NE1 . TRP B  1 188 ? 33.830  19.617  75.336  1.00 65.31  ? 187  TRP B NE1 1 
ATOM   3831  C CE2 . TRP B  1 188 ? 33.323  19.202  76.540  1.00 62.78  ? 187  TRP B CE2 1 
ATOM   3832  C CE3 . TRP B  1 188 ? 31.729  17.571  77.349  1.00 55.03  ? 187  TRP B CE3 1 
ATOM   3833  C CZ2 . TRP B  1 188 ? 33.601  19.645  77.833  1.00 52.30  ? 187  TRP B CZ2 1 
ATOM   3834  C CZ3 . TRP B  1 188 ? 32.006  18.014  78.638  1.00 61.56  ? 187  TRP B CZ3 1 
ATOM   3835  C CH2 . TRP B  1 188 ? 32.933  19.043  78.866  1.00 72.19  ? 187  TRP B CH2 1 
ATOM   3836  N N   . ASN B  1 189 ? 29.683  19.843  73.732  1.00 64.25  ? 188  ASN B N   1 
ATOM   3837  C CA  . ASN B  1 189 ? 29.731  21.163  73.140  1.00 53.16  ? 188  ASN B CA  1 
ATOM   3838  C C   . ASN B  1 189 ? 30.816  21.928  73.885  1.00 66.63  ? 188  ASN B C   1 
ATOM   3839  O O   . ASN B  1 189 ? 30.870  21.886  75.108  1.00 62.08  ? 188  ASN B O   1 
ATOM   3840  C CB  . ASN B  1 189 ? 28.374  21.850  73.294  1.00 62.05  ? 188  ASN B CB  1 
ATOM   3841  C CG  . ASN B  1 189 ? 28.362  23.260  72.737  1.00 72.83  ? 188  ASN B CG  1 
ATOM   3842  O OD1 . ASN B  1 189 ? 28.805  24.200  73.391  1.00 73.04  ? 188  ASN B OD1 1 
ATOM   3843  N ND2 . ASN B  1 189 ? 27.842  23.414  71.529  1.00 69.42  ? 188  ASN B ND2 1 
ATOM   3844  N N   . PRO B  1 190 ? 31.702  22.615  73.154  1.00 81.04  ? 189  PRO B N   1 
ATOM   3845  C CA  . PRO B  1 190 ? 32.848  23.280  73.787  1.00 67.37  ? 189  PRO B CA  1 
ATOM   3846  C C   . PRO B  1 190 ? 32.452  24.220  74.921  1.00 60.22  ? 189  PRO B C   1 
ATOM   3847  O O   . PRO B  1 190 ? 33.169  24.315  75.909  1.00 45.05  ? 189  PRO B O   1 
ATOM   3848  C CB  . PRO B  1 190 ? 33.486  24.058  72.637  1.00 67.72  ? 189  PRO B CB  1 
ATOM   3849  C CG  . PRO B  1 190 ? 32.429  24.132  71.577  1.00 77.56  ? 189  PRO B CG  1 
ATOM   3850  C CD  . PRO B  1 190 ? 31.642  22.879  71.710  1.00 68.03  ? 189  PRO B CD  1 
ATOM   3851  N N   . VAL B  1 191 ? 31.322  24.891  74.807  1.00 52.54  ? 190  VAL B N   1 
ATOM   3852  C CA  . VAL B  1 191 ? 30.911  25.757  75.898  1.00 71.75  ? 190  VAL B CA  1 
ATOM   3853  C C   . VAL B  1 191 ? 29.991  25.035  76.897  1.00 56.28  ? 190  VAL B C   1 
ATOM   3854  O O   . VAL B  1 191 ? 30.243  25.076  78.099  1.00 63.58  ? 190  VAL B O   1 
ATOM   3855  C CB  . VAL B  1 191 ? 30.300  27.083  75.376  1.00 71.02  ? 190  VAL B CB  1 
ATOM   3856  C CG1 . VAL B  1 191 ? 31.287  27.756  74.434  1.00 68.71  ? 190  VAL B CG1 1 
ATOM   3857  C CG2 . VAL B  1 191 ? 28.985  26.846  74.667  1.00 81.77  ? 190  VAL B CG2 1 
ATOM   3858  N N   . TYR B  1 192 ? 28.964  24.344  76.407  1.00 58.23  ? 191  TYR B N   1 
ATOM   3859  C CA  . TYR B  1 192 ? 27.938  23.764  77.287  1.00 52.09  ? 191  TYR B CA  1 
ATOM   3860  C C   . TYR B  1 192 ? 28.216  22.324  77.731  1.00 46.77  ? 191  TYR B C   1 
ATOM   3861  O O   . TYR B  1 192 ? 27.422  21.730  78.457  1.00 45.73  ? 191  TYR B O   1 
ATOM   3862  C CB  . TYR B  1 192 ? 26.574  23.842  76.604  1.00 48.60  ? 191  TYR B CB  1 
ATOM   3863  C CG  . TYR B  1 192 ? 26.240  25.240  76.123  1.00 73.04  ? 191  TYR B CG  1 
ATOM   3864  C CD1 . TYR B  1 192 ? 26.136  25.523  74.770  1.00 69.31  ? 191  TYR B CD1 1 
ATOM   3865  C CD2 . TYR B  1 192 ? 26.053  26.281  77.027  1.00 62.60  ? 191  TYR B CD2 1 
ATOM   3866  C CE1 . TYR B  1 192 ? 25.842  26.799  74.329  1.00 74.92  ? 191  TYR B CE1 1 
ATOM   3867  C CE2 . TYR B  1 192 ? 25.760  27.563  76.594  1.00 71.23  ? 191  TYR B CE2 1 
ATOM   3868  C CZ  . TYR B  1 192 ? 25.658  27.815  75.244  1.00 73.50  ? 191  TYR B CZ  1 
ATOM   3869  O OH  . TYR B  1 192 ? 25.367  29.082  74.801  1.00 53.40  ? 191  TYR B OH  1 
ATOM   3870  N N   . GLY B  1 193 ? 29.355  21.778  77.317  1.00 57.03  ? 192  GLY B N   1 
ATOM   3871  C CA  . GLY B  1 193 ? 29.706  20.400  77.621  1.00 46.48  ? 192  GLY B CA  1 
ATOM   3872  C C   . GLY B  1 193 ? 28.639  19.445  77.117  1.00 56.06  ? 192  GLY B C   1 
ATOM   3873  O O   . GLY B  1 193 ? 28.197  19.552  75.975  1.00 49.41  ? 192  GLY B O   1 
ATOM   3874  N N   . ASN B  1 194 ? 28.220  18.513  77.970  1.00 38.82  ? 193  ASN B N   1 
ATOM   3875  C CA  . ASN B  1 194 ? 27.179  17.553  77.620  1.00 32.29  ? 193  ASN B CA  1 
ATOM   3876  C C   . ASN B  1 194 ? 25.829  18.066  78.084  1.00 40.08  ? 193  ASN B C   1 
ATOM   3877  O O   . ASN B  1 194 ? 25.591  18.187  79.283  1.00 44.67  ? 193  ASN B O   1 
ATOM   3878  C CB  . ASN B  1 194 ? 27.458  16.202  78.284  1.00 41.64  ? 193  ASN B CB  1 
ATOM   3879  C CG  . ASN B  1 194 ? 26.517  15.114  77.804  1.00 46.61  ? 193  ASN B CG  1 
ATOM   3880  O OD1 . ASN B  1 194 ? 25.382  15.388  77.426  1.00 49.96  ? 193  ASN B OD1 1 
ATOM   3881  N ND2 . ASN B  1 194 ? 26.991  13.875  77.801  1.00 40.60  ? 193  ASN B ND2 1 
ATOM   3882  N N   . GLN B  1 195 ? 24.938  18.346  77.140  1.00 36.27  ? 194  GLN B N   1 
ATOM   3883  C CA  . GLN B  1 195 ? 23.656  18.967  77.458  1.00 36.67  ? 194  GLN B CA  1 
ATOM   3884  C C   . GLN B  1 195 ? 22.512  17.966  77.693  1.00 46.62  ? 194  GLN B C   1 
ATOM   3885  O O   . GLN B  1 195 ? 21.347  18.355  77.789  1.00 42.36  ? 194  GLN B O   1 
ATOM   3886  C CB  . GLN B  1 195 ? 23.283  19.912  76.324  1.00 38.90  ? 194  GLN B CB  1 
ATOM   3887  C CG  . GLN B  1 195 ? 24.369  20.938  76.028  1.00 54.81  ? 194  GLN B CG  1 
ATOM   3888  C CD  . GLN B  1 195 ? 24.114  21.695  74.747  1.00 44.28  ? 194  GLN B CD  1 
ATOM   3889  O OE1 . GLN B  1 195 ? 23.457  22.731  74.752  1.00 53.50  ? 194  GLN B OE1 1 
ATOM   3890  N NE2 . GLN B  1 195 ? 24.618  21.168  73.635  1.00 48.69  ? 194  GLN B NE2 1 
ATOM   3891  N N   . LEU B  1 196 ? 22.850  16.685  77.802  1.00 37.02  ? 195  LEU B N   1 
ATOM   3892  C CA  . LEU B  1 196 ? 21.856  15.615  77.879  1.00 31.79  ? 195  LEU B CA  1 
ATOM   3893  C C   . LEU B  1 196 ? 20.660  15.950  78.775  1.00 35.26  ? 195  LEU B C   1 
ATOM   3894  O O   . LEU B  1 196 ? 19.517  15.898  78.327  1.00 42.04  ? 195  LEU B O   1 
ATOM   3895  C CB  . LEU B  1 196 ? 22.528  14.325  78.356  1.00 39.26  ? 195  LEU B CB  1 
ATOM   3896  C CG  . LEU B  1 196 ? 21.658  13.076  78.529  1.00 49.73  ? 195  LEU B CG  1 
ATOM   3897  C CD1 . LEU B  1 196 ? 20.848  12.767  77.276  1.00 37.19  ? 195  LEU B CD1 1 
ATOM   3898  C CD2 . LEU B  1 196 ? 22.545  11.902  78.891  1.00 38.86  ? 195  LEU B CD2 1 
ATOM   3899  N N   . PHE B  1 197 ? 20.916  16.298  80.032  1.00 40.70  ? 196  PHE B N   1 
ATOM   3900  C CA  . PHE B  1 197 ? 19.826  16.604  80.969  1.00 40.40  ? 196  PHE B CA  1 
ATOM   3901  C C   . PHE B  1 197 ? 19.840  18.057  81.464  1.00 47.04  ? 196  PHE B C   1 
ATOM   3902  O O   . PHE B  1 197 ? 19.343  18.356  82.540  1.00 37.88  ? 196  PHE B O   1 
ATOM   3903  C CB  . PHE B  1 197 ? 19.874  15.653  82.168  1.00 36.24  ? 196  PHE B CB  1 
ATOM   3904  C CG  . PHE B  1 197 ? 19.767  14.193  81.797  1.00 27.89  ? 196  PHE B CG  1 
ATOM   3905  C CD1 . PHE B  1 197 ? 18.656  13.713  81.121  1.00 33.26  ? 196  PHE B CD1 1 
ATOM   3906  C CD2 . PHE B  1 197 ? 20.775  13.304  82.136  1.00 42.91  ? 196  PHE B CD2 1 
ATOM   3907  C CE1 . PHE B  1 197 ? 18.558  12.366  80.776  1.00 37.81  ? 196  PHE B CE1 1 
ATOM   3908  C CE2 . PHE B  1 197 ? 20.684  11.953  81.798  1.00 39.35  ? 196  PHE B CE2 1 
ATOM   3909  C CZ  . PHE B  1 197 ? 19.575  11.489  81.117  1.00 35.41  ? 196  PHE B CZ  1 
ATOM   3910  N N   . MET B  1 198 ? 20.404  18.960  80.672  1.00 50.54  ? 197  MET B N   1 
ATOM   3911  C CA  . MET B  1 198 ? 20.462  20.373  81.038  1.00 48.71  ? 197  MET B CA  1 
ATOM   3912  C C   . MET B  1 198 ? 19.146  21.066  80.692  1.00 47.91  ? 197  MET B C   1 
ATOM   3913  O O   . MET B  1 198 ? 18.746  21.090  79.527  1.00 42.32  ? 197  MET B O   1 
ATOM   3914  C CB  . MET B  1 198 ? 21.615  21.037  80.283  1.00 46.93  ? 197  MET B CB  1 
ATOM   3915  C CG  . MET B  1 198 ? 21.840  22.506  80.597  1.00 51.57  ? 197  MET B CG  1 
ATOM   3916  S SD  . MET B  1 198 ? 23.205  23.212  79.636  1.00 50.95  ? 197  MET B SD  1 
ATOM   3917  C CE  . MET B  1 198 ? 24.603  22.268  80.255  1.00 46.48  ? 197  MET B CE  1 
ATOM   3918  N N   . LYS B  1 199 ? 18.479  21.639  81.693  1.00 40.45  ? 198  LYS B N   1 
ATOM   3919  C CA  . LYS B  1 199 ? 17.201  22.332  81.465  1.00 44.34  ? 198  LYS B CA  1 
ATOM   3920  C C   . LYS B  1 199 ? 17.338  23.675  80.727  1.00 58.87  ? 198  LYS B C   1 
ATOM   3921  O O   . LYS B  1 199 ? 16.543  23.971  79.833  1.00 49.16  ? 198  LYS B O   1 
ATOM   3922  C CB  . LYS B  1 199 ? 16.440  22.560  82.778  1.00 40.89  ? 198  LYS B CB  1 
ATOM   3923  C CG  . LYS B  1 199 ? 15.042  23.157  82.556  1.00 39.67  ? 198  LYS B CG  1 
ATOM   3924  C CD  . LYS B  1 199 ? 14.303  23.428  83.864  1.00 53.69  ? 198  LYS B CD  1 
ATOM   3925  C CE  . LYS B  1 199 ? 13.962  22.133  84.606  1.00 88.31  ? 198  LYS B CE  1 
ATOM   3926  N NZ  . LYS B  1 199 ? 13.042  21.229  83.840  1.00 83.96  ? 198  LYS B NZ  1 
ATOM   3927  N N   . THR B  1 200 ? 18.319  24.492  81.106  1.00 57.58  ? 199  THR B N   1 
ATOM   3928  C CA  . THR B  1 200 ? 18.546  25.778  80.433  1.00 57.18  ? 199  THR B CA  1 
ATOM   3929  C C   . THR B  1 200 ? 20.045  26.042  80.352  1.00 43.79  ? 199  THR B C   1 
ATOM   3930  O O   . THR B  1 200 ? 20.806  25.563  81.198  1.00 62.84  ? 199  THR B O   1 
ATOM   3931  C CB  . THR B  1 200 ? 17.876  26.983  81.179  1.00 53.20  ? 199  THR B CB  1 
ATOM   3932  O OG1 . THR B  1 200 ? 18.526  27.195  82.432  1.00 57.25  ? 199  THR B OG1 1 
ATOM   3933  C CG2 . THR B  1 200 ? 16.387  26.750  81.430  1.00 53.89  ? 199  THR B CG2 1 
ATOM   3934  N N   . ARG B  1 201 ? 20.470  26.812  79.353  1.00 55.81  ? 200  ARG B N   1 
ATOM   3935  C CA  . ARG B  1 201 ? 21.888  27.125  79.194  1.00 63.34  ? 200  ARG B CA  1 
ATOM   3936  C C   . ARG B  1 201 ? 22.387  28.230  80.123  1.00 54.21  ? 200  ARG B C   1 
ATOM   3937  O O   . ARG B  1 201 ? 23.565  28.248  80.490  1.00 55.27  ? 200  ARG B O   1 
ATOM   3938  C CB  . ARG B  1 201 ? 22.195  27.491  77.744  1.00 61.15  ? 200  ARG B CB  1 
ATOM   3939  C CG  . ARG B  1 201 ? 22.133  26.300  76.816  1.00 62.64  ? 200  ARG B CG  1 
ATOM   3940  C CD  . ARG B  1 201 ? 22.370  26.699  75.378  1.00 73.03  ? 200  ARG B CD  1 
ATOM   3941  N NE  . ARG B  1 201 ? 22.112  25.583  74.477  1.00 61.31  ? 200  ARG B NE  1 
ATOM   3942  C CZ  . ARG B  1 201 ? 22.168  25.657  73.154  1.00 97.91  ? 200  ARG B CZ  1 
ATOM   3943  N NH1 . ARG B  1 201 ? 21.912  24.580  72.423  1.00 102.39 ? 200  ARG B NH1 1 
ATOM   3944  N NH2 . ARG B  1 201 ? 22.482  26.805  72.562  1.00 93.08  ? 200  ARG B NH2 1 
ATOM   3945  N N   . ASN B  1 202 ? 21.506  29.148  80.510  1.00 61.00  ? 201  ASN B N   1 
ATOM   3946  C CA  . ASN B  1 202 ? 21.933  30.283  81.326  1.00 88.83  ? 201  ASN B CA  1 
ATOM   3947  C C   . ASN B  1 202 ? 20.826  30.851  82.206  1.00 83.24  ? 201  ASN B C   1 
ATOM   3948  O O   . ASN B  1 202 ? 20.651  32.064  82.299  1.00 86.21  ? 201  ASN B O   1 
ATOM   3949  C CB  . ASN B  1 202 ? 22.520  31.387  80.437  1.00 61.34  ? 201  ASN B CB  1 
ATOM   3950  C CG  . ASN B  1 202 ? 21.710  31.614  79.178  1.00 81.46  ? 201  ASN B CG  1 
ATOM   3951  O OD1 . ASN B  1 202 ? 20.558  32.053  79.235  1.00 81.66  ? 201  ASN B OD1 1 
ATOM   3952  N ND2 . ASN B  1 202 ? 22.310  31.318  78.026  1.00 80.96  ? 201  ASN B ND2 1 
ATOM   3953  N N   . GLY B  1 203 ? 20.085  29.964  82.856  1.00 72.01  ? 202  GLY B N   1 
ATOM   3954  C CA  . GLY B  1 203 ? 19.060  30.370  83.800  1.00 70.14  ? 202  GLY B CA  1 
ATOM   3955  C C   . GLY B  1 203 ? 19.643  30.760  85.148  1.00 80.21  ? 202  GLY B C   1 
ATOM   3956  O O   . GLY B  1 203 ? 20.713  30.291  85.550  1.00 66.55  ? 202  GLY B O   1 
ATOM   3957  N N   . SER B  1 204 ? 18.930  31.621  85.860  1.00 68.85  ? 203  SER B N   1 
ATOM   3958  C CA  . SER B  1 204 ? 19.420  32.134  87.129  1.00 80.72  ? 203  SER B CA  1 
ATOM   3959  C C   . SER B  1 204 ? 18.771  31.403  88.295  1.00 73.50  ? 203  SER B C   1 
ATOM   3960  O O   . SER B  1 204 ? 18.134  32.017  89.148  1.00 99.97  ? 203  SER B O   1 
ATOM   3961  C CB  . SER B  1 204 ? 19.170  33.644  87.224  1.00 86.98  ? 203  SER B CB  1 
ATOM   3962  O OG  . SER B  1 204 ? 17.824  33.967  86.919  1.00 83.92  ? 203  SER B OG  1 
ATOM   3963  N N   . MET B  1 205 ? 18.933  30.085  88.320  1.00 68.26  ? 204  MET B N   1 
ATOM   3964  C CA  . MET B  1 205 ? 18.464  29.272  89.435  1.00 65.83  ? 204  MET B CA  1 
ATOM   3965  C C   . MET B  1 205 ? 19.630  28.424  89.964  1.00 61.62  ? 204  MET B C   1 
ATOM   3966  O O   . MET B  1 205 ? 20.716  28.436  89.396  1.00 73.95  ? 204  MET B O   1 
ATOM   3967  C CB  . MET B  1 205 ? 17.279  28.392  88.998  1.00 76.94  ? 204  MET B CB  1 
ATOM   3968  C CG  . MET B  1 205 ? 17.645  27.088  88.254  1.00 86.90  ? 204  MET B CG  1 
ATOM   3969  S SD  . MET B  1 205 ? 18.106  27.247  86.504  1.00 74.96  ? 204  MET B SD  1 
ATOM   3970  C CE  . MET B  1 205 ? 16.536  27.667  85.753  1.00 62.75  ? 204  MET B CE  1 
ATOM   3971  N N   . LYS B  1 206 ? 19.413  27.705  91.059  1.00 58.74  ? 205  LYS B N   1 
ATOM   3972  C CA  . LYS B  1 206 ? 20.426  26.797  91.592  1.00 64.85  ? 205  LYS B CA  1 
ATOM   3973  C C   . LYS B  1 206 ? 20.718  25.683  90.583  1.00 70.92  ? 205  LYS B C   1 
ATOM   3974  O O   . LYS B  1 206 ? 19.869  25.335  89.766  1.00 56.27  ? 205  LYS B O   1 
ATOM   3975  C CB  . LYS B  1 206 ? 19.929  26.169  92.894  1.00 82.87  ? 205  LYS B CB  1 
ATOM   3976  C CG  . LYS B  1 206 ? 19.567  27.166  93.977  1.00 90.18  ? 205  LYS B CG  1 
ATOM   3977  C CD  . LYS B  1 206 ? 18.357  26.694  94.779  1.00 113.41 ? 205  LYS B CD  1 
ATOM   3978  C CE  . LYS B  1 206 ? 18.447  25.214  95.155  1.00 109.57 ? 205  LYS B CE  1 
ATOM   3979  N NZ  . LYS B  1 206 ? 19.666  24.888  95.947  1.00 114.22 ? 205  LYS B NZ  1 
ATOM   3980  N N   . ALA B  1 207 ? 21.914  25.114  90.647  1.00 50.16  ? 206  ALA B N   1 
ATOM   3981  C CA  . ALA B  1 207 ? 22.291  24.059  89.720  1.00 54.89  ? 206  ALA B CA  1 
ATOM   3982  C C   . ALA B  1 207 ? 21.329  22.877  89.881  1.00 64.98  ? 206  ALA B C   1 
ATOM   3983  O O   . ALA B  1 207 ? 20.896  22.276  88.907  1.00 57.08  ? 206  ALA B O   1 
ATOM   3984  C CB  . ALA B  1 207 ? 23.726  23.631  89.969  1.00 49.61  ? 206  ALA B CB  1 
ATOM   3985  N N   . ALA B  1 208 ? 20.971  22.578  91.122  1.00 61.79  ? 207  ALA B N   1 
ATOM   3986  C CA  . ALA B  1 208 ? 20.072  21.473  91.430  1.00 63.98  ? 207  ALA B CA  1 
ATOM   3987  C C   . ALA B  1 208 ? 18.683  21.624  90.804  1.00 54.94  ? 207  ALA B C   1 
ATOM   3988  O O   . ALA B  1 208 ? 17.969  20.636  90.637  1.00 52.46  ? 207  ALA B O   1 
ATOM   3989  C CB  . ALA B  1 208 ? 19.946  21.320  92.938  1.00 46.11  ? 207  ALA B CB  1 
ATOM   3990  N N   . GLU B  1 209 ? 18.306  22.850  90.460  1.00 54.32  ? 208  GLU B N   1 
ATOM   3991  C CA  . GLU B  1 209 ? 16.976  23.128  89.922  1.00 51.45  ? 208  GLU B CA  1 
ATOM   3992  C C   . GLU B  1 209 ? 17.020  23.199  88.409  1.00 55.44  ? 208  GLU B C   1 
ATOM   3993  O O   . GLU B  1 209 ? 16.009  23.473  87.751  1.00 58.26  ? 208  GLU B O   1 
ATOM   3994  C CB  . GLU B  1 209 ? 16.457  24.463  90.462  1.00 53.36  ? 208  GLU B CB  1 
ATOM   3995  C CG  . GLU B  1 209 ? 16.082  24.435  91.943  1.00 68.64  ? 208  GLU B CG  1 
ATOM   3996  C CD  . GLU B  1 209 ? 15.687  25.807  92.479  1.00 83.37  ? 208  GLU B CD  1 
ATOM   3997  O OE1 . GLU B  1 209 ? 16.120  26.836  91.898  1.00 85.41  ? 208  GLU B OE1 1 
ATOM   3998  O OE2 . GLU B  1 209 ? 14.941  25.859  93.486  1.00 96.60  ? 208  GLU B OE2 1 
ATOM   3999  N N   . ASN B  1 210 ? 18.204  22.961  87.855  1.00 58.02  ? 209  ASN B N   1 
ATOM   4000  C CA  . ASN B  1 210 ? 18.415  23.121  86.426  1.00 70.52  ? 209  ASN B CA  1 
ATOM   4001  C C   . ASN B  1 210 ? 18.523  21.787  85.698  1.00 55.21  ? 209  ASN B C   1 
ATOM   4002  O O   . ASN B  1 210 ? 18.962  21.745  84.549  1.00 56.76  ? 209  ASN B O   1 
ATOM   4003  C CB  . ASN B  1 210 ? 19.671  23.955  86.160  1.00 45.95  ? 209  ASN B CB  1 
ATOM   4004  C CG  . ASN B  1 210 ? 19.759  24.419  84.725  1.00 50.77  ? 209  ASN B CG  1 
ATOM   4005  O OD1 . ASN B  1 210 ? 18.756  24.816  84.127  1.00 45.53  ? 209  ASN B OD1 1 
ATOM   4006  N ND2 . ASN B  1 210 ? 20.962  24.360  84.155  1.00 47.73  ? 209  ASN B ND2 1 
ATOM   4007  N N   . PHE B  1 211 ? 18.145  20.703  86.372  1.00 56.37  ? 210  PHE B N   1 
ATOM   4008  C CA  . PHE B  1 211 ? 18.083  19.403  85.722  1.00 51.80  ? 210  PHE B CA  1 
ATOM   4009  C C   . PHE B  1 211 ? 16.726  19.225  85.055  1.00 51.68  ? 210  PHE B C   1 
ATOM   4010  O O   . PHE B  1 211 ? 15.698  19.665  85.560  1.00 49.46  ? 210  PHE B O   1 
ATOM   4011  C CB  . PHE B  1 211 ? 18.341  18.265  86.712  1.00 52.27  ? 210  PHE B CB  1 
ATOM   4012  C CG  . PHE B  1 211 ? 19.755  18.209  87.219  1.00 56.60  ? 210  PHE B CG  1 
ATOM   4013  C CD1 . PHE B  1 211 ? 20.793  17.852  86.376  1.00 43.29  ? 210  PHE B CD1 1 
ATOM   4014  C CD2 . PHE B  1 211 ? 20.043  18.503  88.543  1.00 60.41  ? 210  PHE B CD2 1 
ATOM   4015  C CE1 . PHE B  1 211 ? 22.095  17.787  86.845  1.00 51.00  ? 210  PHE B CE1 1 
ATOM   4016  C CE2 . PHE B  1 211 ? 21.338  18.442  89.017  1.00 57.31  ? 210  PHE B CE2 1 
ATOM   4017  C CZ  . PHE B  1 211 ? 22.367  18.083  88.168  1.00 58.96  ? 210  PHE B CZ  1 
ATOM   4018  N N   . LEU B  1 212 ? 16.736  18.570  83.905  1.00 50.10  ? 211  LEU B N   1 
ATOM   4019  C CA  . LEU B  1 212 ? 15.515  18.286  83.176  1.00 49.56  ? 211  LEU B CA  1 
ATOM   4020  C C   . LEU B  1 212 ? 14.526  17.537  84.069  1.00 49.40  ? 211  LEU B C   1 
ATOM   4021  O O   . LEU B  1 212 ? 14.908  16.639  84.817  1.00 43.56  ? 211  LEU B O   1 
ATOM   4022  C CB  . LEU B  1 212 ? 15.851  17.455  81.937  1.00 51.86  ? 211  LEU B CB  1 
ATOM   4023  C CG  . LEU B  1 212 ? 14.720  17.190  80.946  1.00 53.49  ? 211  LEU B CG  1 
ATOM   4024  C CD1 . LEU B  1 212 ? 14.201  18.492  80.365  1.00 46.39  ? 211  LEU B CD1 1 
ATOM   4025  C CD2 . LEU B  1 212 ? 15.202  16.263  79.842  1.00 47.40  ? 211  LEU B CD2 1 
ATOM   4026  N N   . ASP B  1 213 ? 13.260  17.934  84.004  1.00 41.96  ? 212  ASP B N   1 
ATOM   4027  C CA  . ASP B  1 213 ? 12.208  17.290  84.768  1.00 54.31  ? 212  ASP B CA  1 
ATOM   4028  C C   . ASP B  1 213 ? 12.009  15.862  84.260  1.00 51.54  ? 212  ASP B C   1 
ATOM   4029  O O   . ASP B  1 213 ? 11.907  15.644  83.055  1.00 46.24  ? 212  ASP B O   1 
ATOM   4030  C CB  . ASP B  1 213 ? 10.914  18.101  84.639  1.00 53.67  ? 212  ASP B CB  1 
ATOM   4031  C CG  . ASP B  1 213 ? 9.697   17.382  85.216  1.00 83.91  ? 212  ASP B CG  1 
ATOM   4032  O OD1 . ASP B  1 213 ? 9.863   16.425  86.009  1.00 82.52  ? 212  ASP B OD1 1 
ATOM   4033  O OD2 . ASP B  1 213 ? 8.562   17.787  84.875  1.00 79.45  ? 212  ASP B OD2 1 
ATOM   4034  N N   . PRO B  1 214 ? 11.969  14.883  85.177  1.00 48.72  ? 213  PRO B N   1 
ATOM   4035  C CA  . PRO B  1 214 ? 11.774  13.480  84.775  1.00 51.57  ? 213  PRO B CA  1 
ATOM   4036  C C   . PRO B  1 214 ? 10.560  13.271  83.859  1.00 43.48  ? 213  PRO B C   1 
ATOM   4037  O O   . PRO B  1 214 ? 10.620  12.449  82.957  1.00 37.67  ? 213  PRO B O   1 
ATOM   4038  C CB  . PRO B  1 214 ? 11.590  12.742  86.117  1.00 43.73  ? 213  PRO B CB  1 
ATOM   4039  C CG  . PRO B  1 214 ? 11.417  13.818  87.158  1.00 50.33  ? 213  PRO B CG  1 
ATOM   4040  C CD  . PRO B  1 214 ? 12.139  15.015  86.632  1.00 45.72  ? 213  PRO B CD  1 
ATOM   4041  N N   . ASN B  1 215 ? 9.482   14.018  84.076  1.00 45.10  ? 214  ASN B N   1 
ATOM   4042  C CA  . ASN B  1 215 ? 8.303   13.904  83.226  1.00 39.73  ? 214  ASN B CA  1 
ATOM   4043  C C   . ASN B  1 215 ? 8.569   14.268  81.764  1.00 57.23  ? 214  ASN B C   1 
ATOM   4044  O O   . ASN B  1 215 ? 7.818   13.875  80.872  1.00 52.29  ? 214  ASN B O   1 
ATOM   4045  C CB  . ASN B  1 215 ? 7.183   14.788  83.766  1.00 50.87  ? 214  ASN B CB  1 
ATOM   4046  C CG  . ASN B  1 215 ? 6.656   14.312  85.113  1.00 70.10  ? 214  ASN B CG  1 
ATOM   4047  O OD1 . ASN B  1 215 ? 6.849   13.153  85.502  1.00 60.02  ? 214  ASN B OD1 1 
ATOM   4048  N ND2 . ASN B  1 215 ? 5.978   15.205  85.826  1.00 61.22  ? 214  ASN B ND2 1 
ATOM   4049  N N   . LYS B  1 216 ? 9.627   15.032  81.517  1.00 48.99  ? 215  LYS B N   1 
ATOM   4050  C CA  . LYS B  1 216 ? 9.967   15.443  80.159  1.00 53.71  ? 215  LYS B CA  1 
ATOM   4051  C C   . LYS B  1 216 ? 11.067  14.572  79.555  1.00 57.41  ? 215  LYS B C   1 
ATOM   4052  O O   . LYS B  1 216 ? 11.575  14.864  78.469  1.00 45.72  ? 215  LYS B O   1 
ATOM   4053  C CB  . LYS B  1 216 ? 10.394  16.912  80.138  1.00 48.82  ? 215  LYS B CB  1 
ATOM   4054  C CG  . LYS B  1 216 ? 9.276   17.877  80.477  1.00 58.44  ? 215  LYS B CG  1 
ATOM   4055  C CD  . LYS B  1 216 ? 9.742   19.315  80.342  1.00 79.24  ? 215  LYS B CD  1 
ATOM   4056  C CE  . LYS B  1 216 ? 8.619   20.291  80.622  1.00 86.14  ? 215  LYS B CE  1 
ATOM   4057  N NZ  . LYS B  1 216 ? 9.073   21.693  80.458  1.00 93.38  ? 215  LYS B NZ  1 
ATOM   4058  N N   . ALA B  1 217 ? 11.434  13.506  80.258  1.00 43.64  ? 216  ALA B N   1 
ATOM   4059  C CA  . ALA B  1 217 ? 12.447  12.583  79.763  1.00 45.68  ? 216  ALA B CA  1 
ATOM   4060  C C   . ALA B  1 217 ? 11.856  11.175  79.666  1.00 47.39  ? 216  ALA B C   1 
ATOM   4061  O O   . ALA B  1 217 ? 10.733  10.937  80.099  1.00 47.20  ? 216  ALA B O   1 
ATOM   4062  C CB  . ALA B  1 217 ? 13.658  12.596  80.673  1.00 45.43  ? 216  ALA B CB  1 
ATOM   4063  N N   . SER B  1 218 ? 12.604  10.250  79.081  1.00 40.42  ? 217  SER B N   1 
ATOM   4064  C CA  . SER B  1 218 ? 12.146  8.873   78.970  1.00 37.25  ? 217  SER B CA  1 
ATOM   4065  C C   . SER B  1 218 ? 11.694  8.351   80.328  1.00 39.66  ? 217  SER B C   1 
ATOM   4066  O O   . SER B  1 218 ? 12.402  8.484   81.325  1.00 35.29  ? 217  SER B O   1 
ATOM   4067  C CB  . SER B  1 218 ? 13.259  7.984   78.426  1.00 46.61  ? 217  SER B CB  1 
ATOM   4068  O OG  . SER B  1 218 ? 12.930  6.613   78.579  1.00 50.22  ? 217  SER B OG  1 
ATOM   4069  N N   . SER B  1 219 ? 10.513  7.750   80.364  1.00 33.10  ? 218  SER B N   1 
ATOM   4070  C CA  . SER B  1 219 ? 9.962   7.262   81.618  1.00 41.21  ? 218  SER B CA  1 
ATOM   4071  C C   . SER B  1 219 ? 10.818  6.144   82.229  1.00 43.01  ? 218  SER B C   1 
ATOM   4072  O O   . SER B  1 219 ? 10.721  5.875   83.423  1.00 44.45  ? 218  SER B O   1 
ATOM   4073  C CB  . SER B  1 219 ? 8.524   6.779   81.417  1.00 44.31  ? 218  SER B CB  1 
ATOM   4074  O OG  . SER B  1 219 ? 8.475   5.664   80.540  1.00 48.92  ? 218  SER B OG  1 
ATOM   4075  N N   . LEU B  1 220 ? 11.661  5.499   81.425  1.00 31.15  ? 219  LEU B N   1 
ATOM   4076  C CA  . LEU B  1 220 ? 12.551  4.471   81.957  1.00 36.11  ? 219  LEU B CA  1 
ATOM   4077  C C   . LEU B  1 220 ? 13.542  5.072   82.941  1.00 34.46  ? 219  LEU B C   1 
ATOM   4078  O O   . LEU B  1 220 ? 13.986  4.391   83.864  1.00 39.01  ? 219  LEU B O   1 
ATOM   4079  C CB  . LEU B  1 220 ? 13.338  3.754   80.850  1.00 38.45  ? 219  LEU B CB  1 
ATOM   4080  C CG  . LEU B  1 220 ? 12.595  2.984   79.761  1.00 35.29  ? 219  LEU B CG  1 
ATOM   4081  C CD1 . LEU B  1 220 ? 13.458  1.809   79.309  1.00 36.17  ? 219  LEU B CD1 1 
ATOM   4082  C CD2 . LEU B  1 220 ? 11.256  2.503   80.244  1.00 46.22  ? 219  LEU B CD2 1 
ATOM   4083  N N   . LEU B  1 221 ? 13.896  6.340   82.744  1.00 34.21  ? 220  LEU B N   1 
ATOM   4084  C CA  . LEU B  1 221 ? 14.897  6.992   83.592  1.00 33.84  ? 220  LEU B CA  1 
ATOM   4085  C C   . LEU B  1 221 ? 14.449  7.107   85.049  1.00 37.02  ? 220  LEU B C   1 
ATOM   4086  O O   . LEU B  1 221 ? 15.253  6.961   85.970  1.00 44.22  ? 220  LEU B O   1 
ATOM   4087  C CB  . LEU B  1 221 ? 15.237  8.374   83.046  1.00 32.82  ? 220  LEU B CB  1 
ATOM   4088  C CG  . LEU B  1 221 ? 15.939  8.374   81.687  1.00 37.47  ? 220  LEU B CG  1 
ATOM   4089  C CD1 . LEU B  1 221 ? 16.006  9.781   81.150  1.00 33.83  ? 220  LEU B CD1 1 
ATOM   4090  C CD2 . LEU B  1 221 ? 17.329  7.757   81.782  1.00 31.45  ? 220  LEU B CD2 1 
ATOM   4091  N N   . SER B  1 222 ? 13.165  7.363   85.257  1.00 34.55  ? 221  SER B N   1 
ATOM   4092  C CA  . SER B  1 222 ? 12.646  7.546   86.597  1.00 34.38  ? 221  SER B CA  1 
ATOM   4093  C C   . SER B  1 222 ? 11.834  6.338   87.067  1.00 42.86  ? 221  SER B C   1 
ATOM   4094  O O   . SER B  1 222 ? 12.255  5.613   87.970  1.00 44.68  ? 221  SER B O   1 
ATOM   4095  C CB  . SER B  1 222 ? 11.800  8.816   86.660  1.00 38.17  ? 221  SER B CB  1 
ATOM   4096  O OG  . SER B  1 222 ? 10.858  8.849   85.607  1.00 46.14  ? 221  SER B OG  1 
ATOM   4097  N N   . SER B  1 223 ? 10.676  6.126   86.453  1.00 34.88  ? 222  SER B N   1 
ATOM   4098  C CA  . SER B  1 223 ? 9.787   5.047   86.857  1.00 41.29  ? 222  SER B CA  1 
ATOM   4099  C C   . SER B  1 223 ? 10.385  3.664   86.602  1.00 38.45  ? 222  SER B C   1 
ATOM   4100  O O   . SER B  1 223 ? 10.174  2.740   87.383  1.00 42.77  ? 222  SER B O   1 
ATOM   4101  C CB  . SER B  1 223 ? 8.450   5.182   86.145  1.00 39.51  ? 222  SER B CB  1 
ATOM   4102  O OG  . SER B  1 223 ? 7.756   6.315   86.625  1.00 52.20  ? 222  SER B OG  1 
ATOM   4103  N N   . GLY B  1 224 ? 11.120  3.514   85.506  1.00 38.12  ? 223  GLY B N   1 
ATOM   4104  C CA  . GLY B  1 224 ? 11.908  2.308   85.305  1.00 35.24  ? 223  GLY B CA  1 
ATOM   4105  C C   . GLY B  1 224 ? 11.464  1.375   84.196  1.00 39.07  ? 223  GLY B C   1 
ATOM   4106  O O   . GLY B  1 224 ? 10.503  1.634   83.475  1.00 32.78  ? 223  GLY B O   1 
ATOM   4107  N N   . PHE B  1 225 ? 12.184  0.262   84.089  1.00 29.80  ? 224  PHE B N   1 
ATOM   4108  C CA  . PHE B  1 225 ? 12.052  -0.654  82.980  1.00 28.84  ? 224  PHE B CA  1 
ATOM   4109  C C   . PHE B  1 225 ? 11.493  -1.993  83.432  1.00 27.93  ? 224  PHE B C   1 
ATOM   4110  O O   . PHE B  1 225 ? 11.928  -2.536  84.439  1.00 29.66  ? 224  PHE B O   1 
ATOM   4111  C CB  . PHE B  1 225 ? 13.428  -0.871  82.350  1.00 28.02  ? 224  PHE B CB  1 
ATOM   4112  C CG  . PHE B  1 225 ? 13.465  -1.998  81.369  1.00 29.42  ? 224  PHE B CG  1 
ATOM   4113  C CD1 . PHE B  1 225 ? 12.816  -1.890  80.148  1.00 33.89  ? 224  PHE B CD1 1 
ATOM   4114  C CD2 . PHE B  1 225 ? 14.141  -3.167  81.666  1.00 32.92  ? 224  PHE B CD2 1 
ATOM   4115  C CE1 . PHE B  1 225 ? 12.840  -2.930  79.239  1.00 32.53  ? 224  PHE B CE1 1 
ATOM   4116  C CE2 . PHE B  1 225 ? 14.169  -4.211  80.768  1.00 25.89  ? 224  PHE B CE2 1 
ATOM   4117  C CZ  . PHE B  1 225 ? 13.515  -4.094  79.550  1.00 33.59  ? 224  PHE B CZ  1 
ATOM   4118  N N   . SER B  1 226 ? 10.549  -2.534  82.671  1.00 25.33  ? 225  SER B N   1 
ATOM   4119  C CA  . SER B  1 226 ? 9.959   -3.836  82.989  1.00 30.67  ? 225  SER B CA  1 
ATOM   4120  C C   . SER B  1 226 ? 10.472  -4.910  82.043  1.00 30.25  ? 225  SER B C   1 
ATOM   4121  O O   . SER B  1 226 ? 10.063  -4.970  80.888  1.00 35.08  ? 225  SER B O   1 
ATOM   4122  C CB  . SER B  1 226 ? 8.437   -3.773  82.908  1.00 24.89  ? 225  SER B CB  1 
ATOM   4123  O OG  . SER B  1 226 ? 7.920   -2.903  83.901  1.00 33.67  ? 225  SER B OG  1 
ATOM   4124  N N   . PRO B  1 227 ? 11.378  -5.765  82.528  1.00 33.32  ? 226  PRO B N   1 
ATOM   4125  C CA  . PRO B  1 227 ? 11.884  -6.844  81.676  1.00 39.24  ? 226  PRO B CA  1 
ATOM   4126  C C   . PRO B  1 227 ? 10.771  -7.764  81.210  1.00 35.86  ? 226  PRO B C   1 
ATOM   4127  O O   . PRO B  1 227 ? 9.784   -7.964  81.928  1.00 36.96  ? 226  PRO B O   1 
ATOM   4128  C CB  . PRO B  1 227 ? 12.834  -7.606  82.598  1.00 26.12  ? 226  PRO B CB  1 
ATOM   4129  C CG  . PRO B  1 227 ? 13.180  -6.647  83.682  1.00 40.95  ? 226  PRO B CG  1 
ATOM   4130  C CD  . PRO B  1 227 ? 11.964  -5.808  83.875  1.00 29.16  ? 226  PRO B CD  1 
ATOM   4131  N N   . ASP B  1 228 ? 10.924  -8.307  80.007  1.00 31.66  ? 227  ASP B N   1 
ATOM   4132  C CA  . ASP B  1 228 ? 10.029  -9.345  79.522  1.00 41.29  ? 227  ASP B CA  1 
ATOM   4133  C C   . ASP B  1 228 ? 10.827  -10.308 78.642  1.00 39.94  ? 227  ASP B C   1 
ATOM   4134  O O   . ASP B  1 228 ? 10.688  -10.313 77.422  1.00 38.19  ? 227  ASP B O   1 
ATOM   4135  C CB  . ASP B  1 228 ? 8.863   -8.743  78.740  1.00 34.10  ? 227  ASP B CB  1 
ATOM   4136  C CG  . ASP B  1 228 ? 7.702   -9.723  78.581  1.00 70.50  ? 227  ASP B CG  1 
ATOM   4137  O OD1 . ASP B  1 228 ? 7.857   -10.909 78.968  1.00 52.89  ? 227  ASP B OD1 1 
ATOM   4138  O OD2 . ASP B  1 228 ? 6.638   -9.311  78.068  1.00 70.70  ? 227  ASP B OD2 1 
ATOM   4139  N N   . PHE B  1 229 ? 11.670  -11.111 79.280  1.00 25.69  ? 228  PHE B N   1 
ATOM   4140  C CA  . PHE B  1 229 ? 12.616  -11.939 78.570  1.00 30.93  ? 228  PHE B CA  1 
ATOM   4141  C C   . PHE B  1 229 ? 12.295  -13.394 78.833  1.00 27.77  ? 228  PHE B C   1 
ATOM   4142  O O   . PHE B  1 229 ? 11.841  -13.744 79.916  1.00 32.61  ? 228  PHE B O   1 
ATOM   4143  C CB  . PHE B  1 229 ? 14.041  -11.631 79.032  1.00 30.37  ? 228  PHE B CB  1 
ATOM   4144  C CG  . PHE B  1 229 ? 14.404  -10.173 78.957  1.00 29.63  ? 228  PHE B CG  1 
ATOM   4145  C CD1 . PHE B  1 229 ? 14.081  -9.423  77.844  1.00 28.86  ? 228  PHE B CD1 1 
ATOM   4146  C CD2 . PHE B  1 229 ? 15.068  -9.560  80.000  1.00 26.79  ? 228  PHE B CD2 1 
ATOM   4147  C CE1 . PHE B  1 229 ? 14.421  -8.093  77.765  1.00 35.17  ? 228  PHE B CE1 1 
ATOM   4148  C CE2 . PHE B  1 229 ? 15.409  -8.215  79.935  1.00 34.06  ? 228  PHE B CE2 1 
ATOM   4149  C CZ  . PHE B  1 229 ? 15.082  -7.481  78.813  1.00 31.92  ? 228  PHE B CZ  1 
ATOM   4150  N N   . ALA B  1 230 ? 12.554  -14.240 77.843  1.00 30.13  ? 229  ALA B N   1 
ATOM   4151  C CA  . ALA B  1 230 ? 12.262  -15.665 77.952  1.00 22.35  ? 229  ALA B CA  1 
ATOM   4152  C C   . ALA B  1 230 ? 13.527  -16.485 77.757  1.00 33.32  ? 229  ALA B C   1 
ATOM   4153  O O   . ALA B  1 230 ? 14.325  -16.221 76.863  1.00 28.00  ? 229  ALA B O   1 
ATOM   4154  C CB  . ALA B  1 230 ? 11.213  -16.067 76.929  1.00 21.66  ? 229  ALA B CB  1 
ATOM   4155  N N   . THR B  1 231 ? 13.704  -17.488 78.606  1.00 33.15  ? 230  THR B N   1 
ATOM   4156  C CA  . THR B  1 231 ? 14.835  -18.390 78.502  1.00 32.93  ? 230  THR B CA  1 
ATOM   4157  C C   . THR B  1 231 ? 14.297  -19.820 78.521  1.00 31.48  ? 230  THR B C   1 
ATOM   4158  O O   . THR B  1 231 ? 13.476  -20.165 79.358  1.00 34.58  ? 230  THR B O   1 
ATOM   4159  C CB  . THR B  1 231 ? 15.807  -18.223 79.684  1.00 35.80  ? 230  THR B CB  1 
ATOM   4160  O OG1 . THR B  1 231 ? 16.251  -16.866 79.772  1.00 44.76  ? 230  THR B OG1 1 
ATOM   4161  C CG2 . THR B  1 231 ? 17.015  -19.138 79.507  1.00 38.54  ? 230  THR B CG2 1 
ATOM   4162  N N   . VAL B  1 232 ? 14.755  -20.646 77.594  1.00 30.88  ? 231  VAL B N   1 
ATOM   4163  C CA  . VAL B  1 232 ? 14.344  -22.038 77.553  1.00 27.03  ? 231  VAL B CA  1 
ATOM   4164  C C   . VAL B  1 232 ? 15.505  -22.916 78.006  1.00 33.70  ? 231  VAL B C   1 
ATOM   4165  O O   . VAL B  1 232 ? 16.610  -22.823 77.475  1.00 32.81  ? 231  VAL B O   1 
ATOM   4166  C CB  . VAL B  1 232 ? 13.899  -22.459 76.148  1.00 33.31  ? 231  VAL B CB  1 
ATOM   4167  C CG1 . VAL B  1 232 ? 13.383  -23.890 76.169  1.00 30.93  ? 231  VAL B CG1 1 
ATOM   4168  C CG2 . VAL B  1 232 ? 12.835  -21.499 75.620  1.00 30.44  ? 231  VAL B CG2 1 
ATOM   4169  N N   . ILE B  1 233 ? 15.247  -23.749 79.007  1.00 31.12  ? 232  ILE B N   1 
ATOM   4170  C CA  . ILE B  1 233 ? 16.242  -24.665 79.534  1.00 30.56  ? 232  ILE B CA  1 
ATOM   4171  C C   . ILE B  1 233 ? 15.795  -26.097 79.277  1.00 32.20  ? 232  ILE B C   1 
ATOM   4172  O O   . ILE B  1 233 ? 14.650  -26.445 79.548  1.00 35.77  ? 232  ILE B O   1 
ATOM   4173  C CB  . ILE B  1 233 ? 16.419  -24.433 81.029  1.00 40.25  ? 232  ILE B CB  1 
ATOM   4174  C CG1 . ILE B  1 233 ? 16.910  -23.001 81.260  1.00 34.01  ? 232  ILE B CG1 1 
ATOM   4175  C CG2 . ILE B  1 233 ? 17.374  -25.466 81.617  1.00 39.89  ? 232  ILE B CG2 1 
ATOM   4176  C CD1 . ILE B  1 233 ? 16.914  -22.569 82.686  1.00 42.66  ? 232  ILE B CD1 1 
ATOM   4177  N N   . THR B  1 234 ? 16.687  -26.919 78.726  1.00 31.21  ? 233  THR B N   1 
ATOM   4178  C CA  . THR B  1 234 ? 16.368  -28.313 78.424  1.00 35.89  ? 233  THR B CA  1 
ATOM   4179  C C   . THR B  1 234 ? 17.116  -29.248 79.370  1.00 44.25  ? 233  THR B C   1 
ATOM   4180  O O   . THR B  1 234 ? 18.203  -28.933 79.836  1.00 42.23  ? 233  THR B O   1 
ATOM   4181  C CB  . THR B  1 234 ? 16.718  -28.697 76.963  1.00 36.52  ? 233  THR B CB  1 
ATOM   4182  O OG1 . THR B  1 234 ? 18.098  -28.413 76.707  1.00 50.98  ? 233  THR B OG1 1 
ATOM   4183  C CG2 . THR B  1 234 ? 15.845  -27.936 75.966  1.00 38.87  ? 233  THR B CG2 1 
ATOM   4184  N N   . MET B  1 235 ? 16.529  -30.410 79.630  1.00 33.08  ? 234  MET B N   1 
ATOM   4185  C CA  . MET B  1 235 ? 17.104  -31.377 80.552  1.00 34.17  ? 234  MET B CA  1 
ATOM   4186  C C   . MET B  1 235 ? 16.862  -32.801 80.058  1.00 37.72  ? 234  MET B C   1 
ATOM   4187  O O   . MET B  1 235 ? 15.734  -33.183 79.769  1.00 37.42  ? 234  MET B O   1 
ATOM   4188  C CB  . MET B  1 235 ? 16.459  -31.209 81.922  1.00 36.91  ? 234  MET B CB  1 
ATOM   4189  C CG  . MET B  1 235 ? 17.009  -32.114 83.008  1.00 45.59  ? 234  MET B CG  1 
ATOM   4190  S SD  . MET B  1 235 ? 18.743  -31.790 83.337  1.00 53.49  ? 234  MET B SD  1 
ATOM   4191  C CE  . MET B  1 235 ? 18.913  -32.381 85.005  1.00 46.57  ? 234  MET B CE  1 
ATOM   4192  N N   . ASP B  1 236 ? 17.925  -33.583 79.959  1.00 42.44  ? 235  ASP B N   1 
ATOM   4193  C CA  . ASP B  1 236 ? 17.805  -34.988 79.586  1.00 42.99  ? 235  ASP B CA  1 
ATOM   4194  C C   . ASP B  1 236 ? 17.061  -35.762 80.680  1.00 36.75  ? 235  ASP B C   1 
ATOM   4195  O O   . ASP B  1 236 ? 17.363  -35.631 81.867  1.00 45.43  ? 235  ASP B O   1 
ATOM   4196  C CB  . ASP B  1 236 ? 19.196  -35.578 79.373  1.00 43.13  ? 235  ASP B CB  1 
ATOM   4197  C CG  . ASP B  1 236 ? 19.170  -36.896 78.610  1.00 76.03  ? 235  ASP B CG  1 
ATOM   4198  O OD1 . ASP B  1 236 ? 18.328  -37.776 78.916  1.00 65.62  ? 235  ASP B OD1 1 
ATOM   4199  O OD2 . ASP B  1 236 ? 20.004  -37.052 77.693  1.00 90.25  ? 235  ASP B OD2 1 
ATOM   4200  N N   . ARG B  1 237 ? 16.079  -36.562 80.286  1.00 35.23  ? 236  ARG B N   1 
ATOM   4201  C CA  . ARG B  1 237 ? 15.289  -37.323 81.251  1.00 45.21  ? 236  ARG B CA  1 
ATOM   4202  C C   . ARG B  1 237 ? 16.106  -38.383 82.000  1.00 49.69  ? 236  ARG B C   1 
ATOM   4203  O O   . ARG B  1 237 ? 15.724  -38.816 83.101  1.00 40.36  ? 236  ARG B O   1 
ATOM   4204  C CB  . ARG B  1 237 ? 14.102  -37.991 80.553  1.00 48.29  ? 236  ARG B CB  1 
ATOM   4205  C CG  . ARG B  1 237 ? 13.058  -37.001 80.064  1.00 50.63  ? 236  ARG B CG  1 
ATOM   4206  C CD  . ARG B  1 237 ? 11.836  -37.698 79.497  1.00 45.57  ? 236  ARG B CD  1 
ATOM   4207  N NE  . ARG B  1 237 ? 10.880  -36.742 78.940  1.00 47.24  ? 236  ARG B NE  1 
ATOM   4208  C CZ  . ARG B  1 237 ? 10.910  -36.297 77.685  1.00 41.90  ? 236  ARG B CZ  1 
ATOM   4209  N NH1 . ARG B  1 237 ? 10.005  -35.431 77.264  1.00 39.91  ? 236  ARG B NH1 1 
ATOM   4210  N NH2 . ARG B  1 237 ? 11.847  -36.717 76.845  1.00 38.12  ? 236  ARG B NH2 1 
ATOM   4211  N N   . LYS B  1 238 ? 17.222  -38.796 81.403  1.00 34.27  ? 237  LYS B N   1 
ATOM   4212  C CA  . LYS B  1 238 ? 18.088  -39.824 81.977  1.00 43.89  ? 237  LYS B CA  1 
ATOM   4213  C C   . LYS B  1 238 ? 19.179  -39.257 82.882  1.00 48.21  ? 237  LYS B C   1 
ATOM   4214  O O   . LYS B  1 238 ? 19.915  -40.019 83.501  1.00 55.05  ? 237  LYS B O   1 
ATOM   4215  C CB  . LYS B  1 238 ? 18.748  -40.647 80.867  1.00 48.52  ? 237  LYS B CB  1 
ATOM   4216  C CG  . LYS B  1 238 ? 17.788  -41.497 80.059  1.00 51.92  ? 237  LYS B CG  1 
ATOM   4217  C CD  . LYS B  1 238 ? 17.259  -42.647 80.887  1.00 76.97  ? 237  LYS B CD  1 
ATOM   4218  C CE  . LYS B  1 238 ? 18.366  -43.635 81.222  1.00 77.19  ? 237  LYS B CE  1 
ATOM   4219  N NZ  . LYS B  1 238 ? 17.862  -44.758 82.039  1.00 85.12  ? 237  LYS B NZ  1 
ATOM   4220  N N   . ALA B  1 239 ? 19.303  -37.935 82.952  1.00 44.62  ? 238  ALA B N   1 
ATOM   4221  C CA  . ALA B  1 239 ? 20.301  -37.329 83.827  1.00 43.39  ? 238  ALA B CA  1 
ATOM   4222  C C   . ALA B  1 239 ? 20.121  -37.856 85.252  1.00 52.17  ? 238  ALA B C   1 
ATOM   4223  O O   . ALA B  1 239 ? 18.997  -37.977 85.742  1.00 54.84  ? 238  ALA B O   1 
ATOM   4224  C CB  . ALA B  1 239 ? 20.184  -35.821 83.801  1.00 43.77  ? 238  ALA B CB  1 
ATOM   4225  N N   . SER B  1 240 ? 21.225  -38.183 85.915  1.00 56.63  ? 239  SER B N   1 
ATOM   4226  C CA  . SER B  1 240 ? 21.154  -38.766 87.256  1.00 60.84  ? 239  SER B CA  1 
ATOM   4227  C C   . SER B  1 240 ? 20.655  -37.752 88.282  1.00 43.95  ? 239  SER B C   1 
ATOM   4228  O O   . SER B  1 240 ? 19.879  -38.094 89.169  1.00 62.64  ? 239  SER B O   1 
ATOM   4229  C CB  . SER B  1 240 ? 22.515  -39.322 87.676  1.00 55.47  ? 239  SER B CB  1 
ATOM   4230  O OG  . SER B  1 240 ? 23.524  -38.338 87.559  1.00 77.31  ? 239  SER B OG  1 
ATOM   4231  N N   . LYS B  1 241 ? 21.095  -36.504 88.159  1.00 50.83  ? 240  LYS B N   1 
ATOM   4232  C CA  . LYS B  1 241 ? 20.680  -35.453 89.083  1.00 48.29  ? 240  LYS B CA  1 
ATOM   4233  C C   . LYS B  1 241 ? 19.554  -34.623 88.465  1.00 51.09  ? 240  LYS B C   1 
ATOM   4234  O O   . LYS B  1 241 ? 19.781  -33.866 87.527  1.00 52.85  ? 240  LYS B O   1 
ATOM   4235  C CB  . LYS B  1 241 ? 21.880  -34.573 89.437  1.00 43.86  ? 240  LYS B CB  1 
ATOM   4236  C CG  . LYS B  1 241 ? 21.578  -33.435 90.397  1.00 51.50  ? 240  LYS B CG  1 
ATOM   4237  C CD  . LYS B  1 241 ? 22.859  -32.714 90.794  1.00 68.75  ? 240  LYS B CD  1 
ATOM   4238  C CE  . LYS B  1 241 ? 22.593  -31.301 91.304  1.00 72.49  ? 240  LYS B CE  1 
ATOM   4239  N NZ  . LYS B  1 241 ? 21.668  -31.273 92.464  1.00 81.35  ? 240  LYS B NZ  1 
ATOM   4240  N N   . GLN B  1 242 ? 18.339  -34.778 88.988  1.00 43.26  ? 241  GLN B N   1 
ATOM   4241  C CA  . GLN B  1 242 ? 17.160  -34.128 88.414  1.00 47.57  ? 241  GLN B CA  1 
ATOM   4242  C C   . GLN B  1 242 ? 16.743  -32.868 89.185  1.00 44.91  ? 241  GLN B C   1 
ATOM   4243  O O   . GLN B  1 242 ? 15.591  -32.451 89.130  1.00 39.02  ? 241  GLN B O   1 
ATOM   4244  C CB  . GLN B  1 242 ? 15.991  -35.118 88.341  1.00 43.91  ? 241  GLN B CB  1 
ATOM   4245  C CG  . GLN B  1 242 ? 16.151  -36.192 87.263  1.00 41.45  ? 241  GLN B CG  1 
ATOM   4246  C CD  . GLN B  1 242 ? 15.982  -35.631 85.856  1.00 43.30  ? 241  GLN B CD  1 
ATOM   4247  O OE1 . GLN B  1 242 ? 15.173  -34.740 85.624  1.00 51.78  ? 241  GLN B OE1 1 
ATOM   4248  N NE2 . GLN B  1 242 ? 16.746  -36.152 84.916  1.00 48.64  ? 241  GLN B NE2 1 
ATOM   4249  N N   . GLN B  1 243 ? 17.688  -32.275 89.905  1.00 47.18  ? 242  GLN B N   1 
ATOM   4250  C CA  . GLN B  1 243 ? 17.494  -30.969 90.522  1.00 39.84  ? 242  GLN B CA  1 
ATOM   4251  C C   . GLN B  1 243 ? 18.616  -30.057 90.044  1.00 52.05  ? 242  GLN B C   1 
ATOM   4252  O O   . GLN B  1 243 ? 19.761  -30.489 89.909  1.00 51.25  ? 242  GLN B O   1 
ATOM   4253  C CB  . GLN B  1 243 ? 17.498  -31.055 92.050  1.00 42.89  ? 242  GLN B CB  1 
ATOM   4254  C CG  . GLN B  1 243 ? 16.298  -31.775 92.651  1.00 56.14  ? 242  GLN B CG  1 
ATOM   4255  C CD  . GLN B  1 243 ? 16.339  -33.280 92.420  1.00 83.58  ? 242  GLN B CD  1 
ATOM   4256  O OE1 . GLN B  1 243 ? 17.405  -33.901 92.483  1.00 75.68  ? 242  GLN B OE1 1 
ATOM   4257  N NE2 . GLN B  1 243 ? 15.177  -33.871 92.141  1.00 59.74  ? 242  GLN B NE2 1 
ATOM   4258  N N   . THR B  1 244 ? 18.284  -28.798 89.777  1.00 42.16  ? 243  THR B N   1 
ATOM   4259  C CA  . THR B  1 244 ? 19.246  -27.853 89.215  1.00 37.54  ? 243  THR B CA  1 
ATOM   4260  C C   . THR B  1 244 ? 19.063  -26.495 89.864  1.00 43.03  ? 243  THR B C   1 
ATOM   4261  O O   . THR B  1 244 ? 17.949  -25.991 89.936  1.00 42.52  ? 243  THR B O   1 
ATOM   4262  C CB  . THR B  1 244 ? 19.031  -27.664 87.689  1.00 47.32  ? 243  THR B CB  1 
ATOM   4263  O OG1 . THR B  1 244 ? 19.063  -28.930 87.018  1.00 49.56  ? 243  THR B OG1 1 
ATOM   4264  C CG2 . THR B  1 244 ? 20.101  -26.763 87.100  1.00 51.46  ? 243  THR B CG2 1 
ATOM   4265  N N   . ASN B  1 245 ? 20.150  -25.890 90.325  1.00 46.77  ? 244  ASN B N   1 
ATOM   4266  C CA  . ASN B  1 245 ? 20.083  -24.523 90.819  1.00 41.64  ? 244  ASN B CA  1 
ATOM   4267  C C   . ASN B  1 245 ? 20.274  -23.556 89.665  1.00 43.79  ? 244  ASN B C   1 
ATOM   4268  O O   . ASN B  1 245 ? 20.964  -23.862 88.701  1.00 40.95  ? 244  ASN B O   1 
ATOM   4269  C CB  . ASN B  1 245 ? 21.143  -24.280 91.890  1.00 44.14  ? 244  ASN B CB  1 
ATOM   4270  C CG  . ASN B  1 245 ? 20.837  -25.006 93.191  1.00 57.45  ? 244  ASN B CG  1 
ATOM   4271  O OD1 . ASN B  1 245 ? 19.676  -25.230 93.544  1.00 45.91  ? 244  ASN B OD1 1 
ATOM   4272  N ND2 . ASN B  1 245 ? 21.883  -25.377 93.911  1.00 63.01  ? 244  ASN B ND2 1 
ATOM   4273  N N   . ILE B  1 246 ? 19.647  -22.393 89.749  1.00 37.38  ? 245  ILE B N   1 
ATOM   4274  C CA  . ILE B  1 246 ? 19.843  -21.375 88.733  1.00 33.35  ? 245  ILE B CA  1 
ATOM   4275  C C   . ILE B  1 246 ? 19.874  -20.021 89.411  1.00 33.82  ? 245  ILE B C   1 
ATOM   4276  O O   . ILE B  1 246 ? 19.108  -19.777 90.346  1.00 36.26  ? 245  ILE B O   1 
ATOM   4277  C CB  . ILE B  1 246 ? 18.743  -21.431 87.651  1.00 37.73  ? 245  ILE B CB  1 
ATOM   4278  C CG1 . ILE B  1 246 ? 19.088  -20.495 86.492  1.00 41.38  ? 245  ILE B CG1 1 
ATOM   4279  C CG2 . ILE B  1 246 ? 17.382  -21.078 88.241  1.00 31.24  ? 245  ILE B CG2 1 
ATOM   4280  C CD1 . ILE B  1 246 ? 18.122  -20.588 85.337  1.00 39.80  ? 245  ILE B CD1 1 
ATOM   4281  N N   . ASP B  1 247 ? 20.784  -19.158 88.971  1.00 34.58  ? 246  ASP B N   1 
ATOM   4282  C CA  . ASP B  1 247 ? 20.859  -17.791 89.494  1.00 38.37  ? 246  ASP B CA  1 
ATOM   4283  C C   . ASP B  1 247 ? 20.261  -16.816 88.503  1.00 37.93  ? 246  ASP B C   1 
ATOM   4284  O O   . ASP B  1 247 ? 20.491  -16.920 87.294  1.00 37.21  ? 246  ASP B O   1 
ATOM   4285  C CB  . ASP B  1 247 ? 22.304  -17.386 89.773  1.00 44.40  ? 246  ASP B CB  1 
ATOM   4286  C CG  . ASP B  1 247 ? 22.892  -18.108 90.957  1.00 62.75  ? 246  ASP B CG  1 
ATOM   4287  O OD1 . ASP B  1 247 ? 22.161  -18.284 91.951  1.00 71.75  ? 246  ASP B OD1 1 
ATOM   4288  O OD2 . ASP B  1 247 ? 24.077  -18.497 90.898  1.00 73.85  ? 246  ASP B OD2 1 
ATOM   4289  N N   . VAL B  1 248 ? 19.493  -15.869 89.027  1.00 37.83  ? 247  VAL B N   1 
ATOM   4290  C CA  . VAL B  1 248 ? 18.938  -14.788 88.231  1.00 34.67  ? 247  VAL B CA  1 
ATOM   4291  C C   . VAL B  1 248 ? 19.407  -13.463 88.822  1.00 40.78  ? 247  VAL B C   1 
ATOM   4292  O O   . VAL B  1 248 ? 19.223  -13.200 90.010  1.00 36.99  ? 247  VAL B O   1 
ATOM   4293  C CB  . VAL B  1 248 ? 17.404  -14.843 88.214  1.00 35.46  ? 247  VAL B CB  1 
ATOM   4294  C CG1 . VAL B  1 248 ? 16.829  -13.690 87.402  1.00 30.48  ? 247  VAL B CG1 1 
ATOM   4295  C CG2 . VAL B  1 248 ? 16.948  -16.179 87.638  1.00 32.98  ? 247  VAL B CG2 1 
ATOM   4296  N N   . ILE B  1 249 ? 20.036  -12.636 87.996  1.00 31.95  ? 248  ILE B N   1 
ATOM   4297  C CA  . ILE B  1 249 ? 20.566  -11.358 88.451  1.00 32.25  ? 248  ILE B CA  1 
ATOM   4298  C C   . ILE B  1 249 ? 19.890  -10.207 87.714  1.00 29.54  ? 248  ILE B C   1 
ATOM   4299  O O   . ILE B  1 249 ? 19.847  -10.196 86.490  1.00 32.92  ? 248  ILE B O   1 
ATOM   4300  C CB  . ILE B  1 249 ? 22.091  -11.268 88.224  1.00 38.19  ? 248  ILE B CB  1 
ATOM   4301  C CG1 . ILE B  1 249 ? 22.807  -12.428 88.913  1.00 49.32  ? 248  ILE B CG1 1 
ATOM   4302  C CG2 . ILE B  1 249 ? 22.636  -9.953  88.734  1.00 44.80  ? 248  ILE B CG2 1 
ATOM   4303  C CD1 . ILE B  1 249 ? 22.842  -13.709 88.082  1.00 54.18  ? 248  ILE B CD1 1 
ATOM   4304  N N   . TYR B  1 250 ? 19.351  -9.253  88.473  1.00 34.21  ? 249  TYR B N   1 
ATOM   4305  C CA  . TYR B  1 250 ? 18.877  -7.981  87.933  1.00 32.29  ? 249  TYR B CA  1 
ATOM   4306  C C   . TYR B  1 250 ? 19.896  -6.903  88.274  1.00 42.11  ? 249  TYR B C   1 
ATOM   4307  O O   . TYR B  1 250 ? 20.422  -6.863  89.384  1.00 40.89  ? 249  TYR B O   1 
ATOM   4308  C CB  . TYR B  1 250 ? 17.527  -7.598  88.539  1.00 31.44  ? 249  TYR B CB  1 
ATOM   4309  C CG  . TYR B  1 250 ? 16.341  -8.330  87.965  1.00 35.10  ? 249  TYR B CG  1 
ATOM   4310  C CD1 . TYR B  1 250 ? 15.123  -7.685  87.798  1.00 29.40  ? 249  TYR B CD1 1 
ATOM   4311  C CD2 . TYR B  1 250 ? 16.432  -9.666  87.598  1.00 40.80  ? 249  TYR B CD2 1 
ATOM   4312  C CE1 . TYR B  1 250 ? 14.031  -8.343  87.276  1.00 28.43  ? 249  TYR B CE1 1 
ATOM   4313  C CE2 . TYR B  1 250 ? 15.346  -10.337 87.084  1.00 38.22  ? 249  TYR B CE2 1 
ATOM   4314  C CZ  . TYR B  1 250 ? 14.147  -9.670  86.925  1.00 39.27  ? 249  TYR B CZ  1 
ATOM   4315  O OH  . TYR B  1 250 ? 13.067  -10.341 86.410  1.00 39.24  ? 249  TYR B OH  1 
ATOM   4316  N N   . GLU B  1 251 ? 20.166  -6.011  87.333  1.00 40.51  ? 250  GLU B N   1 
ATOM   4317  C CA  . GLU B  1 251 ? 21.214  -5.029  87.532  1.00 39.03  ? 250  GLU B CA  1 
ATOM   4318  C C   . GLU B  1 251 ? 20.793  -3.655  87.004  1.00 32.39  ? 250  GLU B C   1 
ATOM   4319  O O   . GLU B  1 251 ? 20.103  -3.551  85.999  1.00 32.98  ? 250  GLU B O   1 
ATOM   4320  C CB  . GLU B  1 251 ? 22.490  -5.536  86.856  1.00 36.29  ? 250  GLU B CB  1 
ATOM   4321  C CG  . GLU B  1 251 ? 23.732  -4.686  87.079  1.00 62.60  ? 250  GLU B CG  1 
ATOM   4322  C CD  . GLU B  1 251 ? 25.007  -5.398  86.629  1.00 80.46  ? 250  GLU B CD  1 
ATOM   4323  O OE1 . GLU B  1 251 ? 25.183  -6.582  86.988  1.00 69.18  ? 250  GLU B OE1 1 
ATOM   4324  O OE2 . GLU B  1 251 ? 25.826  -4.779  85.912  1.00 85.37  ? 250  GLU B OE2 1 
ATOM   4325  N N   . ARG B  1 252 ? 21.183  -2.610  87.723  1.00 33.02  ? 251  ARG B N   1 
ATOM   4326  C CA  . ARG B  1 252 ? 21.036  -1.233  87.252  1.00 35.88  ? 251  ARG B CA  1 
ATOM   4327  C C   . ARG B  1 252 ? 22.408  -0.573  87.240  1.00 31.21  ? 251  ARG B C   1 
ATOM   4328  O O   . ARG B  1 252 ? 23.091  -0.550  88.250  1.00 39.55  ? 251  ARG B O   1 
ATOM   4329  C CB  . ARG B  1 252 ? 20.113  -0.443  88.181  1.00 31.99  ? 251  ARG B CB  1 
ATOM   4330  C CG  . ARG B  1 252 ? 19.918  1.008   87.756  1.00 30.87  ? 251  ARG B CG  1 
ATOM   4331  C CD  . ARG B  1 252 ? 19.373  1.871   88.891  1.00 32.29  ? 251  ARG B CD  1 
ATOM   4332  N NE  . ARG B  1 252 ? 18.050  1.431   89.317  1.00 31.81  ? 251  ARG B NE  1 
ATOM   4333  C CZ  . ARG B  1 252 ? 17.806  0.686   90.391  1.00 37.83  ? 251  ARG B CZ  1 
ATOM   4334  N NH1 . ARG B  1 252 ? 16.563  0.330   90.674  1.00 30.35  ? 251  ARG B NH1 1 
ATOM   4335  N NH2 . ARG B  1 252 ? 18.795  0.297   91.184  1.00 32.25  ? 251  ARG B NH2 1 
ATOM   4336  N N   . VAL B  1 253 ? 22.823  -0.058  86.092  1.00 40.18  ? 252  VAL B N   1 
ATOM   4337  C CA  . VAL B  1 253 ? 24.046  0.732   86.016  1.00 33.26  ? 252  VAL B CA  1 
ATOM   4338  C C   . VAL B  1 253 ? 23.659  2.199   85.939  1.00 36.94  ? 252  VAL B C   1 
ATOM   4339  O O   . VAL B  1 253 ? 22.834  2.578   85.114  1.00 38.06  ? 252  VAL B O   1 
ATOM   4340  C CB  . VAL B  1 253 ? 24.888  0.362   84.784  1.00 34.09  ? 252  VAL B CB  1 
ATOM   4341  C CG1 . VAL B  1 253 ? 26.120  1.246   84.695  1.00 28.32  ? 252  VAL B CG1 1 
ATOM   4342  C CG2 . VAL B  1 253 ? 25.275  -1.103  84.841  1.00 35.39  ? 252  VAL B CG2 1 
ATOM   4343  N N   . ARG B  1 254 ? 24.253  3.017   86.803  1.00 41.09  ? 253  ARG B N   1 
ATOM   4344  C CA  . ARG B  1 254 ? 23.948  4.442   86.853  1.00 43.38  ? 253  ARG B CA  1 
ATOM   4345  C C   . ARG B  1 254 ? 25.142  5.317   86.469  1.00 47.25  ? 253  ARG B C   1 
ATOM   4346  O O   . ARG B  1 254 ? 26.274  5.086   86.903  1.00 37.83  ? 253  ARG B O   1 
ATOM   4347  C CB  . ARG B  1 254 ? 23.461  4.820   88.249  1.00 37.83  ? 253  ARG B CB  1 
ATOM   4348  C CG  . ARG B  1 254 ? 22.027  4.390   88.533  1.00 44.57  ? 253  ARG B CG  1 
ATOM   4349  C CD  . ARG B  1 254 ? 21.618  4.746   89.951  1.00 45.50  ? 253  ARG B CD  1 
ATOM   4350  N NE  . ARG B  1 254 ? 22.390  3.970   90.916  1.00 57.50  ? 253  ARG B NE  1 
ATOM   4351  C CZ  . ARG B  1 254 ? 22.717  4.391   92.134  1.00 79.05  ? 253  ARG B CZ  1 
ATOM   4352  N NH1 . ARG B  1 254 ? 23.423  3.599   92.934  1.00 62.38  ? 253  ARG B NH1 1 
ATOM   4353  N NH2 . ARG B  1 254 ? 22.346  5.596   92.551  1.00 60.71  ? 253  ARG B NH2 1 
ATOM   4354  N N   . ASP B  1 255 ? 24.870  6.313   85.635  1.00 37.58  ? 254  ASP B N   1 
ATOM   4355  C CA  . ASP B  1 255 ? 25.853  7.324   85.280  1.00 46.72  ? 254  ASP B CA  1 
ATOM   4356  C C   . ASP B  1 255 ? 25.713  8.521   86.210  1.00 48.87  ? 254  ASP B C   1 
ATOM   4357  O O   . ASP B  1 255 ? 24.730  8.644   86.945  1.00 39.62  ? 254  ASP B O   1 
ATOM   4358  C CB  . ASP B  1 255 ? 25.653  7.799   83.835  1.00 37.75  ? 254  ASP B CB  1 
ATOM   4359  C CG  . ASP B  1 255 ? 26.231  6.846   82.824  1.00 41.74  ? 254  ASP B CG  1 
ATOM   4360  O OD1 . ASP B  1 255 ? 26.376  7.240   81.656  1.00 45.59  ? 254  ASP B OD1 1 
ATOM   4361  O OD2 . ASP B  1 255 ? 26.543  5.704   83.197  1.00 44.08  ? 254  ASP B OD2 1 
ATOM   4362  N N   . ASP B  1 256 ? 26.691  9.417   86.141  1.00 45.23  ? 255  ASP B N   1 
ATOM   4363  C CA  . ASP B  1 256 ? 26.732  10.600  86.999  1.00 38.33  ? 255  ASP B CA  1 
ATOM   4364  C C   . ASP B  1 256 ? 26.755  11.846  86.124  1.00 40.48  ? 255  ASP B C   1 
ATOM   4365  O O   . ASP B  1 256 ? 27.762  12.146  85.492  1.00 35.64  ? 255  ASP B O   1 
ATOM   4366  C CB  . ASP B  1 256 ? 27.983  10.543  87.879  1.00 48.30  ? 255  ASP B CB  1 
ATOM   4367  C CG  . ASP B  1 256 ? 28.160  11.775  88.745  1.00 57.17  ? 255  ASP B CG  1 
ATOM   4368  O OD1 . ASP B  1 256 ? 29.213  11.865  89.411  1.00 64.14  ? 255  ASP B OD1 1 
ATOM   4369  O OD2 . ASP B  1 256 ? 27.265  12.648  88.757  1.00 56.11  ? 255  ASP B OD2 1 
ATOM   4370  N N   . TYR B  1 257 ? 25.631  12.547  86.072  1.00 39.68  ? 256  TYR B N   1 
ATOM   4371  C CA  . TYR B  1 257 ? 25.513  13.752  85.276  1.00 43.73  ? 256  TYR B CA  1 
ATOM   4372  C C   . TYR B  1 257 ? 25.580  14.998  86.158  1.00 59.04  ? 256  TYR B C   1 
ATOM   4373  O O   . TYR B  1 257 ? 24.722  15.207  87.026  1.00 46.13  ? 256  TYR B O   1 
ATOM   4374  C CB  . TYR B  1 257 ? 24.204  13.735  84.492  1.00 33.20  ? 256  TYR B CB  1 
ATOM   4375  C CG  . TYR B  1 257 ? 24.055  14.923  83.567  1.00 35.73  ? 256  TYR B CG  1 
ATOM   4376  C CD1 . TYR B  1 257 ? 24.802  15.017  82.399  1.00 38.50  ? 256  TYR B CD1 1 
ATOM   4377  C CD2 . TYR B  1 257 ? 23.174  15.956  83.866  1.00 43.08  ? 256  TYR B CD2 1 
ATOM   4378  C CE1 . TYR B  1 257 ? 24.670  16.101  81.549  1.00 33.43  ? 256  TYR B CE1 1 
ATOM   4379  C CE2 . TYR B  1 257 ? 23.036  17.046  83.022  1.00 45.08  ? 256  TYR B CE2 1 
ATOM   4380  C CZ  . TYR B  1 257 ? 23.787  17.109  81.867  1.00 44.68  ? 256  TYR B CZ  1 
ATOM   4381  O OH  . TYR B  1 257 ? 23.643  18.188  81.035  1.00 44.98  ? 256  TYR B OH  1 
ATOM   4382  N N   . GLN B  1 258 ? 26.595  15.826  85.913  1.00 38.78  ? 257  GLN B N   1 
ATOM   4383  C CA  . GLN B  1 258 ? 26.861  17.004  86.741  1.00 53.79  ? 257  GLN B CA  1 
ATOM   4384  C C   . GLN B  1 258 ? 26.743  18.302  85.961  1.00 51.86  ? 257  GLN B C   1 
ATOM   4385  O O   . GLN B  1 258 ? 27.249  18.411  84.845  1.00 51.73  ? 257  GLN B O   1 
ATOM   4386  C CB  . GLN B  1 258 ? 28.266  16.916  87.335  1.00 51.56  ? 257  GLN B CB  1 
ATOM   4387  C CG  . GLN B  1 258 ? 28.470  15.717  88.260  1.00 53.26  ? 257  GLN B CG  1 
ATOM   4388  C CD  . GLN B  1 258 ? 29.927  15.485  88.593  1.00 68.02  ? 257  GLN B CD  1 
ATOM   4389  O OE1 . GLN B  1 258 ? 30.817  16.073  87.975  1.00 90.70  ? 257  GLN B OE1 1 
ATOM   4390  N NE2 . GLN B  1 258 ? 30.182  14.624  89.569  1.00 73.93  ? 257  GLN B NE2 1 
ATOM   4391  N N   . LEU B  1 259 ? 26.062  19.279  86.551  1.00 48.54  ? 258  LEU B N   1 
ATOM   4392  C CA  . LEU B  1 259 ? 26.032  20.633  86.016  1.00 53.50  ? 258  LEU B CA  1 
ATOM   4393  C C   . LEU B  1 259 ? 26.909  21.535  86.879  1.00 69.78  ? 258  LEU B C   1 
ATOM   4394  O O   . LEU B  1 259 ? 26.833  21.488  88.109  1.00 48.56  ? 258  LEU B O   1 
ATOM   4395  C CB  . LEU B  1 259 ? 24.604  21.181  85.997  1.00 42.27  ? 258  LEU B CB  1 
ATOM   4396  C CG  . LEU B  1 259 ? 23.650  20.544  84.988  1.00 51.15  ? 258  LEU B CG  1 
ATOM   4397  C CD1 . LEU B  1 259 ? 22.244  21.129  85.130  1.00 49.48  ? 258  LEU B CD1 1 
ATOM   4398  C CD2 . LEU B  1 259 ? 24.173  20.720  83.569  1.00 47.80  ? 258  LEU B CD2 1 
ATOM   4399  N N   . HIS B  1 260 ? 27.749  22.348  86.244  1.00 58.32  ? 259  HIS B N   1 
ATOM   4400  C CA  . HIS B  1 260 ? 28.512  23.352  86.978  1.00 55.39  ? 259  HIS B CA  1 
ATOM   4401  C C   . HIS B  1 260 ? 28.400  24.689  86.276  1.00 52.83  ? 259  HIS B C   1 
ATOM   4402  O O   . HIS B  1 260 ? 28.418  24.760  85.055  1.00 54.37  ? 259  HIS B O   1 
ATOM   4403  C CB  . HIS B  1 260 ? 29.975  22.927  87.150  1.00 58.35  ? 259  HIS B CB  1 
ATOM   4404  C CG  . HIS B  1 260 ? 30.796  23.028  85.903  1.00 82.86  ? 259  HIS B CG  1 
ATOM   4405  N ND1 . HIS B  1 260 ? 31.042  21.948  85.084  1.00 93.74  ? 259  HIS B ND1 1 
ATOM   4406  C CD2 . HIS B  1 260 ? 31.454  24.076  85.351  1.00 84.31  ? 259  HIS B CD2 1 
ATOM   4407  C CE1 . HIS B  1 260 ? 31.803  22.328  84.072  1.00 87.77  ? 259  HIS B CE1 1 
ATOM   4408  N NE2 . HIS B  1 260 ? 32.067  23.615  84.211  1.00 90.18  ? 259  HIS B NE2 1 
ATOM   4409  N N   . TRP B  1 261 ? 28.241  25.752  87.051  1.00 67.66  ? 260  TRP B N   1 
ATOM   4410  C CA  . TRP B  1 261 ? 28.167  27.091  86.483  1.00 71.39  ? 260  TRP B CA  1 
ATOM   4411  C C   . TRP B  1 261 ? 29.580  27.582  86.215  1.00 59.91  ? 260  TRP B C   1 
ATOM   4412  O O   . TRP B  1 261 ? 30.428  27.556  87.107  1.00 69.66  ? 260  TRP B O   1 
ATOM   4413  C CB  . TRP B  1 261 ? 27.445  28.034  87.443  1.00 62.80  ? 260  TRP B CB  1 
ATOM   4414  C CG  . TRP B  1 261 ? 27.364  29.441  86.971  1.00 81.07  ? 260  TRP B CG  1 
ATOM   4415  C CD1 . TRP B  1 261 ? 28.120  30.490  87.401  1.00 79.48  ? 260  TRP B CD1 1 
ATOM   4416  C CD2 . TRP B  1 261 ? 26.473  29.967  85.979  1.00 80.15  ? 260  TRP B CD2 1 
ATOM   4417  N NE1 . TRP B  1 261 ? 27.758  31.636  86.740  1.00 65.05  ? 260  TRP B NE1 1 
ATOM   4418  C CE2 . TRP B  1 261 ? 26.748  31.343  85.861  1.00 82.50  ? 260  TRP B CE2 1 
ATOM   4419  C CE3 . TRP B  1 261 ? 25.471  29.408  85.181  1.00 67.70  ? 260  TRP B CE3 1 
ATOM   4420  C CZ2 . TRP B  1 261 ? 26.059  32.170  84.977  1.00 82.16  ? 260  TRP B CZ2 1 
ATOM   4421  C CZ3 . TRP B  1 261 ? 24.787  30.230  84.303  1.00 67.35  ? 260  TRP B CZ3 1 
ATOM   4422  C CH2 . TRP B  1 261 ? 25.084  31.598  84.209  1.00 85.32  ? 260  TRP B CH2 1 
ATOM   4423  N N   . THR B  1 262 ? 29.850  27.962  84.971  1.00 56.50  ? 261  THR B N   1 
ATOM   4424  C CA  . THR B  1 262 ? 31.092  28.646  84.646  1.00 91.99  ? 261  THR B CA  1 
ATOM   4425  C C   . THR B  1 262 ? 30.827  30.122  84.848  1.00 92.70  ? 261  THR B C   1 
ATOM   4426  O O   . THR B  1 262 ? 29.703  30.530  85.132  1.00 104.77 ? 261  THR B O   1 
ATOM   4427  C CB  . THR B  1 262 ? 31.557  28.406  83.186  1.00 87.73  ? 261  THR B CB  1 
ATOM   4428  O OG1 . THR B  1 262 ? 30.727  29.140  82.272  1.00 63.77  ? 261  THR B OG1 1 
ATOM   4429  C CG2 . THR B  1 262 ? 31.518  26.926  82.841  1.00 82.73  ? 261  THR B CG2 1 
ATOM   4430  N N   . SER B  1 263 ? 31.859  30.929  84.695  1.00 97.65  ? 262  SER B N   1 
ATOM   4431  C CA  . SER B  1 263 ? 31.707  32.357  84.866  1.00 98.30  ? 262  SER B CA  1 
ATOM   4432  C C   . SER B  1 263 ? 30.479  32.871  84.112  1.00 99.05  ? 262  SER B C   1 
ATOM   4433  O O   . SER B  1 263 ? 29.879  33.869  84.501  1.00 92.69  ? 262  SER B O   1 
ATOM   4434  C CB  . SER B  1 263 ? 32.972  33.061  84.377  1.00 123.42 ? 262  SER B CB  1 
ATOM   4435  O OG  . SER B  1 263 ? 34.120  32.563  85.050  1.00 102.92 ? 262  SER B OG  1 
ATOM   4436  N N   . THR B  1 264 ? 30.089  32.171  83.051  1.00 104.09 ? 263  THR B N   1 
ATOM   4437  C CA  . THR B  1 264 ? 29.085  32.695  82.132  1.00 99.54  ? 263  THR B CA  1 
ATOM   4438  C C   . THR B  1 264 ? 27.835  31.824  81.955  1.00 96.87  ? 263  THR B C   1 
ATOM   4439  O O   . THR B  1 264 ? 26.717  32.341  81.972  1.00 91.04  ? 263  THR B O   1 
ATOM   4440  C CB  . THR B  1 264 ? 29.709  32.956  80.744  1.00 112.08 ? 263  THR B CB  1 
ATOM   4441  O OG1 . THR B  1 264 ? 28.728  32.737  79.724  1.00 119.87 ? 263  THR B OG1 1 
ATOM   4442  C CG2 . THR B  1 264 ? 30.904  32.039  80.505  1.00 101.23 ? 263  THR B CG2 1 
ATOM   4443  N N   . ASN B  1 265 ? 28.014  30.518  81.777  1.00 77.57  ? 264  ASN B N   1 
ATOM   4444  C CA  . ASN B  1 265 ? 26.891  29.641  81.435  1.00 67.41  ? 264  ASN B CA  1 
ATOM   4445  C C   . ASN B  1 265 ? 26.942  28.296  82.138  1.00 60.62  ? 264  ASN B C   1 
ATOM   4446  O O   . ASN B  1 265 ? 27.921  27.970  82.805  1.00 56.37  ? 264  ASN B O   1 
ATOM   4447  C CB  . ASN B  1 265 ? 26.858  29.399  79.926  1.00 67.22  ? 264  ASN B CB  1 
ATOM   4448  C CG  . ASN B  1 265 ? 28.150  28.790  79.409  1.00 61.65  ? 264  ASN B CG  1 
ATOM   4449  O OD1 . ASN B  1 265 ? 29.076  29.502  79.021  1.00 66.54  ? 264  ASN B OD1 1 
ATOM   4450  N ND2 . ASN B  1 265 ? 28.224  27.465  79.415  1.00 58.07  ? 264  ASN B ND2 1 
ATOM   4451  N N   . TRP B  1 266 ? 25.884  27.508  81.968  1.00 59.74  ? 265  TRP B N   1 
ATOM   4452  C CA  . TRP B  1 266 ? 25.822  26.171  82.554  1.00 68.76  ? 265  TRP B CA  1 
ATOM   4453  C C   . TRP B  1 266 ? 26.578  25.166  81.697  1.00 67.56  ? 265  TRP B C   1 
ATOM   4454  O O   . TRP B  1 266 ? 26.420  25.124  80.479  1.00 53.52  ? 265  TRP B O   1 
ATOM   4455  C CB  . TRP B  1 266 ? 24.374  25.705  82.709  1.00 56.42  ? 265  TRP B CB  1 
ATOM   4456  C CG  . TRP B  1 266 ? 23.656  26.348  83.840  1.00 61.41  ? 265  TRP B CG  1 
ATOM   4457  C CD1 . TRP B  1 266 ? 22.576  27.180  83.763  1.00 41.42  ? 265  TRP B CD1 1 
ATOM   4458  C CD2 . TRP B  1 266 ? 23.958  26.209  85.231  1.00 53.44  ? 265  TRP B CD2 1 
ATOM   4459  N NE1 . TRP B  1 266 ? 22.186  27.563  85.024  1.00 57.93  ? 265  TRP B NE1 1 
ATOM   4460  C CE2 . TRP B  1 266 ? 23.025  26.986  85.942  1.00 55.99  ? 265  TRP B CE2 1 
ATOM   4461  C CE3 . TRP B  1 266 ? 24.938  25.502  85.940  1.00 58.04  ? 265  TRP B CE3 1 
ATOM   4462  C CZ2 . TRP B  1 266 ? 23.038  27.083  87.329  1.00 47.14  ? 265  TRP B CZ2 1 
ATOM   4463  C CZ3 . TRP B  1 266 ? 24.951  25.593  87.314  1.00 51.63  ? 265  TRP B CZ3 1 
ATOM   4464  C CH2 . TRP B  1 266 ? 24.006  26.380  87.998  1.00 75.76  ? 265  TRP B CH2 1 
ATOM   4465  N N   . LYS B  1 267 ? 27.383  24.338  82.348  1.00 47.44  ? 266  LYS B N   1 
ATOM   4466  C CA  . LYS B  1 267 ? 28.143  23.327  81.648  1.00 55.03  ? 266  LYS B CA  1 
ATOM   4467  C C   . LYS B  1 267 ? 27.898  21.958  82.276  1.00 48.37  ? 266  LYS B C   1 
ATOM   4468  O O   . LYS B  1 267 ? 27.923  21.815  83.493  1.00 47.50  ? 266  LYS B O   1 
ATOM   4469  C CB  . LYS B  1 267 ? 29.627  23.679  81.683  1.00 49.55  ? 266  LYS B CB  1 
ATOM   4470  C CG  . LYS B  1 267 ? 30.462  22.915  80.680  1.00 61.56  ? 266  LYS B CG  1 
ATOM   4471  C CD  . LYS B  1 267 ? 31.887  23.437  80.622  1.00 60.04  ? 266  LYS B CD  1 
ATOM   4472  C CE  . LYS B  1 267 ? 32.668  22.791  79.491  1.00 61.04  ? 266  LYS B CE  1 
ATOM   4473  N NZ  . LYS B  1 267 ? 34.059  23.302  79.379  1.00 65.81  ? 266  LYS B NZ  1 
ATOM   4474  N N   . GLY B  1 268 ? 27.660  20.955  81.436  1.00 60.72  ? 267  GLY B N   1 
ATOM   4475  C CA  . GLY B  1 268 ? 27.359  19.615  81.913  1.00 51.39  ? 267  GLY B CA  1 
ATOM   4476  C C   . GLY B  1 268 ? 28.450  18.609  81.599  1.00 47.70  ? 267  GLY B C   1 
ATOM   4477  O O   . GLY B  1 268 ? 29.130  18.711  80.581  1.00 46.23  ? 267  GLY B O   1 
ATOM   4478  N N   . THR B  1 269 ? 28.629  17.637  82.486  1.00 45.29  ? 268  THR B N   1 
ATOM   4479  C CA  . THR B  1 269 ? 29.538  16.527  82.228  1.00 56.34  ? 268  THR B CA  1 
ATOM   4480  C C   . THR B  1 269 ? 28.870  15.220  82.637  1.00 46.84  ? 268  THR B C   1 
ATOM   4481  O O   . THR B  1 269 ? 28.032  15.190  83.537  1.00 50.88  ? 268  THR B O   1 
ATOM   4482  C CB  . THR B  1 269 ? 30.866  16.676  82.995  1.00 59.12  ? 268  THR B CB  1 
ATOM   4483  O OG1 . THR B  1 269 ? 30.613  16.699  84.407  1.00 67.25  ? 268  THR B OG1 1 
ATOM   4484  C CG2 . THR B  1 269 ? 31.576  17.955  82.587  1.00 66.00  ? 268  THR B CG2 1 
ATOM   4485  N N   . ASN B  1 270 ? 29.241  14.137  81.974  1.00 59.19  ? 269  ASN B N   1 
ATOM   4486  C CA  . ASN B  1 270 ? 28.691  12.838  82.310  1.00 43.28  ? 269  ASN B CA  1 
ATOM   4487  C C   . ASN B  1 270 ? 29.791  11.806  82.494  1.00 48.01  ? 269  ASN B C   1 
ATOM   4488  O O   . ASN B  1 270 ? 30.622  11.604  81.611  1.00 51.41  ? 269  ASN B O   1 
ATOM   4489  C CB  . ASN B  1 270 ? 27.708  12.375  81.236  1.00 44.21  ? 269  ASN B CB  1 
ATOM   4490  C CG  . ASN B  1 270 ? 27.023  11.067  81.609  1.00 45.68  ? 269  ASN B CG  1 
ATOM   4491  O OD1 . ASN B  1 270 ? 26.097  11.045  82.419  1.00 42.14  ? 269  ASN B OD1 1 
ATOM   4492  N ND2 . ASN B  1 270 ? 27.492  9.974   81.040  1.00 37.30  ? 269  ASN B ND2 1 
ATOM   4493  N N   . THR B  1 271 ? 29.790  11.160  83.652  1.00 44.49  ? 270  THR B N   1 
ATOM   4494  C CA  . THR B  1 271 ? 30.723  10.078  83.933  1.00 53.94  ? 270  THR B CA  1 
ATOM   4495  C C   . THR B  1 271 ? 30.009  8.729   83.793  1.00 55.08  ? 270  THR B C   1 
ATOM   4496  O O   . THR B  1 271 ? 28.980  8.486   84.431  1.00 54.16  ? 270  THR B O   1 
ATOM   4497  C CB  . THR B  1 271 ? 31.289  10.198  85.361  1.00 57.59  ? 270  THR B CB  1 
ATOM   4498  O OG1 . THR B  1 271 ? 31.811  11.519  85.562  1.00 72.22  ? 270  THR B OG1 1 
ATOM   4499  C CG2 . THR B  1 271 ? 32.388  9.172   85.590  1.00 54.68  ? 270  THR B CG2 1 
ATOM   4500  N N   . LYS B  1 272 ? 30.567  7.848   82.972  1.00 52.74  ? 271  LYS B N   1 
ATOM   4501  C CA  . LYS B  1 272 ? 29.935  6.571   82.671  1.00 47.16  ? 271  LYS B CA  1 
ATOM   4502  C C   . LYS B  1 272 ? 30.147  5.514   83.757  1.00 54.39  ? 271  LYS B C   1 
ATOM   4503  O O   . LYS B  1 272 ? 31.210  5.441   84.376  1.00 49.69  ? 271  LYS B O   1 
ATOM   4504  C CB  . LYS B  1 272 ? 30.483  6.033   81.358  1.00 43.10  ? 271  LYS B CB  1 
ATOM   4505  C CG  . LYS B  1 272 ? 30.186  6.894   80.150  1.00 48.18  ? 271  LYS B CG  1 
ATOM   4506  C CD  . LYS B  1 272 ? 30.789  6.257   78.900  1.00 46.05  ? 271  LYS B CD  1 
ATOM   4507  C CE  . LYS B  1 272 ? 30.576  7.112   77.678  1.00 56.49  ? 271  LYS B CE  1 
ATOM   4508  N NZ  . LYS B  1 272 ? 31.150  6.441   76.475  1.00 84.70  ? 271  LYS B NZ  1 
ATOM   4509  N N   . ASP B  1 273 ? 29.116  4.698   83.970  1.00 53.58  ? 272  ASP B N   1 
ATOM   4510  C CA  . ASP B  1 273 ? 29.189  3.521   84.840  1.00 49.66  ? 272  ASP B CA  1 
ATOM   4511  C C   . ASP B  1 273 ? 29.787  3.828   86.209  1.00 51.84  ? 272  ASP B C   1 
ATOM   4512  O O   . ASP B  1 273 ? 30.682  3.122   86.683  1.00 51.49  ? 272  ASP B O   1 
ATOM   4513  C CB  . ASP B  1 273 ? 30.000  2.418   84.153  1.00 45.11  ? 272  ASP B CB  1 
ATOM   4514  C CG  . ASP B  1 273 ? 29.553  2.172   82.722  1.00 58.04  ? 272  ASP B CG  1 
ATOM   4515  O OD1 . ASP B  1 273 ? 28.414  2.552   82.386  1.00 54.82  ? 272  ASP B OD1 1 
ATOM   4516  O OD2 . ASP B  1 273 ? 30.334  1.601   81.932  1.00 76.97  ? 272  ASP B OD2 1 
ATOM   4517  N N   . LYS B  1 274 ? 29.283  4.884   86.836  1.00 52.91  ? 273  LYS B N   1 
ATOM   4518  C CA  . LYS B  1 274 ? 29.755  5.303   88.149  1.00 55.36  ? 273  LYS B CA  1 
ATOM   4519  C C   . LYS B  1 274 ? 29.350  4.285   89.212  1.00 57.89  ? 273  LYS B C   1 
ATOM   4520  O O   . LYS B  1 274 ? 30.193  3.790   89.957  1.00 55.34  ? 273  LYS B O   1 
ATOM   4521  C CB  . LYS B  1 274 ? 29.177  6.675   88.492  1.00 53.63  ? 273  LYS B CB  1 
ATOM   4522  C CG  . LYS B  1 274 ? 29.685  7.274   89.793  1.00 71.57  ? 273  LYS B CG  1 
ATOM   4523  C CD  . LYS B  1 274 ? 30.976  8.043   89.584  1.00 74.32  ? 273  LYS B CD  1 
ATOM   4524  C CE  . LYS B  1 274 ? 31.345  8.848   90.822  1.00 82.03  ? 273  LYS B CE  1 
ATOM   4525  N NZ  . LYS B  1 274 ? 32.493  9.767   90.567  1.00 98.66  ? 273  LYS B NZ  1 
ATOM   4526  N N   . TRP B  1 275 ? 28.057  3.975   89.270  1.00 51.19  ? 274  TRP B N   1 
ATOM   4527  C CA  . TRP B  1 275 ? 27.534  3.030   90.256  1.00 44.75  ? 274  TRP B CA  1 
ATOM   4528  C C   . TRP B  1 275 ? 26.868  1.823   89.608  1.00 40.17  ? 274  TRP B C   1 
ATOM   4529  O O   . TRP B  1 275 ? 26.399  1.890   88.481  1.00 48.40  ? 274  TRP B O   1 
ATOM   4530  C CB  . TRP B  1 275 ? 26.531  3.728   91.175  1.00 45.20  ? 274  TRP B CB  1 
ATOM   4531  C CG  . TRP B  1 275 ? 27.089  4.936   91.850  1.00 59.87  ? 274  TRP B CG  1 
ATOM   4532  C CD1 . TRP B  1 275 ? 27.894  4.962   92.952  1.00 57.88  ? 274  TRP B CD1 1 
ATOM   4533  C CD2 . TRP B  1 275 ? 26.883  6.299   91.470  1.00 52.12  ? 274  TRP B CD2 1 
ATOM   4534  N NE1 . TRP B  1 275 ? 28.201  6.260   93.282  1.00 65.34  ? 274  TRP B NE1 1 
ATOM   4535  C CE2 . TRP B  1 275 ? 27.593  7.101   92.388  1.00 66.53  ? 274  TRP B CE2 1 
ATOM   4536  C CE3 . TRP B  1 275 ? 26.164  6.921   90.444  1.00 51.53  ? 274  TRP B CE3 1 
ATOM   4537  C CZ2 . TRP B  1 275 ? 27.608  8.498   92.309  1.00 59.77  ? 274  TRP B CZ2 1 
ATOM   4538  C CZ3 . TRP B  1 275 ? 26.180  8.313   90.366  1.00 60.24  ? 274  TRP B CZ3 1 
ATOM   4539  C CH2 . TRP B  1 275 ? 26.899  9.083   91.294  1.00 53.64  ? 274  TRP B CH2 1 
ATOM   4540  N N   . THR B  1 276 ? 26.837  0.714   90.333  1.00 49.77  ? 275  THR B N   1 
ATOM   4541  C CA  . THR B  1 276 ? 26.153  -0.487  89.874  1.00 40.26  ? 275  THR B CA  1 
ATOM   4542  C C   . THR B  1 276 ? 25.363  -1.095  91.032  1.00 51.33  ? 275  THR B C   1 
ATOM   4543  O O   . THR B  1 276 ? 25.899  -1.304  92.125  1.00 45.50  ? 275  THR B O   1 
ATOM   4544  C CB  . THR B  1 276 ? 27.143  -1.524  89.324  1.00 44.28  ? 275  THR B CB  1 
ATOM   4545  O OG1 . THR B  1 276 ? 27.780  -1.014  88.143  1.00 44.87  ? 275  THR B OG1 1 
ATOM   4546  C CG2 . THR B  1 276 ? 26.429  -2.815  88.972  1.00 53.11  ? 275  THR B CG2 1 
ATOM   4547  N N   . ASP B  1 277 ? 24.083  -1.353  90.788  1.00 45.45  ? 276  ASP B N   1 
ATOM   4548  C CA  . ASP B  1 277 ? 23.219  -2.012  91.760  1.00 41.97  ? 276  ASP B CA  1 
ATOM   4549  C C   . ASP B  1 277 ? 22.892  -3.421  91.261  1.00 43.17  ? 276  ASP B C   1 
ATOM   4550  O O   . ASP B  1 277 ? 22.390  -3.603  90.155  1.00 42.80  ? 276  ASP B O   1 
ATOM   4551  C CB  . ASP B  1 277 ? 21.940  -1.203  91.958  1.00 36.31  ? 276  ASP B CB  1 
ATOM   4552  C CG  . ASP B  1 277 ? 22.223  0.258   92.295  1.00 67.19  ? 276  ASP B CG  1 
ATOM   4553  O OD1 . ASP B  1 277 ? 23.189  0.521   93.043  1.00 66.97  ? 276  ASP B OD1 1 
ATOM   4554  O OD2 . ASP B  1 277 ? 21.492  1.145   91.808  1.00 49.17  ? 276  ASP B OD2 1 
ATOM   4555  N N   . ARG B  1 278 ? 23.194  -4.416  92.080  1.00 45.22  ? 277  ARG B N   1 
ATOM   4556  C CA  . ARG B  1 278 ? 23.084  -5.806  91.662  1.00 44.78  ? 277  ARG B CA  1 
ATOM   4557  C C   . ARG B  1 278 ? 22.212  -6.572  92.646  1.00 48.30  ? 277  ARG B C   1 
ATOM   4558  O O   . ARG B  1 278 ? 22.452  -6.538  93.851  1.00 46.14  ? 277  ARG B O   1 
ATOM   4559  C CB  . ARG B  1 278 ? 24.476  -6.422  91.603  1.00 49.04  ? 277  ARG B CB  1 
ATOM   4560  C CG  . ARG B  1 278 ? 24.663  -7.440  90.507  1.00 71.38  ? 277  ARG B CG  1 
ATOM   4561  C CD  . ARG B  1 278 ? 26.140  -7.692  90.244  1.00 74.78  ? 277  ARG B CD  1 
ATOM   4562  N NE  . ARG B  1 278 ? 26.344  -8.545  89.077  1.00 84.64  ? 277  ARG B NE  1 
ATOM   4563  C CZ  . ARG B  1 278 ? 26.390  -9.873  89.119  1.00 90.53  ? 277  ARG B CZ  1 
ATOM   4564  N NH1 . ARG B  1 278 ? 26.576  -10.570 88.003  1.00 87.51  ? 277  ARG B NH1 1 
ATOM   4565  N NH2 . ARG B  1 278 ? 26.251  -10.511 90.275  1.00 98.74  ? 277  ARG B NH2 1 
ATOM   4566  N N   . SER B  1 279 ? 21.192  -7.248  92.133  1.00 38.35  ? 278  SER B N   1 
ATOM   4567  C CA  . SER B  1 279 ? 20.281  -8.011  92.972  1.00 38.76  ? 278  SER B CA  1 
ATOM   4568  C C   . SER B  1 279 ? 20.179  -9.439  92.442  1.00 44.39  ? 278  SER B C   1 
ATOM   4569  O O   . SER B  1 279 ? 19.816  -9.642  91.289  1.00 41.42  ? 278  SER B O   1 
ATOM   4570  C CB  . SER B  1 279 ? 18.908  -7.346  92.983  1.00 38.41  ? 278  SER B CB  1 
ATOM   4571  O OG  . SER B  1 279 ? 18.071  -7.917  93.965  1.00 42.07  ? 278  SER B OG  1 
ATOM   4572  N N   . SER B  1 280 ? 20.503  -10.418 93.285  1.00 46.78  ? 279  SER B N   1 
ATOM   4573  C CA  . SER B  1 280 ? 20.570  -11.820 92.863  1.00 40.96  ? 279  SER B CA  1 
ATOM   4574  C C   . SER B  1 280 ? 19.592  -12.696 93.630  1.00 44.46  ? 279  SER B C   1 
ATOM   4575  O O   . SER B  1 280 ? 19.308  -12.450 94.796  1.00 41.20  ? 279  SER B O   1 
ATOM   4576  C CB  . SER B  1 280 ? 21.980  -12.373 93.068  1.00 40.52  ? 279  SER B CB  1 
ATOM   4577  O OG  . SER B  1 280 ? 22.925  -11.665 92.287  1.00 80.52  ? 279  SER B OG  1 
ATOM   4578  N N   . GLU B  1 281 ? 19.074  -13.715 92.953  1.00 39.75  ? 280  GLU B N   1 
ATOM   4579  C CA  . GLU B  1 281 ? 18.285  -14.753 93.598  1.00 40.03  ? 280  GLU B CA  1 
ATOM   4580  C C   . GLU B  1 281 ? 18.783  -16.088 93.093  1.00 43.59  ? 280  GLU B C   1 
ATOM   4581  O O   . GLU B  1 281 ? 19.235  -16.197 91.956  1.00 38.09  ? 280  GLU B O   1 
ATOM   4582  C CB  . GLU B  1 281 ? 16.799  -14.612 93.266  1.00 46.52  ? 280  GLU B CB  1 
ATOM   4583  C CG  . GLU B  1 281 ? 16.189  -13.274 93.638  1.00 55.59  ? 280  GLU B CG  1 
ATOM   4584  C CD  . GLU B  1 281 ? 16.109  -13.040 95.135  1.00 74.93  ? 280  GLU B CD  1 
ATOM   4585  O OE1 . GLU B  1 281 ? 16.081  -11.858 95.545  1.00 75.76  ? 280  GLU B OE1 1 
ATOM   4586  O OE2 . GLU B  1 281 ? 16.065  -14.027 95.900  1.00 73.01  ? 280  GLU B OE2 1 
ATOM   4587  N N   . ARG B  1 282 ? 18.713  -17.102 93.943  1.00 45.04  ? 281  ARG B N   1 
ATOM   4588  C CA  . ARG B  1 282 ? 19.003  -18.455 93.521  1.00 45.10  ? 281  ARG B CA  1 
ATOM   4589  C C   . ARG B  1 282 ? 17.735  -19.298 93.630  1.00 41.40  ? 281  ARG B C   1 
ATOM   4590  O O   . ARG B  1 282 ? 17.050  -19.274 94.645  1.00 39.61  ? 281  ARG B O   1 
ATOM   4591  C CB  . ARG B  1 282 ? 20.123  -19.056 94.363  1.00 44.11  ? 281  ARG B CB  1 
ATOM   4592  C CG  . ARG B  1 282 ? 20.396  -20.504 94.012  1.00 59.34  ? 281  ARG B CG  1 
ATOM   4593  C CD  . ARG B  1 282 ? 21.718  -20.984 94.564  1.00 61.71  ? 281  ARG B CD  1 
ATOM   4594  N NE  . ARG B  1 282 ? 22.835  -20.319 93.906  1.00 71.07  ? 281  ARG B NE  1 
ATOM   4595  C CZ  . ARG B  1 282 ? 24.110  -20.654 94.065  1.00 89.74  ? 281  ARG B CZ  1 
ATOM   4596  N NH1 . ARG B  1 282 ? 25.055  -19.987 93.418  1.00 93.05  ? 281  ARG B NH1 1 
ATOM   4597  N NH2 . ARG B  1 282 ? 24.442  -21.658 94.864  1.00 99.49  ? 281  ARG B NH2 1 
ATOM   4598  N N   . TYR B  1 283 ? 17.420  -20.038 92.576  1.00 35.92  ? 282  TYR B N   1 
ATOM   4599  C CA  . TYR B  1 283 ? 16.217  -20.848 92.568  1.00 32.53  ? 282  TYR B CA  1 
ATOM   4600  C C   . TYR B  1 283 ? 16.595  -22.305 92.431  1.00 39.18  ? 282  TYR B C   1 
ATOM   4601  O O   . TYR B  1 283 ? 17.654  -22.638 91.891  1.00 40.41  ? 282  TYR B O   1 
ATOM   4602  C CB  . TYR B  1 283 ? 15.303  -20.439 91.411  1.00 37.74  ? 282  TYR B CB  1 
ATOM   4603  C CG  . TYR B  1 283 ? 14.825  -18.997 91.471  1.00 34.21  ? 282  TYR B CG  1 
ATOM   4604  C CD1 . TYR B  1 283 ? 15.528  -17.990 90.832  1.00 38.29  ? 282  TYR B CD1 1 
ATOM   4605  C CD2 . TYR B  1 283 ? 13.676  -18.650 92.164  1.00 36.58  ? 282  TYR B CD2 1 
ATOM   4606  C CE1 . TYR B  1 283 ? 15.099  -16.673 90.879  1.00 40.05  ? 282  TYR B CE1 1 
ATOM   4607  C CE2 . TYR B  1 283 ? 13.236  -17.332 92.221  1.00 40.36  ? 282  TYR B CE2 1 
ATOM   4608  C CZ  . TYR B  1 283 ? 13.954  -16.351 91.573  1.00 38.49  ? 282  TYR B CZ  1 
ATOM   4609  O OH  . TYR B  1 283 ? 13.531  -15.046 91.620  1.00 43.64  ? 282  TYR B OH  1 
ATOM   4610  N N   . LYS B  1 284 ? 15.722  -23.170 92.925  1.00 34.04  ? 283  LYS B N   1 
ATOM   4611  C CA  . LYS B  1 284 ? 15.872  -24.601 92.748  1.00 34.03  ? 283  LYS B CA  1 
ATOM   4612  C C   . LYS B  1 284 ? 14.849  -25.064 91.729  1.00 33.74  ? 283  LYS B C   1 
ATOM   4613  O O   . LYS B  1 284 ? 13.651  -24.832 91.881  1.00 32.82  ? 283  LYS B O   1 
ATOM   4614  C CB  . LYS B  1 284 ? 15.648  -25.331 94.076  1.00 38.65  ? 283  LYS B CB  1 
ATOM   4615  C CG  . LYS B  1 284 ? 15.762  -26.849 93.975  1.00 49.65  ? 283  LYS B CG  1 
ATOM   4616  C CD  . LYS B  1 284 ? 15.453  -27.511 95.304  1.00 60.09  ? 283  LYS B CD  1 
ATOM   4617  C CE  . LYS B  1 284 ? 15.533  -29.021 95.213  1.00 79.49  ? 283  LYS B CE  1 
ATOM   4618  N NZ  . LYS B  1 284 ? 15.221  -29.670 96.517  1.00 89.86  ? 283  LYS B NZ  1 
ATOM   4619  N N   . ILE B  1 285 ? 15.336  -25.709 90.683  1.00 28.23  ? 284  ILE B N   1 
ATOM   4620  C CA  . ILE B  1 285 ? 14.480  -26.315 89.681  1.00 37.60  ? 284  ILE B CA  1 
ATOM   4621  C C   . ILE B  1 285 ? 14.376  -27.800 89.975  1.00 36.43  ? 284  ILE B C   1 
ATOM   4622  O O   . ILE B  1 285 ? 15.365  -28.527 89.894  1.00 35.01  ? 284  ILE B O   1 
ATOM   4623  C CB  . ILE B  1 285 ? 15.064  -26.158 88.270  1.00 28.72  ? 284  ILE B CB  1 
ATOM   4624  C CG1 . ILE B  1 285 ? 15.204  -24.678 87.906  1.00 32.68  ? 284  ILE B CG1 1 
ATOM   4625  C CG2 . ILE B  1 285 ? 14.189  -26.895 87.257  1.00 33.34  ? 284  ILE B CG2 1 
ATOM   4626  C CD1 . ILE B  1 285 ? 16.042  -24.444 86.651  1.00 35.61  ? 284  ILE B CD1 1 
ATOM   4627  N N   . ASP B  1 286 ? 13.182  -28.251 90.323  1.00 39.87  ? 285  ASP B N   1 
ATOM   4628  C CA  . ASP B  1 286 ? 12.952  -29.669 90.561  1.00 31.12  ? 285  ASP B CA  1 
ATOM   4629  C C   . ASP B  1 286 ? 12.264  -30.258 89.339  1.00 31.78  ? 285  ASP B C   1 
ATOM   4630  O O   . ASP B  1 286 ? 11.059  -30.114 89.175  1.00 38.29  ? 285  ASP B O   1 
ATOM   4631  C CB  . ASP B  1 286 ? 12.086  -29.865 91.801  1.00 34.55  ? 285  ASP B CB  1 
ATOM   4632  C CG  . ASP B  1 286 ? 12.017  -31.328 92.245  1.00 61.77  ? 285  ASP B CG  1 
ATOM   4633  O OD1 . ASP B  1 286 ? 12.238  -32.225 91.406  1.00 51.18  ? 285  ASP B OD1 1 
ATOM   4634  O OD2 . ASP B  1 286 ? 11.740  -31.580 93.437  1.00 70.35  ? 285  ASP B OD2 1 
ATOM   4635  N N   . TRP B  1 287 ? 13.039  -30.922 88.486  1.00 34.82  ? 286  TRP B N   1 
ATOM   4636  C CA  . TRP B  1 287 ? 12.529  -31.460 87.229  1.00 39.78  ? 286  TRP B CA  1 
ATOM   4637  C C   . TRP B  1 287 ? 11.566  -32.624 87.409  1.00 44.66  ? 286  TRP B C   1 
ATOM   4638  O O   . TRP B  1 287 ? 10.795  -32.931 86.506  1.00 45.88  ? 286  TRP B O   1 
ATOM   4639  C CB  . TRP B  1 287 ? 13.683  -31.928 86.344  1.00 35.02  ? 286  TRP B CB  1 
ATOM   4640  C CG  . TRP B  1 287 ? 14.596  -30.825 85.888  1.00 41.03  ? 286  TRP B CG  1 
ATOM   4641  C CD1 . TRP B  1 287 ? 15.774  -30.448 86.464  1.00 36.93  ? 286  TRP B CD1 1 
ATOM   4642  C CD2 . TRP B  1 287 ? 14.409  -29.964 84.759  1.00 37.12  ? 286  TRP B CD2 1 
ATOM   4643  N NE1 . TRP B  1 287 ? 16.332  -29.413 85.767  1.00 39.27  ? 286  TRP B NE1 1 
ATOM   4644  C CE2 . TRP B  1 287 ? 15.518  -29.094 84.713  1.00 43.13  ? 286  TRP B CE2 1 
ATOM   4645  C CE3 . TRP B  1 287 ? 13.416  -29.847 83.780  1.00 32.67  ? 286  TRP B CE3 1 
ATOM   4646  C CZ2 . TRP B  1 287 ? 15.664  -28.119 83.729  1.00 33.47  ? 286  TRP B CZ2 1 
ATOM   4647  C CZ3 . TRP B  1 287 ? 13.561  -28.881 82.803  1.00 34.30  ? 286  TRP B CZ3 1 
ATOM   4648  C CH2 . TRP B  1 287 ? 14.679  -28.028 82.783  1.00 36.06  ? 286  TRP B CH2 1 
ATOM   4649  N N   . GLU B  1 288 ? 11.621  -33.287 88.558  1.00 33.81  ? 287  GLU B N   1 
ATOM   4650  C CA  . GLU B  1 288 ? 10.759  -34.439 88.789  1.00 35.15  ? 287  GLU B CA  1 
ATOM   4651  C C   . GLU B  1 288 ? 9.383   -34.002 89.310  1.00 42.45  ? 287  GLU B C   1 
ATOM   4652  O O   . GLU B  1 288 ? 8.354   -34.497 88.852  1.00 45.37  ? 287  GLU B O   1 
ATOM   4653  C CB  . GLU B  1 288 ? 11.439  -35.420 89.751  1.00 43.02  ? 287  GLU B CB  1 
ATOM   4654  C CG  . GLU B  1 288 ? 12.595  -36.175 89.104  1.00 44.85  ? 287  GLU B CG  1 
ATOM   4655  C CD  . GLU B  1 288 ? 13.493  -36.887 90.107  1.00 76.63  ? 287  GLU B CD  1 
ATOM   4656  O OE1 . GLU B  1 288 ? 13.604  -36.406 91.256  1.00 66.80  ? 287  GLU B OE1 1 
ATOM   4657  O OE2 . GLU B  1 288 ? 14.094  -37.927 89.737  1.00 73.70  ? 287  GLU B OE2 1 
ATOM   4658  N N   . LYS B  1 289 ? 9.364   -33.062 90.248  1.00 45.73  ? 288  LYS B N   1 
ATOM   4659  C CA  . LYS B  1 289 ? 8.107   -32.523 90.743  1.00 46.10  ? 288  LYS B CA  1 
ATOM   4660  C C   . LYS B  1 289 ? 7.579   -31.439 89.816  1.00 47.35  ? 288  LYS B C   1 
ATOM   4661  O O   . LYS B  1 289 ? 6.428   -31.019 89.944  1.00 41.35  ? 288  LYS B O   1 
ATOM   4662  C CB  . LYS B  1 289 ? 8.284   -31.947 92.144  1.00 47.46  ? 288  LYS B CB  1 
ATOM   4663  C CG  . LYS B  1 289 ? 8.636   -32.983 93.189  1.00 71.49  ? 288  LYS B CG  1 
ATOM   4664  C CD  . LYS B  1 289 ? 8.851   -32.356 94.562  1.00 85.86  ? 288  LYS B CD  1 
ATOM   4665  C CE  . LYS B  1 289 ? 7.590   -31.685 95.085  1.00 96.09  ? 288  LYS B CE  1 
ATOM   4666  N NZ  . LYS B  1 289 ? 7.802   -31.071 96.426  1.00 96.42  ? 288  LYS B NZ  1 
ATOM   4667  N N   . GLU B  1 290 ? 8.420   -30.997 88.882  1.00 41.44  ? 289  GLU B N   1 
ATOM   4668  C CA  . GLU B  1 290 ? 8.089   -29.863 88.019  1.00 39.39  ? 289  GLU B CA  1 
ATOM   4669  C C   . GLU B  1 290 ? 7.641   -28.672 88.859  1.00 37.61  ? 289  GLU B C   1 
ATOM   4670  O O   . GLU B  1 290 ? 6.536   -28.165 88.727  1.00 35.56  ? 289  GLU B O   1 
ATOM   4671  C CB  . GLU B  1 290 ? 7.023   -30.239 86.986  1.00 34.09  ? 289  GLU B CB  1 
ATOM   4672  C CG  . GLU B  1 290 ? 7.508   -31.299 85.990  1.00 43.85  ? 289  GLU B CG  1 
ATOM   4673  C CD  . GLU B  1 290 ? 6.487   -31.623 84.909  1.00 67.18  ? 289  GLU B CD  1 
ATOM   4674  O OE1 . GLU B  1 290 ? 5.291   -31.324 85.104  1.00 77.08  ? 289  GLU B OE1 1 
ATOM   4675  O OE2 . GLU B  1 290 ? 6.883   -32.178 83.860  1.00 76.10  ? 289  GLU B OE2 1 
ATOM   4676  N N   . GLU B  1 291 ? 8.516   -28.239 89.747  1.00 36.30  ? 290  GLU B N   1 
ATOM   4677  C CA  . GLU B  1 291 ? 8.298   -26.996 90.448  1.00 38.72  ? 290  GLU B CA  1 
ATOM   4678  C C   . GLU B  1 291 ? 9.601   -26.230 90.583  1.00 41.42  ? 290  GLU B C   1 
ATOM   4679  O O   . GLU B  1 291 ? 10.698  -26.780 90.448  1.00 40.89  ? 290  GLU B O   1 
ATOM   4680  C CB  . GLU B  1 291 ? 7.667   -27.247 91.817  1.00 49.35  ? 290  GLU B CB  1 
ATOM   4681  C CG  . GLU B  1 291 ? 8.568   -27.947 92.800  1.00 68.26  ? 290  GLU B CG  1 
ATOM   4682  C CD  . GLU B  1 291 ? 7.853   -28.278 94.105  1.00 92.90  ? 290  GLU B CD  1 
ATOM   4683  O OE1 . GLU B  1 291 ? 6.644   -28.592 94.057  1.00 85.63  ? 290  GLU B OE1 1 
ATOM   4684  O OE2 . GLU B  1 291 ? 8.497   -28.221 95.177  1.00 79.81  ? 290  GLU B OE2 1 
ATOM   4685  N N   . MET B  1 292 ? 9.470   -24.937 90.823  1.00 28.65  ? 291  MET B N   1 
ATOM   4686  C CA  . MET B  1 292 ? 10.621  -24.079 90.976  1.00 34.14  ? 291  MET B CA  1 
ATOM   4687  C C   . MET B  1 292 ? 10.387  -23.304 92.261  1.00 39.74  ? 291  MET B C   1 
ATOM   4688  O O   . MET B  1 292 ? 9.277   -22.837 92.503  1.00 40.19  ? 291  MET B O   1 
ATOM   4689  C CB  . MET B  1 292 ? 10.695  -23.156 89.766  1.00 39.75  ? 291  MET B CB  1 
ATOM   4690  C CG  . MET B  1 292 ? 12.012  -22.476 89.552  1.00 50.32  ? 291  MET B CG  1 
ATOM   4691  S SD  . MET B  1 292 ? 12.058  -21.675 87.933  1.00 41.64  ? 291  MET B SD  1 
ATOM   4692  C CE  . MET B  1 292 ? 13.611  -20.802 88.085  1.00 43.49  ? 291  MET B CE  1 
ATOM   4693  N N   . THR B  1 293 ? 11.410  -23.193 93.102  1.00 33.91  ? 292  THR B N   1 
ATOM   4694  C CA  . THR B  1 293 ? 11.266  -22.478 94.371  1.00 45.20  ? 292  THR B CA  1 
ATOM   4695  C C   . THR B  1 293 ? 12.474  -21.591 94.637  1.00 38.08  ? 292  THR B C   1 
ATOM   4696  O O   . THR B  1 293 ? 13.568  -21.864 94.151  1.00 40.24  ? 292  THR B O   1 
ATOM   4697  C CB  . THR B  1 293 ? 11.099  -23.458 95.564  1.00 51.50  ? 292  THR B CB  1 
ATOM   4698  O OG1 . THR B  1 293 ? 12.186  -24.395 95.579  1.00 51.38  ? 292  THR B OG1 1 
ATOM   4699  C CG2 . THR B  1 293 ? 9.791   -24.230 95.457  1.00 49.87  ? 292  THR B CG2 1 
ATOM   4700  N N   . ASN B  1 294 ? 12.272  -20.535 95.413  1.00 37.41  ? 293  ASN B N   1 
ATOM   4701  C CA  . ASN B  1 294 ? 13.361  -19.655 95.815  1.00 48.65  ? 293  ASN B CA  1 
ATOM   4702  C C   . ASN B  1 294 ? 14.114  -20.264 96.992  1.00 53.15  ? 293  ASN B C   1 
ATOM   4703  O O   . ASN B  1 294 ? 13.517  -20.587 98.016  1.00 57.36  ? 293  ASN B O   1 
ATOM   4704  C CB  . ASN B  1 294 ? 12.809  -18.277 96.203  1.00 50.90  ? 293  ASN B CB  1 
ATOM   4705  C CG  . ASN B  1 294 ? 13.891  -17.206 96.276  1.00 67.11  ? 293  ASN B CG  1 
ATOM   4706  O OD1 . ASN B  1 294 ? 15.040  -17.479 96.625  1.00 63.63  ? 293  ASN B OD1 1 
ATOM   4707  N ND2 . ASN B  1 294 ? 13.522  -15.978 95.936  1.00 58.88  ? 293  ASN B ND2 1 
ATOM   4708  N N   . LEU B  1 295 ? 15.424  -20.431 96.836  1.00 60.07  ? 294  LEU B N   1 
ATOM   4709  C CA  . LEU B  1 295 ? 16.256  -20.983 97.903  1.00 75.12  ? 294  LEU B CA  1 
ATOM   4710  C C   . LEU B  1 295 ? 16.421  -20.010 99.078  1.00 86.97  ? 294  LEU B C   1 
ATOM   4711  O O   . LEU B  1 295 ? 16.991  -20.369 100.109 1.00 82.40  ? 294  LEU B O   1 
ATOM   4712  C CB  . LEU B  1 295 ? 17.628  -21.386 97.351  1.00 64.96  ? 294  LEU B CB  1 
ATOM   4713  C CG  . LEU B  1 295 ? 17.649  -22.673 96.525  1.00 50.33  ? 294  LEU B CG  1 
ATOM   4714  C CD1 . LEU B  1 295 ? 19.065  -23.035 96.134  1.00 68.61  ? 294  LEU B CD1 1 
ATOM   4715  C CD2 . LEU B  1 295 ? 17.024  -23.819 97.295  1.00 59.75  ? 294  LEU B CD2 1 
ATOM   4716  N N   . GLU B  1 296 ? 15.918  -18.788 98.909  1.00 70.39  ? 295  GLU B N   1 
ATOM   4717  C CA  . GLU B  1 296 ? 15.948  -17.759 99.951  1.00 99.56  ? 295  GLU B CA  1 
ATOM   4718  C C   . GLU B  1 296 ? 17.354  -17.206 100.175 1.00 105.82 ? 295  GLU B C   1 
ATOM   4719  O O   . GLU B  1 296 ? 18.343  -17.935 100.091 1.00 95.98  ? 295  GLU B O   1 
ATOM   4720  C CB  . GLU B  1 296 ? 15.386  -18.314 101.261 1.00 100.08 ? 295  GLU B CB  1 
ATOM   4721  C CG  . GLU B  1 296 ? 14.033  -18.990 101.107 1.00 110.22 ? 295  GLU B CG  1 
ATOM   4722  C CD  . GLU B  1 296 ? 13.928  -20.274 101.913 1.00 123.46 ? 295  GLU B CD  1 
ATOM   4723  O OE1 . GLU B  1 296 ? 14.578  -20.367 102.978 1.00 125.02 ? 295  GLU B OE1 1 
ATOM   4724  O OE2 . GLU B  1 296 ? 13.204  -21.194 101.477 1.00 112.85 ? 295  GLU B OE2 1 
ATOM   4725  N N   . ALA C  1 2   ? -0.994  -19.133 46.900  1.00 78.91  ? 1    ALA C N   1 
ATOM   4726  C CA  . ALA C  1 2   ? -1.746  -19.823 47.996  1.00 87.39  ? 1    ALA C CA  1 
ATOM   4727  C C   . ALA C  1 2   ? -2.886  -20.672 47.438  1.00 82.90  ? 1    ALA C C   1 
ATOM   4728  O O   . ALA C  1 2   ? -3.384  -20.412 46.343  1.00 79.50  ? 1    ALA C O   1 
ATOM   4729  C CB  . ALA C  1 2   ? -2.291  -18.806 48.977  1.00 83.21  ? 1    ALA C CB  1 
ATOM   4730  N N   . ASP C  1 3   ? -3.301  -21.683 48.199  1.00 63.69  ? 2    ASP C N   1 
ATOM   4731  C CA  . ASP C  1 3   ? -4.359  -22.586 47.762  1.00 55.60  ? 2    ASP C CA  1 
ATOM   4732  C C   . ASP C  1 3   ? -5.615  -21.819 47.357  1.00 56.20  ? 2    ASP C C   1 
ATOM   4733  O O   . ASP C  1 3   ? -6.295  -22.191 46.401  1.00 50.73  ? 2    ASP C O   1 
ATOM   4734  C CB  . ASP C  1 3   ? -4.699  -23.596 48.862  1.00 64.53  ? 2    ASP C CB  1 
ATOM   4735  C CG  . ASP C  1 3   ? -3.546  -24.541 49.170  1.00 88.11  ? 2    ASP C CG  1 
ATOM   4736  O OD1 . ASP C  1 3   ? -2.378  -24.101 49.071  1.00 95.29  ? 2    ASP C OD1 1 
ATOM   4737  O OD2 . ASP C  1 3   ? -3.806  -25.721 49.515  1.00 73.01  ? 2    ASP C OD2 1 
ATOM   4738  N N   . SER C  1 4   ? -5.918  -20.750 48.088  1.00 43.80  ? 3    SER C N   1 
ATOM   4739  C CA  . SER C  1 4   ? -7.098  -19.939 47.816  1.00 50.07  ? 3    SER C CA  1 
ATOM   4740  C C   . SER C  1 4   ? -7.058  -19.315 46.414  1.00 50.17  ? 3    SER C C   1 
ATOM   4741  O O   . SER C  1 4   ? -8.094  -19.162 45.764  1.00 50.51  ? 3    SER C O   1 
ATOM   4742  C CB  . SER C  1 4   ? -7.243  -18.848 48.886  1.00 46.93  ? 3    SER C CB  1 
ATOM   4743  O OG  . SER C  1 4   ? -6.058  -18.075 48.996  1.00 67.17  ? 3    SER C OG  1 
ATOM   4744  N N   . ASP C  1 5   ? -5.866  -18.957 45.946  1.00 41.66  ? 4    ASP C N   1 
ATOM   4745  C CA  . ASP C  1 5   ? -5.713  -18.365 44.611  1.00 49.63  ? 4    ASP C CA  1 
ATOM   4746  C C   . ASP C  1 5   ? -6.047  -19.343 43.485  1.00 48.52  ? 4    ASP C C   1 
ATOM   4747  O O   . ASP C  1 5   ? -6.319  -18.942 42.363  1.00 48.51  ? 4    ASP C O   1 
ATOM   4748  C CB  . ASP C  1 5   ? -4.294  -17.828 44.429  1.00 49.68  ? 4    ASP C CB  1 
ATOM   4749  C CG  . ASP C  1 5   ? -3.956  -16.752 45.432  1.00 62.55  ? 4    ASP C CG  1 
ATOM   4750  O OD1 . ASP C  1 5   ? -4.515  -15.640 45.303  1.00 60.29  ? 4    ASP C OD1 1 
ATOM   4751  O OD2 . ASP C  1 5   ? -3.150  -17.022 46.352  1.00 62.09  ? 4    ASP C OD2 1 
ATOM   4752  N N   . ILE C  1 6   ? -6.026  -20.631 43.789  1.00 41.77  ? 5    ILE C N   1 
ATOM   4753  C CA  . ILE C  1 6   ? -6.363  -21.647 42.803  1.00 39.09  ? 5    ILE C CA  1 
ATOM   4754  C C   . ILE C  1 6   ? -7.595  -22.454 43.227  1.00 44.06  ? 5    ILE C C   1 
ATOM   4755  O O   . ILE C  1 6   ? -7.728  -23.629 42.894  1.00 40.66  ? 5    ILE C O   1 
ATOM   4756  C CB  . ILE C  1 6   ? -5.162  -22.578 42.541  1.00 43.83  ? 5    ILE C CB  1 
ATOM   4757  C CG1 . ILE C  1 6   ? -4.639  -23.176 43.848  1.00 40.70  ? 5    ILE C CG1 1 
ATOM   4758  C CG2 . ILE C  1 6   ? -4.040  -21.809 41.847  1.00 39.39  ? 5    ILE C CG2 1 
ATOM   4759  C CD1 . ILE C  1 6   ? -3.483  -24.146 43.657  1.00 38.76  ? 5    ILE C CD1 1 
ATOM   4760  N N   . ASN C  1 7   ? -8.493  -21.803 43.968  1.00 51.56  ? 6    ASN C N   1 
ATOM   4761  C CA  . ASN C  1 7   ? -9.803  -22.363 44.311  1.00 43.07  ? 6    ASN C CA  1 
ATOM   4762  C C   . ASN C  1 7   ? -9.742  -23.654 45.120  1.00 43.15  ? 6    ASN C C   1 
ATOM   4763  O O   . ASN C  1 7   ? -10.605 -24.522 44.994  1.00 38.97  ? 6    ASN C O   1 
ATOM   4764  C CB  . ASN C  1 7   ? -10.622 -22.593 43.043  1.00 43.01  ? 6    ASN C CB  1 
ATOM   4765  C CG  . ASN C  1 7   ? -10.782 -21.327 42.226  1.00 57.56  ? 6    ASN C CG  1 
ATOM   4766  O OD1 . ASN C  1 7   ? -10.309 -21.244 41.092  1.00 56.29  ? 6    ASN C OD1 1 
ATOM   4767  N ND2 . ASN C  1 7   ? -11.434 -20.326 42.805  1.00 48.40  ? 6    ASN C ND2 1 
ATOM   4768  N N   . ILE C  1 8   ? -8.728  -23.773 45.964  1.00 44.83  ? 7    ILE C N   1 
ATOM   4769  C CA  . ILE C  1 8   ? -8.581  -24.946 46.814  1.00 44.40  ? 7    ILE C CA  1 
ATOM   4770  C C   . ILE C  1 8   ? -8.622  -24.529 48.283  1.00 46.78  ? 7    ILE C C   1 
ATOM   4771  O O   . ILE C  1 8   ? -8.018  -23.527 48.674  1.00 40.29  ? 7    ILE C O   1 
ATOM   4772  C CB  . ILE C  1 8   ? -7.263  -25.679 46.500  1.00 46.92  ? 7    ILE C CB  1 
ATOM   4773  C CG1 . ILE C  1 8   ? -7.306  -26.245 45.079  1.00 43.01  ? 7    ILE C CG1 1 
ATOM   4774  C CG2 . ILE C  1 8   ? -7.012  -26.786 47.490  1.00 41.21  ? 7    ILE C CG2 1 
ATOM   4775  C CD1 . ILE C  1 8   ? -6.012  -26.855 44.636  1.00 46.46  ? 7    ILE C CD1 1 
ATOM   4776  N N   . LYS C  1 9   ? -9.358  -25.288 49.088  1.00 45.76  ? 8    LYS C N   1 
ATOM   4777  C CA  . LYS C  1 9   ? -9.429  -25.046 50.529  1.00 50.70  ? 8    LYS C CA  1 
ATOM   4778  C C   . LYS C  1 9   ? -8.038  -24.865 51.115  1.00 45.23  ? 8    LYS C C   1 
ATOM   4779  O O   . LYS C  1 9   ? -7.140  -25.674 50.858  1.00 47.78  ? 8    LYS C O   1 
ATOM   4780  C CB  . LYS C  1 9   ? -10.109 -26.220 51.232  1.00 52.64  ? 8    LYS C CB  1 
ATOM   4781  C CG  . LYS C  1 9   ? -11.403 -25.865 51.932  1.00 75.82  ? 8    LYS C CG  1 
ATOM   4782  C CD  . LYS C  1 9   ? -12.610 -26.315 51.125  1.00 79.37  ? 8    LYS C CD  1 
ATOM   4783  C CE  . LYS C  1 9   ? -13.910 -26.066 51.883  1.00 86.71  ? 8    LYS C CE  1 
ATOM   4784  N NZ  . LYS C  1 9   ? -15.099 -26.567 51.136  1.00 76.80  ? 8    LYS C NZ  1 
ATOM   4785  N N   . THR C  1 10  ? -7.862  -23.813 51.909  1.00 43.79  ? 9    THR C N   1 
ATOM   4786  C CA  . THR C  1 10  ? -6.565  -23.516 52.512  1.00 56.37  ? 9    THR C CA  1 
ATOM   4787  C C   . THR C  1 10  ? -6.040  -24.716 53.318  1.00 59.84  ? 9    THR C C   1 
ATOM   4788  O O   . THR C  1 10  ? -6.787  -25.357 54.064  1.00 49.25  ? 9    THR C O   1 
ATOM   4789  C CB  . THR C  1 10  ? -6.649  -22.259 53.415  1.00 56.47  ? 9    THR C CB  1 
ATOM   4790  O OG1 . THR C  1 10  ? -7.125  -21.154 52.639  1.00 66.00  ? 9    THR C OG1 1 
ATOM   4791  C CG2 . THR C  1 10  ? -5.284  -21.911 54.006  1.00 51.54  ? 9    THR C CG2 1 
ATOM   4792  N N   . GLY C  1 11  ? -4.757  -25.029 53.143  1.00 51.69  ? 10   GLY C N   1 
ATOM   4793  C CA  . GLY C  1 11  ? -4.112  -26.086 53.905  1.00 48.91  ? 10   GLY C CA  1 
ATOM   4794  C C   . GLY C  1 11  ? -4.275  -27.481 53.317  1.00 52.88  ? 10   GLY C C   1 
ATOM   4795  O O   . GLY C  1 11  ? -3.636  -28.429 53.765  1.00 54.26  ? 10   GLY C O   1 
ATOM   4796  N N   . THR C  1 12  ? -5.125  -27.607 52.307  1.00 48.60  ? 11   THR C N   1 
ATOM   4797  C CA  . THR C  1 12  ? -5.425  -28.902 51.709  1.00 45.58  ? 11   THR C CA  1 
ATOM   4798  C C   . THR C  1 12  ? -4.178  -29.637 51.204  1.00 49.90  ? 11   THR C C   1 
ATOM   4799  O O   . THR C  1 12  ? -4.085  -30.854 51.332  1.00 50.64  ? 11   THR C O   1 
ATOM   4800  C CB  . THR C  1 12  ? -6.403  -28.753 50.523  1.00 50.52  ? 11   THR C CB  1 
ATOM   4801  O OG1 . THR C  1 12  ? -7.668  -28.274 50.990  1.00 58.77  ? 11   THR C OG1 1 
ATOM   4802  C CG2 . THR C  1 12  ? -6.603  -30.089 49.824  1.00 46.04  ? 11   THR C CG2 1 
ATOM   4803  N N   . THR C  1 13  ? -3.226  -28.909 50.626  1.00 43.88  ? 12   THR C N   1 
ATOM   4804  C CA  . THR C  1 13  ? -2.068  -29.547 50.007  1.00 48.39  ? 12   THR C CA  1 
ATOM   4805  C C   . THR C  1 13  ? -0.846  -29.611 50.922  1.00 47.61  ? 12   THR C C   1 
ATOM   4806  O O   . THR C  1 13  ? 0.222   -30.033 50.498  1.00 61.99  ? 12   THR C O   1 
ATOM   4807  C CB  . THR C  1 13  ? -1.654  -28.830 48.710  1.00 45.05  ? 12   THR C CB  1 
ATOM   4808  O OG1 . THR C  1 13  ? -1.194  -27.506 49.014  1.00 45.19  ? 12   THR C OG1 1 
ATOM   4809  C CG2 . THR C  1 13  ? -2.827  -28.777 47.732  1.00 43.79  ? 12   THR C CG2 1 
ATOM   4810  N N   . ASP C  1 14  ? -0.996  -29.215 52.178  1.00 58.66  ? 13   ASP C N   1 
ATOM   4811  C CA  . ASP C  1 14  ? 0.142   -29.219 53.089  1.00 65.33  ? 13   ASP C CA  1 
ATOM   4812  C C   . ASP C  1 14  ? 0.363   -30.586 53.732  1.00 60.02  ? 13   ASP C C   1 
ATOM   4813  O O   . ASP C  1 14  ? -0.502  -31.455 53.698  1.00 66.82  ? 13   ASP C O   1 
ATOM   4814  C CB  . ASP C  1 14  ? -0.025  -28.136 54.153  1.00 65.61  ? 13   ASP C CB  1 
ATOM   4815  C CG  . ASP C  1 14  ? 0.045   -26.737 53.565  1.00 90.74  ? 13   ASP C CG  1 
ATOM   4816  O OD1 . ASP C  1 14  ? -0.498  -25.796 54.187  1.00 87.18  ? 13   ASP C OD1 1 
ATOM   4817  O OD2 . ASP C  1 14  ? 0.637   -26.586 52.469  1.00 84.81  ? 13   ASP C OD2 1 
ATOM   4818  N N   . ILE C  1 15  ? 1.538   -30.759 54.317  1.00 51.97  ? 14   ILE C N   1 
ATOM   4819  C CA  . ILE C  1 15  ? 1.950   -32.025 54.894  1.00 56.29  ? 14   ILE C CA  1 
ATOM   4820  C C   . ILE C  1 15  ? 1.790   -31.993 56.405  1.00 55.92  ? 14   ILE C C   1 
ATOM   4821  O O   . ILE C  1 15  ? 2.044   -30.964 57.032  1.00 58.49  ? 14   ILE C O   1 
ATOM   4822  C CB  . ILE C  1 15  ? 3.429   -32.269 54.578  1.00 47.23  ? 14   ILE C CB  1 
ATOM   4823  C CG1 . ILE C  1 15  ? 3.595   -32.630 53.110  1.00 46.72  ? 14   ILE C CG1 1 
ATOM   4824  C CG2 . ILE C  1 15  ? 4.007   -33.368 55.451  1.00 37.96  ? 14   ILE C CG2 1 
ATOM   4825  C CD1 . ILE C  1 15  ? 5.026   -32.531 52.659  1.00 66.84  ? 14   ILE C CD1 1 
ATOM   4826  N N   . GLY C  1 16  ? 1.379   -33.109 57.000  1.00 57.39  ? 15   GLY C N   1 
ATOM   4827  C CA  . GLY C  1 16  ? 1.403   -33.213 58.450  1.00 75.21  ? 15   GLY C CA  1 
ATOM   4828  C C   . GLY C  1 16  ? 0.168   -33.763 59.140  1.00 87.65  ? 15   GLY C C   1 
ATOM   4829  O O   . GLY C  1 16  ? 0.287   -34.518 60.105  1.00 93.32  ? 15   GLY C O   1 
ATOM   4830  N N   . SER C  1 17  ? -1.014  -33.377 58.672  1.00 84.77  ? 16   SER C N   1 
ATOM   4831  C CA  . SER C  1 17  ? -2.259  -33.783 59.321  1.00 92.12  ? 16   SER C CA  1 
ATOM   4832  C C   . SER C  1 17  ? -2.266  -35.280 59.643  1.00 48.48  ? 16   SER C C   1 
ATOM   4833  O O   . SER C  1 17  ? -1.754  -36.084 58.871  1.00 64.91  ? 16   SER C O   1 
ATOM   4834  C CB  . SER C  1 17  ? -3.451  -33.438 58.426  1.00 95.00  ? 16   SER C CB  1 
ATOM   4835  O OG  . SER C  1 17  ? -3.342  -34.083 57.169  1.00 95.05  ? 16   SER C OG  1 
ATOM   4836  N N   . ASN C  1 18  ? -2.833  -35.642 60.791  1.00 88.64  ? 17   ASN C N   1 
ATOM   4837  C CA  . ASN C  1 18  ? -2.991  -37.050 61.165  1.00 79.25  ? 17   ASN C CA  1 
ATOM   4838  C C   . ASN C  1 18  ? -1.664  -37.788 61.384  1.00 93.32  ? 17   ASN C C   1 
ATOM   4839  O O   . ASN C  1 18  ? -1.556  -38.994 61.119  1.00 72.88  ? 17   ASN C O   1 
ATOM   4840  C CB  . ASN C  1 18  ? -3.809  -37.779 60.096  1.00 95.95  ? 17   ASN C CB  1 
ATOM   4841  C CG  . ASN C  1 18  ? -5.209  -38.110 60.560  1.00 108.99 ? 17   ASN C CG  1 
ATOM   4842  O OD1 . ASN C  1 18  ? -5.490  -39.244 60.952  1.00 107.82 ? 17   ASN C OD1 1 
ATOM   4843  N ND2 . ASN C  1 18  ? -6.097  -37.121 60.520  1.00 98.59  ? 17   ASN C ND2 1 
ATOM   4844  N N   . THR C  1 19  ? -0.660  -37.065 61.872  1.00 65.09  ? 18   THR C N   1 
ATOM   4845  C CA  . THR C  1 19  ? 0.668   -37.636 62.084  1.00 79.20  ? 18   THR C CA  1 
ATOM   4846  C C   . THR C  1 19  ? 1.131   -37.333 63.504  1.00 66.96  ? 18   THR C C   1 
ATOM   4847  O O   . THR C  1 19  ? 0.863   -36.257 64.027  1.00 56.84  ? 18   THR C O   1 
ATOM   4848  C CB  . THR C  1 19  ? 1.723   -37.046 61.088  1.00 80.17  ? 18   THR C CB  1 
ATOM   4849  O OG1 . THR C  1 19  ? 1.207   -37.057 59.750  1.00 65.74  ? 18   THR C OG1 1 
ATOM   4850  C CG2 . THR C  1 19  ? 3.034   -37.845 61.132  1.00 55.82  ? 18   THR C CG2 1 
ATOM   4851  N N   . THR C  1 20  ? 1.806   -38.287 64.136  1.00 62.62  ? 19   THR C N   1 
ATOM   4852  C CA  . THR C  1 20  ? 2.540   -38.000 65.361  1.00 51.94  ? 19   THR C CA  1 
ATOM   4853  C C   . THR C  1 20  ? 3.933   -37.540 64.953  1.00 49.21  ? 19   THR C C   1 
ATOM   4854  O O   . THR C  1 20  ? 4.598   -38.198 64.161  1.00 53.10  ? 19   THR C O   1 
ATOM   4855  C CB  . THR C  1 20  ? 2.649   -39.235 66.275  1.00 44.20  ? 19   THR C CB  1 
ATOM   4856  O OG1 . THR C  1 20  ? 1.342   -39.631 66.700  1.00 58.42  ? 19   THR C OG1 1 
ATOM   4857  C CG2 . THR C  1 20  ? 3.506   -38.920 67.501  1.00 41.73  ? 19   THR C CG2 1 
ATOM   4858  N N   . VAL C  1 21  ? 4.364   -36.402 65.481  1.00 43.74  ? 20   VAL C N   1 
ATOM   4859  C CA  . VAL C  1 21  ? 5.638   -35.812 65.091  1.00 31.67  ? 20   VAL C CA  1 
ATOM   4860  C C   . VAL C  1 21  ? 6.621   -35.927 66.246  1.00 31.48  ? 20   VAL C C   1 
ATOM   4861  O O   . VAL C  1 21  ? 6.313   -35.553 67.377  1.00 43.22  ? 20   VAL C O   1 
ATOM   4862  C CB  . VAL C  1 21  ? 5.447   -34.323 64.720  1.00 39.64  ? 20   VAL C CB  1 
ATOM   4863  C CG1 . VAL C  1 21  ? 6.787   -33.639 64.473  1.00 33.32  ? 20   VAL C CG1 1 
ATOM   4864  C CG2 . VAL C  1 21  ? 4.546   -34.209 63.512  1.00 37.74  ? 20   VAL C CG2 1 
ATOM   4865  N N   . LYS C  1 22  ? 7.811   -36.430 65.962  1.00 31.16  ? 21   LYS C N   1 
ATOM   4866  C CA  . LYS C  1 22  ? 8.855   -36.546 66.971  1.00 33.83  ? 21   LYS C CA  1 
ATOM   4867  C C   . LYS C  1 22  ? 9.837   -35.408 66.811  1.00 33.10  ? 21   LYS C C   1 
ATOM   4868  O O   . LYS C  1 22  ? 10.311  -35.165 65.717  1.00 33.27  ? 21   LYS C O   1 
ATOM   4869  C CB  . LYS C  1 22  ? 9.605   -37.864 66.808  1.00 38.83  ? 21   LYS C CB  1 
ATOM   4870  C CG  . LYS C  1 22  ? 8.755   -39.092 66.980  1.00 39.11  ? 21   LYS C CG  1 
ATOM   4871  C CD  . LYS C  1 22  ? 8.327   -39.257 68.412  1.00 55.98  ? 21   LYS C CD  1 
ATOM   4872  C CE  . LYS C  1 22  ? 7.642   -40.596 68.623  1.00 67.48  ? 21   LYS C CE  1 
ATOM   4873  N NZ  . LYS C  1 22  ? 7.351   -40.835 70.059  1.00 76.47  ? 21   LYS C NZ  1 
ATOM   4874  N N   . THR C  1 23  ? 10.159  -34.727 67.905  1.00 27.18  ? 22   THR C N   1 
ATOM   4875  C CA  . THR C  1 23  ? 10.990  -33.535 67.838  1.00 30.79  ? 22   THR C CA  1 
ATOM   4876  C C   . THR C  1 23  ? 12.102  -33.648 68.860  1.00 35.67  ? 22   THR C C   1 
ATOM   4877  O O   . THR C  1 23  ? 12.050  -34.505 69.741  1.00 29.78  ? 22   THR C O   1 
ATOM   4878  C CB  . THR C  1 23  ? 10.172  -32.281 68.141  1.00 31.91  ? 22   THR C CB  1 
ATOM   4879  O OG1 . THR C  1 23  ? 9.591   -32.405 69.447  1.00 34.22  ? 22   THR C OG1 1 
ATOM   4880  C CG2 . THR C  1 23  ? 9.059   -32.117 67.131  1.00 31.86  ? 22   THR C CG2 1 
ATOM   4881  N N   . GLY C  1 24  ? 13.100  -32.776 68.752  1.00 32.68  ? 23   GLY C N   1 
ATOM   4882  C CA  . GLY C  1 24  ? 14.205  -32.790 69.690  1.00 33.19  ? 23   GLY C CA  1 
ATOM   4883  C C   . GLY C  1 24  ? 15.068  -31.543 69.632  1.00 35.87  ? 23   GLY C C   1 
ATOM   4884  O O   . GLY C  1 24  ? 15.050  -30.793 68.662  1.00 34.30  ? 23   GLY C O   1 
ATOM   4885  N N   . ASP C  1 25  ? 15.828  -31.335 70.701  1.00 39.44  ? 24   ASP C N   1 
ATOM   4886  C CA  . ASP C  1 25  ? 16.759  -30.225 70.820  1.00 37.97  ? 24   ASP C CA  1 
ATOM   4887  C C   . ASP C  1 25  ? 18.141  -30.799 71.076  1.00 38.33  ? 24   ASP C C   1 
ATOM   4888  O O   . ASP C  1 25  ? 18.313  -31.676 71.923  1.00 38.33  ? 24   ASP C O   1 
ATOM   4889  C CB  . ASP C  1 25  ? 16.375  -29.314 72.000  1.00 41.62  ? 24   ASP C CB  1 
ATOM   4890  C CG  . ASP C  1 25  ? 15.330  -28.279 71.633  1.00 69.55  ? 24   ASP C CG  1 
ATOM   4891  O OD1 . ASP C  1 25  ? 15.494  -27.630 70.576  1.00 74.77  ? 24   ASP C OD1 1 
ATOM   4892  O OD2 . ASP C  1 25  ? 14.349  -28.108 72.402  1.00 71.10  ? 24   ASP C OD2 1 
ATOM   4893  N N   . LEU C  1 26  ? 19.125  -30.307 70.337  1.00 32.43  ? 25   LEU C N   1 
ATOM   4894  C CA  . LEU C  1 26  ? 20.510  -30.679 70.572  1.00 32.11  ? 25   LEU C CA  1 
ATOM   4895  C C   . LEU C  1 26  ? 21.322  -29.406 70.735  1.00 38.02  ? 25   LEU C C   1 
ATOM   4896  O O   . LEU C  1 26  ? 21.378  -28.572 69.838  1.00 34.59  ? 25   LEU C O   1 
ATOM   4897  C CB  . LEU C  1 26  ? 21.039  -31.520 69.410  1.00 29.90  ? 25   LEU C CB  1 
ATOM   4898  C CG  . LEU C  1 26  ? 20.273  -32.828 69.153  1.00 38.76  ? 25   LEU C CG  1 
ATOM   4899  C CD1 . LEU C  1 26  ? 20.785  -33.515 67.907  1.00 37.43  ? 25   LEU C CD1 1 
ATOM   4900  C CD2 . LEU C  1 26  ? 20.365  -33.779 70.349  1.00 38.27  ? 25   LEU C CD2 1 
ATOM   4901  N N   . VAL C  1 27  ? 21.946  -29.249 71.891  1.00 32.74  ? 26   VAL C N   1 
ATOM   4902  C CA  . VAL C  1 27  ? 22.641  -28.015 72.210  1.00 40.09  ? 26   VAL C CA  1 
ATOM   4903  C C   . VAL C  1 27  ? 24.103  -28.282 72.518  1.00 38.47  ? 26   VAL C C   1 
ATOM   4904  O O   . VAL C  1 27  ? 24.435  -29.180 73.276  1.00 38.64  ? 26   VAL C O   1 
ATOM   4905  C CB  . VAL C  1 27  ? 22.015  -27.317 73.436  1.00 31.95  ? 26   VAL C CB  1 
ATOM   4906  C CG1 . VAL C  1 27  ? 22.816  -26.075 73.801  1.00 38.28  ? 26   VAL C CG1 1 
ATOM   4907  C CG2 . VAL C  1 27  ? 20.570  -26.957 73.161  1.00 39.90  ? 26   VAL C CG2 1 
ATOM   4908  N N   . THR C  1 28  ? 24.977  -27.478 71.938  1.00 33.45  ? 27   THR C N   1 
ATOM   4909  C CA  . THR C  1 28  ? 26.385  -27.532 72.276  1.00 47.38  ? 27   THR C CA  1 
ATOM   4910  C C   . THR C  1 28  ? 26.963  -26.118 72.283  1.00 44.95  ? 27   THR C C   1 
ATOM   4911  O O   . THR C  1 28  ? 26.556  -25.274 71.500  1.00 44.47  ? 27   THR C O   1 
ATOM   4912  C CB  . THR C  1 28  ? 27.161  -28.446 71.288  1.00 51.17  ? 27   THR C CB  1 
ATOM   4913  O OG1 . THR C  1 28  ? 28.559  -28.416 71.595  1.00 68.25  ? 27   THR C OG1 1 
ATOM   4914  C CG2 . THR C  1 28  ? 26.950  -27.999 69.858  1.00 50.06  ? 27   THR C CG2 1 
ATOM   4915  N N   . TYR C  1 29  ? 27.888  -25.857 73.194  1.00 41.83  ? 28   TYR C N   1 
ATOM   4916  C CA  . TYR C  1 29  ? 28.573  -24.580 73.221  1.00 40.36  ? 28   TYR C CA  1 
ATOM   4917  C C   . TYR C  1 29  ? 30.062  -24.740 72.925  1.00 40.57  ? 28   TYR C C   1 
ATOM   4918  O O   . TYR C  1 29  ? 30.774  -25.452 73.625  1.00 34.60  ? 28   TYR C O   1 
ATOM   4919  C CB  . TYR C  1 29  ? 28.396  -23.891 74.568  1.00 35.14  ? 28   TYR C CB  1 
ATOM   4920  C CG  . TYR C  1 29  ? 29.107  -22.551 74.618  1.00 41.24  ? 28   TYR C CG  1 
ATOM   4921  C CD1 . TYR C  1 29  ? 28.688  -21.492 73.824  1.00 37.75  ? 28   TYR C CD1 1 
ATOM   4922  C CD2 . TYR C  1 29  ? 30.200  -22.350 75.453  1.00 39.13  ? 28   TYR C CD2 1 
ATOM   4923  C CE1 . TYR C  1 29  ? 29.339  -20.258 73.861  1.00 39.33  ? 28   TYR C CE1 1 
ATOM   4924  C CE2 . TYR C  1 29  ? 30.854  -21.127 75.501  1.00 43.61  ? 28   TYR C CE2 1 
ATOM   4925  C CZ  . TYR C  1 29  ? 30.423  -20.085 74.700  1.00 45.21  ? 28   TYR C CZ  1 
ATOM   4926  O OH  . TYR C  1 29  ? 31.077  -18.874 74.755  1.00 38.49  ? 28   TYR C OH  1 
ATOM   4927  N N   . ASP C  1 30  ? 30.519  -24.069 71.876  1.00 41.82  ? 29   ASP C N   1 
ATOM   4928  C CA  . ASP C  1 30  ? 31.929  -24.068 71.508  1.00 32.26  ? 29   ASP C CA  1 
ATOM   4929  C C   . ASP C  1 30  ? 32.621  -22.861 72.132  1.00 48.68  ? 29   ASP C C   1 
ATOM   4930  O O   . ASP C  1 30  ? 32.474  -21.733 71.656  1.00 45.56  ? 29   ASP C O   1 
ATOM   4931  C CB  . ASP C  1 30  ? 32.067  -24.012 69.999  1.00 35.76  ? 29   ASP C CB  1 
ATOM   4932  C CG  . ASP C  1 30  ? 33.506  -24.076 69.549  1.00 59.25  ? 29   ASP C CG  1 
ATOM   4933  O OD1 . ASP C  1 30  ? 33.741  -24.517 68.404  1.00 45.74  ? 29   ASP C OD1 1 
ATOM   4934  O OD2 . ASP C  1 30  ? 34.395  -23.690 70.343  1.00 60.48  ? 29   ASP C OD2 1 
ATOM   4935  N N   . LYS C  1 31  ? 33.373  -23.113 73.200  1.00 53.38  ? 30   LYS C N   1 
ATOM   4936  C CA  . LYS C  1 31  ? 33.992  -22.062 73.993  1.00 58.13  ? 30   LYS C CA  1 
ATOM   4937  C C   . LYS C  1 31  ? 35.063  -21.319 73.198  1.00 60.06  ? 30   LYS C C   1 
ATOM   4938  O O   . LYS C  1 31  ? 35.114  -20.093 73.208  1.00 56.83  ? 30   LYS C O   1 
ATOM   4939  C CB  . LYS C  1 31  ? 34.602  -22.673 75.257  1.00 68.03  ? 30   LYS C CB  1 
ATOM   4940  C CG  . LYS C  1 31  ? 34.842  -21.683 76.381  1.00 84.88  ? 30   LYS C CG  1 
ATOM   4941  C CD  . LYS C  1 31  ? 35.227  -22.406 77.667  1.00 108.07 ? 30   LYS C CD  1 
ATOM   4942  C CE  . LYS C  1 31  ? 35.225  -21.466 78.866  1.00 115.14 ? 30   LYS C CE  1 
ATOM   4943  N NZ  . LYS C  1 31  ? 36.179  -20.334 78.699  1.00 103.88 ? 30   LYS C NZ  1 
ATOM   4944  N N   . GLU C  1 32  ? 35.908  -22.067 72.499  1.00 45.09  ? 31   GLU C N   1 
ATOM   4945  C CA  . GLU C  1 32  ? 37.006  -21.472 71.743  1.00 49.67  ? 31   GLU C CA  1 
ATOM   4946  C C   . GLU C  1 32  ? 36.508  -20.486 70.699  1.00 52.05  ? 31   GLU C C   1 
ATOM   4947  O O   . GLU C  1 32  ? 37.132  -19.457 70.469  1.00 48.80  ? 31   GLU C O   1 
ATOM   4948  C CB  . GLU C  1 32  ? 37.829  -22.553 71.042  1.00 53.80  ? 31   GLU C CB  1 
ATOM   4949  C CG  . GLU C  1 32  ? 39.030  -23.048 71.835  1.00 98.93  ? 31   GLU C CG  1 
ATOM   4950  C CD  . GLU C  1 32  ? 38.666  -24.091 72.879  1.00 117.49 ? 31   GLU C CD  1 
ATOM   4951  O OE1 . GLU C  1 32  ? 37.467  -24.424 73.005  1.00 105.25 ? 31   GLU C OE1 1 
ATOM   4952  O OE2 . GLU C  1 32  ? 39.584  -24.581 73.573  1.00 124.18 ? 31   GLU C OE2 1 
ATOM   4953  N N   . ASN C  1 33  ? 35.393  -20.811 70.054  1.00 47.73  ? 32   ASN C N   1 
ATOM   4954  C CA  . ASN C  1 33  ? 34.897  -20.005 68.947  1.00 46.08  ? 32   ASN C CA  1 
ATOM   4955  C C   . ASN C  1 33  ? 33.729  -19.090 69.331  1.00 39.11  ? 32   ASN C C   1 
ATOM   4956  O O   . ASN C  1 33  ? 33.232  -18.345 68.499  1.00 51.58  ? 32   ASN C O   1 
ATOM   4957  C CB  . ASN C  1 33  ? 34.487  -20.907 67.784  1.00 48.58  ? 32   ASN C CB  1 
ATOM   4958  C CG  . ASN C  1 33  ? 35.673  -21.546 67.101  1.00 56.17  ? 32   ASN C CG  1 
ATOM   4959  O OD1 . ASN C  1 33  ? 36.616  -20.864 66.712  1.00 58.69  ? 32   ASN C OD1 1 
ATOM   4960  N ND2 . ASN C  1 33  ? 35.638  -22.867 66.964  1.00 49.51  ? 32   ASN C ND2 1 
ATOM   4961  N N   . GLY C  1 34  ? 33.307  -19.139 70.586  1.00 35.90  ? 33   GLY C N   1 
ATOM   4962  C CA  . GLY C  1 34  ? 32.192  -18.325 71.046  1.00 45.10  ? 33   GLY C CA  1 
ATOM   4963  C C   . GLY C  1 34  ? 30.895  -18.557 70.276  1.00 47.26  ? 33   GLY C C   1 
ATOM   4964  O O   . GLY C  1 34  ? 30.275  -17.612 69.783  1.00 33.29  ? 33   GLY C O   1 
ATOM   4965  N N   . MET C  1 35  ? 30.473  -19.814 70.184  1.00 39.32  ? 34   MET C N   1 
ATOM   4966  C CA  . MET C  1 35  ? 29.272  -20.157 69.434  1.00 39.74  ? 34   MET C CA  1 
ATOM   4967  C C   . MET C  1 35  ? 28.345  -21.081 70.204  1.00 32.75  ? 34   MET C C   1 
ATOM   4968  O O   . MET C  1 35  ? 28.691  -22.206 70.530  1.00 37.80  ? 34   MET C O   1 
ATOM   4969  C CB  . MET C  1 35  ? 29.645  -20.809 68.110  1.00 37.46  ? 34   MET C CB  1 
ATOM   4970  C CG  . MET C  1 35  ? 30.478  -19.905 67.228  1.00 35.10  ? 34   MET C CG  1 
ATOM   4971  S SD  . MET C  1 35  ? 30.914  -20.729 65.720  1.00 45.52  ? 34   MET C SD  1 
ATOM   4972  C CE  . MET C  1 35  ? 31.824  -19.435 64.861  1.00 35.54  ? 34   MET C CE  1 
ATOM   4973  N N   . HIS C  1 36  ? 27.159  -20.580 70.497  1.00 38.24  ? 35   HIS C N   1 
ATOM   4974  C CA  . HIS C  1 36  ? 26.102  -21.386 71.078  1.00 33.23  ? 35   HIS C CA  1 
ATOM   4975  C C   . HIS C  1 36  ? 25.332  -21.978 69.910  1.00 39.12  ? 35   HIS C C   1 
ATOM   4976  O O   . HIS C  1 36  ? 24.767  -21.250 69.094  1.00 38.03  ? 35   HIS C O   1 
ATOM   4977  C CB  . HIS C  1 36  ? 25.194  -20.513 71.951  1.00 33.54  ? 35   HIS C CB  1 
ATOM   4978  C CG  . HIS C  1 36  ? 24.091  -21.272 72.616  1.00 38.78  ? 35   HIS C CG  1 
ATOM   4979  N ND1 . HIS C  1 36  ? 22.761  -21.013 72.374  1.00 44.37  ? 35   HIS C ND1 1 
ATOM   4980  C CD2 . HIS C  1 36  ? 24.121  -22.283 73.511  1.00 38.44  ? 35   HIS C CD2 1 
ATOM   4981  C CE1 . HIS C  1 36  ? 22.017  -21.838 73.087  1.00 38.80  ? 35   HIS C CE1 1 
ATOM   4982  N NE2 . HIS C  1 36  ? 22.818  -22.618 73.789  1.00 39.51  ? 35   HIS C NE2 1 
ATOM   4983  N N   . LYS C  1 37  ? 25.337  -23.299 69.811  1.00 39.08  ? 36   LYS C N   1 
ATOM   4984  C CA  . LYS C  1 37  ? 24.747  -23.978 68.671  1.00 40.37  ? 36   LYS C CA  1 
ATOM   4985  C C   . LYS C  1 37  ? 23.573  -24.839 69.107  1.00 45.17  ? 36   LYS C C   1 
ATOM   4986  O O   . LYS C  1 37  ? 23.680  -25.646 70.028  1.00 42.31  ? 36   LYS C O   1 
ATOM   4987  C CB  . LYS C  1 37  ? 25.811  -24.823 67.962  1.00 49.15  ? 36   LYS C CB  1 
ATOM   4988  C CG  . LYS C  1 37  ? 26.999  -23.986 67.511  1.00 46.74  ? 36   LYS C CG  1 
ATOM   4989  C CD  . LYS C  1 37  ? 27.935  -24.746 66.594  1.00 51.17  ? 36   LYS C CD  1 
ATOM   4990  C CE  . LYS C  1 37  ? 28.653  -25.861 67.338  1.00 50.65  ? 36   LYS C CE  1 
ATOM   4991  N NZ  . LYS C  1 37  ? 29.645  -26.542 66.457  1.00 52.09  ? 36   LYS C NZ  1 
ATOM   4992  N N   . LYS C  1 38  ? 22.438  -24.638 68.454  1.00 39.63  ? 37   LYS C N   1 
ATOM   4993  C CA  . LYS C  1 38  ? 21.246  -25.382 68.796  1.00 34.04  ? 37   LYS C CA  1 
ATOM   4994  C C   . LYS C  1 38  ? 20.602  -25.938 67.534  1.00 38.48  ? 37   LYS C C   1 
ATOM   4995  O O   . LYS C  1 38  ? 20.363  -25.218 66.578  1.00 34.19  ? 37   LYS C O   1 
ATOM   4996  C CB  . LYS C  1 38  ? 20.262  -24.481 69.536  1.00 39.92  ? 37   LYS C CB  1 
ATOM   4997  C CG  . LYS C  1 38  ? 19.197  -25.239 70.294  1.00 48.06  ? 37   LYS C CG  1 
ATOM   4998  C CD  . LYS C  1 38  ? 18.067  -25.676 69.391  1.00 44.46  ? 37   LYS C CD  1 
ATOM   4999  C CE  . LYS C  1 38  ? 16.899  -24.709 69.448  1.00 48.68  ? 37   LYS C CE  1 
ATOM   5000  N NZ  . LYS C  1 38  ? 16.223  -24.701 70.768  1.00 37.85  ? 37   LYS C NZ  1 
ATOM   5001  N N   . VAL C  1 39  ? 20.353  -27.236 67.531  1.00 32.12  ? 38   VAL C N   1 
ATOM   5002  C CA  . VAL C  1 39  ? 19.549  -27.846 66.497  1.00 40.77  ? 38   VAL C CA  1 
ATOM   5003  C C   . VAL C  1 39  ? 18.178  -28.178 67.076  1.00 43.08  ? 38   VAL C C   1 
ATOM   5004  O O   . VAL C  1 39  ? 18.070  -28.811 68.129  1.00 44.77  ? 38   VAL C O   1 
ATOM   5005  C CB  . VAL C  1 39  ? 20.210  -29.147 65.975  1.00 44.85  ? 38   VAL C CB  1 
ATOM   5006  C CG1 . VAL C  1 39  ? 19.234  -29.938 65.129  1.00 33.81  ? 38   VAL C CG1 1 
ATOM   5007  C CG2 . VAL C  1 39  ? 21.480  -28.816 65.185  1.00 37.40  ? 38   VAL C CG2 1 
ATOM   5008  N N   . PHE C  1 40  ? 17.129  -27.729 66.404  1.00 35.62  ? 39   PHE C N   1 
ATOM   5009  C CA  . PHE C  1 40  ? 15.791  -28.187 66.716  1.00 31.67  ? 39   PHE C CA  1 
ATOM   5010  C C   . PHE C  1 40  ? 15.296  -29.013 65.533  1.00 30.13  ? 39   PHE C C   1 
ATOM   5011  O O   . PHE C  1 40  ? 15.189  -28.506 64.427  1.00 30.71  ? 39   PHE C O   1 
ATOM   5012  C CB  . PHE C  1 40  ? 14.853  -27.004 66.980  1.00 32.10  ? 39   PHE C CB  1 
ATOM   5013  C CG  . PHE C  1 40  ? 13.432  -27.417 67.210  1.00 38.11  ? 39   PHE C CG  1 
ATOM   5014  C CD1 . PHE C  1 40  ? 13.032  -27.881 68.448  1.00 40.61  ? 39   PHE C CD1 1 
ATOM   5015  C CD2 . PHE C  1 40  ? 12.506  -27.374 66.186  1.00 41.60  ? 39   PHE C CD2 1 
ATOM   5016  C CE1 . PHE C  1 40  ? 11.729  -28.283 68.668  1.00 44.18  ? 39   PHE C CE1 1 
ATOM   5017  C CE2 . PHE C  1 40  ? 11.203  -27.774 66.399  1.00 41.22  ? 39   PHE C CE2 1 
ATOM   5018  C CZ  . PHE C  1 40  ? 10.814  -28.232 67.645  1.00 36.07  ? 39   PHE C CZ  1 
ATOM   5019  N N   . TYR C  1 41  ? 14.990  -30.286 65.754  1.00 30.35  ? 40   TYR C N   1 
ATOM   5020  C CA  . TYR C  1 41  ? 14.602  -31.149 64.642  1.00 27.19  ? 40   TYR C CA  1 
ATOM   5021  C C   . TYR C  1 41  ? 13.193  -31.708 64.813  1.00 28.01  ? 40   TYR C C   1 
ATOM   5022  O O   . TYR C  1 41  ? 12.694  -31.830 65.929  1.00 34.23  ? 40   TYR C O   1 
ATOM   5023  C CB  . TYR C  1 41  ? 15.624  -32.285 64.457  1.00 30.67  ? 40   TYR C CB  1 
ATOM   5024  C CG  . TYR C  1 41  ? 15.629  -33.325 65.566  1.00 31.83  ? 40   TYR C CG  1 
ATOM   5025  C CD1 . TYR C  1 41  ? 14.697  -34.350 65.585  1.00 29.63  ? 40   TYR C CD1 1 
ATOM   5026  C CD2 . TYR C  1 41  ? 16.565  -33.273 66.595  1.00 34.19  ? 40   TYR C CD2 1 
ATOM   5027  C CE1 . TYR C  1 41  ? 14.693  -35.303 66.603  1.00 33.58  ? 40   TYR C CE1 1 
ATOM   5028  C CE2 . TYR C  1 41  ? 16.570  -34.220 67.614  1.00 30.52  ? 40   TYR C CE2 1 
ATOM   5029  C CZ  . TYR C  1 41  ? 15.637  -35.236 67.608  1.00 36.56  ? 40   TYR C CZ  1 
ATOM   5030  O OH  . TYR C  1 41  ? 15.636  -36.191 68.610  1.00 37.92  ? 40   TYR C OH  1 
ATOM   5031  N N   . SER C  1 42  ? 12.556  -32.034 63.693  1.00 31.96  ? 41   SER C N   1 
ATOM   5032  C CA  . SER C  1 42  ? 11.211  -32.603 63.698  1.00 30.26  ? 41   SER C CA  1 
ATOM   5033  C C   . SER C  1 42  ? 11.102  -33.647 62.597  1.00 33.60  ? 41   SER C C   1 
ATOM   5034  O O   . SER C  1 42  ? 11.260  -33.328 61.420  1.00 28.89  ? 41   SER C O   1 
ATOM   5035  C CB  . SER C  1 42  ? 10.161  -31.511 63.441  1.00 35.96  ? 41   SER C CB  1 
ATOM   5036  O OG  . SER C  1 42  ? 10.325  -30.410 64.320  1.00 38.99  ? 41   SER C OG  1 
ATOM   5037  N N   . PHE C  1 43  ? 10.826  -34.890 62.981  1.00 32.76  ? 42   PHE C N   1 
ATOM   5038  C CA  . PHE C  1 43  ? 10.550  -35.958 62.030  1.00 35.82  ? 42   PHE C CA  1 
ATOM   5039  C C   . PHE C  1 43  ? 9.063   -36.000 61.717  1.00 39.54  ? 42   PHE C C   1 
ATOM   5040  O O   . PHE C  1 43  ? 8.233   -36.141 62.615  1.00 39.49  ? 42   PHE C O   1 
ATOM   5041  C CB  . PHE C  1 43  ? 10.966  -37.316 62.608  1.00 32.24  ? 42   PHE C CB  1 
ATOM   5042  C CG  . PHE C  1 43  ? 12.444  -37.542 62.626  1.00 36.42  ? 42   PHE C CG  1 
ATOM   5043  C CD1 . PHE C  1 43  ? 13.192  -37.239 63.749  1.00 33.38  ? 42   PHE C CD1 1 
ATOM   5044  C CD2 . PHE C  1 43  ? 13.088  -38.067 61.513  1.00 37.49  ? 42   PHE C CD2 1 
ATOM   5045  C CE1 . PHE C  1 43  ? 14.560  -37.455 63.767  1.00 38.56  ? 42   PHE C CE1 1 
ATOM   5046  C CE2 . PHE C  1 43  ? 14.453  -38.288 61.526  1.00 36.19  ? 42   PHE C CE2 1 
ATOM   5047  C CZ  . PHE C  1 43  ? 15.188  -37.983 62.658  1.00 30.91  ? 42   PHE C CZ  1 
ATOM   5048  N N   . ILE C  1 44  ? 8.732   -35.884 60.441  1.00 35.97  ? 43   ILE C N   1 
ATOM   5049  C CA  . ILE C  1 44  ? 7.351   -35.958 60.000  1.00 37.56  ? 43   ILE C CA  1 
ATOM   5050  C C   . ILE C  1 44  ? 7.222   -37.133 59.061  1.00 36.37  ? 43   ILE C C   1 
ATOM   5051  O O   . ILE C  1 44  ? 7.761   -37.112 57.959  1.00 44.37  ? 43   ILE C O   1 
ATOM   5052  C CB  . ILE C  1 44  ? 6.936   -34.681 59.243  1.00 32.12  ? 43   ILE C CB  1 
ATOM   5053  C CG1 . ILE C  1 44  ? 7.190   -33.450 60.110  1.00 34.73  ? 43   ILE C CG1 1 
ATOM   5054  C CG2 . ILE C  1 44  ? 5.484   -34.760 58.829  1.00 39.05  ? 43   ILE C CG2 1 
ATOM   5055  C CD1 . ILE C  1 44  ? 6.860   -32.142 59.417  1.00 36.92  ? 43   ILE C CD1 1 
ATOM   5056  N N   . ASP C  1 45  ? 6.509   -38.160 59.496  1.00 46.48  ? 44   ASP C N   1 
ATOM   5057  C CA  . ASP C  1 45  ? 6.283   -39.339 58.666  1.00 37.02  ? 44   ASP C CA  1 
ATOM   5058  C C   . ASP C  1 45  ? 4.799   -39.413 58.321  1.00 42.69  ? 44   ASP C C   1 
ATOM   5059  O O   . ASP C  1 45  ? 4.024   -40.106 58.974  1.00 46.66  ? 44   ASP C O   1 
ATOM   5060  C CB  . ASP C  1 45  ? 6.742   -40.606 59.393  1.00 44.06  ? 44   ASP C CB  1 
ATOM   5061  C CG  . ASP C  1 45  ? 6.646   -41.860 58.518  1.00 65.06  ? 44   ASP C CG  1 
ATOM   5062  O OD1 . ASP C  1 45  ? 6.855   -42.975 59.044  1.00 59.99  ? 44   ASP C OD1 1 
ATOM   5063  O OD2 . ASP C  1 45  ? 6.365   -41.733 57.307  1.00 53.56  ? 44   ASP C OD2 1 
ATOM   5064  N N   . ASP C  1 46  ? 4.419   -38.667 57.294  1.00 39.57  ? 45   ASP C N   1 
ATOM   5065  C CA  . ASP C  1 46  ? 3.044   -38.583 56.837  1.00 37.75  ? 45   ASP C CA  1 
ATOM   5066  C C   . ASP C  1 46  ? 2.823   -39.675 55.807  1.00 40.19  ? 45   ASP C C   1 
ATOM   5067  O O   . ASP C  1 46  ? 3.420   -39.644 54.733  1.00 39.01  ? 45   ASP C O   1 
ATOM   5068  C CB  . ASP C  1 46  ? 2.806   -37.201 56.216  1.00 37.13  ? 45   ASP C CB  1 
ATOM   5069  C CG  . ASP C  1 46  ? 1.410   -37.032 55.661  1.00 46.08  ? 45   ASP C CG  1 
ATOM   5070  O OD1 . ASP C  1 46  ? 1.054   -35.887 55.302  1.00 54.95  ? 45   ASP C OD1 1 
ATOM   5071  O OD2 . ASP C  1 46  ? 0.666   -38.029 55.593  1.00 53.44  ? 45   ASP C OD2 1 
ATOM   5072  N N   . LYS C  1 47  ? 1.957   -40.631 56.125  1.00 29.35  ? 46   LYS C N   1 
ATOM   5073  C CA  . LYS C  1 47  ? 1.769   -41.811 55.265  1.00 41.27  ? 46   LYS C CA  1 
ATOM   5074  C C   . LYS C  1 47  ? 1.185   -41.464 53.900  1.00 33.14  ? 46   LYS C C   1 
ATOM   5075  O O   . LYS C  1 47  ? 1.240   -42.267 52.988  1.00 45.51  ? 46   LYS C O   1 
ATOM   5076  C CB  . LYS C  1 47  ? 0.863   -42.845 55.947  1.00 47.17  ? 46   LYS C CB  1 
ATOM   5077  C CG  . LYS C  1 47  ? 1.404   -43.393 57.256  1.00 56.98  ? 46   LYS C CG  1 
ATOM   5078  C CD  . LYS C  1 47  ? 2.768   -44.035 57.072  1.00 62.06  ? 46   LYS C CD  1 
ATOM   5079  C CE  . LYS C  1 47  ? 3.262   -44.644 58.375  1.00 61.92  ? 46   LYS C CE  1 
ATOM   5080  N NZ  . LYS C  1 47  ? 4.613   -45.227 58.218  1.00 66.10  ? 46   LYS C NZ  1 
ATOM   5081  N N   . ASN C  1 48  ? 0.620   -40.271 53.769  1.00 36.33  ? 47   ASN C N   1 
ATOM   5082  C CA  . ASN C  1 48  ? 0.076   -39.812 52.502  1.00 35.13  ? 47   ASN C CA  1 
ATOM   5083  C C   . ASN C  1 48  ? 1.095   -38.994 51.709  1.00 39.41  ? 47   ASN C C   1 
ATOM   5084  O O   . ASN C  1 48  ? 0.760   -38.399 50.685  1.00 34.56  ? 47   ASN C O   1 
ATOM   5085  C CB  . ASN C  1 48  ? -1.183  -38.984 52.748  1.00 35.10  ? 47   ASN C CB  1 
ATOM   5086  C CG  . ASN C  1 48  ? -2.334  -39.822 53.280  1.00 53.92  ? 47   ASN C CG  1 
ATOM   5087  O OD1 . ASN C  1 48  ? -2.541  -40.950 52.845  1.00 47.50  ? 47   ASN C OD1 1 
ATOM   5088  N ND2 . ASN C  1 48  ? -3.080  -39.274 54.225  1.00 46.87  ? 47   ASN C ND2 1 
ATOM   5089  N N   . HIS C  1 49  ? 2.331   -38.955 52.199  1.00 29.96  ? 48   HIS C N   1 
ATOM   5090  C CA  . HIS C  1 49  ? 3.435   -38.284 51.500  1.00 33.91  ? 48   HIS C CA  1 
ATOM   5091  C C   . HIS C  1 49  ? 4.431   -39.348 51.032  1.00 34.21  ? 48   HIS C C   1 
ATOM   5092  O O   . HIS C  1 49  ? 4.649   -40.339 51.723  1.00 35.15  ? 48   HIS C O   1 
ATOM   5093  C CB  . HIS C  1 49  ? 4.128   -37.298 52.439  1.00 30.05  ? 48   HIS C CB  1 
ATOM   5094  C CG  . HIS C  1 49  ? 5.048   -36.339 51.750  1.00 36.36  ? 48   HIS C CG  1 
ATOM   5095  N ND1 . HIS C  1 49  ? 4.611   -35.429 50.815  1.00 36.59  ? 48   HIS C ND1 1 
ATOM   5096  C CD2 . HIS C  1 49  ? 6.378   -36.129 51.889  1.00 31.34  ? 48   HIS C CD2 1 
ATOM   5097  C CE1 . HIS C  1 49  ? 5.631   -34.698 50.402  1.00 30.61  ? 48   HIS C CE1 1 
ATOM   5098  N NE2 . HIS C  1 49  ? 6.713   -35.103 51.039  1.00 37.24  ? 48   HIS C NE2 1 
ATOM   5099  N N   . ASN C  1 50  ? 5.042   -39.150 49.870  1.00 30.55  ? 49   ASN C N   1 
ATOM   5100  C CA  . ASN C  1 50  ? 5.892   -40.187 49.281  1.00 30.68  ? 49   ASN C CA  1 
ATOM   5101  C C   . ASN C  1 50  ? 7.253   -40.349 49.956  1.00 34.27  ? 49   ASN C C   1 
ATOM   5102  O O   . ASN C  1 50  ? 8.000   -41.245 49.608  1.00 49.57  ? 49   ASN C O   1 
ATOM   5103  C CB  . ASN C  1 50  ? 6.096   -39.922 47.796  1.00 34.45  ? 49   ASN C CB  1 
ATOM   5104  C CG  . ASN C  1 50  ? 7.064   -38.769 47.534  1.00 42.96  ? 49   ASN C CG  1 
ATOM   5105  O OD1 . ASN C  1 50  ? 7.334   -37.951 48.415  1.00 36.09  ? 49   ASN C OD1 1 
ATOM   5106  N ND2 . ASN C  1 50  ? 7.586   -38.701 46.316  1.00 40.21  ? 49   ASN C ND2 1 
ATOM   5107  N N   . LYS C  1 51  ? 7.574   -39.499 50.925  1.00 34.01  ? 50   LYS C N   1 
ATOM   5108  C CA  . LYS C  1 51  ? 8.869   -39.576 51.609  1.00 38.12  ? 50   LYS C CA  1 
ATOM   5109  C C   . LYS C  1 51  ? 8.724   -39.305 53.099  1.00 34.72  ? 50   LYS C C   1 
ATOM   5110  O O   . LYS C  1 51  ? 7.785   -38.639 53.519  1.00 35.15  ? 50   LYS C O   1 
ATOM   5111  C CB  . LYS C  1 51  ? 9.829   -38.517 51.059  1.00 49.89  ? 50   LYS C CB  1 
ATOM   5112  C CG  . LYS C  1 51  ? 10.085  -38.570 49.564  1.00 50.37  ? 50   LYS C CG  1 
ATOM   5113  C CD  . LYS C  1 51  ? 11.252  -39.458 49.225  1.00 54.39  ? 50   LYS C CD  1 
ATOM   5114  C CE  . LYS C  1 51  ? 11.512  -39.476 47.724  1.00 45.58  ? 50   LYS C CE  1 
ATOM   5115  N NZ  . LYS C  1 51  ? 11.898  -38.144 47.223  1.00 50.62  ? 50   LYS C NZ  1 
ATOM   5116  N N   . LYS C  1 52  ? 9.670   -39.806 53.887  1.00 36.95  ? 51   LYS C N   1 
ATOM   5117  C CA  . LYS C  1 52  ? 9.858   -39.341 55.255  1.00 36.76  ? 51   LYS C CA  1 
ATOM   5118  C C   . LYS C  1 52  ? 10.525  -37.978 55.198  1.00 41.84  ? 51   LYS C C   1 
ATOM   5119  O O   . LYS C  1 52  ? 11.350  -37.731 54.322  1.00 35.79  ? 51   LYS C O   1 
ATOM   5120  C CB  . LYS C  1 52  ? 10.760  -40.293 56.044  1.00 45.04  ? 51   LYS C CB  1 
ATOM   5121  C CG  . LYS C  1 52  ? 10.157  -41.642 56.398  1.00 59.17  ? 51   LYS C CG  1 
ATOM   5122  C CD  . LYS C  1 52  ? 11.199  -42.506 57.112  1.00 72.57  ? 51   LYS C CD  1 
ATOM   5123  C CE  . LYS C  1 52  ? 10.669  -43.892 57.460  1.00 80.68  ? 51   LYS C CE  1 
ATOM   5124  N NZ  . LYS C  1 52  ? 11.722  -44.734 58.097  1.00 66.50  ? 51   LYS C NZ  1 
ATOM   5125  N N   . LEU C  1 53  ? 10.186  -37.105 56.140  1.00 34.92  ? 52   LEU C N   1 
ATOM   5126  C CA  . LEU C  1 53  ? 10.732  -35.759 56.176  1.00 29.90  ? 52   LEU C CA  1 
ATOM   5127  C C   . LEU C  1 53  ? 11.405  -35.487 57.508  1.00 41.95  ? 52   LEU C C   1 
ATOM   5128  O O   . LEU C  1 53  ? 10.946  -35.949 58.550  1.00 34.41  ? 52   LEU C O   1 
ATOM   5129  C CB  . LEU C  1 53  ? 9.620   -34.722 55.971  1.00 36.08  ? 52   LEU C CB  1 
ATOM   5130  C CG  . LEU C  1 53  ? 9.482   -34.138 54.565  1.00 57.48  ? 52   LEU C CG  1 
ATOM   5131  C CD1 . LEU C  1 53  ? 9.179   -35.228 53.562  1.00 66.17  ? 52   LEU C CD1 1 
ATOM   5132  C CD2 . LEU C  1 53  ? 8.402   -33.075 54.549  1.00 50.05  ? 52   LEU C CD2 1 
ATOM   5133  N N   . LEU C  1 54  ? 12.487  -34.717 57.463  1.00 33.70  ? 53   LEU C N   1 
ATOM   5134  C CA  . LEU C  1 54  ? 13.146  -34.216 58.656  1.00 31.93  ? 53   LEU C CA  1 
ATOM   5135  C C   . LEU C  1 54  ? 13.311  -32.715 58.491  1.00 36.81  ? 53   LEU C C   1 
ATOM   5136  O O   . LEU C  1 54  ? 13.890  -32.264 57.509  1.00 36.12  ? 53   LEU C O   1 
ATOM   5137  C CB  . LEU C  1 54  ? 14.515  -34.869 58.830  1.00 33.52  ? 53   LEU C CB  1 
ATOM   5138  C CG  . LEU C  1 54  ? 15.377  -34.302 59.962  1.00 36.68  ? 53   LEU C CG  1 
ATOM   5139  C CD1 . LEU C  1 54  ? 14.725  -34.535 61.306  1.00 31.03  ? 53   LEU C CD1 1 
ATOM   5140  C CD2 . LEU C  1 54  ? 16.762  -34.922 59.938  1.00 37.23  ? 53   LEU C CD2 1 
ATOM   5141  N N   . VAL C  1 55  ? 12.784  -31.935 59.429  1.00 37.23  ? 54   VAL C N   1 
ATOM   5142  C CA  . VAL C  1 55  ? 12.993  -30.494 59.406  1.00 28.91  ? 54   VAL C CA  1 
ATOM   5143  C C   . VAL C  1 55  ? 14.036  -30.140 60.449  1.00 30.07  ? 54   VAL C C   1 
ATOM   5144  O O   . VAL C  1 55  ? 13.862  -30.425 61.622  1.00 36.77  ? 54   VAL C O   1 
ATOM   5145  C CB  . VAL C  1 55  ? 11.702  -29.707 59.696  1.00 35.89  ? 54   VAL C CB  1 
ATOM   5146  C CG1 . VAL C  1 55  ? 11.954  -28.199 59.549  1.00 26.51  ? 54   VAL C CG1 1 
ATOM   5147  C CG2 . VAL C  1 55  ? 10.585  -30.150 58.764  1.00 32.02  ? 54   VAL C CG2 1 
ATOM   5148  N N   . ILE C  1 56  ? 15.131  -29.534 60.006  1.00 36.10  ? 55   ILE C N   1 
ATOM   5149  C CA  . ILE C  1 56  ? 16.205  -29.132 60.898  1.00 29.78  ? 55   ILE C CA  1 
ATOM   5150  C C   . ILE C  1 56  ? 16.275  -27.610 60.974  1.00 35.90  ? 55   ILE C C   1 
ATOM   5151  O O   . ILE C  1 56  ? 16.500  -26.932 59.972  1.00 30.15  ? 55   ILE C O   1 
ATOM   5152  C CB  . ILE C  1 56  ? 17.569  -29.654 60.407  1.00 34.24  ? 55   ILE C CB  1 
ATOM   5153  C CG1 . ILE C  1 56  ? 17.587  -31.186 60.408  1.00 36.49  ? 55   ILE C CG1 1 
ATOM   5154  C CG2 . ILE C  1 56  ? 18.688  -29.138 61.289  1.00 28.07  ? 55   ILE C CG2 1 
ATOM   5155  C CD1 . ILE C  1 56  ? 18.861  -31.760 59.815  1.00 46.62  ? 55   ILE C CD1 1 
ATOM   5156  N N   . ARG C  1 57  ? 16.097  -27.075 62.170  1.00 27.54  ? 56   ARG C N   1 
ATOM   5157  C CA  . ARG C  1 57  ? 16.232  -25.643 62.388  1.00 39.06  ? 56   ARG C CA  1 
ATOM   5158  C C   . ARG C  1 57  ? 17.540  -25.409 63.106  1.00 36.54  ? 56   ARG C C   1 
ATOM   5159  O O   . ARG C  1 57  ? 17.782  -25.960 64.174  1.00 36.53  ? 56   ARG C O   1 
ATOM   5160  C CB  . ARG C  1 57  ? 15.051  -25.083 63.194  1.00 34.83  ? 56   ARG C CB  1 
ATOM   5161  C CG  . ARG C  1 57  ? 13.738  -25.137 62.426  1.00 36.53  ? 56   ARG C CG  1 
ATOM   5162  C CD  . ARG C  1 57  ? 12.629  -24.365 63.110  1.00 63.61  ? 56   ARG C CD  1 
ATOM   5163  N NE  . ARG C  1 57  ? 11.478  -24.191 62.226  1.00 77.70  ? 56   ARG C NE  1 
ATOM   5164  C CZ  . ARG C  1 57  ? 10.504  -25.087 62.083  1.00 69.95  ? 56   ARG C CZ  1 
ATOM   5165  N NH1 . ARG C  1 57  ? 9.498   -24.848 61.252  1.00 74.89  ? 56   ARG C NH1 1 
ATOM   5166  N NH2 . ARG C  1 57  ? 10.534  -26.222 62.771  1.00 51.21  ? 56   ARG C NH2 1 
ATOM   5167  N N   . THR C  1 58  ? 18.406  -24.621 62.488  1.00 29.75  ? 57   THR C N   1 
ATOM   5168  C CA  . THR C  1 58  ? 19.679  -24.277 63.097  1.00 34.69  ? 57   THR C CA  1 
ATOM   5169  C C   . THR C  1 58  ? 19.516  -22.921 63.756  1.00 39.77  ? 57   THR C C   1 
ATOM   5170  O O   . THR C  1 58  ? 19.240  -21.933 63.080  1.00 34.99  ? 57   THR C O   1 
ATOM   5171  C CB  . THR C  1 58  ? 20.799  -24.220 62.043  1.00 36.90  ? 57   THR C CB  1 
ATOM   5172  O OG1 . THR C  1 58  ? 20.356  -23.439 60.927  1.00 38.65  ? 57   THR C OG1 1 
ATOM   5173  C CG2 . THR C  1 58  ? 21.149  -25.620 61.544  1.00 27.62  ? 57   THR C CG2 1 
ATOM   5174  N N   . LYS C  1 59  ? 19.667  -22.891 65.077  1.00 31.29  ? 58   LYS C N   1 
ATOM   5175  C CA  . LYS C  1 59  ? 19.498  -21.671 65.865  1.00 35.93  ? 58   LYS C CA  1 
ATOM   5176  C C   . LYS C  1 59  ? 20.737  -21.444 66.723  1.00 34.14  ? 58   LYS C C   1 
ATOM   5177  O O   . LYS C  1 59  ? 21.837  -21.807 66.328  1.00 40.57  ? 58   LYS C O   1 
ATOM   5178  C CB  . LYS C  1 59  ? 18.239  -21.771 66.737  1.00 29.05  ? 58   LYS C CB  1 
ATOM   5179  C CG  . LYS C  1 59  ? 17.005  -22.194 65.952  1.00 37.60  ? 58   LYS C CG  1 
ATOM   5180  C CD  . LYS C  1 59  ? 15.750  -22.219 66.806  1.00 47.97  ? 58   LYS C CD  1 
ATOM   5181  C CE  . LYS C  1 59  ? 15.258  -20.814 67.085  1.00 55.22  ? 58   LYS C CE  1 
ATOM   5182  N NZ  . LYS C  1 59  ? 13.978  -20.814 67.829  1.00 52.19  ? 58   LYS C NZ  1 
ATOM   5183  N N   . GLY C  1 60  ? 20.567  -20.843 67.894  1.00 34.95  ? 59   GLY C N   1 
ATOM   5184  C CA  . GLY C  1 60  ? 21.700  -20.515 68.741  1.00 36.77  ? 59   GLY C CA  1 
ATOM   5185  C C   . GLY C  1 60  ? 22.203  -19.113 68.460  1.00 35.66  ? 59   GLY C C   1 
ATOM   5186  O O   . GLY C  1 60  ? 21.471  -18.298 67.914  1.00 36.88  ? 59   GLY C O   1 
ATOM   5187  N N   . THR C  1 61  ? 23.443  -18.826 68.842  1.00 37.98  ? 60   THR C N   1 
ATOM   5188  C CA  . THR C  1 61  ? 24.020  -17.498 68.649  1.00 38.14  ? 60   THR C CA  1 
ATOM   5189  C C   . THR C  1 61  ? 25.526  -17.557 68.394  1.00 35.92  ? 60   THR C C   1 
ATOM   5190  O O   . THR C  1 61  ? 26.273  -18.157 69.164  1.00 35.46  ? 60   THR C O   1 
ATOM   5191  C CB  . THR C  1 61  ? 23.805  -16.589 69.885  1.00 41.59  ? 60   THR C CB  1 
ATOM   5192  O OG1 . THR C  1 61  ? 22.407  -16.448 70.154  1.00 37.25  ? 60   THR C OG1 1 
ATOM   5193  C CG2 . THR C  1 61  ? 24.424  -15.191 69.649  1.00 29.19  ? 60   THR C CG2 1 
ATOM   5194  N N   . ILE C  1 62  ? 25.957  -16.918 67.314  1.00 29.93  ? 61   ILE C N   1 
ATOM   5195  C CA  . ILE C  1 62  ? 27.375  -16.706 67.042  1.00 31.16  ? 61   ILE C CA  1 
ATOM   5196  C C   . ILE C  1 62  ? 27.777  -15.332 67.583  1.00 36.07  ? 61   ILE C C   1 
ATOM   5197  O O   . ILE C  1 62  ? 27.343  -14.299 67.059  1.00 29.06  ? 61   ILE C O   1 
ATOM   5198  C CB  . ILE C  1 62  ? 27.653  -16.765 65.531  1.00 28.87  ? 61   ILE C CB  1 
ATOM   5199  C CG1 . ILE C  1 62  ? 27.222  -18.129 64.972  1.00 26.88  ? 61   ILE C CG1 1 
ATOM   5200  C CG2 . ILE C  1 62  ? 29.126  -16.505 65.248  1.00 30.25  ? 61   ILE C CG2 1 
ATOM   5201  C CD1 . ILE C  1 62  ? 27.201  -18.179 63.460  1.00 33.85  ? 61   ILE C CD1 1 
ATOM   5202  N N   . ALA C  1 63  ? 28.571  -15.313 68.650  1.00 34.25  ? 62   ALA C N   1 
ATOM   5203  C CA  . ALA C  1 63  ? 29.022  -14.053 69.238  1.00 37.16  ? 62   ALA C CA  1 
ATOM   5204  C C   . ALA C  1 63  ? 29.724  -13.220 68.176  1.00 37.69  ? 62   ALA C C   1 
ATOM   5205  O O   . ALA C  1 63  ? 30.353  -13.764 67.270  1.00 40.26  ? 62   ALA C O   1 
ATOM   5206  C CB  . ALA C  1 63  ? 29.951  -14.314 70.409  1.00 37.87  ? 62   ALA C CB  1 
ATOM   5207  N N   . GLY C  1 64  ? 29.600  -11.904 68.274  1.00 42.61  ? 63   GLY C N   1 
ATOM   5208  C CA  . GLY C  1 64  ? 30.239  -11.003 67.329  1.00 32.83  ? 63   GLY C CA  1 
ATOM   5209  C C   . GLY C  1 64  ? 31.732  -10.881 67.565  1.00 41.60  ? 63   GLY C C   1 
ATOM   5210  O O   . GLY C  1 64  ? 32.537  -11.093 66.648  1.00 43.20  ? 63   GLY C O   1 
ATOM   5211  N N   . GLN C  1 65  ? 32.101  -10.538 68.796  1.00 35.37  ? 64   GLN C N   1 
ATOM   5212  C CA  . GLN C  1 65  ? 33.505  -10.496 69.211  1.00 60.08  ? 64   GLN C CA  1 
ATOM   5213  C C   . GLN C  1 65  ? 34.272  -9.321  68.590  1.00 52.25  ? 64   GLN C C   1 
ATOM   5214  O O   . GLN C  1 65  ? 35.435  -9.444  68.209  1.00 59.20  ? 64   GLN C O   1 
ATOM   5215  C CB  . GLN C  1 65  ? 34.188  -11.837 68.911  1.00 41.58  ? 64   GLN C CB  1 
ATOM   5216  C CG  . GLN C  1 65  ? 33.589  -12.982 69.726  1.00 50.03  ? 64   GLN C CG  1 
ATOM   5217  C CD  . GLN C  1 65  ? 34.393  -14.262 69.631  1.00 45.02  ? 64   GLN C CD  1 
ATOM   5218  O OE1 . GLN C  1 65  ? 35.163  -14.465 68.696  1.00 62.10  ? 64   GLN C OE1 1 
ATOM   5219  N NE2 . GLN C  1 65  ? 34.221  -15.131 70.613  1.00 53.39  ? 64   GLN C NE2 1 
ATOM   5220  N N   . TYR C  1 66  ? 33.579  -8.194  68.482  1.00 47.59  ? 65   TYR C N   1 
ATOM   5221  C CA  . TYR C  1 66  ? 34.157  -6.912  68.107  1.00 46.47  ? 65   TYR C CA  1 
ATOM   5222  C C   . TYR C  1 66  ? 35.110  -6.501  69.220  1.00 53.74  ? 65   TYR C C   1 
ATOM   5223  O O   . TYR C  1 66  ? 34.672  -6.282  70.351  1.00 45.49  ? 65   TYR C O   1 
ATOM   5224  C CB  . TYR C  1 66  ? 32.996  -5.924  68.000  1.00 48.39  ? 65   TYR C CB  1 
ATOM   5225  C CG  . TYR C  1 66  ? 33.305  -4.477  67.714  1.00 46.85  ? 65   TYR C CG  1 
ATOM   5226  C CD1 . TYR C  1 66  ? 33.250  -3.987  66.418  1.00 43.82  ? 65   TYR C CD1 1 
ATOM   5227  C CD2 . TYR C  1 66  ? 33.579  -3.583  68.740  1.00 41.02  ? 65   TYR C CD2 1 
ATOM   5228  C CE1 . TYR C  1 66  ? 33.493  -2.668  66.145  1.00 37.73  ? 65   TYR C CE1 1 
ATOM   5229  C CE2 . TYR C  1 66  ? 33.824  -2.241  68.472  1.00 36.58  ? 65   TYR C CE2 1 
ATOM   5230  C CZ  . TYR C  1 66  ? 33.777  -1.792  67.169  1.00 46.54  ? 65   TYR C CZ  1 
ATOM   5231  O OH  . TYR C  1 66  ? 34.015  -0.465  66.866  1.00 35.55  ? 65   TYR C OH  1 
ATOM   5232  N N   . ARG C  1 67  ? 36.407  -6.416  68.932  1.00 36.15  ? 66   ARG C N   1 
ATOM   5233  C CA  . ARG C  1 67  ? 37.370  -6.117  69.996  1.00 52.98  ? 66   ARG C CA  1 
ATOM   5234  C C   . ARG C  1 67  ? 38.717  -5.613  69.502  1.00 53.12  ? 66   ARG C C   1 
ATOM   5235  O O   . ARG C  1 67  ? 39.159  -5.938  68.401  1.00 53.65  ? 66   ARG C O   1 
ATOM   5236  C CB  . ARG C  1 67  ? 37.602  -7.356  70.869  1.00 46.65  ? 66   ARG C CB  1 
ATOM   5237  C CG  . ARG C  1 67  ? 38.209  -8.542  70.114  1.00 67.01  ? 66   ARG C CG  1 
ATOM   5238  C CD  . ARG C  1 67  ? 38.552  -9.701  71.048  1.00 81.31  ? 66   ARG C CD  1 
ATOM   5239  N NE  . ARG C  1 67  ? 39.757  -9.448  71.840  1.00 86.67  ? 66   ARG C NE  1 
ATOM   5240  C CZ  . ARG C  1 67  ? 40.957  -9.975  71.592  1.00 89.26  ? 66   ARG C CZ  1 
ATOM   5241  N NH1 . ARG C  1 67  ? 41.976  -9.672  72.386  1.00 75.84  ? 66   ARG C NH1 1 
ATOM   5242  N NH2 . ARG C  1 67  ? 41.147  -10.805 70.566  1.00 58.43  ? 66   ARG C NH2 1 
ATOM   5243  N N   . VAL C  1 68  ? 39.370  -4.822  70.343  1.00 45.73  ? 67   VAL C N   1 
ATOM   5244  C CA  . VAL C  1 68  ? 40.708  -4.344  70.061  1.00 50.58  ? 67   VAL C CA  1 
ATOM   5245  C C   . VAL C  1 68  ? 41.706  -5.468  70.329  1.00 60.40  ? 67   VAL C C   1 
ATOM   5246  O O   . VAL C  1 68  ? 41.964  -5.810  71.480  1.00 70.24  ? 67   VAL C O   1 
ATOM   5247  C CB  . VAL C  1 68  ? 41.048  -3.132  70.935  1.00 61.41  ? 67   VAL C CB  1 
ATOM   5248  C CG1 . VAL C  1 68  ? 42.417  -2.603  70.587  1.00 45.43  ? 67   VAL C CG1 1 
ATOM   5249  C CG2 . VAL C  1 68  ? 39.997  -2.041  70.766  1.00 49.00  ? 67   VAL C CG2 1 
ATOM   5250  N N   . TYR C  1 69  ? 42.264  -6.048  69.269  1.00 61.81  ? 68   TYR C N   1 
ATOM   5251  C CA  . TYR C  1 69  ? 43.125  -7.219  69.419  1.00 73.64  ? 68   TYR C CA  1 
ATOM   5252  C C   . TYR C  1 69  ? 44.600  -6.873  69.560  1.00 81.22  ? 68   TYR C C   1 
ATOM   5253  O O   . TYR C  1 69  ? 45.364  -7.655  70.123  1.00 68.57  ? 68   TYR C O   1 
ATOM   5254  C CB  . TYR C  1 69  ? 42.950  -8.183  68.246  1.00 62.48  ? 68   TYR C CB  1 
ATOM   5255  C CG  . TYR C  1 69  ? 43.551  -7.699  66.955  1.00 55.01  ? 68   TYR C CG  1 
ATOM   5256  C CD1 . TYR C  1 69  ? 44.851  -8.038  66.597  1.00 67.36  ? 68   TYR C CD1 1 
ATOM   5257  C CD2 . TYR C  1 69  ? 42.814  -6.911  66.080  1.00 59.91  ? 68   TYR C CD2 1 
ATOM   5258  C CE1 . TYR C  1 69  ? 45.405  -7.597  65.399  1.00 51.73  ? 68   TYR C CE1 1 
ATOM   5259  C CE2 . TYR C  1 69  ? 43.357  -6.464  64.885  1.00 56.85  ? 68   TYR C CE2 1 
ATOM   5260  C CZ  . TYR C  1 69  ? 44.652  -6.808  64.552  1.00 67.47  ? 68   TYR C CZ  1 
ATOM   5261  O OH  . TYR C  1 69  ? 45.188  -6.360  63.365  1.00 75.23  ? 68   TYR C OH  1 
ATOM   5262  N N   . SER C  1 70  ? 45.011  -5.720  69.044  1.00 56.93  ? 69   SER C N   1 
ATOM   5263  C CA  . SER C  1 70  ? 46.412  -5.338  69.145  1.00 63.21  ? 69   SER C CA  1 
ATOM   5264  C C   . SER C  1 70  ? 46.606  -3.839  69.133  1.00 62.44  ? 69   SER C C   1 
ATOM   5265  O O   . SER C  1 70  ? 45.809  -3.100  68.574  1.00 70.18  ? 69   SER C O   1 
ATOM   5266  C CB  . SER C  1 70  ? 47.229  -5.966  68.009  1.00 74.02  ? 69   SER C CB  1 
ATOM   5267  O OG  . SER C  1 70  ? 46.887  -5.415  66.746  1.00 57.61  ? 69   SER C OG  1 
ATOM   5268  N N   . GLU C  1 71  ? 47.672  -3.397  69.780  1.00 65.17  ? 70   GLU C N   1 
ATOM   5269  C CA  . GLU C  1 71  ? 48.129  -2.031  69.638  1.00 78.13  ? 70   GLU C CA  1 
ATOM   5270  C C   . GLU C  1 71  ? 49.632  -2.020  69.823  1.00 71.44  ? 70   GLU C C   1 
ATOM   5271  O O   . GLU C  1 71  ? 50.159  -2.540  70.805  1.00 79.03  ? 70   GLU C O   1 
ATOM   5272  C CB  . GLU C  1 71  ? 47.436  -1.087  70.626  1.00 71.91  ? 70   GLU C CB  1 
ATOM   5273  C CG  . GLU C  1 71  ? 47.725  -1.344  72.091  1.00 84.28  ? 70   GLU C CG  1 
ATOM   5274  C CD  . GLU C  1 71  ? 47.356  -0.151  72.965  1.00 100.33 ? 70   GLU C CD  1 
ATOM   5275  O OE1 . GLU C  1 71  ? 47.191  0.965   72.419  1.00 100.38 ? 70   GLU C OE1 1 
ATOM   5276  O OE2 . GLU C  1 71  ? 47.231  -0.327  74.196  1.00 79.97  ? 70   GLU C OE2 1 
ATOM   5277  N N   . GLU C  1 72  ? 50.316  -1.458  68.842  1.00 79.28  ? 71   GLU C N   1 
ATOM   5278  C CA  . GLU C  1 72  ? 51.756  -1.319  68.898  1.00 90.35  ? 71   GLU C CA  1 
ATOM   5279  C C   . GLU C  1 72  ? 52.064  0.171   68.945  1.00 72.31  ? 71   GLU C C   1 
ATOM   5280  O O   . GLU C  1 72  ? 52.162  0.834   67.916  1.00 79.59  ? 71   GLU C O   1 
ATOM   5281  C CB  . GLU C  1 72  ? 52.396  -2.005  67.687  1.00 100.11 ? 71   GLU C CB  1 
ATOM   5282  C CG  . GLU C  1 72  ? 52.300  -3.535  67.738  1.00 111.33 ? 71   GLU C CG  1 
ATOM   5283  C CD  . GLU C  1 72  ? 52.121  -4.175  66.369  1.00 109.59 ? 71   GLU C CD  1 
ATOM   5284  O OE1 . GLU C  1 72  ? 51.564  -3.511  65.469  1.00 110.78 ? 71   GLU C OE1 1 
ATOM   5285  O OE2 . GLU C  1 72  ? 52.533  -5.345  66.192  1.00 65.76  ? 71   GLU C OE2 1 
ATOM   5286  N N   . GLY C  1 73  ? 52.188  0.696   70.158  1.00 67.93  ? 72   GLY C N   1 
ATOM   5287  C CA  . GLY C  1 73  ? 52.382  2.118   70.348  1.00 83.69  ? 72   GLY C CA  1 
ATOM   5288  C C   . GLY C  1 73  ? 51.032  2.779   70.492  1.00 84.51  ? 72   GLY C C   1 
ATOM   5289  O O   . GLY C  1 73  ? 50.000  2.140   70.293  1.00 95.86  ? 72   GLY C O   1 
ATOM   5290  N N   . ALA C  1 74  ? 51.032  4.059   70.838  1.00 64.39  ? 73   ALA C N   1 
ATOM   5291  C CA  . ALA C  1 74  ? 49.785  4.783   71.029  1.00 52.75  ? 73   ALA C CA  1 
ATOM   5292  C C   . ALA C  1 74  ? 49.298  5.397   69.720  1.00 64.43  ? 73   ALA C C   1 
ATOM   5293  O O   . ALA C  1 74  ? 48.299  6.116   69.694  1.00 73.03  ? 73   ALA C O   1 
ATOM   5294  C CB  . ALA C  1 74  ? 49.960  5.859   72.089  1.00 76.47  ? 73   ALA C CB  1 
ATOM   5295  N N   . ASN C  1 75  ? 49.994  5.102   68.629  1.00 66.61  ? 74   ASN C N   1 
ATOM   5296  C CA  . ASN C  1 75  ? 49.649  5.692   67.347  1.00 71.94  ? 74   ASN C CA  1 
ATOM   5297  C C   . ASN C  1 75  ? 49.133  4.671   66.342  1.00 66.90  ? 74   ASN C C   1 
ATOM   5298  O O   . ASN C  1 75  ? 48.799  5.023   65.213  1.00 66.94  ? 74   ASN C O   1 
ATOM   5299  C CB  . ASN C  1 75  ? 50.856  6.436   66.772  1.00 83.36  ? 74   ASN C CB  1 
ATOM   5300  C CG  . ASN C  1 75  ? 51.363  7.523   67.703  1.00 91.65  ? 74   ASN C CG  1 
ATOM   5301  O OD1 . ASN C  1 75  ? 50.825  8.630   67.731  1.00 80.29  ? 74   ASN C OD1 1 
ATOM   5302  N ND2 . ASN C  1 75  ? 52.400  7.210   68.474  1.00 95.94  ? 74   ASN C ND2 1 
ATOM   5303  N N   . LYS C  1 76  ? 49.055  3.408   66.749  1.00 52.37  ? 75   LYS C N   1 
ATOM   5304  C CA  . LYS C  1 76  ? 48.576  2.365   65.848  1.00 52.18  ? 75   LYS C CA  1 
ATOM   5305  C C   . LYS C  1 76  ? 47.835  1.274   66.616  1.00 68.60  ? 75   LYS C C   1 
ATOM   5306  O O   . LYS C  1 76  ? 48.347  0.728   67.597  1.00 65.16  ? 75   LYS C O   1 
ATOM   5307  C CB  . LYS C  1 76  ? 49.743  1.775   65.047  1.00 61.67  ? 75   LYS C CB  1 
ATOM   5308  C CG  . LYS C  1 76  ? 49.485  0.378   64.474  1.00 80.29  ? 75   LYS C CG  1 
ATOM   5309  C CD  . LYS C  1 76  ? 50.651  -0.096  63.596  1.00 90.15  ? 75   LYS C CD  1 
ATOM   5310  C CE  . LYS C  1 76  ? 50.624  -1.607  63.333  1.00 82.84  ? 75   LYS C CE  1 
ATOM   5311  N NZ  . LYS C  1 76  ? 49.426  -2.081  62.577  1.00 69.23  ? 75   LYS C NZ  1 
ATOM   5312  N N   . SER C  1 77  ? 46.623  0.960   66.170  1.00 67.32  ? 76   SER C N   1 
ATOM   5313  C CA  . SER C  1 77  ? 45.823  -0.051  66.846  1.00 56.08  ? 76   SER C CA  1 
ATOM   5314  C C   . SER C  1 77  ? 44.940  -0.805  65.860  1.00 47.36  ? 76   SER C C   1 
ATOM   5315  O O   . SER C  1 77  ? 44.580  -0.277  64.808  1.00 53.98  ? 76   SER C O   1 
ATOM   5316  C CB  . SER C  1 77  ? 44.968  0.601   67.933  1.00 57.10  ? 76   SER C CB  1 
ATOM   5317  O OG  . SER C  1 77  ? 44.400  -0.377  68.783  1.00 66.21  ? 76   SER C OG  1 
ATOM   5318  N N   . GLY C  1 78  ? 44.605  -2.046  66.204  1.00 51.92  ? 77   GLY C N   1 
ATOM   5319  C CA  . GLY C  1 78  ? 43.800  -2.902  65.351  1.00 46.60  ? 77   GLY C CA  1 
ATOM   5320  C C   . GLY C  1 78  ? 42.527  -3.401  66.020  1.00 51.04  ? 77   GLY C C   1 
ATOM   5321  O O   . GLY C  1 78  ? 42.503  -3.671  67.219  1.00 46.23  ? 77   GLY C O   1 
ATOM   5322  N N   . LEU C  1 79  ? 41.472  -3.536  65.224  1.00 54.11  ? 78   LEU C N   1 
ATOM   5323  C CA  . LEU C  1 79  ? 40.160  -3.947  65.701  1.00 47.74  ? 78   LEU C CA  1 
ATOM   5324  C C   . LEU C  1 79  ? 39.669  -5.115  64.866  1.00 45.16  ? 78   LEU C C   1 
ATOM   5325  O O   . LEU C  1 79  ? 39.568  -5.008  63.649  1.00 50.02  ? 78   LEU C O   1 
ATOM   5326  C CB  . LEU C  1 79  ? 39.166  -2.793  65.566  1.00 48.55  ? 78   LEU C CB  1 
ATOM   5327  C CG  . LEU C  1 79  ? 37.693  -3.133  65.821  1.00 51.43  ? 78   LEU C CG  1 
ATOM   5328  C CD1 . LEU C  1 79  ? 37.438  -3.293  67.308  1.00 44.01  ? 78   LEU C CD1 1 
ATOM   5329  C CD2 . LEU C  1 79  ? 36.795  -2.043  65.258  1.00 57.83  ? 78   LEU C CD2 1 
ATOM   5330  N N   . ALA C  1 80  ? 39.367  -6.234  65.512  1.00 45.91  ? 79   ALA C N   1 
ATOM   5331  C CA  . ALA C  1 80  ? 38.790  -7.384  64.814  1.00 50.35  ? 79   ALA C CA  1 
ATOM   5332  C C   . ALA C  1 80  ? 37.269  -7.345  64.934  1.00 45.62  ? 79   ALA C C   1 
ATOM   5333  O O   . ALA C  1 80  ? 36.732  -7.189  66.026  1.00 48.74  ? 79   ALA C O   1 
ATOM   5334  C CB  . ALA C  1 80  ? 39.334  -8.684  65.384  1.00 41.41  ? 79   ALA C CB  1 
ATOM   5335  N N   . TRP C  1 81  ? 36.576  -7.476  63.810  1.00 40.52  ? 80   TRP C N   1 
ATOM   5336  C CA  . TRP C  1 81  ? 35.122  -7.379  63.815  1.00 45.61  ? 80   TRP C CA  1 
ATOM   5337  C C   . TRP C  1 81  ? 34.526  -8.339  62.800  1.00 42.02  ? 80   TRP C C   1 
ATOM   5338  O O   . TRP C  1 81  ? 35.163  -8.663  61.806  1.00 42.62  ? 80   TRP C O   1 
ATOM   5339  C CB  . TRP C  1 81  ? 34.673  -5.941  63.518  1.00 33.92  ? 80   TRP C CB  1 
ATOM   5340  C CG  . TRP C  1 81  ? 35.052  -5.460  62.145  1.00 34.32  ? 80   TRP C CG  1 
ATOM   5341  C CD1 . TRP C  1 81  ? 36.266  -4.972  61.753  1.00 44.05  ? 80   TRP C CD1 1 
ATOM   5342  C CD2 . TRP C  1 81  ? 34.207  -5.410  60.988  1.00 42.09  ? 80   TRP C CD2 1 
ATOM   5343  N NE1 . TRP C  1 81  ? 36.232  -4.621  60.417  1.00 42.12  ? 80   TRP C NE1 1 
ATOM   5344  C CE2 . TRP C  1 81  ? 34.981  -4.879  59.924  1.00 40.83  ? 80   TRP C CE2 1 
ATOM   5345  C CE3 . TRP C  1 81  ? 32.874  -5.753  60.746  1.00 29.96  ? 80   TRP C CE3 1 
ATOM   5346  C CZ2 . TRP C  1 81  ? 34.463  -4.691  58.642  1.00 31.78  ? 80   TRP C CZ2 1 
ATOM   5347  C CZ3 . TRP C  1 81  ? 32.359  -5.569  59.468  1.00 33.52  ? 80   TRP C CZ3 1 
ATOM   5348  C CH2 . TRP C  1 81  ? 33.152  -5.041  58.434  1.00 38.45  ? 80   TRP C CH2 1 
ATOM   5349  N N   . PRO C  1 82  ? 33.291  -8.795  63.051  1.00 42.93  ? 81   PRO C N   1 
ATOM   5350  C CA  . PRO C  1 82  ? 32.649  -9.818  62.216  1.00 30.61  ? 81   PRO C CA  1 
ATOM   5351  C C   . PRO C  1 82  ? 32.014  -9.243  60.960  1.00 33.99  ? 81   PRO C C   1 
ATOM   5352  O O   . PRO C  1 82  ? 31.049  -8.485  61.049  1.00 35.02  ? 81   PRO C O   1 
ATOM   5353  C CB  . PRO C  1 82  ? 31.570  -10.386 63.138  1.00 33.62  ? 81   PRO C CB  1 
ATOM   5354  C CG  . PRO C  1 82  ? 31.205  -9.231  64.040  1.00 33.91  ? 81   PRO C CG  1 
ATOM   5355  C CD  . PRO C  1 82  ? 32.473  -8.435  64.227  1.00 35.46  ? 81   PRO C CD  1 
ATOM   5356  N N   . SER C  1 83  ? 32.552  -9.607  59.801  1.00 33.58  ? 82   SER C N   1 
ATOM   5357  C CA  . SER C  1 83  ? 31.994  -9.164  58.528  1.00 34.96  ? 82   SER C CA  1 
ATOM   5358  C C   . SER C  1 83  ? 31.047  -10.192 57.917  1.00 31.24  ? 82   SER C C   1 
ATOM   5359  O O   . SER C  1 83  ? 30.369  -9.899  56.939  1.00 37.67  ? 82   SER C O   1 
ATOM   5360  C CB  . SER C  1 83  ? 33.123  -8.858  57.541  1.00 39.02  ? 82   SER C CB  1 
ATOM   5361  O OG  . SER C  1 83  ? 33.966  -9.991  57.379  1.00 45.63  ? 82   SER C OG  1 
ATOM   5362  N N   . ALA C  1 84  ? 31.003  -11.397 58.479  1.00 34.14  ? 83   ALA C N   1 
ATOM   5363  C CA  . ALA C  1 84  ? 30.075  -12.416 57.990  1.00 36.45  ? 83   ALA C CA  1 
ATOM   5364  C C   . ALA C  1 84  ? 29.836  -13.491 59.026  1.00 31.80  ? 83   ALA C C   1 
ATOM   5365  O O   . ALA C  1 84  ? 30.737  -13.852 59.773  1.00 39.14  ? 83   ALA C O   1 
ATOM   5366  C CB  . ALA C  1 84  ? 30.594  -13.048 56.696  1.00 35.96  ? 83   ALA C CB  1 
ATOM   5367  N N   . PHE C  1 85  ? 28.603  -13.985 59.068  1.00 36.24  ? 84   PHE C N   1 
ATOM   5368  C CA  . PHE C  1 85  ? 28.241  -15.146 59.867  1.00 32.13  ? 84   PHE C CA  1 
ATOM   5369  C C   . PHE C  1 85  ? 27.711  -16.162 58.884  1.00 35.91  ? 84   PHE C C   1 
ATOM   5370  O O   . PHE C  1 85  ? 27.026  -15.787 57.936  1.00 37.37  ? 84   PHE C O   1 
ATOM   5371  C CB  . PHE C  1 85  ? 27.132  -14.810 60.871  1.00 32.00  ? 84   PHE C CB  1 
ATOM   5372  C CG  . PHE C  1 85  ? 27.471  -13.699 61.804  1.00 29.09  ? 84   PHE C CG  1 
ATOM   5373  C CD1 . PHE C  1 85  ? 28.113  -13.952 63.002  1.00 26.40  ? 84   PHE C CD1 1 
ATOM   5374  C CD2 . PHE C  1 85  ? 27.139  -12.390 61.487  1.00 30.59  ? 84   PHE C CD2 1 
ATOM   5375  C CE1 . PHE C  1 85  ? 28.410  -12.912 63.876  1.00 32.54  ? 84   PHE C CE1 1 
ATOM   5376  C CE2 . PHE C  1 85  ? 27.441  -11.356 62.348  1.00 30.48  ? 84   PHE C CE2 1 
ATOM   5377  C CZ  . PHE C  1 85  ? 28.074  -11.620 63.545  1.00 27.17  ? 84   PHE C CZ  1 
ATOM   5378  N N   . LYS C  1 86  ? 28.014  -17.440 59.094  1.00 35.12  ? 85   LYS C N   1 
ATOM   5379  C CA  . LYS C  1 86  ? 27.588  -18.470 58.150  1.00 33.55  ? 85   LYS C CA  1 
ATOM   5380  C C   . LYS C  1 86  ? 27.087  -19.719 58.852  1.00 36.69  ? 85   LYS C C   1 
ATOM   5381  O O   . LYS C  1 86  ? 27.577  -20.102 59.917  1.00 33.85  ? 85   LYS C O   1 
ATOM   5382  C CB  . LYS C  1 86  ? 28.732  -18.846 57.206  1.00 40.34  ? 85   LYS C CB  1 
ATOM   5383  C CG  . LYS C  1 86  ? 29.219  -17.698 56.337  1.00 43.78  ? 85   LYS C CG  1 
ATOM   5384  C CD  . LYS C  1 86  ? 30.368  -18.142 55.441  1.00 48.42  ? 85   LYS C CD  1 
ATOM   5385  C CE  . LYS C  1 86  ? 30.910  -16.988 54.616  1.00 50.67  ? 85   LYS C CE  1 
ATOM   5386  N NZ  . LYS C  1 86  ? 32.064  -17.422 53.787  1.00 61.60  ? 85   LYS C NZ  1 
ATOM   5387  N N   . VAL C  1 87  ? 26.100  -20.354 58.241  1.00 30.91  ? 86   VAL C N   1 
ATOM   5388  C CA  . VAL C  1 87  ? 25.648  -21.657 58.691  1.00 30.38  ? 86   VAL C CA  1 
ATOM   5389  C C   . VAL C  1 87  ? 25.539  -22.555 57.476  1.00 37.30  ? 86   VAL C C   1 
ATOM   5390  O O   . VAL C  1 87  ? 25.007  -22.142 56.446  1.00 39.45  ? 86   VAL C O   1 
ATOM   5391  C CB  . VAL C  1 87  ? 24.284  -21.563 59.399  1.00 40.96  ? 86   VAL C CB  1 
ATOM   5392  C CG1 . VAL C  1 87  ? 23.750  -22.958 59.739  1.00 33.02  ? 86   VAL C CG1 1 
ATOM   5393  C CG2 . VAL C  1 87  ? 24.404  -20.710 60.652  1.00 31.38  ? 86   VAL C CG2 1 
ATOM   5394  N N   . GLN C  1 88  ? 26.049  -23.779 57.592  1.00 36.28  ? 87   GLN C N   1 
ATOM   5395  C CA  . GLN C  1 88  ? 26.034  -24.715 56.472  1.00 39.81  ? 87   GLN C CA  1 
ATOM   5396  C C   . GLN C  1 88  ? 25.704  -26.111 56.948  1.00 39.02  ? 87   GLN C C   1 
ATOM   5397  O O   . GLN C  1 88  ? 26.122  -26.537 58.028  1.00 38.68  ? 87   GLN C O   1 
ATOM   5398  C CB  . GLN C  1 88  ? 27.389  -24.714 55.755  1.00 39.02  ? 87   GLN C CB  1 
ATOM   5399  C CG  . GLN C  1 88  ? 27.820  -23.320 55.272  1.00 57.88  ? 87   GLN C CG  1 
ATOM   5400  C CD  . GLN C  1 88  ? 29.293  -23.249 54.889  1.00 71.66  ? 87   GLN C CD  1 
ATOM   5401  O OE1 . GLN C  1 88  ? 30.030  -24.228 55.019  1.00 68.44  ? 87   GLN C OE1 1 
ATOM   5402  N NE2 . GLN C  1 88  ? 29.727  -22.081 54.411  1.00 64.82  ? 87   GLN C NE2 1 
ATOM   5403  N N   . LEU C  1 89  ? 24.937  -26.829 56.146  1.00 31.09  ? 88   LEU C N   1 
ATOM   5404  C CA  . LEU C  1 89  ? 24.660  -28.223 56.435  1.00 32.13  ? 88   LEU C CA  1 
ATOM   5405  C C   . LEU C  1 89  ? 25.085  -29.043 55.236  1.00 39.17  ? 88   LEU C C   1 
ATOM   5406  O O   . LEU C  1 89  ? 24.967  -28.590 54.091  1.00 35.66  ? 88   LEU C O   1 
ATOM   5407  C CB  . LEU C  1 89  ? 23.178  -28.440 56.727  1.00 33.30  ? 88   LEU C CB  1 
ATOM   5408  C CG  . LEU C  1 89  ? 22.612  -27.755 57.975  1.00 43.22  ? 88   LEU C CG  1 
ATOM   5409  C CD1 . LEU C  1 89  ? 22.308  -26.294 57.674  1.00 35.13  ? 88   LEU C CD1 1 
ATOM   5410  C CD2 . LEU C  1 89  ? 21.354  -28.465 58.467  1.00 33.36  ? 88   LEU C CD2 1 
ATOM   5411  N N   . GLN C  1 90  ? 25.575  -30.251 55.492  1.00 38.58  ? 89   GLN C N   1 
ATOM   5412  C CA  . GLN C  1 90  ? 26.080  -31.094 54.419  1.00 42.39  ? 89   GLN C CA  1 
ATOM   5413  C C   . GLN C  1 90  ? 25.769  -32.562 54.672  1.00 40.94  ? 89   GLN C C   1 
ATOM   5414  O O   . GLN C  1 90  ? 26.067  -33.094 55.739  1.00 34.36  ? 89   GLN C O   1 
ATOM   5415  C CB  . GLN C  1 90  ? 27.584  -30.881 54.263  1.00 48.94  ? 89   GLN C CB  1 
ATOM   5416  C CG  . GLN C  1 90  ? 28.199  -31.608 53.081  1.00 66.29  ? 89   GLN C CG  1 
ATOM   5417  C CD  . GLN C  1 90  ? 29.585  -31.098 52.767  1.00 87.15  ? 89   GLN C CD  1 
ATOM   5418  O OE1 . GLN C  1 90  ? 30.147  -30.290 53.513  1.00 83.40  ? 89   GLN C OE1 1 
ATOM   5419  N NE2 . GLN C  1 90  ? 30.145  -31.560 51.655  1.00 84.94  ? 89   GLN C NE2 1 
ATOM   5420  N N   . LEU C  1 91  ? 25.143  -33.185 53.676  1.00 33.87  ? 90   LEU C N   1 
ATOM   5421  C CA  . LEU C  1 91  ? 24.852  -34.607 53.655  1.00 31.09  ? 90   LEU C CA  1 
ATOM   5422  C C   . LEU C  1 91  ? 25.942  -35.355 52.876  1.00 34.80  ? 90   LEU C C   1 
ATOM   5423  O O   . LEU C  1 91  ? 26.603  -34.776 52.022  1.00 42.82  ? 90   LEU C O   1 
ATOM   5424  C CB  . LEU C  1 91  ? 23.491  -34.842 52.980  1.00 27.02  ? 90   LEU C CB  1 
ATOM   5425  C CG  . LEU C  1 91  ? 22.252  -34.382 53.774  1.00 41.98  ? 90   LEU C CG  1 
ATOM   5426  C CD1 . LEU C  1 91  ? 20.999  -34.425 52.924  1.00 39.04  ? 90   LEU C CD1 1 
ATOM   5427  C CD2 . LEU C  1 91  ? 22.044  -35.223 55.031  1.00 33.17  ? 90   LEU C CD2 1 
ATOM   5428  N N   . PRO C  1 92  ? 26.130  -36.652 53.163  1.00 52.77  ? 91   PRO C N   1 
ATOM   5429  C CA  . PRO C  1 92  ? 27.069  -37.448 52.363  1.00 40.53  ? 91   PRO C CA  1 
ATOM   5430  C C   . PRO C  1 92  ? 26.534  -37.626 50.947  1.00 51.31  ? 91   PRO C C   1 
ATOM   5431  O O   . PRO C  1 92  ? 25.391  -38.056 50.783  1.00 45.60  ? 91   PRO C O   1 
ATOM   5432  C CB  . PRO C  1 92  ? 27.092  -38.804 53.078  1.00 47.73  ? 91   PRO C CB  1 
ATOM   5433  C CG  . PRO C  1 92  ? 26.456  -38.581 54.414  1.00 50.76  ? 91   PRO C CG  1 
ATOM   5434  C CD  . PRO C  1 92  ? 25.501  -37.443 54.233  1.00 47.96  ? 91   PRO C CD  1 
ATOM   5435  N N   . ASP C  1 93  ? 27.338  -37.306 49.941  1.00 49.58  ? 92   ASP C N   1 
ATOM   5436  C CA  . ASP C  1 93  ? 26.886  -37.420 48.554  1.00 70.18  ? 92   ASP C CA  1 
ATOM   5437  C C   . ASP C  1 93  ? 26.757  -38.878 48.098  1.00 57.94  ? 92   ASP C C   1 
ATOM   5438  O O   . ASP C  1 93  ? 26.141  -39.163 47.069  1.00 62.59  ? 92   ASP C O   1 
ATOM   5439  C CB  . ASP C  1 93  ? 27.793  -36.625 47.603  1.00 77.76  ? 92   ASP C CB  1 
ATOM   5440  C CG  . ASP C  1 93  ? 29.265  -36.915 47.810  1.00 88.53  ? 92   ASP C CG  1 
ATOM   5441  O OD1 . ASP C  1 93  ? 29.749  -36.811 48.958  1.00 86.54  ? 92   ASP C OD1 1 
ATOM   5442  O OD2 . ASP C  1 93  ? 29.945  -37.241 46.813  1.00 125.34 ? 92   ASP C OD2 1 
ATOM   5443  N N   . ASN C  1 94  ? 27.311  -39.800 48.877  1.00 52.77  ? 93   ASN C N   1 
ATOM   5444  C CA  . ASN C  1 94  ? 27.214  -41.224 48.560  1.00 81.27  ? 93   ASN C CA  1 
ATOM   5445  C C   . ASN C  1 94  ? 25.903  -41.849 49.045  1.00 80.63  ? 93   ASN C C   1 
ATOM   5446  O O   . ASN C  1 94  ? 25.686  -43.044 48.887  1.00 71.07  ? 93   ASN C O   1 
ATOM   5447  C CB  . ASN C  1 94  ? 28.404  -41.986 49.157  1.00 83.40  ? 93   ASN C CB  1 
ATOM   5448  C CG  . ASN C  1 94  ? 28.616  -41.681 50.637  1.00 102.73 ? 93   ASN C CG  1 
ATOM   5449  O OD1 . ASN C  1 94  ? 29.191  -40.648 50.991  1.00 99.73  ? 93   ASN C OD1 1 
ATOM   5450  N ND2 . ASN C  1 94  ? 28.159  -42.581 51.506  1.00 85.47  ? 93   ASN C ND2 1 
ATOM   5451  N N   . GLU C  1 95  ? 25.020  -41.040 49.619  1.00 69.35  ? 94   GLU C N   1 
ATOM   5452  C CA  . GLU C  1 95  ? 23.797  -41.573 50.205  1.00 70.63  ? 94   GLU C CA  1 
ATOM   5453  C C   . GLU C  1 95  ? 22.539  -40.865 49.696  1.00 53.77  ? 94   GLU C C   1 
ATOM   5454  O O   . GLU C  1 95  ? 22.621  -39.882 48.963  1.00 50.32  ? 94   GLU C O   1 
ATOM   5455  C CB  . GLU C  1 95  ? 23.905  -41.544 51.728  1.00 66.20  ? 94   GLU C CB  1 
ATOM   5456  C CG  . GLU C  1 95  ? 25.102  -42.362 52.213  1.00 60.19  ? 94   GLU C CG  1 
ATOM   5457  C CD  . GLU C  1 95  ? 25.309  -42.313 53.718  1.00 92.45  ? 94   GLU C CD  1 
ATOM   5458  O OE1 . GLU C  1 95  ? 24.356  -41.969 54.451  1.00 85.47  ? 94   GLU C OE1 1 
ATOM   5459  O OE2 . GLU C  1 95  ? 26.435  -42.621 54.166  1.00 99.36  ? 94   GLU C OE2 1 
ATOM   5460  N N   . VAL C  1 96  ? 21.378  -41.381 50.083  1.00 47.76  ? 95   VAL C N   1 
ATOM   5461  C CA  . VAL C  1 96  ? 20.150  -41.111 49.344  1.00 50.56  ? 95   VAL C CA  1 
ATOM   5462  C C   . VAL C  1 96  ? 19.273  -40.035 49.988  1.00 42.70  ? 95   VAL C C   1 
ATOM   5463  O O   . VAL C  1 96  ? 18.334  -39.553 49.361  1.00 38.37  ? 95   VAL C O   1 
ATOM   5464  C CB  . VAL C  1 96  ? 19.327  -42.423 49.137  1.00 65.74  ? 95   VAL C CB  1 
ATOM   5465  C CG1 . VAL C  1 96  ? 18.893  -42.998 50.468  1.00 55.37  ? 95   VAL C CG1 1 
ATOM   5466  C CG2 . VAL C  1 96  ? 18.115  -42.179 48.240  1.00 80.32  ? 95   VAL C CG2 1 
ATOM   5467  N N   . ALA C  1 97  ? 19.565  -39.661 51.232  1.00 32.15  ? 96   ALA C N   1 
ATOM   5468  C CA  . ALA C  1 97  ? 18.876  -38.519 51.831  1.00 42.55  ? 96   ALA C CA  1 
ATOM   5469  C C   . ALA C  1 97  ? 19.189  -37.280 50.995  1.00 43.54  ? 96   ALA C C   1 
ATOM   5470  O O   . ALA C  1 97  ? 20.329  -37.070 50.575  1.00 38.29  ? 96   ALA C O   1 
ATOM   5471  C CB  . ALA C  1 97  ? 19.308  -38.313 53.277  1.00 34.90  ? 96   ALA C CB  1 
ATOM   5472  N N   . GLN C  1 98  ? 18.167  -36.472 50.745  1.00 37.96  ? 97   GLN C N   1 
ATOM   5473  C CA  . GLN C  1 98  ? 18.325  -35.258 49.951  1.00 37.80  ? 97   GLN C CA  1 
ATOM   5474  C C   . GLN C  1 98  ? 17.805  -34.023 50.665  1.00 42.64  ? 97   GLN C C   1 
ATOM   5475  O O   . GLN C  1 98  ? 16.834  -34.090 51.428  1.00 36.70  ? 97   GLN C O   1 
ATOM   5476  C CB  . GLN C  1 98  ? 17.572  -35.395 48.635  1.00 38.45  ? 97   GLN C CB  1 
ATOM   5477  C CG  . GLN C  1 98  ? 18.137  -36.453 47.708  1.00 41.52  ? 97   GLN C CG  1 
ATOM   5478  C CD  . GLN C  1 98  ? 17.325  -36.567 46.450  1.00 37.28  ? 97   GLN C CD  1 
ATOM   5479  O OE1 . GLN C  1 98  ? 16.185  -37.023 46.478  1.00 36.38  ? 97   GLN C OE1 1 
ATOM   5480  N NE2 . GLN C  1 98  ? 17.892  -36.130 45.337  1.00 38.93  ? 97   GLN C NE2 1 
ATOM   5481  N N   . ILE C  1 99  ? 18.460  -32.895 50.408  1.00 33.78  ? 98   ILE C N   1 
ATOM   5482  C CA  . ILE C  1 99  ? 17.933  -31.591 50.787  1.00 27.97  ? 98   ILE C CA  1 
ATOM   5483  C C   . ILE C  1 99  ? 16.811  -31.242 49.831  1.00 29.89  ? 98   ILE C C   1 
ATOM   5484  O O   . ILE C  1 99  ? 16.991  -31.249 48.628  1.00 36.71  ? 98   ILE C O   1 
ATOM   5485  C CB  . ILE C  1 99  ? 19.026  -30.525 50.760  1.00 39.12  ? 98   ILE C CB  1 
ATOM   5486  C CG1 . ILE C  1 99  ? 19.993  -30.775 51.922  1.00 33.42  ? 98   ILE C CG1 1 
ATOM   5487  C CG2 . ILE C  1 99  ? 18.412  -29.132 50.864  1.00 34.73  ? 98   ILE C CG2 1 
ATOM   5488  C CD1 . ILE C  1 99  ? 21.199  -29.895 51.920  1.00 43.28  ? 98   ILE C CD1 1 
ATOM   5489  N N   . SER C  1 100 ? 15.648  -30.938 50.384  1.00 36.58  ? 99   SER C N   1 
ATOM   5490  C CA  . SER C  1 100 ? 14.420  -30.798 49.609  1.00 36.46  ? 99   SER C CA  1 
ATOM   5491  C C   . SER C  1 100 ? 13.927  -29.351 49.623  1.00 35.52  ? 99   SER C C   1 
ATOM   5492  O O   . SER C  1 100 ? 13.356  -28.869 48.651  1.00 43.45  ? 99   SER C O   1 
ATOM   5493  C CB  . SER C  1 100 ? 13.339  -31.708 50.210  1.00 32.97  ? 99   SER C CB  1 
ATOM   5494  O OG  . SER C  1 100 ? 12.057  -31.377 49.716  1.00 58.32  ? 99   SER C OG  1 
ATOM   5495  N N   . ASP C  1 101 ? 14.121  -28.671 50.747  1.00 33.76  ? 100  ASP C N   1 
ATOM   5496  C CA  . ASP C  1 101 ? 13.699  -27.279 50.879  1.00 35.31  ? 100  ASP C CA  1 
ATOM   5497  C C   . ASP C  1 101 ? 14.495  -26.568 51.975  1.00 29.08  ? 100  ASP C C   1 
ATOM   5498  O O   . ASP C  1 101 ? 15.264  -27.180 52.714  1.00 39.38  ? 100  ASP C O   1 
ATOM   5499  C CB  . ASP C  1 101 ? 12.199  -27.188 51.175  1.00 31.19  ? 100  ASP C CB  1 
ATOM   5500  C CG  . ASP C  1 101 ? 11.550  -25.933 50.584  1.00 55.93  ? 100  ASP C CG  1 
ATOM   5501  O OD1 . ASP C  1 101 ? 10.302  -25.862 50.589  1.00 49.36  ? 100  ASP C OD1 1 
ATOM   5502  O OD2 . ASP C  1 101 ? 12.272  -25.025 50.102  1.00 48.41  ? 100  ASP C OD2 1 
ATOM   5503  N N   . TYR C  1 102 ? 14.310  -25.264 52.067  1.00 30.26  ? 101  TYR C N   1 
ATOM   5504  C CA  . TYR C  1 102 ? 15.105  -24.435 52.955  1.00 31.39  ? 101  TYR C CA  1 
ATOM   5505  C C   . TYR C  1 102 ? 14.420  -23.085 53.055  1.00 31.54  ? 101  TYR C C   1 
ATOM   5506  O O   . TYR C  1 102 ? 13.733  -22.655 52.126  1.00 32.53  ? 101  TYR C O   1 
ATOM   5507  C CB  . TYR C  1 102 ? 16.518  -24.269 52.397  1.00 27.40  ? 101  TYR C CB  1 
ATOM   5508  C CG  . TYR C  1 102 ? 16.556  -24.438 50.900  1.00 36.01  ? 101  TYR C CG  1 
ATOM   5509  C CD1 . TYR C  1 102 ? 17.029  -25.612 50.336  1.00 29.46  ? 101  TYR C CD1 1 
ATOM   5510  C CD2 . TYR C  1 102 ? 16.088  -23.441 50.047  1.00 35.53  ? 101  TYR C CD2 1 
ATOM   5511  C CE1 . TYR C  1 102 ? 17.054  -25.787 48.970  1.00 39.91  ? 101  TYR C CE1 1 
ATOM   5512  C CE2 . TYR C  1 102 ? 16.116  -23.611 48.663  1.00 35.62  ? 101  TYR C CE2 1 
ATOM   5513  C CZ  . TYR C  1 102 ? 16.602  -24.791 48.136  1.00 35.27  ? 101  TYR C CZ  1 
ATOM   5514  O OH  . TYR C  1 102 ? 16.628  -24.998 46.777  1.00 36.72  ? 101  TYR C OH  1 
ATOM   5515  N N   . TYR C  1 103 ? 14.606  -22.421 54.185  1.00 33.06  ? 102  TYR C N   1 
ATOM   5516  C CA  . TYR C  1 103 ? 14.019  -21.110 54.402  1.00 31.64  ? 102  TYR C CA  1 
ATOM   5517  C C   . TYR C  1 103 ? 14.872  -20.380 55.432  1.00 28.55  ? 102  TYR C C   1 
ATOM   5518  O O   . TYR C  1 103 ? 15.334  -20.994 56.389  1.00 35.45  ? 102  TYR C O   1 
ATOM   5519  C CB  . TYR C  1 103 ? 12.568  -21.260 54.884  1.00 29.77  ? 102  TYR C CB  1 
ATOM   5520  C CG  . TYR C  1 103 ? 11.823  -19.951 54.871  1.00 37.26  ? 102  TYR C CG  1 
ATOM   5521  C CD1 . TYR C  1 103 ? 11.259  -19.465 53.698  1.00 44.83  ? 102  TYR C CD1 1 
ATOM   5522  C CD2 . TYR C  1 103 ? 11.711  -19.180 56.022  1.00 44.67  ? 102  TYR C CD2 1 
ATOM   5523  C CE1 . TYR C  1 103 ? 10.597  -18.251 53.668  1.00 42.38  ? 102  TYR C CE1 1 
ATOM   5524  C CE2 . TYR C  1 103 ? 11.048  -17.961 56.005  1.00 46.26  ? 102  TYR C CE2 1 
ATOM   5525  C CZ  . TYR C  1 103 ? 10.493  -17.502 54.825  1.00 54.53  ? 102  TYR C CZ  1 
ATOM   5526  O OH  . TYR C  1 103 ? 9.830   -16.293 54.803  1.00 66.44  ? 102  TYR C OH  1 
ATOM   5527  N N   . PRO C  1 104 ? 15.105  -19.069 55.243  1.00 30.66  ? 103  PRO C N   1 
ATOM   5528  C CA  . PRO C  1 104 ? 14.614  -18.189 54.179  1.00 31.41  ? 103  PRO C CA  1 
ATOM   5529  C C   . PRO C  1 104 ? 15.389  -18.332 52.876  1.00 35.59  ? 103  PRO C C   1 
ATOM   5530  O O   . PRO C  1 104 ? 16.417  -19.009 52.834  1.00 31.97  ? 103  PRO C O   1 
ATOM   5531  C CB  . PRO C  1 104 ? 14.862  -16.791 54.752  1.00 31.37  ? 103  PRO C CB  1 
ATOM   5532  C CG  . PRO C  1 104 ? 16.085  -16.949 55.578  1.00 30.55  ? 103  PRO C CG  1 
ATOM   5533  C CD  . PRO C  1 104 ? 15.985  -18.346 56.180  1.00 29.24  ? 103  PRO C CD  1 
ATOM   5534  N N   . ARG C  1 105 ? 14.898  -17.659 51.840  1.00 33.89  ? 104  ARG C N   1 
ATOM   5535  C CA  . ARG C  1 105 ? 15.520  -17.656 50.518  1.00 43.18  ? 104  ARG C CA  1 
ATOM   5536  C C   . ARG C  1 105 ? 15.840  -16.218 50.113  1.00 38.48  ? 104  ARG C C   1 
ATOM   5537  O O   . ARG C  1 105 ? 15.616  -15.293 50.882  1.00 43.08  ? 104  ARG C O   1 
ATOM   5538  C CB  . ARG C  1 105 ? 14.574  -18.310 49.516  1.00 35.87  ? 104  ARG C CB  1 
ATOM   5539  C CG  . ARG C  1 105 ? 13.929  -19.572 50.091  1.00 45.67  ? 104  ARG C CG  1 
ATOM   5540  C CD  . ARG C  1 105 ? 13.004  -20.246 49.123  1.00 42.25  ? 104  ARG C CD  1 
ATOM   5541  N NE  . ARG C  1 105 ? 12.349  -21.393 49.745  1.00 53.78  ? 104  ARG C NE  1 
ATOM   5542  C CZ  . ARG C  1 105 ? 11.118  -21.379 50.239  1.00 49.51  ? 104  ARG C CZ  1 
ATOM   5543  N NH1 . ARG C  1 105 ? 10.617  -22.470 50.800  1.00 39.51  ? 104  ARG C NH1 1 
ATOM   5544  N NH2 . ARG C  1 105 ? 10.389  -20.275 50.184  1.00 35.08  ? 104  ARG C NH2 1 
ATOM   5545  N N   . ASN C  1 106 ? 16.370  -16.024 48.915  1.00 38.87  ? 105  ASN C N   1 
ATOM   5546  C CA  . ASN C  1 106 ? 16.726  -14.683 48.464  1.00 37.59  ? 105  ASN C CA  1 
ATOM   5547  C C   . ASN C  1 106 ? 15.519  -13.956 47.914  1.00 33.06  ? 105  ASN C C   1 
ATOM   5548  O O   . ASN C  1 106 ? 14.836  -14.442 47.024  1.00 49.19  ? 105  ASN C O   1 
ATOM   5549  C CB  . ASN C  1 106 ? 17.834  -14.749 47.418  1.00 28.23  ? 105  ASN C CB  1 
ATOM   5550  C CG  . ASN C  1 106 ? 19.098  -15.341 47.973  1.00 43.38  ? 105  ASN C CG  1 
ATOM   5551  O OD1 . ASN C  1 106 ? 19.445  -15.091 49.136  1.00 38.00  ? 105  ASN C OD1 1 
ATOM   5552  N ND2 . ASN C  1 106 ? 19.799  -16.139 47.159  1.00 39.61  ? 105  ASN C ND2 1 
ATOM   5553  N N   . SER C  1 107 ? 15.245  -12.784 48.457  1.00 37.84  ? 106  SER C N   1 
ATOM   5554  C CA  . SER C  1 107 ? 14.097  -12.022 48.017  1.00 42.33  ? 106  SER C CA  1 
ATOM   5555  C C   . SER C  1 107 ? 14.556  -10.984 47.011  1.00 43.28  ? 106  SER C C   1 
ATOM   5556  O O   . SER C  1 107 ? 15.717  -10.573 47.018  1.00 41.44  ? 106  SER C O   1 
ATOM   5557  C CB  . SER C  1 107 ? 13.410  -11.355 49.213  1.00 53.58  ? 106  SER C CB  1 
ATOM   5558  O OG  . SER C  1 107 ? 14.338  -10.579 49.952  1.00 76.99  ? 106  SER C OG  1 
ATOM   5559  N N   . ILE C  1 108 ? 13.644  -10.588 46.132  1.00 42.16  ? 107  ILE C N   1 
ATOM   5560  C CA  . ILE C  1 108 ? 13.914  -9.561  45.142  1.00 34.20  ? 107  ILE C CA  1 
ATOM   5561  C C   . ILE C  1 108 ? 13.807  -8.197  45.811  1.00 42.93  ? 107  ILE C C   1 
ATOM   5562  O O   . ILE C  1 108 ? 12.792  -7.875  46.437  1.00 45.13  ? 107  ILE C O   1 
ATOM   5563  C CB  . ILE C  1 108 ? 12.909  -9.662  43.987  1.00 37.05  ? 107  ILE C CB  1 
ATOM   5564  C CG1 . ILE C  1 108 ? 13.058  -11.021 43.294  1.00 42.90  ? 107  ILE C CG1 1 
ATOM   5565  C CG2 . ILE C  1 108 ? 13.101  -8.522  43.001  1.00 32.54  ? 107  ILE C CG2 1 
ATOM   5566  C CD1 . ILE C  1 108 ? 12.021  -11.282 42.224  1.00 44.62  ? 107  ILE C CD1 1 
ATOM   5567  N N   . ASP C  1 109 ? 14.863  -7.403  45.692  1.00 43.68  ? 108  ASP C N   1 
ATOM   5568  C CA  . ASP C  1 109 ? 14.897  -6.067  46.285  1.00 50.26  ? 108  ASP C CA  1 
ATOM   5569  C C   . ASP C  1 109 ? 14.203  -5.043  45.391  1.00 46.45  ? 108  ASP C C   1 
ATOM   5570  O O   . ASP C  1 109 ? 14.063  -5.246  44.187  1.00 43.75  ? 108  ASP C O   1 
ATOM   5571  C CB  . ASP C  1 109 ? 16.342  -5.635  46.521  1.00 55.76  ? 108  ASP C CB  1 
ATOM   5572  C CG  . ASP C  1 109 ? 16.520  -4.887  47.820  1.00 89.68  ? 108  ASP C CG  1 
ATOM   5573  O OD1 . ASP C  1 109 ? 15.529  -4.313  48.326  1.00 81.76  ? 108  ASP C OD1 1 
ATOM   5574  O OD2 . ASP C  1 109 ? 17.657  -4.875  48.340  1.00 113.32 ? 108  ASP C OD2 1 
ATOM   5575  N N   . THR C  1 110 ? 13.769  -3.940  45.984  1.00 37.11  ? 109  THR C N   1 
ATOM   5576  C CA  . THR C  1 110 ? 13.074  -2.900  45.232  1.00 44.73  ? 109  THR C CA  1 
ATOM   5577  C C   . THR C  1 110 ? 13.606  -1.516  45.585  1.00 47.49  ? 109  THR C C   1 
ATOM   5578  O O   . THR C  1 110 ? 14.351  -1.343  46.548  1.00 43.93  ? 109  THR C O   1 
ATOM   5579  C CB  . THR C  1 110 ? 11.553  -2.911  45.503  1.00 53.27  ? 109  THR C CB  1 
ATOM   5580  O OG1 . THR C  1 110 ? 11.305  -2.546  46.867  1.00 49.61  ? 109  THR C OG1 1 
ATOM   5581  C CG2 . THR C  1 110 ? 10.961  -4.292  45.234  1.00 53.01  ? 109  THR C CG2 1 
ATOM   5582  N N   . LYS C  1 111 ? 13.205  -0.532  44.795  1.00 41.64  ? 110  LYS C N   1 
ATOM   5583  C CA  . LYS C  1 111 ? 13.590  0.849   45.023  1.00 44.32  ? 110  LYS C CA  1 
ATOM   5584  C C   . LYS C  1 111 ? 12.490  1.730   44.474  1.00 47.30  ? 110  LYS C C   1 
ATOM   5585  O O   . LYS C  1 111 ? 11.704  1.299   43.627  1.00 42.39  ? 110  LYS C O   1 
ATOM   5586  C CB  . LYS C  1 111 ? 14.918  1.175   44.330  1.00 43.43  ? 110  LYS C CB  1 
ATOM   5587  C CG  . LYS C  1 111 ? 14.940  0.850   42.847  1.00 44.01  ? 110  LYS C CG  1 
ATOM   5588  C CD  . LYS C  1 111 ? 16.287  0.281   42.446  1.00 63.08  ? 110  LYS C CD  1 
ATOM   5589  C CE  . LYS C  1 111 ? 16.230  -0.417  41.098  1.00 64.12  ? 110  LYS C CE  1 
ATOM   5590  N NZ  . LYS C  1 111 ? 15.356  -1.626  41.119  1.00 55.19  ? 110  LYS C NZ  1 
ATOM   5591  N N   . GLU C  1 112 ? 12.437  2.959   44.972  1.00 39.30  ? 111  GLU C N   1 
ATOM   5592  C CA  . GLU C  1 112 ? 11.442  3.929   44.566  1.00 48.48  ? 111  GLU C CA  1 
ATOM   5593  C C   . GLU C  1 112 ? 12.112  5.001   43.715  1.00 50.38  ? 111  GLU C C   1 
ATOM   5594  O O   . GLU C  1 112 ? 13.167  5.521   44.072  1.00 49.55  ? 111  GLU C O   1 
ATOM   5595  C CB  . GLU C  1 112 ? 10.808  4.561   45.806  1.00 51.21  ? 111  GLU C CB  1 
ATOM   5596  C CG  . GLU C  1 112 ? 9.686   5.544   45.519  1.00 64.60  ? 111  GLU C CG  1 
ATOM   5597  C CD  . GLU C  1 112 ? 9.013   6.043   46.794  1.00 88.77  ? 111  GLU C CD  1 
ATOM   5598  O OE1 . GLU C  1 112 ? 9.035   7.268   47.041  1.00 98.92  ? 111  GLU C OE1 1 
ATOM   5599  O OE2 . GLU C  1 112 ? 8.462   5.210   47.548  1.00 91.28  ? 111  GLU C OE2 1 
ATOM   5600  N N   . TYR C  1 113 ? 11.494  5.323   42.585  1.00 49.46  ? 112  TYR C N   1 
ATOM   5601  C CA  . TYR C  1 113 ? 12.023  6.334   41.682  1.00 49.66  ? 112  TYR C CA  1 
ATOM   5602  C C   . TYR C  1 113 ? 11.020  7.464   41.523  1.00 48.07  ? 112  TYR C C   1 
ATOM   5603  O O   . TYR C  1 113 ? 9.816   7.224   41.416  1.00 48.37  ? 112  TYR C O   1 
ATOM   5604  C CB  . TYR C  1 113 ? 12.341  5.716   40.318  1.00 47.96  ? 112  TYR C CB  1 
ATOM   5605  C CG  . TYR C  1 113 ? 13.308  6.542   39.508  1.00 63.33  ? 112  TYR C CG  1 
ATOM   5606  C CD1 . TYR C  1 113 ? 14.671  6.508   39.779  1.00 73.46  ? 112  TYR C CD1 1 
ATOM   5607  C CD2 . TYR C  1 113 ? 12.864  7.369   38.482  1.00 67.54  ? 112  TYR C CD2 1 
ATOM   5608  C CE1 . TYR C  1 113 ? 15.570  7.268   39.047  1.00 77.97  ? 112  TYR C CE1 1 
ATOM   5609  C CE2 . TYR C  1 113 ? 13.753  8.136   37.744  1.00 64.99  ? 112  TYR C CE2 1 
ATOM   5610  C CZ  . TYR C  1 113 ? 15.107  8.078   38.032  1.00 83.07  ? 112  TYR C CZ  1 
ATOM   5611  O OH  . TYR C  1 113 ? 16.008  8.826   37.306  1.00 96.70  ? 112  TYR C OH  1 
ATOM   5612  N N   . MET C  1 114 ? 11.520  8.696   41.531  1.00 41.67  ? 113  MET C N   1 
ATOM   5613  C CA  . MET C  1 114 ? 10.685  9.878   41.317  1.00 46.03  ? 113  MET C CA  1 
ATOM   5614  C C   . MET C  1 114 ? 11.308  10.792  40.273  1.00 47.38  ? 113  MET C C   1 
ATOM   5615  O O   . MET C  1 114 ? 12.509  11.057  40.319  1.00 51.18  ? 113  MET C O   1 
ATOM   5616  C CB  . MET C  1 114 ? 10.552  10.676  42.605  1.00 48.36  ? 113  MET C CB  1 
ATOM   5617  C CG  . MET C  1 114 ? 9.894   9.935   43.736  1.00 71.98  ? 113  MET C CG  1 
ATOM   5618  S SD  . MET C  1 114 ? 9.790   10.976  45.197  1.00 105.65 ? 113  MET C SD  1 
ATOM   5619  C CE  . MET C  1 114 ? 8.802   12.333  44.566  1.00 68.98  ? 113  MET C CE  1 
ATOM   5620  N N   . SER C  1 115 ? 10.494  11.276  39.339  1.00 50.25  ? 114  SER C N   1 
ATOM   5621  C CA  . SER C  1 115 ? 10.931  12.292  38.373  1.00 55.02  ? 114  SER C CA  1 
ATOM   5622  C C   . SER C  1 115 ? 10.078  13.543  38.541  1.00 49.67  ? 114  SER C C   1 
ATOM   5623  O O   . SER C  1 115 ? 8.873   13.454  38.789  1.00 48.32  ? 114  SER C O   1 
ATOM   5624  C CB  . SER C  1 115 ? 10.815  11.776  36.938  1.00 45.62  ? 114  SER C CB  1 
ATOM   5625  O OG  . SER C  1 115 ? 11.719  10.715  36.706  1.00 75.91  ? 114  SER C OG  1 
ATOM   5626  N N   . THR C  1 116 ? 10.704  14.708  38.417  1.00 56.82  ? 115  THR C N   1 
ATOM   5627  C CA  . THR C  1 116 ? 10.006  15.974  38.625  1.00 44.28  ? 115  THR C CA  1 
ATOM   5628  C C   . THR C  1 116 ? 10.337  16.957  37.515  1.00 51.41  ? 115  THR C C   1 
ATOM   5629  O O   . THR C  1 116 ? 11.493  17.104  37.118  1.00 54.20  ? 115  THR C O   1 
ATOM   5630  C CB  . THR C  1 116 ? 10.378  16.606  39.970  1.00 47.43  ? 115  THR C CB  1 
ATOM   5631  O OG1 . THR C  1 116 ? 9.960   15.746  41.035  1.00 66.90  ? 115  THR C OG1 1 
ATOM   5632  C CG2 . THR C  1 116 ? 9.702   17.962  40.134  1.00 52.76  ? 115  THR C CG2 1 
ATOM   5633  N N   . LEU C  1 117 ? 9.308   17.622  37.010  1.00 52.52  ? 116  LEU C N   1 
ATOM   5634  C CA  . LEU C  1 117 ? 9.477   18.659  36.011  1.00 48.75  ? 116  LEU C CA  1 
ATOM   5635  C C   . LEU C  1 117 ? 8.790   19.911  36.525  1.00 55.20  ? 116  LEU C C   1 
ATOM   5636  O O   . LEU C  1 117 ? 7.610   19.883  36.860  1.00 54.30  ? 116  LEU C O   1 
ATOM   5637  C CB  . LEU C  1 117 ? 8.869   18.207  34.680  1.00 55.31  ? 116  LEU C CB  1 
ATOM   5638  C CG  . LEU C  1 117 ? 8.949   19.163  33.484  1.00 64.93  ? 116  LEU C CG  1 
ATOM   5639  C CD1 . LEU C  1 117 ? 7.858   20.211  33.563  1.00 68.76  ? 116  LEU C CD1 1 
ATOM   5640  C CD2 . LEU C  1 117 ? 10.325  19.813  33.385  1.00 55.97  ? 116  LEU C CD2 1 
ATOM   5641  N N   . THR C  1 118 ? 9.536   21.005  36.611  1.00 53.45  ? 117  THR C N   1 
ATOM   5642  C CA  . THR C  1 118 ? 8.982   22.266  37.091  1.00 56.63  ? 117  THR C CA  1 
ATOM   5643  C C   . THR C  1 118 ? 9.317   23.378  36.111  1.00 57.23  ? 117  THR C C   1 
ATOM   5644  O O   . THR C  1 118 ? 10.390  23.389  35.508  1.00 57.96  ? 117  THR C O   1 
ATOM   5645  C CB  . THR C  1 118 ? 9.558   22.642  38.471  1.00 62.95  ? 117  THR C CB  1 
ATOM   5646  O OG1 . THR C  1 118 ? 9.339   21.572  39.397  1.00 70.84  ? 117  THR C OG1 1 
ATOM   5647  C CG2 . THR C  1 118 ? 8.900   23.892  39.003  1.00 65.05  ? 117  THR C CG2 1 
ATOM   5648  N N   . TYR C  1 119 ? 8.392   24.307  35.929  1.00 46.95  ? 118  TYR C N   1 
ATOM   5649  C CA  . TYR C  1 119 ? 8.714   25.526  35.198  1.00 61.56  ? 118  TYR C CA  1 
ATOM   5650  C C   . TYR C  1 119 ? 7.956   26.684  35.806  1.00 58.96  ? 118  TYR C C   1 
ATOM   5651  O O   . TYR C  1 119 ? 6.884   26.505  36.394  1.00 56.42  ? 118  TYR C O   1 
ATOM   5652  C CB  . TYR C  1 119 ? 8.421   25.388  33.700  1.00 57.79  ? 118  TYR C CB  1 
ATOM   5653  C CG  . TYR C  1 119 ? 7.018   24.945  33.378  1.00 59.15  ? 118  TYR C CG  1 
ATOM   5654  C CD1 . TYR C  1 119 ? 6.018   25.872  33.127  1.00 66.60  ? 118  TYR C CD1 1 
ATOM   5655  C CD2 . TYR C  1 119 ? 6.696   23.596  33.311  1.00 69.04  ? 118  TYR C CD2 1 
ATOM   5656  C CE1 . TYR C  1 119 ? 4.729   25.467  32.826  1.00 74.80  ? 118  TYR C CE1 1 
ATOM   5657  C CE2 . TYR C  1 119 ? 5.413   23.179  33.012  1.00 75.86  ? 118  TYR C CE2 1 
ATOM   5658  C CZ  . TYR C  1 119 ? 4.432   24.119  32.770  1.00 84.54  ? 118  TYR C CZ  1 
ATOM   5659  O OH  . TYR C  1 119 ? 3.149   23.714  32.474  1.00 91.09  ? 118  TYR C OH  1 
ATOM   5660  N N   . GLY C  1 120 ? 8.532   27.874  35.696  1.00 53.11  ? 119  GLY C N   1 
ATOM   5661  C CA  . GLY C  1 120 ? 7.944   29.045  36.310  1.00 51.85  ? 119  GLY C CA  1 
ATOM   5662  C C   . GLY C  1 120 ? 8.215   30.312  35.532  1.00 58.62  ? 119  GLY C C   1 
ATOM   5663  O O   . GLY C  1 120 ? 9.050   30.351  34.623  1.00 49.26  ? 119  GLY C O   1 
ATOM   5664  N N   . PHE C  1 121 ? 7.482   31.356  35.896  1.00 54.27  ? 120  PHE C N   1 
ATOM   5665  C CA  . PHE C  1 121 ? 7.662   32.662  35.313  1.00 59.73  ? 120  PHE C CA  1 
ATOM   5666  C C   . PHE C  1 121 ? 7.620   33.665  36.438  1.00 57.05  ? 120  PHE C C   1 
ATOM   5667  O O   . PHE C  1 121 ? 6.912   33.483  37.421  1.00 57.84  ? 120  PHE C O   1 
ATOM   5668  C CB  . PHE C  1 121 ? 6.552   32.950  34.302  1.00 61.25  ? 120  PHE C CB  1 
ATOM   5669  C CG  . PHE C  1 121 ? 6.463   31.930  33.204  1.00 66.28  ? 120  PHE C CG  1 
ATOM   5670  C CD1 . PHE C  1 121 ? 7.208   32.072  32.043  1.00 72.11  ? 120  PHE C CD1 1 
ATOM   5671  C CD2 . PHE C  1 121 ? 5.639   30.823  33.337  1.00 69.94  ? 120  PHE C CD2 1 
ATOM   5672  C CE1 . PHE C  1 121 ? 7.128   31.133  31.033  1.00 73.94  ? 120  PHE C CE1 1 
ATOM   5673  C CE2 . PHE C  1 121 ? 5.552   29.880  32.331  1.00 68.83  ? 120  PHE C CE2 1 
ATOM   5674  C CZ  . PHE C  1 121 ? 6.298   30.030  31.179  1.00 70.95  ? 120  PHE C CZ  1 
ATOM   5675  N N   . ASN C  1 122 ? 8.387   34.728  36.303  1.00 49.94  ? 121  ASN C N   1 
ATOM   5676  C CA  . ASN C  1 122 ? 8.376   35.768  37.305  1.00 58.79  ? 121  ASN C CA  1 
ATOM   5677  C C   . ASN C  1 122 ? 8.584   37.118  36.642  1.00 60.51  ? 121  ASN C C   1 
ATOM   5678  O O   . ASN C  1 122 ? 8.987   37.198  35.486  1.00 52.02  ? 121  ASN C O   1 
ATOM   5679  C CB  . ASN C  1 122 ? 9.467   35.499  38.336  1.00 49.70  ? 121  ASN C CB  1 
ATOM   5680  C CG  . ASN C  1 122 ? 10.854  35.646  37.759  1.00 59.88  ? 121  ASN C CG  1 
ATOM   5681  O OD1 . ASN C  1 122 ? 11.282  34.839  36.931  1.00 57.82  ? 121  ASN C OD1 1 
ATOM   5682  N ND2 . ASN C  1 122 ? 11.571  36.681  38.195  1.00 63.14  ? 121  ASN C ND2 1 
ATOM   5683  N N   . GLY C  1 123 ? 8.284   38.177  37.378  1.00 58.56  ? 122  GLY C N   1 
ATOM   5684  C CA  . GLY C  1 123 ? 8.492   39.525  36.898  1.00 47.22  ? 122  GLY C CA  1 
ATOM   5685  C C   . GLY C  1 123 ? 8.551   40.470  38.072  1.00 52.88  ? 122  GLY C C   1 
ATOM   5686  O O   . GLY C  1 123 ? 8.085   40.142  39.165  1.00 52.84  ? 122  GLY C O   1 
ATOM   5687  N N   . ASN C  1 124 ? 9.139   41.639  37.860  1.00 51.76  ? 123  ASN C N   1 
ATOM   5688  C CA  . ASN C  1 124 ? 9.119   42.675  38.882  1.00 63.37  ? 123  ASN C CA  1 
ATOM   5689  C C   . ASN C  1 124 ? 9.205   44.063  38.259  1.00 63.03  ? 123  ASN C C   1 
ATOM   5690  O O   . ASN C  1 124 ? 9.555   44.215  37.088  1.00 60.23  ? 123  ASN C O   1 
ATOM   5691  C CB  . ASN C  1 124 ? 10.258  42.461  39.891  1.00 50.67  ? 123  ASN C CB  1 
ATOM   5692  C CG  . ASN C  1 124 ? 11.631  42.777  39.309  1.00 61.80  ? 123  ASN C CG  1 
ATOM   5693  O OD1 . ASN C  1 124 ? 11.782  43.698  38.509  1.00 76.94  ? 123  ASN C OD1 1 
ATOM   5694  N ND2 . ASN C  1 124 ? 12.636  42.020  39.718  1.00 59.36  ? 123  ASN C ND2 1 
ATOM   5695  N N   . VAL C  1 125 ? 8.862   45.068  39.048  1.00 55.19  ? 124  VAL C N   1 
ATOM   5696  C CA  . VAL C  1 125 ? 9.064   46.447  38.662  1.00 59.37  ? 124  VAL C CA  1 
ATOM   5697  C C   . VAL C  1 125 ? 9.826   47.084  39.802  1.00 61.76  ? 124  VAL C C   1 
ATOM   5698  O O   . VAL C  1 125 ? 9.493   46.882  40.965  1.00 54.94  ? 124  VAL C O   1 
ATOM   5699  C CB  . VAL C  1 125 ? 7.731   47.179  38.419  1.00 67.15  ? 124  VAL C CB  1 
ATOM   5700  C CG1 . VAL C  1 125 ? 7.035   46.614  37.191  1.00 64.13  ? 124  VAL C CG1 1 
ATOM   5701  C CG2 . VAL C  1 125 ? 6.833   47.072  39.634  1.00 71.12  ? 124  VAL C CG2 1 
ATOM   5702  N N   . THR C  1 126 ? 10.885  47.807  39.467  1.00 71.36  ? 125  THR C N   1 
ATOM   5703  C CA  . THR C  1 126 ? 11.713  48.455  40.467  1.00 63.70  ? 125  THR C CA  1 
ATOM   5704  C C   . THR C  1 126 ? 11.674  49.960  40.232  1.00 68.12  ? 125  THR C C   1 
ATOM   5705  O O   . THR C  1 126 ? 11.078  50.422  39.262  1.00 73.29  ? 125  THR C O   1 
ATOM   5706  C CB  . THR C  1 126 ? 13.156  47.927  40.406  1.00 57.60  ? 125  THR C CB  1 
ATOM   5707  O OG1 . THR C  1 126 ? 13.716  48.193  39.115  1.00 86.00  ? 125  THR C OG1 1 
ATOM   5708  C CG2 . THR C  1 126 ? 13.177  46.428  40.652  1.00 73.35  ? 125  THR C CG2 1 
ATOM   5709  N N   . GLY C  1 127 ? 12.285  50.721  41.131  1.00 66.63  ? 126  GLY C N   1 
ATOM   5710  C CA  . GLY C  1 127 ? 12.313  52.164  41.007  1.00 69.49  ? 126  GLY C CA  1 
ATOM   5711  C C   . GLY C  1 127 ? 12.855  52.816  42.259  1.00 69.26  ? 126  GLY C C   1 
ATOM   5712  O O   . GLY C  1 127 ? 12.638  52.316  43.358  1.00 71.89  ? 126  GLY C O   1 
ATOM   5713  N N   . ASP C  1 128 ? 13.565  53.929  42.095  1.00 72.58  ? 127  ASP C N   1 
ATOM   5714  C CA  . ASP C  1 128 ? 14.106  54.669  43.236  1.00 85.68  ? 127  ASP C CA  1 
ATOM   5715  C C   . ASP C  1 128 ? 13.527  56.085  43.305  1.00 83.76  ? 127  ASP C C   1 
ATOM   5716  O O   . ASP C  1 128 ? 12.655  56.443  42.512  1.00 85.94  ? 127  ASP C O   1 
ATOM   5717  C CB  . ASP C  1 128 ? 15.639  54.712  43.188  1.00 80.13  ? 127  ASP C CB  1 
ATOM   5718  C CG  . ASP C  1 128 ? 16.177  55.326  41.902  1.00 107.65 ? 127  ASP C CG  1 
ATOM   5719  O OD1 . ASP C  1 128 ? 17.359  55.074  41.576  1.00 86.57  ? 127  ASP C OD1 1 
ATOM   5720  O OD2 . ASP C  1 128 ? 15.425  56.057  41.219  1.00 110.55 ? 127  ASP C OD2 1 
ATOM   5721  N N   . ASP C  1 129 ? 14.005  56.876  44.263  1.00 97.17  ? 128  ASP C N   1 
ATOM   5722  C CA  . ASP C  1 129 ? 13.529  58.250  44.446  1.00 103.53 ? 128  ASP C CA  1 
ATOM   5723  C C   . ASP C  1 129 ? 14.049  59.200  43.366  1.00 94.00  ? 128  ASP C C   1 
ATOM   5724  O O   . ASP C  1 129 ? 13.589  60.332  43.260  1.00 91.80  ? 128  ASP C O   1 
ATOM   5725  C CB  . ASP C  1 129 ? 13.895  58.779  45.838  1.00 101.05 ? 128  ASP C CB  1 
ATOM   5726  C CG  . ASP C  1 129 ? 15.302  58.399  46.265  1.00 100.51 ? 128  ASP C CG  1 
ATOM   5727  O OD1 . ASP C  1 129 ? 15.558  58.390  47.489  1.00 92.94  ? 128  ASP C OD1 1 
ATOM   5728  O OD2 . ASP C  1 129 ? 16.149  58.107  45.391  1.00 86.37  ? 128  ASP C OD2 1 
ATOM   5729  N N   . THR C  1 130 ? 15.002  58.728  42.567  1.00 93.97  ? 129  THR C N   1 
ATOM   5730  C CA  . THR C  1 130 ? 15.475  59.461  41.397  1.00 68.45  ? 129  THR C CA  1 
ATOM   5731  C C   . THR C  1 130 ? 14.378  59.522  40.331  1.00 86.38  ? 129  THR C C   1 
ATOM   5732  O O   . THR C  1 130 ? 14.527  60.191  39.310  1.00 96.18  ? 129  THR C O   1 
ATOM   5733  C CB  . THR C  1 130 ? 16.728  58.782  40.797  1.00 86.40  ? 129  THR C CB  1 
ATOM   5734  O OG1 . THR C  1 130 ? 17.787  58.788  41.762  1.00 82.54  ? 129  THR C OG1 1 
ATOM   5735  C CG2 . THR C  1 130 ? 17.197  59.489  39.529  1.00 97.67  ? 129  THR C CG2 1 
ATOM   5736  N N   . GLY C  1 131 ? 13.276  58.817  40.573  1.00 95.92  ? 130  GLY C N   1 
ATOM   5737  C CA  . GLY C  1 131 ? 12.175  58.761  39.629  1.00 85.80  ? 130  GLY C CA  1 
ATOM   5738  C C   . GLY C  1 131 ? 12.344  57.636  38.622  1.00 84.22  ? 130  GLY C C   1 
ATOM   5739  O O   . GLY C  1 131 ? 11.376  57.213  37.982  1.00 67.63  ? 130  GLY C O   1 
ATOM   5740  N N   . LYS C  1 132 ? 13.580  57.156  38.489  1.00 69.38  ? 131  LYS C N   1 
ATOM   5741  C CA  . LYS C  1 132 ? 13.921  56.082  37.558  1.00 84.06  ? 131  LYS C CA  1 
ATOM   5742  C C   . LYS C  1 132 ? 13.121  54.802  37.838  1.00 92.30  ? 131  LYS C C   1 
ATOM   5743  O O   . LYS C  1 132 ? 12.835  54.475  38.988  1.00 87.72  ? 131  LYS C O   1 
ATOM   5744  C CB  . LYS C  1 132 ? 15.420  55.789  37.655  1.00 85.80  ? 131  LYS C CB  1 
ATOM   5745  C CG  . LYS C  1 132 ? 15.938  54.746  36.679  1.00 96.44  ? 131  LYS C CG  1 
ATOM   5746  C CD  . LYS C  1 132 ? 17.349  54.294  37.052  1.00 111.57 ? 131  LYS C CD  1 
ATOM   5747  C CE  . LYS C  1 132 ? 18.286  55.479  37.265  1.00 131.28 ? 131  LYS C CE  1 
ATOM   5748  N NZ  . LYS C  1 132 ? 19.648  55.054  37.699  1.00 133.05 ? 131  LYS C NZ  1 
ATOM   5749  N N   . ILE C  1 133 ? 12.772  54.078  36.779  1.00 72.97  ? 132  ILE C N   1 
ATOM   5750  C CA  . ILE C  1 133 ? 11.977  52.862  36.900  1.00 66.21  ? 132  ILE C CA  1 
ATOM   5751  C C   . ILE C  1 133 ? 12.638  51.710  36.163  1.00 64.46  ? 132  ILE C C   1 
ATOM   5752  O O   . ILE C  1 133 ? 13.313  51.909  35.154  1.00 83.22  ? 132  ILE C O   1 
ATOM   5753  C CB  . ILE C  1 133 ? 10.577  53.062  36.308  1.00 79.75  ? 132  ILE C CB  1 
ATOM   5754  C CG1 . ILE C  1 133 ? 9.881   54.244  36.981  1.00 64.76  ? 132  ILE C CG1 1 
ATOM   5755  C CG2 . ILE C  1 133 ? 9.747   51.801  36.461  1.00 52.59  ? 132  ILE C CG2 1 
ATOM   5756  C CD1 . ILE C  1 133 ? 9.618   54.036  38.452  1.00 78.27  ? 132  ILE C CD1 1 
ATOM   5757  N N   . GLY C  1 134 ? 12.440  50.501  36.669  1.00 75.85  ? 133  GLY C N   1 
ATOM   5758  C CA  . GLY C  1 134 ? 13.001  49.314  36.050  1.00 68.97  ? 133  GLY C CA  1 
ATOM   5759  C C   . GLY C  1 134 ? 11.980  48.195  35.992  1.00 60.35  ? 133  GLY C C   1 
ATOM   5760  O O   . GLY C  1 134 ? 10.949  48.238  36.661  1.00 62.44  ? 133  GLY C O   1 
ATOM   5761  N N   . GLY C  1 135 ? 12.270  47.187  35.181  1.00 72.06  ? 134  GLY C N   1 
ATOM   5762  C CA  . GLY C  1 135 ? 11.356  46.083  34.980  1.00 50.53  ? 134  GLY C CA  1 
ATOM   5763  C C   . GLY C  1 135 ? 12.112  44.816  34.652  1.00 70.34  ? 134  GLY C C   1 
ATOM   5764  O O   . GLY C  1 135 ? 13.239  44.869  34.154  1.00 54.34  ? 134  GLY C O   1 
ATOM   5765  N N   . LEU C  1 136 ? 11.497  43.673  34.939  1.00 62.53  ? 135  LEU C N   1 
ATOM   5766  C CA  . LEU C  1 136 ? 12.140  42.390  34.684  1.00 67.88  ? 135  LEU C CA  1 
ATOM   5767  C C   . LEU C  1 136 ? 11.112  41.322  34.328  1.00 54.01  ? 135  LEU C C   1 
ATOM   5768  O O   . LEU C  1 136 ? 9.989   41.328  34.825  1.00 58.62  ? 135  LEU C O   1 
ATOM   5769  C CB  . LEU C  1 136 ? 12.965  41.958  35.901  1.00 44.29  ? 135  LEU C CB  1 
ATOM   5770  C CG  . LEU C  1 136 ? 13.762  40.655  35.752  1.00 76.45  ? 135  LEU C CG  1 
ATOM   5771  C CD1 . LEU C  1 136 ? 14.996  40.668  36.643  1.00 72.44  ? 135  LEU C CD1 1 
ATOM   5772  C CD2 . LEU C  1 136 ? 12.902  39.428  36.053  1.00 59.52  ? 135  LEU C CD2 1 
ATOM   5773  N N   . ILE C  1 137 ? 11.500  40.416  33.442  1.00 62.31  ? 136  ILE C N   1 
ATOM   5774  C CA  . ILE C  1 137 ? 10.675  39.266  33.122  1.00 62.28  ? 136  ILE C CA  1 
ATOM   5775  C C   . ILE C  1 137 ? 11.584  38.051  33.051  1.00 74.62  ? 136  ILE C C   1 
ATOM   5776  O O   . ILE C  1 137 ? 12.609  38.083  32.368  1.00 65.51  ? 136  ILE C O   1 
ATOM   5777  C CB  . ILE C  1 137 ? 9.936   39.443  31.788  1.00 67.72  ? 136  ILE C CB  1 
ATOM   5778  C CG1 . ILE C  1 137 ? 8.964   40.616  31.882  1.00 77.81  ? 136  ILE C CG1 1 
ATOM   5779  C CG2 . ILE C  1 137 ? 9.180   38.173  31.427  1.00 68.75  ? 136  ILE C CG2 1 
ATOM   5780  C CD1 . ILE C  1 137 ? 8.167   40.852  30.614  1.00 95.28  ? 136  ILE C CD1 1 
ATOM   5781  N N   . GLY C  1 138 ? 11.221  36.989  33.766  1.00 60.07  ? 137  GLY C N   1 
ATOM   5782  C CA  . GLY C  1 138 ? 12.050  35.797  33.815  1.00 57.63  ? 137  GLY C CA  1 
ATOM   5783  C C   . GLY C  1 138 ? 11.269  34.503  33.674  1.00 57.85  ? 137  GLY C C   1 
ATOM   5784  O O   . GLY C  1 138 ? 10.052  34.459  33.858  1.00 59.40  ? 137  GLY C O   1 
ATOM   5785  N N   . ALA C  1 139 ? 11.986  33.437  33.349  1.00 48.80  ? 138  ALA C N   1 
ATOM   5786  C CA  . ALA C  1 139 ? 11.398  32.112  33.254  1.00 47.27  ? 138  ALA C CA  1 
ATOM   5787  C C   . ALA C  1 139 ? 12.440  31.085  33.649  1.00 53.87  ? 138  ALA C C   1 
ATOM   5788  O O   . ALA C  1 139 ? 13.637  31.337  33.563  1.00 49.50  ? 138  ALA C O   1 
ATOM   5789  C CB  . ALA C  1 139 ? 10.900  31.843  31.850  1.00 42.92  ? 138  ALA C CB  1 
ATOM   5790  N N   . ASN C  1 140 ? 11.982  29.924  34.097  1.00 47.57  ? 139  ASN C N   1 
ATOM   5791  C CA  . ASN C  1 140 ? 12.899  28.859  34.453  1.00 51.63  ? 139  ASN C CA  1 
ATOM   5792  C C   . ASN C  1 140 ? 12.255  27.500  34.257  1.00 46.87  ? 139  ASN C C   1 
ATOM   5793  O O   . ASN C  1 140 ? 11.033  27.380  34.172  1.00 48.50  ? 139  ASN C O   1 
ATOM   5794  C CB  . ASN C  1 140 ? 13.359  29.021  35.901  1.00 51.21  ? 139  ASN C CB  1 
ATOM   5795  C CG  . ASN C  1 140 ? 12.203  29.177  36.855  1.00 60.22  ? 139  ASN C CG  1 
ATOM   5796  O OD1 . ASN C  1 140 ? 11.590  28.194  37.265  1.00 71.93  ? 139  ASN C OD1 1 
ATOM   5797  N ND2 . ASN C  1 140 ? 11.887  30.419  37.207  1.00 79.67  ? 139  ASN C ND2 1 
ATOM   5798  N N   . VAL C  1 141 ? 13.095  26.480  34.160  1.00 42.26  ? 140  VAL C N   1 
ATOM   5799  C CA  . VAL C  1 141 ? 12.630  25.109  34.068  1.00 46.97  ? 140  VAL C CA  1 
ATOM   5800  C C   . VAL C  1 141 ? 13.644  24.261  34.810  1.00 51.41  ? 140  VAL C C   1 
ATOM   5801  O O   . VAL C  1 141 ? 14.833  24.566  34.805  1.00 51.57  ? 140  VAL C O   1 
ATOM   5802  C CB  . VAL C  1 141 ? 12.485  24.652  32.602  1.00 46.67  ? 140  VAL C CB  1 
ATOM   5803  C CG1 . VAL C  1 141 ? 13.808  24.788  31.865  1.00 47.60  ? 140  VAL C CG1 1 
ATOM   5804  C CG2 . VAL C  1 141 ? 11.977  23.222  32.538  1.00 45.75  ? 140  VAL C CG2 1 
ATOM   5805  N N   . SER C  1 142 ? 13.176  23.218  35.482  1.00 50.43  ? 141  SER C N   1 
ATOM   5806  C CA  . SER C  1 142 ? 14.077  22.326  36.195  1.00 55.94  ? 141  SER C CA  1 
ATOM   5807  C C   . SER C  1 142 ? 13.569  20.887  36.142  1.00 57.44  ? 141  SER C C   1 
ATOM   5808  O O   . SER C  1 142 ? 12.366  20.631  36.174  1.00 54.66  ? 141  SER C O   1 
ATOM   5809  C CB  . SER C  1 142 ? 14.253  22.788  37.644  1.00 50.39  ? 141  SER C CB  1 
ATOM   5810  O OG  . SER C  1 142 ? 13.012  22.787  38.325  1.00 80.76  ? 141  SER C OG  1 
ATOM   5811  N N   . ILE C  1 143 ? 14.505  19.956  36.028  1.00 51.50  ? 142  ILE C N   1 
ATOM   5812  C CA  . ILE C  1 143 ? 14.198  18.540  36.051  1.00 53.68  ? 142  ILE C CA  1 
ATOM   5813  C C   . ILE C  1 143 ? 14.925  17.918  37.228  1.00 60.36  ? 142  ILE C C   1 
ATOM   5814  O O   . ILE C  1 143 ? 16.070  18.270  37.512  1.00 54.29  ? 142  ILE C O   1 
ATOM   5815  C CB  . ILE C  1 143 ? 14.653  17.856  34.761  1.00 60.04  ? 142  ILE C CB  1 
ATOM   5816  C CG1 . ILE C  1 143 ? 13.909  18.451  33.566  1.00 62.96  ? 142  ILE C CG1 1 
ATOM   5817  C CG2 . ILE C  1 143 ? 14.411  16.373  34.834  1.00 58.15  ? 142  ILE C CG2 1 
ATOM   5818  C CD1 . ILE C  1 143 ? 14.297  17.821  32.243  1.00 83.59  ? 142  ILE C CD1 1 
ATOM   5819  N N   . GLY C  1 144 ? 14.250  17.007  37.918  1.00 53.39  ? 143  GLY C N   1 
ATOM   5820  C CA  . GLY C  1 144 ? 14.823  16.337  39.070  1.00 55.40  ? 143  GLY C CA  1 
ATOM   5821  C C   . GLY C  1 144 ? 14.577  14.840  39.017  1.00 58.55  ? 143  GLY C C   1 
ATOM   5822  O O   . GLY C  1 144 ? 13.572  14.377  38.477  1.00 44.68  ? 143  GLY C O   1 
ATOM   5823  N N   . HIS C  1 145 ? 15.511  14.082  39.572  1.00 52.71  ? 144  HIS C N   1 
ATOM   5824  C CA  . HIS C  1 145 ? 15.366  12.643  39.689  1.00 53.75  ? 144  HIS C CA  1 
ATOM   5825  C C   . HIS C  1 145 ? 15.750  12.268  41.107  1.00 56.00  ? 144  HIS C C   1 
ATOM   5826  O O   . HIS C  1 145 ? 16.742  12.760  41.635  1.00 54.85  ? 144  HIS C O   1 
ATOM   5827  C CB  . HIS C  1 145 ? 16.259  11.921  38.681  1.00 58.93  ? 144  HIS C CB  1 
ATOM   5828  C CG  . HIS C  1 145 ? 16.012  12.325  37.261  1.00 82.99  ? 144  HIS C CG  1 
ATOM   5829  N ND1 . HIS C  1 145 ? 14.931  11.868  36.535  1.00 82.57  ? 144  HIS C ND1 1 
ATOM   5830  C CD2 . HIS C  1 145 ? 16.700  13.147  36.432  1.00 71.83  ? 144  HIS C CD2 1 
ATOM   5831  C CE1 . HIS C  1 145 ? 14.966  12.391  35.322  1.00 79.02  ? 144  HIS C CE1 1 
ATOM   5832  N NE2 . HIS C  1 145 ? 16.029  13.171  35.234  1.00 78.92  ? 144  HIS C NE2 1 
ATOM   5833  N N   . THR C  1 146 ? 14.954  11.410  41.730  1.00 41.57  ? 145  THR C N   1 
ATOM   5834  C CA  . THR C  1 146 ? 15.231  10.979  43.088  1.00 40.00  ? 145  THR C CA  1 
ATOM   5835  C C   . THR C  1 146 ? 15.151  9.461   43.173  1.00 43.09  ? 145  THR C C   1 
ATOM   5836  O O   . THR C  1 146 ? 14.291  8.833   42.568  1.00 46.38  ? 145  THR C O   1 
ATOM   5837  C CB  . THR C  1 146 ? 14.251  11.611  44.085  1.00 49.84  ? 145  THR C CB  1 
ATOM   5838  O OG1 . THR C  1 146 ? 14.422  13.034  44.084  1.00 64.50  ? 145  THR C OG1 1 
ATOM   5839  C CG2 . THR C  1 146 ? 14.500  11.096  45.482  1.00 52.63  ? 145  THR C CG2 1 
ATOM   5840  N N   . LEU C  1 147 ? 16.066  8.886   43.936  1.00 48.22  ? 146  LEU C N   1 
ATOM   5841  C CA  . LEU C  1 147 ? 16.145  7.452   44.114  1.00 49.10  ? 146  LEU C CA  1 
ATOM   5842  C C   . LEU C  1 147 ? 16.105  7.166   45.603  1.00 42.61  ? 146  LEU C C   1 
ATOM   5843  O O   . LEU C  1 147 ? 16.885  7.734   46.356  1.00 45.19  ? 146  LEU C O   1 
ATOM   5844  C CB  . LEU C  1 147 ? 17.452  6.938   43.523  1.00 41.00  ? 146  LEU C CB  1 
ATOM   5845  C CG  . LEU C  1 147 ? 17.787  5.477   43.783  1.00 59.11  ? 146  LEU C CG  1 
ATOM   5846  C CD1 . LEU C  1 147 ? 16.764  4.578   43.103  1.00 45.56  ? 146  LEU C CD1 1 
ATOM   5847  C CD2 . LEU C  1 147 ? 19.194  5.180   43.284  1.00 62.77  ? 146  LEU C CD2 1 
ATOM   5848  N N   . LYS C  1 148 ? 15.193  6.298   46.029  1.00 32.03  ? 147  LYS C N   1 
ATOM   5849  C CA  . LYS C  1 148 ? 15.063  5.961   47.443  1.00 46.21  ? 147  LYS C CA  1 
ATOM   5850  C C   . LYS C  1 148 ? 15.015  4.441   47.641  1.00 46.58  ? 147  LYS C C   1 
ATOM   5851  O O   . LYS C  1 148 ? 14.345  3.742   46.899  1.00 45.49  ? 147  LYS C O   1 
ATOM   5852  C CB  . LYS C  1 148 ? 13.796  6.597   48.010  1.00 36.40  ? 147  LYS C CB  1 
ATOM   5853  C CG  . LYS C  1 148 ? 13.504  6.212   49.443  1.00 67.05  ? 147  LYS C CG  1 
ATOM   5854  C CD  . LYS C  1 148 ? 12.080  6.580   49.840  1.00 82.96  ? 147  LYS C CD  1 
ATOM   5855  C CE  . LYS C  1 148 ? 11.835  8.081   49.744  1.00 92.97  ? 147  LYS C CE  1 
ATOM   5856  N NZ  . LYS C  1 148 ? 10.474  8.455   50.226  1.00 104.80 ? 147  LYS C NZ  1 
ATOM   5857  N N   . TYR C  1 149 ? 15.725  3.931   48.642  1.00 36.95  ? 148  TYR C N   1 
ATOM   5858  C CA  . TYR C  1 149 ? 15.680  2.506   48.951  1.00 45.02  ? 148  TYR C CA  1 
ATOM   5859  C C   . TYR C  1 149 ? 16.200  2.240   50.356  1.00 48.41  ? 148  TYR C C   1 
ATOM   5860  O O   . TYR C  1 149 ? 16.901  3.068   50.937  1.00 38.44  ? 148  TYR C O   1 
ATOM   5861  C CB  . TYR C  1 149 ? 16.496  1.704   47.936  1.00 41.16  ? 148  TYR C CB  1 
ATOM   5862  C CG  . TYR C  1 149 ? 17.901  2.218   47.800  1.00 38.55  ? 148  TYR C CG  1 
ATOM   5863  C CD1 . TYR C  1 149 ? 18.949  1.643   48.503  1.00 54.57  ? 148  TYR C CD1 1 
ATOM   5864  C CD2 . TYR C  1 149 ? 18.175  3.299   46.980  1.00 51.40  ? 148  TYR C CD2 1 
ATOM   5865  C CE1 . TYR C  1 149 ? 20.235  2.133   48.384  1.00 59.87  ? 148  TYR C CE1 1 
ATOM   5866  C CE2 . TYR C  1 149 ? 19.450  3.791   46.852  1.00 59.16  ? 148  TYR C CE2 1 
ATOM   5867  C CZ  . TYR C  1 149 ? 20.474  3.208   47.555  1.00 60.15  ? 148  TYR C CZ  1 
ATOM   5868  O OH  . TYR C  1 149 ? 21.734  3.717   47.416  1.00 67.95  ? 148  TYR C OH  1 
ATOM   5869  N N   . VAL C  1 150 ? 15.855  1.073   50.888  1.00 41.63  ? 149  VAL C N   1 
ATOM   5870  C CA  . VAL C  1 150 ? 16.226  0.706   52.249  1.00 43.26  ? 149  VAL C CA  1 
ATOM   5871  C C   . VAL C  1 150 ? 17.459  -0.187  52.231  1.00 38.30  ? 149  VAL C C   1 
ATOM   5872  O O   . VAL C  1 150 ? 17.624  -1.018  51.342  1.00 49.66  ? 149  VAL C O   1 
ATOM   5873  C CB  . VAL C  1 150 ? 15.063  -0.032  52.949  1.00 48.87  ? 149  VAL C CB  1 
ATOM   5874  C CG1 . VAL C  1 150 ? 15.481  -0.513  54.322  1.00 52.47  ? 149  VAL C CG1 1 
ATOM   5875  C CG2 . VAL C  1 150 ? 13.854  0.882   53.042  1.00 49.46  ? 149  VAL C CG2 1 
ATOM   5876  N N   . GLN C  1 151 ? 18.327  -0.010  53.219  1.00 40.14  ? 150  GLN C N   1 
ATOM   5877  C CA  . GLN C  1 151 ? 19.542  -0.801  53.322  1.00 50.17  ? 150  GLN C CA  1 
ATOM   5878  C C   . GLN C  1 151 ? 19.736  -1.318  54.732  1.00 50.51  ? 150  GLN C C   1 
ATOM   5879  O O   . GLN C  1 151 ? 19.944  -0.534  55.647  1.00 49.21  ? 150  GLN C O   1 
ATOM   5880  C CB  . GLN C  1 151 ? 20.750  0.044   52.960  1.00 58.42  ? 150  GLN C CB  1 
ATOM   5881  C CG  . GLN C  1 151 ? 20.785  0.479   51.521  1.00 72.90  ? 150  GLN C CG  1 
ATOM   5882  C CD  . GLN C  1 151 ? 22.112  1.093   51.159  1.00 90.26  ? 150  GLN C CD  1 
ATOM   5883  O OE1 . GLN C  1 151 ? 22.934  0.469   50.484  1.00 96.93  ? 150  GLN C OE1 1 
ATOM   5884  N NE2 . GLN C  1 151 ? 22.339  2.322   51.615  1.00 76.27  ? 150  GLN C NE2 1 
ATOM   5885  N N   . PRO C  1 152 ? 19.681  -2.644  54.909  1.00 46.64  ? 151  PRO C N   1 
ATOM   5886  C CA  . PRO C  1 152 ? 19.942  -3.222  56.231  1.00 45.52  ? 151  PRO C CA  1 
ATOM   5887  C C   . PRO C  1 152 ? 21.436  -3.194  56.554  1.00 38.52  ? 151  PRO C C   1 
ATOM   5888  O O   . PRO C  1 152 ? 22.254  -3.175  55.636  1.00 41.22  ? 151  PRO C O   1 
ATOM   5889  C CB  . PRO C  1 152 ? 19.440  -4.662  56.082  1.00 32.78  ? 151  PRO C CB  1 
ATOM   5890  C CG  . PRO C  1 152 ? 19.647  -4.974  54.623  1.00 45.69  ? 151  PRO C CG  1 
ATOM   5891  C CD  . PRO C  1 152 ? 19.393  -3.676  53.892  1.00 40.65  ? 151  PRO C CD  1 
ATOM   5892  N N   . ASP C  1 153 ? 21.787  -3.195  57.835  1.00 35.41  ? 152  ASP C N   1 
ATOM   5893  C CA  . ASP C  1 153 ? 23.190  -3.232  58.237  1.00 38.59  ? 152  ASP C CA  1 
ATOM   5894  C C   . ASP C  1 153 ? 23.857  -4.525  57.762  1.00 43.66  ? 152  ASP C C   1 
ATOM   5895  O O   . ASP C  1 153 ? 25.013  -4.508  57.358  1.00 38.20  ? 152  ASP C O   1 
ATOM   5896  C CB  . ASP C  1 153 ? 23.321  -3.124  59.760  1.00 43.62  ? 152  ASP C CB  1 
ATOM   5897  C CG  . ASP C  1 153 ? 23.027  -1.717  60.286  1.00 61.86  ? 152  ASP C CG  1 
ATOM   5898  O OD1 . ASP C  1 153 ? 23.047  -1.531  61.523  1.00 54.16  ? 152  ASP C OD1 1 
ATOM   5899  O OD2 . ASP C  1 153 ? 22.788  -0.797  59.471  1.00 52.49  ? 152  ASP C OD2 1 
ATOM   5900  N N   . PHE C  1 154 ? 23.131  -5.640  57.851  1.00 38.01  ? 153  PHE C N   1 
ATOM   5901  C CA  . PHE C  1 154 ? 23.599  -6.934  57.339  1.00 43.51  ? 153  PHE C CA  1 
ATOM   5902  C C   . PHE C  1 154 ? 22.565  -7.489  56.367  1.00 41.82  ? 153  PHE C C   1 
ATOM   5903  O O   . PHE C  1 154 ? 21.366  -7.262  56.539  1.00 45.48  ? 153  PHE C O   1 
ATOM   5904  C CB  . PHE C  1 154 ? 23.788  -7.942  58.478  1.00 36.68  ? 153  PHE C CB  1 
ATOM   5905  C CG  . PHE C  1 154 ? 25.016  -7.715  59.310  1.00 39.23  ? 153  PHE C CG  1 
ATOM   5906  C CD1 . PHE C  1 154 ? 26.103  -8.570  59.200  1.00 36.34  ? 153  PHE C CD1 1 
ATOM   5907  C CD2 . PHE C  1 154 ? 25.082  -6.662  60.214  1.00 38.24  ? 153  PHE C CD2 1 
ATOM   5908  C CE1 . PHE C  1 154 ? 27.241  -8.377  59.979  1.00 38.07  ? 153  PHE C CE1 1 
ATOM   5909  C CE2 . PHE C  1 154 ? 26.211  -6.462  60.989  1.00 39.99  ? 153  PHE C CE2 1 
ATOM   5910  C CZ  . PHE C  1 154 ? 27.292  -7.317  60.873  1.00 41.81  ? 153  PHE C CZ  1 
ATOM   5911  N N   . LYS C  1 155 ? 23.025  -8.214  55.351  1.00 34.79  ? 154  LYS C N   1 
ATOM   5912  C CA  . LYS C  1 155 ? 22.122  -8.885  54.428  1.00 39.12  ? 154  LYS C CA  1 
ATOM   5913  C C   . LYS C  1 155 ? 22.102  -10.371 54.731  1.00 40.19  ? 154  LYS C C   1 
ATOM   5914  O O   . LYS C  1 155 ? 23.144  -10.964 55.023  1.00 40.26  ? 154  LYS C O   1 
ATOM   5915  C CB  . LYS C  1 155 ? 22.573  -8.662  52.988  1.00 39.74  ? 154  LYS C CB  1 
ATOM   5916  C CG  . LYS C  1 155 ? 22.535  -7.219  52.548  1.00 61.52  ? 154  LYS C CG  1 
ATOM   5917  C CD  . LYS C  1 155 ? 23.237  -7.014  51.213  1.00 63.91  ? 154  LYS C CD  1 
ATOM   5918  C CE  . LYS C  1 155 ? 22.549  -7.772  50.095  1.00 71.63  ? 154  LYS C CE  1 
ATOM   5919  N NZ  . LYS C  1 155 ? 23.141  -7.451  48.761  1.00 79.34  ? 154  LYS C NZ  1 
ATOM   5920  N N   . THR C  1 156 ? 20.919  -10.970 54.664  1.00 37.26  ? 155  THR C N   1 
ATOM   5921  C CA  . THR C  1 156 ? 20.776  -12.408 54.856  1.00 38.15  ? 155  THR C CA  1 
ATOM   5922  C C   . THR C  1 156 ? 20.637  -13.070 53.489  1.00 43.17  ? 155  THR C C   1 
ATOM   5923  O O   . THR C  1 156 ? 19.744  -12.725 52.714  1.00 37.50  ? 155  THR C O   1 
ATOM   5924  C CB  . THR C  1 156 ? 19.553  -12.733 55.718  1.00 41.53  ? 155  THR C CB  1 
ATOM   5925  O OG1 . THR C  1 156 ? 19.663  -12.034 56.962  1.00 48.88  ? 155  THR C OG1 1 
ATOM   5926  C CG2 . THR C  1 156 ? 19.443  -14.236 55.981  1.00 34.34  ? 155  THR C CG2 1 
ATOM   5927  N N   . ILE C  1 157 ? 21.526  -14.012 53.193  1.00 37.74  ? 156  ILE C N   1 
ATOM   5928  C CA  . ILE C  1 157 ? 21.589  -14.595 51.865  1.00 32.65  ? 156  ILE C CA  1 
ATOM   5929  C C   . ILE C  1 157 ? 21.595  -16.112 51.907  1.00 35.11  ? 156  ILE C C   1 
ATOM   5930  O O   . ILE C  1 157 ? 22.357  -16.720 52.660  1.00 37.08  ? 156  ILE C O   1 
ATOM   5931  C CB  . ILE C  1 157 ? 22.856  -14.139 51.137  1.00 45.38  ? 156  ILE C CB  1 
ATOM   5932  C CG1 . ILE C  1 157 ? 22.845  -12.620 50.973  1.00 43.10  ? 156  ILE C CG1 1 
ATOM   5933  C CG2 . ILE C  1 157 ? 22.970  -14.844 49.776  1.00 32.01  ? 156  ILE C CG2 1 
ATOM   5934  C CD1 . ILE C  1 157 ? 24.094  -12.078 50.335  1.00 45.04  ? 156  ILE C CD1 1 
ATOM   5935  N N   . LEU C  1 158 ? 20.740  -16.715 51.090  1.00 34.22  ? 157  LEU C N   1 
ATOM   5936  C CA  . LEU C  1 158 ? 20.778  -18.151 50.869  1.00 36.91  ? 157  LEU C CA  1 
ATOM   5937  C C   . LEU C  1 158 ? 21.821  -18.446 49.805  1.00 31.48  ? 157  LEU C C   1 
ATOM   5938  O O   . LEU C  1 158 ? 21.703  -17.976 48.683  1.00 36.34  ? 157  LEU C O   1 
ATOM   5939  C CB  . LEU C  1 158 ? 19.408  -18.652 50.410  1.00 26.17  ? 157  LEU C CB  1 
ATOM   5940  C CG  . LEU C  1 158 ? 19.363  -20.127 49.992  1.00 33.20  ? 157  LEU C CG  1 
ATOM   5941  C CD1 . LEU C  1 158 ? 19.500  -21.038 51.206  1.00 28.05  ? 157  LEU C CD1 1 
ATOM   5942  C CD2 . LEU C  1 158 ? 18.081  -20.424 49.242  1.00 30.80  ? 157  LEU C CD2 1 
ATOM   5943  N N   . GLU C  1 159 ? 22.842  -19.216 50.157  1.00 36.11  ? 158  GLU C N   1 
ATOM   5944  C CA  . GLU C  1 159 ? 23.851  -19.631 49.184  1.00 48.62  ? 158  GLU C CA  1 
ATOM   5945  C C   . GLU C  1 159 ? 23.282  -20.691 48.242  1.00 45.63  ? 158  GLU C C   1 
ATOM   5946  O O   . GLU C  1 159 ? 22.392  -21.452 48.619  1.00 55.64  ? 158  GLU C O   1 
ATOM   5947  C CB  . GLU C  1 159 ? 25.069  -20.194 49.907  1.00 46.94  ? 158  GLU C CB  1 
ATOM   5948  C CG  . GLU C  1 159 ? 25.609  -19.290 51.000  1.00 52.28  ? 158  GLU C CG  1 
ATOM   5949  C CD  . GLU C  1 159 ? 27.042  -18.855 50.745  1.00 75.39  ? 158  GLU C CD  1 
ATOM   5950  O OE1 . GLU C  1 159 ? 27.858  -18.881 51.700  1.00 67.57  ? 158  GLU C OE1 1 
ATOM   5951  O OE2 . GLU C  1 159 ? 27.351  -18.485 49.591  1.00 77.25  ? 158  GLU C OE2 1 
ATOM   5952  N N   . SER C  1 160 ? 23.804  -20.744 47.022  1.00 39.63  ? 159  SER C N   1 
ATOM   5953  C CA  . SER C  1 160 ? 23.350  -21.724 46.026  1.00 42.07  ? 159  SER C CA  1 
ATOM   5954  C C   . SER C  1 160 ? 23.351  -23.147 46.583  1.00 34.69  ? 159  SER C C   1 
ATOM   5955  O O   . SER C  1 160 ? 24.411  -23.721 46.809  1.00 41.38  ? 159  SER C O   1 
ATOM   5956  C CB  . SER C  1 160 ? 24.252  -21.663 44.797  1.00 44.44  ? 159  SER C CB  1 
ATOM   5957  O OG  . SER C  1 160 ? 24.353  -20.335 44.317  1.00 56.13  ? 159  SER C OG  1 
ATOM   5958  N N   . PRO C  1 161 ? 22.159  -23.714 46.823  1.00 49.85  ? 160  PRO C N   1 
ATOM   5959  C CA  . PRO C  1 161 ? 22.069  -25.053 47.416  1.00 41.50  ? 160  PRO C CA  1 
ATOM   5960  C C   . PRO C  1 161 ? 22.116  -26.166 46.384  1.00 44.02  ? 160  PRO C C   1 
ATOM   5961  O O   . PRO C  1 161 ? 21.809  -25.932 45.218  1.00 40.66  ? 160  PRO C O   1 
ATOM   5962  C CB  . PRO C  1 161 ? 20.697  -25.035 48.088  1.00 38.94  ? 160  PRO C CB  1 
ATOM   5963  C CG  . PRO C  1 161 ? 19.884  -24.141 47.227  1.00 46.82  ? 160  PRO C CG  1 
ATOM   5964  C CD  . PRO C  1 161 ? 20.832  -23.086 46.693  1.00 43.63  ? 160  PRO C CD  1 
ATOM   5965  N N   . THR C  1 162 ? 22.515  -27.354 46.823  1.00 32.62  ? 161  THR C N   1 
ATOM   5966  C CA  . THR C  1 162 ? 22.430  -28.562 46.017  1.00 37.89  ? 161  THR C CA  1 
ATOM   5967  C C   . THR C  1 162 ? 21.527  -29.511 46.798  1.00 45.80  ? 161  THR C C   1 
ATOM   5968  O O   . THR C  1 162 ? 20.978  -29.122 47.817  1.00 40.37  ? 161  THR C O   1 
ATOM   5969  C CB  . THR C  1 162 ? 23.811  -29.215 45.829  1.00 35.88  ? 161  THR C CB  1 
ATOM   5970  O OG1 . THR C  1 162 ? 24.210  -29.848 47.051  1.00 43.94  ? 161  THR C OG1 1 
ATOM   5971  C CG2 . THR C  1 162 ? 24.859  -28.170 45.434  1.00 37.88  ? 161  THR C CG2 1 
ATOM   5972  N N   . ASP C  1 163 ? 21.376  -30.745 46.333  1.00 44.56  ? 162  ASP C N   1 
ATOM   5973  C CA  . ASP C  1 163 ? 20.569  -31.723 47.055  1.00 38.90  ? 162  ASP C CA  1 
ATOM   5974  C C   . ASP C  1 163 ? 21.358  -32.347 48.207  1.00 34.64  ? 162  ASP C C   1 
ATOM   5975  O O   . ASP C  1 163 ? 20.857  -33.223 48.909  1.00 38.71  ? 162  ASP C O   1 
ATOM   5976  C CB  . ASP C  1 163 ? 20.039  -32.811 46.102  1.00 41.34  ? 162  ASP C CB  1 
ATOM   5977  C CG  . ASP C  1 163 ? 21.150  -33.672 45.499  1.00 62.02  ? 162  ASP C CG  1 
ATOM   5978  O OD1 . ASP C  1 163 ? 22.326  -33.236 45.471  1.00 62.63  ? 162  ASP C OD1 1 
ATOM   5979  O OD2 . ASP C  1 163 ? 20.839  -34.797 45.040  1.00 77.16  ? 162  ASP C OD2 1 
ATOM   5980  N N   . LYS C  1 164 ? 22.588  -31.891 48.415  1.00 35.64  ? 163  LYS C N   1 
ATOM   5981  C CA  . LYS C  1 164 ? 23.420  -32.441 49.481  1.00 34.65  ? 163  LYS C CA  1 
ATOM   5982  C C   . LYS C  1 164 ? 23.989  -31.361 50.393  1.00 38.43  ? 163  LYS C C   1 
ATOM   5983  O O   . LYS C  1 164 ? 24.460  -31.662 51.488  1.00 41.26  ? 163  LYS C O   1 
ATOM   5984  C CB  . LYS C  1 164 ? 24.566  -33.286 48.897  1.00 39.68  ? 163  LYS C CB  1 
ATOM   5985  C CG  . LYS C  1 164 ? 24.104  -34.548 48.160  1.00 40.97  ? 163  LYS C CG  1 
ATOM   5986  C CD  . LYS C  1 164 ? 23.309  -35.477 49.080  1.00 48.17  ? 163  LYS C CD  1 
ATOM   5987  C CE  . LYS C  1 164 ? 22.566  -36.574 48.308  1.00 54.86  ? 163  LYS C CE  1 
ATOM   5988  N NZ  . LYS C  1 164 ? 23.488  -37.480 47.575  1.00 65.45  ? 163  LYS C NZ  1 
ATOM   5989  N N   . LYS C  1 165 ? 23.946  -30.107 49.951  1.00 33.71  ? 164  LYS C N   1 
ATOM   5990  C CA  . LYS C  1 165 ? 24.559  -29.010 50.701  1.00 43.38  ? 164  LYS C CA  1 
ATOM   5991  C C   . LYS C  1 165 ? 23.671  -27.775 50.656  1.00 36.66  ? 164  LYS C C   1 
ATOM   5992  O O   . LYS C  1 165 ? 23.114  -27.438 49.620  1.00 40.45  ? 164  LYS C O   1 
ATOM   5993  C CB  . LYS C  1 165 ? 25.934  -28.659 50.113  1.00 37.21  ? 164  LYS C CB  1 
ATOM   5994  C CG  . LYS C  1 165 ? 26.951  -29.782 50.216  1.00 79.49  ? 164  LYS C CG  1 
ATOM   5995  C CD  . LYS C  1 165 ? 28.179  -29.515 49.361  1.00 87.48  ? 164  LYS C CD  1 
ATOM   5996  C CE  . LYS C  1 165 ? 28.847  -28.205 49.738  1.00 92.40  ? 164  LYS C CE  1 
ATOM   5997  N NZ  . LYS C  1 165 ? 30.048  -27.936 48.897  1.00 112.43 ? 164  LYS C NZ  1 
ATOM   5998  N N   . VAL C  1 166 ? 23.534  -27.100 51.787  1.00 45.43  ? 165  VAL C N   1 
ATOM   5999  C CA  . VAL C  1 166 ? 22.817  -25.832 51.824  1.00 34.10  ? 165  VAL C CA  1 
ATOM   6000  C C   . VAL C  1 166 ? 23.496  -24.955 52.850  1.00 35.01  ? 165  VAL C C   1 
ATOM   6001  O O   . VAL C  1 166 ? 24.083  -25.462 53.804  1.00 40.25  ? 165  VAL C O   1 
ATOM   6002  C CB  . VAL C  1 166 ? 21.333  -26.026 52.181  1.00 43.29  ? 165  VAL C CB  1 
ATOM   6003  C CG1 . VAL C  1 166 ? 21.185  -26.608 53.576  1.00 36.49  ? 165  VAL C CG1 1 
ATOM   6004  C CG2 . VAL C  1 166 ? 20.589  -24.712 52.077  1.00 39.06  ? 165  VAL C CG2 1 
ATOM   6005  N N   . GLY C  1 167 ? 23.444  -23.644 52.649  1.00 28.82  ? 166  GLY C N   1 
ATOM   6006  C CA  . GLY C  1 167 ? 24.031  -22.724 53.607  1.00 29.50  ? 166  GLY C CA  1 
ATOM   6007  C C   . GLY C  1 167 ? 23.450  -21.338 53.493  1.00 34.23  ? 166  GLY C C   1 
ATOM   6008  O O   . GLY C  1 167 ? 22.841  -21.005 52.478  1.00 34.57  ? 166  GLY C O   1 
ATOM   6009  N N   . TRP C  1 168 ? 23.632  -20.541 54.544  1.00 27.04  ? 167  TRP C N   1 
ATOM   6010  C CA  . TRP C  1 168 ? 23.263  -19.137 54.533  1.00 29.26  ? 167  TRP C CA  1 
ATOM   6011  C C   . TRP C  1 168 ? 24.468  -18.320 54.968  1.00 36.20  ? 167  TRP C C   1 
ATOM   6012  O O   . TRP C  1 168 ? 25.328  -18.803 55.715  1.00 35.81  ? 167  TRP C O   1 
ATOM   6013  C CB  . TRP C  1 168 ? 22.117  -18.867 55.519  1.00 32.55  ? 167  TRP C CB  1 
ATOM   6014  C CG  . TRP C  1 168 ? 20.811  -19.496 55.162  1.00 32.98  ? 167  TRP C CG  1 
ATOM   6015  C CD1 . TRP C  1 168 ? 19.758  -18.899 54.525  1.00 28.95  ? 167  TRP C CD1 1 
ATOM   6016  C CD2 . TRP C  1 168 ? 20.411  -20.848 55.419  1.00 26.76  ? 167  TRP C CD2 1 
ATOM   6017  N NE1 . TRP C  1 168 ? 18.732  -19.797 54.369  1.00 31.68  ? 167  TRP C NE1 1 
ATOM   6018  C CE2 . TRP C  1 168 ? 19.109  -21.001 54.902  1.00 30.14  ? 167  TRP C CE2 1 
ATOM   6019  C CE3 . TRP C  1 168 ? 21.032  -21.945 56.025  1.00 29.79  ? 167  TRP C CE3 1 
ATOM   6020  C CZ2 . TRP C  1 168 ? 18.411  -22.204 54.987  1.00 32.26  ? 167  TRP C CZ2 1 
ATOM   6021  C CZ3 . TRP C  1 168 ? 20.337  -23.147 56.105  1.00 28.89  ? 167  TRP C CZ3 1 
ATOM   6022  C CH2 . TRP C  1 168 ? 19.042  -23.267 55.590  1.00 30.47  ? 167  TRP C CH2 1 
ATOM   6023  N N   . LYS C  1 169 ? 24.521  -17.075 54.524  1.00 27.39  ? 168  LYS C N   1 
ATOM   6024  C CA  . LYS C  1 169 ? 25.499  -16.153 55.052  1.00 33.16  ? 168  LYS C CA  1 
ATOM   6025  C C   . LYS C  1 169 ? 24.808  -14.837 55.363  1.00 33.88  ? 168  LYS C C   1 
ATOM   6026  O O   . LYS C  1 169 ? 23.976  -14.351 54.600  1.00 35.10  ? 168  LYS C O   1 
ATOM   6027  C CB  . LYS C  1 169 ? 26.657  -15.961 54.066  1.00 29.78  ? 168  LYS C CB  1 
ATOM   6028  C CG  . LYS C  1 169 ? 26.249  -15.420 52.714  1.00 34.30  ? 168  LYS C CG  1 
ATOM   6029  C CD  . LYS C  1 169 ? 27.465  -15.308 51.778  1.00 38.22  ? 168  LYS C CD  1 
ATOM   6030  C CE  . LYS C  1 169 ? 27.049  -14.858 50.384  1.00 43.36  ? 168  LYS C CE  1 
ATOM   6031  N NZ  . LYS C  1 169 ? 28.223  -14.685 49.464  1.00 62.31  ? 168  LYS C NZ  1 
ATOM   6032  N N   . VAL C  1 170 ? 25.153  -14.276 56.510  1.00 35.89  ? 169  VAL C N   1 
ATOM   6033  C CA  . VAL C  1 170 ? 24.684  -12.966 56.905  1.00 29.10  ? 169  VAL C CA  1 
ATOM   6034  C C   . VAL C  1 170 ? 25.895  -12.050 56.846  1.00 35.17  ? 169  VAL C C   1 
ATOM   6035  O O   . VAL C  1 170 ? 26.812  -12.185 57.654  1.00 35.80  ? 169  VAL C O   1 
ATOM   6036  C CB  . VAL C  1 170 ? 24.096  -13.033 58.325  1.00 32.81  ? 169  VAL C CB  1 
ATOM   6037  C CG1 . VAL C  1 170 ? 23.676  -11.657 58.816  1.00 34.23  ? 169  VAL C CG1 1 
ATOM   6038  C CG2 . VAL C  1 170 ? 22.915  -13.995 58.340  1.00 30.42  ? 169  VAL C CG2 1 
ATOM   6039  N N   . ILE C  1 171 ? 25.917  -11.137 55.879  1.00 27.05  ? 170  ILE C N   1 
ATOM   6040  C CA  . ILE C  1 171 ? 27.130  -10.384 55.594  1.00 34.81  ? 170  ILE C CA  1 
ATOM   6041  C C   . ILE C  1 171 ? 26.964  -8.898  55.876  1.00 37.05  ? 170  ILE C C   1 
ATOM   6042  O O   . ILE C  1 171 ? 25.921  -8.307  55.597  1.00 36.72  ? 170  ILE C O   1 
ATOM   6043  C CB  . ILE C  1 171 ? 27.574  -10.541 54.116  1.00 41.28  ? 170  ILE C CB  1 
ATOM   6044  C CG1 . ILE C  1 171 ? 26.498  -10.005 53.177  1.00 39.37  ? 170  ILE C CG1 1 
ATOM   6045  C CG2 . ILE C  1 171 ? 27.878  -11.997 53.795  1.00 42.03  ? 170  ILE C CG2 1 
ATOM   6046  C CD1 . ILE C  1 171 ? 26.859  -10.081 51.736  1.00 50.71  ? 170  ILE C CD1 1 
ATOM   6047  N N   . PHE C  1 172 ? 28.009  -8.291  56.420  1.00 36.24  ? 171  PHE C N   1 
ATOM   6048  C CA  . PHE C  1 172 ? 28.002  -6.855  56.652  1.00 37.17  ? 171  PHE C CA  1 
ATOM   6049  C C   . PHE C  1 172 ? 27.765  -6.118  55.349  1.00 34.03  ? 171  PHE C C   1 
ATOM   6050  O O   . PHE C  1 172 ? 28.402  -6.397  54.341  1.00 37.84  ? 171  PHE C O   1 
ATOM   6051  C CB  . PHE C  1 172 ? 29.316  -6.395  57.265  1.00 38.78  ? 171  PHE C CB  1 
ATOM   6052  C CG  . PHE C  1 172 ? 29.359  -4.919  57.551  1.00 43.12  ? 171  PHE C CG  1 
ATOM   6053  C CD1 . PHE C  1 172 ? 28.875  -4.417  58.750  1.00 34.34  ? 171  PHE C CD1 1 
ATOM   6054  C CD2 . PHE C  1 172 ? 29.871  -4.037  56.619  1.00 33.45  ? 171  PHE C CD2 1 
ATOM   6055  C CE1 . PHE C  1 172 ? 28.908  -3.063  59.019  1.00 43.37  ? 171  PHE C CE1 1 
ATOM   6056  C CE2 . PHE C  1 172 ? 29.906  -2.676  56.879  1.00 46.61  ? 171  PHE C CE2 1 
ATOM   6057  C CZ  . PHE C  1 172 ? 29.427  -2.186  58.084  1.00 36.00  ? 171  PHE C CZ  1 
ATOM   6058  N N   . ASN C  1 173 ? 26.834  -5.174  55.385  1.00 35.71  ? 172  ASN C N   1 
ATOM   6059  C CA  . ASN C  1 173 ? 26.466  -4.403  54.211  1.00 43.39  ? 172  ASN C CA  1 
ATOM   6060  C C   . ASN C  1 173 ? 27.063  -3.000  54.330  1.00 48.41  ? 172  ASN C C   1 
ATOM   6061  O O   . ASN C  1 173 ? 28.066  -2.688  53.695  1.00 46.84  ? 172  ASN C O   1 
ATOM   6062  C CB  . ASN C  1 173 ? 24.943  -4.353  54.083  1.00 43.74  ? 172  ASN C CB  1 
ATOM   6063  C CG  . ASN C  1 173 ? 24.486  -3.723  52.782  1.00 49.78  ? 172  ASN C CG  1 
ATOM   6064  O OD1 . ASN C  1 173 ? 25.173  -3.806  51.773  1.00 52.13  ? 172  ASN C OD1 1 
ATOM   6065  N ND2 . ASN C  1 173 ? 23.319  -3.087  52.803  1.00 54.76  ? 172  ASN C ND2 1 
ATOM   6066  N N   . ASN C  1 174 ? 26.451  -2.168  55.165  1.00 36.12  ? 173  ASN C N   1 
ATOM   6067  C CA  . ASN C  1 174 ? 27.018  -0.870  55.516  1.00 53.03  ? 173  ASN C CA  1 
ATOM   6068  C C   . ASN C  1 174 ? 26.398  -0.382  56.817  1.00 50.71  ? 173  ASN C C   1 
ATOM   6069  O O   . ASN C  1 174 ? 25.428  -0.958  57.312  1.00 47.25  ? 173  ASN C O   1 
ATOM   6070  C CB  . ASN C  1 174 ? 26.817  0.153   54.393  1.00 45.83  ? 173  ASN C CB  1 
ATOM   6071  C CG  . ASN C  1 174 ? 25.357  0.366   54.046  1.00 56.57  ? 173  ASN C CG  1 
ATOM   6072  O OD1 . ASN C  1 174 ? 24.498  0.428   54.923  1.00 55.27  ? 173  ASN C OD1 1 
ATOM   6073  N ND2 . ASN C  1 174 ? 25.069  0.465   52.759  1.00 47.79  ? 173  ASN C ND2 1 
ATOM   6074  N N   . MET C  1 175 ? 26.960  0.674   57.383  1.00 39.04  ? 174  MET C N   1 
ATOM   6075  C CA  . MET C  1 175 ? 26.543  1.092   58.707  1.00 43.93  ? 174  MET C CA  1 
ATOM   6076  C C   . MET C  1 175 ? 26.726  2.576   58.906  1.00 49.72  ? 174  MET C C   1 
ATOM   6077  O O   . MET C  1 175 ? 27.686  3.164   58.411  1.00 43.79  ? 174  MET C O   1 
ATOM   6078  C CB  . MET C  1 175 ? 27.343  0.335   59.767  1.00 42.33  ? 174  MET C CB  1 
ATOM   6079  C CG  . MET C  1 175 ? 26.731  0.395   61.152  1.00 42.69  ? 174  MET C CG  1 
ATOM   6080  S SD  . MET C  1 175 ? 27.794  -0.314  62.419  1.00 56.12  ? 174  MET C SD  1 
ATOM   6081  C CE  . MET C  1 175 ? 29.114  0.900   62.458  1.00 55.98  ? 174  MET C CE  1 
ATOM   6082  N N   . VAL C  1 176 ? 25.795  3.179   59.634  1.00 49.86  ? 175  VAL C N   1 
ATOM   6083  C CA  . VAL C  1 176 ? 25.911  4.575   60.006  1.00 43.18  ? 175  VAL C CA  1 
ATOM   6084  C C   . VAL C  1 176 ? 26.865  4.698   61.185  1.00 48.17  ? 175  VAL C C   1 
ATOM   6085  O O   . VAL C  1 176 ? 26.725  4.007   62.192  1.00 52.89  ? 175  VAL C O   1 
ATOM   6086  C CB  . VAL C  1 176 ? 24.543  5.165   60.402  1.00 57.36  ? 175  VAL C CB  1 
ATOM   6087  C CG1 . VAL C  1 176 ? 24.701  6.609   60.868  1.00 45.04  ? 175  VAL C CG1 1 
ATOM   6088  C CG2 . VAL C  1 176 ? 23.575  5.075   59.234  1.00 54.60  ? 175  VAL C CG2 1 
ATOM   6089  N N   . ASN C  1 177 ? 27.839  5.583   61.048  1.00 41.03  ? 176  ASN C N   1 
ATOM   6090  C CA  . ASN C  1 177 ? 28.747  5.909   62.135  1.00 44.61  ? 176  ASN C CA  1 
ATOM   6091  C C   . ASN C  1 177 ? 28.471  7.315   62.675  1.00 48.95  ? 176  ASN C C   1 
ATOM   6092  O O   . ASN C  1 177 ? 28.916  8.306   62.094  1.00 37.21  ? 176  ASN C O   1 
ATOM   6093  C CB  . ASN C  1 177 ? 30.188  5.823   61.640  1.00 37.22  ? 176  ASN C CB  1 
ATOM   6094  C CG  . ASN C  1 177 ? 31.192  6.224   62.697  1.00 51.83  ? 176  ASN C CG  1 
ATOM   6095  O OD1 . ASN C  1 177 ? 30.834  6.754   63.750  1.00 55.56  ? 176  ASN C OD1 1 
ATOM   6096  N ND2 . ASN C  1 177 ? 32.464  5.993   62.411  1.00 47.17  ? 176  ASN C ND2 1 
ATOM   6097  N N   . GLN C  1 178 ? 27.748  7.387   63.792  1.00 52.51  ? 177  GLN C N   1 
ATOM   6098  C CA  . GLN C  1 178 ? 27.441  8.655   64.449  1.00 53.77  ? 177  GLN C CA  1 
ATOM   6099  C C   . GLN C  1 178 ? 26.809  9.675   63.507  1.00 51.71  ? 177  GLN C C   1 
ATOM   6100  O O   . GLN C  1 178 ? 27.289  10.796  63.405  1.00 55.17  ? 177  GLN C O   1 
ATOM   6101  C CB  . GLN C  1 178 ? 28.712  9.248   65.052  1.00 52.46  ? 177  GLN C CB  1 
ATOM   6102  C CG  . GLN C  1 178 ? 29.324  8.391   66.144  1.00 58.83  ? 177  GLN C CG  1 
ATOM   6103  C CD  . GLN C  1 178 ? 30.614  8.969   66.684  1.00 60.88  ? 177  GLN C CD  1 
ATOM   6104  O OE1 . GLN C  1 178 ? 30.617  9.699   67.674  1.00 83.17  ? 177  GLN C OE1 1 
ATOM   6105  N NE2 . GLN C  1 178 ? 31.719  8.642   66.040  1.00 55.63  ? 177  GLN C NE2 1 
ATOM   6106  N N   . ASN C  1 179 ? 25.732  9.279   62.832  1.00 57.34  ? 178  ASN C N   1 
ATOM   6107  C CA  . ASN C  1 179 ? 25.012  10.146  61.894  1.00 69.66  ? 178  ASN C CA  1 
ATOM   6108  C C   . ASN C  1 179 ? 25.716  10.340  60.552  1.00 63.74  ? 178  ASN C C   1 
ATOM   6109  O O   . ASN C  1 179 ? 25.140  10.920  59.634  1.00 71.47  ? 178  ASN C O   1 
ATOM   6110  C CB  . ASN C  1 179 ? 24.727  11.514  62.519  1.00 78.40  ? 178  ASN C CB  1 
ATOM   6111  C CG  . ASN C  1 179 ? 24.140  11.412  63.914  1.00 87.26  ? 178  ASN C CG  1 
ATOM   6112  O OD1 . ASN C  1 179 ? 24.421  12.244  64.774  1.00 102.43 ? 178  ASN C OD1 1 
ATOM   6113  N ND2 . ASN C  1 179 ? 23.337  10.383  64.151  1.00 81.61  ? 178  ASN C ND2 1 
ATOM   6114  N N   . TRP C  1 180 ? 26.950  9.847   60.437  1.00 77.62  ? 179  TRP C N   1 
ATOM   6115  C CA  . TRP C  1 180 ? 27.729  9.961   59.199  1.00 82.62  ? 179  TRP C CA  1 
ATOM   6116  C C   . TRP C  1 180 ? 27.681  8.676   58.374  1.00 80.09  ? 179  TRP C C   1 
ATOM   6117  O O   . TRP C  1 180 ? 27.385  7.603   58.896  1.00 83.53  ? 179  TRP C O   1 
ATOM   6118  C CB  . TRP C  1 180 ? 29.192  10.290  59.516  1.00 83.65  ? 179  TRP C CB  1 
ATOM   6119  C CG  . TRP C  1 180 ? 29.414  11.697  59.982  1.00 109.46 ? 179  TRP C CG  1 
ATOM   6120  C CD1 . TRP C  1 180 ? 29.150  12.202  61.224  1.00 107.37 ? 179  TRP C CD1 1 
ATOM   6121  C CD2 . TRP C  1 180 ? 29.953  12.780  59.215  1.00 123.05 ? 179  TRP C CD2 1 
ATOM   6122  N NE1 . TRP C  1 180 ? 29.489  13.534  61.275  1.00 123.47 ? 179  TRP C NE1 1 
ATOM   6123  C CE2 . TRP C  1 180 ? 29.983  13.912  60.055  1.00 127.92 ? 179  TRP C CE2 1 
ATOM   6124  C CE3 . TRP C  1 180 ? 30.411  12.903  57.899  1.00 121.54 ? 179  TRP C CE3 1 
ATOM   6125  C CZ2 . TRP C  1 180 ? 30.452  15.149  59.622  1.00 125.51 ? 179  TRP C CZ2 1 
ATOM   6126  C CZ3 . TRP C  1 180 ? 30.876  14.133  57.472  1.00 125.25 ? 179  TRP C CZ3 1 
ATOM   6127  C CH2 . TRP C  1 180 ? 30.894  15.239  58.331  1.00 123.77 ? 179  TRP C CH2 1 
ATOM   6128  N N   . GLY C  1 181 ? 27.985  8.785   57.085  1.00 71.00  ? 180  GLY C N   1 
ATOM   6129  C CA  . GLY C  1 181 ? 28.045  7.620   56.220  1.00 56.43  ? 180  GLY C CA  1 
ATOM   6130  C C   . GLY C  1 181 ? 26.786  7.434   55.397  1.00 64.74  ? 180  GLY C C   1 
ATOM   6131  O O   . GLY C  1 181 ? 26.266  8.392   54.830  1.00 74.64  ? 180  GLY C O   1 
ATOM   6132  N N   . PRO C  1 182 ? 26.293  6.191   55.306  1.00 49.68  ? 181  PRO C N   1 
ATOM   6133  C CA  . PRO C  1 182 ? 26.903  5.023   55.941  1.00 54.49  ? 181  PRO C CA  1 
ATOM   6134  C C   . PRO C  1 182 ? 28.250  4.677   55.315  1.00 62.32  ? 181  PRO C C   1 
ATOM   6135  O O   . PRO C  1 182 ? 28.562  5.145   54.220  1.00 55.95  ? 181  PRO C O   1 
ATOM   6136  C CB  . PRO C  1 182 ? 25.884  3.909   55.676  1.00 55.21  ? 181  PRO C CB  1 
ATOM   6137  C CG  . PRO C  1 182 ? 25.169  4.331   54.454  1.00 57.57  ? 181  PRO C CG  1 
ATOM   6138  C CD  . PRO C  1 182 ? 25.119  5.830   54.494  1.00 50.33  ? 181  PRO C CD  1 
ATOM   6139  N N   . TYR C  1 183 ? 29.040  3.873   56.016  1.00 50.30  ? 182  TYR C N   1 
ATOM   6140  C CA  . TYR C  1 183 ? 30.306  3.403   55.491  1.00 46.05  ? 182  TYR C CA  1 
ATOM   6141  C C   . TYR C  1 183 ? 30.256  1.894   55.316  1.00 56.49  ? 182  TYR C C   1 
ATOM   6142  O O   . TYR C  1 183 ? 29.465  1.208   55.973  1.00 47.78  ? 182  TYR C O   1 
ATOM   6143  C CB  . TYR C  1 183 ? 31.445  3.775   56.436  1.00 50.74  ? 182  TYR C CB  1 
ATOM   6144  C CG  . TYR C  1 183 ? 31.575  5.262   56.666  1.00 57.71  ? 182  TYR C CG  1 
ATOM   6145  C CD1 . TYR C  1 183 ? 31.091  5.848   57.821  1.00 51.56  ? 182  TYR C CD1 1 
ATOM   6146  C CD2 . TYR C  1 183 ? 32.182  6.081   55.724  1.00 55.59  ? 182  TYR C CD2 1 
ATOM   6147  C CE1 . TYR C  1 183 ? 31.208  7.206   58.037  1.00 59.29  ? 182  TYR C CE1 1 
ATOM   6148  C CE2 . TYR C  1 183 ? 32.302  7.436   55.933  1.00 52.49  ? 182  TYR C CE2 1 
ATOM   6149  C CZ  . TYR C  1 183 ? 31.812  7.995   57.092  1.00 57.89  ? 182  TYR C CZ  1 
ATOM   6150  O OH  . TYR C  1 183 ? 31.925  9.353   57.308  1.00 59.88  ? 182  TYR C OH  1 
ATOM   6151  N N   . ASP C  1 184 ? 31.095  1.379   54.422  1.00 45.69  ? 183  ASP C N   1 
ATOM   6152  C CA  . ASP C  1 184 ? 31.206  -0.059  54.235  1.00 44.66  ? 183  ASP C CA  1 
ATOM   6153  C C   . ASP C  1 184 ? 32.677  -0.479  54.182  1.00 50.40  ? 183  ASP C C   1 
ATOM   6154  O O   . ASP C  1 184 ? 33.571  0.313   54.470  1.00 45.66  ? 183  ASP C O   1 
ATOM   6155  C CB  . ASP C  1 184 ? 30.438  -0.509  52.989  1.00 42.50  ? 183  ASP C CB  1 
ATOM   6156  C CG  . ASP C  1 184 ? 31.000  0.067   51.706  1.00 63.86  ? 183  ASP C CG  1 
ATOM   6157  O OD1 . ASP C  1 184 ? 32.179  0.477   51.691  1.00 71.98  ? 183  ASP C OD1 1 
ATOM   6158  O OD2 . ASP C  1 184 ? 30.260  0.099   50.698  1.00 78.53  ? 183  ASP C OD2 1 
ATOM   6159  N N   . ARG C  1 185 ? 32.925  -1.732  53.825  1.00 47.72  ? 184  ARG C N   1 
ATOM   6160  C CA  . ARG C  1 185 ? 34.275  -2.283  53.877  1.00 53.97  ? 184  ARG C CA  1 
ATOM   6161  C C   . ARG C  1 185 ? 35.214  -1.660  52.844  1.00 50.81  ? 184  ARG C C   1 
ATOM   6162  O O   . ARG C  1 185 ? 36.424  -1.820  52.936  1.00 55.19  ? 184  ARG C O   1 
ATOM   6163  C CB  . ARG C  1 185 ? 34.224  -3.788  53.664  1.00 44.04  ? 184  ARG C CB  1 
ATOM   6164  C CG  . ARG C  1 185 ? 33.269  -4.505  54.594  1.00 49.47  ? 184  ARG C CG  1 
ATOM   6165  C CD  . ARG C  1 185 ? 32.932  -5.872  54.044  1.00 46.15  ? 184  ARG C CD  1 
ATOM   6166  N NE  . ARG C  1 185 ? 33.929  -6.857  54.412  1.00 41.80  ? 184  ARG C NE  1 
ATOM   6167  C CZ  . ARG C  1 185 ? 34.164  -7.979  53.738  1.00 46.01  ? 184  ARG C CZ  1 
ATOM   6168  N NH1 . ARG C  1 185 ? 35.088  -8.820  54.171  1.00 34.15  ? 184  ARG C NH1 1 
ATOM   6169  N NH2 . ARG C  1 185 ? 33.486  -8.255  52.628  1.00 38.83  ? 184  ARG C NH2 1 
ATOM   6170  N N   . ASP C  1 186 ? 34.650  -0.953  51.869  1.00 50.05  ? 185  ASP C N   1 
ATOM   6171  C CA  . ASP C  1 186 ? 35.431  -0.360  50.788  1.00 58.75  ? 185  ASP C CA  1 
ATOM   6172  C C   . ASP C  1 186 ? 35.444  1.165   50.812  1.00 66.42  ? 185  ASP C C   1 
ATOM   6173  O O   . ASP C  1 186 ? 36.019  1.796   49.926  1.00 68.64  ? 185  ASP C O   1 
ATOM   6174  C CB  . ASP C  1 186 ? 34.873  -0.822  49.445  1.00 64.59  ? 185  ASP C CB  1 
ATOM   6175  C CG  . ASP C  1 186 ? 35.078  -2.299  49.213  1.00 82.03  ? 185  ASP C CG  1 
ATOM   6176  O OD1 . ASP C  1 186 ? 36.127  -2.823  49.648  1.00 77.73  ? 185  ASP C OD1 1 
ATOM   6177  O OD2 . ASP C  1 186 ? 34.194  -2.933  48.600  1.00 96.07  ? 185  ASP C OD2 1 
ATOM   6178  N N   . SER C  1 187 ? 34.802  1.760   51.807  1.00 47.31  ? 186  SER C N   1 
ATOM   6179  C CA  . SER C  1 187 ? 34.763  3.204   51.898  1.00 51.21  ? 186  SER C CA  1 
ATOM   6180  C C   . SER C  1 187 ? 36.180  3.753   51.952  1.00 49.71  ? 186  SER C C   1 
ATOM   6181  O O   . SER C  1 187 ? 37.038  3.234   52.666  1.00 50.06  ? 186  SER C O   1 
ATOM   6182  C CB  . SER C  1 187 ? 33.976  3.636   53.133  1.00 45.00  ? 186  SER C CB  1 
ATOM   6183  O OG  . SER C  1 187 ? 32.589  3.467   52.917  1.00 54.84  ? 186  SER C OG  1 
ATOM   6184  N N   . TRP C  1 188 ? 36.428  4.802   51.186  1.00 46.32  ? 187  TRP C N   1 
ATOM   6185  C CA  . TRP C  1 188 ? 37.745  5.422   51.197  1.00 70.83  ? 187  TRP C CA  1 
ATOM   6186  C C   . TRP C  1 188 ? 37.688  6.926   50.979  1.00 60.63  ? 187  TRP C C   1 
ATOM   6187  O O   . TRP C  1 188 ? 37.170  7.413   49.974  1.00 66.05  ? 187  TRP C O   1 
ATOM   6188  C CB  . TRP C  1 188 ? 38.665  4.787   50.155  1.00 55.29  ? 187  TRP C CB  1 
ATOM   6189  C CG  . TRP C  1 188 ? 40.076  5.243   50.298  1.00 69.95  ? 187  TRP C CG  1 
ATOM   6190  C CD1 . TRP C  1 188 ? 40.710  6.194   49.552  1.00 71.05  ? 187  TRP C CD1 1 
ATOM   6191  C CD2 . TRP C  1 188 ? 41.032  4.787   51.262  1.00 72.07  ? 187  TRP C CD2 1 
ATOM   6192  N NE1 . TRP C  1 188 ? 42.003  6.353   49.988  1.00 55.74  ? 187  TRP C NE1 1 
ATOM   6193  C CE2 . TRP C  1 188 ? 42.227  5.501   51.036  1.00 66.31  ? 187  TRP C CE2 1 
ATOM   6194  C CE3 . TRP C  1 188 ? 40.996  3.841   52.292  1.00 61.87  ? 187  TRP C CE3 1 
ATOM   6195  C CZ2 . TRP C  1 188 ? 43.376  5.298   51.798  1.00 62.14  ? 187  TRP C CZ2 1 
ATOM   6196  C CZ3 . TRP C  1 188 ? 42.141  3.638   53.051  1.00 67.98  ? 187  TRP C CZ3 1 
ATOM   6197  C CH2 . TRP C  1 188 ? 43.314  4.364   52.799  1.00 75.26  ? 187  TRP C CH2 1 
ATOM   6198  N N   . ASN C  1 189 ? 38.226  7.649   51.949  1.00 74.29  ? 188  ASN C N   1 
ATOM   6199  C CA  . ASN C  1 189 ? 38.391  9.087   51.857  1.00 71.73  ? 188  ASN C CA  1 
ATOM   6200  C C   . ASN C  1 189 ? 39.888  9.346   51.768  1.00 81.10  ? 188  ASN C C   1 
ATOM   6201  O O   . ASN C  1 189 ? 40.659  8.753   52.517  1.00 74.20  ? 188  ASN C O   1 
ATOM   6202  C CB  . ASN C  1 189 ? 37.790  9.754   53.094  1.00 69.55  ? 188  ASN C CB  1 
ATOM   6203  C CG  . ASN C  1 189 ? 37.972  11.248  53.098  1.00 80.78  ? 188  ASN C CG  1 
ATOM   6204  O OD1 . ASN C  1 189 ? 39.026  11.748  53.473  1.00 79.82  ? 188  ASN C OD1 1 
ATOM   6205  N ND2 . ASN C  1 189 ? 36.938  11.973  52.693  1.00 86.74  ? 188  ASN C ND2 1 
ATOM   6206  N N   . PRO C  1 190 ? 40.313  10.205  50.832  1.00 80.27  ? 189  PRO C N   1 
ATOM   6207  C CA  . PRO C  1 190 ? 41.748  10.403  50.605  1.00 73.15  ? 189  PRO C CA  1 
ATOM   6208  C C   . PRO C  1 190 ? 42.527  10.775  51.872  1.00 70.68  ? 189  PRO C C   1 
ATOM   6209  O O   . PRO C  1 190 ? 43.676  10.364  52.021  1.00 65.87  ? 189  PRO C O   1 
ATOM   6210  C CB  . PRO C  1 190 ? 41.791  11.541  49.576  1.00 80.96  ? 189  PRO C CB  1 
ATOM   6211  C CG  . PRO C  1 190 ? 40.430  12.171  49.621  1.00 84.67  ? 189  PRO C CG  1 
ATOM   6212  C CD  . PRO C  1 190 ? 39.491  11.077  49.978  1.00 76.90  ? 189  PRO C CD  1 
ATOM   6213  N N   . VAL C  1 191 ? 41.920  11.516  52.789  1.00 56.62  ? 190  VAL C N   1 
ATOM   6214  C CA  . VAL C  1 191 ? 42.666  11.998  53.950  1.00 69.97  ? 190  VAL C CA  1 
ATOM   6215  C C   . VAL C  1 191 ? 42.513  11.094  55.174  1.00 66.78  ? 190  VAL C C   1 
ATOM   6216  O O   . VAL C  1 191 ? 43.504  10.778  55.835  1.00 68.44  ? 190  VAL C O   1 
ATOM   6217  C CB  . VAL C  1 191 ? 42.314  13.475  54.302  1.00 71.34  ? 190  VAL C CB  1 
ATOM   6218  C CG1 . VAL C  1 191 ? 41.079  13.951  53.538  1.00 79.76  ? 190  VAL C CG1 1 
ATOM   6219  C CG2 . VAL C  1 191 ? 42.136  13.651  55.807  1.00 75.13  ? 190  VAL C CG2 1 
ATOM   6220  N N   . TYR C  1 192 ? 41.286  10.663  55.462  1.00 68.32  ? 191  TYR C N   1 
ATOM   6221  C CA  . TYR C  1 192 ? 41.018  9.839   56.643  1.00 67.28  ? 191  TYR C CA  1 
ATOM   6222  C C   . TYR C  1 192 ? 40.906  8.335   56.348  1.00 63.95  ? 191  TYR C C   1 
ATOM   6223  O O   . TYR C  1 192 ? 40.755  7.526   57.264  1.00 61.33  ? 191  TYR C O   1 
ATOM   6224  C CB  . TYR C  1 192 ? 39.732  10.303  57.307  1.00 57.18  ? 191  TYR C CB  1 
ATOM   6225  C CG  . TYR C  1 192 ? 39.719  11.766  57.666  1.00 60.45  ? 191  TYR C CG  1 
ATOM   6226  C CD1 . TYR C  1 192 ? 38.946  12.666  56.951  1.00 65.19  ? 191  TYR C CD1 1 
ATOM   6227  C CD2 . TYR C  1 192 ? 40.473  12.246  58.729  1.00 67.76  ? 191  TYR C CD2 1 
ATOM   6228  C CE1 . TYR C  1 192 ? 38.922  14.012  57.286  1.00 72.73  ? 191  TYR C CE1 1 
ATOM   6229  C CE2 . TYR C  1 192 ? 40.457  13.590  59.071  1.00 65.58  ? 191  TYR C CE2 1 
ATOM   6230  C CZ  . TYR C  1 192 ? 39.679  14.466  58.347  1.00 67.31  ? 191  TYR C CZ  1 
ATOM   6231  O OH  . TYR C  1 192 ? 39.657  15.800  58.677  1.00 80.36  ? 191  TYR C OH  1 
ATOM   6232  N N   . GLY C  1 193 ? 40.982  7.967   55.075  1.00 66.86  ? 192  GLY C N   1 
ATOM   6233  C CA  . GLY C  1 193 ? 40.839  6.580   54.664  1.00 70.87  ? 192  GLY C CA  1 
ATOM   6234  C C   . GLY C  1 193 ? 39.443  6.047   54.926  1.00 55.62  ? 192  GLY C C   1 
ATOM   6235  O O   . GLY C  1 193 ? 38.453  6.768   54.784  1.00 45.66  ? 192  GLY C O   1 
ATOM   6236  N N   . ASN C  1 194 ? 39.366  4.771   55.295  1.00 61.87  ? 193  ASN C N   1 
ATOM   6237  C CA  . ASN C  1 194 ? 38.108  4.156   55.709  1.00 57.12  ? 193  ASN C CA  1 
ATOM   6238  C C   . ASN C  1 194 ? 37.765  4.506   57.163  1.00 50.04  ? 193  ASN C C   1 
ATOM   6239  O O   . ASN C  1 194 ? 38.465  4.102   58.096  1.00 44.78  ? 193  ASN C O   1 
ATOM   6240  C CB  . ASN C  1 194 ? 38.169  2.634   55.537  1.00 44.40  ? 193  ASN C CB  1 
ATOM   6241  C CG  . ASN C  1 194 ? 36.803  1.984   55.655  1.00 49.51  ? 193  ASN C CG  1 
ATOM   6242  O OD1 . ASN C  1 194 ? 35.903  2.528   56.291  1.00 57.90  ? 193  ASN C OD1 1 
ATOM   6243  N ND2 . ASN C  1 194 ? 36.637  0.824   55.032  1.00 48.72  ? 193  ASN C ND2 1 
ATOM   6244  N N   . GLN C  1 195 ? 36.680  5.253   57.344  1.00 38.76  ? 194  GLN C N   1 
ATOM   6245  C CA  . GLN C  1 195 ? 36.268  5.735   58.660  1.00 43.29  ? 194  GLN C CA  1 
ATOM   6246  C C   . GLN C  1 195 ? 35.193  4.850   59.305  1.00 42.72  ? 194  GLN C C   1 
ATOM   6247  O O   . GLN C  1 195 ? 34.476  5.290   60.199  1.00 38.58  ? 194  GLN C O   1 
ATOM   6248  C CB  . GLN C  1 195 ? 35.723  7.158   58.531  1.00 45.49  ? 194  GLN C CB  1 
ATOM   6249  C CG  . GLN C  1 195 ? 36.631  8.088   57.738  1.00 54.46  ? 194  GLN C CG  1 
ATOM   6250  C CD  . GLN C  1 195 ? 36.006  9.456   57.492  1.00 56.85  ? 194  GLN C CD  1 
ATOM   6251  O OE1 . GLN C  1 195 ? 35.756  10.216  58.428  1.00 62.40  ? 194  GLN C OE1 1 
ATOM   6252  N NE2 . GLN C  1 195 ? 35.738  9.765   56.227  1.00 55.93  ? 194  GLN C NE2 1 
ATOM   6253  N N   . LEU C  1 196 ? 35.090  3.604   58.854  1.00 61.47  ? 195  LEU C N   1 
ATOM   6254  C CA  . LEU C  1 196 ? 34.018  2.716   59.294  1.00 43.63  ? 195  LEU C CA  1 
ATOM   6255  C C   . LEU C  1 196 ? 33.816  2.746   60.817  1.00 52.25  ? 195  LEU C C   1 
ATOM   6256  O O   . LEU C  1 196 ? 32.740  3.119   61.292  1.00 39.02  ? 195  LEU C O   1 
ATOM   6257  C CB  . LEU C  1 196 ? 34.289  1.290   58.806  1.00 49.07  ? 195  LEU C CB  1 
ATOM   6258  C CG  . LEU C  1 196 ? 33.255  0.226   59.172  1.00 56.25  ? 195  LEU C CG  1 
ATOM   6259  C CD1 . LEU C  1 196 ? 31.822  0.737   59.016  1.00 46.19  ? 195  LEU C CD1 1 
ATOM   6260  C CD2 . LEU C  1 196 ? 33.486  -1.021  58.331  1.00 55.23  ? 195  LEU C CD2 1 
ATOM   6261  N N   . PHE C  1 197 ? 34.843  2.372   61.579  1.00 38.81  ? 196  PHE C N   1 
ATOM   6262  C CA  . PHE C  1 197 ? 34.734  2.349   63.035  1.00 38.44  ? 196  PHE C CA  1 
ATOM   6263  C C   . PHE C  1 197 ? 35.584  3.413   63.734  1.00 48.07  ? 196  PHE C C   1 
ATOM   6264  O O   . PHE C  1 197 ? 36.026  3.220   64.868  1.00 46.63  ? 196  PHE C O   1 
ATOM   6265  C CB  . PHE C  1 197 ? 35.107  0.965   63.565  1.00 46.68  ? 196  PHE C CB  1 
ATOM   6266  C CG  . PHE C  1 197 ? 34.247  -0.141  63.022  1.00 47.55  ? 196  PHE C CG  1 
ATOM   6267  C CD1 . PHE C  1 197 ? 34.819  -1.230  62.382  1.00 40.15  ? 196  PHE C CD1 1 
ATOM   6268  C CD2 . PHE C  1 197 ? 32.865  -0.088  63.143  1.00 37.29  ? 196  PHE C CD2 1 
ATOM   6269  C CE1 . PHE C  1 197 ? 34.027  -2.257  61.876  1.00 44.34  ? 196  PHE C CE1 1 
ATOM   6270  C CE2 . PHE C  1 197 ? 32.063  -1.110  62.642  1.00 41.64  ? 196  PHE C CE2 1 
ATOM   6271  C CZ  . PHE C  1 197 ? 32.648  -2.197  62.006  1.00 39.64  ? 196  PHE C CZ  1 
ATOM   6272  N N   . MET C  1 198 ? 35.797  4.538   63.062  1.00 45.96  ? 197  MET C N   1 
ATOM   6273  C CA  . MET C  1 198 ? 36.614  5.619   63.608  1.00 53.70  ? 197  MET C CA  1 
ATOM   6274  C C   . MET C  1 198 ? 35.802  6.461   64.584  1.00 41.87  ? 197  MET C C   1 
ATOM   6275  O O   . MET C  1 198 ? 34.756  7.007   64.227  1.00 51.94  ? 197  MET C O   1 
ATOM   6276  C CB  . MET C  1 198 ? 37.144  6.502   62.473  1.00 51.46  ? 197  MET C CB  1 
ATOM   6277  C CG  . MET C  1 198 ? 38.128  7.580   62.926  1.00 67.03  ? 197  MET C CG  1 
ATOM   6278  S SD  . MET C  1 198 ? 39.112  8.279   61.575  1.00 64.15  ? 197  MET C SD  1 
ATOM   6279  C CE  . MET C  1 198 ? 37.856  9.163   60.668  1.00 68.38  ? 197  MET C CE  1 
ATOM   6280  N N   . LYS C  1 199 ? 36.283  6.574   65.818  1.00 46.79  ? 198  LYS C N   1 
ATOM   6281  C CA  . LYS C  1 199 ? 35.567  7.336   66.841  1.00 51.75  ? 198  LYS C CA  1 
ATOM   6282  C C   . LYS C  1 199 ? 35.713  8.844   66.628  1.00 45.00  ? 198  LYS C C   1 
ATOM   6283  O O   . LYS C  1 199 ? 34.723  9.572   66.632  1.00 57.29  ? 198  LYS C O   1 
ATOM   6284  C CB  . LYS C  1 199 ? 36.044  6.952   68.242  1.00 42.76  ? 198  LYS C CB  1 
ATOM   6285  C CG  . LYS C  1 199 ? 35.322  7.700   69.360  1.00 55.28  ? 198  LYS C CG  1 
ATOM   6286  C CD  . LYS C  1 199 ? 35.712  7.162   70.731  1.00 53.29  ? 198  LYS C CD  1 
ATOM   6287  C CE  . LYS C  1 199 ? 34.827  7.744   71.822  1.00 90.80  ? 198  LYS C CE  1 
ATOM   6288  N NZ  . LYS C  1 199 ? 35.097  7.147   73.165  1.00 76.32  ? 198  LYS C NZ  1 
ATOM   6289  N N   . THR C  1 200 ? 36.944  9.310   66.439  1.00 38.01  ? 199  THR C N   1 
ATOM   6290  C CA  . THR C  1 200 ? 37.198  10.732  66.201  1.00 51.41  ? 199  THR C CA  1 
ATOM   6291  C C   . THR C  1 200 ? 38.305  10.903  65.171  1.00 52.10  ? 199  THR C C   1 
ATOM   6292  O O   . THR C  1 200 ? 39.213  10.082  65.101  1.00 60.00  ? 199  THR C O   1 
ATOM   6293  C CB  . THR C  1 200 ? 37.641  11.464  67.489  1.00 50.64  ? 199  THR C CB  1 
ATOM   6294  O OG1 . THR C  1 200 ? 38.955  11.025  67.865  1.00 53.73  ? 199  THR C OG1 1 
ATOM   6295  C CG2 . THR C  1 200 ? 36.664  11.210  68.642  1.00 42.10  ? 199  THR C CG2 1 
ATOM   6296  N N   . ARG C  1 201 ? 38.248  11.982  64.394  1.00 68.70  ? 200  ARG C N   1 
ATOM   6297  C CA  . ARG C  1 201 ? 39.268  12.239  63.378  1.00 70.46  ? 200  ARG C CA  1 
ATOM   6298  C C   . ARG C  1 201 ? 40.525  12.897  63.936  1.00 66.61  ? 200  ARG C C   1 
ATOM   6299  O O   . ARG C  1 201 ? 41.580  12.833  63.312  1.00 69.85  ? 200  ARG C O   1 
ATOM   6300  C CB  . ARG C  1 201 ? 38.710  13.132  62.278  1.00 58.93  ? 200  ARG C CB  1 
ATOM   6301  C CG  . ARG C  1 201 ? 37.457  12.594  61.645  1.00 69.97  ? 200  ARG C CG  1 
ATOM   6302  C CD  . ARG C  1 201 ? 37.076  13.404  60.428  1.00 63.89  ? 200  ARG C CD  1 
ATOM   6303  N NE  . ARG C  1 201 ? 35.818  12.950  59.852  1.00 73.80  ? 200  ARG C NE  1 
ATOM   6304  C CZ  . ARG C  1 201 ? 35.280  13.446  58.745  1.00 74.65  ? 200  ARG C CZ  1 
ATOM   6305  N NH1 . ARG C  1 201 ? 34.124  12.970  58.301  1.00 97.18  ? 200  ARG C NH1 1 
ATOM   6306  N NH2 . ARG C  1 201 ? 35.892  14.420  58.084  1.00 88.45  ? 200  ARG C NH2 1 
ATOM   6307  N N   . ASN C  1 202 ? 40.416  13.519  65.107  1.00 51.56  ? 201  ASN C N   1 
ATOM   6308  C CA  . ASN C  1 202 ? 41.498  14.359  65.617  1.00 79.43  ? 201  ASN C CA  1 
ATOM   6309  C C   . ASN C  1 202 ? 41.848  14.120  67.078  1.00 89.51  ? 201  ASN C C   1 
ATOM   6310  O O   . ASN C  1 202 ? 42.803  14.703  67.592  1.00 88.13  ? 201  ASN C O   1 
ATOM   6311  C CB  . ASN C  1 202 ? 41.130  15.834  65.436  1.00 65.30  ? 201  ASN C CB  1 
ATOM   6312  C CG  . ASN C  1 202 ? 40.968  16.215  63.980  1.00 91.76  ? 201  ASN C CG  1 
ATOM   6313  O OD1 . ASN C  1 202 ? 41.679  15.708  63.109  1.00 81.01  ? 201  ASN C OD1 1 
ATOM   6314  N ND2 . ASN C  1 202 ? 40.031  17.111  63.706  1.00 94.77  ? 201  ASN C ND2 1 
ATOM   6315  N N   . GLY C  1 203 ? 41.074  13.270  67.745  1.00 68.04  ? 202  GLY C N   1 
ATOM   6316  C CA  . GLY C  1 203 ? 41.244  13.036  69.166  1.00 55.06  ? 202  GLY C CA  1 
ATOM   6317  C C   . GLY C  1 203 ? 42.688  12.825  69.572  1.00 60.24  ? 202  GLY C C   1 
ATOM   6318  O O   . GLY C  1 203 ? 43.501  12.343  68.781  1.00 70.40  ? 202  GLY C O   1 
ATOM   6319  N N   . SER C  1 204 ? 43.000  13.179  70.816  1.00 83.94  ? 203  SER C N   1 
ATOM   6320  C CA  . SER C  1 204 ? 44.354  13.048  71.344  1.00 78.43  ? 203  SER C CA  1 
ATOM   6321  C C   . SER C  1 204 ? 44.491  11.801  72.216  1.00 87.64  ? 203  SER C C   1 
ATOM   6322  O O   . SER C  1 204 ? 45.482  11.636  72.927  1.00 95.40  ? 203  SER C O   1 
ATOM   6323  C CB  . SER C  1 204 ? 44.724  14.295  72.149  1.00 91.59  ? 203  SER C CB  1 
ATOM   6324  O OG  . SER C  1 204 ? 43.794  14.517  73.196  1.00 84.59  ? 203  SER C OG  1 
ATOM   6325  N N   . MET C  1 205 ? 43.493  10.926  72.155  1.00 72.33  ? 204  MET C N   1 
ATOM   6326  C CA  . MET C  1 205 ? 43.521  9.673   72.899  1.00 62.06  ? 204  MET C CA  1 
ATOM   6327  C C   . MET C  1 205 ? 44.438  8.663   72.203  1.00 73.62  ? 204  MET C C   1 
ATOM   6328  O O   . MET C  1 205 ? 44.865  8.882   71.070  1.00 54.08  ? 204  MET C O   1 
ATOM   6329  C CB  . MET C  1 205 ? 42.100  9.103   73.037  1.00 65.43  ? 204  MET C CB  1 
ATOM   6330  C CG  . MET C  1 205 ? 41.528  8.449   71.771  1.00 66.84  ? 204  MET C CG  1 
ATOM   6331  S SD  . MET C  1 205 ? 41.025  9.601   70.470  1.00 77.40  ? 204  MET C SD  1 
ATOM   6332  C CE  . MET C  1 205 ? 39.617  10.404  71.236  1.00 58.37  ? 204  MET C CE  1 
ATOM   6333  N N   . LYS C  1 206 ? 44.743  7.563   72.886  1.00 80.37  ? 205  LYS C N   1 
ATOM   6334  C CA  . LYS C  1 206 ? 45.532  6.483   72.295  1.00 82.29  ? 205  LYS C CA  1 
ATOM   6335  C C   . LYS C  1 206 ? 44.823  5.926   71.066  1.00 72.98  ? 205  LYS C C   1 
ATOM   6336  O O   . LYS C  1 206 ? 43.630  6.154   70.872  1.00 64.42  ? 205  LYS C O   1 
ATOM   6337  C CB  . LYS C  1 206 ? 45.737  5.350   73.303  1.00 87.86  ? 205  LYS C CB  1 
ATOM   6338  C CG  . LYS C  1 206 ? 46.437  5.763   74.586  1.00 107.27 ? 205  LYS C CG  1 
ATOM   6339  C CD  . LYS C  1 206 ? 45.977  4.913   75.766  1.00 109.25 ? 205  LYS C CD  1 
ATOM   6340  C CE  . LYS C  1 206 ? 46.078  3.428   75.463  1.00 95.97  ? 205  LYS C CE  1 
ATOM   6341  N NZ  . LYS C  1 206 ? 47.471  3.027   75.143  1.00 108.63 ? 205  LYS C NZ  1 
ATOM   6342  N N   . ALA C  1 207 ? 45.555  5.185   70.241  1.00 69.07  ? 206  ALA C N   1 
ATOM   6343  C CA  . ALA C  1 207 ? 44.967  4.579   69.055  1.00 72.14  ? 206  ALA C CA  1 
ATOM   6344  C C   . ALA C  1 207 ? 43.881  3.589   69.468  1.00 68.75  ? 206  ALA C C   1 
ATOM   6345  O O   . ALA C  1 207 ? 42.788  3.586   68.905  1.00 58.89  ? 206  ALA C O   1 
ATOM   6346  C CB  . ALA C  1 207 ? 46.037  3.886   68.217  1.00 61.97  ? 206  ALA C CB  1 
ATOM   6347  N N   . ALA C  1 208 ? 44.181  2.764   70.467  1.00 56.88  ? 207  ALA C N   1 
ATOM   6348  C CA  . ALA C  1 208 ? 43.251  1.726   70.902  1.00 62.30  ? 207  ALA C CA  1 
ATOM   6349  C C   . ALA C  1 208 ? 42.020  2.310   71.586  1.00 63.08  ? 207  ALA C C   1 
ATOM   6350  O O   . ALA C  1 208 ? 41.087  1.581   71.921  1.00 65.02  ? 207  ALA C O   1 
ATOM   6351  C CB  . ALA C  1 208 ? 43.953  0.750   71.830  1.00 53.92  ? 207  ALA C CB  1 
ATOM   6352  N N   . GLU C  1 209 ? 42.017  3.622   71.789  1.00 57.87  ? 208  GLU C N   1 
ATOM   6353  C CA  . GLU C  1 209 ? 40.908  4.288   72.463  1.00 43.72  ? 208  GLU C CA  1 
ATOM   6354  C C   . GLU C  1 209 ? 40.042  5.038   71.467  1.00 51.11  ? 208  GLU C C   1 
ATOM   6355  O O   . GLU C  1 209 ? 39.096  5.724   71.852  1.00 54.85  ? 208  GLU C O   1 
ATOM   6356  C CB  . GLU C  1 209 ? 41.441  5.289   73.486  1.00 69.02  ? 208  GLU C CB  1 
ATOM   6357  C CG  . GLU C  1 209 ? 42.144  4.667   74.684  1.00 68.92  ? 208  GLU C CG  1 
ATOM   6358  C CD  . GLU C  1 209 ? 42.459  5.698   75.763  1.00 100.22 ? 208  GLU C CD  1 
ATOM   6359  O OE1 . GLU C  1 209 ? 42.709  6.879   75.417  1.00 89.68  ? 208  GLU C OE1 1 
ATOM   6360  O OE2 . GLU C  1 209 ? 42.440  5.332   76.961  1.00 93.66  ? 208  GLU C OE2 1 
ATOM   6361  N N   . ASN C  1 210 ? 40.373  4.923   70.186  1.00 43.77  ? 209  ASN C N   1 
ATOM   6362  C CA  . ASN C  1 210 ? 39.718  5.739   69.179  1.00 56.09  ? 209  ASN C CA  1 
ATOM   6363  C C   . ASN C  1 210 ? 38.782  4.964   68.258  1.00 54.55  ? 209  ASN C C   1 
ATOM   6364  O O   . ASN C  1 210 ? 38.531  5.372   67.128  1.00 51.74  ? 209  ASN C O   1 
ATOM   6365  C CB  . ASN C  1 210 ? 40.754  6.474   68.335  1.00 52.66  ? 209  ASN C CB  1 
ATOM   6366  C CG  . ASN C  1 210 ? 40.132  7.562   67.503  1.00 50.94  ? 209  ASN C CG  1 
ATOM   6367  O OD1 . ASN C  1 210 ? 39.161  8.194   67.922  1.00 47.02  ? 209  ASN C OD1 1 
ATOM   6368  N ND2 . ASN C  1 210 ? 40.657  7.765   66.306  1.00 52.97  ? 209  ASN C ND2 1 
ATOM   6369  N N   . PHE C  1 211 ? 38.261  3.849   68.748  1.00 53.20  ? 210  PHE C N   1 
ATOM   6370  C CA  . PHE C  1 211 ? 37.313  3.053   67.984  1.00 52.49  ? 210  PHE C CA  1 
ATOM   6371  C C   . PHE C  1 211 ? 35.888  3.320   68.455  1.00 49.67  ? 210  PHE C C   1 
ATOM   6372  O O   . PHE C  1 211 ? 35.656  3.593   69.628  1.00 42.21  ? 210  PHE C O   1 
ATOM   6373  C CB  . PHE C  1 211 ? 37.634  1.570   68.131  1.00 48.28  ? 210  PHE C CB  1 
ATOM   6374  C CG  . PHE C  1 211 ? 38.916  1.157   67.452  1.00 55.63  ? 210  PHE C CG  1 
ATOM   6375  C CD1 . PHE C  1 211 ? 38.991  1.102   66.075  1.00 42.79  ? 210  PHE C CD1 1 
ATOM   6376  C CD2 . PHE C  1 211 ? 40.037  0.811   68.194  1.00 53.77  ? 210  PHE C CD2 1 
ATOM   6377  C CE1 . PHE C  1 211 ? 40.161  0.721   65.447  1.00 54.12  ? 210  PHE C CE1 1 
ATOM   6378  C CE2 . PHE C  1 211 ? 41.208  0.439   67.571  1.00 49.03  ? 210  PHE C CE2 1 
ATOM   6379  C CZ  . PHE C  1 211 ? 41.270  0.390   66.196  1.00 48.97  ? 210  PHE C CZ  1 
ATOM   6380  N N   . LEU C  1 212 ? 34.945  3.253   67.523  1.00 53.02  ? 211  LEU C N   1 
ATOM   6381  C CA  . LEU C  1 212 ? 33.538  3.434   67.834  1.00 44.83  ? 211  LEU C CA  1 
ATOM   6382  C C   . LEU C  1 212 ? 33.117  2.475   68.952  1.00 51.39  ? 211  LEU C C   1 
ATOM   6383  O O   . LEU C  1 212 ? 33.504  1.309   68.976  1.00 47.77  ? 211  LEU C O   1 
ATOM   6384  C CB  . LEU C  1 212 ? 32.700  3.203   66.576  1.00 43.49  ? 211  LEU C CB  1 
ATOM   6385  C CG  . LEU C  1 212 ? 31.211  3.526   66.651  1.00 53.24  ? 211  LEU C CG  1 
ATOM   6386  C CD1 . LEU C  1 212 ? 30.987  4.991   66.992  1.00 48.58  ? 211  LEU C CD1 1 
ATOM   6387  C CD2 . LEU C  1 212 ? 30.538  3.169   65.334  1.00 43.98  ? 211  LEU C CD2 1 
ATOM   6388  N N   . ASP C  1 213 ? 32.344  2.987   69.899  1.00 49.08  ? 212  ASP C N   1 
ATOM   6389  C CA  . ASP C  1 213 ? 31.829  2.174   70.988  1.00 50.34  ? 212  ASP C CA  1 
ATOM   6390  C C   . ASP C  1 213 ? 30.846  1.148   70.426  1.00 44.79  ? 212  ASP C C   1 
ATOM   6391  O O   . ASP C  1 213 ? 29.961  1.498   69.651  1.00 43.46  ? 212  ASP C O   1 
ATOM   6392  C CB  . ASP C  1 213 ? 31.153  3.089   72.020  1.00 48.18  ? 212  ASP C CB  1 
ATOM   6393  C CG  . ASP C  1 213 ? 30.381  2.330   73.075  1.00 72.97  ? 212  ASP C CG  1 
ATOM   6394  O OD1 . ASP C  1 213 ? 30.607  1.112   73.250  1.00 79.47  ? 212  ASP C OD1 1 
ATOM   6395  O OD2 . ASP C  1 213 ? 29.544  2.968   73.742  1.00 76.80  ? 212  ASP C OD2 1 
ATOM   6396  N N   . PRO C  1 214 ? 31.006  -0.130  70.805  1.00 46.91  ? 213  PRO C N   1 
ATOM   6397  C CA  . PRO C  1 214 ? 30.087  -1.179  70.337  1.00 50.69  ? 213  PRO C CA  1 
ATOM   6398  C C   . PRO C  1 214 ? 28.604  -0.856  70.568  1.00 49.15  ? 213  PRO C C   1 
ATOM   6399  O O   . PRO C  1 214 ? 27.762  -1.242  69.761  1.00 38.56  ? 213  PRO C O   1 
ATOM   6400  C CB  . PRO C  1 214 ? 30.507  -2.416  71.153  1.00 45.12  ? 213  PRO C CB  1 
ATOM   6401  C CG  . PRO C  1 214 ? 31.433  -1.904  72.237  1.00 53.47  ? 213  PRO C CG  1 
ATOM   6402  C CD  . PRO C  1 214 ? 32.070  -0.680  71.662  1.00 50.20  ? 213  PRO C CD  1 
ATOM   6403  N N   . ASN C  1 215 ? 28.284  -0.150  71.647  1.00 40.16  ? 214  ASN C N   1 
ATOM   6404  C CA  . ASN C  1 215 ? 26.899  0.232   71.901  1.00 43.08  ? 214  ASN C CA  1 
ATOM   6405  C C   . ASN C  1 215 ? 26.333  1.160   70.832  1.00 42.96  ? 214  ASN C C   1 
ATOM   6406  O O   . ASN C  1 215 ? 25.120  1.248   70.659  1.00 43.67  ? 214  ASN C O   1 
ATOM   6407  C CB  . ASN C  1 215 ? 26.771  0.894   73.272  1.00 49.99  ? 214  ASN C CB  1 
ATOM   6408  C CG  . ASN C  1 215 ? 27.035  -0.069  74.409  1.00 60.06  ? 214  ASN C CG  1 
ATOM   6409  O OD1 . ASN C  1 215 ? 26.936  -1.288  74.248  1.00 53.32  ? 214  ASN C OD1 1 
ATOM   6410  N ND2 . ASN C  1 215 ? 27.363  0.475   75.573  1.00 65.44  ? 214  ASN C ND2 1 
ATOM   6411  N N   . LYS C  1 216 ? 27.210  1.860   70.121  1.00 42.68  ? 215  LYS C N   1 
ATOM   6412  C CA  . LYS C  1 216 ? 26.772  2.793   69.080  1.00 54.84  ? 215  LYS C CA  1 
ATOM   6413  C C   . LYS C  1 216 ? 26.852  2.177   67.683  1.00 48.10  ? 215  LYS C C   1 
ATOM   6414  O O   . LYS C  1 216 ? 26.669  2.862   66.684  1.00 53.81  ? 215  LYS C O   1 
ATOM   6415  C CB  . LYS C  1 216 ? 27.600  4.080   69.129  1.00 48.42  ? 215  LYS C CB  1 
ATOM   6416  C CG  . LYS C  1 216 ? 27.403  4.884   70.396  1.00 53.58  ? 215  LYS C CG  1 
ATOM   6417  C CD  . LYS C  1 216 ? 28.179  6.184   70.320  1.00 73.25  ? 215  LYS C CD  1 
ATOM   6418  C CE  . LYS C  1 216 ? 27.933  7.051   71.542  1.00 88.96  ? 215  LYS C CE  1 
ATOM   6419  N NZ  . LYS C  1 216 ? 28.663  8.345   71.455  1.00 88.60  ? 215  LYS C NZ  1 
ATOM   6420  N N   . ALA C  1 217 ? 27.129  0.881   67.620  1.00 49.78  ? 216  ALA C N   1 
ATOM   6421  C CA  . ALA C  1 217 ? 27.173  0.172   66.349  1.00 48.69  ? 216  ALA C CA  1 
ATOM   6422  C C   . ALA C  1 217 ? 26.173  -0.973  66.367  1.00 42.43  ? 216  ALA C C   1 
ATOM   6423  O O   . ALA C  1 217 ? 25.594  -1.282  67.403  1.00 50.49  ? 216  ALA C O   1 
ATOM   6424  C CB  . ALA C  1 217 ? 28.564  -0.349  66.095  1.00 41.59  ? 216  ALA C CB  1 
ATOM   6425  N N   . SER C  1 218 ? 25.966  -1.598  65.215  1.00 46.44  ? 217  SER C N   1 
ATOM   6426  C CA  . SER C  1 218 ? 25.068  -2.737  65.126  1.00 41.02  ? 217  SER C CA  1 
ATOM   6427  C C   . SER C  1 218 ? 25.392  -3.755  66.220  1.00 44.02  ? 217  SER C C   1 
ATOM   6428  O O   . SER C  1 218 ? 26.548  -4.132  66.416  1.00 41.85  ? 217  SER C O   1 
ATOM   6429  C CB  . SER C  1 218 ? 25.178  -3.399  63.752  1.00 43.91  ? 217  SER C CB  1 
ATOM   6430  O OG  . SER C  1 218 ? 24.512  -4.651  63.743  1.00 47.01  ? 217  SER C OG  1 
ATOM   6431  N N   . SER C  1 219 ? 24.365  -4.210  66.921  1.00 29.14  ? 218  SER C N   1 
ATOM   6432  C CA  . SER C  1 219 ? 24.564  -5.135  68.023  1.00 35.01  ? 218  SER C CA  1 
ATOM   6433  C C   . SER C  1 219 ? 25.114  -6.484  67.538  1.00 35.06  ? 218  SER C C   1 
ATOM   6434  O O   . SER C  1 219 ? 25.686  -7.239  68.326  1.00 37.91  ? 218  SER C O   1 
ATOM   6435  C CB  . SER C  1 219 ? 23.253  -5.324  68.795  1.00 31.82  ? 218  SER C CB  1 
ATOM   6436  O OG  . SER C  1 219 ? 22.250  -5.872  67.956  1.00 45.59  ? 218  SER C OG  1 
ATOM   6437  N N   . LEU C  1 220 ? 24.961  -6.785  66.249  1.00 40.13  ? 219  LEU C N   1 
ATOM   6438  C CA  . LEU C  1 220 ? 25.515  -8.028  65.705  1.00 41.02  ? 219  LEU C CA  1 
ATOM   6439  C C   . LEU C  1 220 ? 27.037  -8.022  65.788  1.00 44.30  ? 219  LEU C C   1 
ATOM   6440  O O   . LEU C  1 220 ? 27.655  -9.076  65.877  1.00 39.51  ? 219  LEU C O   1 
ATOM   6441  C CB  . LEU C  1 220 ? 25.112  -8.251  64.244  1.00 38.53  ? 219  LEU C CB  1 
ATOM   6442  C CG  . LEU C  1 220 ? 23.637  -8.421  63.871  1.00 45.03  ? 219  LEU C CG  1 
ATOM   6443  C CD1 . LEU C  1 220 ? 23.520  -9.371  62.675  1.00 38.80  ? 219  LEU C CD1 1 
ATOM   6444  C CD2 . LEU C  1 220 ? 22.835  -8.932  65.022  1.00 42.56  ? 219  LEU C CD2 1 
ATOM   6445  N N   . LEU C  1 221 ? 27.641  -6.837  65.761  1.00 36.20  ? 220  LEU C N   1 
ATOM   6446  C CA  . LEU C  1 221 ? 29.102  -6.733  65.745  1.00 36.10  ? 220  LEU C CA  1 
ATOM   6447  C C   . LEU C  1 221 ? 29.722  -7.222  67.047  1.00 38.58  ? 220  LEU C C   1 
ATOM   6448  O O   . LEU C  1 221 ? 30.797  -7.815  67.049  1.00 46.75  ? 220  LEU C O   1 
ATOM   6449  C CB  . LEU C  1 221 ? 29.533  -5.289  65.486  1.00 38.95  ? 220  LEU C CB  1 
ATOM   6450  C CG  . LEU C  1 221 ? 29.168  -4.754  64.105  1.00 33.40  ? 220  LEU C CG  1 
ATOM   6451  C CD1 . LEU C  1 221 ? 29.436  -3.271  64.046  1.00 42.37  ? 220  LEU C CD1 1 
ATOM   6452  C CD2 . LEU C  1 221 ? 29.941  -5.501  63.013  1.00 44.38  ? 220  LEU C CD2 1 
ATOM   6453  N N   . SER C  1 222 ? 29.044  -6.969  68.160  1.00 36.06  ? 221  SER C N   1 
ATOM   6454  C CA  . SER C  1 222 ? 29.573  -7.348  69.466  1.00 36.42  ? 221  SER C CA  1 
ATOM   6455  C C   . SER C  1 222 ? 28.830  -8.554  70.047  1.00 42.42  ? 221  SER C C   1 
ATOM   6456  O O   . SER C  1 222 ? 29.390  -9.649  70.148  1.00 39.36  ? 221  SER C O   1 
ATOM   6457  C CB  . SER C  1 222 ? 29.522  -6.157  70.434  1.00 36.64  ? 221  SER C CB  1 
ATOM   6458  O OG  . SER C  1 222 ? 28.258  -5.514  70.414  1.00 40.41  ? 221  SER C OG  1 
ATOM   6459  N N   . SER C  1 223 ? 27.568  -8.360  70.410  1.00 34.86  ? 222  SER C N   1 
ATOM   6460  C CA  . SER C  1 223 ? 26.787  -9.421  71.042  1.00 38.88  ? 222  SER C CA  1 
ATOM   6461  C C   . SER C  1 223 ? 26.530  -10.602 70.110  1.00 31.47  ? 222  SER C C   1 
ATOM   6462  O O   . SER C  1 223 ? 26.544  -11.751 70.541  1.00 44.69  ? 222  SER C O   1 
ATOM   6463  C CB  . SER C  1 223 ? 25.474  -8.859  71.572  1.00 33.27  ? 222  SER C CB  1 
ATOM   6464  O OG  . SER C  1 223 ? 25.734  -7.966  72.640  1.00 49.38  ? 222  SER C OG  1 
ATOM   6465  N N   . GLY C  1 224 ? 26.279  -10.329 68.842  1.00 35.22  ? 223  GLY C N   1 
ATOM   6466  C CA  . GLY C  1 224 ? 26.262  -11.390 67.855  1.00 43.88  ? 223  GLY C CA  1 
ATOM   6467  C C   . GLY C  1 224 ? 24.930  -11.674 67.192  1.00 41.35  ? 223  GLY C C   1 
ATOM   6468  O O   . GLY C  1 224 ? 23.917  -11.031 67.460  1.00 37.32  ? 223  GLY C O   1 
ATOM   6469  N N   . PHE C  1 225 ? 24.951  -12.683 66.332  1.00 29.14  ? 224  PHE C N   1 
ATOM   6470  C CA  . PHE C  1 225 ? 23.835  -13.012 65.463  1.00 31.86  ? 224  PHE C CA  1 
ATOM   6471  C C   . PHE C  1 225 ? 23.230  -14.369 65.810  1.00 30.86  ? 224  PHE C C   1 
ATOM   6472  O O   . PHE C  1 225 ? 23.951  -15.338 66.049  1.00 36.63  ? 224  PHE C O   1 
ATOM   6473  C CB  . PHE C  1 225 ? 24.326  -13.030 64.009  1.00 32.02  ? 224  PHE C CB  1 
ATOM   6474  C CG  . PHE C  1 225 ? 23.340  -13.609 63.058  1.00 38.62  ? 224  PHE C CG  1 
ATOM   6475  C CD1 . PHE C  1 225 ? 22.184  -12.909 62.738  1.00 40.97  ? 224  PHE C CD1 1 
ATOM   6476  C CD2 . PHE C  1 225 ? 23.548  -14.864 62.500  1.00 28.80  ? 224  PHE C CD2 1 
ATOM   6477  C CE1 . PHE C  1 225 ? 21.254  -13.443 61.867  1.00 39.28  ? 224  PHE C CE1 1 
ATOM   6478  C CE2 . PHE C  1 225 ? 22.625  -15.404 61.625  1.00 35.16  ? 224  PHE C CE2 1 
ATOM   6479  C CZ  . PHE C  1 225 ? 21.469  -14.691 61.313  1.00 35.67  ? 224  PHE C CZ  1 
ATOM   6480  N N   . SER C  1 226 ? 21.903  -14.442 65.832  1.00 27.21  ? 225  SER C N   1 
ATOM   6481  C CA  . SER C  1 226 ? 21.201  -15.682 66.181  1.00 31.40  ? 225  SER C CA  1 
ATOM   6482  C C   . SER C  1 226 ? 20.564  -16.251 64.933  1.00 32.64  ? 225  SER C C   1 
ATOM   6483  O O   . SER C  1 226 ? 19.557  -15.737 64.460  1.00 31.98  ? 225  SER C O   1 
ATOM   6484  C CB  . SER C  1 226 ? 20.115  -15.443 67.227  1.00 24.26  ? 225  SER C CB  1 
ATOM   6485  O OG  . SER C  1 226 ? 20.675  -15.041 68.463  1.00 35.78  ? 225  SER C OG  1 
ATOM   6486  N N   . PRO C  1 227 ? 21.164  -17.310 64.381  1.00 39.15  ? 226  PRO C N   1 
ATOM   6487  C CA  . PRO C  1 227 ? 20.595  -17.930 63.185  1.00 36.86  ? 226  PRO C CA  1 
ATOM   6488  C C   . PRO C  1 227 ? 19.182  -18.413 63.459  1.00 41.07  ? 226  PRO C C   1 
ATOM   6489  O O   . PRO C  1 227 ? 18.852  -18.788 64.592  1.00 35.88  ? 226  PRO C O   1 
ATOM   6490  C CB  . PRO C  1 227 ? 21.521  -19.131 62.932  1.00 32.15  ? 226  PRO C CB  1 
ATOM   6491  C CG  . PRO C  1 227 ? 22.786  -18.808 63.654  1.00 42.23  ? 226  PRO C CG  1 
ATOM   6492  C CD  . PRO C  1 227 ? 22.371  -18.011 64.852  1.00 38.01  ? 226  PRO C CD  1 
ATOM   6493  N N   . ASP C  1 228 ? 18.355  -18.404 62.424  1.00 44.37  ? 227  ASP C N   1 
ATOM   6494  C CA  . ASP C  1 228 ? 17.047  -19.045 62.484  1.00 43.64  ? 227  ASP C CA  1 
ATOM   6495  C C   . ASP C  1 228 ? 16.712  -19.602 61.102  1.00 37.50  ? 227  ASP C C   1 
ATOM   6496  O O   . ASP C  1 228 ? 15.876  -19.066 60.379  1.00 50.05  ? 227  ASP C O   1 
ATOM   6497  C CB  . ASP C  1 228 ? 15.976  -18.047 62.927  1.00 45.92  ? 227  ASP C CB  1 
ATOM   6498  C CG  . ASP C  1 228 ? 14.707  -18.738 63.409  1.00 75.97  ? 227  ASP C CG  1 
ATOM   6499  O OD1 . ASP C  1 228 ? 14.613  -19.980 63.253  1.00 68.04  ? 227  ASP C OD1 1 
ATOM   6500  O OD2 . ASP C  1 228 ? 13.809  -18.045 63.937  1.00 77.56  ? 227  ASP C OD2 1 
ATOM   6501  N N   . PHE C  1 229 ? 17.387  -20.674 60.729  1.00 31.88  ? 228  PHE C N   1 
ATOM   6502  C CA  . PHE C  1 229 ? 17.284  -21.192 59.380  1.00 31.38  ? 228  PHE C CA  1 
ATOM   6503  C C   . PHE C  1 229 ? 16.665  -22.570 59.417  1.00 27.17  ? 228  PHE C C   1 
ATOM   6504  O O   . PHE C  1 229 ? 16.878  -23.326 60.363  1.00 35.94  ? 228  PHE C O   1 
ATOM   6505  C CB  . PHE C  1 229 ? 18.679  -21.266 58.750  1.00 35.43  ? 228  PHE C CB  1 
ATOM   6506  C CG  . PHE C  1 229 ? 19.438  -19.966 58.793  1.00 32.60  ? 228  PHE C CG  1 
ATOM   6507  C CD1 . PHE C  1 229 ? 18.816  -18.772 58.457  1.00 36.21  ? 228  PHE C CD1 1 
ATOM   6508  C CD2 . PHE C  1 229 ? 20.766  -19.940 59.172  1.00 28.63  ? 228  PHE C CD2 1 
ATOM   6509  C CE1 . PHE C  1 229 ? 19.513  -17.577 58.479  1.00 38.39  ? 228  PHE C CE1 1 
ATOM   6510  C CE2 . PHE C  1 229 ? 21.478  -18.748 59.178  1.00 35.87  ? 228  PHE C CE2 1 
ATOM   6511  C CZ  . PHE C  1 229 ? 20.847  -17.563 58.841  1.00 29.53  ? 228  PHE C CZ  1 
ATOM   6512  N N   . ALA C  1 230 ? 15.903  -22.908 58.385  1.00 33.19  ? 229  ALA C N   1 
ATOM   6513  C CA  . ALA C  1 230 ? 15.249  -24.210 58.327  1.00 36.89  ? 229  ALA C CA  1 
ATOM   6514  C C   . ALA C  1 230 ? 15.703  -24.955 57.084  1.00 40.73  ? 229  ALA C C   1 
ATOM   6515  O O   . ALA C  1 230 ? 15.811  -24.365 56.012  1.00 34.84  ? 229  ALA C O   1 
ATOM   6516  C CB  . ALA C  1 230 ? 13.736  -24.053 58.327  1.00 26.07  ? 229  ALA C CB  1 
ATOM   6517  N N   . THR C  1 231 ? 15.981  -26.243 57.250  1.00 27.50  ? 230  THR C N   1 
ATOM   6518  C CA  . THR C  1 231 ? 16.352  -27.121 56.156  1.00 30.78  ? 230  THR C CA  1 
ATOM   6519  C C   . THR C  1 231 ? 15.447  -28.349 56.192  1.00 32.77  ? 230  THR C C   1 
ATOM   6520  O O   . THR C  1 231 ? 15.270  -28.969 57.240  1.00 41.11  ? 230  THR C O   1 
ATOM   6521  C CB  . THR C  1 231 ? 17.806  -27.595 56.292  1.00 36.91  ? 230  THR C CB  1 
ATOM   6522  O OG1 . THR C  1 231 ? 18.684  -26.465 56.334  1.00 45.13  ? 230  THR C OG1 1 
ATOM   6523  C CG2 . THR C  1 231 ? 18.191  -28.487 55.110  1.00 37.35  ? 230  THR C CG2 1 
ATOM   6524  N N   . VAL C  1 232 ? 14.866  -28.699 55.056  1.00 33.63  ? 231  VAL C N   1 
ATOM   6525  C CA  . VAL C  1 232 ? 14.056  -29.904 54.975  1.00 36.17  ? 231  VAL C CA  1 
ATOM   6526  C C   . VAL C  1 232 ? 14.815  -31.006 54.247  1.00 35.05  ? 231  VAL C C   1 
ATOM   6527  O O   . VAL C  1 232 ? 15.323  -30.800 53.140  1.00 38.48  ? 231  VAL C O   1 
ATOM   6528  C CB  . VAL C  1 232 ? 12.726  -29.631 54.262  1.00 34.80  ? 231  VAL C CB  1 
ATOM   6529  C CG1 . VAL C  1 232 ? 11.842  -30.883 54.280  1.00 30.12  ? 231  VAL C CG1 1 
ATOM   6530  C CG2 . VAL C  1 232 ? 12.012  -28.466 54.928  1.00 35.05  ? 231  VAL C CG2 1 
ATOM   6531  N N   . ILE C  1 233 ? 14.884  -32.177 54.873  1.00 38.39  ? 232  ILE C N   1 
ATOM   6532  C CA  . ILE C  1 233 ? 15.578  -33.327 54.295  1.00 34.29  ? 232  ILE C CA  1 
ATOM   6533  C C   . ILE C  1 233 ? 14.575  -34.455 54.075  1.00 37.64  ? 232  ILE C C   1 
ATOM   6534  O O   . ILE C  1 233 ? 13.818  -34.795 54.977  1.00 38.60  ? 232  ILE C O   1 
ATOM   6535  C CB  . ILE C  1 233 ? 16.716  -33.782 55.223  1.00 38.90  ? 232  ILE C CB  1 
ATOM   6536  C CG1 . ILE C  1 233 ? 17.741  -32.649 55.356  1.00 38.99  ? 232  ILE C CG1 1 
ATOM   6537  C CG2 . ILE C  1 233 ? 17.378  -35.059 54.690  1.00 38.57  ? 232  ILE C CG2 1 
ATOM   6538  C CD1 . ILE C  1 233 ? 18.784  -32.895 56.412  1.00 48.83  ? 232  ILE C CD1 1 
ATOM   6539  N N   . THR C  1 234 ? 14.548  -35.016 52.870  1.00 35.38  ? 233  THR C N   1 
ATOM   6540  C CA  . THR C  1 234 ? 13.624  -36.099 52.553  1.00 36.01  ? 233  THR C CA  1 
ATOM   6541  C C   . THR C  1 234 ? 14.374  -37.416 52.398  1.00 45.82  ? 233  THR C C   1 
ATOM   6542  O O   . THR C  1 234 ? 15.541  -37.438 52.013  1.00 42.40  ? 233  THR C O   1 
ATOM   6543  C CB  . THR C  1 234 ? 12.835  -35.826 51.257  1.00 43.42  ? 233  THR C CB  1 
ATOM   6544  O OG1 . THR C  1 234 ? 13.747  -35.578 50.187  1.00 50.53  ? 233  THR C OG1 1 
ATOM   6545  C CG2 . THR C  1 234 ? 11.914  -34.621 51.411  1.00 38.89  ? 233  THR C CG2 1 
ATOM   6546  N N   . MET C  1 235 ? 13.684  -38.513 52.689  1.00 37.73  ? 234  MET C N   1 
ATOM   6547  C CA  . MET C  1 235 ? 14.279  -39.840 52.683  1.00 36.15  ? 234  MET C CA  1 
ATOM   6548  C C   . MET C  1 235 ? 13.270  -40.858 52.177  1.00 39.66  ? 234  MET C C   1 
ATOM   6549  O O   . MET C  1 235 ? 12.163  -40.952 52.693  1.00 37.71  ? 234  MET C O   1 
ATOM   6550  C CB  . MET C  1 235 ? 14.723  -40.222 54.094  1.00 39.56  ? 234  MET C CB  1 
ATOM   6551  C CG  . MET C  1 235 ? 15.438  -41.567 54.187  1.00 48.55  ? 234  MET C CG  1 
ATOM   6552  S SD  . MET C  1 235 ? 16.965  -41.595 53.231  1.00 57.52  ? 234  MET C SD  1 
ATOM   6553  C CE  . MET C  1 235 ? 17.868  -42.889 54.073  1.00 55.52  ? 234  MET C CE  1 
ATOM   6554  N N   . ASP C  1 236 ? 13.655  -41.612 51.156  1.00 40.31  ? 235  ASP C N   1 
ATOM   6555  C CA  . ASP C  1 236 ? 12.812  -42.685 50.643  1.00 46.59  ? 235  ASP C CA  1 
ATOM   6556  C C   . ASP C  1 236 ? 12.681  -43.766 51.711  1.00 36.42  ? 235  ASP C C   1 
ATOM   6557  O O   . ASP C  1 236 ? 13.673  -44.148 52.332  1.00 43.47  ? 235  ASP C O   1 
ATOM   6558  C CB  . ASP C  1 236 ? 13.434  -43.268 49.370  1.00 49.72  ? 235  ASP C CB  1 
ATOM   6559  C CG  . ASP C  1 236 ? 12.455  -44.120 48.568  1.00 77.58  ? 235  ASP C CG  1 
ATOM   6560  O OD1 . ASP C  1 236 ? 11.730  -44.951 49.163  1.00 66.04  ? 235  ASP C OD1 1 
ATOM   6561  O OD2 . ASP C  1 236 ? 12.412  -43.953 47.329  1.00 96.93  ? 235  ASP C OD2 1 
ATOM   6562  N N   . ARG C  1 237 ? 11.461  -44.255 51.925  1.00 40.75  ? 236  ARG C N   1 
ATOM   6563  C CA  . ARG C  1 237 ? 11.215  -45.271 52.948  1.00 41.36  ? 236  ARG C CA  1 
ATOM   6564  C C   . ARG C  1 237 ? 11.860  -46.612 52.611  1.00 49.87  ? 236  ARG C C   1 
ATOM   6565  O O   . ARG C  1 237 ? 12.134  -47.421 53.504  1.00 50.61  ? 236  ARG C O   1 
ATOM   6566  C CB  . ARG C  1 237 ? 9.712   -45.453 53.164  1.00 44.25  ? 236  ARG C CB  1 
ATOM   6567  C CG  . ARG C  1 237 ? 9.049   -44.248 53.815  1.00 46.63  ? 236  ARG C CG  1 
ATOM   6568  C CD  . ARG C  1 237 ? 7.594   -44.507 54.133  1.00 42.45  ? 236  ARG C CD  1 
ATOM   6569  N NE  . ARG C  1 237 ? 6.951   -43.326 54.698  1.00 44.68  ? 236  ARG C NE  1 
ATOM   6570  C CZ  . ARG C  1 237 ? 6.376   -42.370 53.973  1.00 41.35  ? 236  ARG C CZ  1 
ATOM   6571  N NH1 . ARG C  1 237 ? 5.817   -41.329 54.565  1.00 37.59  ? 236  ARG C NH1 1 
ATOM   6572  N NH2 . ARG C  1 237 ? 6.357   -42.456 52.650  1.00 37.84  ? 236  ARG C NH2 1 
ATOM   6573  N N   . LYS C  1 238 ? 12.099  -46.839 51.321  1.00 46.58  ? 237  LYS C N   1 
ATOM   6574  C CA  . LYS C  1 238 ? 12.659  -48.098 50.832  1.00 56.19  ? 237  LYS C CA  1 
ATOM   6575  C C   . LYS C  1 238 ? 14.190  -48.094 50.798  1.00 55.73  ? 237  LYS C C   1 
ATOM   6576  O O   . LYS C  1 238 ? 14.803  -49.109 50.492  1.00 55.85  ? 237  LYS C O   1 
ATOM   6577  C CB  . LYS C  1 238 ? 12.131  -48.400 49.423  1.00 53.73  ? 237  LYS C CB  1 
ATOM   6578  C CG  . LYS C  1 238 ? 10.647  -48.722 49.362  1.00 55.44  ? 237  LYS C CG  1 
ATOM   6579  C CD  . LYS C  1 238 ? 10.359  -50.064 49.994  1.00 75.88  ? 237  LYS C CD  1 
ATOM   6580  C CE  . LYS C  1 238 ? 10.954  -51.197 49.182  1.00 79.62  ? 237  LYS C CE  1 
ATOM   6581  N NZ  . LYS C  1 238 ? 10.683  -52.506 49.811  1.00 86.67  ? 237  LYS C NZ  1 
ATOM   6582  N N   . ALA C  1 239 ? 14.815  -46.960 51.095  1.00 58.07  ? 238  ALA C N   1 
ATOM   6583  C CA  . ALA C  1 239 ? 16.272  -46.901 51.094  1.00 52.25  ? 238  ALA C CA  1 
ATOM   6584  C C   . ALA C  1 239 ? 16.814  -47.986 52.019  1.00 64.31  ? 238  ALA C C   1 
ATOM   6585  O O   . ALA C  1 239 ? 16.281  -48.199 53.108  1.00 62.94  ? 238  ALA C O   1 
ATOM   6586  C CB  . ALA C  1 239 ? 16.749  -45.539 51.540  1.00 51.83  ? 238  ALA C CB  1 
ATOM   6587  N N   . SER C  1 240 ? 17.870  -48.672 51.592  1.00 47.78  ? 239  SER C N   1 
ATOM   6588  C CA  . SER C  1 240 ? 18.413  -49.783 52.375  1.00 58.60  ? 239  SER C CA  1 
ATOM   6589  C C   . SER C  1 240 ? 19.075  -49.291 53.659  1.00 48.80  ? 239  SER C C   1 
ATOM   6590  O O   . SER C  1 240 ? 18.929  -49.903 54.716  1.00 54.29  ? 239  SER C O   1 
ATOM   6591  C CB  . SER C  1 240 ? 19.413  -50.600 51.543  1.00 54.53  ? 239  SER C CB  1 
ATOM   6592  O OG  . SER C  1 240 ? 20.419  -49.761 51.007  1.00 81.90  ? 239  SER C OG  1 
ATOM   6593  N N   . LYS C  1 241 ? 19.791  -48.172 53.568  1.00 49.51  ? 240  LYS C N   1 
ATOM   6594  C CA  . LYS C  1 241 ? 20.458  -47.598 54.735  1.00 49.45  ? 240  LYS C CA  1 
ATOM   6595  C C   . LYS C  1 241 ? 19.612  -46.471 55.341  1.00 48.31  ? 240  LYS C C   1 
ATOM   6596  O O   . LYS C  1 241 ? 19.503  -45.385 54.767  1.00 44.63  ? 240  LYS C O   1 
ATOM   6597  C CB  . LYS C  1 241 ? 21.844  -47.089 54.334  1.00 50.44  ? 240  LYS C CB  1 
ATOM   6598  C CG  . LYS C  1 241 ? 22.651  -46.467 55.461  1.00 56.10  ? 240  LYS C CG  1 
ATOM   6599  C CD  . LYS C  1 241 ? 24.054  -46.111 54.985  1.00 65.51  ? 240  LYS C CD  1 
ATOM   6600  C CE  . LYS C  1 241 ? 24.704  -45.047 55.858  1.00 71.63  ? 240  LYS C CE  1 
ATOM   6601  N NZ  . LYS C  1 241 ? 24.787  -45.442 57.291  1.00 86.05  ? 240  LYS C NZ  1 
ATOM   6602  N N   . GLN C  1 242 ? 19.023  -46.732 56.504  1.00 52.98  ? 241  GLN C N   1 
ATOM   6603  C CA  . GLN C  1 242 ? 18.094  -45.784 57.129  1.00 57.84  ? 241  GLN C CA  1 
ATOM   6604  C C   . GLN C  1 242 ? 18.751  -44.952 58.239  1.00 48.74  ? 241  GLN C C   1 
ATOM   6605  O O   . GLN C  1 242 ? 18.075  -44.439 59.125  1.00 51.48  ? 241  GLN C O   1 
ATOM   6606  C CB  . GLN C  1 242 ? 16.866  -46.534 57.670  1.00 54.14  ? 241  GLN C CB  1 
ATOM   6607  C CG  . GLN C  1 242 ? 15.910  -47.035 56.582  1.00 46.42  ? 241  GLN C CG  1 
ATOM   6608  C CD  . GLN C  1 242 ? 15.142  -45.897 55.922  1.00 57.66  ? 241  GLN C CD  1 
ATOM   6609  O OE1 . GLN C  1 242 ? 14.778  -44.917 56.575  1.00 63.87  ? 241  GLN C OE1 1 
ATOM   6610  N NE2 . GLN C  1 242 ? 14.890  -46.024 54.626  1.00 52.33  ? 241  GLN C NE2 1 
ATOM   6611  N N   . GLN C  1 243 ? 20.072  -44.840 58.197  1.00 50.55  ? 242  GLN C N   1 
ATOM   6612  C CA  . GLN C  1 243 ? 20.793  -43.917 59.065  1.00 48.26  ? 242  GLN C CA  1 
ATOM   6613  C C   . GLN C  1 243 ? 21.628  -43.005 58.173  1.00 58.50  ? 242  GLN C C   1 
ATOM   6614  O O   . GLN C  1 243 ? 22.174  -43.452 57.163  1.00 58.18  ? 242  GLN C O   1 
ATOM   6615  C CB  . GLN C  1 243 ? 21.691  -44.654 60.059  1.00 48.53  ? 242  GLN C CB  1 
ATOM   6616  C CG  . GLN C  1 243 ? 20.955  -45.445 61.117  1.00 61.04  ? 242  GLN C CG  1 
ATOM   6617  C CD  . GLN C  1 243 ? 20.279  -46.698 60.560  1.00 94.64  ? 242  GLN C CD  1 
ATOM   6618  O OE1 . GLN C  1 243 ? 20.827  -47.387 59.694  1.00 79.37  ? 242  GLN C OE1 1 
ATOM   6619  N NE2 . GLN C  1 243 ? 19.079  -46.992 61.057  1.00 76.05  ? 242  GLN C NE2 1 
ATOM   6620  N N   . THR C  1 244 ? 21.711  -41.728 58.541  1.00 40.74  ? 243  THR C N   1 
ATOM   6621  C CA  . THR C  1 244 ? 22.397  -40.733 57.730  1.00 40.83  ? 243  THR C CA  1 
ATOM   6622  C C   . THR C  1 244 ? 23.184  -39.793 58.632  1.00 47.12  ? 243  THR C C   1 
ATOM   6623  O O   . THR C  1 244 ? 22.650  -39.276 59.604  1.00 46.04  ? 243  THR C O   1 
ATOM   6624  C CB  . THR C  1 244 ? 21.393  -39.876 56.936  1.00 50.25  ? 243  THR C CB  1 
ATOM   6625  O OG1 . THR C  1 244 ? 20.515  -40.719 56.186  1.00 49.36  ? 243  THR C OG1 1 
ATOM   6626  C CG2 . THR C  1 244 ? 22.120  -38.923 55.996  1.00 50.79  ? 243  THR C CG2 1 
ATOM   6627  N N   . ASN C  1 245 ? 24.450  -39.563 58.314  1.00 47.19  ? 244  ASN C N   1 
ATOM   6628  C CA  . ASN C  1 245 ? 25.219  -38.547 59.018  1.00 47.26  ? 244  ASN C CA  1 
ATOM   6629  C C   . ASN C  1 245 ? 25.000  -37.203 58.347  1.00 46.72  ? 244  ASN C C   1 
ATOM   6630  O O   . ASN C  1 245 ? 24.769  -37.137 57.144  1.00 47.94  ? 244  ASN C O   1 
ATOM   6631  C CB  . ASN C  1 245 ? 26.706  -38.891 59.026  1.00 50.61  ? 244  ASN C CB  1 
ATOM   6632  C CG  . ASN C  1 245 ? 27.024  -40.071 59.922  1.00 61.30  ? 244  ASN C CG  1 
ATOM   6633  O OD1 . ASN C  1 245 ? 26.361  -40.295 60.931  1.00 50.16  ? 244  ASN C OD1 1 
ATOM   6634  N ND2 . ASN C  1 245 ? 28.039  -40.839 59.552  1.00 65.61  ? 244  ASN C ND2 1 
ATOM   6635  N N   . ILE C  1 246 ? 25.058  -36.132 59.125  1.00 44.94  ? 245  ILE C N   1 
ATOM   6636  C CA  . ILE C  1 246 ? 24.968  -34.791 58.566  1.00 37.60  ? 245  ILE C CA  1 
ATOM   6637  C C   . ILE C  1 246 ? 25.905  -33.881 59.340  1.00 45.32  ? 245  ILE C C   1 
ATOM   6638  O O   . ILE C  1 246 ? 26.006  -33.979 60.566  1.00 45.82  ? 245  ILE C O   1 
ATOM   6639  C CB  . ILE C  1 246 ? 23.525  -34.254 58.635  1.00 47.68  ? 245  ILE C CB  1 
ATOM   6640  C CG1 . ILE C  1 246 ? 23.408  -32.933 57.881  1.00 46.86  ? 245  ILE C CG1 1 
ATOM   6641  C CG2 . ILE C  1 246 ? 23.080  -34.071 60.081  1.00 39.12  ? 245  ILE C CG2 1 
ATOM   6642  C CD1 . ILE C  1 246 ? 21.999  -32.418 57.816  1.00 49.02  ? 245  ILE C CD1 1 
ATOM   6643  N N   . ASP C  1 247 ? 26.616  -33.023 58.620  1.00 36.67  ? 246  ASP C N   1 
ATOM   6644  C CA  . ASP C  1 247 ? 27.488  -32.035 59.243  1.00 45.80  ? 246  ASP C CA  1 
ATOM   6645  C C   . ASP C  1 247 ? 26.831  -30.657 59.266  1.00 38.74  ? 246  ASP C C   1 
ATOM   6646  O O   . ASP C  1 247 ? 26.205  -30.238 58.296  1.00 35.10  ? 246  ASP C O   1 
ATOM   6647  C CB  . ASP C  1 247 ? 28.814  -31.940 58.476  1.00 52.23  ? 246  ASP C CB  1 
ATOM   6648  C CG  . ASP C  1 247 ? 29.693  -33.156 58.678  1.00 72.27  ? 246  ASP C CG  1 
ATOM   6649  O OD1 . ASP C  1 247 ? 29.742  -33.657 59.821  1.00 75.55  ? 246  ASP C OD1 1 
ATOM   6650  O OD2 . ASP C  1 247 ? 30.332  -33.605 57.698  1.00 75.89  ? 246  ASP C OD2 1 
ATOM   6651  N N   . VAL C  1 248 ? 26.993  -29.958 60.379  1.00 39.07  ? 247  VAL C N   1 
ATOM   6652  C CA  . VAL C  1 248 ? 26.510  -28.598 60.514  1.00 36.24  ? 247  VAL C CA  1 
ATOM   6653  C C   . VAL C  1 248 ? 27.690  -27.730 60.914  1.00 45.29  ? 247  VAL C C   1 
ATOM   6654  O O   . VAL C  1 248 ? 28.380  -28.018 61.895  1.00 36.41  ? 247  VAL C O   1 
ATOM   6655  C CB  . VAL C  1 248 ? 25.415  -28.488 61.586  1.00 48.31  ? 247  VAL C CB  1 
ATOM   6656  C CG1 . VAL C  1 248 ? 24.921  -27.036 61.707  1.00 32.83  ? 247  VAL C CG1 1 
ATOM   6657  C CG2 . VAL C  1 248 ? 24.256  -29.433 61.266  1.00 41.22  ? 247  VAL C CG2 1 
ATOM   6658  N N   . ILE C  1 249 ? 27.929  -26.677 60.142  1.00 34.78  ? 248  ILE C N   1 
ATOM   6659  C CA  . ILE C  1 249 ? 29.062  -25.798 60.382  1.00 39.12  ? 248  ILE C CA  1 
ATOM   6660  C C   . ILE C  1 249 ? 28.561  -24.389 60.654  1.00 36.60  ? 248  ILE C C   1 
ATOM   6661  O O   . ILE C  1 249 ? 27.766  -23.859 59.884  1.00 34.86  ? 248  ILE C O   1 
ATOM   6662  C CB  . ILE C  1 249 ? 30.022  -25.763 59.161  1.00 42.55  ? 248  ILE C CB  1 
ATOM   6663  C CG1 . ILE C  1 249 ? 30.501  -27.174 58.815  1.00 50.02  ? 248  ILE C CG1 1 
ATOM   6664  C CG2 . ILE C  1 249 ? 31.215  -24.859 59.446  1.00 39.99  ? 248  ILE C CG2 1 
ATOM   6665  C CD1 . ILE C  1 249 ? 29.544  -27.949 57.932  1.00 56.71  ? 248  ILE C CD1 1 
ATOM   6666  N N   . TYR C  1 250 ? 29.018  -23.808 61.761  1.00 29.39  ? 249  TYR C N   1 
ATOM   6667  C CA  . TYR C  1 250 ? 28.844  -22.389 62.047  1.00 34.35  ? 249  TYR C CA  1 
ATOM   6668  C C   . TYR C  1 250 ? 30.169  -21.692 61.824  1.00 40.09  ? 249  TYR C C   1 
ATOM   6669  O O   . TYR C  1 250 ? 31.219  -22.217 62.201  1.00 41.72  ? 249  TYR C O   1 
ATOM   6670  C CB  . TYR C  1 250 ? 28.427  -22.176 63.500  1.00 33.22  ? 249  TYR C CB  1 
ATOM   6671  C CG  . TYR C  1 250 ? 26.977  -22.457 63.790  1.00 39.14  ? 249  TYR C CG  1 
ATOM   6672  C CD1 . TYR C  1 250 ? 26.266  -21.676 64.706  1.00 36.21  ? 249  TYR C CD1 1 
ATOM   6673  C CD2 . TYR C  1 250 ? 26.311  -23.493 63.154  1.00 40.67  ? 249  TYR C CD2 1 
ATOM   6674  C CE1 . TYR C  1 250 ? 24.937  -21.927 64.971  1.00 28.51  ? 249  TYR C CE1 1 
ATOM   6675  C CE2 . TYR C  1 250 ? 24.986  -23.755 63.415  1.00 34.19  ? 249  TYR C CE2 1 
ATOM   6676  C CZ  . TYR C  1 250 ? 24.304  -22.976 64.328  1.00 37.64  ? 249  TYR C CZ  1 
ATOM   6677  O OH  . TYR C  1 250 ? 22.982  -23.254 64.578  1.00 30.82  ? 249  TYR C OH  1 
ATOM   6678  N N   . GLU C  1 251 ? 30.124  -20.497 61.247  1.00 37.81  ? 250  GLU C N   1 
ATOM   6679  C CA  . GLU C  1 251 ? 31.343  -19.798 60.866  1.00 34.14  ? 250  GLU C CA  1 
ATOM   6680  C C   . GLU C  1 251 ? 31.257  -18.282 61.135  1.00 44.39  ? 250  GLU C C   1 
ATOM   6681  O O   . GLU C  1 251 ? 30.214  -17.654 60.958  1.00 34.10  ? 250  GLU C O   1 
ATOM   6682  C CB  . GLU C  1 251 ? 31.638  -20.083 59.390  1.00 39.81  ? 250  GLU C CB  1 
ATOM   6683  C CG  . GLU C  1 251 ? 32.952  -19.535 58.863  1.00 59.48  ? 250  GLU C CG  1 
ATOM   6684  C CD  . GLU C  1 251 ? 33.305  -20.109 57.491  1.00 85.84  ? 250  GLU C CD  1 
ATOM   6685  O OE1 . GLU C  1 251 ? 33.192  -21.346 57.318  1.00 69.02  ? 250  GLU C OE1 1 
ATOM   6686  O OE2 . GLU C  1 251 ? 33.686  -19.327 56.586  1.00 86.60  ? 250  GLU C OE2 1 
ATOM   6687  N N   . ARG C  1 252 ? 32.363  -17.709 61.592  1.00 40.58  ? 251  ARG C N   1 
ATOM   6688  C CA  . ARG C  1 252 ? 32.487  -16.265 61.735  1.00 35.79  ? 251  ARG C CA  1 
ATOM   6689  C C   . ARG C  1 252 ? 33.698  -15.807 60.923  1.00 45.53  ? 251  ARG C C   1 
ATOM   6690  O O   . ARG C  1 252 ? 34.811  -16.301 61.117  1.00 40.27  ? 251  ARG C O   1 
ATOM   6691  C CB  . ARG C  1 252 ? 32.680  -15.877 63.201  1.00 31.11  ? 251  ARG C CB  1 
ATOM   6692  C CG  . ARG C  1 252 ? 32.855  -14.380 63.416  1.00 36.81  ? 251  ARG C CG  1 
ATOM   6693  C CD  . ARG C  1 252 ? 33.496  -14.065 64.760  1.00 31.76  ? 251  ARG C CD  1 
ATOM   6694  N NE  . ARG C  1 252 ? 32.673  -14.530 65.871  1.00 37.45  ? 251  ARG C NE  1 
ATOM   6695  C CZ  . ARG C  1 252 ? 32.887  -15.643 66.568  1.00 42.60  ? 251  ARG C CZ  1 
ATOM   6696  N NH1 . ARG C  1 252 ? 32.068  -15.977 67.559  1.00 40.64  ? 251  ARG C NH1 1 
ATOM   6697  N NH2 . ARG C  1 252 ? 33.914  -16.421 66.286  1.00 37.77  ? 251  ARG C NH2 1 
ATOM   6698  N N   . VAL C  1 253 ? 33.478  -14.886 59.995  1.00 40.85  ? 252  VAL C N   1 
ATOM   6699  C CA  . VAL C  1 253 ? 34.576  -14.273 59.260  1.00 34.54  ? 252  VAL C CA  1 
ATOM   6700  C C   . VAL C  1 253 ? 34.824  -12.893 59.851  1.00 41.03  ? 252  VAL C C   1 
ATOM   6701  O O   . VAL C  1 253 ? 33.900  -12.105 59.989  1.00 42.42  ? 252  VAL C O   1 
ATOM   6702  C CB  . VAL C  1 253 ? 34.261  -14.155 57.760  1.00 43.41  ? 252  VAL C CB  1 
ATOM   6703  C CG1 . VAL C  1 253 ? 35.411  -13.477 57.023  1.00 38.69  ? 252  VAL C CG1 1 
ATOM   6704  C CG2 . VAL C  1 253 ? 33.985  -15.543 57.157  1.00 37.65  ? 252  VAL C CG2 1 
ATOM   6705  N N   . ARG C  1 254 ? 36.065  -12.616 60.223  1.00 43.30  ? 253  ARG C N   1 
ATOM   6706  C CA  . ARG C  1 254 ? 36.415  -11.335 60.820  1.00 42.77  ? 253  ARG C CA  1 
ATOM   6707  C C   . ARG C  1 254 ? 37.334  -10.511 59.920  1.00 51.59  ? 253  ARG C C   1 
ATOM   6708  O O   . ARG C  1 254 ? 38.295  -11.034 59.350  1.00 50.49  ? 253  ARG C O   1 
ATOM   6709  C CB  . ARG C  1 254 ? 37.084  -11.559 62.179  1.00 41.67  ? 253  ARG C CB  1 
ATOM   6710  C CG  . ARG C  1 254 ? 36.108  -11.911 63.283  1.00 49.73  ? 253  ARG C CG  1 
ATOM   6711  C CD  . ARG C  1 254 ? 36.826  -12.194 64.580  1.00 48.61  ? 253  ARG C CD  1 
ATOM   6712  N NE  . ARG C  1 254 ? 37.663  -13.379 64.463  1.00 61.13  ? 253  ARG C NE  1 
ATOM   6713  C CZ  . ARG C  1 254 ? 38.782  -13.579 65.150  1.00 80.96  ? 253  ARG C CZ  1 
ATOM   6714  N NH1 . ARG C  1 254 ? 39.473  -14.697 64.970  1.00 67.70  ? 253  ARG C NH1 1 
ATOM   6715  N NH2 . ARG C  1 254 ? 39.216  -12.669 66.012  1.00 72.75  ? 253  ARG C NH2 1 
ATOM   6716  N N   . ASP C  1 255 ? 37.016  -9.224  59.793  1.00 46.63  ? 254  ASP C N   1 
ATOM   6717  C CA  . ASP C  1 255 ? 37.879  -8.257  59.129  1.00 42.58  ? 254  ASP C CA  1 
ATOM   6718  C C   . ASP C  1 255 ? 38.802  -7.599  60.151  1.00 48.81  ? 254  ASP C C   1 
ATOM   6719  O O   . ASP C  1 255 ? 38.607  -7.718  61.366  1.00 38.11  ? 254  ASP C O   1 
ATOM   6720  C CB  . ASP C  1 255 ? 37.051  -7.167  58.441  1.00 36.28  ? 254  ASP C CB  1 
ATOM   6721  C CG  . ASP C  1 255 ? 36.460  -7.621  57.129  1.00 47.96  ? 254  ASP C CG  1 
ATOM   6722  O OD1 . ASP C  1 255 ? 35.993  -6.749  56.373  1.00 39.96  ? 254  ASP C OD1 1 
ATOM   6723  O OD2 . ASP C  1 255 ? 36.457  -8.842  56.860  1.00 38.00  ? 254  ASP C OD2 1 
ATOM   6724  N N   . ASP C  1 256 ? 39.798  -6.887  59.642  1.00 43.68  ? 255  ASP C N   1 
ATOM   6725  C CA  . ASP C  1 256 ? 40.827  -6.276  60.471  1.00 56.96  ? 255  ASP C CA  1 
ATOM   6726  C C   . ASP C  1 256 ? 40.879  -4.776  60.191  1.00 47.43  ? 255  ASP C C   1 
ATOM   6727  O O   . ASP C  1 256 ? 41.468  -4.345  59.206  1.00 55.08  ? 255  ASP C O   1 
ATOM   6728  C CB  . ASP C  1 256 ? 42.178  -6.927  60.160  1.00 68.85  ? 255  ASP C CB  1 
ATOM   6729  C CG  . ASP C  1 256 ? 43.340  -6.231  60.839  1.00 69.33  ? 255  ASP C CG  1 
ATOM   6730  O OD1 . ASP C  1 256 ? 44.465  -6.340  60.310  1.00 80.74  ? 255  ASP C OD1 1 
ATOM   6731  O OD2 . ASP C  1 256 ? 43.136  -5.586  61.892  1.00 64.37  ? 255  ASP C OD2 1 
ATOM   6732  N N   . TYR C  1 257 ? 40.244  -3.995  61.057  1.00 52.07  ? 256  TYR C N   1 
ATOM   6733  C CA  . TYR C  1 257 ? 40.172  -2.547  60.903  1.00 49.41  ? 256  TYR C CA  1 
ATOM   6734  C C   . TYR C  1 257 ? 41.252  -1.892  61.749  1.00 53.24  ? 256  TYR C C   1 
ATOM   6735  O O   . TYR C  1 257 ? 41.317  -2.102  62.961  1.00 44.09  ? 256  TYR C O   1 
ATOM   6736  C CB  . TYR C  1 257 ? 38.789  -2.052  61.337  1.00 45.63  ? 256  TYR C CB  1 
ATOM   6737  C CG  . TYR C  1 257 ? 38.595  -0.565  61.180  1.00 53.24  ? 256  TYR C CG  1 
ATOM   6738  C CD1 . TYR C  1 257 ? 38.261  -0.018  59.948  1.00 36.46  ? 256  TYR C CD1 1 
ATOM   6739  C CD2 . TYR C  1 257 ? 38.730  0.296   62.269  1.00 35.19  ? 256  TYR C CD2 1 
ATOM   6740  C CE1 . TYR C  1 257 ? 38.080  1.350   59.799  1.00 54.19  ? 256  TYR C CE1 1 
ATOM   6741  C CE2 . TYR C  1 257 ? 38.550  1.666   62.127  1.00 43.98  ? 256  TYR C CE2 1 
ATOM   6742  C CZ  . TYR C  1 257 ? 38.227  2.184   60.888  1.00 39.36  ? 256  TYR C CZ  1 
ATOM   6743  O OH  . TYR C  1 257 ? 38.047  3.536   60.722  1.00 52.39  ? 256  TYR C OH  1 
ATOM   6744  N N   . GLN C  1 258 ? 42.108  -1.103  61.112  1.00 45.98  ? 257  GLN C N   1 
ATOM   6745  C CA  . GLN C  1 258 ? 43.250  -0.515  61.807  1.00 49.81  ? 257  GLN C CA  1 
ATOM   6746  C C   . GLN C  1 258 ? 43.236  1.001   61.735  1.00 50.42  ? 257  GLN C C   1 
ATOM   6747  O O   . GLN C  1 258 ? 43.047  1.582   60.665  1.00 55.42  ? 257  GLN C O   1 
ATOM   6748  C CB  . GLN C  1 258 ? 44.564  -1.036  61.217  1.00 52.26  ? 257  GLN C CB  1 
ATOM   6749  C CG  . GLN C  1 258 ? 44.680  -2.551  61.182  1.00 56.40  ? 257  GLN C CG  1 
ATOM   6750  C CD  . GLN C  1 258 ? 46.055  -3.008  60.743  1.00 85.71  ? 257  GLN C CD  1 
ATOM   6751  O OE1 . GLN C  1 258 ? 47.065  -2.397  61.099  1.00 94.13  ? 257  GLN C OE1 1 
ATOM   6752  N NE2 . GLN C  1 258 ? 46.104  -4.079  59.957  1.00 66.15  ? 257  GLN C NE2 1 
ATOM   6753  N N   . LEU C  1 259 ? 43.436  1.632   62.886  1.00 41.97  ? 258  LEU C N   1 
ATOM   6754  C CA  . LEU C  1 259 ? 43.651  3.074   62.950  1.00 55.70  ? 258  LEU C CA  1 
ATOM   6755  C C   . LEU C  1 259 ? 45.132  3.380   63.131  1.00 61.07  ? 258  LEU C C   1 
ATOM   6756  O O   . LEU C  1 259 ? 45.809  2.755   63.948  1.00 60.57  ? 258  LEU C O   1 
ATOM   6757  C CB  . LEU C  1 259 ? 42.877  3.688   64.123  1.00 36.41  ? 258  LEU C CB  1 
ATOM   6758  C CG  . LEU C  1 259 ? 41.358  3.764   63.971  1.00 56.52  ? 258  LEU C CG  1 
ATOM   6759  C CD1 . LEU C  1 259 ? 40.687  4.231   65.261  1.00 40.59  ? 258  LEU C CD1 1 
ATOM   6760  C CD2 . LEU C  1 259 ? 41.000  4.679   62.815  1.00 40.95  ? 258  LEU C CD2 1 
ATOM   6761  N N   . HIS C  1 260 ? 45.638  4.345   62.374  1.00 62.24  ? 259  HIS C N   1 
ATOM   6762  C CA  . HIS C  1 260 ? 46.960  4.888   62.655  1.00 72.09  ? 259  HIS C CA  1 
ATOM   6763  C C   . HIS C  1 260 ? 46.959  6.407   62.505  1.00 60.80  ? 259  HIS C C   1 
ATOM   6764  O O   . HIS C  1 260 ? 46.325  6.965   61.605  1.00 59.70  ? 259  HIS C O   1 
ATOM   6765  C CB  . HIS C  1 260 ? 48.036  4.231   61.781  1.00 71.84  ? 259  HIS C CB  1 
ATOM   6766  C CG  . HIS C  1 260 ? 48.125  4.787   60.395  1.00 76.67  ? 259  HIS C CG  1 
ATOM   6767  N ND1 . HIS C  1 260 ? 47.115  4.645   59.469  1.00 82.05  ? 259  HIS C ND1 1 
ATOM   6768  C CD2 . HIS C  1 260 ? 49.116  5.467   59.771  1.00 95.59  ? 259  HIS C CD2 1 
ATOM   6769  C CE1 . HIS C  1 260 ? 47.475  5.225   58.337  1.00 96.49  ? 259  HIS C CE1 1 
ATOM   6770  N NE2 . HIS C  1 260 ? 48.684  5.731   58.494  1.00 103.47 ? 259  HIS C NE2 1 
ATOM   6771  N N   . TRP C  1 261 ? 47.655  7.068   63.419  1.00 55.47  ? 260  TRP C N   1 
ATOM   6772  C CA  . TRP C  1 261 ? 47.755  8.522   63.417  1.00 72.51  ? 260  TRP C CA  1 
ATOM   6773  C C   . TRP C  1 261 ? 48.819  8.980   62.420  1.00 75.13  ? 260  TRP C C   1 
ATOM   6774  O O   . TRP C  1 261 ? 49.991  8.611   62.534  1.00 71.52  ? 260  TRP C O   1 
ATOM   6775  C CB  . TRP C  1 261 ? 48.087  9.015   64.832  1.00 72.17  ? 260  TRP C CB  1 
ATOM   6776  C CG  . TRP C  1 261 ? 48.381  10.481  64.930  1.00 84.98  ? 260  TRP C CG  1 
ATOM   6777  C CD1 . TRP C  1 261 ? 49.611  11.067  64.980  1.00 69.17  ? 260  TRP C CD1 1 
ATOM   6778  C CD2 . TRP C  1 261 ? 47.425  11.544  65.001  1.00 76.75  ? 260  TRP C CD2 1 
ATOM   6779  N NE1 . TRP C  1 261 ? 49.480  12.430  65.072  1.00 71.98  ? 260  TRP C NE1 1 
ATOM   6780  C CE2 . TRP C  1 261 ? 48.149  12.748  65.085  1.00 74.67  ? 260  TRP C CE2 1 
ATOM   6781  C CE3 . TRP C  1 261 ? 46.029  11.595  64.999  1.00 72.67  ? 260  TRP C CE3 1 
ATOM   6782  C CZ2 . TRP C  1 261 ? 47.524  13.986  65.165  1.00 75.63  ? 260  TRP C CZ2 1 
ATOM   6783  C CZ3 . TRP C  1 261 ? 45.410  12.825  65.078  1.00 71.72  ? 260  TRP C CZ3 1 
ATOM   6784  C CH2 . TRP C  1 261 ? 46.156  14.003  65.161  1.00 78.49  ? 260  TRP C CH2 1 
ATOM   6785  N N   . THR C  1 262 ? 48.395  9.742   61.415  1.00 60.31  ? 261  THR C N   1 
ATOM   6786  C CA  . THR C  1 262 ? 49.330  10.423  60.527  1.00 86.37  ? 261  THR C CA  1 
ATOM   6787  C C   . THR C  1 262 ? 49.761  11.708  61.214  1.00 106.68 ? 261  THR C C   1 
ATOM   6788  O O   . THR C  1 262 ? 49.307  12.012  62.316  1.00 117.69 ? 261  THR C O   1 
ATOM   6789  C CB  . THR C  1 262 ? 48.698  10.784  59.168  1.00 101.00 ? 261  THR C CB  1 
ATOM   6790  O OG1 . THR C  1 262 ? 47.865  11.946  59.310  1.00 86.64  ? 261  THR C OG1 1 
ATOM   6791  C CG2 . THR C  1 262 ? 47.885  9.613   58.621  1.00 69.64  ? 261  THR C CG2 1 
ATOM   6792  N N   . SER C  1 263 ? 50.623  12.471  60.560  1.00 104.18 ? 262  SER C N   1 
ATOM   6793  C CA  . SER C  1 263 ? 51.131  13.699  61.150  1.00 107.86 ? 262  SER C CA  1 
ATOM   6794  C C   . SER C  1 263 ? 50.020  14.527  61.810  1.00 95.75  ? 262  SER C C   1 
ATOM   6795  O O   . SER C  1 263 ? 50.212  15.066  62.900  1.00 92.80  ? 262  SER C O   1 
ATOM   6796  C CB  . SER C  1 263 ? 51.852  14.527  60.085  1.00 113.90 ? 262  SER C CB  1 
ATOM   6797  O OG  . SER C  1 263 ? 52.892  13.771  59.483  1.00 133.91 ? 262  SER C OG  1 
ATOM   6798  N N   . THR C  1 264 ? 48.854  14.597  61.171  1.00 87.97  ? 263  THR C N   1 
ATOM   6799  C CA  . THR C  1 264 ? 47.832  15.572  61.558  1.00 91.18  ? 263  THR C CA  1 
ATOM   6800  C C   . THR C  1 264 ? 46.432  15.019  61.839  1.00 87.89  ? 263  THR C C   1 
ATOM   6801  O O   . THR C  1 264 ? 45.539  15.783  62.209  1.00 77.78  ? 263  THR C O   1 
ATOM   6802  C CB  . THR C  1 264 ? 47.662  16.642  60.460  1.00 102.86 ? 263  THR C CB  1 
ATOM   6803  O OG1 . THR C  1 264 ? 47.294  16.009  59.226  1.00 89.34  ? 263  THR C OG1 1 
ATOM   6804  C CG2 . THR C  1 264 ? 48.954  17.425  60.265  1.00 111.26 ? 263  THR C CG2 1 
ATOM   6805  N N   . ASN C  1 265 ? 46.218  13.720  61.652  1.00 73.33  ? 264  ASN C N   1 
ATOM   6806  C CA  . ASN C  1 265 ? 44.889  13.154  61.879  1.00 73.87  ? 264  ASN C CA  1 
ATOM   6807  C C   . ASN C  1 265 ? 44.839  11.628  61.809  1.00 74.82  ? 264  ASN C C   1 
ATOM   6808  O O   . ASN C  1 265 ? 45.791  10.977  61.386  1.00 63.59  ? 264  ASN C O   1 
ATOM   6809  C CB  . ASN C  1 265 ? 43.888  13.739  60.879  1.00 65.17  ? 264  ASN C CB  1 
ATOM   6810  C CG  . ASN C  1 265 ? 44.179  13.322  59.455  1.00 74.58  ? 264  ASN C CG  1 
ATOM   6811  O OD1 . ASN C  1 265 ? 43.945  12.176  59.073  1.00 79.21  ? 264  ASN C OD1 1 
ATOM   6812  N ND2 . ASN C  1 265 ? 44.691  14.251  58.659  1.00 82.00  ? 264  ASN C ND2 1 
ATOM   6813  N N   . TRP C  1 266 ? 43.712  11.060  62.223  1.00 76.73  ? 265  TRP C N   1 
ATOM   6814  C CA  . TRP C  1 266 ? 43.532  9.613   62.183  1.00 70.76  ? 265  TRP C CA  1 
ATOM   6815  C C   . TRP C  1 266 ? 43.107  9.152   60.795  1.00 55.90  ? 265  TRP C C   1 
ATOM   6816  O O   . TRP C  1 266 ? 42.317  9.808   60.116  1.00 66.95  ? 265  TRP C O   1 
ATOM   6817  C CB  . TRP C  1 266 ? 42.486  9.170   63.203  1.00 63.48  ? 265  TRP C CB  1 
ATOM   6818  C CG  . TRP C  1 266 ? 42.898  9.374   64.617  1.00 61.01  ? 265  TRP C CG  1 
ATOM   6819  C CD1 . TRP C  1 266 ? 42.429  10.325  65.478  1.00 46.31  ? 265  TRP C CD1 1 
ATOM   6820  C CD2 . TRP C  1 266 ? 43.864  8.610   65.347  1.00 43.55  ? 265  TRP C CD2 1 
ATOM   6821  N NE1 . TRP C  1 266 ? 43.041  10.195  66.703  1.00 58.03  ? 265  TRP C NE1 1 
ATOM   6822  C CE2 . TRP C  1 266 ? 43.929  9.152   66.646  1.00 59.16  ? 265  TRP C CE2 1 
ATOM   6823  C CE3 . TRP C  1 266 ? 44.676  7.519   65.031  1.00 57.31  ? 265  TRP C CE3 1 
ATOM   6824  C CZ2 . TRP C  1 266 ? 44.775  8.638   67.629  1.00 53.19  ? 265  TRP C CZ2 1 
ATOM   6825  C CZ3 . TRP C  1 266 ? 45.517  7.013   66.005  1.00 58.13  ? 265  TRP C CZ3 1 
ATOM   6826  C CH2 . TRP C  1 266 ? 45.561  7.572   67.288  1.00 49.85  ? 265  TRP C CH2 1 
ATOM   6827  N N   . LYS C  1 267 ? 43.642  8.011   60.386  1.00 43.83  ? 266  LYS C N   1 
ATOM   6828  C CA  . LYS C  1 267 ? 43.308  7.410   59.112  1.00 54.31  ? 266  LYS C CA  1 
ATOM   6829  C C   . LYS C  1 267 ? 43.001  5.937   59.354  1.00 56.02  ? 266  LYS C C   1 
ATOM   6830  O O   . LYS C  1 267 ? 43.704  5.272   60.118  1.00 48.90  ? 266  LYS C O   1 
ATOM   6831  C CB  . LYS C  1 267 ? 44.486  7.558   58.154  1.00 49.21  ? 266  LYS C CB  1 
ATOM   6832  C CG  . LYS C  1 267 ? 44.160  7.236   56.706  1.00 67.87  ? 266  LYS C CG  1 
ATOM   6833  C CD  . LYS C  1 267 ? 45.321  7.580   55.783  1.00 59.77  ? 266  LYS C CD  1 
ATOM   6834  C CE  . LYS C  1 267 ? 44.932  7.422   54.319  1.00 71.72  ? 266  LYS C CE  1 
ATOM   6835  N NZ  . LYS C  1 267 ? 46.028  7.822   53.393  1.00 80.98  ? 266  LYS C NZ  1 
ATOM   6836  N N   . GLY C  1 268 ? 41.958  5.424   58.711  1.00 62.79  ? 267  GLY C N   1 
ATOM   6837  C CA  . GLY C  1 268 ? 41.546  4.045   58.920  1.00 52.64  ? 267  GLY C CA  1 
ATOM   6838  C C   . GLY C  1 268 ? 41.710  3.188   57.681  1.00 54.74  ? 267  GLY C C   1 
ATOM   6839  O O   . GLY C  1 268 ? 41.573  3.665   56.558  1.00 54.41  ? 267  GLY C O   1 
ATOM   6840  N N   . THR C  1 269 ? 42.023  1.913   57.888  1.00 46.91  ? 268  THR C N   1 
ATOM   6841  C CA  . THR C  1 269 ? 42.060  0.949   56.795  1.00 62.01  ? 268  THR C CA  1 
ATOM   6842  C C   . THR C  1 269 ? 41.350  -0.333  57.208  1.00 49.56  ? 268  THR C C   1 
ATOM   6843  O O   . THR C  1 269 ? 41.322  -0.684  58.381  1.00 49.51  ? 268  THR C O   1 
ATOM   6844  C CB  . THR C  1 269 ? 43.505  0.611   56.393  1.00 63.90  ? 268  THR C CB  1 
ATOM   6845  O OG1 . THR C  1 269 ? 44.188  0.007   57.500  1.00 58.70  ? 268  THR C OG1 1 
ATOM   6846  C CG2 . THR C  1 269 ? 44.238  1.874   55.970  1.00 69.43  ? 268  THR C CG2 1 
ATOM   6847  N N   . ASN C  1 270 ? 40.781  -1.034  56.237  1.00 57.48  ? 269  ASN C N   1 
ATOM   6848  C CA  . ASN C  1 270 ? 40.115  -2.299  56.518  1.00 41.66  ? 269  ASN C CA  1 
ATOM   6849  C C   . ASN C  1 270 ? 40.603  -3.416  55.602  1.00 48.71  ? 269  ASN C C   1 
ATOM   6850  O O   . ASN C  1 270 ? 40.565  -3.303  54.373  1.00 49.91  ? 269  ASN C O   1 
ATOM   6851  C CB  . ASN C  1 270 ? 38.604  -2.142  56.386  1.00 44.07  ? 269  ASN C CB  1 
ATOM   6852  C CG  . ASN C  1 270 ? 37.858  -3.390  56.804  1.00 52.48  ? 269  ASN C CG  1 
ATOM   6853  O OD1 . ASN C  1 270 ? 37.737  -3.686  57.992  1.00 45.65  ? 269  ASN C OD1 1 
ATOM   6854  N ND2 . ASN C  1 270 ? 37.366  -4.140  55.826  1.00 46.41  ? 269  ASN C ND2 1 
ATOM   6855  N N   . THR C  1 271 ? 41.071  -4.494  56.212  1.00 47.06  ? 270  THR C N   1 
ATOM   6856  C CA  . THR C  1 271 ? 41.484  -5.677  55.472  1.00 56.01  ? 270  THR C CA  1 
ATOM   6857  C C   . THR C  1 271 ? 40.401  -6.753  55.550  1.00 56.95  ? 270  THR C C   1 
ATOM   6858  O O   . THR C  1 271 ? 39.996  -7.163  56.635  1.00 50.38  ? 270  THR C O   1 
ATOM   6859  C CB  . THR C  1 271 ? 42.787  -6.252  56.042  1.00 55.74  ? 270  THR C CB  1 
ATOM   6860  O OG1 . THR C  1 271 ? 43.778  -5.219  56.115  1.00 74.60  ? 270  THR C OG1 1 
ATOM   6861  C CG2 . THR C  1 271 ? 43.296  -7.392  55.173  1.00 57.31  ? 270  THR C CG2 1 
ATOM   6862  N N   . LYS C  1 272 ? 39.939  -7.215  54.396  1.00 54.66  ? 271  LYS C N   1 
ATOM   6863  C CA  . LYS C  1 272 ? 38.838  -8.164  54.340  1.00 44.96  ? 271  LYS C CA  1 
ATOM   6864  C C   . LYS C  1 272 ? 39.260  -9.596  54.655  1.00 54.16  ? 271  LYS C C   1 
ATOM   6865  O O   . LYS C  1 272 ? 40.356  -10.028 54.302  1.00 62.24  ? 271  LYS C O   1 
ATOM   6866  C CB  . LYS C  1 272 ? 38.205  -8.127  52.952  1.00 44.45  ? 271  LYS C CB  1 
ATOM   6867  C CG  . LYS C  1 272 ? 37.605  -6.787  52.573  1.00 42.40  ? 271  LYS C CG  1 
ATOM   6868  C CD  . LYS C  1 272 ? 37.031  -6.859  51.171  1.00 52.02  ? 271  LYS C CD  1 
ATOM   6869  C CE  . LYS C  1 272 ? 36.443  -5.542  50.713  1.00 64.85  ? 271  LYS C CE  1 
ATOM   6870  N NZ  . LYS C  1 272 ? 35.858  -5.666  49.343  1.00 75.90  ? 271  LYS C NZ  1 
ATOM   6871  N N   . ASP C  1 273 ? 38.366  -10.325 55.319  1.00 59.40  ? 272  ASP C N   1 
ATOM   6872  C CA  . ASP C  1 273 ? 38.504  -11.763 55.535  1.00 50.37  ? 272  ASP C CA  1 
ATOM   6873  C C   . ASP C  1 273 ? 39.871  -12.158 56.097  1.00 55.57  ? 272  ASP C C   1 
ATOM   6874  O O   . ASP C  1 273 ? 40.509  -13.098 55.621  1.00 62.21  ? 272  ASP C O   1 
ATOM   6875  C CB  . ASP C  1 273 ? 38.240  -12.512 54.221  1.00 45.36  ? 272  ASP C CB  1 
ATOM   6876  C CG  . ASP C  1 273 ? 36.958  -12.053 53.532  1.00 65.56  ? 272  ASP C CG  1 
ATOM   6877  O OD1 . ASP C  1 273 ? 36.092  -11.466 54.210  1.00 63.03  ? 272  ASP C OD1 1 
ATOM   6878  O OD2 . ASP C  1 273 ? 36.814  -12.278 52.313  1.00 79.53  ? 272  ASP C OD2 1 
ATOM   6879  N N   . LYS C  1 274 ? 40.307  -11.445 57.122  1.00 53.05  ? 273  LYS C N   1 
ATOM   6880  C CA  . LYS C  1 274 ? 41.588  -11.713 57.751  1.00 43.65  ? 273  LYS C CA  1 
ATOM   6881  C C   . LYS C  1 274 ? 41.556  -13.049 58.482  1.00 62.84  ? 273  LYS C C   1 
ATOM   6882  O O   . LYS C  1 274 ? 42.397  -13.916 58.244  1.00 62.78  ? 273  LYS C O   1 
ATOM   6883  C CB  . LYS C  1 274 ? 41.917  -10.594 58.736  1.00 57.08  ? 273  LYS C CB  1 
ATOM   6884  C CG  . LYS C  1 274 ? 43.293  -10.683 59.358  1.00 65.67  ? 273  LYS C CG  1 
ATOM   6885  C CD  . LYS C  1 274 ? 44.339  -10.006 58.493  1.00 69.99  ? 273  LYS C CD  1 
ATOM   6886  C CE  . LYS C  1 274 ? 45.655  -9.860  59.246  1.00 82.47  ? 273  LYS C CE  1 
ATOM   6887  N NZ  . LYS C  1 274 ? 46.649  -9.041  58.496  1.00 95.55  ? 273  LYS C NZ  1 
ATOM   6888  N N   . TRP C  1 275 ? 40.589  -13.214 59.378  1.00 52.20  ? 274  TRP C N   1 
ATOM   6889  C CA  . TRP C  1 275 ? 40.480  -14.443 60.151  1.00 43.37  ? 274  TRP C CA  1 
ATOM   6890  C C   . TRP C  1 275 ? 39.165  -15.167 59.887  1.00 50.23  ? 274  TRP C C   1 
ATOM   6891  O O   . TRP C  1 275 ? 38.183  -14.561 59.479  1.00 58.75  ? 274  TRP C O   1 
ATOM   6892  C CB  . TRP C  1 275 ? 40.600  -14.131 61.641  1.00 51.44  ? 274  TRP C CB  1 
ATOM   6893  C CG  . TRP C  1 275 ? 41.849  -13.398 61.990  1.00 63.52  ? 274  TRP C CG  1 
ATOM   6894  C CD1 . TRP C  1 275 ? 43.088  -13.936 62.160  1.00 63.78  ? 274  TRP C CD1 1 
ATOM   6895  C CD2 . TRP C  1 275 ? 41.986  -11.991 62.219  1.00 57.06  ? 274  TRP C CD2 1 
ATOM   6896  N NE1 . TRP C  1 275 ? 43.992  -12.951 62.479  1.00 70.17  ? 274  TRP C NE1 1 
ATOM   6897  C CE2 . TRP C  1 275 ? 43.341  -11.748 62.521  1.00 66.76  ? 274  TRP C CE2 1 
ATOM   6898  C CE3 . TRP C  1 275 ? 41.097  -10.913 62.199  1.00 48.82  ? 274  TRP C CE3 1 
ATOM   6899  C CZ2 . TRP C  1 275 ? 43.829  -10.471 62.799  1.00 66.17  ? 274  TRP C CZ2 1 
ATOM   6900  C CZ3 . TRP C  1 275 ? 41.582  -9.646  62.477  1.00 60.02  ? 274  TRP C CZ3 1 
ATOM   6901  C CH2 . TRP C  1 275 ? 42.936  -9.437  62.773  1.00 63.61  ? 274  TRP C CH2 1 
ATOM   6902  N N   . THR C  1 276 ? 39.158  -16.473 60.124  1.00 58.06  ? 275  THR C N   1 
ATOM   6903  C CA  . THR C  1 276 ? 37.943  -17.276 60.014  1.00 44.64  ? 275  THR C CA  1 
ATOM   6904  C C   . THR C  1 276 ? 37.851  -18.264 61.181  1.00 56.00  ? 275  THR C C   1 
ATOM   6905  O O   . THR C  1 276 ? 38.793  -19.004 61.464  1.00 49.77  ? 275  THR C O   1 
ATOM   6906  C CB  . THR C  1 276 ? 37.899  -18.054 58.691  1.00 50.68  ? 275  THR C CB  1 
ATOM   6907  O OG1 . THR C  1 276 ? 37.814  -17.140 57.595  1.00 59.11  ? 275  THR C OG1 1 
ATOM   6908  C CG2 . THR C  1 276 ? 36.699  -18.975 58.647  1.00 57.80  ? 275  THR C CG2 1 
ATOM   6909  N N   . ASP C  1 277 ? 36.714  -18.255 61.867  1.00 52.48  ? 276  ASP C N   1 
ATOM   6910  C CA  . ASP C  1 277 ? 36.465  -19.175 62.965  1.00 49.92  ? 276  ASP C CA  1 
ATOM   6911  C C   . ASP C  1 277 ? 35.408  -20.175 62.523  1.00 52.32  ? 276  ASP C C   1 
ATOM   6912  O O   . ASP C  1 277 ? 34.326  -19.796 62.090  1.00 49.87  ? 276  ASP C O   1 
ATOM   6913  C CB  . ASP C  1 277 ? 35.998  -18.404 64.195  1.00 42.43  ? 276  ASP C CB  1 
ATOM   6914  C CG  . ASP C  1 277 ? 36.952  -17.287 64.572  1.00 75.70  ? 276  ASP C CG  1 
ATOM   6915  O OD1 . ASP C  1 277 ? 38.181  -17.485 64.430  1.00 74.58  ? 276  ASP C OD1 1 
ATOM   6916  O OD2 . ASP C  1 277 ? 36.477  -16.209 64.999  1.00 57.74  ? 276  ASP C OD2 1 
ATOM   6917  N N   . ARG C  1 278 ? 35.729  -21.457 62.624  1.00 61.01  ? 277  ARG C N   1 
ATOM   6918  C CA  . ARG C  1 278 ? 34.874  -22.494 62.073  1.00 47.99  ? 277  ARG C CA  1 
ATOM   6919  C C   . ARG C  1 278 ? 34.584  -23.520 63.152  1.00 56.53  ? 277  ARG C C   1 
ATOM   6920  O O   . ARG C  1 278 ? 35.503  -24.041 63.783  1.00 64.27  ? 277  ARG C O   1 
ATOM   6921  C CB  . ARG C  1 278 ? 35.572  -23.141 60.884  1.00 56.16  ? 277  ARG C CB  1 
ATOM   6922  C CG  . ARG C  1 278 ? 34.648  -23.587 59.779  1.00 76.68  ? 277  ARG C CG  1 
ATOM   6923  C CD  . ARG C  1 278 ? 35.428  -23.861 58.501  1.00 83.28  ? 277  ARG C CD  1 
ATOM   6924  N NE  . ARG C  1 278 ? 34.543  -24.129 57.373  1.00 93.71  ? 277  ARG C NE  1 
ATOM   6925  C CZ  . ARG C  1 278 ? 34.102  -25.338 57.037  1.00 103.70 ? 277  ARG C CZ  1 
ATOM   6926  N NH1 . ARG C  1 278 ? 33.295  -25.480 55.992  1.00 101.28 ? 277  ARG C NH1 1 
ATOM   6927  N NH2 . ARG C  1 278 ? 34.465  -26.407 57.741  1.00 105.56 ? 277  ARG C NH2 1 
ATOM   6928  N N   . SER C  1 279 ? 33.303  -23.796 63.375  1.00 43.72  ? 278  SER C N   1 
ATOM   6929  C CA  . SER C  1 279 ? 32.893  -24.776 64.372  1.00 42.09  ? 278  SER C CA  1 
ATOM   6930  C C   . SER C  1 279 ? 31.968  -25.817 63.739  1.00 45.15  ? 278  SER C C   1 
ATOM   6931  O O   . SER C  1 279 ? 30.948  -25.467 63.152  1.00 44.56  ? 278  SER C O   1 
ATOM   6932  C CB  . SER C  1 279 ? 32.188  -24.066 65.522  1.00 45.88  ? 278  SER C CB  1 
ATOM   6933  O OG  . SER C  1 279 ? 31.988  -24.928 66.622  1.00 42.34  ? 278  SER C OG  1 
ATOM   6934  N N   . SER C  1 280 ? 32.329  -27.091 63.849  1.00 44.10  ? 279  SER C N   1 
ATOM   6935  C CA  . SER C  1 280 ? 31.594  -28.160 63.170  1.00 42.90  ? 279  SER C CA  1 
ATOM   6936  C C   . SER C  1 280 ? 31.045  -29.184 64.153  1.00 48.67  ? 279  SER C C   1 
ATOM   6937  O O   . SER C  1 280 ? 31.648  -29.462 65.191  1.00 46.89  ? 279  SER C O   1 
ATOM   6938  C CB  . SER C  1 280 ? 32.490  -28.884 62.160  1.00 40.18  ? 279  SER C CB  1 
ATOM   6939  O OG  . SER C  1 280 ? 32.927  -28.011 61.136  1.00 84.23  ? 279  SER C OG  1 
ATOM   6940  N N   . GLU C  1 281 ? 29.892  -29.746 63.814  1.00 45.59  ? 280  GLU C N   1 
ATOM   6941  C CA  . GLU C  1 281 ? 29.343  -30.880 64.542  1.00 41.27  ? 280  GLU C CA  1 
ATOM   6942  C C   . GLU C  1 281 ? 28.875  -31.900 63.533  1.00 43.56  ? 280  GLU C C   1 
ATOM   6943  O O   . GLU C  1 281 ? 28.435  -31.553 62.441  1.00 44.50  ? 280  GLU C O   1 
ATOM   6944  C CB  . GLU C  1 281 ? 28.156  -30.462 65.413  1.00 48.64  ? 280  GLU C CB  1 
ATOM   6945  C CG  . GLU C  1 281 ? 28.469  -29.376 66.410  1.00 53.32  ? 280  GLU C CG  1 
ATOM   6946  C CD  . GLU C  1 281 ? 29.417  -29.829 67.504  1.00 75.24  ? 280  GLU C CD  1 
ATOM   6947  O OE1 . GLU C  1 281 ? 30.101  -28.960 68.092  1.00 70.49  ? 280  GLU C OE1 1 
ATOM   6948  O OE2 . GLU C  1 281 ? 29.471  -31.048 67.782  1.00 70.55  ? 280  GLU C OE2 1 
ATOM   6949  N N   . ARG C  1 282 ? 28.966  -33.167 63.894  1.00 43.57  ? 281  ARG C N   1 
ATOM   6950  C CA  . ARG C  1 282 ? 28.396  -34.205 63.068  1.00 45.34  ? 281  ARG C CA  1 
ATOM   6951  C C   . ARG C  1 282 ? 27.274  -34.864 63.847  1.00 37.75  ? 281  ARG C C   1 
ATOM   6952  O O   . ARG C  1 282 ? 27.432  -35.186 65.026  1.00 33.52  ? 281  ARG C O   1 
ATOM   6953  C CB  . ARG C  1 282 ? 29.455  -35.233 62.684  1.00 50.41  ? 281  ARG C CB  1 
ATOM   6954  C CG  . ARG C  1 282 ? 28.886  -36.383 61.887  1.00 60.16  ? 281  ARG C CG  1 
ATOM   6955  C CD  . ARG C  1 282 ? 29.963  -37.173 61.189  1.00 65.45  ? 281  ARG C CD  1 
ATOM   6956  N NE  . ARG C  1 282 ? 30.576  -36.396 60.123  1.00 67.80  ? 281  ARG C NE  1 
ATOM   6957  C CZ  . ARG C  1 282 ? 31.452  -36.901 59.274  1.00 89.23  ? 281  ARG C CZ  1 
ATOM   6958  N NH1 . ARG C  1 282 ? 31.981  -36.142 58.322  1.00 76.91  ? 281  ARG C NH1 1 
ATOM   6959  N NH2 . ARG C  1 282 ? 31.785  -38.173 59.409  1.00 99.87  ? 281  ARG C NH2 1 
ATOM   6960  N N   . TYR C  1 283 ? 26.139  -35.057 63.192  1.00 37.52  ? 282  TYR C N   1 
ATOM   6961  C CA  . TYR C  1 283 ? 24.987  -35.669 63.836  1.00 36.72  ? 282  TYR C CA  1 
ATOM   6962  C C   . TYR C  1 283 ? 24.606  -36.945 63.116  1.00 43.91  ? 282  TYR C C   1 
ATOM   6963  O O   . TYR C  1 283 ? 24.880  -37.119 61.932  1.00 42.81  ? 282  TYR C O   1 
ATOM   6964  C CB  . TYR C  1 283 ? 23.793  -34.717 63.838  1.00 39.28  ? 282  TYR C CB  1 
ATOM   6965  C CG  . TYR C  1 283 ? 24.038  -33.403 64.561  1.00 33.25  ? 282  TYR C CG  1 
ATOM   6966  C CD1 . TYR C  1 283 ? 24.508  -32.283 63.877  1.00 42.89  ? 282  TYR C CD1 1 
ATOM   6967  C CD2 . TYR C  1 283 ? 23.795  -33.282 65.924  1.00 42.86  ? 282  TYR C CD2 1 
ATOM   6968  C CE1 . TYR C  1 283 ? 24.733  -31.083 64.532  1.00 32.04  ? 282  TYR C CE1 1 
ATOM   6969  C CE2 . TYR C  1 283 ? 24.015  -32.078 66.593  1.00 41.92  ? 282  TYR C CE2 1 
ATOM   6970  C CZ  . TYR C  1 283 ? 24.478  -30.986 65.891  1.00 36.74  ? 282  TYR C CZ  1 
ATOM   6971  O OH  . TYR C  1 283 ? 24.694  -29.800 66.551  1.00 44.49  ? 282  TYR C OH  1 
ATOM   6972  N N   . LYS C  1 284 ? 23.977  -37.848 63.848  1.00 39.01  ? 283  LYS C N   1 
ATOM   6973  C CA  . LYS C  1 284 ? 23.434  -39.050 63.259  1.00 43.81  ? 283  LYS C CA  1 
ATOM   6974  C C   . LYS C  1 284 ? 21.920  -38.905 63.195  1.00 41.65  ? 283  LYS C C   1 
ATOM   6975  O O   . LYS C  1 284 ? 21.268  -38.649 64.203  1.00 42.88  ? 283  LYS C O   1 
ATOM   6976  C CB  . LYS C  1 284 ? 23.824  -40.271 64.095  1.00 42.74  ? 283  LYS C CB  1 
ATOM   6977  C CG  . LYS C  1 284 ? 23.272  -41.588 63.573  1.00 59.01  ? 283  LYS C CG  1 
ATOM   6978  C CD  . LYS C  1 284 ? 23.607  -42.734 64.519  1.00 63.23  ? 283  LYS C CD  1 
ATOM   6979  C CE  . LYS C  1 284 ? 23.038  -44.053 64.023  1.00 87.09  ? 283  LYS C CE  1 
ATOM   6980  N NZ  . LYS C  1 284 ? 23.353  -45.182 64.940  1.00 87.91  ? 283  LYS C NZ  1 
ATOM   6981  N N   . ILE C  1 285 ? 21.377  -39.035 61.994  1.00 38.64  ? 284  ILE C N   1 
ATOM   6982  C CA  . ILE C  1 285 ? 19.942  -39.083 61.791  1.00 37.15  ? 284  ILE C CA  1 
ATOM   6983  C C   . ILE C  1 285 ? 19.510  -40.538 61.713  1.00 43.68  ? 284  ILE C C   1 
ATOM   6984  O O   . ILE C  1 285 ? 19.892  -41.251 60.793  1.00 40.88  ? 284  ILE C O   1 
ATOM   6985  C CB  . ILE C  1 285 ? 19.560  -38.408 60.477  1.00 34.97  ? 284  ILE C CB  1 
ATOM   6986  C CG1 . ILE C  1 285 ? 20.012  -36.946 60.489  1.00 31.35  ? 284  ILE C CG1 1 
ATOM   6987  C CG2 . ILE C  1 285 ? 18.052  -38.532 60.236  1.00 32.87  ? 284  ILE C CG2 1 
ATOM   6988  C CD1 . ILE C  1 285 ? 19.874  -36.268 59.147  1.00 34.82  ? 284  ILE C CD1 1 
ATOM   6989  N N   . ASP C  1 286 ? 18.732  -40.986 62.688  1.00 41.86  ? 285  ASP C N   1 
ATOM   6990  C CA  . ASP C  1 286 ? 18.158  -42.323 62.644  1.00 35.53  ? 285  ASP C CA  1 
ATOM   6991  C C   . ASP C  1 286 ? 16.714  -42.224 62.167  1.00 35.97  ? 285  ASP C C   1 
ATOM   6992  O O   . ASP C  1 286 ? 15.829  -41.852 62.938  1.00 38.22  ? 285  ASP C O   1 
ATOM   6993  C CB  . ASP C  1 286 ? 18.223  -42.971 64.026  1.00 39.54  ? 285  ASP C CB  1 
ATOM   6994  C CG  . ASP C  1 286 ? 17.903  -44.460 63.994  1.00 61.89  ? 285  ASP C CG  1 
ATOM   6995  O OD1 . ASP C  1 286 ? 17.238  -44.926 63.043  1.00 52.64  ? 285  ASP C OD1 1 
ATOM   6996  O OD2 . ASP C  1 286 ? 18.321  -45.164 64.933  1.00 70.19  ? 285  ASP C OD2 1 
ATOM   6997  N N   . TRP C  1 287 ? 16.481  -42.556 60.899  1.00 36.61  ? 286  TRP C N   1 
ATOM   6998  C CA  . TRP C  1 287 ? 15.158  -42.424 60.292  1.00 41.97  ? 286  TRP C CA  1 
ATOM   6999  C C   . TRP C  1 287 ? 14.156  -43.454 60.802  1.00 43.39  ? 286  TRP C C   1 
ATOM   7000  O O   . TRP C  1 287 ? 12.950  -43.265 60.668  1.00 45.35  ? 286  TRP C O   1 
ATOM   7001  C CB  . TRP C  1 287 ? 15.243  -42.544 58.770  1.00 35.15  ? 286  TRP C CB  1 
ATOM   7002  C CG  . TRP C  1 287 ? 16.020  -41.453 58.108  1.00 42.66  ? 286  TRP C CG  1 
ATOM   7003  C CD1 . TRP C  1 287 ? 17.335  -41.485 57.754  1.00 36.45  ? 286  TRP C CD1 1 
ATOM   7004  C CD2 . TRP C  1 287 ? 15.525  -40.164 57.709  1.00 35.98  ? 286  TRP C CD2 1 
ATOM   7005  N NE1 . TRP C  1 287 ? 17.689  -40.299 57.153  1.00 42.03  ? 286  TRP C NE1 1 
ATOM   7006  C CE2 . TRP C  1 287 ? 16.599  -39.471 57.120  1.00 40.29  ? 286  TRP C CE2 1 
ATOM   7007  C CE3 . TRP C  1 287 ? 14.280  -39.534 57.790  1.00 34.61  ? 286  TRP C CE3 1 
ATOM   7008  C CZ2 . TRP C  1 287 ? 16.467  -38.173 56.619  1.00 34.45  ? 286  TRP C CZ2 1 
ATOM   7009  C CZ3 . TRP C  1 287 ? 14.149  -38.245 57.296  1.00 32.01  ? 286  TRP C CZ3 1 
ATOM   7010  C CH2 . TRP C  1 287 ? 15.236  -37.582 56.708  1.00 31.68  ? 286  TRP C CH2 1 
ATOM   7011  N N   . GLU C  1 288 ? 14.644  -44.544 61.381  1.00 43.03  ? 287  GLU C N   1 
ATOM   7012  C CA  . GLU C  1 288 ? 13.745  -45.592 61.862  1.00 48.89  ? 287  GLU C CA  1 
ATOM   7013  C C   . GLU C  1 288 ? 13.269  -45.300 63.273  1.00 39.84  ? 287  GLU C C   1 
ATOM   7014  O O   . GLU C  1 288 ? 12.092  -45.457 63.566  1.00 51.79  ? 287  GLU C O   1 
ATOM   7015  C CB  . GLU C  1 288 ? 14.409  -46.975 61.776  1.00 51.43  ? 287  GLU C CB  1 
ATOM   7016  C CG  . GLU C  1 288 ? 14.554  -47.472 60.335  1.00 54.51  ? 287  GLU C CG  1 
ATOM   7017  C CD  . GLU C  1 288 ? 15.524  -48.635 60.187  1.00 71.91  ? 287  GLU C CD  1 
ATOM   7018  O OE1 . GLU C  1 288 ? 16.492  -48.720 60.975  1.00 66.77  ? 287  GLU C OE1 1 
ATOM   7019  O OE2 . GLU C  1 288 ? 15.317  -49.466 59.275  1.00 66.64  ? 287  GLU C OE2 1 
ATOM   7020  N N   . LYS C  1 289 ? 14.182  -44.877 64.144  1.00 49.49  ? 288  LYS C N   1 
ATOM   7021  C CA  . LYS C  1 289 ? 13.815  -44.492 65.498  1.00 44.23  ? 288  LYS C CA  1 
ATOM   7022  C C   . LYS C  1 289 ? 13.294  -43.050 65.526  1.00 56.47  ? 288  LYS C C   1 
ATOM   7023  O O   . LYS C  1 289 ? 12.716  -42.605 66.528  1.00 46.74  ? 288  LYS C O   1 
ATOM   7024  C CB  . LYS C  1 289 ? 15.014  -44.617 66.433  1.00 54.95  ? 288  LYS C CB  1 
ATOM   7025  C CG  . LYS C  1 289 ? 15.498  -46.034 66.627  1.00 82.31  ? 288  LYS C CG  1 
ATOM   7026  C CD  . LYS C  1 289 ? 16.721  -46.101 67.534  1.00 93.18  ? 288  LYS C CD  1 
ATOM   7027  C CE  . LYS C  1 289 ? 16.414  -45.601 68.937  1.00 98.24  ? 288  LYS C CE  1 
ATOM   7028  N NZ  . LYS C  1 289 ? 17.608  -45.674 69.828  1.00 103.63 ? 288  LYS C NZ  1 
ATOM   7029  N N   . GLU C  1 290 ? 13.497  -42.327 64.427  1.00 41.76  ? 289  GLU C N   1 
ATOM   7030  C CA  . GLU C  1 290 ? 13.134  -40.910 64.367  1.00 54.22  ? 289  GLU C CA  1 
ATOM   7031  C C   . GLU C  1 290 ? 13.775  -40.138 65.512  1.00 41.86  ? 289  GLU C C   1 
ATOM   7032  O O   . GLU C  1 290 ? 13.094  -39.507 66.318  1.00 35.52  ? 289  GLU C O   1 
ATOM   7033  C CB  . GLU C  1 290 ? 11.609  -40.732 64.382  1.00 40.49  ? 289  GLU C CB  1 
ATOM   7034  C CG  . GLU C  1 290 ? 10.962  -41.190 63.078  1.00 50.26  ? 289  GLU C CG  1 
ATOM   7035  C CD  . GLU C  1 290 ? 9.466   -40.939 63.031  1.00 66.61  ? 289  GLU C CD  1 
ATOM   7036  O OE1 . GLU C  1 290 ? 8.870   -40.644 64.087  1.00 74.99  ? 289  GLU C OE1 1 
ATOM   7037  O OE2 . GLU C  1 290 ? 8.884   -41.034 61.930  1.00 81.07  ? 289  GLU C OE2 1 
ATOM   7038  N N   . GLU C  1 291 ? 15.094  -40.222 65.587  1.00 39.15  ? 290  GLU C N   1 
ATOM   7039  C CA  . GLU C  1 291 ? 15.846  -39.425 66.528  1.00 40.26  ? 290  GLU C CA  1 
ATOM   7040  C C   . GLU C  1 291 ? 17.131  -38.939 65.877  1.00 51.53  ? 290  GLU C C   1 
ATOM   7041  O O   . GLU C  1 291 ? 17.585  -39.478 64.866  1.00 43.26  ? 290  GLU C O   1 
ATOM   7042  C CB  . GLU C  1 291 ? 16.148  -40.212 67.806  1.00 52.63  ? 290  GLU C CB  1 
ATOM   7043  C CG  . GLU C  1 291 ? 17.118  -41.356 67.643  1.00 69.50  ? 290  GLU C CG  1 
ATOM   7044  C CD  . GLU C  1 291 ? 17.289  -42.156 68.931  1.00 98.87  ? 290  GLU C CD  1 
ATOM   7045  O OE1 . GLU C  1 291 ? 16.299  -42.294 69.687  1.00 81.12  ? 290  GLU C OE1 1 
ATOM   7046  O OE2 . GLU C  1 291 ? 18.414  -42.642 69.190  1.00 101.00 ? 290  GLU C OE2 1 
ATOM   7047  N N   . MET C  1 292 ? 17.702  -37.900 66.464  1.00 39.23  ? 291  MET C N   1 
ATOM   7048  C CA  . MET C  1 292 ? 18.912  -37.299 65.956  1.00 42.56  ? 291  MET C CA  1 
ATOM   7049  C C   . MET C  1 292 ? 19.825  -37.150 67.163  1.00 41.75  ? 291  MET C C   1 
ATOM   7050  O O   . MET C  1 292 ? 19.381  -36.742 68.229  1.00 38.60  ? 291  MET C O   1 
ATOM   7051  C CB  . MET C  1 292 ? 18.563  -35.947 65.338  1.00 33.23  ? 291  MET C CB  1 
ATOM   7052  C CG  . MET C  1 292 ? 19.597  -35.371 64.427  1.00 54.28  ? 291  MET C CG  1 
ATOM   7053  S SD  . MET C  1 292 ? 18.963  -33.920 63.540  1.00 42.68  ? 291  MET C SD  1 
ATOM   7054  C CE  . MET C  1 292 ? 20.478  -33.375 62.744  1.00 43.47  ? 291  MET C CE  1 
ATOM   7055  N N   . THR C  1 293 ? 21.090  -37.522 67.014  1.00 36.36  ? 292  THR C N   1 
ATOM   7056  C CA  . THR C  1 293 ? 22.031  -37.419 68.120  1.00 39.57  ? 292  THR C CA  1 
ATOM   7057  C C   . THR C  1 293 ? 23.370  -36.851 67.653  1.00 36.37  ? 292  THR C C   1 
ATOM   7058  O O   . THR C  1 293 ? 23.732  -36.966 66.491  1.00 46.09  ? 292  THR C O   1 
ATOM   7059  C CB  . THR C  1 293 ? 22.272  -38.797 68.773  1.00 45.44  ? 292  THR C CB  1 
ATOM   7060  O OG1 . THR C  1 293 ? 22.696  -39.726 67.771  1.00 49.07  ? 292  THR C OG1 1 
ATOM   7061  C CG2 . THR C  1 293 ? 20.999  -39.326 69.432  1.00 44.36  ? 292  THR C CG2 1 
ATOM   7062  N N   . ASN C  1 294 ? 24.105  -36.238 68.571  1.00 42.74  ? 293  ASN C N   1 
ATOM   7063  C CA  . ASN C  1 294 ? 25.449  -35.760 68.283  1.00 44.41  ? 293  ASN C CA  1 
ATOM   7064  C C   . ASN C  1 294 ? 26.472  -36.892 68.414  1.00 49.27  ? 293  ASN C C   1 
ATOM   7065  O O   . ASN C  1 294 ? 26.501  -37.585 69.423  1.00 51.38  ? 293  ASN C O   1 
ATOM   7066  C CB  . ASN C  1 294 ? 25.811  -34.637 69.254  1.00 41.06  ? 293  ASN C CB  1 
ATOM   7067  C CG  . ASN C  1 294 ? 27.014  -33.829 68.791  1.00 61.42  ? 293  ASN C CG  1 
ATOM   7068  O OD1 . ASN C  1 294 ? 27.935  -34.362 68.170  1.00 49.34  ? 293  ASN C OD1 1 
ATOM   7069  N ND2 . ASN C  1 294 ? 27.007  -32.531 69.089  1.00 60.68  ? 293  ASN C ND2 1 
ATOM   7070  N N   . LEU C  1 295 ? 27.327  -37.069 67.412  1.00 59.78  ? 294  LEU C N   1 
ATOM   7071  C CA  . LEU C  1 295 ? 28.311  -38.152 67.425  1.00 52.83  ? 294  LEU C CA  1 
ATOM   7072  C C   . LEU C  1 295 ? 29.551  -37.844 68.270  1.00 58.18  ? 294  LEU C C   1 
ATOM   7073  O O   . LEU C  1 295 ? 29.662  -36.781 68.891  1.00 75.08  ? 294  LEU C O   1 
ATOM   7074  C CB  . LEU C  1 295 ? 28.727  -38.478 65.987  1.00 56.67  ? 294  LEU C CB  1 
ATOM   7075  C CG  . LEU C  1 295 ? 27.609  -39.136 65.172  1.00 59.10  ? 294  LEU C CG  1 
ATOM   7076  C CD1 . LEU C  1 295 ? 27.935  -39.168 63.700  1.00 66.17  ? 294  LEU C CD1 1 
ATOM   7077  C CD2 . LEU C  1 295 ? 27.337  -40.541 65.675  1.00 62.15  ? 294  LEU C CD2 1 
ATOM   7078  N N   . ALA D  1 2   ? -14.358 -12.444 46.344  1.00 89.22  ? 1    ALA D N   1 
ATOM   7079  C CA  . ALA D  1 2   ? -14.464 -13.457 47.433  1.00 88.68  ? 1    ALA D CA  1 
ATOM   7080  C C   . ALA D  1 2   ? -15.920 -13.853 47.659  1.00 88.08  ? 1    ALA D C   1 
ATOM   7081  O O   . ALA D  1 2   ? -16.836 -13.090 47.352  1.00 84.53  ? 1    ALA D O   1 
ATOM   7082  C CB  . ALA D  1 2   ? -13.861 -12.910 48.719  1.00 89.48  ? 1    ALA D CB  1 
ATOM   7083  N N   . ASP D  1 3   ? -16.125 -15.048 48.207  1.00 73.91  ? 2    ASP D N   1 
ATOM   7084  C CA  . ASP D  1 3   ? -17.468 -15.564 48.437  1.00 69.74  ? 2    ASP D CA  1 
ATOM   7085  C C   . ASP D  1 3   ? -18.300 -14.572 49.249  1.00 54.70  ? 2    ASP D C   1 
ATOM   7086  O O   . ASP D  1 3   ? -19.498 -14.415 49.023  1.00 54.07  ? 2    ASP D O   1 
ATOM   7087  C CB  . ASP D  1 3   ? -17.408 -16.917 49.155  1.00 59.52  ? 2    ASP D CB  1 
ATOM   7088  C CG  . ASP D  1 3   ? -16.764 -18.007 48.307  1.00 91.52  ? 2    ASP D CG  1 
ATOM   7089  O OD1 . ASP D  1 3   ? -15.855 -17.679 47.514  1.00 98.46  ? 2    ASP D OD1 1 
ATOM   7090  O OD2 . ASP D  1 3   ? -17.160 -19.193 48.438  1.00 74.63  ? 2    ASP D OD2 1 
ATOM   7091  N N   . SER D  1 4   ? -17.656 -13.898 50.193  1.00 44.28  ? 3    SER D N   1 
ATOM   7092  C CA  . SER D  1 4   ? -18.352 -12.971 51.072  1.00 56.38  ? 3    SER D CA  1 
ATOM   7093  C C   . SER D  1 4   ? -18.954 -11.800 50.287  1.00 61.19  ? 3    SER D C   1 
ATOM   7094  O O   . SER D  1 4   ? -20.013 -11.282 50.646  1.00 57.74  ? 3    SER D O   1 
ATOM   7095  C CB  . SER D  1 4   ? -17.394 -12.460 52.152  1.00 63.38  ? 3    SER D CB  1 
ATOM   7096  O OG  . SER D  1 4   ? -16.211 -11.925 51.577  1.00 74.44  ? 3    SER D OG  1 
ATOM   7097  N N   . ASP D  1 5   ? -18.278 -11.390 49.216  1.00 50.77  ? 4    ASP D N   1 
ATOM   7098  C CA  . ASP D  1 5   ? -18.750 -10.284 48.382  1.00 54.08  ? 4    ASP D CA  1 
ATOM   7099  C C   . ASP D  1 5   ? -20.029 -10.635 47.630  1.00 54.78  ? 4    ASP D C   1 
ATOM   7100  O O   . ASP D  1 5   ? -20.742 -9.752  47.174  1.00 44.97  ? 4    ASP D O   1 
ATOM   7101  C CB  . ASP D  1 5   ? -17.668 -9.867  47.382  1.00 54.32  ? 4    ASP D CB  1 
ATOM   7102  C CG  . ASP D  1 5   ? -16.414 -9.360  48.061  1.00 65.99  ? 4    ASP D CG  1 
ATOM   7103  O OD1 . ASP D  1 5   ? -16.456 -8.245  48.635  1.00 55.07  ? 4    ASP D OD1 1 
ATOM   7104  O OD2 . ASP D  1 5   ? -15.391 -10.080 48.020  1.00 64.80  ? 4    ASP D OD2 1 
ATOM   7105  N N   . ILE D  1 6   ? -20.312 -11.926 47.498  1.00 42.12  ? 5    ILE D N   1 
ATOM   7106  C CA  . ILE D  1 6   ? -21.528 -12.365 46.832  1.00 43.59  ? 5    ILE D CA  1 
ATOM   7107  C C   . ILE D  1 6   ? -22.421 -13.162 47.793  1.00 45.57  ? 5    ILE D C   1 
ATOM   7108  O O   . ILE D  1 6   ? -23.154 -14.060 47.375  1.00 42.86  ? 5    ILE D O   1 
ATOM   7109  C CB  . ILE D  1 6   ? -21.205 -13.185 45.560  1.00 43.17  ? 5    ILE D CB  1 
ATOM   7110  C CG1 . ILE D  1 6   ? -20.289 -14.366 45.897  1.00 42.95  ? 5    ILE D CG1 1 
ATOM   7111  C CG2 . ILE D  1 6   ? -20.544 -12.290 44.511  1.00 41.25  ? 5    ILE D CG2 1 
ATOM   7112  C CD1 . ILE D  1 6   ? -19.924 -15.224 44.698  1.00 40.08  ? 5    ILE D CD1 1 
ATOM   7113  N N   . ASN D  1 7   ? -22.345 -12.819 49.079  1.00 44.22  ? 6    ASN D N   1 
ATOM   7114  C CA  . ASN D  1 7   ? -23.271 -13.332 50.087  1.00 46.83  ? 6    ASN D CA  1 
ATOM   7115  C C   . ASN D  1 7   ? -23.227 -14.846 50.243  1.00 50.31  ? 6    ASN D C   1 
ATOM   7116  O O   . ASN D  1 7   ? -24.245 -15.475 50.509  1.00 50.43  ? 6    ASN D O   1 
ATOM   7117  C CB  . ASN D  1 7   ? -24.698 -12.895 49.761  1.00 46.44  ? 6    ASN D CB  1 
ATOM   7118  C CG  . ASN D  1 7   ? -24.832 -11.379 49.660  1.00 63.14  ? 6    ASN D CG  1 
ATOM   7119  O OD1 . ASN D  1 7   ? -25.171 -10.840 48.606  1.00 51.18  ? 6    ASN D OD1 1 
ATOM   7120  N ND2 . ASN D  1 7   ? -24.548 -10.687 50.756  1.00 53.51  ? 6    ASN D ND2 1 
ATOM   7121  N N   . ILE D  1 8   ? -22.044 -15.423 50.075  1.00 44.82  ? 7    ILE D N   1 
ATOM   7122  C CA  . ILE D  1 8   ? -21.864 -16.858 50.227  1.00 48.54  ? 7    ILE D CA  1 
ATOM   7123  C C   . ILE D  1 8   ? -20.837 -17.128 51.319  1.00 51.45  ? 7    ILE D C   1 
ATOM   7124  O O   . ILE D  1 8   ? -19.808 -16.458 51.387  1.00 43.40  ? 7    ILE D O   1 
ATOM   7125  C CB  . ILE D  1 8   ? -21.406 -17.501 48.903  1.00 50.34  ? 7    ILE D CB  1 
ATOM   7126  C CG1 . ILE D  1 8   ? -22.515 -17.384 47.854  1.00 44.70  ? 7    ILE D CG1 1 
ATOM   7127  C CG2 . ILE D  1 8   ? -21.030 -18.963 49.111  1.00 47.05  ? 7    ILE D CG2 1 
ATOM   7128  C CD1 . ILE D  1 8   ? -22.086 -17.813 46.457  1.00 44.81  ? 7    ILE D CD1 1 
ATOM   7129  N N   . LYS D  1 9   ? -21.137 -18.094 52.185  1.00 46.87  ? 8    LYS D N   1 
ATOM   7130  C CA  . LYS D  1 9   ? -20.223 -18.494 53.247  1.00 47.11  ? 8    LYS D CA  1 
ATOM   7131  C C   . LYS D  1 9   ? -18.826 -18.698 52.676  1.00 45.41  ? 8    LYS D C   1 
ATOM   7132  O O   . LYS D  1 9   ? -18.652 -19.370 51.656  1.00 43.48  ? 8    LYS D O   1 
ATOM   7133  C CB  . LYS D  1 9   ? -20.702 -19.794 53.905  1.00 46.19  ? 8    LYS D CB  1 
ATOM   7134  C CG  . LYS D  1 9   ? -21.060 -19.662 55.373  1.00 75.54  ? 8    LYS D CG  1 
ATOM   7135  C CD  . LYS D  1 9   ? -22.569 -19.609 55.589  1.00 78.38  ? 8    LYS D CD  1 
ATOM   7136  C CE  . LYS D  1 9   ? -22.923 -19.587 57.074  1.00 81.35  ? 8    LYS D CE  1 
ATOM   7137  N NZ  . LYS D  1 9   ? -24.396 -19.583 57.298  1.00 72.14  ? 8    LYS D NZ  1 
ATOM   7138  N N   . THR D  1 10  ? -17.828 -18.121 53.334  1.00 38.90  ? 9    THR D N   1 
ATOM   7139  C CA  . THR D  1 10  ? -16.445 -18.261 52.894  1.00 45.23  ? 9    THR D CA  1 
ATOM   7140  C C   . THR D  1 10  ? -16.032 -19.730 52.766  1.00 59.76  ? 9    THR D C   1 
ATOM   7141  O O   . THR D  1 10  ? -16.321 -20.550 53.641  1.00 56.86  ? 9    THR D O   1 
ATOM   7142  C CB  . THR D  1 10  ? -15.481 -17.546 53.870  1.00 60.09  ? 9    THR D CB  1 
ATOM   7143  O OG1 . THR D  1 10  ? -15.859 -16.167 53.998  1.00 75.30  ? 9    THR D OG1 1 
ATOM   7144  C CG2 . THR D  1 10  ? -14.042 -17.640 53.372  1.00 56.67  ? 9    THR D CG2 1 
ATOM   7145  N N   . GLY D  1 11  ? -15.363 -20.058 51.666  1.00 53.08  ? 10   GLY D N   1 
ATOM   7146  C CA  . GLY D  1 11  ? -14.844 -21.399 51.454  1.00 51.91  ? 10   GLY D CA  1 
ATOM   7147  C C   . GLY D  1 11  ? -15.834 -22.380 50.847  1.00 59.66  ? 10   GLY D C   1 
ATOM   7148  O O   . GLY D  1 11  ? -15.461 -23.492 50.471  1.00 64.83  ? 10   GLY D O   1 
ATOM   7149  N N   . THR D  1 12  ? -17.094 -21.972 50.740  1.00 51.90  ? 11   THR D N   1 
ATOM   7150  C CA  . THR D  1 12  ? -18.156 -22.844 50.237  1.00 48.43  ? 11   THR D CA  1 
ATOM   7151  C C   . THR D  1 12  ? -17.866 -23.399 48.838  1.00 54.57  ? 11   THR D C   1 
ATOM   7152  O O   . THR D  1 12  ? -18.179 -24.552 48.558  1.00 60.05  ? 11   THR D O   1 
ATOM   7153  C CB  . THR D  1 12  ? -19.519 -22.098 50.193  1.00 49.31  ? 11   THR D CB  1 
ATOM   7154  O OG1 . THR D  1 12  ? -19.929 -21.758 51.522  1.00 61.90  ? 11   THR D OG1 1 
ATOM   7155  C CG2 . THR D  1 12  ? -20.595 -22.958 49.544  1.00 42.58  ? 11   THR D CG2 1 
ATOM   7156  N N   . THR D  1 13  ? -17.277 -22.589 47.962  1.00 44.51  ? 12   THR D N   1 
ATOM   7157  C CA  . THR D  1 13  ? -17.085 -22.997 46.574  1.00 45.33  ? 12   THR D CA  1 
ATOM   7158  C C   . THR D  1 13  ? -15.695 -23.563 46.288  1.00 47.97  ? 12   THR D C   1 
ATOM   7159  O O   . THR D  1 13  ? -15.400 -23.916 45.157  1.00 55.65  ? 12   THR D O   1 
ATOM   7160  C CB  . THR D  1 13  ? -17.329 -21.822 45.609  1.00 49.00  ? 12   THR D CB  1 
ATOM   7161  O OG1 . THR D  1 13  ? -16.332 -20.810 45.812  1.00 51.77  ? 12   THR D OG1 1 
ATOM   7162  C CG2 . THR D  1 13  ? -18.724 -21.236 45.821  1.00 43.99  ? 12   THR D CG2 1 
ATOM   7163  N N   . ASP D  1 14  ? -14.832 -23.636 47.292  1.00 48.85  ? 13   ASP D N   1 
ATOM   7164  C CA  . ASP D  1 14  ? -13.504 -24.201 47.085  1.00 41.63  ? 13   ASP D CA  1 
ATOM   7165  C C   . ASP D  1 14  ? -13.590 -25.723 47.067  1.00 66.92  ? 13   ASP D C   1 
ATOM   7166  O O   . ASP D  1 14  ? -14.563 -26.302 47.561  1.00 59.23  ? 13   ASP D O   1 
ATOM   7167  C CB  . ASP D  1 14  ? -12.541 -23.747 48.184  1.00 61.62  ? 13   ASP D CB  1 
ATOM   7168  C CG  . ASP D  1 14  ? -12.088 -22.306 48.007  1.00 80.62  ? 13   ASP D CG  1 
ATOM   7169  O OD1 . ASP D  1 14  ? -12.118 -21.806 46.859  1.00 84.74  ? 13   ASP D OD1 1 
ATOM   7170  O OD2 . ASP D  1 14  ? -11.692 -21.677 49.016  1.00 88.80  ? 13   ASP D OD2 1 
ATOM   7171  N N   . ILE D  1 15  ? -12.574 -26.371 46.505  1.00 41.68  ? 14   ILE D N   1 
ATOM   7172  C CA  . ILE D  1 15  ? -12.557 -27.828 46.446  1.00 59.23  ? 14   ILE D CA  1 
ATOM   7173  C C   . ILE D  1 15  ? -11.572 -28.397 47.474  1.00 53.50  ? 14   ILE D C   1 
ATOM   7174  O O   . ILE D  1 15  ? -10.621 -27.725 47.871  1.00 53.92  ? 14   ILE D O   1 
ATOM   7175  C CB  . ILE D  1 15  ? -12.206 -28.322 45.018  1.00 68.35  ? 14   ILE D CB  1 
ATOM   7176  C CG1 . ILE D  1 15  ? -10.717 -28.164 44.732  1.00 62.98  ? 14   ILE D CG1 1 
ATOM   7177  C CG2 . ILE D  1 15  ? -13.005 -27.555 43.977  1.00 62.60  ? 14   ILE D CG2 1 
ATOM   7178  C CD1 . ILE D  1 15  ? -9.922  -29.407 45.010  1.00 59.99  ? 14   ILE D CD1 1 
ATOM   7179  N N   . GLY D  1 16  ? -11.809 -29.626 47.924  1.00 57.63  ? 15   GLY D N   1 
ATOM   7180  C CA  . GLY D  1 16  ? -10.861 -30.288 48.803  1.00 65.28  ? 15   GLY D CA  1 
ATOM   7181  C C   . GLY D  1 16  ? -11.421 -30.962 50.043  1.00 74.51  ? 15   GLY D C   1 
ATOM   7182  O O   . GLY D  1 16  ? -10.783 -31.869 50.583  1.00 71.74  ? 15   GLY D O   1 
ATOM   7183  N N   . SER D  1 17  ? -12.594 -30.535 50.508  1.00 53.88  ? 16   SER D N   1 
ATOM   7184  C CA  . SER D  1 17  ? -13.165 -31.100 51.736  1.00 77.85  ? 16   SER D CA  1 
ATOM   7185  C C   . SER D  1 17  ? -13.533 -32.575 51.570  1.00 79.50  ? 16   SER D C   1 
ATOM   7186  O O   . SER D  1 17  ? -13.870 -33.024 50.469  1.00 68.60  ? 16   SER D O   1 
ATOM   7187  C CB  . SER D  1 17  ? -14.394 -30.303 52.194  1.00 82.92  ? 16   SER D CB  1 
ATOM   7188  O OG  . SER D  1 17  ? -15.475 -30.427 51.284  1.00 89.98  ? 16   SER D OG  1 
ATOM   7189  N N   . ASN D  1 18  ? -13.458 -33.321 52.672  1.00 77.50  ? 17   ASN D N   1 
ATOM   7190  C CA  . ASN D  1 18  ? -13.831 -34.736 52.689  1.00 88.00  ? 17   ASN D CA  1 
ATOM   7191  C C   . ASN D  1 18  ? -12.978 -35.581 51.736  1.00 88.79  ? 17   ASN D C   1 
ATOM   7192  O O   . ASN D  1 18  ? -13.451 -36.578 51.182  1.00 65.15  ? 17   ASN D O   1 
ATOM   7193  C CB  . ASN D  1 18  ? -15.320 -34.897 52.346  1.00 96.46  ? 17   ASN D CB  1 
ATOM   7194  C CG  . ASN D  1 18  ? -16.235 -34.243 53.376  1.00 110.00 ? 17   ASN D CG  1 
ATOM   7195  O OD1 . ASN D  1 18  ? -15.944 -34.253 54.571  1.00 111.63 ? 17   ASN D OD1 1 
ATOM   7196  N ND2 . ASN D  1 18  ? -17.346 -33.673 52.912  1.00 99.60  ? 17   ASN D ND2 1 
ATOM   7197  N N   . THR D  1 19  ? -11.719 -35.184 51.561  1.00 78.85  ? 18   THR D N   1 
ATOM   7198  C CA  . THR D  1 19  ? -10.836 -35.821 50.587  1.00 62.03  ? 18   THR D CA  1 
ATOM   7199  C C   . THR D  1 19  ? -9.465  -36.125 51.186  1.00 44.39  ? 18   THR D C   1 
ATOM   7200  O O   . THR D  1 19  ? -8.829  -35.258 51.786  1.00 61.72  ? 18   THR D O   1 
ATOM   7201  C CB  . THR D  1 19  ? -10.621 -34.913 49.349  1.00 77.76  ? 18   THR D CB  1 
ATOM   7202  O OG1 . THR D  1 19  ? -11.888 -34.478 48.839  1.00 60.46  ? 18   THR D OG1 1 
ATOM   7203  C CG2 . THR D  1 19  ? -9.836  -35.653 48.248  1.00 61.99  ? 18   THR D CG2 1 
ATOM   7204  N N   . THR D  1 20  ? -9.012  -37.362 51.021  1.00 58.54  ? 19   THR D N   1 
ATOM   7205  C CA  . THR D  1 20  ? -7.639  -37.709 51.357  1.00 50.75  ? 19   THR D CA  1 
ATOM   7206  C C   . THR D  1 20  ? -6.753  -37.250 50.203  1.00 52.32  ? 19   THR D C   1 
ATOM   7207  O O   . THR D  1 20  ? -7.009  -37.576 49.046  1.00 44.55  ? 19   THR D O   1 
ATOM   7208  C CB  . THR D  1 20  ? -7.465  -39.230 51.580  1.00 47.16  ? 19   THR D CB  1 
ATOM   7209  O OG1 . THR D  1 20  ? -8.257  -39.646 52.697  1.00 58.10  ? 19   THR D OG1 1 
ATOM   7210  C CG2 . THR D  1 20  ? -6.009  -39.578 51.840  1.00 36.25  ? 19   THR D CG2 1 
ATOM   7211  N N   . VAL D  1 21  ? -5.724  -36.476 50.527  1.00 45.57  ? 20   VAL D N   1 
ATOM   7212  C CA  . VAL D  1 21  ? -4.840  -35.914 49.522  1.00 37.57  ? 20   VAL D CA  1 
ATOM   7213  C C   . VAL D  1 21  ? -3.484  -36.623 49.551  1.00 37.37  ? 20   VAL D C   1 
ATOM   7214  O O   . VAL D  1 21  ? -2.879  -36.781 50.606  1.00 47.86  ? 20   VAL D O   1 
ATOM   7215  C CB  . VAL D  1 21  ? -4.649  -34.405 49.761  1.00 36.93  ? 20   VAL D CB  1 
ATOM   7216  C CG1 . VAL D  1 21  ? -3.608  -33.830 48.810  1.00 39.48  ? 20   VAL D CG1 1 
ATOM   7217  C CG2 . VAL D  1 21  ? -5.969  -33.686 49.609  1.00 34.68  ? 20   VAL D CG2 1 
ATOM   7218  N N   . LYS D  1 22  ? -3.012  -37.048 48.386  1.00 38.68  ? 21   LYS D N   1 
ATOM   7219  C CA  . LYS D  1 22  ? -1.708  -37.706 48.273  1.00 36.25  ? 21   LYS D CA  1 
ATOM   7220  C C   . LYS D  1 22  ? -0.681  -36.731 47.739  1.00 35.84  ? 21   LYS D C   1 
ATOM   7221  O O   . LYS D  1 22  ? -0.912  -36.092 46.728  1.00 38.12  ? 21   LYS D O   1 
ATOM   7222  C CB  . LYS D  1 22  ? -1.793  -38.881 47.308  1.00 37.27  ? 21   LYS D CB  1 
ATOM   7223  C CG  . LYS D  1 22  ? -2.750  -39.963 47.739  1.00 47.70  ? 21   LYS D CG  1 
ATOM   7224  C CD  . LYS D  1 22  ? -2.221  -40.715 48.942  1.00 62.73  ? 21   LYS D CD  1 
ATOM   7225  C CE  . LYS D  1 22  ? -3.069  -41.936 49.251  1.00 71.97  ? 21   LYS D CE  1 
ATOM   7226  N NZ  . LYS D  1 22  ? -2.474  -42.756 50.338  1.00 72.97  ? 21   LYS D NZ  1 
ATOM   7227  N N   . THR D  1 23  ? 0.458   -36.623 48.408  1.00 33.52  ? 22   THR D N   1 
ATOM   7228  C CA  . THR D  1 23  ? 1.439   -35.606 48.076  1.00 34.16  ? 22   THR D CA  1 
ATOM   7229  C C   . THR D  1 23  ? 2.800   -36.259 47.955  1.00 36.08  ? 22   THR D C   1 
ATOM   7230  O O   . THR D  1 23  ? 2.990   -37.380 48.417  1.00 32.63  ? 22   THR D O   1 
ATOM   7231  C CB  . THR D  1 23  ? 1.522   -34.523 49.165  1.00 32.13  ? 22   THR D CB  1 
ATOM   7232  O OG1 . THR D  1 23  ? 1.919   -35.127 50.402  1.00 32.64  ? 22   THR D OG1 1 
ATOM   7233  C CG2 . THR D  1 23  ? 0.184   -33.831 49.342  1.00 34.10  ? 22   THR D CG2 1 
ATOM   7234  N N   . GLY D  1 24  ? 3.748   -35.550 47.347  1.00 32.92  ? 23   GLY D N   1 
ATOM   7235  C CA  . GLY D  1 24  ? 5.091   -36.070 47.176  1.00 30.13  ? 23   GLY D CA  1 
ATOM   7236  C C   . GLY D  1 24  ? 6.124   -35.007 46.870  1.00 36.16  ? 23   GLY D C   1 
ATOM   7237  O O   . GLY D  1 24  ? 5.805   -33.902 46.424  1.00 32.67  ? 23   GLY D O   1 
ATOM   7238  N N   . ASP D  1 25  ? 7.376   -35.352 47.144  1.00 40.84  ? 24   ASP D N   1 
ATOM   7239  C CA  . ASP D  1 25  ? 8.519   -34.512 46.813  1.00 41.80  ? 24   ASP D CA  1 
ATOM   7240  C C   . ASP D  1 25  ? 9.421   -35.272 45.846  1.00 44.55  ? 24   ASP D C   1 
ATOM   7241  O O   . ASP D  1 25  ? 9.715   -36.442 46.068  1.00 36.53  ? 24   ASP D O   1 
ATOM   7242  C CB  . ASP D  1 25  ? 9.314   -34.167 48.078  1.00 38.14  ? 24   ASP D CB  1 
ATOM   7243  C CG  . ASP D  1 25  ? 8.738   -32.974 48.828  1.00 80.29  ? 24   ASP D CG  1 
ATOM   7244  O OD1 . ASP D  1 25  ? 8.453   -31.944 48.172  1.00 78.34  ? 24   ASP D OD1 1 
ATOM   7245  O OD2 . ASP D  1 25  ? 8.575   -33.062 50.072  1.00 69.64  ? 24   ASP D OD2 1 
ATOM   7246  N N   . LEU D  1 26  ? 9.847   -34.609 44.774  1.00 36.31  ? 25   LEU D N   1 
ATOM   7247  C CA  . LEU D  1 26  ? 10.829  -35.174 43.851  1.00 41.18  ? 25   LEU D CA  1 
ATOM   7248  C C   . LEU D  1 26  ? 11.967  -34.171 43.700  1.00 42.99  ? 25   LEU D C   1 
ATOM   7249  O O   . LEU D  1 26  ? 11.754  -33.042 43.295  1.00 36.47  ? 25   LEU D O   1 
ATOM   7250  C CB  . LEU D  1 26  ? 10.193  -35.477 42.497  1.00 35.80  ? 25   LEU D CB  1 
ATOM   7251  C CG  . LEU D  1 26  ? 8.999   -36.434 42.556  1.00 44.85  ? 25   LEU D CG  1 
ATOM   7252  C CD1 . LEU D  1 26  ? 8.306   -36.522 41.202  1.00 45.98  ? 25   LEU D CD1 1 
ATOM   7253  C CD2 . LEU D  1 26  ? 9.443   -37.813 43.024  1.00 40.11  ? 25   LEU D CD2 1 
ATOM   7254  N N   . VAL D  1 27  ? 13.172  -34.585 44.060  1.00 36.93  ? 26   VAL D N   1 
ATOM   7255  C CA  . VAL D  1 27  ? 14.307  -33.681 44.105  1.00 35.00  ? 26   VAL D CA  1 
ATOM   7256  C C   . VAL D  1 27  ? 15.417  -34.204 43.207  1.00 45.98  ? 26   VAL D C   1 
ATOM   7257  O O   . VAL D  1 27  ? 15.754  -35.388 43.233  1.00 39.18  ? 26   VAL D O   1 
ATOM   7258  C CB  . VAL D  1 27  ? 14.869  -33.559 45.536  1.00 42.01  ? 26   VAL D CB  1 
ATOM   7259  C CG1 . VAL D  1 27  ? 16.120  -32.686 45.554  1.00 35.01  ? 26   VAL D CG1 1 
ATOM   7260  C CG2 . VAL D  1 27  ? 13.816  -33.002 46.470  1.00 39.46  ? 26   VAL D CG2 1 
ATOM   7261  N N   . THR D  1 28  ? 15.988  -33.309 42.418  1.00 38.31  ? 27   THR D N   1 
ATOM   7262  C CA  . THR D  1 28  ? 17.141  -33.638 41.606  1.00 42.42  ? 27   THR D CA  1 
ATOM   7263  C C   . THR D  1 28  ? 18.068  -32.428 41.545  1.00 45.72  ? 27   THR D C   1 
ATOM   7264  O O   . THR D  1 28  ? 17.616  -31.285 41.518  1.00 44.80  ? 27   THR D O   1 
ATOM   7265  C CB  . THR D  1 28  ? 16.725  -34.091 40.177  1.00 45.87  ? 27   THR D CB  1 
ATOM   7266  O OG1 . THR D  1 28  ? 17.896  -34.358 39.398  1.00 71.50  ? 27   THR D OG1 1 
ATOM   7267  C CG2 . THR D  1 28  ? 15.900  -33.028 39.483  1.00 45.72  ? 27   THR D CG2 1 
ATOM   7268  N N   . TYR D  1 29  ? 19.370  -32.683 41.561  1.00 47.60  ? 28   TYR D N   1 
ATOM   7269  C CA  . TYR D  1 29  ? 20.344  -31.620 41.407  1.00 40.96  ? 28   TYR D CA  1 
ATOM   7270  C C   . TYR D  1 29  ? 21.139  -31.777 40.112  1.00 49.47  ? 28   TYR D C   1 
ATOM   7271  O O   . TYR D  1 29  ? 21.794  -32.796 39.887  1.00 37.72  ? 28   TYR D O   1 
ATOM   7272  C CB  . TYR D  1 29  ? 21.300  -31.572 42.594  1.00 37.84  ? 28   TYR D CB  1 
ATOM   7273  C CG  . TYR D  1 29  ? 22.324  -30.465 42.452  1.00 46.21  ? 28   TYR D CG  1 
ATOM   7274  C CD1 . TYR D  1 29  ? 21.939  -29.130 42.494  1.00 40.73  ? 28   TYR D CD1 1 
ATOM   7275  C CD2 . TYR D  1 29  ? 23.673  -30.753 42.271  1.00 42.17  ? 28   TYR D CD2 1 
ATOM   7276  C CE1 . TYR D  1 29  ? 22.871  -28.112 42.361  1.00 44.42  ? 28   TYR D CE1 1 
ATOM   7277  C CE2 . TYR D  1 29  ? 24.613  -29.743 42.139  1.00 41.63  ? 28   TYR D CE2 1 
ATOM   7278  C CZ  . TYR D  1 29  ? 24.206  -28.426 42.180  1.00 51.47  ? 28   TYR D CZ  1 
ATOM   7279  O OH  . TYR D  1 29  ? 25.137  -27.422 42.049  1.00 41.76  ? 28   TYR D OH  1 
ATOM   7280  N N   . ASP D  1 30  ? 21.071  -30.755 39.267  1.00 43.45  ? 29   ASP D N   1 
ATOM   7281  C CA  . ASP D  1 30  ? 21.831  -30.714 38.029  1.00 39.87  ? 29   ASP D CA  1 
ATOM   7282  C C   . ASP D  1 30  ? 23.150  -29.985 38.264  1.00 42.80  ? 29   ASP D C   1 
ATOM   7283  O O   . ASP D  1 30  ? 23.183  -28.760 38.337  1.00 40.85  ? 29   ASP D O   1 
ATOM   7284  C CB  . ASP D  1 30  ? 21.023  -30.007 36.943  1.00 35.98  ? 29   ASP D CB  1 
ATOM   7285  C CG  . ASP D  1 30  ? 21.737  -29.998 35.597  1.00 60.13  ? 29   ASP D CG  1 
ATOM   7286  O OD1 . ASP D  1 30  ? 21.047  -29.893 34.560  1.00 50.96  ? 29   ASP D OD1 1 
ATOM   7287  O OD2 . ASP D  1 30  ? 22.985  -30.095 35.577  1.00 49.37  ? 29   ASP D OD2 1 
ATOM   7288  N N   . LYS D  1 31  ? 24.229  -30.751 38.380  1.00 48.21  ? 30   LYS D N   1 
ATOM   7289  C CA  . LYS D  1 31  ? 25.543  -30.217 38.707  1.00 55.70  ? 30   LYS D CA  1 
ATOM   7290  C C   . LYS D  1 31  ? 26.081  -29.302 37.610  1.00 59.38  ? 30   LYS D C   1 
ATOM   7291  O O   . LYS D  1 31  ? 26.570  -28.213 37.896  1.00 61.23  ? 30   LYS D O   1 
ATOM   7292  C CB  . LYS D  1 31  ? 26.520  -31.369 38.939  1.00 65.93  ? 30   LYS D CB  1 
ATOM   7293  C CG  . LYS D  1 31  ? 27.737  -30.999 39.761  1.00 81.25  ? 30   LYS D CG  1 
ATOM   7294  C CD  . LYS D  1 31  ? 28.522  -32.245 40.154  1.00 108.23 ? 30   LYS D CD  1 
ATOM   7295  C CE  . LYS D  1 31  ? 29.603  -31.933 41.181  1.00 113.24 ? 30   LYS D CE  1 
ATOM   7296  N NZ  . LYS D  1 31  ? 30.590  -30.937 40.680  1.00 93.88  ? 30   LYS D NZ  1 
ATOM   7297  N N   . GLU D  1 32  ? 25.979  -29.744 36.360  1.00 53.69  ? 31   GLU D N   1 
ATOM   7298  C CA  . GLU D  1 32  ? 26.501  -28.979 35.222  1.00 61.26  ? 31   GLU D CA  1 
ATOM   7299  C C   . GLU D  1 32  ? 25.881  -27.591 35.143  1.00 60.93  ? 31   GLU D C   1 
ATOM   7300  O O   . GLU D  1 32  ? 26.564  -26.616 34.828  1.00 53.10  ? 31   GLU D O   1 
ATOM   7301  C CB  . GLU D  1 32  ? 26.243  -29.714 33.896  1.00 64.86  ? 31   GLU D CB  1 
ATOM   7302  C CG  . GLU D  1 32  ? 27.372  -30.630 33.442  1.00 95.58  ? 31   GLU D CG  1 
ATOM   7303  C CD  . GLU D  1 32  ? 27.364  -31.980 34.140  1.00 120.94 ? 31   GLU D CD  1 
ATOM   7304  O OE1 . GLU D  1 32  ? 26.471  -32.216 34.984  1.00 107.81 ? 31   GLU D OE1 1 
ATOM   7305  O OE2 . GLU D  1 32  ? 28.250  -32.809 33.836  1.00 130.53 ? 31   GLU D OE2 1 
ATOM   7306  N N   . ASN D  1 33  ? 24.584  -27.505 35.419  1.00 50.45  ? 32   ASN D N   1 
ATOM   7307  C CA  . ASN D  1 33  ? 23.858  -26.253 35.237  1.00 48.27  ? 32   ASN D CA  1 
ATOM   7308  C C   . ASN D  1 33  ? 23.621  -25.498 36.537  1.00 43.07  ? 32   ASN D C   1 
ATOM   7309  O O   . ASN D  1 33  ? 23.071  -24.405 36.517  1.00 45.12  ? 32   ASN D O   1 
ATOM   7310  C CB  . ASN D  1 33  ? 22.525  -26.511 34.538  1.00 47.80  ? 32   ASN D CB  1 
ATOM   7311  C CG  . ASN D  1 33  ? 22.701  -26.880 33.086  1.00 58.51  ? 32   ASN D CG  1 
ATOM   7312  O OD1 . ASN D  1 33  ? 23.392  -26.183 32.349  1.00 61.75  ? 32   ASN D OD1 1 
ATOM   7313  N ND2 . ASN D  1 33  ? 22.090  -27.986 32.667  1.00 53.98  ? 32   ASN D ND2 1 
ATOM   7314  N N   . GLY D  1 34  ? 24.046  -26.077 37.659  1.00 38.21  ? 33   GLY D N   1 
ATOM   7315  C CA  . GLY D  1 34  ? 23.879  -25.438 38.953  1.00 45.75  ? 33   GLY D CA  1 
ATOM   7316  C C   . GLY D  1 34  ? 22.420  -25.178 39.309  1.00 50.77  ? 33   GLY D C   1 
ATOM   7317  O O   . GLY D  1 34  ? 22.046  -24.058 39.651  1.00 41.24  ? 33   GLY D O   1 
ATOM   7318  N N   . MET D  1 35  ? 21.592  -26.217 39.234  1.00 40.42  ? 34   MET D N   1 
ATOM   7319  C CA  . MET D  1 35  ? 20.172  -26.064 39.502  1.00 37.12  ? 34   MET D CA  1 
ATOM   7320  C C   . MET D  1 35  ? 19.652  -27.135 40.436  1.00 44.75  ? 34   MET D C   1 
ATOM   7321  O O   . MET D  1 35  ? 19.673  -28.323 40.116  1.00 39.55  ? 34   MET D O   1 
ATOM   7322  C CB  . MET D  1 35  ? 19.379  -26.101 38.203  1.00 37.73  ? 34   MET D CB  1 
ATOM   7323  C CG  . MET D  1 35  ? 19.719  -24.971 37.271  1.00 32.48  ? 34   MET D CG  1 
ATOM   7324  S SD  . MET D  1 35  ? 18.829  -25.117 35.716  1.00 48.52  ? 34   MET D SD  1 
ATOM   7325  C CE  . MET D  1 35  ? 19.445  -23.676 34.834  1.00 41.72  ? 34   MET D CE  1 
ATOM   7326  N N   . HIS D  1 36  ? 19.195  -26.698 41.604  1.00 43.65  ? 35   HIS D N   1 
ATOM   7327  C CA  . HIS D  1 36  ? 18.490  -27.571 42.533  1.00 43.90  ? 35   HIS D CA  1 
ATOM   7328  C C   . HIS D  1 36  ? 17.018  -27.541 42.161  1.00 39.39  ? 35   HIS D C   1 
ATOM   7329  O O   . HIS D  1 36  ? 16.384  -26.491 42.200  1.00 41.62  ? 35   HIS D O   1 
ATOM   7330  C CB  . HIS D  1 36  ? 18.697  -27.091 43.966  1.00 37.21  ? 35   HIS D CB  1 
ATOM   7331  C CG  . HIS D  1 36  ? 18.055  -27.965 44.994  1.00 38.91  ? 35   HIS D CG  1 
ATOM   7332  N ND1 . HIS D  1 36  ? 17.096  -27.504 45.867  1.00 47.22  ? 35   HIS D ND1 1 
ATOM   7333  C CD2 . HIS D  1 36  ? 18.239  -29.275 45.294  1.00 50.39  ? 35   HIS D CD2 1 
ATOM   7334  C CE1 . HIS D  1 36  ? 16.708  -28.490 46.655  1.00 47.82  ? 35   HIS D CE1 1 
ATOM   7335  N NE2 . HIS D  1 36  ? 17.386  -29.576 46.330  1.00 41.40  ? 35   HIS D NE2 1 
ATOM   7336  N N   . LYS D  1 37  ? 16.485  -28.687 41.763  1.00 37.76  ? 36   LYS D N   1 
ATOM   7337  C CA  . LYS D  1 37  ? 15.120  -28.746 41.261  1.00 37.85  ? 36   LYS D CA  1 
ATOM   7338  C C   . LYS D  1 37  ? 14.238  -29.596 42.174  1.00 47.35  ? 36   LYS D C   1 
ATOM   7339  O O   . LYS D  1 37  ? 14.575  -30.726 42.516  1.00 47.53  ? 36   LYS D O   1 
ATOM   7340  C CB  . LYS D  1 37  ? 15.102  -29.280 39.829  1.00 41.32  ? 36   LYS D CB  1 
ATOM   7341  C CG  . LYS D  1 37  ? 15.965  -28.445 38.889  1.00 50.87  ? 36   LYS D CG  1 
ATOM   7342  C CD  . LYS D  1 37  ? 15.771  -28.830 37.448  1.00 47.75  ? 36   LYS D CD  1 
ATOM   7343  C CE  . LYS D  1 37  ? 16.353  -30.198 37.155  1.00 45.47  ? 36   LYS D CE  1 
ATOM   7344  N NZ  . LYS D  1 37  ? 16.226  -30.500 35.712  1.00 58.96  ? 36   LYS D NZ  1 
ATOM   7345  N N   . LYS D  1 38  ? 13.115  -29.026 42.588  1.00 48.35  ? 37   LYS D N   1 
ATOM   7346  C CA  . LYS D  1 38  ? 12.215  -29.714 43.487  1.00 43.68  ? 37   LYS D CA  1 
ATOM   7347  C C   . LYS D  1 38  ? 10.792  -29.572 42.977  1.00 38.72  ? 37   LYS D C   1 
ATOM   7348  O O   . LYS D  1 38  ? 10.314  -28.470 42.726  1.00 35.00  ? 37   LYS D O   1 
ATOM   7349  C CB  . LYS D  1 38  ? 12.339  -29.136 44.901  1.00 44.21  ? 37   LYS D CB  1 
ATOM   7350  C CG  . LYS D  1 38  ? 11.774  -30.038 45.979  1.00 48.67  ? 37   LYS D CG  1 
ATOM   7351  C CD  . LYS D  1 38  ? 10.267  -29.927 46.065  1.00 53.38  ? 37   LYS D CD  1 
ATOM   7352  C CE  . LYS D  1 38  ? 9.846   -28.965 47.164  1.00 48.88  ? 37   LYS D CE  1 
ATOM   7353  N NZ  . LYS D  1 38  ? 10.179  -29.492 48.515  1.00 51.30  ? 37   LYS D NZ  1 
ATOM   7354  N N   . VAL D  1 39  ? 10.128  -30.701 42.802  1.00 33.95  ? 38   VAL D N   1 
ATOM   7355  C CA  . VAL D  1 39  ? 8.708   -30.715 42.527  1.00 40.26  ? 38   VAL D CA  1 
ATOM   7356  C C   . VAL D  1 39  ? 7.989   -31.147 43.806  1.00 44.60  ? 38   VAL D C   1 
ATOM   7357  O O   . VAL D  1 39  ? 8.337   -32.161 44.408  1.00 39.79  ? 38   VAL D O   1 
ATOM   7358  C CB  . VAL D  1 39  ? 8.371   -31.714 41.411  1.00 46.11  ? 38   VAL D CB  1 
ATOM   7359  C CG1 . VAL D  1 39  ? 6.877   -31.980 41.357  1.00 41.85  ? 38   VAL D CG1 1 
ATOM   7360  C CG2 . VAL D  1 39  ? 8.881   -31.202 40.087  1.00 41.16  ? 38   VAL D CG2 1 
ATOM   7361  N N   . PHE D  1 40  ? 7.009   -30.359 44.229  1.00 35.02  ? 39   PHE D N   1 
ATOM   7362  C CA  . PHE D  1 40  ? 6.099   -30.776 45.275  1.00 36.01  ? 39   PHE D CA  1 
ATOM   7363  C C   . PHE D  1 40  ? 4.733   -30.938 44.639  1.00 33.64  ? 39   PHE D C   1 
ATOM   7364  O O   . PHE D  1 40  ? 4.190   -29.981 44.099  1.00 32.85  ? 39   PHE D O   1 
ATOM   7365  C CB  . PHE D  1 40  ? 6.046   -29.742 46.400  1.00 32.87  ? 39   PHE D CB  1 
ATOM   7366  C CG  . PHE D  1 40  ? 5.042   -30.079 47.471  1.00 44.32  ? 39   PHE D CG  1 
ATOM   7367  C CD1 . PHE D  1 40  ? 5.352   -30.989 48.466  1.00 39.09  ? 39   PHE D CD1 1 
ATOM   7368  C CD2 . PHE D  1 40  ? 3.780   -29.504 47.467  1.00 49.41  ? 39   PHE D CD2 1 
ATOM   7369  C CE1 . PHE D  1 40  ? 4.431   -31.310 49.442  1.00 43.29  ? 39   PHE D CE1 1 
ATOM   7370  C CE2 . PHE D  1 40  ? 2.849   -29.826 48.447  1.00 48.29  ? 39   PHE D CE2 1 
ATOM   7371  C CZ  . PHE D  1 40  ? 3.179   -30.735 49.431  1.00 38.10  ? 39   PHE D CZ  1 
ATOM   7372  N N   . TYR D  1 41  ? 4.176   -32.145 44.687  1.00 30.45  ? 40   TYR D N   1 
ATOM   7373  C CA  . TYR D  1 41  ? 2.898   -32.389 44.028  1.00 31.54  ? 40   TYR D CA  1 
ATOM   7374  C C   . TYR D  1 41  ? 1.806   -32.818 45.003  1.00 32.86  ? 40   TYR D C   1 
ATOM   7375  O O   . TYR D  1 41  ? 2.087   -33.367 46.067  1.00 31.75  ? 40   TYR D O   1 
ATOM   7376  C CB  . TYR D  1 41  ? 3.064   -33.428 42.923  1.00 30.69  ? 40   TYR D CB  1 
ATOM   7377  C CG  . TYR D  1 41  ? 3.361   -34.837 43.394  1.00 32.93  ? 40   TYR D CG  1 
ATOM   7378  C CD1 . TYR D  1 41  ? 2.339   -35.688 43.793  1.00 35.40  ? 40   TYR D CD1 1 
ATOM   7379  C CD2 . TYR D  1 41  ? 4.662   -35.325 43.412  1.00 34.62  ? 40   TYR D CD2 1 
ATOM   7380  C CE1 . TYR D  1 41  ? 2.609   -36.983 44.216  1.00 39.30  ? 40   TYR D CE1 1 
ATOM   7381  C CE2 . TYR D  1 41  ? 4.943   -36.625 43.832  1.00 36.87  ? 40   TYR D CE2 1 
ATOM   7382  C CZ  . TYR D  1 41  ? 3.918   -37.451 44.226  1.00 39.43  ? 40   TYR D CZ  1 
ATOM   7383  O OH  . TYR D  1 41  ? 4.209   -38.744 44.635  1.00 40.66  ? 40   TYR D OH  1 
ATOM   7384  N N   . SER D  1 42  ? 0.559   -32.571 44.618  1.00 35.28  ? 41   SER D N   1 
ATOM   7385  C CA  . SER D  1 42  ? -0.601  -32.953 45.422  1.00 34.47  ? 41   SER D CA  1 
ATOM   7386  C C   . SER D  1 42  ? -1.740  -33.409 44.522  1.00 32.90  ? 41   SER D C   1 
ATOM   7387  O O   . SER D  1 42  ? -2.243  -32.635 43.710  1.00 37.51  ? 41   SER D O   1 
ATOM   7388  C CB  . SER D  1 42  ? -1.089  -31.757 46.255  1.00 37.29  ? 41   SER D CB  1 
ATOM   7389  O OG  . SER D  1 42  ? -0.046  -31.215 47.049  1.00 42.59  ? 41   SER D OG  1 
ATOM   7390  N N   . PHE D  1 43  ? -2.152  -34.659 44.675  1.00 28.31  ? 42   PHE D N   1 
ATOM   7391  C CA  . PHE D  1 43  ? -3.320  -35.176 43.981  1.00 34.94  ? 42   PHE D CA  1 
ATOM   7392  C C   . PHE D  1 43  ? -4.567  -34.952 44.821  1.00 37.40  ? 42   PHE D C   1 
ATOM   7393  O O   . PHE D  1 43  ? -4.662  -35.442 45.943  1.00 35.11  ? 42   PHE D O   1 
ATOM   7394  C CB  . PHE D  1 43  ? -3.174  -36.682 43.737  1.00 33.78  ? 42   PHE D CB  1 
ATOM   7395  C CG  . PHE D  1 43  ? -2.215  -37.037 42.639  1.00 35.62  ? 42   PHE D CG  1 
ATOM   7396  C CD1 . PHE D  1 43  ? -0.891  -37.340 42.925  1.00 29.67  ? 42   PHE D CD1 1 
ATOM   7397  C CD2 . PHE D  1 43  ? -2.643  -37.087 41.323  1.00 37.70  ? 42   PHE D CD2 1 
ATOM   7398  C CE1 . PHE D  1 43  ? -0.010  -37.693 41.910  1.00 40.58  ? 42   PHE D CE1 1 
ATOM   7399  C CE2 . PHE D  1 43  ? -1.764  -37.427 40.299  1.00 37.49  ? 42   PHE D CE2 1 
ATOM   7400  C CZ  . PHE D  1 43  ? -0.451  -37.740 40.596  1.00 34.84  ? 42   PHE D CZ  1 
ATOM   7401  N N   . ILE D  1 44  ? -5.526  -34.234 44.255  1.00 39.31  ? 43   ILE D N   1 
ATOM   7402  C CA  . ILE D  1 44  ? -6.797  -33.990 44.905  1.00 35.07  ? 43   ILE D CA  1 
ATOM   7403  C C   . ILE D  1 44  ? -7.895  -34.621 44.068  1.00 44.48  ? 43   ILE D C   1 
ATOM   7404  O O   . ILE D  1 44  ? -8.182  -34.165 42.961  1.00 46.26  ? 43   ILE D O   1 
ATOM   7405  C CB  . ILE D  1 44  ? -7.077  -32.487 45.011  1.00 41.19  ? 43   ILE D CB  1 
ATOM   7406  C CG1 . ILE D  1 44  ? -5.912  -31.780 45.703  1.00 40.51  ? 43   ILE D CG1 1 
ATOM   7407  C CG2 . ILE D  1 44  ? -8.373  -32.244 45.754  1.00 41.79  ? 43   ILE D CG2 1 
ATOM   7408  C CD1 . ILE D  1 44  ? -6.094  -30.282 45.800  1.00 46.16  ? 43   ILE D CD1 1 
ATOM   7409  N N   . ASP D  1 45  ? -8.504  -35.675 44.596  1.00 44.73  ? 44   ASP D N   1 
ATOM   7410  C CA  . ASP D  1 45  ? -9.611  -36.334 43.922  1.00 34.83  ? 44   ASP D CA  1 
ATOM   7411  C C   . ASP D  1 45  ? -10.880 -36.102 44.727  1.00 42.36  ? 44   ASP D C   1 
ATOM   7412  O O   . ASP D  1 45  ? -11.288 -36.945 45.523  1.00 47.04  ? 44   ASP D O   1 
ATOM   7413  C CB  . ASP D  1 45  ? -9.326  -37.830 43.770  1.00 46.43  ? 44   ASP D CB  1 
ATOM   7414  C CG  . ASP D  1 45  ? -10.388 -38.553 42.949  1.00 63.73  ? 44   ASP D CG  1 
ATOM   7415  O OD1 . ASP D  1 45  ? -10.340 -39.799 42.873  1.00 64.89  ? 44   ASP D OD1 1 
ATOM   7416  O OD2 . ASP D  1 45  ? -11.272 -37.880 42.375  1.00 60.93  ? 44   ASP D OD2 1 
ATOM   7417  N N   . ASP D  1 46  ? -11.484 -34.938 44.518  1.00 40.18  ? 45   ASP D N   1 
ATOM   7418  C CA  . ASP D  1 46  ? -12.708 -34.537 45.198  1.00 30.52  ? 45   ASP D CA  1 
ATOM   7419  C C   . ASP D  1 46  ? -13.904 -35.056 44.408  1.00 36.77  ? 45   ASP D C   1 
ATOM   7420  O O   . ASP D  1 46  ? -14.127 -34.625 43.292  1.00 37.96  ? 45   ASP D O   1 
ATOM   7421  C CB  . ASP D  1 46  ? -12.753 -33.007 45.280  1.00 30.58  ? 45   ASP D CB  1 
ATOM   7422  C CG  . ASP D  1 46  ? -13.997 -32.487 45.998  1.00 53.04  ? 45   ASP D CG  1 
ATOM   7423  O OD1 . ASP D  1 46  ? -14.039 -31.281 46.331  1.00 51.95  ? 45   ASP D OD1 1 
ATOM   7424  O OD2 . ASP D  1 46  ? -14.932 -33.281 46.235  1.00 52.78  ? 45   ASP D OD2 1 
ATOM   7425  N N   . LYS D  1 47  ? -14.676 -35.974 44.985  1.00 38.85  ? 46   LYS D N   1 
ATOM   7426  C CA  . LYS D  1 47  ? -15.772 -36.628 44.268  1.00 37.33  ? 46   LYS D CA  1 
ATOM   7427  C C   . LYS D  1 47  ? -16.893 -35.668 43.885  1.00 43.87  ? 46   LYS D C   1 
ATOM   7428  O O   . LYS D  1 47  ? -17.728 -35.996 43.043  1.00 47.79  ? 46   LYS D O   1 
ATOM   7429  C CB  . LYS D  1 47  ? -16.371 -37.758 45.116  1.00 54.66  ? 46   LYS D CB  1 
ATOM   7430  C CG  . LYS D  1 47  ? -15.404 -38.887 45.452  1.00 55.56  ? 46   LYS D CG  1 
ATOM   7431  C CD  . LYS D  1 47  ? -14.798 -39.494 44.206  1.00 63.22  ? 46   LYS D CD  1 
ATOM   7432  C CE  . LYS D  1 47  ? -13.878 -40.650 44.562  1.00 72.80  ? 46   LYS D CE  1 
ATOM   7433  N NZ  . LYS D  1 47  ? -13.264 -41.252 43.357  1.00 68.85  ? 46   LYS D NZ  1 
ATOM   7434  N N   . ASN D  1 48  ? -16.931 -34.502 44.521  1.00 30.25  ? 47   ASN D N   1 
ATOM   7435  C CA  . ASN D  1 48  ? -17.897 -33.471 44.161  1.00 34.40  ? 47   ASN D CA  1 
ATOM   7436  C C   . ASN D  1 48  ? -17.353 -32.488 43.118  1.00 37.85  ? 47   ASN D C   1 
ATOM   7437  O O   . ASN D  1 48  ? -17.993 -31.479 42.825  1.00 42.35  ? 47   ASN D O   1 
ATOM   7438  C CB  . ASN D  1 48  ? -18.349 -32.711 45.412  1.00 31.08  ? 47   ASN D CB  1 
ATOM   7439  C CG  . ASN D  1 48  ? -19.104 -33.603 46.392  1.00 56.37  ? 47   ASN D CG  1 
ATOM   7440  O OD1 . ASN D  1 48  ? -19.926 -34.429 45.993  1.00 42.10  ? 47   ASN D OD1 1 
ATOM   7441  N ND2 . ASN D  1 48  ? -18.818 -33.446 47.677  1.00 46.87  ? 47   ASN D ND2 1 
ATOM   7442  N N   . HIS D  1 49  ? -16.173 -32.785 42.573  1.00 30.35  ? 48   HIS D N   1 
ATOM   7443  C CA  . HIS D  1 49  ? -15.578 -31.986 41.493  1.00 35.46  ? 48   HIS D CA  1 
ATOM   7444  C C   . HIS D  1 49  ? -15.568 -32.829 40.220  1.00 36.13  ? 48   HIS D C   1 
ATOM   7445  O O   . HIS D  1 49  ? -15.335 -34.032 40.281  1.00 34.31  ? 48   HIS D O   1 
ATOM   7446  C CB  . HIS D  1 49  ? -14.146 -31.594 41.858  1.00 32.93  ? 48   HIS D CB  1 
ATOM   7447  C CG  . HIS D  1 49  ? -13.569 -30.515 40.991  1.00 41.75  ? 48   HIS D CG  1 
ATOM   7448  N ND1 . HIS D  1 49  ? -14.135 -29.265 40.881  1.00 41.20  ? 48   HIS D ND1 1 
ATOM   7449  C CD2 . HIS D  1 49  ? -12.460 -30.496 40.214  1.00 39.49  ? 48   HIS D CD2 1 
ATOM   7450  C CE1 . HIS D  1 49  ? -13.409 -28.522 40.063  1.00 38.19  ? 48   HIS D CE1 1 
ATOM   7451  N NE2 . HIS D  1 49  ? -12.390 -29.247 39.641  1.00 44.35  ? 48   HIS D NE2 1 
ATOM   7452  N N   . ASN D  1 50  ? -15.802 -32.207 39.069  1.00 34.56  ? 49   ASN D N   1 
ATOM   7453  C CA  . ASN D  1 50  ? -15.948 -32.943 37.816  1.00 32.02  ? 49   ASN D CA  1 
ATOM   7454  C C   . ASN D  1 50  ? -14.636 -33.518 37.246  1.00 39.92  ? 49   ASN D C   1 
ATOM   7455  O O   . ASN D  1 50  ? -14.664 -34.232 36.253  1.00 46.66  ? 49   ASN D O   1 
ATOM   7456  C CB  . ASN D  1 50  ? -16.610 -32.064 36.750  1.00 38.47  ? 49   ASN D CB  1 
ATOM   7457  C CG  . ASN D  1 50  ? -15.634 -31.055 36.139  1.00 47.72  ? 49   ASN D CG  1 
ATOM   7458  O OD1 . ASN D  1 50  ? -14.575 -30.783 36.706  1.00 38.55  ? 49   ASN D OD1 1 
ATOM   7459  N ND2 . ASN D  1 50  ? -15.992 -30.493 34.987  1.00 39.23  ? 49   ASN D ND2 1 
ATOM   7460  N N   . LYS D  1 51  ? -13.497 -33.218 37.864  1.00 32.07  ? 50   LYS D N   1 
ATOM   7461  C CA  . LYS D  1 51  ? -12.213 -33.731 37.376  1.00 37.57  ? 50   LYS D CA  1 
ATOM   7462  C C   . LYS D  1 51  ? -11.314 -34.134 38.533  1.00 36.72  ? 50   LYS D C   1 
ATOM   7463  O O   . LYS D  1 51  ? -11.460 -33.626 39.633  1.00 32.50  ? 50   LYS D O   1 
ATOM   7464  C CB  . LYS D  1 51  ? -11.461 -32.645 36.585  1.00 44.39  ? 50   LYS D CB  1 
ATOM   7465  C CG  . LYS D  1 51  ? -12.217 -32.031 35.424  1.00 46.91  ? 50   LYS D CG  1 
ATOM   7466  C CD  . LYS D  1 51  ? -11.999 -32.812 34.159  1.00 56.20  ? 50   LYS D CD  1 
ATOM   7467  C CE  . LYS D  1 51  ? -12.720 -32.177 32.978  1.00 46.77  ? 50   LYS D CE  1 
ATOM   7468  N NZ  . LYS D  1 51  ? -12.240 -30.805 32.689  1.00 54.57  ? 50   LYS D NZ  1 
ATOM   7469  N N   . LYS D  1 52  ? -10.360 -35.020 38.271  1.00 37.16  ? 51   LYS D N   1 
ATOM   7470  C CA  . LYS D  1 52  ? -9.217  -35.193 39.161  1.00 34.20  ? 51   LYS D CA  1 
ATOM   7471  C C   . LYS D  1 52  ? -8.282  -33.991 38.995  1.00 40.60  ? 51   LYS D C   1 
ATOM   7472  O O   . LYS D  1 52  ? -8.170  -33.437 37.906  1.00 41.69  ? 51   LYS D O   1 
ATOM   7473  C CB  . LYS D  1 52  ? -8.445  -36.471 38.820  1.00 40.98  ? 51   LYS D CB  1 
ATOM   7474  C CG  . LYS D  1 52  ? -9.158  -37.780 39.133  1.00 46.31  ? 51   LYS D CG  1 
ATOM   7475  C CD  . LYS D  1 52  ? -8.304  -38.950 38.670  1.00 64.57  ? 51   LYS D CD  1 
ATOM   7476  C CE  . LYS D  1 52  ? -8.978  -40.292 38.902  1.00 79.06  ? 51   LYS D CE  1 
ATOM   7477  N NZ  . LYS D  1 52  ? -8.159  -41.414 38.352  1.00 61.38  ? 51   LYS D NZ  1 
ATOM   7478  N N   . LEU D  1 53  ? -7.604  -33.605 40.070  1.00 36.42  ? 52   LEU D N   1 
ATOM   7479  C CA  . LEU D  1 53  ? -6.697  -32.464 40.049  1.00 38.52  ? 52   LEU D CA  1 
ATOM   7480  C C   . LEU D  1 53  ? -5.312  -32.863 40.530  1.00 43.75  ? 52   LEU D C   1 
ATOM   7481  O O   . LEU D  1 53  ? -5.170  -33.673 41.447  1.00 43.18  ? 52   LEU D O   1 
ATOM   7482  C CB  . LEU D  1 53  ? -7.221  -31.341 40.954  1.00 39.65  ? 52   LEU D CB  1 
ATOM   7483  C CG  . LEU D  1 53  ? -7.945  -30.197 40.250  1.00 53.42  ? 52   LEU D CG  1 
ATOM   7484  C CD1 . LEU D  1 53  ? -9.189  -30.709 39.543  1.00 67.10  ? 52   LEU D CD1 1 
ATOM   7485  C CD2 . LEU D  1 53  ? -8.301  -29.120 41.247  1.00 58.51  ? 52   LEU D CD2 1 
ATOM   7486  N N   . LEU D  1 54  ? -4.297  -32.283 39.906  1.00 36.57  ? 53   LEU D N   1 
ATOM   7487  C CA  . LEU D  1 54  ? -2.929  -32.409 40.364  1.00 34.18  ? 53   LEU D CA  1 
ATOM   7488  C C   . LEU D  1 54  ? -2.368  -30.998 40.498  1.00 38.14  ? 53   LEU D C   1 
ATOM   7489  O O   . LEU D  1 54  ? -2.419  -30.218 39.557  1.00 40.92  ? 53   LEU D O   1 
ATOM   7490  C CB  . LEU D  1 54  ? -2.098  -33.204 39.360  1.00 37.69  ? 53   LEU D CB  1 
ATOM   7491  C CG  . LEU D  1 54  ? -0.593  -33.257 39.628  1.00 41.42  ? 53   LEU D CG  1 
ATOM   7492  C CD1 . LEU D  1 54  ? -0.311  -33.973 40.933  1.00 35.71  ? 53   LEU D CD1 1 
ATOM   7493  C CD2 . LEU D  1 54  ? 0.155   -33.936 38.487  1.00 40.92  ? 53   LEU D CD2 1 
ATOM   7494  N N   . VAL D  1 55  ? -1.851  -30.662 41.670  1.00 35.38  ? 54   VAL D N   1 
ATOM   7495  C CA  . VAL D  1 55  ? -1.182  -29.382 41.854  1.00 31.61  ? 54   VAL D CA  1 
ATOM   7496  C C   . VAL D  1 55  ? 0.312   -29.646 41.880  1.00 37.20  ? 54   VAL D C   1 
ATOM   7497  O O   . VAL D  1 55  ? 0.801   -30.445 42.685  1.00 40.04  ? 54   VAL D O   1 
ATOM   7498  C CB  . VAL D  1 55  ? -1.604  -28.690 43.170  1.00 35.01  ? 54   VAL D CB  1 
ATOM   7499  C CG1 . VAL D  1 55  ? -0.936  -27.328 43.290  1.00 35.06  ? 54   VAL D CG1 1 
ATOM   7500  C CG2 . VAL D  1 55  ? -3.122  -28.551 43.242  1.00 30.10  ? 54   VAL D CG2 1 
ATOM   7501  N N   . ILE D  1 56  ? 1.032   -28.994 40.978  1.00 35.89  ? 55   ILE D N   1 
ATOM   7502  C CA  . ILE D  1 56  ? 2.478   -29.130 40.909  1.00 35.24  ? 55   ILE D CA  1 
ATOM   7503  C C   . ILE D  1 56  ? 3.134   -27.820 41.291  1.00 38.55  ? 55   ILE D C   1 
ATOM   7504  O O   . ILE D  1 56  ? 2.919   -26.798 40.644  1.00 43.41  ? 55   ILE D O   1 
ATOM   7505  C CB  . ILE D  1 56  ? 2.938   -29.500 39.489  1.00 41.29  ? 55   ILE D CB  1 
ATOM   7506  C CG1 . ILE D  1 56  ? 2.372   -30.865 39.087  1.00 35.06  ? 55   ILE D CG1 1 
ATOM   7507  C CG2 . ILE D  1 56  ? 4.464   -29.518 39.404  1.00 42.84  ? 55   ILE D CG2 1 
ATOM   7508  C CD1 . ILE D  1 56  ? 2.710   -31.252 37.667  1.00 46.67  ? 55   ILE D CD1 1 
ATOM   7509  N N   . ARG D  1 57  ? 3.935   -27.854 42.344  1.00 34.19  ? 56   ARG D N   1 
ATOM   7510  C CA  . ARG D  1 57  ? 4.696   -26.685 42.743  1.00 42.34  ? 56   ARG D CA  1 
ATOM   7511  C C   . ARG D  1 57  ? 6.148   -26.890 42.360  1.00 41.42  ? 56   ARG D C   1 
ATOM   7512  O O   . ARG D  1 57  ? 6.783   -27.832 42.810  1.00 40.28  ? 56   ARG D O   1 
ATOM   7513  C CB  . ARG D  1 57  ? 4.560   -26.422 44.245  1.00 40.50  ? 56   ARG D CB  1 
ATOM   7514  C CG  . ARG D  1 57  ? 3.158   -25.974 44.654  1.00 41.47  ? 56   ARG D CG  1 
ATOM   7515  C CD  . ARG D  1 57  ? 3.100   -25.488 46.089  1.00 58.89  ? 56   ARG D CD  1 
ATOM   7516  N NE  . ARG D  1 57  ? 1.826   -24.828 46.363  1.00 78.07  ? 56   ARG D NE  1 
ATOM   7517  C CZ  . ARG D  1 57  ? 0.718   -25.467 46.726  1.00 68.76  ? 56   ARG D CZ  1 
ATOM   7518  N NH1 . ARG D  1 57  ? -0.400  -24.785 46.947  1.00 69.93  ? 56   ARG D NH1 1 
ATOM   7519  N NH2 . ARG D  1 57  ? 0.724   -26.788 46.870  1.00 48.51  ? 56   ARG D NH2 1 
ATOM   7520  N N   . THR D  1 58  ? 6.661   -26.007 41.512  1.00 38.64  ? 57   THR D N   1 
ATOM   7521  C CA  . THR D  1 58  ? 8.057   -26.066 41.111  1.00 35.89  ? 57   THR D CA  1 
ATOM   7522  C C   . THR D  1 58  ? 8.852   -25.138 42.014  1.00 38.07  ? 57   THR D C   1 
ATOM   7523  O O   . THR D  1 58  ? 8.602   -23.945 42.061  1.00 34.49  ? 57   THR D O   1 
ATOM   7524  C CB  . THR D  1 58  ? 8.226   -25.665 39.632  1.00 34.57  ? 57   THR D CB  1 
ATOM   7525  O OG1 . THR D  1 58  ? 7.511   -24.453 39.386  1.00 40.86  ? 57   THR D OG1 1 
ATOM   7526  C CG2 . THR D  1 58  ? 7.664   -26.744 38.719  1.00 34.64  ? 57   THR D CG2 1 
ATOM   7527  N N   . LYS D  1 59  ? 9.795   -25.705 42.755  1.00 35.44  ? 58   LYS D N   1 
ATOM   7528  C CA  . LYS D  1 59  ? 10.601  -24.942 43.703  1.00 38.93  ? 58   LYS D CA  1 
ATOM   7529  C C   . LYS D  1 59  ? 12.082  -25.235 43.449  1.00 39.37  ? 58   LYS D C   1 
ATOM   7530  O O   . LYS D  1 59  ? 12.471  -25.476 42.321  1.00 42.06  ? 58   LYS D O   1 
ATOM   7531  C CB  . LYS D  1 59  ? 10.206  -25.298 45.143  1.00 33.34  ? 58   LYS D CB  1 
ATOM   7532  C CG  . LYS D  1 59  ? 8.694   -25.207 45.395  1.00 39.60  ? 58   LYS D CG  1 
ATOM   7533  C CD  . LYS D  1 59  ? 8.333   -25.487 46.851  1.00 53.11  ? 58   LYS D CD  1 
ATOM   7534  C CE  . LYS D  1 59  ? 8.707   -24.308 47.733  1.00 55.17  ? 58   LYS D CE  1 
ATOM   7535  N NZ  . LYS D  1 59  ? 8.290   -24.504 49.130  1.00 52.89  ? 58   LYS D NZ  1 
ATOM   7536  N N   . GLY D  1 60  ? 12.898  -25.232 44.495  1.00 34.13  ? 59   GLY D N   1 
ATOM   7537  C CA  . GLY D  1 60  ? 14.329  -25.382 44.343  1.00 38.12  ? 59   GLY D CA  1 
ATOM   7538  C C   . GLY D  1 60  ? 15.019  -24.040 44.148  1.00 48.93  ? 59   GLY D C   1 
ATOM   7539  O O   . GLY D  1 60  ? 14.475  -22.991 44.524  1.00 44.28  ? 59   GLY D O   1 
ATOM   7540  N N   . THR D  1 61  ? 16.221  -24.066 43.568  1.00 39.21  ? 60   THR D N   1 
ATOM   7541  C CA  . THR D  1 61  ? 17.007  -22.850 43.374  1.00 33.38  ? 60   THR D CA  1 
ATOM   7542  C C   . THR D  1 61  ? 17.886  -22.935 42.128  1.00 37.01  ? 60   THR D C   1 
ATOM   7543  O O   . THR D  1 61  ? 18.658  -23.879 41.959  1.00 31.49  ? 60   THR D O   1 
ATOM   7544  C CB  . THR D  1 61  ? 17.947  -22.580 44.571  1.00 42.80  ? 60   THR D CB  1 
ATOM   7545  O OG1 . THR D  1 61  ? 17.184  -22.434 45.777  1.00 44.80  ? 60   THR D OG1 1 
ATOM   7546  C CG2 . THR D  1 61  ? 18.769  -21.300 44.330  1.00 35.21  ? 60   THR D CG2 1 
ATOM   7547  N N   . ILE D  1 62  ? 17.765  -21.933 41.269  1.00 37.68  ? 61   ILE D N   1 
ATOM   7548  C CA  . ILE D  1 62  ? 18.666  -21.758 40.136  1.00 38.97  ? 61   ILE D CA  1 
ATOM   7549  C C   . ILE D  1 62  ? 19.782  -20.803 40.541  1.00 34.81  ? 61   ILE D C   1 
ATOM   7550  O O   . ILE D  1 62  ? 19.542  -19.607 40.737  1.00 31.24  ? 61   ILE D O   1 
ATOM   7551  C CB  . ILE D  1 62  ? 17.911  -21.181 38.936  1.00 36.08  ? 61   ILE D CB  1 
ATOM   7552  C CG1 . ILE D  1 62  ? 16.752  -22.114 38.558  1.00 34.71  ? 61   ILE D CG1 1 
ATOM   7553  C CG2 . ILE D  1 62  ? 18.860  -20.978 37.753  1.00 45.51  ? 61   ILE D CG2 1 
ATOM   7554  C CD1 . ILE D  1 62  ? 15.775  -21.497 37.570  1.00 37.45  ? 61   ILE D CD1 1 
ATOM   7555  N N   . ALA D  1 63  ? 20.996  -21.326 40.685  1.00 33.00  ? 62   ALA D N   1 
ATOM   7556  C CA  . ALA D  1 63  ? 22.138  -20.496 41.064  1.00 37.45  ? 62   ALA D CA  1 
ATOM   7557  C C   . ALA D  1 63  ? 22.291  -19.333 40.083  1.00 37.91  ? 62   ALA D C   1 
ATOM   7558  O O   . ALA D  1 63  ? 21.957  -19.455 38.905  1.00 34.69  ? 62   ALA D O   1 
ATOM   7559  C CB  . ALA D  1 63  ? 23.413  -21.328 41.118  1.00 36.03  ? 62   ALA D CB  1 
ATOM   7560  N N   . GLY D  1 64  ? 22.775  -18.194 40.577  1.00 38.85  ? 63   GLY D N   1 
ATOM   7561  C CA  . GLY D  1 64  ? 22.976  -17.028 39.733  1.00 33.55  ? 63   GLY D CA  1 
ATOM   7562  C C   . GLY D  1 64  ? 24.213  -17.152 38.846  1.00 44.67  ? 63   GLY D C   1 
ATOM   7563  O O   . GLY D  1 64  ? 24.133  -16.992 37.629  1.00 30.57  ? 63   GLY D O   1 
ATOM   7564  N N   . GLN D  1 65  ? 25.355  -17.436 39.467  1.00 39.29  ? 64   GLN D N   1 
ATOM   7565  C CA  . GLN D  1 65  ? 26.602  -17.721 38.755  1.00 57.13  ? 64   GLN D CA  1 
ATOM   7566  C C   . GLN D  1 65  ? 27.207  -16.481 38.086  1.00 47.86  ? 64   GLN D C   1 
ATOM   7567  O O   . GLN D  1 65  ? 27.667  -16.526 36.955  1.00 54.86  ? 64   GLN D O   1 
ATOM   7568  C CB  . GLN D  1 65  ? 26.390  -18.851 37.751  1.00 32.22  ? 64   GLN D CB  1 
ATOM   7569  C CG  . GLN D  1 65  ? 26.068  -20.177 38.435  1.00 43.08  ? 64   GLN D CG  1 
ATOM   7570  C CD  . GLN D  1 65  ? 26.068  -21.365 37.483  1.00 44.30  ? 64   GLN D CD  1 
ATOM   7571  O OE1 . GLN D  1 65  ? 25.967  -21.209 36.263  1.00 60.45  ? 64   GLN D OE1 1 
ATOM   7572  N NE2 . GLN D  1 65  ? 26.176  -22.561 38.044  1.00 52.03  ? 64   GLN D NE2 1 
ATOM   7573  N N   . TYR D  1 66  ? 27.206  -15.380 38.824  1.00 48.39  ? 65   TYR D N   1 
ATOM   7574  C CA  . TYR D  1 66  ? 27.812  -14.120 38.407  1.00 41.07  ? 65   TYR D CA  1 
ATOM   7575  C C   . TYR D  1 66  ? 29.314  -14.274 38.581  1.00 53.55  ? 65   TYR D C   1 
ATOM   7576  O O   . TYR D  1 66  ? 29.791  -14.536 39.682  1.00 50.67  ? 65   TYR D O   1 
ATOM   7577  C CB  . TYR D  1 66  ? 27.237  -13.035 39.312  1.00 42.39  ? 65   TYR D CB  1 
ATOM   7578  C CG  . TYR D  1 66  ? 27.799  -11.628 39.287  1.00 39.69  ? 65   TYR D CG  1 
ATOM   7579  C CD1 . TYR D  1 66  ? 27.184  -10.629 38.547  1.00 43.98  ? 65   TYR D CD1 1 
ATOM   7580  C CD2 . TYR D  1 66  ? 28.855  -11.268 40.110  1.00 49.30  ? 65   TYR D CD2 1 
ATOM   7581  C CE1 . TYR D  1 66  ? 27.649  -9.321  38.572  1.00 44.51  ? 65   TYR D CE1 1 
ATOM   7582  C CE2 . TYR D  1 66  ? 29.323  -9.962  40.149  1.00 46.27  ? 65   TYR D CE2 1 
ATOM   7583  C CZ  . TYR D  1 66  ? 28.721  -8.995  39.373  1.00 53.38  ? 65   TYR D CZ  1 
ATOM   7584  O OH  . TYR D  1 66  ? 29.193  -7.699  39.405  1.00 40.65  ? 65   TYR D OH  1 
ATOM   7585  N N   . ARG D  1 67  ? 30.064  -14.172 37.491  1.00 39.63  ? 66   ARG D N   1 
ATOM   7586  C CA  . ARG D  1 67  ? 31.503  -14.394 37.582  1.00 62.94  ? 66   ARG D CA  1 
ATOM   7587  C C   . ARG D  1 67  ? 32.292  -13.894 36.384  1.00 46.13  ? 66   ARG D C   1 
ATOM   7588  O O   . ARG D  1 67  ? 31.806  -13.844 35.251  1.00 49.36  ? 66   ARG D O   1 
ATOM   7589  C CB  . ARG D  1 67  ? 31.802  -15.880 37.795  1.00 43.98  ? 66   ARG D CB  1 
ATOM   7590  C CG  . ARG D  1 67  ? 31.429  -16.763 36.625  1.00 54.96  ? 66   ARG D CG  1 
ATOM   7591  C CD  . ARG D  1 67  ? 31.793  -18.227 36.893  1.00 63.49  ? 66   ARG D CD  1 
ATOM   7592  N NE  . ARG D  1 67  ? 33.240  -18.442 36.889  1.00 96.07  ? 66   ARG D NE  1 
ATOM   7593  C CZ  . ARG D  1 67  ? 33.953  -18.768 35.811  1.00 86.89  ? 66   ARG D CZ  1 
ATOM   7594  N NH1 . ARG D  1 67  ? 35.264  -18.940 35.916  1.00 68.96  ? 66   ARG D NH1 1 
ATOM   7595  N NH2 . ARG D  1 67  ? 33.364  -18.927 34.629  1.00 57.37  ? 66   ARG D NH2 1 
ATOM   7596  N N   . VAL D  1 68  ? 33.526  -13.512 36.663  1.00 55.68  ? 67   VAL D N   1 
ATOM   7597  C CA  . VAL D  1 68  ? 34.448  -13.121 35.621  1.00 53.42  ? 67   VAL D CA  1 
ATOM   7598  C C   . VAL D  1 68  ? 34.854  -14.388 34.915  1.00 58.28  ? 67   VAL D C   1 
ATOM   7599  O O   . VAL D  1 68  ? 35.453  -15.270 35.529  1.00 62.97  ? 67   VAL D O   1 
ATOM   7600  C CB  . VAL D  1 68  ? 35.689  -12.464 36.219  1.00 69.84  ? 67   VAL D CB  1 
ATOM   7601  C CG1 . VAL D  1 68  ? 36.622  -11.993 35.118  1.00 77.53  ? 67   VAL D CG1 1 
ATOM   7602  C CG2 . VAL D  1 68  ? 35.285  -11.309 37.125  1.00 59.06  ? 67   VAL D CG2 1 
ATOM   7603  N N   . TYR D  1 69  ? 34.518  -14.503 33.635  1.00 58.10  ? 68   TYR D N   1 
ATOM   7604  C CA  . TYR D  1 69  ? 34.790  -15.743 32.916  1.00 52.44  ? 68   TYR D CA  1 
ATOM   7605  C C   . TYR D  1 69  ? 36.063  -15.660 32.064  1.00 83.95  ? 68   TYR D C   1 
ATOM   7606  O O   . TYR D  1 69  ? 36.765  -16.657 31.913  1.00 71.16  ? 68   TYR D O   1 
ATOM   7607  C CB  . TYR D  1 69  ? 33.591  -16.132 32.053  1.00 56.99  ? 68   TYR D CB  1 
ATOM   7608  C CG  . TYR D  1 69  ? 33.331  -15.206 30.894  1.00 62.25  ? 68   TYR D CG  1 
ATOM   7609  C CD1 . TYR D  1 69  ? 33.839  -15.493 29.634  1.00 75.60  ? 68   TYR D CD1 1 
ATOM   7610  C CD2 . TYR D  1 69  ? 32.575  -14.047 31.052  1.00 51.28  ? 68   TYR D CD2 1 
ATOM   7611  C CE1 . TYR D  1 69  ? 33.606  -14.657 28.558  1.00 75.82  ? 68   TYR D CE1 1 
ATOM   7612  C CE2 . TYR D  1 69  ? 32.332  -13.200 29.977  1.00 58.87  ? 68   TYR D CE2 1 
ATOM   7613  C CZ  . TYR D  1 69  ? 32.857  -13.514 28.730  1.00 64.91  ? 68   TYR D CZ  1 
ATOM   7614  O OH  . TYR D  1 69  ? 32.632  -12.699 27.644  1.00 54.10  ? 68   TYR D OH  1 
ATOM   7615  N N   . SER D  1 70  ? 36.366  -14.480 31.522  1.00 61.31  ? 69   SER D N   1 
ATOM   7616  C CA  . SER D  1 70  ? 37.558  -14.315 30.692  1.00 85.35  ? 69   SER D CA  1 
ATOM   7617  C C   . SER D  1 70  ? 38.329  -13.042 31.014  1.00 89.49  ? 69   SER D C   1 
ATOM   7618  O O   . SER D  1 70  ? 37.874  -12.199 31.785  1.00 71.04  ? 69   SER D O   1 
ATOM   7619  C CB  . SER D  1 70  ? 37.185  -14.306 29.208  1.00 83.96  ? 69   SER D CB  1 
ATOM   7620  O OG  . SER D  1 70  ? 36.483  -13.121 28.869  1.00 97.48  ? 69   SER D OG  1 
ATOM   7621  N N   . GLU D  1 71  ? 39.499  -12.913 30.402  1.00 80.47  ? 70   GLU D N   1 
ATOM   7622  C CA  . GLU D  1 71  ? 40.347  -11.749 30.599  1.00 92.91  ? 70   GLU D CA  1 
ATOM   7623  C C   . GLU D  1 71  ? 41.387  -11.667 29.490  1.00 100.16 ? 70   GLU D C   1 
ATOM   7624  O O   . GLU D  1 71  ? 42.432  -12.318 29.558  1.00 86.66  ? 70   GLU D O   1 
ATOM   7625  C CB  . GLU D  1 71  ? 41.041  -11.828 31.957  1.00 82.50  ? 70   GLU D CB  1 
ATOM   7626  C CG  . GLU D  1 71  ? 41.801  -10.571 32.335  1.00 100.60 ? 70   GLU D CG  1 
ATOM   7627  C CD  . GLU D  1 71  ? 42.456  -10.675 33.700  1.00 112.46 ? 70   GLU D CD  1 
ATOM   7628  O OE1 . GLU D  1 71  ? 42.587  -9.632  34.379  1.00 110.24 ? 70   GLU D OE1 1 
ATOM   7629  O OE2 . GLU D  1 71  ? 42.840  -11.800 34.093  1.00 81.21  ? 70   GLU D OE2 1 
ATOM   7630  N N   . GLU D  1 72  ? 41.091  -10.875 28.464  1.00 96.22  ? 71   GLU D N   1 
ATOM   7631  C CA  . GLU D  1 72  ? 42.030  -10.645 27.371  1.00 109.42 ? 71   GLU D CA  1 
ATOM   7632  C C   . GLU D  1 72  ? 42.948  -9.475  27.702  1.00 92.39  ? 71   GLU D C   1 
ATOM   7633  O O   . GLU D  1 72  ? 42.709  -8.348  27.269  1.00 95.79  ? 71   GLU D O   1 
ATOM   7634  C CB  . GLU D  1 72  ? 41.278  -10.354 26.071  1.00 115.59 ? 71   GLU D CB  1 
ATOM   7635  C CG  . GLU D  1 72  ? 40.355  -11.475 25.624  1.00 131.65 ? 71   GLU D CG  1 
ATOM   7636  C CD  . GLU D  1 72  ? 39.742  -11.214 24.263  1.00 143.37 ? 71   GLU D CD  1 
ATOM   7637  O OE1 . GLU D  1 72  ? 40.196  -10.274 23.575  1.00 141.02 ? 71   GLU D OE1 1 
ATOM   7638  O OE2 . GLU D  1 72  ? 38.807  -11.949 23.882  1.00 134.98 ? 71   GLU D OE2 1 
ATOM   7639  N N   . GLY D  1 73  ? 43.995  -9.746  28.475  1.00 61.99  ? 72   GLY D N   1 
ATOM   7640  C CA  . GLY D  1 73  ? 44.919  -8.707  28.892  1.00 75.94  ? 72   GLY D CA  1 
ATOM   7641  C C   . GLY D  1 73  ? 44.510  -8.079  30.208  1.00 81.27  ? 72   GLY D C   1 
ATOM   7642  O O   . GLY D  1 73  ? 43.574  -8.540  30.859  1.00 91.45  ? 72   GLY D O   1 
ATOM   7643  N N   . ALA D  1 74  ? 45.212  -7.023  30.605  1.00 93.45  ? 73   ALA D N   1 
ATOM   7644  C CA  . ALA D  1 74  ? 44.948  -6.371  31.886  1.00 85.86  ? 73   ALA D CA  1 
ATOM   7645  C C   . ALA D  1 74  ? 43.987  -5.196  31.743  1.00 69.51  ? 73   ALA D C   1 
ATOM   7646  O O   . ALA D  1 74  ? 43.572  -4.603  32.738  1.00 71.96  ? 73   ALA D O   1 
ATOM   7647  C CB  . ALA D  1 74  ? 46.249  -5.907  32.516  1.00 93.35  ? 73   ALA D CB  1 
ATOM   7648  N N   . ASN D  1 75  ? 43.631  -4.867  30.506  1.00 70.22  ? 74   ASN D N   1 
ATOM   7649  C CA  . ASN D  1 75  ? 42.755  -3.733  30.234  1.00 73.95  ? 74   ASN D CA  1 
ATOM   7650  C C   . ASN D  1 75  ? 41.396  -4.161  29.672  1.00 73.59  ? 74   ASN D C   1 
ATOM   7651  O O   . ASN D  1 75  ? 40.611  -3.326  29.229  1.00 60.56  ? 74   ASN D O   1 
ATOM   7652  C CB  . ASN D  1 75  ? 43.435  -2.760  29.257  1.00 92.78  ? 74   ASN D CB  1 
ATOM   7653  C CG  . ASN D  1 75  ? 44.672  -2.084  29.851  1.00 99.34  ? 74   ASN D CG  1 
ATOM   7654  O OD1 . ASN D  1 75  ? 44.671  -1.644  31.004  1.00 107.74 ? 74   ASN D OD1 1 
ATOM   7655  N ND2 . ASN D  1 75  ? 45.733  -2.001  29.056  1.00 102.61 ? 74   ASN D ND2 1 
ATOM   7656  N N   . LYS D  1 76  ? 41.115  -5.460  29.683  1.00 66.04  ? 75   LYS D N   1 
ATOM   7657  C CA  . LYS D  1 76  ? 39.820  -5.949  29.214  1.00 77.14  ? 75   LYS D CA  1 
ATOM   7658  C C   . LYS D  1 76  ? 39.426  -7.244  29.932  1.00 72.92  ? 75   LYS D C   1 
ATOM   7659  O O   . LYS D  1 76  ? 40.262  -8.120  30.147  1.00 77.44  ? 75   LYS D O   1 
ATOM   7660  C CB  . LYS D  1 76  ? 39.856  -6.156  27.700  1.00 69.63  ? 75   LYS D CB  1 
ATOM   7661  C CG  . LYS D  1 76  ? 38.491  -6.337  27.065  1.00 76.27  ? 75   LYS D CG  1 
ATOM   7662  C CD  . LYS D  1 76  ? 38.603  -6.581  25.570  1.00 92.40  ? 75   LYS D CD  1 
ATOM   7663  C CE  . LYS D  1 76  ? 37.238  -6.770  24.928  1.00 97.40  ? 75   LYS D CE  1 
ATOM   7664  N NZ  . LYS D  1 76  ? 36.510  -7.939  25.495  1.00 98.85  ? 75   LYS D NZ  1 
ATOM   7665  N N   . SER D  1 77  ? 38.152  -7.352  30.307  1.00 73.92  ? 76   SER D N   1 
ATOM   7666  C CA  . SER D  1 77  ? 37.659  -8.503  31.060  1.00 71.87  ? 76   SER D CA  1 
ATOM   7667  C C   . SER D  1 77  ? 36.156  -8.683  30.844  1.00 65.25  ? 76   SER D C   1 
ATOM   7668  O O   . SER D  1 77  ? 35.448  -7.728  30.532  1.00 66.19  ? 76   SER D O   1 
ATOM   7669  C CB  . SER D  1 77  ? 37.964  -8.329  32.551  1.00 72.05  ? 76   SER D CB  1 
ATOM   7670  O OG  . SER D  1 77  ? 37.711  -9.521  33.273  1.00 67.46  ? 76   SER D OG  1 
ATOM   7671  N N   . GLY D  1 78  ? 35.678  -9.914  31.001  1.00 56.62  ? 77   GLY D N   1 
ATOM   7672  C CA  . GLY D  1 78  ? 34.274  -10.228 30.785  1.00 60.28  ? 77   GLY D CA  1 
ATOM   7673  C C   . GLY D  1 78  ? 33.604  -10.839 32.009  1.00 57.76  ? 77   GLY D C   1 
ATOM   7674  O O   . GLY D  1 78  ? 34.224  -11.600 32.751  1.00 45.12  ? 77   GLY D O   1 
ATOM   7675  N N   . LEU D  1 79  ? 32.329  -10.506 32.199  1.00 62.24  ? 78   LEU D N   1 
ATOM   7676  C CA  . LEU D  1 79  ? 31.540  -10.964 33.340  1.00 56.00  ? 78   LEU D CA  1 
ATOM   7677  C C   . LEU D  1 79  ? 30.253  -11.608 32.846  1.00 44.45  ? 78   LEU D C   1 
ATOM   7678  O O   . LEU D  1 79  ? 29.486  -10.987 32.127  1.00 47.72  ? 78   LEU D O   1 
ATOM   7679  C CB  . LEU D  1 79  ? 31.189  -9.781  34.243  1.00 53.22  ? 78   LEU D CB  1 
ATOM   7680  C CG  . LEU D  1 79  ? 30.194  -10.067 35.373  1.00 52.21  ? 78   LEU D CG  1 
ATOM   7681  C CD1 . LEU D  1 79  ? 30.874  -10.840 36.480  1.00 57.57  ? 78   LEU D CD1 1 
ATOM   7682  C CD2 . LEU D  1 79  ? 29.626  -8.772  35.919  1.00 59.13  ? 78   LEU D CD2 1 
ATOM   7683  N N   . ALA D  1 80  ? 30.021  -12.859 33.219  1.00 41.61  ? 79   ALA D N   1 
ATOM   7684  C CA  . ALA D  1 80  ? 28.768  -13.522 32.882  1.00 48.52  ? 79   ALA D CA  1 
ATOM   7685  C C   . ALA D  1 80  ? 27.802  -13.394 34.062  1.00 42.61  ? 79   ALA D C   1 
ATOM   7686  O O   . ALA D  1 80  ? 28.168  -13.661 35.208  1.00 39.36  ? 79   ALA D O   1 
ATOM   7687  C CB  . ALA D  1 80  ? 29.017  -14.984 32.556  1.00 46.22  ? 79   ALA D CB  1 
ATOM   7688  N N   . TRP D  1 81  ? 26.573  -12.981 33.779  1.00 31.53  ? 80   TRP D N   1 
ATOM   7689  C CA  . TRP D  1 81  ? 25.590  -12.746 34.822  1.00 38.71  ? 80   TRP D CA  1 
ATOM   7690  C C   . TRP D  1 81  ? 24.199  -13.095 34.325  1.00 44.26  ? 80   TRP D C   1 
ATOM   7691  O O   . TRP D  1 81  ? 23.930  -13.011 33.131  1.00 33.85  ? 80   TRP D O   1 
ATOM   7692  C CB  . TRP D  1 81  ? 25.630  -11.283 35.290  1.00 33.29  ? 80   TRP D CB  1 
ATOM   7693  C CG  . TRP D  1 81  ? 25.229  -10.294 34.242  1.00 35.45  ? 80   TRP D CG  1 
ATOM   7694  C CD1 . TRP D  1 81  ? 26.021  -9.787  33.245  1.00 46.98  ? 80   TRP D CD1 1 
ATOM   7695  C CD2 . TRP D  1 81  ? 23.949  -9.658  34.097  1.00 48.79  ? 80   TRP D CD2 1 
ATOM   7696  N NE1 . TRP D  1 81  ? 25.311  -8.878  32.491  1.00 41.20  ? 80   TRP D NE1 1 
ATOM   7697  C CE2 . TRP D  1 81  ? 24.039  -8.781  32.992  1.00 39.67  ? 80   TRP D CE2 1 
ATOM   7698  C CE3 . TRP D  1 81  ? 22.738  -9.740  34.797  1.00 37.83  ? 80   TRP D CE3 1 
ATOM   7699  C CZ2 . TRP D  1 81  ? 22.965  -8.005  32.569  1.00 38.77  ? 80   TRP D CZ2 1 
ATOM   7700  C CZ3 . TRP D  1 81  ? 21.672  -8.966  34.370  1.00 34.38  ? 80   TRP D CZ3 1 
ATOM   7701  C CH2 . TRP D  1 81  ? 21.791  -8.113  33.270  1.00 39.29  ? 80   TRP D CH2 1 
ATOM   7702  N N   . PRO D  1 82  ? 23.306  -13.481 35.253  1.00 45.45  ? 81   PRO D N   1 
ATOM   7703  C CA  . PRO D  1 82  ? 21.966  -13.973 34.913  1.00 36.92  ? 81   PRO D CA  1 
ATOM   7704  C C   . PRO D  1 82  ? 20.965  -12.853 34.687  1.00 39.74  ? 81   PRO D C   1 
ATOM   7705  O O   . PRO D  1 82  ? 20.646  -12.105 35.603  1.00 51.89  ? 81   PRO D O   1 
ATOM   7706  C CB  . PRO D  1 82  ? 21.580  -14.789 36.146  1.00 40.48  ? 81   PRO D CB  1 
ATOM   7707  C CG  . PRO D  1 82  ? 22.299  -14.116 37.272  1.00 46.12  ? 81   PRO D CG  1 
ATOM   7708  C CD  . PRO D  1 82  ? 23.599  -13.617 36.691  1.00 40.91  ? 81   PRO D CD  1 
ATOM   7709  N N   . SER D  1 83  ? 20.464  -12.742 33.468  1.00 42.18  ? 82   SER D N   1 
ATOM   7710  C CA  . SER D  1 83  ? 19.496  -11.708 33.145  1.00 38.80  ? 82   SER D CA  1 
ATOM   7711  C C   . SER D  1 83  ? 18.085  -12.274 33.146  1.00 32.24  ? 82   SER D C   1 
ATOM   7712  O O   . SER D  1 83  ? 17.124  -11.523 33.045  1.00 38.00  ? 82   SER D O   1 
ATOM   7713  C CB  . SER D  1 83  ? 19.808  -11.113 31.765  1.00 40.07  ? 82   SER D CB  1 
ATOM   7714  O OG  . SER D  1 83  ? 19.869  -12.142 30.787  1.00 44.51  ? 82   SER D OG  1 
ATOM   7715  N N   . ALA D  1 84  ? 17.955  -13.593 33.216  1.00 32.18  ? 83   ALA D N   1 
ATOM   7716  C CA  . ALA D  1 84  ? 16.631  -14.209 33.312  1.00 41.98  ? 83   ALA D CA  1 
ATOM   7717  C C   . ALA D  1 84  ? 16.690  -15.605 33.907  1.00 36.92  ? 83   ALA D C   1 
ATOM   7718  O O   . ALA D  1 84  ? 17.644  -16.344 33.693  1.00 42.84  ? 83   ALA D O   1 
ATOM   7719  C CB  . ALA D  1 84  ? 15.942  -14.249 31.948  1.00 37.54  ? 83   ALA D CB  1 
ATOM   7720  N N   . PHE D  1 85  ? 15.659  -15.943 34.675  1.00 38.21  ? 84   PHE D N   1 
ATOM   7721  C CA  . PHE D  1 85  ? 15.460  -17.296 35.164  1.00 38.23  ? 84   PHE D CA  1 
ATOM   7722  C C   . PHE D  1 85  ? 14.107  -17.735 34.634  1.00 41.21  ? 84   PHE D C   1 
ATOM   7723  O O   . PHE D  1 85  ? 13.189  -16.933 34.553  1.00 42.77  ? 84   PHE D O   1 
ATOM   7724  C CB  . PHE D  1 85  ? 15.448  -17.339 36.684  1.00 37.85  ? 84   PHE D CB  1 
ATOM   7725  C CG  . PHE D  1 85  ? 16.679  -16.763 37.331  1.00 27.99  ? 84   PHE D CG  1 
ATOM   7726  C CD1 . PHE D  1 85  ? 17.755  -17.571 37.640  1.00 29.70  ? 84   PHE D CD1 1 
ATOM   7727  C CD2 . PHE D  1 85  ? 16.732  -15.426 37.677  1.00 35.92  ? 84   PHE D CD2 1 
ATOM   7728  C CE1 . PHE D  1 85  ? 18.875  -17.057 38.258  1.00 34.44  ? 84   PHE D CE1 1 
ATOM   7729  C CE2 . PHE D  1 85  ? 17.858  -14.897 38.299  1.00 33.65  ? 84   PHE D CE2 1 
ATOM   7730  C CZ  . PHE D  1 85  ? 18.925  -15.717 38.592  1.00 33.58  ? 84   PHE D CZ  1 
ATOM   7731  N N   . LYS D  1 86  ? 13.975  -18.993 34.246  1.00 36.95  ? 85   LYS D N   1 
ATOM   7732  C CA  . LYS D  1 86  ? 12.718  -19.447 33.673  1.00 40.13  ? 85   LYS D CA  1 
ATOM   7733  C C   . LYS D  1 86  ? 12.338  -20.824 34.184  1.00 39.95  ? 85   LYS D C   1 
ATOM   7734  O O   . LYS D  1 86  ? 13.194  -21.673 34.456  1.00 42.03  ? 85   LYS D O   1 
ATOM   7735  C CB  . LYS D  1 86  ? 12.794  -19.478 32.143  1.00 39.55  ? 85   LYS D CB  1 
ATOM   7736  C CG  . LYS D  1 86  ? 13.044  -18.131 31.505  1.00 43.55  ? 85   LYS D CG  1 
ATOM   7737  C CD  . LYS D  1 86  ? 13.135  -18.254 29.993  1.00 43.55  ? 85   LYS D CD  1 
ATOM   7738  C CE  . LYS D  1 86  ? 13.445  -16.915 29.352  1.00 61.76  ? 85   LYS D CE  1 
ATOM   7739  N NZ  . LYS D  1 86  ? 13.624  -17.027 27.878  1.00 80.14  ? 85   LYS D NZ  1 
ATOM   7740  N N   . VAL D  1 87  ? 11.036  -21.038 34.304  1.00 35.03  ? 86   VAL D N   1 
ATOM   7741  C CA  . VAL D  1 87  ? 10.514  -22.361 34.610  1.00 35.54  ? 86   VAL D CA  1 
ATOM   7742  C C   . VAL D  1 87  ? 9.357   -22.608 33.665  1.00 38.18  ? 86   VAL D C   1 
ATOM   7743  O O   . VAL D  1 87  ? 8.526   -21.728 33.459  1.00 42.72  ? 86   VAL D O   1 
ATOM   7744  C CB  . VAL D  1 87  ? 10.035  -22.465 36.070  1.00 41.78  ? 86   VAL D CB  1 
ATOM   7745  C CG1 . VAL D  1 87  ? 9.353   -23.817 36.319  1.00 39.28  ? 86   VAL D CG1 1 
ATOM   7746  C CG2 . VAL D  1 87  ? 11.201  -22.272 37.031  1.00 31.40  ? 86   VAL D CG2 1 
ATOM   7747  N N   . GLN D  1 88  ? 9.317   -23.792 33.075  1.00 36.26  ? 87   GLN D N   1 
ATOM   7748  C CA  . GLN D  1 88  ? 8.272   -24.131 32.121  1.00 42.46  ? 87   GLN D CA  1 
ATOM   7749  C C   . GLN D  1 88  ? 7.814   -25.563 32.348  1.00 40.67  ? 87   GLN D C   1 
ATOM   7750  O O   . GLN D  1 88  ? 8.605   -26.432 32.706  1.00 41.32  ? 87   GLN D O   1 
ATOM   7751  C CB  . GLN D  1 88  ? 8.808   -23.974 30.691  1.00 39.80  ? 87   GLN D CB  1 
ATOM   7752  C CG  . GLN D  1 88  ? 9.319   -22.556 30.396  1.00 63.89  ? 87   GLN D CG  1 
ATOM   7753  C CD  . GLN D  1 88  ? 10.146  -22.458 29.116  1.00 68.81  ? 87   GLN D CD  1 
ATOM   7754  O OE1 . GLN D  1 88  ? 10.392  -23.457 28.439  1.00 73.22  ? 87   GLN D OE1 1 
ATOM   7755  N NE2 . GLN D  1 88  ? 10.579  -21.245 28.785  1.00 63.84  ? 87   GLN D NE2 1 
ATOM   7756  N N   . LEU D  1 89  ? 6.530   -25.809 32.143  1.00 37.73  ? 88   LEU D N   1 
ATOM   7757  C CA  . LEU D  1 89  ? 6.015   -27.166 32.189  1.00 41.88  ? 88   LEU D CA  1 
ATOM   7758  C C   . LEU D  1 89  ? 5.248   -27.416 30.906  1.00 47.26  ? 88   LEU D C   1 
ATOM   7759  O O   . LEU D  1 89  ? 4.602   -26.506 30.371  1.00 37.19  ? 88   LEU D O   1 
ATOM   7760  C CB  . LEU D  1 89  ? 5.089   -27.373 33.385  1.00 35.05  ? 88   LEU D CB  1 
ATOM   7761  C CG  . LEU D  1 89  ? 5.696   -27.219 34.778  1.00 52.79  ? 88   LEU D CG  1 
ATOM   7762  C CD1 . LEU D  1 89  ? 5.828   -25.742 35.149  1.00 42.37  ? 88   LEU D CD1 1 
ATOM   7763  C CD2 . LEU D  1 89  ? 4.836   -27.953 35.816  1.00 38.41  ? 88   LEU D CD2 1 
ATOM   7764  N N   . GLN D  1 90  ? 5.303   -28.650 30.420  1.00 33.56  ? 89   GLN D N   1 
ATOM   7765  C CA  . GLN D  1 90  ? 4.687   -28.964 29.145  1.00 48.90  ? 89   GLN D CA  1 
ATOM   7766  C C   . GLN D  1 90  ? 4.091   -30.360 29.151  1.00 43.67  ? 89   GLN D C   1 
ATOM   7767  O O   . GLN D  1 90  ? 4.736   -31.327 29.554  1.00 41.23  ? 89   GLN D O   1 
ATOM   7768  C CB  . GLN D  1 90  ? 5.724   -28.839 28.033  1.00 45.30  ? 89   GLN D CB  1 
ATOM   7769  C CG  . GLN D  1 90  ? 5.161   -29.036 26.643  1.00 67.79  ? 89   GLN D CG  1 
ATOM   7770  C CD  . GLN D  1 90  ? 6.128   -28.578 25.572  1.00 85.80  ? 89   GLN D CD  1 
ATOM   7771  O OE1 . GLN D  1 90  ? 7.276   -28.233 25.864  1.00 74.19  ? 89   GLN D OE1 1 
ATOM   7772  N NE2 . GLN D  1 90  ? 5.668   -28.564 24.326  1.00 90.99  ? 89   GLN D NE2 1 
ATOM   7773  N N   . LEU D  1 91  ? 2.841   -30.449 28.717  1.00 36.70  ? 90   LEU D N   1 
ATOM   7774  C CA  . LEU D  1 91  ? 2.196   -31.733 28.520  1.00 35.40  ? 90   LEU D CA  1 
ATOM   7775  C C   . LEU D  1 91  ? 2.268   -32.092 27.036  1.00 49.13  ? 90   LEU D C   1 
ATOM   7776  O O   . LEU D  1 91  ? 2.345   -31.206 26.178  1.00 44.86  ? 90   LEU D O   1 
ATOM   7777  C CB  . LEU D  1 91  ? 0.737   -31.667 28.977  1.00 44.52  ? 90   LEU D CB  1 
ATOM   7778  C CG  . LEU D  1 91  ? 0.520   -31.426 30.475  1.00 51.09  ? 90   LEU D CG  1 
ATOM   7779  C CD1 . LEU D  1 91  ? -0.881  -30.892 30.746  1.00 36.54  ? 90   LEU D CD1 1 
ATOM   7780  C CD2 . LEU D  1 91  ? 0.787   -32.719 31.264  1.00 37.19  ? 90   LEU D CD2 1 
ATOM   7781  N N   . PRO D  1 92  ? 2.249   -33.395 26.727  1.00 61.13  ? 91   PRO D N   1 
ATOM   7782  C CA  . PRO D  1 92  ? 2.210   -33.851 25.333  1.00 62.67  ? 91   PRO D CA  1 
ATOM   7783  C C   . PRO D  1 92  ? 0.964   -33.335 24.618  1.00 75.66  ? 91   PRO D C   1 
ATOM   7784  O O   . PRO D  1 92  ? -0.093  -33.160 25.238  1.00 49.59  ? 91   PRO D O   1 
ATOM   7785  C CB  . PRO D  1 92  ? 2.185   -35.378 25.457  1.00 75.09  ? 91   PRO D CB  1 
ATOM   7786  C CG  . PRO D  1 92  ? 1.744   -35.655 26.856  1.00 85.44  ? 91   PRO D CG  1 
ATOM   7787  C CD  . PRO D  1 92  ? 2.227   -34.515 27.682  1.00 71.77  ? 91   PRO D CD  1 
ATOM   7788  N N   . ASP D  1 93  ? 1.089   -33.090 23.319  1.00 68.65  ? 92   ASP D N   1 
ATOM   7789  C CA  . ASP D  1 93  ? 0.020   -32.426 22.586  1.00 81.27  ? 92   ASP D CA  1 
ATOM   7790  C C   . ASP D  1 93  ? -1.232  -33.286 22.441  1.00 75.44  ? 92   ASP D C   1 
ATOM   7791  O O   . ASP D  1 93  ? -2.346  -32.763 22.470  1.00 80.19  ? 92   ASP D O   1 
ATOM   7792  C CB  . ASP D  1 93  ? 0.504   -31.987 21.208  1.00 95.66  ? 92   ASP D CB  1 
ATOM   7793  C CG  . ASP D  1 93  ? -0.296  -30.818 20.666  1.00 123.33 ? 92   ASP D CG  1 
ATOM   7794  O OD1 . ASP D  1 93  ? -0.747  -29.984 21.485  1.00 97.88  ? 92   ASP D OD1 1 
ATOM   7795  O OD2 . ASP D  1 93  ? -0.476  -30.732 19.430  1.00 132.79 ? 92   ASP D OD2 1 
ATOM   7796  N N   . ASN D  1 94  ? -1.056  -34.596 22.285  1.00 71.53  ? 93   ASN D N   1 
ATOM   7797  C CA  . ASN D  1 94  ? -2.196  -35.502 22.129  1.00 83.59  ? 93   ASN D CA  1 
ATOM   7798  C C   . ASN D  1 94  ? -2.665  -36.144 23.438  1.00 83.52  ? 93   ASN D C   1 
ATOM   7799  O O   . ASN D  1 94  ? -3.374  -37.154 23.436  1.00 51.40  ? 93   ASN D O   1 
ATOM   7800  C CB  . ASN D  1 94  ? -1.879  -36.581 21.092  1.00 78.58  ? 93   ASN D CB  1 
ATOM   7801  C CG  . ASN D  1 94  ? -1.931  -36.049 19.669  1.00 107.75 ? 93   ASN D CG  1 
ATOM   7802  O OD1 . ASN D  1 94  ? -1.896  -34.834 19.443  1.00 91.33  ? 93   ASN D OD1 1 
ATOM   7803  N ND2 . ASN D  1 94  ? -2.023  -36.957 18.699  1.00 100.18 ? 93   ASN D ND2 1 
ATOM   7804  N N   . GLU D  1 95  ? -2.281  -35.545 24.558  1.00 107.21 ? 94   GLU D N   1 
ATOM   7805  C CA  . GLU D  1 95  ? -2.722  -36.021 25.861  1.00 99.08  ? 94   GLU D CA  1 
ATOM   7806  C C   . GLU D  1 95  ? -4.067  -35.394 26.209  1.00 91.60  ? 94   GLU D C   1 
ATOM   7807  O O   . GLU D  1 95  ? -4.457  -34.381 25.631  1.00 76.74  ? 94   GLU D O   1 
ATOM   7808  C CB  . GLU D  1 95  ? -1.684  -35.669 26.923  1.00 104.34 ? 94   GLU D CB  1 
ATOM   7809  C CG  . GLU D  1 95  ? -1.958  -36.266 28.293  1.00 116.84 ? 94   GLU D CG  1 
ATOM   7810  C CD  . GLU D  1 95  ? -1.791  -37.776 28.323  1.00 125.37 ? 94   GLU D CD  1 
ATOM   7811  O OE1 . GLU D  1 95  ? -0.896  -38.292 27.613  1.00 114.19 ? 94   GLU D OE1 1 
ATOM   7812  O OE2 . GLU D  1 95  ? -2.557  -38.446 29.056  1.00 108.14 ? 94   GLU D OE2 1 
ATOM   7813  N N   . VAL D  1 96  ? -4.777  -35.998 27.156  1.00 68.67  ? 95   VAL D N   1 
ATOM   7814  C CA  . VAL D  1 96  ? -6.090  -35.497 27.553  1.00 52.90  ? 95   VAL D CA  1 
ATOM   7815  C C   . VAL D  1 96  ? -6.012  -34.550 28.753  1.00 48.37  ? 95   VAL D C   1 
ATOM   7816  O O   . VAL D  1 96  ? -6.886  -33.713 28.931  1.00 40.37  ? 95   VAL D O   1 
ATOM   7817  C CB  . VAL D  1 96  ? -7.039  -36.652 27.889  1.00 69.01  ? 95   VAL D CB  1 
ATOM   7818  C CG1 . VAL D  1 96  ? -8.458  -36.146 28.013  1.00 65.24  ? 95   VAL D CG1 1 
ATOM   7819  C CG2 . VAL D  1 96  ? -6.951  -37.726 26.813  1.00 87.22  ? 95   VAL D CG2 1 
ATOM   7820  N N   . ALA D  1 97  ? -4.968  -34.695 29.569  1.00 41.14  ? 96   ALA D N   1 
ATOM   7821  C CA  . ALA D  1 97  ? -4.733  -33.818 30.716  1.00 35.86  ? 96   ALA D CA  1 
ATOM   7822  C C   . ALA D  1 97  ? -4.487  -32.373 30.282  1.00 40.14  ? 96   ALA D C   1 
ATOM   7823  O O   . ALA D  1 97  ? -3.746  -32.116 29.336  1.00 39.28  ? 96   ALA D O   1 
ATOM   7824  C CB  . ALA D  1 97  ? -3.548  -34.328 31.518  1.00 32.60  ? 96   ALA D CB  1 
ATOM   7825  N N   . GLN D  1 98  ? -5.105  -31.432 30.988  1.00 37.06  ? 97   GLN D N   1 
ATOM   7826  C CA  . GLN D  1 98  ? -4.995  -30.016 30.651  1.00 37.27  ? 97   GLN D CA  1 
ATOM   7827  C C   . GLN D  1 98  ? -4.470  -29.170 31.802  1.00 45.09  ? 97   GLN D C   1 
ATOM   7828  O O   . GLN D  1 98  ? -4.690  -29.469 32.976  1.00 39.59  ? 97   GLN D O   1 
ATOM   7829  C CB  . GLN D  1 98  ? -6.358  -29.466 30.254  1.00 41.18  ? 97   GLN D CB  1 
ATOM   7830  C CG  . GLN D  1 98  ? -6.939  -30.090 29.014  1.00 42.25  ? 97   GLN D CG  1 
ATOM   7831  C CD  . GLN D  1 98  ? -8.319  -29.557 28.720  1.00 45.02  ? 97   GLN D CD  1 
ATOM   7832  O OE1 . GLN D  1 98  ? -9.275  -29.823 29.454  1.00 44.40  ? 97   GLN D OE1 1 
ATOM   7833  N NE2 . GLN D  1 98  ? -8.432  -28.787 27.652  1.00 36.23  ? 97   GLN D NE2 1 
ATOM   7834  N N   . ILE D  1 99  ? -3.769  -28.105 31.446  1.00 40.55  ? 98   ILE D N   1 
ATOM   7835  C CA  . ILE D  1 99  ? -3.411  -27.076 32.397  1.00 31.93  ? 98   ILE D CA  1 
ATOM   7836  C C   . ILE D  1 99  ? -4.649  -26.236 32.639  1.00 40.28  ? 98   ILE D C   1 
ATOM   7837  O O   . ILE D  1 99  ? -5.265  -25.740 31.698  1.00 40.33  ? 98   ILE D O   1 
ATOM   7838  C CB  . ILE D  1 99  ? -2.263  -26.216 31.872  1.00 40.60  ? 98   ILE D CB  1 
ATOM   7839  C CG1 . ILE D  1 99  ? -0.973  -27.050 31.884  1.00 33.16  ? 98   ILE D CG1 1 
ATOM   7840  C CG2 . ILE D  1 99  ? -2.116  -24.972 32.710  1.00 27.15  ? 98   ILE D CG2 1 
ATOM   7841  C CD1 . ILE D  1 99  ? 0.209   -26.363 31.271  1.00 47.03  ? 98   ILE D CD1 1 
ATOM   7842  N N   . SER D  1 100 ? -5.004  -26.087 33.913  1.00 36.96  ? 99   SER D N   1 
ATOM   7843  C CA  . SER D  1 100 ? -6.275  -25.511 34.314  1.00 46.80  ? 99   SER D CA  1 
ATOM   7844  C C   . SER D  1 100 ? -6.076  -24.172 35.017  1.00 41.73  ? 99   SER D C   1 
ATOM   7845  O O   . SER D  1 100 ? -6.887  -23.259 34.881  1.00 51.02  ? 99   SER D O   1 
ATOM   7846  C CB  . SER D  1 100 ? -7.005  -26.486 35.250  1.00 39.51  ? 99   SER D CB  1 
ATOM   7847  O OG  . SER D  1 100 ? -8.082  -25.846 35.909  1.00 63.95  ? 99   SER D OG  1 
ATOM   7848  N N   . ASP D  1 101 ? -4.998  -24.062 35.782  1.00 42.26  ? 100  ASP D N   1 
ATOM   7849  C CA  . ASP D  1 101 ? -4.718  -22.830 36.509  1.00 40.24  ? 100  ASP D CA  1 
ATOM   7850  C C   . ASP D  1 101 ? -3.234  -22.760 36.846  1.00 36.86  ? 100  ASP D C   1 
ATOM   7851  O O   . ASP D  1 101 ? -2.503  -23.733 36.651  1.00 40.44  ? 100  ASP D O   1 
ATOM   7852  C CB  . ASP D  1 101 ? -5.563  -22.748 37.785  1.00 30.85  ? 100  ASP D CB  1 
ATOM   7853  C CG  . ASP D  1 101 ? -5.896  -21.309 38.180  1.00 60.02  ? 100  ASP D CG  1 
ATOM   7854  O OD1 . ASP D  1 101 ? -6.721  -21.136 39.100  1.00 50.18  ? 100  ASP D OD1 1 
ATOM   7855  O OD2 . ASP D  1 101 ? -5.346  -20.353 37.573  1.00 51.30  ? 100  ASP D OD2 1 
ATOM   7856  N N   . TYR D  1 102 ? -2.804  -21.609 37.355  1.00 35.08  ? 101  TYR D N   1 
ATOM   7857  C CA  . TYR D  1 102 ? -1.395  -21.338 37.601  1.00 35.26  ? 101  TYR D CA  1 
ATOM   7858  C C   . TYR D  1 102 ? -1.303  -20.113 38.494  1.00 36.86  ? 101  TYR D C   1 
ATOM   7859  O O   . TYR D  1 102 ? -2.182  -19.244 38.481  1.00 37.63  ? 101  TYR D O   1 
ATOM   7860  C CB  . TYR D  1 102 ? -0.677  -21.080 36.266  1.00 34.26  ? 101  TYR D CB  1 
ATOM   7861  C CG  . TYR D  1 102 ? -1.631  -20.579 35.207  1.00 33.62  ? 101  TYR D CG  1 
ATOM   7862  C CD1 . TYR D  1 102 ? -2.076  -21.425 34.205  1.00 39.49  ? 101  TYR D CD1 1 
ATOM   7863  C CD2 . TYR D  1 102 ? -2.124  -19.283 35.239  1.00 33.81  ? 101  TYR D CD2 1 
ATOM   7864  C CE1 . TYR D  1 102 ? -2.971  -20.991 33.245  1.00 36.93  ? 101  TYR D CE1 1 
ATOM   7865  C CE2 . TYR D  1 102 ? -3.028  -18.830 34.277  1.00 33.59  ? 101  TYR D CE2 1 
ATOM   7866  C CZ  . TYR D  1 102 ? -3.448  -19.703 33.285  1.00 42.16  ? 101  TYR D CZ  1 
ATOM   7867  O OH  . TYR D  1 102 ? -4.345  -19.298 32.326  1.00 42.34  ? 101  TYR D OH  1 
ATOM   7868  N N   . TYR D  1 103 ? -0.237  -20.036 39.274  1.00 35.04  ? 102  TYR D N   1 
ATOM   7869  C CA  . TYR D  1 103 ? -0.034  -18.897 40.161  1.00 34.85  ? 102  TYR D CA  1 
ATOM   7870  C C   . TYR D  1 103 ? 1.463   -18.780 40.411  1.00 32.69  ? 102  TYR D C   1 
ATOM   7871  O O   . TYR D  1 103 ? 2.135   -19.797 40.573  1.00 40.70  ? 102  TYR D O   1 
ATOM   7872  C CB  . TYR D  1 103 ? -0.806  -19.111 41.483  1.00 37.86  ? 102  TYR D CB  1 
ATOM   7873  C CG  . TYR D  1 103 ? -0.853  -17.870 42.335  1.00 41.88  ? 102  TYR D CG  1 
ATOM   7874  C CD1 . TYR D  1 103 ? -1.788  -16.871 42.084  1.00 43.86  ? 102  TYR D CD1 1 
ATOM   7875  C CD2 . TYR D  1 103 ? 0.065   -17.671 43.357  1.00 43.22  ? 102  TYR D CD2 1 
ATOM   7876  C CE1 . TYR D  1 103 ? -1.818  -15.712 42.834  1.00 44.17  ? 102  TYR D CE1 1 
ATOM   7877  C CE2 . TYR D  1 103 ? 0.044   -16.508 44.116  1.00 50.17  ? 102  TYR D CE2 1 
ATOM   7878  C CZ  . TYR D  1 103 ? -0.903  -15.537 43.852  1.00 50.44  ? 102  TYR D CZ  1 
ATOM   7879  O OH  . TYR D  1 103 ? -0.933  -14.384 44.607  1.00 71.59  ? 102  TYR D OH  1 
ATOM   7880  N N   . PRO D  1 104 ? 2.009   -17.549 40.431  1.00 39.80  ? 103  PRO D N   1 
ATOM   7881  C CA  . PRO D  1 104 ? 1.347   -16.249 40.285  1.00 44.97  ? 103  PRO D CA  1 
ATOM   7882  C C   . PRO D  1 104 ? 1.033   -15.880 38.841  1.00 41.31  ? 103  PRO D C   1 
ATOM   7883  O O   . PRO D  1 104 ? 1.456   -16.555 37.906  1.00 41.61  ? 103  PRO D O   1 
ATOM   7884  C CB  . PRO D  1 104 ? 2.398   -15.271 40.818  1.00 45.08  ? 103  PRO D CB  1 
ATOM   7885  C CG  . PRO D  1 104 ? 3.695   -15.902 40.441  1.00 38.15  ? 103  PRO D CG  1 
ATOM   7886  C CD  . PRO D  1 104 ? 3.470   -17.398 40.575  1.00 33.41  ? 103  PRO D CD  1 
ATOM   7887  N N   . ARG D  1 105 ? 0.306   -14.786 38.677  1.00 37.47  ? 104  ARG D N   1 
ATOM   7888  C CA  . ARG D  1 105 ? -0.059  -14.277 37.366  1.00 35.95  ? 104  ARG D CA  1 
ATOM   7889  C C   . ARG D  1 105 ? 0.436   -12.843 37.247  1.00 37.81  ? 104  ARG D C   1 
ATOM   7890  O O   . ARG D  1 105 ? 1.110   -12.339 38.149  1.00 44.19  ? 104  ARG D O   1 
ATOM   7891  C CB  . ARG D  1 105 ? -1.572  -14.344 37.202  1.00 36.83  ? 104  ARG D CB  1 
ATOM   7892  C CG  . ARG D  1 105 ? -2.131  -15.643 37.757  1.00 41.80  ? 104  ARG D CG  1 
ATOM   7893  C CD  . ARG D  1 105 ? -3.630  -15.726 37.627  1.00 38.28  ? 104  ARG D CD  1 
ATOM   7894  N NE  . ARG D  1 105 ? -4.140  -16.965 38.205  1.00 50.31  ? 104  ARG D NE  1 
ATOM   7895  C CZ  . ARG D  1 105 ? -4.698  -17.068 39.412  1.00 50.32  ? 104  ARG D CZ  1 
ATOM   7896  N NH1 . ARG D  1 105 ? -5.124  -18.242 39.831  1.00 39.60  ? 104  ARG D NH1 1 
ATOM   7897  N NH2 . ARG D  1 105 ? -4.838  -16.009 40.204  1.00 39.32  ? 104  ARG D NH2 1 
ATOM   7898  N N   . ASN D  1 106 ? 0.117   -12.182 36.140  1.00 37.12  ? 105  ASN D N   1 
ATOM   7899  C CA  . ASN D  1 106 ? 0.611   -10.823 35.922  1.00 47.14  ? 105  ASN D CA  1 
ATOM   7900  C C   . ASN D  1 106 ? -0.284  -9.808  36.602  1.00 46.33  ? 105  ASN D C   1 
ATOM   7901  O O   . ASN D  1 106 ? -1.489  -9.766  36.367  1.00 49.38  ? 105  ASN D O   1 
ATOM   7902  C CB  . ASN D  1 106 ? 0.730   -10.509 34.427  1.00 33.30  ? 105  ASN D CB  1 
ATOM   7903  C CG  . ASN D  1 106 ? 1.726   -11.416 33.729  1.00 44.16  ? 105  ASN D CG  1 
ATOM   7904  O OD1 . ASN D  1 106 ? 2.765   -11.770 34.293  1.00 46.03  ? 105  ASN D OD1 1 
ATOM   7905  N ND2 . ASN D  1 106 ? 1.402   -11.814 32.503  1.00 38.76  ? 105  ASN D ND2 1 
ATOM   7906  N N   . SER D  1 107 ? 0.305   -8.986  37.454  1.00 53.59  ? 106  SER D N   1 
ATOM   7907  C CA  . SER D  1 107 ? -0.473  -7.983  38.157  1.00 54.51  ? 106  SER D CA  1 
ATOM   7908  C C   . SER D  1 107 ? -0.378  -6.653  37.423  1.00 49.72  ? 106  SER D C   1 
ATOM   7909  O O   . SER D  1 107 ? 0.607   -6.372  36.751  1.00 42.81  ? 106  SER D O   1 
ATOM   7910  C CB  . SER D  1 107 ? 0.019   -7.841  39.599  1.00 60.20  ? 106  SER D CB  1 
ATOM   7911  O OG  . SER D  1 107 ? 1.409   -7.554  39.628  1.00 92.64  ? 106  SER D OG  1 
ATOM   7912  N N   . ILE D  1 108 ? -1.423  -5.845  37.549  1.00 45.84  ? 107  ILE D N   1 
ATOM   7913  C CA  . ILE D  1 108 ? -1.442  -4.516  36.976  1.00 40.41  ? 107  ILE D CA  1 
ATOM   7914  C C   . ILE D  1 108 ? -0.598  -3.574  37.837  1.00 45.20  ? 107  ILE D C   1 
ATOM   7915  O O   . ILE D  1 108 ? -0.792  -3.479  39.050  1.00 48.08  ? 107  ILE D O   1 
ATOM   7916  C CB  . ILE D  1 108 ? -2.886  -4.011  36.880  1.00 44.79  ? 107  ILE D CB  1 
ATOM   7917  C CG1 . ILE D  1 108 ? -3.700  -4.961  35.993  1.00 40.89  ? 107  ILE D CG1 1 
ATOM   7918  C CG2 . ILE D  1 108 ? -2.924  -2.596  36.354  1.00 40.10  ? 107  ILE D CG2 1 
ATOM   7919  C CD1 . ILE D  1 108 ? -5.180  -4.614  35.927  1.00 47.01  ? 107  ILE D CD1 1 
ATOM   7920  N N   . ASP D  1 109 ? 0.350   -2.894  37.203  1.00 46.66  ? 108  ASP D N   1 
ATOM   7921  C CA  . ASP D  1 109 ? 1.242   -1.978  37.904  1.00 50.34  ? 108  ASP D CA  1 
ATOM   7922  C C   . ASP D  1 109 ? 0.604   -0.597  38.050  1.00 49.94  ? 108  ASP D C   1 
ATOM   7923  O O   . ASP D  1 109 ? -0.285  -0.224  37.286  1.00 49.14  ? 108  ASP D O   1 
ATOM   7924  C CB  . ASP D  1 109 ? 2.563   -1.857  37.147  1.00 61.80  ? 108  ASP D CB  1 
ATOM   7925  C CG  . ASP D  1 109 ? 3.760   -1.755  38.073  1.00 90.60  ? 108  ASP D CG  1 
ATOM   7926  O OD1 . ASP D  1 109 ? 3.583   -1.364  39.250  1.00 74.59  ? 108  ASP D OD1 1 
ATOM   7927  O OD2 . ASP D  1 109 ? 4.880   -2.071  37.620  1.00 110.24 ? 108  ASP D OD2 1 
ATOM   7928  N N   . THR D  1 110 ? 1.055   0.161   39.040  1.00 48.12  ? 109  THR D N   1 
ATOM   7929  C CA  . THR D  1 110 ? 0.507   1.489   39.282  1.00 52.52  ? 109  THR D CA  1 
ATOM   7930  C C   . THR D  1 110 ? 1.617   2.517   39.482  1.00 55.37  ? 109  THR D C   1 
ATOM   7931  O O   . THR D  1 110 ? 2.787   2.172   39.656  1.00 53.46  ? 109  THR D O   1 
ATOM   7932  C CB  . THR D  1 110 ? -0.390  1.515   40.533  1.00 56.59  ? 109  THR D CB  1 
ATOM   7933  O OG1 . THR D  1 110 ? 0.414   1.293   41.698  1.00 63.56  ? 109  THR D OG1 1 
ATOM   7934  C CG2 . THR D  1 110 ? -1.482  0.452   40.451  1.00 60.19  ? 109  THR D CG2 1 
ATOM   7935  N N   . LYS D  1 111 ? 1.228   3.783   39.473  1.00 45.12  ? 110  LYS D N   1 
ATOM   7936  C CA  . LYS D  1 111 ? 2.149   4.879   39.717  1.00 47.55  ? 110  LYS D CA  1 
ATOM   7937  C C   . LYS D  1 111 ? 1.390   6.012   40.363  1.00 44.08  ? 110  LYS D C   1 
ATOM   7938  O O   . LYS D  1 111 ? 0.166   6.093   40.260  1.00 49.21  ? 110  LYS D O   1 
ATOM   7939  C CB  . LYS D  1 111 ? 2.775   5.355   38.410  1.00 46.68  ? 110  LYS D CB  1 
ATOM   7940  C CG  . LYS D  1 111 ? 1.757   5.699   37.334  1.00 50.84  ? 110  LYS D CG  1 
ATOM   7941  C CD  . LYS D  1 111 ? 2.244   5.215   35.979  1.00 60.91  ? 110  LYS D CD  1 
ATOM   7942  C CE  . LYS D  1 111 ? 1.126   5.194   34.949  1.00 68.04  ? 110  LYS D CE  1 
ATOM   7943  N NZ  . LYS D  1 111 ? 0.087   4.173   35.251  1.00 54.50  ? 110  LYS D NZ  1 
ATOM   7944  N N   . GLU D  1 112 ? 2.123   6.887   41.037  1.00 44.22  ? 111  GLU D N   1 
ATOM   7945  C CA  . GLU D  1 112 ? 1.527   8.028   41.714  1.00 49.71  ? 111  GLU D CA  1 
ATOM   7946  C C   . GLU D  1 112 ? 1.874   9.287   40.930  1.00 43.74  ? 111  GLU D C   1 
ATOM   7947  O O   . GLU D  1 112 ? 3.013   9.475   40.519  1.00 38.30  ? 111  GLU D O   1 
ATOM   7948  C CB  . GLU D  1 112 ? 2.058   8.106   43.148  1.00 45.41  ? 111  GLU D CB  1 
ATOM   7949  C CG  . GLU D  1 112 ? 1.480   9.232   43.992  1.00 65.56  ? 111  GLU D CG  1 
ATOM   7950  C CD  . GLU D  1 112 ? 1.965   9.179   45.437  1.00 86.85  ? 111  GLU D CD  1 
ATOM   7951  O OE1 . GLU D  1 112 ? 2.580   10.161  45.904  1.00 95.42  ? 111  GLU D OE1 1 
ATOM   7952  O OE2 . GLU D  1 112 ? 1.735   8.150   46.108  1.00 96.84  ? 111  GLU D OE2 1 
ATOM   7953  N N   . TYR D  1 113 ? 0.878   10.135  40.710  1.00 54.32  ? 112  TYR D N   1 
ATOM   7954  C CA  . TYR D  1 113 ? 1.077   11.379  39.987  1.00 51.84  ? 112  TYR D CA  1 
ATOM   7955  C C   . TYR D  1 113 ? 0.704   12.562  40.874  1.00 50.05  ? 112  TYR D C   1 
ATOM   7956  O O   . TYR D  1 113 ? -0.285  12.506  41.605  1.00 56.57  ? 112  TYR D O   1 
ATOM   7957  C CB  . TYR D  1 113 ? 0.235   11.387  38.709  1.00 46.63  ? 112  TYR D CB  1 
ATOM   7958  C CG  . TYR D  1 113 ? 0.715   12.396  37.691  1.00 69.37  ? 112  TYR D CG  1 
ATOM   7959  C CD1 . TYR D  1 113 ? 1.818   12.123  36.892  1.00 74.48  ? 112  TYR D CD1 1 
ATOM   7960  C CD2 . TYR D  1 113 ? 0.081   13.627  37.537  1.00 76.64  ? 112  TYR D CD2 1 
ATOM   7961  C CE1 . TYR D  1 113 ? 2.277   13.041  35.959  1.00 79.52  ? 112  TYR D CE1 1 
ATOM   7962  C CE2 . TYR D  1 113 ? 0.534   14.556  36.602  1.00 71.84  ? 112  TYR D CE2 1 
ATOM   7963  C CZ  . TYR D  1 113 ? 1.633   14.251  35.816  1.00 82.70  ? 112  TYR D CZ  1 
ATOM   7964  O OH  . TYR D  1 113 ? 2.099   15.153  34.883  1.00 92.81  ? 112  TYR D OH  1 
ATOM   7965  N N   . MET D  1 114 ? 1.507   13.622  40.817  1.00 45.49  ? 113  MET D N   1 
ATOM   7966  C CA  . MET D  1 114 ? 1.227   14.848  41.570  1.00 54.44  ? 113  MET D CA  1 
ATOM   7967  C C   . MET D  1 114 ? 1.374   16.064  40.678  1.00 49.05  ? 113  MET D C   1 
ATOM   7968  O O   . MET D  1 114 ? 2.330   16.162  39.920  1.00 51.79  ? 113  MET D O   1 
ATOM   7969  C CB  . MET D  1 114 ? 2.201   15.008  42.730  1.00 52.21  ? 113  MET D CB  1 
ATOM   7970  C CG  . MET D  1 114 ? 2.154   13.907  43.761  1.00 70.49  ? 113  MET D CG  1 
ATOM   7971  S SD  . MET D  1 114 ? 3.366   14.209  45.057  1.00 105.72 ? 113  MET D SD  1 
ATOM   7972  C CE  . MET D  1 114 ? 2.819   15.801  45.663  1.00 65.20  ? 113  MET D CE  1 
ATOM   7973  N N   . SER D  1 115 ? 0.426   16.989  40.773  1.00 54.68  ? 114  SER D N   1 
ATOM   7974  C CA  . SER D  1 115 ? 0.515   18.267  40.077  1.00 52.71  ? 114  SER D CA  1 
ATOM   7975  C C   . SER D  1 115 ? 0.497   19.387  41.110  1.00 49.31  ? 114  SER D C   1 
ATOM   7976  O O   . SER D  1 115 ? -0.224  19.313  42.102  1.00 47.26  ? 114  SER D O   1 
ATOM   7977  C CB  . SER D  1 115 ? -0.650  18.433  39.100  1.00 52.14  ? 114  SER D CB  1 
ATOM   7978  O OG  . SER D  1 115 ? -0.566  17.486  38.047  1.00 76.83  ? 114  SER D OG  1 
ATOM   7979  N N   . THR D  1 116 ? 1.295   20.421  40.878  1.00 47.65  ? 115  THR D N   1 
ATOM   7980  C CA  . THR D  1 116 ? 1.385   21.533  41.809  1.00 49.73  ? 115  THR D CA  1 
ATOM   7981  C C   . THR D  1 116 ? 1.316   22.863  41.076  1.00 48.06  ? 115  THR D C   1 
ATOM   7982  O O   . THR D  1 116 ? 1.951   23.044  40.046  1.00 44.60  ? 115  THR D O   1 
ATOM   7983  C CB  . THR D  1 116 ? 2.700   21.479  42.599  1.00 53.74  ? 115  THR D CB  1 
ATOM   7984  O OG1 . THR D  1 116 ? 2.727   20.292  43.396  1.00 62.55  ? 115  THR D OG1 1 
ATOM   7985  C CG2 . THR D  1 116 ? 2.832   22.698  43.509  1.00 54.96  ? 115  THR D CG2 1 
ATOM   7986  N N   . LEU D  1 117 ? 0.539   23.786  41.624  1.00 49.96  ? 116  LEU D N   1 
ATOM   7987  C CA  . LEU D  1 117 ? 0.434   25.135  41.098  1.00 43.41  ? 116  LEU D CA  1 
ATOM   7988  C C   . LEU D  1 117 ? 0.728   26.087  42.246  1.00 53.03  ? 116  LEU D C   1 
ATOM   7989  O O   . LEU D  1 117 ? 0.100   26.008  43.299  1.00 47.54  ? 116  LEU D O   1 
ATOM   7990  C CB  . LEU D  1 117 ? -0.972  25.374  40.538  1.00 47.23  ? 116  LEU D CB  1 
ATOM   7991  C CG  . LEU D  1 117 ? -1.313  26.749  39.950  1.00 48.82  ? 116  LEU D CG  1 
ATOM   7992  C CD1 . LEU D  1 117 ? -1.633  27.752  41.039  1.00 66.72  ? 116  LEU D CD1 1 
ATOM   7993  C CD2 . LEU D  1 117 ? -0.178  27.243  39.073  1.00 51.05  ? 116  LEU D CD2 1 
ATOM   7994  N N   . THR D  1 118 ? 1.698   26.969  42.047  1.00 42.83  ? 117  THR D N   1 
ATOM   7995  C CA  . THR D  1 118 ? 2.071   27.933  43.067  1.00 47.48  ? 117  THR D CA  1 
ATOM   7996  C C   . THR D  1 118 ? 2.128   29.324  42.463  1.00 43.20  ? 117  THR D C   1 
ATOM   7997  O O   . THR D  1 118 ? 2.521   29.494  41.318  1.00 46.58  ? 117  THR D O   1 
ATOM   7998  C CB  . THR D  1 118 ? 3.454   27.610  43.654  1.00 54.90  ? 117  THR D CB  1 
ATOM   7999  O OG1 . THR D  1 118 ? 3.473   26.262  44.125  1.00 58.26  ? 117  THR D OG1 1 
ATOM   8000  C CG2 . THR D  1 118 ? 3.779   28.551  44.808  1.00 56.36  ? 117  THR D CG2 1 
ATOM   8001  N N   . TYR D  1 119 ? 1.721   30.323  43.228  1.00 47.62  ? 118  TYR D N   1 
ATOM   8002  C CA  . TYR D  1 119 ? 1.951   31.697  42.823  1.00 50.33  ? 118  TYR D CA  1 
ATOM   8003  C C   . TYR D  1 119 ? 2.224   32.526  44.054  1.00 41.61  ? 118  TYR D C   1 
ATOM   8004  O O   . TYR D  1 119 ? 1.767   32.198  45.141  1.00 46.55  ? 118  TYR D O   1 
ATOM   8005  C CB  . TYR D  1 119 ? 0.775   32.246  42.018  1.00 48.76  ? 118  TYR D CB  1 
ATOM   8006  C CG  . TYR D  1 119 ? -0.563  32.124  42.690  1.00 45.95  ? 118  TYR D CG  1 
ATOM   8007  C CD1 . TYR D  1 119 ? -1.080  33.170  43.445  1.00 57.42  ? 118  TYR D CD1 1 
ATOM   8008  C CD2 . TYR D  1 119 ? -1.326  30.972  42.550  1.00 58.87  ? 118  TYR D CD2 1 
ATOM   8009  C CE1 . TYR D  1 119 ? -2.316  33.065  44.064  1.00 70.14  ? 118  TYR D CE1 1 
ATOM   8010  C CE2 . TYR D  1 119 ? -2.563  30.857  43.161  1.00 74.69  ? 118  TYR D CE2 1 
ATOM   8011  C CZ  . TYR D  1 119 ? -3.054  31.909  43.919  1.00 79.83  ? 118  TYR D CZ  1 
ATOM   8012  O OH  . TYR D  1 119 ? -4.282  31.809  44.534  1.00 79.96  ? 118  TYR D OH  1 
ATOM   8013  N N   . GLY D  1 120 ? 3.004   33.584  43.888  1.00 42.15  ? 119  GLY D N   1 
ATOM   8014  C CA  . GLY D  1 120 ? 3.370   34.424  45.008  1.00 42.28  ? 119  GLY D CA  1 
ATOM   8015  C C   . GLY D  1 120 ? 3.583   35.863  44.608  1.00 49.91  ? 119  GLY D C   1 
ATOM   8016  O O   . GLY D  1 120 ? 3.665   36.193  43.425  1.00 44.79  ? 119  GLY D O   1 
ATOM   8017  N N   . PHE D  1 121 ? 3.666   36.719  45.616  1.00 45.68  ? 120  PHE D N   1 
ATOM   8018  C CA  . PHE D  1 121 ? 3.939   38.126  45.416  1.00 48.48  ? 120  PHE D CA  1 
ATOM   8019  C C   . PHE D  1 121 ? 4.977   38.526  46.436  1.00 52.18  ? 120  PHE D C   1 
ATOM   8020  O O   . PHE D  1 121 ? 5.034   37.967  47.528  1.00 50.19  ? 120  PHE D O   1 
ATOM   8021  C CB  . PHE D  1 121 ? 2.662   38.941  45.604  1.00 51.26  ? 120  PHE D CB  1 
ATOM   8022  C CG  . PHE D  1 121 ? 1.547   38.514  44.700  1.00 57.80  ? 120  PHE D CG  1 
ATOM   8023  C CD1 . PHE D  1 121 ? 1.413   39.066  43.438  1.00 62.81  ? 120  PHE D CD1 1 
ATOM   8024  C CD2 . PHE D  1 121 ? 0.642   37.551  45.103  1.00 61.01  ? 120  PHE D CD2 1 
ATOM   8025  C CE1 . PHE D  1 121 ? 0.393   38.672  42.598  1.00 63.93  ? 120  PHE D CE1 1 
ATOM   8026  C CE2 . PHE D  1 121 ? -0.383  37.150  44.264  1.00 66.70  ? 120  PHE D CE2 1 
ATOM   8027  C CZ  . PHE D  1 121 ? -0.506  37.712  43.011  1.00 62.77  ? 120  PHE D CZ  1 
ATOM   8028  N N   . ASN D  1 122 ? 5.812   39.484  46.076  1.00 50.94  ? 121  ASN D N   1 
ATOM   8029  C CA  . ASN D  1 122 ? 6.819   39.975  46.995  1.00 56.53  ? 121  ASN D CA  1 
ATOM   8030  C C   . ASN D  1 122 ? 7.074   41.447  46.750  1.00 56.26  ? 121  ASN D C   1 
ATOM   8031  O O   . ASN D  1 122 ? 6.699   41.985  45.715  1.00 53.01  ? 121  ASN D O   1 
ATOM   8032  C CB  . ASN D  1 122 ? 8.113   39.175  46.841  1.00 44.92  ? 121  ASN D CB  1 
ATOM   8033  C CG  . ASN D  1 122 ? 8.802   39.423  45.509  1.00 56.33  ? 121  ASN D CG  1 
ATOM   8034  O OD1 . ASN D  1 122 ? 8.307   39.027  44.451  1.00 60.42  ? 121  ASN D OD1 1 
ATOM   8035  N ND2 . ASN D  1 122 ? 9.958   40.066  45.558  1.00 65.46  ? 121  ASN D ND2 1 
ATOM   8036  N N   . GLY D  1 123 ? 7.700   42.095  47.718  1.00 53.17  ? 122  GLY D N   1 
ATOM   8037  C CA  . GLY D  1 123 ? 8.043   43.494  47.596  1.00 52.65  ? 122  GLY D CA  1 
ATOM   8038  C C   . GLY D  1 123 ? 9.174   43.805  48.544  1.00 56.28  ? 122  GLY D C   1 
ATOM   8039  O O   . GLY D  1 123 ? 9.415   43.059  49.496  1.00 48.46  ? 122  GLY D O   1 
ATOM   8040  N N   . ASN D  1 124 ? 9.884   44.892  48.278  1.00 48.76  ? 123  ASN D N   1 
ATOM   8041  C CA  . ASN D  1 124 ? 10.879  45.373  49.220  1.00 52.19  ? 123  ASN D CA  1 
ATOM   8042  C C   . ASN D  1 124 ? 11.085  46.869  49.095  1.00 46.72  ? 123  ASN D C   1 
ATOM   8043  O O   . ASN D  1 124 ? 10.663  47.483  48.121  1.00 51.63  ? 123  ASN D O   1 
ATOM   8044  C CB  . ASN D  1 124 ? 12.204  44.627  49.027  1.00 45.81  ? 123  ASN D CB  1 
ATOM   8045  C CG  . ASN D  1 124 ? 12.941  45.053  47.775  1.00 59.28  ? 123  ASN D CG  1 
ATOM   8046  O OD1 . ASN D  1 124 ? 12.899  46.215  47.372  1.00 66.75  ? 123  ASN D OD1 1 
ATOM   8047  N ND2 . ASN D  1 124 ? 13.627  44.107  47.151  1.00 65.85  ? 123  ASN D ND2 1 
ATOM   8048  N N   . VAL D  1 125 ? 11.715  47.450  50.105  1.00 47.20  ? 124  VAL D N   1 
ATOM   8049  C CA  . VAL D  1 125 ? 12.135  48.836  50.056  1.00 51.12  ? 124  VAL D CA  1 
ATOM   8050  C C   . VAL D  1 125 ? 13.605  48.816  50.450  1.00 49.85  ? 124  VAL D C   1 
ATOM   8051  O O   . VAL D  1 125 ? 13.978  48.125  51.385  1.00 42.55  ? 124  VAL D O   1 
ATOM   8052  C CB  . VAL D  1 125 ? 11.308  49.716  51.020  1.00 52.76  ? 124  VAL D CB  1 
ATOM   8053  C CG1 . VAL D  1 125 ? 9.859   49.799  50.552  1.00 44.85  ? 124  VAL D CG1 1 
ATOM   8054  C CG2 . VAL D  1 125 ? 11.383  49.166  52.431  1.00 48.50  ? 124  VAL D CG2 1 
ATOM   8055  N N   . THR D  1 126 ? 14.454  49.507  49.701  1.00 52.03  ? 125  THR D N   1 
ATOM   8056  C CA  . THR D  1 126 ? 15.865  49.625  50.058  1.00 60.00  ? 125  THR D CA  1 
ATOM   8057  C C   . THR D  1 126 ? 16.192  51.086  50.390  1.00 58.79  ? 125  THR D C   1 
ATOM   8058  O O   . THR D  1 126 ? 15.370  51.974  50.198  1.00 55.03  ? 125  THR D O   1 
ATOM   8059  C CB  . THR D  1 126 ? 16.790  49.128  48.913  1.00 65.06  ? 125  THR D CB  1 
ATOM   8060  O OG1 . THR D  1 126 ? 16.304  49.608  47.653  1.00 58.39  ? 125  THR D OG1 1 
ATOM   8061  C CG2 . THR D  1 126 ? 16.835  47.614  48.871  1.00 62.50  ? 125  THR D CG2 1 
ATOM   8062  N N   . GLY D  1 127 ? 17.394  51.334  50.887  1.00 57.95  ? 126  GLY D N   1 
ATOM   8063  C CA  . GLY D  1 127 ? 17.800  52.683  51.217  1.00 62.39  ? 126  GLY D CA  1 
ATOM   8064  C C   . GLY D  1 127 ? 19.196  52.685  51.785  1.00 62.03  ? 126  GLY D C   1 
ATOM   8065  O O   . GLY D  1 127 ? 19.619  51.702  52.392  1.00 60.43  ? 126  GLY D O   1 
ATOM   8066  N N   . ASP D  1 128 ? 19.912  53.786  51.577  1.00 61.52  ? 127  ASP D N   1 
ATOM   8067  C CA  . ASP D  1 128 ? 21.274  53.932  52.076  1.00 70.43  ? 127  ASP D CA  1 
ATOM   8068  C C   . ASP D  1 128 ? 21.384  55.180  52.944  1.00 59.58  ? 127  ASP D C   1 
ATOM   8069  O O   . ASP D  1 128 ? 20.433  55.950  53.052  1.00 51.53  ? 127  ASP D O   1 
ATOM   8070  C CB  . ASP D  1 128 ? 22.258  54.017  50.912  1.00 67.74  ? 127  ASP D CB  1 
ATOM   8071  C CG  . ASP D  1 128 ? 21.900  55.112  49.934  1.00 84.95  ? 127  ASP D CG  1 
ATOM   8072  O OD1 . ASP D  1 128 ? 22.200  54.964  48.730  1.00 82.14  ? 127  ASP D OD1 1 
ATOM   8073  O OD2 . ASP D  1 128 ? 21.304  56.119  50.369  1.00 85.18  ? 127  ASP D OD2 1 
ATOM   8074  N N   . ASP D  1 129 ? 22.553  55.379  53.548  1.00 83.78  ? 128  ASP D N   1 
ATOM   8075  C CA  . ASP D  1 129 ? 22.766  56.471  54.499  1.00 81.66  ? 128  ASP D CA  1 
ATOM   8076  C C   . ASP D  1 129 ? 22.712  57.864  53.864  1.00 77.69  ? 128  ASP D C   1 
ATOM   8077  O O   . ASP D  1 129 ? 22.727  58.868  54.574  1.00 75.09  ? 128  ASP D O   1 
ATOM   8078  C CB  . ASP D  1 129 ? 24.105  56.289  55.232  1.00 72.84  ? 128  ASP D CB  1 
ATOM   8079  C CG  . ASP D  1 129 ? 25.286  56.135  54.279  1.00 102.05 ? 128  ASP D CG  1 
ATOM   8080  O OD1 . ASP D  1 129 ? 25.132  56.409  53.066  1.00 98.98  ? 128  ASP D OD1 1 
ATOM   8081  O OD2 . ASP D  1 129 ? 26.377  55.742  54.749  1.00 105.24 ? 128  ASP D OD2 1 
ATOM   8082  N N   . THR D  1 130 ? 22.657  57.929  52.536  1.00 56.40  ? 129  THR D N   1 
ATOM   8083  C CA  . THR D  1 130 ? 22.569  59.213  51.846  1.00 55.65  ? 129  THR D CA  1 
ATOM   8084  C C   . THR D  1 130 ? 21.116  59.590  51.564  1.00 57.19  ? 129  THR D C   1 
ATOM   8085  O O   . THR D  1 130 ? 20.844  60.605  50.927  1.00 56.93  ? 129  THR D O   1 
ATOM   8086  C CB  . THR D  1 130 ? 23.340  59.205  50.510  1.00 64.67  ? 129  THR D CB  1 
ATOM   8087  O OG1 . THR D  1 130 ? 22.546  58.571  49.498  1.00 65.31  ? 129  THR D OG1 1 
ATOM   8088  C CG2 . THR D  1 130 ? 24.685  58.482  50.653  1.00 62.01  ? 129  THR D CG2 1 
ATOM   8089  N N   . GLY D  1 131 ? 20.182  58.769  52.032  1.00 65.35  ? 130  GLY D N   1 
ATOM   8090  C CA  . GLY D  1 131 ? 18.768  59.078  51.901  1.00 58.55  ? 130  GLY D CA  1 
ATOM   8091  C C   . GLY D  1 131 ? 18.113  58.574  50.624  1.00 65.18  ? 130  GLY D C   1 
ATOM   8092  O O   . GLY D  1 131 ? 16.910  58.760  50.428  1.00 67.59  ? 130  GLY D O   1 
ATOM   8093  N N   . LYS D  1 132 ? 18.891  57.945  49.748  1.00 55.29  ? 131  LYS D N   1 
ATOM   8094  C CA  . LYS D  1 132 ? 18.318  57.272  48.585  1.00 58.49  ? 131  LYS D CA  1 
ATOM   8095  C C   . LYS D  1 132 ? 17.394  56.122  49.016  1.00 63.43  ? 131  LYS D C   1 
ATOM   8096  O O   . LYS D  1 132 ? 17.615  55.486  50.052  1.00 51.92  ? 131  LYS D O   1 
ATOM   8097  C CB  . LYS D  1 132 ? 19.422  56.753  47.660  1.00 63.00  ? 131  LYS D CB  1 
ATOM   8098  C CG  . LYS D  1 132 ? 20.090  57.845  46.830  1.00 95.93  ? 131  LYS D CG  1 
ATOM   8099  C CD  . LYS D  1 132 ? 21.031  57.275  45.771  1.00 98.53  ? 131  LYS D CD  1 
ATOM   8100  C CE  . LYS D  1 132 ? 20.318  56.304  44.833  1.00 101.72 ? 131  LYS D CE  1 
ATOM   8101  N NZ  . LYS D  1 132 ? 19.153  56.919  44.137  1.00 92.41  ? 131  LYS D NZ  1 
ATOM   8102  N N   . ILE D  1 133 ? 16.361  55.871  48.212  1.00 46.22  ? 132  ILE D N   1 
ATOM   8103  C CA  . ILE D  1 133 ? 15.341  54.881  48.528  1.00 66.23  ? 132  ILE D CA  1 
ATOM   8104  C C   . ILE D  1 133 ? 14.920  54.125  47.279  1.00 70.48  ? 132  ILE D C   1 
ATOM   8105  O O   . ILE D  1 133 ? 14.558  54.740  46.281  1.00 57.38  ? 132  ILE D O   1 
ATOM   8106  C CB  . ILE D  1 133 ? 14.085  55.540  49.111  1.00 70.93  ? 132  ILE D CB  1 
ATOM   8107  C CG1 . ILE D  1 133 ? 14.432  56.287  50.397  1.00 51.36  ? 132  ILE D CG1 1 
ATOM   8108  C CG2 . ILE D  1 133 ? 12.997  54.486  49.365  1.00 55.43  ? 132  ILE D CG2 1 
ATOM   8109  C CD1 . ILE D  1 133 ? 13.233  56.875  51.087  1.00 72.06  ? 132  ILE D CD1 1 
ATOM   8110  N N   . GLY D  1 134 ? 14.960  52.795  47.343  1.00 71.94  ? 133  GLY D N   1 
ATOM   8111  C CA  . GLY D  1 134 ? 14.539  51.954  46.234  1.00 48.95  ? 133  GLY D CA  1 
ATOM   8112  C C   . GLY D  1 134 ? 13.313  51.119  46.556  1.00 47.85  ? 133  GLY D C   1 
ATOM   8113  O O   . GLY D  1 134 ? 12.923  50.984  47.711  1.00 50.67  ? 133  GLY D O   1 
ATOM   8114  N N   . GLY D  1 135 ? 12.700  50.551  45.525  1.00 72.05  ? 134  GLY D N   1 
ATOM   8115  C CA  . GLY D  1 135 ? 11.518  49.731  45.703  1.00 54.92  ? 134  GLY D CA  1 
ATOM   8116  C C   . GLY D  1 135 ? 11.481  48.601  44.701  1.00 63.09  ? 134  GLY D C   1 
ATOM   8117  O O   . GLY D  1 135 ? 12.132  48.670  43.664  1.00 58.17  ? 134  GLY D O   1 
ATOM   8118  N N   . LEU D  1 136 ? 10.732  47.551  45.026  1.00 66.94  ? 135  LEU D N   1 
ATOM   8119  C CA  . LEU D  1 136 ? 10.526  46.422  44.122  1.00 53.79  ? 135  LEU D CA  1 
ATOM   8120  C C   . LEU D  1 136 ? 9.179   45.766  44.412  1.00 50.63  ? 135  LEU D C   1 
ATOM   8121  O O   . LEU D  1 136 ? 8.846   45.509  45.567  1.00 48.19  ? 135  LEU D O   1 
ATOM   8122  C CB  . LEU D  1 136 ? 11.653  45.393  44.268  1.00 49.81  ? 135  LEU D CB  1 
ATOM   8123  C CG  . LEU D  1 136 ? 11.488  44.086  43.473  1.00 62.84  ? 135  LEU D CG  1 
ATOM   8124  C CD1 . LEU D  1 136 ? 12.835  43.414  43.202  1.00 37.92  ? 135  LEU D CD1 1 
ATOM   8125  C CD2 . LEU D  1 136 ? 10.550  43.109  44.177  1.00 44.49  ? 135  LEU D CD2 1 
ATOM   8126  N N   . ILE D  1 137 ? 8.395   45.526  43.365  1.00 57.15  ? 136  ILE D N   1 
ATOM   8127  C CA  . ILE D  1 137 ? 7.188   44.717  43.473  1.00 58.78  ? 136  ILE D CA  1 
ATOM   8128  C C   . ILE D  1 137 ? 7.320   43.575  42.483  1.00 60.13  ? 136  ILE D C   1 
ATOM   8129  O O   . ILE D  1 137 ? 7.643   43.795  41.320  1.00 60.20  ? 136  ILE D O   1 
ATOM   8130  C CB  . ILE D  1 137 ? 5.915   45.525  43.172  1.00 64.11  ? 136  ILE D CB  1 
ATOM   8131  C CG1 . ILE D  1 137 ? 5.741   46.634  44.207  1.00 84.66  ? 136  ILE D CG1 1 
ATOM   8132  C CG2 . ILE D  1 137 ? 4.688   44.624  43.200  1.00 63.55  ? 136  ILE D CG2 1 
ATOM   8133  C CD1 . ILE D  1 137 ? 4.487   47.473  44.008  1.00 96.47  ? 136  ILE D CD1 1 
ATOM   8134  N N   . GLY D  1 138 ? 7.086   42.353  42.946  1.00 54.80  ? 137  GLY D N   1 
ATOM   8135  C CA  . GLY D  1 138 ? 7.277   41.180  42.107  1.00 54.08  ? 137  GLY D CA  1 
ATOM   8136  C C   . GLY D  1 138 ? 6.168   40.151  42.239  1.00 52.66  ? 137  GLY D C   1 
ATOM   8137  O O   . GLY D  1 138 ? 5.411   40.156  43.209  1.00 48.45  ? 137  GLY D O   1 
ATOM   8138  N N   . ALA D  1 139 ? 6.072   39.271  41.248  1.00 50.02  ? 138  ALA D N   1 
ATOM   8139  C CA  . ALA D  1 139 ? 5.099   38.188  41.270  1.00 48.99  ? 138  ALA D CA  1 
ATOM   8140  C C   . ALA D  1 139 ? 5.683   36.996  40.542  1.00 55.02  ? 138  ALA D C   1 
ATOM   8141  O O   . ALA D  1 139 ? 6.572   37.137  39.706  1.00 55.06  ? 138  ALA D O   1 
ATOM   8142  C CB  . ALA D  1 139 ? 3.798   38.617  40.624  1.00 50.82  ? 138  ALA D CB  1 
ATOM   8143  N N   . ASN D  1 140 ? 5.198   35.808  40.873  1.00 54.48  ? 139  ASN D N   1 
ATOM   8144  C CA  . ASN D  1 140 ? 5.658   34.604  40.197  1.00 45.57  ? 139  ASN D CA  1 
ATOM   8145  C C   . ASN D  1 140 ? 4.590   33.536  40.178  1.00 44.46  ? 139  ASN D C   1 
ATOM   8146  O O   . ASN D  1 140 ? 3.635   33.570  40.954  1.00 44.69  ? 139  ASN D O   1 
ATOM   8147  C CB  . ASN D  1 140 ? 6.923   34.064  40.859  1.00 46.11  ? 139  ASN D CB  1 
ATOM   8148  C CG  . ASN D  1 140 ? 6.766   33.905  42.353  1.00 60.83  ? 139  ASN D CG  1 
ATOM   8149  O OD1 . ASN D  1 140 ? 6.236   32.902  42.825  1.00 72.20  ? 139  ASN D OD1 1 
ATOM   8150  N ND2 . ASN D  1 140 ? 7.211   34.903  43.108  1.00 74.95  ? 139  ASN D ND2 1 
ATOM   8151  N N   . VAL D  1 141 ? 4.752   32.590  39.264  1.00 40.06  ? 140  VAL D N   1 
ATOM   8152  C CA  . VAL D  1 141 ? 3.861   31.451  39.190  1.00 43.97  ? 140  VAL D CA  1 
ATOM   8153  C C   . VAL D  1 141 ? 4.697   30.267  38.748  1.00 52.33  ? 140  VAL D C   1 
ATOM   8154  O O   . VAL D  1 141 ? 5.634   30.419  37.970  1.00 46.03  ? 140  VAL D O   1 
ATOM   8155  C CB  . VAL D  1 141 ? 2.691   31.703  38.219  1.00 48.55  ? 140  VAL D CB  1 
ATOM   8156  C CG1 . VAL D  1 141 ? 3.212   32.040  36.843  1.00 54.02  ? 140  VAL D CG1 1 
ATOM   8157  C CG2 . VAL D  1 141 ? 1.767   30.494  38.163  1.00 41.56  ? 140  VAL D CG2 1 
ATOM   8158  N N   . SER D  1 142 ? 4.392   29.090  39.276  1.00 43.00  ? 141  SER D N   1 
ATOM   8159  C CA  . SER D  1 142 ? 5.114   27.896  38.881  1.00 54.95  ? 141  SER D CA  1 
ATOM   8160  C C   . SER D  1 142 ? 4.193   26.680  38.850  1.00 54.82  ? 141  SER D C   1 
ATOM   8161  O O   . SER D  1 142 ? 3.282   26.541  39.661  1.00 52.59  ? 141  SER D O   1 
ATOM   8162  C CB  . SER D  1 142 ? 6.289   27.648  39.825  1.00 60.33  ? 141  SER D CB  1 
ATOM   8163  O OG  . SER D  1 142 ? 5.836   27.471  41.154  1.00 87.64  ? 141  SER D OG  1 
ATOM   8164  N N   . ILE D  1 143 ? 4.433   25.812  37.879  1.00 53.21  ? 142  ILE D N   1 
ATOM   8165  C CA  . ILE D  1 143 ? 3.702   24.572  37.762  1.00 51.59  ? 142  ILE D CA  1 
ATOM   8166  C C   . ILE D  1 143 ? 4.696   23.432  37.878  1.00 56.67  ? 142  ILE D C   1 
ATOM   8167  O O   . ILE D  1 143 ? 5.804   23.512  37.357  1.00 57.12  ? 142  ILE D O   1 
ATOM   8168  C CB  . ILE D  1 143 ? 2.977   24.480  36.424  1.00 58.07  ? 142  ILE D CB  1 
ATOM   8169  C CG1 . ILE D  1 143 ? 1.965   25.617  36.303  1.00 56.05  ? 142  ILE D CG1 1 
ATOM   8170  C CG2 . ILE D  1 143 ? 2.280   23.139  36.294  1.00 59.44  ? 142  ILE D CG2 1 
ATOM   8171  C CD1 . ILE D  1 143 ? 1.180   25.588  35.009  1.00 77.06  ? 142  ILE D CD1 1 
ATOM   8172  N N   . GLY D  1 144 ? 4.299   22.375  38.574  1.00 55.67  ? 143  GLY D N   1 
ATOM   8173  C CA  . GLY D  1 144 ? 5.155   21.222  38.767  1.00 52.76  ? 143  GLY D CA  1 
ATOM   8174  C C   . GLY D  1 144 ? 4.395   19.936  38.532  1.00 61.63  ? 143  GLY D C   1 
ATOM   8175  O O   . GLY D  1 144 ? 3.189   19.860  38.774  1.00 56.10  ? 143  GLY D O   1 
ATOM   8176  N N   . HIS D  1 145 ? 5.106   18.924  38.052  1.00 47.60  ? 144  HIS D N   1 
ATOM   8177  C CA  . HIS D  1 145 ? 4.541   17.598  37.882  1.00 46.61  ? 144  HIS D CA  1 
ATOM   8178  C C   . HIS D  1 145 ? 5.544   16.596  38.430  1.00 59.46  ? 144  HIS D C   1 
ATOM   8179  O O   . HIS D  1 145 ? 6.746   16.683  38.159  1.00 54.05  ? 144  HIS D O   1 
ATOM   8180  C CB  . HIS D  1 145 ? 4.267   17.309  36.405  1.00 64.06  ? 144  HIS D CB  1 
ATOM   8181  C CG  . HIS D  1 145 ? 3.377   18.319  35.749  1.00 82.72  ? 144  HIS D CG  1 
ATOM   8182  N ND1 . HIS D  1 145 ? 2.009   18.330  35.923  1.00 74.25  ? 144  HIS D ND1 1 
ATOM   8183  C CD2 . HIS D  1 145 ? 3.658   19.349  34.915  1.00 69.97  ? 144  HIS D CD2 1 
ATOM   8184  C CE1 . HIS D  1 145 ? 1.487   19.324  35.227  1.00 72.27  ? 144  HIS D CE1 1 
ATOM   8185  N NE2 . HIS D  1 145 ? 2.466   19.956  34.605  1.00 78.46  ? 144  HIS D NE2 1 
ATOM   8186  N N   . THR D  1 146 ? 5.051   15.641  39.201  1.00 45.99  ? 145  THR D N   1 
ATOM   8187  C CA  . THR D  1 146 ? 5.911   14.630  39.784  1.00 48.92  ? 145  THR D CA  1 
ATOM   8188  C C   . THR D  1 146 ? 5.336   13.251  39.506  1.00 52.32  ? 145  THR D C   1 
ATOM   8189  O O   . THR D  1 146 ? 4.123   13.039  39.541  1.00 53.30  ? 145  THR D O   1 
ATOM   8190  C CB  . THR D  1 146 ? 6.068   14.840  41.307  1.00 62.08  ? 145  THR D CB  1 
ATOM   8191  O OG1 . THR D  1 146 ? 6.729   16.088  41.548  1.00 64.50  ? 145  THR D OG1 1 
ATOM   8192  C CG2 . THR D  1 146 ? 6.888   13.725  41.929  1.00 58.02  ? 145  THR D CG2 1 
ATOM   8193  N N   . LEU D  1 147 ? 6.228   12.314  39.227  1.00 44.48  ? 146  LEU D N   1 
ATOM   8194  C CA  . LEU D  1 147 ? 5.850   10.947  38.949  1.00 47.42  ? 146  LEU D CA  1 
ATOM   8195  C C   . LEU D  1 147 ? 6.626   10.039  39.896  1.00 49.06  ? 146  LEU D C   1 
ATOM   8196  O O   . LEU D  1 147 ? 7.847   10.141  39.995  1.00 47.15  ? 146  LEU D O   1 
ATOM   8197  C CB  . LEU D  1 147 ? 6.198   10.622  37.502  1.00 46.45  ? 146  LEU D CB  1 
ATOM   8198  C CG  . LEU D  1 147 ? 6.045   9.165   37.080  1.00 59.33  ? 146  LEU D CG  1 
ATOM   8199  C CD1 . LEU D  1 147 ? 4.580   8.750   37.150  1.00 50.71  ? 146  LEU D CD1 1 
ATOM   8200  C CD2 . LEU D  1 147 ? 6.602   8.980   35.677  1.00 61.81  ? 146  LEU D CD2 1 
ATOM   8201  N N   . LYS D  1 148 ? 5.920   9.163   40.602  1.00 43.56  ? 147  LYS D N   1 
ATOM   8202  C CA  . LYS D  1 148 ? 6.560   8.249   41.545  1.00 47.10  ? 147  LYS D CA  1 
ATOM   8203  C C   . LYS D  1 148 ? 6.083   6.807   41.320  1.00 46.63  ? 147  LYS D C   1 
ATOM   8204  O O   . LYS D  1 148 ? 4.899   6.565   41.104  1.00 43.16  ? 147  LYS D O   1 
ATOM   8205  C CB  . LYS D  1 148 ? 6.250   8.693   42.975  1.00 44.63  ? 147  LYS D CB  1 
ATOM   8206  C CG  . LYS D  1 148 ? 6.789   7.759   44.042  1.00 73.84  ? 147  LYS D CG  1 
ATOM   8207  C CD  . LYS D  1 148 ? 6.166   8.041   45.404  1.00 84.33  ? 147  LYS D CD  1 
ATOM   8208  C CE  . LYS D  1 148 ? 6.499   9.438   45.899  1.00 92.62  ? 147  LYS D CE  1 
ATOM   8209  N NZ  . LYS D  1 148 ? 5.953   9.670   47.268  1.00 103.66 ? 147  LYS D NZ  1 
ATOM   8210  N N   . TYR D  1 149 ? 7.005   5.850   41.359  1.00 43.45  ? 148  TYR D N   1 
ATOM   8211  C CA  . TYR D  1 149 ? 6.634   4.442   41.258  1.00 42.50  ? 148  TYR D CA  1 
ATOM   8212  C C   . TYR D  1 149 ? 7.751   3.543   41.768  1.00 45.90  ? 148  TYR D C   1 
ATOM   8213  O O   . TYR D  1 149 ? 8.899   3.957   41.887  1.00 44.22  ? 148  TYR D O   1 
ATOM   8214  C CB  . TYR D  1 149 ? 6.284   4.075   39.816  1.00 47.44  ? 148  TYR D CB  1 
ATOM   8215  C CG  . TYR D  1 149 ? 7.366   4.467   38.844  1.00 51.82  ? 148  TYR D CG  1 
ATOM   8216  C CD1 . TYR D  1 149 ? 8.305   3.542   38.404  1.00 60.61  ? 148  TYR D CD1 1 
ATOM   8217  C CD2 . TYR D  1 149 ? 7.465   5.774   38.388  1.00 57.62  ? 148  TYR D CD2 1 
ATOM   8218  C CE1 . TYR D  1 149 ? 9.305   3.910   37.526  1.00 62.18  ? 148  TYR D CE1 1 
ATOM   8219  C CE2 . TYR D  1 149 ? 8.458   6.153   37.515  1.00 59.60  ? 148  TYR D CE2 1 
ATOM   8220  C CZ  . TYR D  1 149 ? 9.373   5.221   37.088  1.00 75.95  ? 148  TYR D CZ  1 
ATOM   8221  O OH  . TYR D  1 149 ? 10.355  5.614   36.218  1.00 80.53  ? 148  TYR D OH  1 
ATOM   8222  N N   . VAL D  1 150 ? 7.398   2.302   42.067  1.00 48.20  ? 149  VAL D N   1 
ATOM   8223  C CA  . VAL D  1 150 ? 8.344   1.341   42.607  1.00 49.82  ? 149  VAL D CA  1 
ATOM   8224  C C   . VAL D  1 150 ? 8.844   0.412   41.507  1.00 49.74  ? 149  VAL D C   1 
ATOM   8225  O O   . VAL D  1 150 ? 8.087   0.024   40.621  1.00 53.92  ? 149  VAL D O   1 
ATOM   8226  C CB  . VAL D  1 150 ? 7.682   0.495   43.709  1.00 56.15  ? 149  VAL D CB  1 
ATOM   8227  C CG1 . VAL D  1 150 ? 8.635   -0.587  44.195  1.00 64.67  ? 149  VAL D CG1 1 
ATOM   8228  C CG2 . VAL D  1 150 ? 7.238   1.383   44.856  1.00 54.56  ? 149  VAL D CG2 1 
ATOM   8229  N N   . GLN D  1 151 ? 10.126  0.065   41.576  1.00 44.68  ? 150  GLN D N   1 
ATOM   8230  C CA  . GLN D  1 151 ? 10.750  -0.804  40.587  1.00 50.44  ? 150  GLN D CA  1 
ATOM   8231  C C   . GLN D  1 151 ? 11.551  -1.904  41.263  1.00 49.47  ? 150  GLN D C   1 
ATOM   8232  O O   . GLN D  1 151 ? 12.558  -1.635  41.912  1.00 51.05  ? 150  GLN D O   1 
ATOM   8233  C CB  . GLN D  1 151 ? 11.686  -0.002  39.693  1.00 54.64  ? 150  GLN D CB  1 
ATOM   8234  C CG  . GLN D  1 151 ? 10.987  1.001   38.804  1.00 75.18  ? 150  GLN D CG  1 
ATOM   8235  C CD  . GLN D  1 151 ? 11.925  1.612   37.781  1.00 88.22  ? 150  GLN D CD  1 
ATOM   8236  O OE1 . GLN D  1 151 ? 11.862  1.285   36.595  1.00 90.27  ? 150  GLN D OE1 1 
ATOM   8237  N NE2 . GLN D  1 151 ? 12.803  2.505   38.235  1.00 72.95  ? 150  GLN D NE2 1 
ATOM   8238  N N   . PRO D  1 152 ? 11.114  -3.155  41.102  1.00 45.06  ? 151  PRO D N   1 
ATOM   8239  C CA  . PRO D  1 152 ? 11.895  -4.284  41.617  1.00 41.08  ? 151  PRO D CA  1 
ATOM   8240  C C   . PRO D  1 152 ? 13.138  -4.536  40.772  1.00 37.89  ? 151  PRO D C   1 
ATOM   8241  O O   . PRO D  1 152 ? 13.161  -4.156  39.603  1.00 45.44  ? 151  PRO D O   1 
ATOM   8242  C CB  . PRO D  1 152 ? 10.922  -5.452  41.490  1.00 41.62  ? 151  PRO D CB  1 
ATOM   8243  C CG  . PRO D  1 152 ? 10.076  -5.096  40.309  1.00 45.74  ? 151  PRO D CG  1 
ATOM   8244  C CD  . PRO D  1 152 ? 9.917   -3.597  40.366  1.00 46.74  ? 151  PRO D CD  1 
ATOM   8245  N N   . ASP D  1 153 ? 14.159  -5.154  41.358  1.00 34.94  ? 152  ASP D N   1 
ATOM   8246  C CA  . ASP D  1 153 ? 15.387  -5.470  40.633  1.00 39.62  ? 152  ASP D CA  1 
ATOM   8247  C C   . ASP D  1 153 ? 15.101  -6.483  39.530  1.00 45.68  ? 152  ASP D C   1 
ATOM   8248  O O   . ASP D  1 153 ? 15.696  -6.418  38.469  1.00 44.51  ? 152  ASP D O   1 
ATOM   8249  C CB  . ASP D  1 153 ? 16.442  -6.053  41.580  1.00 48.47  ? 152  ASP D CB  1 
ATOM   8250  C CG  . ASP D  1 153 ? 17.095  -5.001  42.460  1.00 60.47  ? 152  ASP D CG  1 
ATOM   8251  O OD1 . ASP D  1 153 ? 17.930  -5.376  43.319  1.00 64.22  ? 152  ASP D OD1 1 
ATOM   8252  O OD2 . ASP D  1 153 ? 16.782  -3.804  42.288  1.00 58.16  ? 152  ASP D OD2 1 
ATOM   8253  N N   . PHE D  1 154 ? 14.208  -7.433  39.814  1.00 40.12  ? 153  PHE D N   1 
ATOM   8254  C CA  . PHE D  1 154 ? 13.747  -8.413  38.833  1.00 39.70  ? 153  PHE D CA  1 
ATOM   8255  C C   . PHE D  1 154 ? 12.223  -8.400  38.798  1.00 39.26  ? 153  PHE D C   1 
ATOM   8256  O O   . PHE D  1 154 ? 11.581  -8.213  39.827  1.00 47.45  ? 153  PHE D O   1 
ATOM   8257  C CB  . PHE D  1 154 ? 14.214  -9.826  39.213  1.00 40.49  ? 153  PHE D CB  1 
ATOM   8258  C CG  . PHE D  1 154 ? 15.676  -10.101 38.929  1.00 38.94  ? 153  PHE D CG  1 
ATOM   8259  C CD1 . PHE D  1 154 ? 16.049  -10.909 37.867  1.00 41.74  ? 153  PHE D CD1 1 
ATOM   8260  C CD2 . PHE D  1 154 ? 16.669  -9.584  39.744  1.00 44.44  ? 153  PHE D CD2 1 
ATOM   8261  C CE1 . PHE D  1 154 ? 17.394  -11.190 37.620  1.00 39.70  ? 153  PHE D CE1 1 
ATOM   8262  C CE2 . PHE D  1 154 ? 18.007  -9.849  39.497  1.00 43.35  ? 153  PHE D CE2 1 
ATOM   8263  C CZ  . PHE D  1 154 ? 18.370  -10.656 38.441  1.00 38.76  ? 153  PHE D CZ  1 
ATOM   8264  N N   . LYS D  1 155 ? 11.647  -8.609  37.619  1.00 36.51  ? 154  LYS D N   1 
ATOM   8265  C CA  . LYS D  1 155 ? 10.202  -8.740  37.482  1.00 41.31  ? 154  LYS D CA  1 
ATOM   8266  C C   . LYS D  1 155 ? 9.819   -10.204 37.317  1.00 39.77  ? 154  LYS D C   1 
ATOM   8267  O O   . LYS D  1 155 ? 10.504  -10.957 36.631  1.00 42.13  ? 154  LYS D O   1 
ATOM   8268  C CB  . LYS D  1 155 ? 9.717   -7.954  36.271  1.00 34.30  ? 154  LYS D CB  1 
ATOM   8269  C CG  . LYS D  1 155 ? 9.956   -6.471  36.374  1.00 58.70  ? 154  LYS D CG  1 
ATOM   8270  C CD  . LYS D  1 155 ? 9.711   -5.769  35.048  1.00 63.10  ? 154  LYS D CD  1 
ATOM   8271  C CE  . LYS D  1 155 ? 8.272   -5.914  34.590  1.00 68.66  ? 154  LYS D CE  1 
ATOM   8272  N NZ  . LYS D  1 155 ? 8.000   -5.101  33.367  1.00 76.67  ? 154  LYS D NZ  1 
ATOM   8273  N N   . THR D  1 156 ? 8.726   -10.606 37.949  1.00 43.64  ? 155  THR D N   1 
ATOM   8274  C CA  . THR D  1 156 ? 8.215   -11.967 37.818  1.00 38.72  ? 155  THR D CA  1 
ATOM   8275  C C   . THR D  1 156 ? 7.038   -11.941 36.856  1.00 40.29  ? 155  THR D C   1 
ATOM   8276  O O   . THR D  1 156 ? 6.079   -11.202 37.055  1.00 46.95  ? 155  THR D O   1 
ATOM   8277  C CB  . THR D  1 156 ? 7.755   -12.539 39.181  1.00 43.96  ? 155  THR D CB  1 
ATOM   8278  O OG1 . THR D  1 156 ? 8.839   -12.482 40.118  1.00 52.81  ? 155  THR D OG1 1 
ATOM   8279  C CG2 . THR D  1 156 ? 7.285   -13.989 39.032  1.00 38.89  ? 155  THR D CG2 1 
ATOM   8280  N N   . ILE D  1 157 ? 7.111   -12.751 35.812  1.00 43.75  ? 156  ILE D N   1 
ATOM   8281  C CA  . ILE D  1 157 ? 6.134   -12.684 34.736  1.00 42.22  ? 156  ILE D CA  1 
ATOM   8282  C C   . ILE D  1 157 ? 5.597   -14.064 34.378  1.00 37.64  ? 156  ILE D C   1 
ATOM   8283  O O   . ILE D  1 157 ? 6.354   -15.019 34.226  1.00 40.60  ? 156  ILE D O   1 
ATOM   8284  C CB  . ILE D  1 157 ? 6.760   -12.056 33.473  1.00 43.02  ? 156  ILE D CB  1 
ATOM   8285  C CG1 . ILE D  1 157 ? 7.180   -10.615 33.767  1.00 43.55  ? 156  ILE D CG1 1 
ATOM   8286  C CG2 . ILE D  1 157 ? 5.770   -12.096 32.310  1.00 38.28  ? 156  ILE D CG2 1 
ATOM   8287  C CD1 . ILE D  1 157 ? 7.909   -9.947  32.612  1.00 46.52  ? 156  ILE D CD1 1 
ATOM   8288  N N   . LEU D  1 158 ? 4.281   -14.159 34.257  1.00 41.61  ? 157  LEU D N   1 
ATOM   8289  C CA  . LEU D  1 158 ? 3.642   -15.365 33.754  1.00 37.83  ? 157  LEU D CA  1 
ATOM   8290  C C   . LEU D  1 158 ? 3.585   -15.273 32.238  1.00 42.47  ? 157  LEU D C   1 
ATOM   8291  O O   . LEU D  1 158 ? 2.968   -14.359 31.685  1.00 42.28  ? 157  LEU D O   1 
ATOM   8292  C CB  . LEU D  1 158 ? 2.219   -15.492 34.302  1.00 32.20  ? 157  LEU D CB  1 
ATOM   8293  C CG  . LEU D  1 158 ? 1.379   -16.624 33.695  1.00 35.78  ? 157  LEU D CG  1 
ATOM   8294  C CD1 . LEU D  1 158 ? 1.848   -17.977 34.193  1.00 31.89  ? 157  LEU D CD1 1 
ATOM   8295  C CD2 . LEU D  1 158 ? -0.071  -16.433 34.012  1.00 32.79  ? 157  LEU D CD2 1 
ATOM   8296  N N   . GLU D  1 159 ? 4.235   -16.212 31.566  1.00 45.13  ? 158  GLU D N   1 
ATOM   8297  C CA  . GLU D  1 159 ? 4.205   -16.263 30.110  1.00 52.40  ? 158  GLU D CA  1 
ATOM   8298  C C   . GLU D  1 159 ? 2.838   -16.741 29.635  1.00 48.32  ? 158  GLU D C   1 
ATOM   8299  O O   . GLU D  1 159 ? 2.161   -17.484 30.335  1.00 62.52  ? 158  GLU D O   1 
ATOM   8300  C CB  . GLU D  1 159 ? 5.293   -17.198 29.597  1.00 46.20  ? 158  GLU D CB  1 
ATOM   8301  C CG  . GLU D  1 159 ? 6.673   -16.886 30.155  1.00 61.97  ? 158  GLU D CG  1 
ATOM   8302  C CD  . GLU D  1 159 ? 7.679   -16.530 29.071  1.00 83.92  ? 158  GLU D CD  1 
ATOM   8303  O OE1 . GLU D  1 159 ? 8.815   -17.055 29.121  1.00 71.20  ? 158  GLU D OE1 1 
ATOM   8304  O OE2 . GLU D  1 159 ? 7.335   -15.727 28.173  1.00 87.42  ? 158  GLU D OE2 1 
ATOM   8305  N N   . SER D  1 160 ? 2.432   -16.297 28.453  1.00 48.25  ? 159  SER D N   1 
ATOM   8306  C CA  . SER D  1 160 ? 1.143   -16.665 27.883  1.00 47.31  ? 159  SER D CA  1 
ATOM   8307  C C   . SER D  1 160 ? 0.963   -18.185 27.896  1.00 45.93  ? 159  SER D C   1 
ATOM   8308  O O   . SER D  1 160 ? 1.637   -18.904 27.162  1.00 45.51  ? 159  SER D O   1 
ATOM   8309  C CB  . SER D  1 160 ? 1.043   -16.146 26.448  1.00 50.67  ? 159  SER D CB  1 
ATOM   8310  O OG  . SER D  1 160 ? 1.329   -14.759 26.391  1.00 61.95  ? 159  SER D OG  1 
ATOM   8311  N N   . PRO D  1 161 ? 0.060   -18.684 28.750  1.00 50.89  ? 160  PRO D N   1 
ATOM   8312  C CA  . PRO D  1 161 ? -0.136  -20.133 28.872  1.00 48.21  ? 160  PRO D CA  1 
ATOM   8313  C C   . PRO D  1 161 ? -1.142  -20.687 27.867  1.00 42.29  ? 160  PRO D C   1 
ATOM   8314  O O   . PRO D  1 161 ? -1.978  -19.960 27.347  1.00 45.07  ? 160  PRO D O   1 
ATOM   8315  C CB  . PRO D  1 161 ? -0.673  -20.281 30.294  1.00 50.26  ? 160  PRO D CB  1 
ATOM   8316  C CG  . PRO D  1 161 ? -1.433  -19.019 30.523  1.00 47.16  ? 160  PRO D CG  1 
ATOM   8317  C CD  . PRO D  1 161 ? -0.703  -17.939 29.764  1.00 42.87  ? 160  PRO D CD  1 
ATOM   8318  N N   . THR D  1 162 ? -1.040  -21.980 27.596  1.00 37.25  ? 161  THR D N   1 
ATOM   8319  C CA  . THR D  1 162 ? -2.040  -22.692 26.818  1.00 42.03  ? 161  THR D CA  1 
ATOM   8320  C C   . THR D  1 162 ? -2.556  -23.793 27.726  1.00 47.28  ? 161  THR D C   1 
ATOM   8321  O O   . THR D  1 162 ? -2.180  -23.847 28.892  1.00 44.43  ? 161  THR D O   1 
ATOM   8322  C CB  . THR D  1 162 ? -1.435  -23.328 25.541  1.00 35.87  ? 161  THR D CB  1 
ATOM   8323  O OG1 . THR D  1 162 ? -0.626  -24.453 25.901  1.00 43.67  ? 161  THR D OG1 1 
ATOM   8324  C CG2 . THR D  1 162 ? -0.578  -22.312 24.765  1.00 32.61  ? 161  THR D CG2 1 
ATOM   8325  N N   . ASP D  1 163 ? -3.392  -24.683 27.201  1.00 44.98  ? 162  ASP D N   1 
ATOM   8326  C CA  . ASP D  1 163 ? -3.879  -25.796 28.004  1.00 44.16  ? 162  ASP D CA  1 
ATOM   8327  C C   . ASP D  1 163 ? -2.867  -26.930 28.030  1.00 46.02  ? 162  ASP D C   1 
ATOM   8328  O O   . ASP D  1 163 ? -3.118  -27.975 28.624  1.00 47.79  ? 162  ASP D O   1 
ATOM   8329  C CB  . ASP D  1 163 ? -5.235  -26.295 27.500  1.00 47.80  ? 162  ASP D CB  1 
ATOM   8330  C CG  . ASP D  1 163 ? -5.165  -26.907 26.113  1.00 67.97  ? 162  ASP D CG  1 
ATOM   8331  O OD1 . ASP D  1 163 ? -4.191  -26.630 25.370  1.00 72.39  ? 162  ASP D OD1 1 
ATOM   8332  O OD2 . ASP D  1 163 ? -6.101  -27.665 25.765  1.00 67.92  ? 162  ASP D OD2 1 
ATOM   8333  N N   . LYS D  1 164 ? -1.711  -26.722 27.406  1.00 38.03  ? 163  LYS D N   1 
ATOM   8334  C CA  . LYS D  1 164 ? -0.680  -27.752 27.406  1.00 39.75  ? 163  LYS D CA  1 
ATOM   8335  C C   . LYS D  1 164 ? 0.677   -27.241 27.894  1.00 33.65  ? 163  LYS D C   1 
ATOM   8336  O O   . LYS D  1 164 ? 1.573   -28.032 28.209  1.00 45.70  ? 163  LYS D O   1 
ATOM   8337  C CB  . LYS D  1 164 ? -0.547  -28.385 26.008  1.00 38.83  ? 163  LYS D CB  1 
ATOM   8338  C CG  . LYS D  1 164 ? -1.792  -29.140 25.551  1.00 41.45  ? 163  LYS D CG  1 
ATOM   8339  C CD  . LYS D  1 164 ? -2.125  -30.299 26.493  1.00 48.65  ? 163  LYS D CD  1 
ATOM   8340  C CE  . LYS D  1 164 ? -3.521  -30.860 26.237  1.00 49.15  ? 163  LYS D CE  1 
ATOM   8341  N NZ  . LYS D  1 164 ? -3.648  -31.447 24.877  1.00 69.37  ? 163  LYS D NZ  1 
ATOM   8342  N N   . LYS D  1 165 ? 0.836   -25.929 27.958  1.00 38.63  ? 164  LYS D N   1 
ATOM   8343  C CA  . LYS D  1 165 ? 2.130   -25.340 28.288  1.00 47.50  ? 164  LYS D CA  1 
ATOM   8344  C C   . LYS D  1 165 ? 1.951   -24.132 29.182  1.00 40.02  ? 164  LYS D C   1 
ATOM   8345  O O   . LYS D  1 165 ? 1.070   -23.318 28.957  1.00 41.06  ? 164  LYS D O   1 
ATOM   8346  C CB  . LYS D  1 165 ? 2.856   -24.903 27.012  1.00 38.66  ? 164  LYS D CB  1 
ATOM   8347  C CG  . LYS D  1 165 ? 3.225   -26.051 26.083  1.00 79.80  ? 164  LYS D CG  1 
ATOM   8348  C CD  . LYS D  1 165 ? 3.660   -25.558 24.707  1.00 87.05  ? 164  LYS D CD  1 
ATOM   8349  C CE  . LYS D  1 165 ? 4.845   -24.612 24.797  1.00 101.51 ? 164  LYS D CE  1 
ATOM   8350  N NZ  . LYS D  1 165 ? 5.269   -24.119 23.452  1.00 116.75 ? 164  LYS D NZ  1 
ATOM   8351  N N   . VAL D  1 166 ? 2.799   -24.011 30.192  1.00 36.85  ? 165  VAL D N   1 
ATOM   8352  C CA  . VAL D  1 166 ? 2.808   -22.822 31.023  1.00 38.33  ? 165  VAL D CA  1 
ATOM   8353  C C   . VAL D  1 166 ? 4.236   -22.544 31.450  1.00 37.02  ? 165  VAL D C   1 
ATOM   8354  O O   . VAL D  1 166 ? 5.051   -23.457 31.545  1.00 42.43  ? 165  VAL D O   1 
ATOM   8355  C CB  . VAL D  1 166 ? 1.903   -23.005 32.264  1.00 42.85  ? 165  VAL D CB  1 
ATOM   8356  C CG1 . VAL D  1 166 ? 2.407   -24.142 33.137  1.00 32.25  ? 165  VAL D CG1 1 
ATOM   8357  C CG2 . VAL D  1 166 ? 1.828   -21.719 33.045  1.00 37.02  ? 165  VAL D CG2 1 
ATOM   8358  N N   . GLY D  1 167 ? 4.554   -21.283 31.699  1.00 39.84  ? 166  GLY D N   1 
ATOM   8359  C CA  . GLY D  1 167 ? 5.880   -20.949 32.176  1.00 33.97  ? 166  GLY D CA  1 
ATOM   8360  C C   . GLY D  1 167 ? 5.944   -19.589 32.819  1.00 37.02  ? 166  GLY D C   1 
ATOM   8361  O O   . GLY D  1 167 ? 5.064   -18.756 32.623  1.00 36.01  ? 166  GLY D O   1 
ATOM   8362  N N   . TRP D  1 168 ? 6.997   -19.370 33.593  1.00 31.57  ? 167  TRP D N   1 
ATOM   8363  C CA  . TRP D  1 168 ? 7.259   -18.067 34.183  1.00 41.36  ? 167  TRP D CA  1 
ATOM   8364  C C   . TRP D  1 168 ? 8.662   -17.619 33.802  1.00 36.57  ? 167  TRP D C   1 
ATOM   8365  O O   . TRP D  1 168 ? 9.540   -18.443 33.536  1.00 36.84  ? 167  TRP D O   1 
ATOM   8366  C CB  . TRP D  1 168 ? 7.158   -18.140 35.713  1.00 31.40  ? 167  TRP D CB  1 
ATOM   8367  C CG  . TRP D  1 168 ? 5.789   -18.423 36.236  1.00 37.36  ? 167  TRP D CG  1 
ATOM   8368  C CD1 . TRP D  1 168 ? 4.890   -17.512 36.707  1.00 33.96  ? 167  TRP D CD1 1 
ATOM   8369  C CD2 . TRP D  1 168 ? 5.159   -19.710 36.355  1.00 29.42  ? 167  TRP D CD2 1 
ATOM   8370  N NE1 . TRP D  1 168 ? 3.737   -18.147 37.107  1.00 41.66  ? 167  TRP D NE1 1 
ATOM   8371  C CE2 . TRP D  1 168 ? 3.876   -19.496 36.902  1.00 38.31  ? 167  TRP D CE2 1 
ATOM   8372  C CE3 . TRP D  1 168 ? 5.558   -21.017 36.054  1.00 31.21  ? 167  TRP D CE3 1 
ATOM   8373  C CZ2 . TRP D  1 168 ? 2.984   -20.542 37.152  1.00 33.38  ? 167  TRP D CZ2 1 
ATOM   8374  C CZ3 . TRP D  1 168 ? 4.674   -22.059 36.299  1.00 33.15  ? 167  TRP D CZ3 1 
ATOM   8375  C CH2 . TRP D  1 168 ? 3.397   -21.817 36.844  1.00 33.72  ? 167  TRP D CH2 1 
ATOM   8376  N N   . LYS D  1 169 ? 8.887   -16.311 33.797  1.00 39.05  ? 168  LYS D N   1 
ATOM   8377  C CA  . LYS D  1 169 ? 10.239  -15.805 33.678  1.00 35.21  ? 168  LYS D CA  1 
ATOM   8378  C C   . LYS D  1 169 ? 10.447  -14.702 34.697  1.00 39.22  ? 168  LYS D C   1 
ATOM   8379  O O   . LYS D  1 169 ? 9.599   -13.822 34.885  1.00 37.23  ? 168  LYS D O   1 
ATOM   8380  C CB  . LYS D  1 169 ? 10.524  -15.322 32.252  1.00 36.99  ? 168  LYS D CB  1 
ATOM   8381  C CG  . LYS D  1 169 ? 9.576   -14.257 31.756  1.00 44.56  ? 168  LYS D CG  1 
ATOM   8382  C CD  . LYS D  1 169 ? 9.905   -13.841 30.326  1.00 48.39  ? 168  LYS D CD  1 
ATOM   8383  C CE  . LYS D  1 169 ? 8.926   -12.792 29.817  1.00 40.48  ? 168  LYS D CE  1 
ATOM   8384  N NZ  . LYS D  1 169 ? 9.276   -12.332 28.436  1.00 71.77  ? 168  LYS D NZ  1 
ATOM   8385  N N   . VAL D  1 170 ? 11.575  -14.780 35.382  1.00 37.26  ? 169  VAL D N   1 
ATOM   8386  C CA  . VAL D  1 170 ? 11.994  -13.735 36.290  1.00 41.12  ? 169  VAL D CA  1 
ATOM   8387  C C   . VAL D  1 170 ? 13.150  -13.010 35.606  1.00 45.79  ? 169  VAL D C   1 
ATOM   8388  O O   . VAL D  1 170 ? 14.245  -13.572 35.477  1.00 40.40  ? 169  VAL D O   1 
ATOM   8389  C CB  . VAL D  1 170 ? 12.420  -14.343 37.632  1.00 37.99  ? 169  VAL D CB  1 
ATOM   8390  C CG1 . VAL D  1 170 ? 12.922  -13.274 38.584  1.00 34.90  ? 169  VAL D CG1 1 
ATOM   8391  C CG2 . VAL D  1 170 ? 11.247  -15.103 38.246  1.00 37.56  ? 169  VAL D CG2 1 
ATOM   8392  N N   . ILE D  1 171 ? 12.900  -11.780 35.149  1.00 36.12  ? 170  ILE D N   1 
ATOM   8393  C CA  . ILE D  1 171 ? 13.862  -11.074 34.298  1.00 43.72  ? 170  ILE D CA  1 
ATOM   8394  C C   . ILE D  1 171 ? 14.463  -9.855  34.966  1.00 46.99  ? 170  ILE D C   1 
ATOM   8395  O O   . ILE D  1 171 ? 13.769  -9.108  35.661  1.00 47.39  ? 170  ILE D O   1 
ATOM   8396  C CB  . ILE D  1 171 ? 13.213  -10.604 32.982  1.00 44.79  ? 170  ILE D CB  1 
ATOM   8397  C CG1 . ILE D  1 171 ? 12.087  -9.613  33.279  1.00 46.72  ? 170  ILE D CG1 1 
ATOM   8398  C CG2 . ILE D  1 171 ? 12.690  -11.797 32.185  1.00 45.93  ? 170  ILE D CG2 1 
ATOM   8399  C CD1 . ILE D  1 171 ? 11.422  -9.075  32.047  1.00 55.60  ? 170  ILE D CD1 1 
ATOM   8400  N N   . PHE D  1 172 ? 15.756  -9.641  34.733  1.00 43.48  ? 171  PHE D N   1 
ATOM   8401  C CA  . PHE D  1 172 ? 16.432  -8.466  35.264  1.00 37.64  ? 171  PHE D CA  1 
ATOM   8402  C C   . PHE D  1 172 ? 15.738  -7.216  34.765  1.00 39.94  ? 171  PHE D C   1 
ATOM   8403  O O   . PHE D  1 172 ? 15.404  -7.111  33.592  1.00 43.63  ? 171  PHE D O   1 
ATOM   8404  C CB  . PHE D  1 172 ? 17.897  -8.440  34.856  1.00 40.96  ? 171  PHE D CB  1 
ATOM   8405  C CG  . PHE D  1 172 ? 18.646  -7.255  35.389  1.00 37.23  ? 171  PHE D CG  1 
ATOM   8406  C CD1 . PHE D  1 172 ? 19.233  -7.296  36.643  1.00 41.66  ? 171  PHE D CD1 1 
ATOM   8407  C CD2 . PHE D  1 172 ? 18.760  -6.104  34.642  1.00 41.12  ? 171  PHE D CD2 1 
ATOM   8408  C CE1 . PHE D  1 172 ? 19.920  -6.204  37.139  1.00 40.07  ? 171  PHE D CE1 1 
ATOM   8409  C CE2 . PHE D  1 172 ? 19.451  -5.008  35.124  1.00 45.20  ? 171  PHE D CE2 1 
ATOM   8410  C CZ  . PHE D  1 172 ? 20.033  -5.058  36.371  1.00 40.15  ? 171  PHE D CZ  1 
ATOM   8411  N N   . ASN D  1 173 ? 15.505  -6.279  35.674  1.00 32.72  ? 172  ASN D N   1 
ATOM   8412  C CA  . ASN D  1 173 ? 14.803  -5.057  35.351  1.00 40.89  ? 172  ASN D CA  1 
ATOM   8413  C C   . ASN D  1 173 ? 15.801  -3.897  35.365  1.00 45.32  ? 172  ASN D C   1 
ATOM   8414  O O   . ASN D  1 173 ? 16.225  -3.423  34.319  1.00 44.49  ? 172  ASN D O   1 
ATOM   8415  C CB  . ASN D  1 173 ? 13.670  -4.831  36.354  1.00 43.58  ? 172  ASN D CB  1 
ATOM   8416  C CG  . ASN D  1 173 ? 12.782  -3.651  35.983  1.00 47.12  ? 172  ASN D CG  1 
ATOM   8417  O OD1 . ASN D  1 173 ? 12.599  -3.346  34.806  1.00 48.53  ? 172  ASN D OD1 1 
ATOM   8418  N ND2 . ASN D  1 173 ? 12.222  -2.989  36.990  1.00 50.31  ? 172  ASN D ND2 1 
ATOM   8419  N N   . ASN D  1 174 ? 16.182  -3.456  36.558  1.00 37.31  ? 173  ASN D N   1 
ATOM   8420  C CA  . ASN D  1 174 ? 17.280  -2.511  36.714  1.00 53.15  ? 173  ASN D CA  1 
ATOM   8421  C C   . ASN D  1 174 ? 17.816  -2.588  38.133  1.00 45.37  ? 173  ASN D C   1 
ATOM   8422  O O   . ASN D  1 174 ? 17.205  -3.207  38.996  1.00 44.17  ? 173  ASN D O   1 
ATOM   8423  C CB  . ASN D  1 174 ? 16.845  -1.080  36.374  1.00 43.22  ? 173  ASN D CB  1 
ATOM   8424  C CG  . ASN D  1 174 ? 15.693  -0.603  37.229  1.00 49.67  ? 173  ASN D CG  1 
ATOM   8425  O OD1 . ASN D  1 174 ? 15.632  -0.885  38.422  1.00 53.46  ? 173  ASN D OD1 1 
ATOM   8426  N ND2 . ASN D  1 174 ? 14.765  0.113   36.618  1.00 48.14  ? 173  ASN D ND2 1 
ATOM   8427  N N   . MET D  1 175 ? 18.959  -1.962  38.373  1.00 38.45  ? 174  MET D N   1 
ATOM   8428  C CA  . MET D  1 175 ? 19.628  -2.113  39.650  1.00 41.26  ? 174  MET D CA  1 
ATOM   8429  C C   . MET D  1 175 ? 20.429  -0.872  40.029  1.00 54.16  ? 174  MET D C   1 
ATOM   8430  O O   . MET D  1 175 ? 21.021  -0.206  39.178  1.00 45.35  ? 174  MET D O   1 
ATOM   8431  C CB  . MET D  1 175 ? 20.567  -3.320  39.595  1.00 39.49  ? 174  MET D CB  1 
ATOM   8432  C CG  . MET D  1 175 ? 21.010  -3.811  40.965  1.00 46.17  ? 174  MET D CG  1 
ATOM   8433  S SD  . MET D  1 175 ? 22.272  -5.095  40.886  1.00 56.06  ? 174  MET D SD  1 
ATOM   8434  C CE  . MET D  1 175 ? 23.664  -4.168  40.243  1.00 50.14  ? 174  MET D CE  1 
ATOM   8435  N N   . VAL D  1 176 ? 20.455  -0.577  41.321  1.00 47.01  ? 175  VAL D N   1 
ATOM   8436  C CA  . VAL D  1 176 ? 21.293  0.486   41.836  1.00 48.05  ? 175  VAL D CA  1 
ATOM   8437  C C   . VAL D  1 176 ? 22.726  -0.010  41.989  1.00 56.40  ? 175  VAL D C   1 
ATOM   8438  O O   . VAL D  1 176 ? 22.982  -1.047  42.608  1.00 49.08  ? 175  VAL D O   1 
ATOM   8439  C CB  . VAL D  1 176 ? 20.800  0.974   43.198  1.00 54.04  ? 175  VAL D CB  1 
ATOM   8440  C CG1 . VAL D  1 176 ? 21.745  2.027   43.758  1.00 49.86  ? 175  VAL D CG1 1 
ATOM   8441  C CG2 . VAL D  1 176 ? 19.387  1.510   43.080  1.00 47.62  ? 175  VAL D CG2 1 
ATOM   8442  N N   . ASN D  1 177 ? 23.658  0.745   41.421  1.00 46.58  ? 176  ASN D N   1 
ATOM   8443  C CA  . ASN D  1 177 ? 25.077  0.468   41.560  1.00 41.03  ? 176  ASN D CA  1 
ATOM   8444  C C   . ASN D  1 177 ? 25.725  1.509   42.460  1.00 52.08  ? 176  ASN D C   1 
ATOM   8445  O O   . ASN D  1 177 ? 26.027  2.618   42.021  1.00 46.38  ? 176  ASN D O   1 
ATOM   8446  C CB  . ASN D  1 177 ? 25.744  0.491   40.182  1.00 46.59  ? 176  ASN D CB  1 
ATOM   8447  C CG  . ASN D  1 177 ? 27.245  0.294   40.252  1.00 49.83  ? 176  ASN D CG  1 
ATOM   8448  O OD1 . ASN D  1 177 ? 27.846  0.326   41.326  1.00 50.44  ? 176  ASN D OD1 1 
ATOM   8449  N ND2 . ASN D  1 177 ? 27.861  0.101   39.096  1.00 43.56  ? 176  ASN D ND2 1 
ATOM   8450  N N   . GLN D  1 178 ? 25.941  1.148   43.719  1.00 43.61  ? 177  GLN D N   1 
ATOM   8451  C CA  . GLN D  1 178 ? 26.589  2.043   44.675  1.00 57.85  ? 177  GLN D CA  1 
ATOM   8452  C C   . GLN D  1 178 ? 25.936  3.429   44.721  1.00 58.66  ? 177  GLN D C   1 
ATOM   8453  O O   . GLN D  1 178 ? 26.611  4.441   44.553  1.00 59.67  ? 177  GLN D O   1 
ATOM   8454  C CB  . GLN D  1 178 ? 28.072  2.186   44.323  1.00 49.72  ? 177  GLN D CB  1 
ATOM   8455  C CG  . GLN D  1 178 ? 28.844  0.879   44.389  1.00 57.02  ? 177  GLN D CG  1 
ATOM   8456  C CD  . GLN D  1 178 ? 30.293  1.030   43.976  1.00 63.10  ? 177  GLN D CD  1 
ATOM   8457  O OE1 . GLN D  1 178 ? 31.170  1.230   44.813  1.00 67.13  ? 177  GLN D OE1 1 
ATOM   8458  N NE2 . GLN D  1 178 ? 30.553  0.923   42.681  1.00 47.63  ? 177  GLN D NE2 1 
ATOM   8459  N N   . ASN D  1 179 ? 24.626  3.465   44.947  1.00 64.07  ? 178  ASN D N   1 
ATOM   8460  C CA  . ASN D  1 179 ? 23.879  4.722   45.063  1.00 76.81  ? 178  ASN D CA  1 
ATOM   8461  C C   . ASN D  1 179 ? 23.630  5.418   43.721  1.00 67.25  ? 178  ASN D C   1 
ATOM   8462  O O   . ASN D  1 179 ? 22.886  6.396   43.656  1.00 78.65  ? 178  ASN D O   1 
ATOM   8463  C CB  . ASN D  1 179 ? 24.579  5.702   46.018  1.00 84.55  ? 178  ASN D CB  1 
ATOM   8464  C CG  . ASN D  1 179 ? 24.994  5.057   47.334  1.00 93.37  ? 178  ASN D CG  1 
ATOM   8465  O OD1 . ASN D  1 179 ? 26.022  5.413   47.908  1.00 104.58 ? 178  ASN D OD1 1 
ATOM   8466  N ND2 . ASN D  1 179 ? 24.205  4.104   47.812  1.00 85.01  ? 178  ASN D ND2 1 
ATOM   8467  N N   . TRP D  1 180 ? 24.255  4.920   42.658  1.00 77.97  ? 179  TRP D N   1 
ATOM   8468  C CA  . TRP D  1 180 ? 24.081  5.487   41.319  1.00 77.66  ? 179  TRP D CA  1 
ATOM   8469  C C   . TRP D  1 180 ? 23.062  4.701   40.496  1.00 79.17  ? 179  TRP D C   1 
ATOM   8470  O O   . TRP D  1 180 ? 22.790  3.533   40.777  1.00 75.34  ? 179  TRP D O   1 
ATOM   8471  C CB  . TRP D  1 180 ? 25.415  5.502   40.574  1.00 79.53  ? 179  TRP D CB  1 
ATOM   8472  C CG  . TRP D  1 180 ? 26.376  6.528   41.076  1.00 105.82 ? 179  TRP D CG  1 
ATOM   8473  C CD1 . TRP D  1 180 ? 27.136  6.457   42.206  1.00 98.94  ? 179  TRP D CD1 1 
ATOM   8474  C CD2 . TRP D  1 180 ? 26.686  7.784   40.460  1.00 119.51 ? 179  TRP D CD2 1 
ATOM   8475  N NE1 . TRP D  1 180 ? 27.898  7.593   42.334  1.00 115.27 ? 179  TRP D NE1 1 
ATOM   8476  C CE2 . TRP D  1 180 ? 27.641  8.423   41.274  1.00 124.03 ? 179  TRP D CE2 1 
ATOM   8477  C CE3 . TRP D  1 180 ? 26.248  8.431   39.299  1.00 119.09 ? 179  TRP D CE3 1 
ATOM   8478  C CZ2 . TRP D  1 180 ? 28.166  9.679   40.965  1.00 119.55 ? 179  TRP D CZ2 1 
ATOM   8479  C CZ3 . TRP D  1 180 ? 26.771  9.676   38.994  1.00 118.21 ? 179  TRP D CZ3 1 
ATOM   8480  C CH2 . TRP D  1 180 ? 27.719  10.286  39.824  1.00 115.89 ? 179  TRP D CH2 1 
ATOM   8481  N N   . GLY D  1 181 ? 22.510  5.343   39.473  1.00 68.80  ? 180  GLY D N   1 
ATOM   8482  C CA  . GLY D  1 181 ? 21.599  4.675   38.561  1.00 57.22  ? 180  GLY D CA  1 
ATOM   8483  C C   . GLY D  1 181 ? 20.148  4.986   38.857  1.00 48.99  ? 180  GLY D C   1 
ATOM   8484  O O   . GLY D  1 181 ? 19.797  6.133   39.088  1.00 62.63  ? 180  GLY D O   1 
ATOM   8485  N N   . PRO D  1 182 ? 19.287  3.958   38.836  1.00 66.16  ? 181  PRO D N   1 
ATOM   8486  C CA  . PRO D  1 182 ? 19.673  2.573   38.541  1.00 62.00  ? 181  PRO D CA  1 
ATOM   8487  C C   . PRO D  1 182 ? 20.096  2.408   37.086  1.00 68.56  ? 181  PRO D C   1 
ATOM   8488  O O   . PRO D  1 182 ? 19.802  3.270   36.257  1.00 72.98  ? 181  PRO D O   1 
ATOM   8489  C CB  . PRO D  1 182 ? 18.390  1.782   38.819  1.00 65.97  ? 181  PRO D CB  1 
ATOM   8490  C CG  . PRO D  1 182 ? 17.285  2.764   38.608  1.00 67.62  ? 181  PRO D CG  1 
ATOM   8491  C CD  . PRO D  1 182 ? 17.834  4.099   39.037  1.00 66.83  ? 181  PRO D CD  1 
ATOM   8492  N N   . TYR D  1 183 ? 20.790  1.319   36.786  1.00 49.40  ? 182  TYR D N   1 
ATOM   8493  C CA  . TYR D  1 183 ? 21.168  1.012   35.419  1.00 49.73  ? 182  TYR D CA  1 
ATOM   8494  C C   . TYR D  1 183 ? 20.437  -0.241  34.961  1.00 54.40  ? 182  TYR D C   1 
ATOM   8495  O O   . TYR D  1 183 ? 19.989  -1.036  35.784  1.00 52.01  ? 182  TYR D O   1 
ATOM   8496  C CB  . TYR D  1 183 ? 22.679  0.808   35.327  1.00 50.36  ? 182  TYR D CB  1 
ATOM   8497  C CG  . TYR D  1 183 ? 23.469  2.021   35.756  1.00 55.93  ? 182  TYR D CG  1 
ATOM   8498  C CD1 . TYR D  1 183 ? 24.060  2.081   37.009  1.00 53.21  ? 182  TYR D CD1 1 
ATOM   8499  C CD2 . TYR D  1 183 ? 23.614  3.115   34.911  1.00 53.41  ? 182  TYR D CD2 1 
ATOM   8500  C CE1 . TYR D  1 183 ? 24.782  3.194   37.407  1.00 64.28  ? 182  TYR D CE1 1 
ATOM   8501  C CE2 . TYR D  1 183 ? 24.335  4.233   35.301  1.00 54.01  ? 182  TYR D CE2 1 
ATOM   8502  C CZ  . TYR D  1 183 ? 24.918  4.263   36.548  1.00 59.50  ? 182  TYR D CZ  1 
ATOM   8503  O OH  . TYR D  1 183 ? 25.635  5.367   36.942  1.00 70.24  ? 182  TYR D OH  1 
ATOM   8504  N N   . ASP D  1 184 ? 20.301  -0.406  33.650  1.00 55.76  ? 183  ASP D N   1 
ATOM   8505  C CA  . ASP D  1 184 ? 19.735  -1.630  33.103  1.00 55.78  ? 183  ASP D CA  1 
ATOM   8506  C C   . ASP D  1 184 ? 20.579  -2.128  31.930  1.00 55.33  ? 183  ASP D C   1 
ATOM   8507  O O   . ASP D  1 184 ? 21.691  -1.651  31.713  1.00 61.80  ? 183  ASP D O   1 
ATOM   8508  C CB  . ASP D  1 184 ? 18.271  -1.419  32.705  1.00 50.87  ? 183  ASP D CB  1 
ATOM   8509  C CG  . ASP D  1 184 ? 18.101  -0.392  31.613  1.00 69.26  ? 183  ASP D CG  1 
ATOM   8510  O OD1 . ASP D  1 184 ? 19.080  -0.126  30.883  1.00 73.16  ? 183  ASP D OD1 1 
ATOM   8511  O OD2 . ASP D  1 184 ? 16.976  0.139   31.478  1.00 73.22  ? 183  ASP D OD2 1 
ATOM   8512  N N   . ARG D  1 185 ? 20.054  -3.089  31.181  1.00 46.98  ? 184  ARG D N   1 
ATOM   8513  C CA  . ARG D  1 185 ? 20.830  -3.748  30.137  1.00 57.69  ? 184  ARG D CA  1 
ATOM   8514  C C   . ARG D  1 185 ? 21.098  -2.831  28.947  1.00 55.38  ? 184  ARG D C   1 
ATOM   8515  O O   . ARG D  1 185 ? 21.940  -3.139  28.106  1.00 60.45  ? 184  ARG D O   1 
ATOM   8516  C CB  . ARG D  1 185 ? 20.104  -5.004  29.654  1.00 45.65  ? 184  ARG D CB  1 
ATOM   8517  C CG  . ARG D  1 185 ? 19.733  -5.959  30.757  1.00 51.87  ? 184  ARG D CG  1 
ATOM   8518  C CD  . ARG D  1 185 ? 18.646  -6.899  30.293  1.00 49.04  ? 184  ARG D CD  1 
ATOM   8519  N NE  . ARG D  1 185 ? 19.196  -8.049  29.592  1.00 43.64  ? 184  ARG D NE  1 
ATOM   8520  C CZ  . ARG D  1 185 ? 18.533  -8.765  28.692  1.00 48.24  ? 184  ARG D CZ  1 
ATOM   8521  N NH1 . ARG D  1 185 ? 19.120  -9.807  28.121  1.00 38.35  ? 184  ARG D NH1 1 
ATOM   8522  N NH2 . ARG D  1 185 ? 17.288  -8.435  28.358  1.00 43.79  ? 184  ARG D NH2 1 
ATOM   8523  N N   . ASP D  1 186 ? 20.378  -1.714  28.883  1.00 58.47  ? 185  ASP D N   1 
ATOM   8524  C CA  . ASP D  1 186 ? 20.476  -0.785  27.757  1.00 66.15  ? 185  ASP D CA  1 
ATOM   8525  C C   . ASP D  1 186 ? 21.059  0.569   28.151  1.00 63.90  ? 185  ASP D C   1 
ATOM   8526  O O   . ASP D  1 186 ? 21.138  1.479   27.329  1.00 68.22  ? 185  ASP D O   1 
ATOM   8527  C CB  . ASP D  1 186 ? 19.093  -0.557  27.144  1.00 60.41  ? 185  ASP D CB  1 
ATOM   8528  C CG  . ASP D  1 186 ? 18.546  -1.794  26.473  1.00 86.13  ? 185  ASP D CG  1 
ATOM   8529  O OD1 . ASP D  1 186 ? 19.350  -2.545  25.881  1.00 82.30  ? 185  ASP D OD1 1 
ATOM   8530  O OD2 . ASP D  1 186 ? 17.315  -2.015  26.539  1.00 94.74  ? 185  ASP D OD2 1 
ATOM   8531  N N   . SER D  1 187 ? 21.453  0.714   29.407  1.00 54.02  ? 186  SER D N   1 
ATOM   8532  C CA  . SER D  1 187 ? 22.012  1.972   29.859  1.00 53.52  ? 186  SER D CA  1 
ATOM   8533  C C   . SER D  1 187 ? 23.237  2.309   29.022  1.00 60.86  ? 186  SER D C   1 
ATOM   8534  O O   . SER D  1 187 ? 24.084  1.452   28.770  1.00 60.99  ? 186  SER D O   1 
ATOM   8535  C CB  . SER D  1 187 ? 22.389  1.897   31.336  1.00 49.33  ? 186  SER D CB  1 
ATOM   8536  O OG  . SER D  1 187 ? 21.239  1.978   32.155  1.00 66.62  ? 186  SER D OG  1 
ATOM   8537  N N   . TRP D  1 188 ? 23.327  3.556   28.582  1.00 51.64  ? 187  TRP D N   1 
ATOM   8538  C CA  . TRP D  1 188 ? 24.487  3.979   27.813  1.00 67.50  ? 187  TRP D CA  1 
ATOM   8539  C C   . TRP D  1 188 ? 24.878  5.428   28.084  1.00 61.02  ? 187  TRP D C   1 
ATOM   8540  O O   . TRP D  1 188 ? 24.091  6.359   27.896  1.00 58.03  ? 187  TRP D O   1 
ATOM   8541  C CB  . TRP D  1 188 ? 24.253  3.772   26.317  1.00 54.55  ? 187  TRP D CB  1 
ATOM   8542  C CG  . TRP D  1 188 ? 25.498  3.987   25.522  1.00 76.37  ? 187  TRP D CG  1 
ATOM   8543  C CD1 . TRP D  1 188 ? 25.842  5.107   24.819  1.00 67.27  ? 187  TRP D CD1 1 
ATOM   8544  C CD2 . TRP D  1 188 ? 26.584  3.067   25.368  1.00 73.64  ? 187  TRP D CD2 1 
ATOM   8545  N NE1 . TRP D  1 188 ? 27.067  4.934   24.229  1.00 63.03  ? 187  TRP D NE1 1 
ATOM   8546  C CE2 . TRP D  1 188 ? 27.547  3.693   24.549  1.00 66.40  ? 187  TRP D CE2 1 
ATOM   8547  C CE3 . TRP D  1 188 ? 26.834  1.770   25.839  1.00 55.97  ? 187  TRP D CE3 1 
ATOM   8548  C CZ2 . TRP D  1 188 ? 28.742  3.069   24.186  1.00 66.42  ? 187  TRP D CZ2 1 
ATOM   8549  C CZ3 . TRP D  1 188 ? 28.022  1.150   25.479  1.00 63.29  ? 187  TRP D CZ3 1 
ATOM   8550  C CH2 . TRP D  1 188 ? 28.961  1.801   24.659  1.00 73.61  ? 187  TRP D CH2 1 
ATOM   8551  N N   . ASN D  1 189 ? 26.111  5.595   28.538  1.00 78.77  ? 188  ASN D N   1 
ATOM   8552  C CA  . ASN D  1 189 ? 26.715  6.904   28.704  1.00 77.51  ? 188  ASN D CA  1 
ATOM   8553  C C   . ASN D  1 189 ? 27.806  7.036   27.652  1.00 83.43  ? 188  ASN D C   1 
ATOM   8554  O O   . ASN D  1 189 ? 28.599  6.118   27.474  1.00 77.17  ? 188  ASN D O   1 
ATOM   8555  C CB  . ASN D  1 189 ? 27.305  7.022   30.107  1.00 77.72  ? 188  ASN D CB  1 
ATOM   8556  C CG  . ASN D  1 189 ? 27.982  8.349   30.344  1.00 85.90  ? 188  ASN D CG  1 
ATOM   8557  O OD1 . ASN D  1 189 ? 29.131  8.548   29.954  1.00 88.61  ? 188  ASN D OD1 1 
ATOM   8558  N ND2 . ASN D  1 189 ? 27.279  9.263   30.995  1.00 84.62  ? 188  ASN D ND2 1 
ATOM   8559  N N   . PRO D  1 190 ? 27.840  8.166   26.933  1.00 78.62  ? 189  PRO D N   1 
ATOM   8560  C CA  . PRO D  1 190 ? 28.783  8.312   25.817  1.00 75.02  ? 189  PRO D CA  1 
ATOM   8561  C C   . PRO D  1 190 ? 30.230  8.048   26.231  1.00 73.45  ? 189  PRO D C   1 
ATOM   8562  O O   . PRO D  1 190 ? 31.027  7.535   25.442  1.00 61.35  ? 189  PRO D O   1 
ATOM   8563  C CB  . PRO D  1 190 ? 28.597  9.772   25.387  1.00 82.27  ? 189  PRO D CB  1 
ATOM   8564  C CG  . PRO D  1 190 ? 27.917  10.442  26.546  1.00 86.89  ? 189  PRO D CG  1 
ATOM   8565  C CD  . PRO D  1 190 ? 27.067  9.394   27.171  1.00 80.11  ? 189  PRO D CD  1 
ATOM   8566  N N   . VAL D  1 191 ? 30.549  8.382   27.476  1.00 65.79  ? 190  VAL D N   1 
ATOM   8567  C CA  . VAL D  1 191 ? 31.909  8.259   27.982  1.00 69.00  ? 190  VAL D CA  1 
ATOM   8568  C C   . VAL D  1 191 ? 32.200  6.889   28.580  1.00 78.04  ? 190  VAL D C   1 
ATOM   8569  O O   . VAL D  1 191 ? 33.210  6.258   28.259  1.00 68.85  ? 190  VAL D O   1 
ATOM   8570  C CB  . VAL D  1 191 ? 32.172  9.291   29.092  1.00 80.16  ? 190  VAL D CB  1 
ATOM   8571  C CG1 . VAL D  1 191 ? 33.618  9.199   29.561  1.00 70.56  ? 190  VAL D CG1 1 
ATOM   8572  C CG2 . VAL D  1 191 ? 31.835  10.694  28.608  1.00 56.56  ? 190  VAL D CG2 1 
ATOM   8573  N N   . TYR D  1 192 ? 31.322  6.439   29.468  1.00 64.54  ? 191  TYR D N   1 
ATOM   8574  C CA  . TYR D  1 192 ? 31.603  5.246   30.250  1.00 67.20  ? 191  TYR D CA  1 
ATOM   8575  C C   . TYR D  1 192 ? 30.863  4.004   29.751  1.00 49.16  ? 191  TYR D C   1 
ATOM   8576  O O   . TYR D  1 192 ? 31.083  2.909   30.248  1.00 64.60  ? 191  TYR D O   1 
ATOM   8577  C CB  . TYR D  1 192 ? 31.250  5.503   31.706  1.00 59.81  ? 191  TYR D CB  1 
ATOM   8578  C CG  . TYR D  1 192 ? 32.060  6.598   32.345  1.00 67.79  ? 191  TYR D CG  1 
ATOM   8579  C CD1 . TYR D  1 192 ? 33.376  6.377   32.730  1.00 68.65  ? 191  TYR D CD1 1 
ATOM   8580  C CD2 . TYR D  1 192 ? 31.504  7.848   32.590  1.00 81.31  ? 191  TYR D CD2 1 
ATOM   8581  C CE1 . TYR D  1 192 ? 34.121  7.376   33.332  1.00 80.08  ? 191  TYR D CE1 1 
ATOM   8582  C CE2 . TYR D  1 192 ? 32.244  8.856   33.190  1.00 71.70  ? 191  TYR D CE2 1 
ATOM   8583  C CZ  . TYR D  1 192 ? 33.552  8.612   33.559  1.00 77.17  ? 191  TYR D CZ  1 
ATOM   8584  O OH  . TYR D  1 192 ? 34.299  9.601   34.156  1.00 76.10  ? 191  TYR D OH  1 
ATOM   8585  N N   . GLY D  1 193 ? 30.004  4.177   28.755  1.00 66.95  ? 192  GLY D N   1 
ATOM   8586  C CA  . GLY D  1 193 ? 29.195  3.087   28.244  1.00 61.44  ? 192  GLY D CA  1 
ATOM   8587  C C   . GLY D  1 193 ? 28.157  2.649   29.264  1.00 48.72  ? 192  GLY D C   1 
ATOM   8588  O O   . GLY D  1 193 ? 27.597  3.477   29.980  1.00 57.32  ? 192  GLY D O   1 
ATOM   8589  N N   . ASN D  1 194 ? 27.898  1.346   29.329  1.00 49.34  ? 193  ASN D N   1 
ATOM   8590  C CA  . ASN D  1 194 ? 27.008  0.786   30.338  1.00 47.85  ? 193  ASN D CA  1 
ATOM   8591  C C   . ASN D  1 194 ? 27.754  0.569   31.659  1.00 41.16  ? 193  ASN D C   1 
ATOM   8592  O O   . ASN D  1 194 ? 28.756  -0.142  31.714  1.00 46.67  ? 193  ASN D O   1 
ATOM   8593  C CB  . ASN D  1 194 ? 26.397  -0.531  29.842  1.00 58.97  ? 193  ASN D CB  1 
ATOM   8594  C CG  . ASN D  1 194 ? 25.197  -0.977  30.680  1.00 50.89  ? 193  ASN D CG  1 
ATOM   8595  O OD1 . ASN D  1 194 ? 25.198  -0.846  31.901  1.00 49.74  ? 193  ASN D OD1 1 
ATOM   8596  N ND2 . ASN D  1 194 ? 24.165  -1.484  30.017  1.00 45.51  ? 193  ASN D ND2 1 
ATOM   8597  N N   . GLN D  1 195 ? 27.249  1.177   32.727  1.00 39.47  ? 194  GLN D N   1 
ATOM   8598  C CA  . GLN D  1 195 ? 27.938  1.167   34.017  1.00 47.45  ? 194  GLN D CA  1 
ATOM   8599  C C   . GLN D  1 195 ? 27.313  0.177   35.016  1.00 54.64  ? 194  GLN D C   1 
ATOM   8600  O O   . GLN D  1 195 ? 27.677  0.156   36.188  1.00 50.11  ? 194  GLN D O   1 
ATOM   8601  C CB  . GLN D  1 195 ? 27.949  2.590   34.590  1.00 48.85  ? 194  GLN D CB  1 
ATOM   8602  C CG  . GLN D  1 195 ? 28.398  3.653   33.560  1.00 48.20  ? 194  GLN D CG  1 
ATOM   8603  C CD  . GLN D  1 195 ? 28.301  5.078   34.084  1.00 65.34  ? 194  GLN D CD  1 
ATOM   8604  O OE1 . GLN D  1 195 ? 29.080  5.487   34.939  1.00 64.47  ? 194  GLN D OE1 1 
ATOM   8605  N NE2 . GLN D  1 195 ? 27.340  5.841   33.567  1.00 60.94  ? 194  GLN D NE2 1 
ATOM   8606  N N   . LEU D  1 196 ? 26.392  -0.654  34.532  1.00 47.82  ? 195  LEU D N   1 
ATOM   8607  C CA  . LEU D  1 196 ? 25.667  -1.611  35.367  1.00 41.37  ? 195  LEU D CA  1 
ATOM   8608  C C   . LEU D  1 196 ? 26.537  -2.243  36.454  1.00 43.79  ? 195  LEU D C   1 
ATOM   8609  O O   . LEU D  1 196 ? 26.259  -2.089  37.629  1.00 43.21  ? 195  LEU D O   1 
ATOM   8610  C CB  . LEU D  1 196 ? 25.061  -2.721  34.499  1.00 49.64  ? 195  LEU D CB  1 
ATOM   8611  C CG  . LEU D  1 196 ? 23.652  -3.145  34.914  1.00 59.38  ? 195  LEU D CG  1 
ATOM   8612  C CD1 . LEU D  1 196 ? 23.206  -4.377  34.156  1.00 44.85  ? 195  LEU D CD1 1 
ATOM   8613  C CD2 . LEU D  1 196 ? 23.598  -3.388  36.409  1.00 52.58  ? 195  LEU D CD2 1 
ATOM   8614  N N   . PHE D  1 197 ? 27.587  -2.962  36.066  1.00 43.18  ? 196  PHE D N   1 
ATOM   8615  C CA  . PHE D  1 197 ? 28.428  -3.634  37.050  1.00 49.34  ? 196  PHE D CA  1 
ATOM   8616  C C   . PHE D  1 197 ? 29.839  -3.060  37.122  1.00 54.25  ? 196  PHE D C   1 
ATOM   8617  O O   . PHE D  1 197 ? 30.779  -3.752  37.515  1.00 49.12  ? 196  PHE D O   1 
ATOM   8618  C CB  . PHE D  1 197 ? 28.470  -5.139  36.773  1.00 56.60  ? 196  PHE D CB  1 
ATOM   8619  C CG  . PHE D  1 197 ? 27.114  -5.786  36.776  1.00 49.44  ? 196  PHE D CG  1 
ATOM   8620  C CD1 . PHE D  1 197 ? 26.629  -6.417  35.637  1.00 51.28  ? 196  PHE D CD1 1 
ATOM   8621  C CD2 . PHE D  1 197 ? 26.313  -5.737  37.907  1.00 48.47  ? 196  PHE D CD2 1 
ATOM   8622  C CE1 . PHE D  1 197 ? 25.378  -7.008  35.627  1.00 48.39  ? 196  PHE D CE1 1 
ATOM   8623  C CE2 . PHE D  1 197 ? 25.057  -6.324  37.907  1.00 49.77  ? 196  PHE D CE2 1 
ATOM   8624  C CZ  . PHE D  1 197 ? 24.590  -6.965  36.761  1.00 48.35  ? 196  PHE D CZ  1 
ATOM   8625  N N   . MET D  1 198 ? 29.970  -1.786  36.764  1.00 52.85  ? 197  MET D N   1 
ATOM   8626  C CA  . MET D  1 198 ? 31.248  -1.083  36.835  1.00 55.48  ? 197  MET D CA  1 
ATOM   8627  C C   . MET D  1 198 ? 31.546  -0.612  38.256  1.00 45.37  ? 197  MET D C   1 
ATOM   8628  O O   . MET D  1 198 ? 30.763  0.115   38.852  1.00 53.47  ? 197  MET D O   1 
ATOM   8629  C CB  . MET D  1 198 ? 31.240  0.122   35.900  1.00 50.87  ? 197  MET D CB  1 
ATOM   8630  C CG  . MET D  1 198 ? 32.567  0.862   35.858  1.00 73.83  ? 197  MET D CG  1 
ATOM   8631  S SD  . MET D  1 198 ? 32.552  2.304   34.775  1.00 58.12  ? 197  MET D SD  1 
ATOM   8632  C CE  . MET D  1 198 ? 32.156  1.571   33.191  1.00 46.98  ? 197  MET D CE  1 
ATOM   8633  N N   . LYS D  1 199 ? 32.694  -1.024  38.780  1.00 50.15  ? 198  LYS D N   1 
ATOM   8634  C CA  . LYS D  1 199 ? 33.072  -0.751  40.165  1.00 54.12  ? 198  LYS D CA  1 
ATOM   8635  C C   . LYS D  1 199 ? 33.591  0.681   40.341  1.00 63.49  ? 198  LYS D C   1 
ATOM   8636  O O   . LYS D  1 199 ? 33.165  1.399   41.246  1.00 68.54  ? 198  LYS D O   1 
ATOM   8637  C CB  . LYS D  1 199 ? 34.138  -1.766  40.599  1.00 59.77  ? 198  LYS D CB  1 
ATOM   8638  C CG  . LYS D  1 199 ? 34.639  -1.622  42.028  1.00 58.97  ? 198  LYS D CG  1 
ATOM   8639  C CD  . LYS D  1 199 ? 35.691  -2.687  42.326  1.00 59.43  ? 198  LYS D CD  1 
ATOM   8640  C CE  . LYS D  1 199 ? 36.309  -2.491  43.697  1.00 79.86  ? 198  LYS D CE  1 
ATOM   8641  N NZ  . LYS D  1 199 ? 37.365  -3.496  43.986  1.00 85.40  ? 198  LYS D NZ  1 
ATOM   8642  N N   . THR D  1 200 ? 34.509  1.090   39.470  1.00 53.03  ? 199  THR D N   1 
ATOM   8643  C CA  . THR D  1 200 ? 35.074  2.437   39.508  1.00 63.68  ? 199  THR D CA  1 
ATOM   8644  C C   . THR D  1 200 ? 35.230  2.966   38.092  1.00 65.17  ? 199  THR D C   1 
ATOM   8645  O O   . THR D  1 200 ? 35.508  2.207   37.161  1.00 64.35  ? 199  THR D O   1 
ATOM   8646  C CB  . THR D  1 200 ? 36.468  2.460   40.151  1.00 57.80  ? 199  THR D CB  1 
ATOM   8647  O OG1 . THR D  1 200 ? 37.416  1.881   39.245  1.00 48.00  ? 199  THR D OG1 1 
ATOM   8648  C CG2 . THR D  1 200 ? 36.480  1.699   41.474  1.00 56.98  ? 199  THR D CG2 1 
ATOM   8649  N N   . ARG D  1 201 ? 35.074  4.273   37.930  1.00 68.06  ? 200  ARG D N   1 
ATOM   8650  C CA  . ARG D  1 201 ? 35.131  4.872   36.604  1.00 71.77  ? 200  ARG D CA  1 
ATOM   8651  C C   . ARG D  1 201 ? 36.557  5.004   36.055  1.00 61.91  ? 200  ARG D C   1 
ATOM   8652  O O   . ARG D  1 201 ? 36.749  5.068   34.842  1.00 67.41  ? 200  ARG D O   1 
ATOM   8653  C CB  . ARG D  1 201 ? 34.413  6.218   36.608  1.00 59.06  ? 200  ARG D CB  1 
ATOM   8654  C CG  . ARG D  1 201 ? 32.907  6.079   36.534  1.00 63.03  ? 200  ARG D CG  1 
ATOM   8655  C CD  . ARG D  1 201 ? 32.185  7.402   36.755  1.00 76.65  ? 200  ARG D CD  1 
ATOM   8656  N NE  . ARG D  1 201 ? 30.741  7.263   36.568  1.00 76.93  ? 200  ARG D NE  1 
ATOM   8657  C CZ  . ARG D  1 201 ? 29.853  8.226   36.794  1.00 83.51  ? 200  ARG D CZ  1 
ATOM   8658  N NH1 . ARG D  1 201 ? 28.562  7.999   36.589  1.00 69.94  ? 200  ARG D NH1 1 
ATOM   8659  N NH2 . ARG D  1 201 ? 30.253  9.417   37.225  1.00 98.74  ? 200  ARG D NH2 1 
ATOM   8660  N N   . ASN D  1 202 ? 37.553  5.022   36.937  1.00 55.17  ? 201  ASN D N   1 
ATOM   8661  C CA  . ASN D  1 202 ? 38.951  5.088   36.504  1.00 77.29  ? 201  ASN D CA  1 
ATOM   8662  C C   . ASN D  1 202 ? 39.932  4.546   37.543  1.00 78.19  ? 201  ASN D C   1 
ATOM   8663  O O   . ASN D  1 202 ? 40.890  5.219   37.922  1.00 80.42  ? 201  ASN D O   1 
ATOM   8664  C CB  . ASN D  1 202 ? 39.334  6.525   36.126  1.00 79.73  ? 201  ASN D CB  1 
ATOM   8665  C CG  . ASN D  1 202 ? 38.781  7.553   37.092  1.00 84.83  ? 201  ASN D CG  1 
ATOM   8666  O OD1 . ASN D  1 202 ? 37.851  8.287   36.758  1.00 84.70  ? 201  ASN D OD1 1 
ATOM   8667  N ND2 . ASN D  1 202 ? 39.339  7.605   38.302  1.00 73.49  ? 201  ASN D ND2 1 
ATOM   8668  N N   . GLY D  1 203 ? 39.694  3.320   37.993  1.00 76.98  ? 202  GLY D N   1 
ATOM   8669  C CA  . GLY D  1 203 ? 40.589  2.669   38.930  1.00 72.34  ? 202  GLY D CA  1 
ATOM   8670  C C   . GLY D  1 203 ? 41.843  2.183   38.229  1.00 71.34  ? 202  GLY D C   1 
ATOM   8671  O O   . GLY D  1 203 ? 41.895  2.127   37.001  1.00 69.04  ? 202  GLY D O   1 
ATOM   8672  N N   . SER D  1 204 ? 42.856  1.826   39.009  1.00 70.60  ? 203  SER D N   1 
ATOM   8673  C CA  . SER D  1 204 ? 44.155  1.487   38.444  1.00 95.36  ? 203  SER D CA  1 
ATOM   8674  C C   . SER D  1 204 ? 44.328  -0.022  38.309  1.00 97.55  ? 203  SER D C   1 
ATOM   8675  O O   . SER D  1 204 ? 45.229  -0.492  37.613  1.00 105.85 ? 203  SER D O   1 
ATOM   8676  C CB  . SER D  1 204 ? 45.276  2.083   39.301  1.00 95.67  ? 203  SER D CB  1 
ATOM   8677  O OG  . SER D  1 204 ? 45.113  1.749   40.669  1.00 96.58  ? 203  SER D OG  1 
ATOM   8678  N N   . MET D  1 205 ? 43.456  -0.775  38.968  1.00 75.32  ? 204  MET D N   1 
ATOM   8679  C CA  . MET D  1 205 ? 43.539  -2.231  38.959  1.00 79.06  ? 204  MET D CA  1 
ATOM   8680  C C   . MET D  1 205 ? 43.198  -2.808  37.583  1.00 71.95  ? 204  MET D C   1 
ATOM   8681  O O   . MET D  1 205 ? 42.698  -2.098  36.707  1.00 55.43  ? 204  MET D O   1 
ATOM   8682  C CB  . MET D  1 205 ? 42.610  -2.830  40.029  1.00 93.96  ? 204  MET D CB  1 
ATOM   8683  C CG  . MET D  1 205 ? 41.105  -2.697  39.749  1.00 72.76  ? 204  MET D CG  1 
ATOM   8684  S SD  . MET D  1 205 ? 40.391  -1.076  40.130  1.00 84.29  ? 204  MET D SD  1 
ATOM   8685  C CE  . MET D  1 205 ? 39.723  -0.638  38.530  1.00 70.35  ? 204  MET D CE  1 
ATOM   8686  N N   . LYS D  1 206 ? 43.481  -4.099  37.407  1.00 78.85  ? 205  LYS D N   1 
ATOM   8687  C CA  . LYS D  1 206 ? 43.150  -4.818  36.175  1.00 66.31  ? 205  LYS D CA  1 
ATOM   8688  C C   . LYS D  1 206 ? 41.648  -4.781  35.928  1.00 70.95  ? 205  LYS D C   1 
ATOM   8689  O O   . LYS D  1 206 ? 40.861  -4.510  36.839  1.00 73.54  ? 205  LYS D O   1 
ATOM   8690  C CB  . LYS D  1 206 ? 43.596  -6.288  36.234  1.00 69.90  ? 205  LYS D CB  1 
ATOM   8691  C CG  . LYS D  1 206 ? 44.408  -6.689  37.460  1.00 82.86  ? 205  LYS D CG  1 
ATOM   8692  C CD  . LYS D  1 206 ? 44.306  -8.184  37.731  1.00 89.12  ? 205  LYS D CD  1 
ATOM   8693  C CE  . LYS D  1 206 ? 44.779  -9.006  36.550  1.00 100.44 ? 205  LYS D CE  1 
ATOM   8694  N NZ  . LYS D  1 206 ? 46.224  -8.788  36.273  1.00 123.43 ? 205  LYS D NZ  1 
ATOM   8695  N N   . ALA D  1 207 ? 41.258  -5.071  34.693  1.00 56.76  ? 206  ALA D N   1 
ATOM   8696  C CA  . ALA D  1 207 ? 39.858  -5.048  34.298  1.00 58.21  ? 206  ALA D CA  1 
ATOM   8697  C C   . ALA D  1 207 ? 39.092  -6.089  35.090  1.00 60.78  ? 206  ALA D C   1 
ATOM   8698  O O   . ALA D  1 207 ? 37.947  -5.876  35.488  1.00 65.75  ? 206  ALA D O   1 
ATOM   8699  C CB  . ALA D  1 207 ? 39.729  -5.323  32.803  1.00 43.39  ? 206  ALA D CB  1 
ATOM   8700  N N   . ALA D  1 208 ? 39.746  -7.216  35.325  1.00 59.56  ? 207  ALA D N   1 
ATOM   8701  C CA  . ALA D  1 208 ? 39.126  -8.336  36.006  1.00 67.88  ? 207  ALA D CA  1 
ATOM   8702  C C   . ALA D  1 208 ? 38.817  -8.005  37.460  1.00 65.66  ? 207  ALA D C   1 
ATOM   8703  O O   . ALA D  1 208 ? 38.110  -8.752  38.131  1.00 70.14  ? 207  ALA D O   1 
ATOM   8704  C CB  . ALA D  1 208 ? 40.030  -9.547  35.926  1.00 58.56  ? 207  ALA D CB  1 
ATOM   8705  N N   . GLU D  1 209 ? 39.350  -6.889  37.945  1.00 72.01  ? 208  GLU D N   1 
ATOM   8706  C CA  . GLU D  1 209 ? 39.140  -6.488  39.330  1.00 58.66  ? 208  GLU D CA  1 
ATOM   8707  C C   . GLU D  1 209 ? 38.283  -5.237  39.421  1.00 52.15  ? 208  GLU D C   1 
ATOM   8708  O O   . GLU D  1 209 ? 38.141  -4.648  40.485  1.00 49.59  ? 208  GLU D O   1 
ATOM   8709  C CB  . GLU D  1 209 ? 40.480  -6.246  40.019  1.00 69.01  ? 208  GLU D CB  1 
ATOM   8710  C CG  . GLU D  1 209 ? 41.348  -7.494  40.129  1.00 75.88  ? 208  GLU D CG  1 
ATOM   8711  C CD  . GLU D  1 209 ? 42.632  -7.247  40.911  1.00 98.80  ? 208  GLU D CD  1 
ATOM   8712  O OE1 . GLU D  1 209 ? 42.836  -6.105  41.388  1.00 97.64  ? 208  GLU D OE1 1 
ATOM   8713  O OE2 . GLU D  1 209 ? 43.433  -8.199  41.058  1.00 89.02  ? 208  GLU D OE2 1 
ATOM   8714  N N   . ASN D  1 210 ? 37.708  -4.827  38.301  1.00 56.82  ? 209  ASN D N   1 
ATOM   8715  C CA  . ASN D  1 210 ? 36.886  -3.633  38.299  1.00 54.11  ? 209  ASN D CA  1 
ATOM   8716  C C   . ASN D  1 210 ? 35.399  -3.938  38.164  1.00 57.45  ? 209  ASN D C   1 
ATOM   8717  O O   . ASN D  1 210 ? 34.639  -3.134  37.634  1.00 61.15  ? 209  ASN D O   1 
ATOM   8718  C CB  . ASN D  1 210 ? 37.318  -2.692  37.179  1.00 63.97  ? 209  ASN D CB  1 
ATOM   8719  C CG  . ASN D  1 210 ? 36.744  -1.302  37.340  1.00 64.94  ? 209  ASN D CG  1 
ATOM   8720  O OD1 . ASN D  1 210 ? 36.563  -0.816  38.458  1.00 52.57  ? 209  ASN D OD1 1 
ATOM   8721  N ND2 . ASN D  1 210 ? 36.433  -0.663  36.223  1.00 49.88  ? 209  ASN D ND2 1 
ATOM   8722  N N   . PHE D  1 211 ? 34.977  -5.100  38.645  1.00 55.11  ? 210  PHE D N   1 
ATOM   8723  C CA  . PHE D  1 211 ? 33.562  -5.434  38.620  1.00 58.03  ? 210  PHE D CA  1 
ATOM   8724  C C   . PHE D  1 211 ? 32.958  -5.267  40.010  1.00 48.98  ? 210  PHE D C   1 
ATOM   8725  O O   . PHE D  1 211 ? 33.608  -5.547  41.022  1.00 43.07  ? 210  PHE D O   1 
ATOM   8726  C CB  . PHE D  1 211 ? 33.348  -6.864  38.118  1.00 51.39  ? 210  PHE D CB  1 
ATOM   8727  C CG  . PHE D  1 211 ? 33.659  -7.050  36.661  1.00 50.43  ? 210  PHE D CG  1 
ATOM   8728  C CD1 . PHE D  1 211 ? 32.830  -6.515  35.688  1.00 47.51  ? 210  PHE D CD1 1 
ATOM   8729  C CD2 . PHE D  1 211 ? 34.772  -7.777  36.265  1.00 52.13  ? 210  PHE D CD2 1 
ATOM   8730  C CE1 . PHE D  1 211 ? 33.116  -6.685  34.344  1.00 54.22  ? 210  PHE D CE1 1 
ATOM   8731  C CE2 . PHE D  1 211 ? 35.056  -7.958  34.931  1.00 55.38  ? 210  PHE D CE2 1 
ATOM   8732  C CZ  . PHE D  1 211 ? 34.229  -7.411  33.965  1.00 56.49  ? 210  PHE D CZ  1 
ATOM   8733  N N   . LEU D  1 212 ? 31.715  -4.797  40.045  1.00 50.90  ? 211  LEU D N   1 
ATOM   8734  C CA  . LEU D  1 212 ? 30.977  -4.653  41.292  1.00 48.61  ? 211  LEU D CA  1 
ATOM   8735  C C   . LEU D  1 212 ? 30.999  -5.965  42.078  1.00 54.71  ? 211  LEU D C   1 
ATOM   8736  O O   . LEU D  1 212 ? 30.820  -7.046  41.509  1.00 52.31  ? 211  LEU D O   1 
ATOM   8737  C CB  . LEU D  1 212 ? 29.535  -4.242  40.987  1.00 49.40  ? 211  LEU D CB  1 
ATOM   8738  C CG  . LEU D  1 212 ? 28.666  -3.856  42.182  1.00 58.46  ? 211  LEU D CG  1 
ATOM   8739  C CD1 . LEU D  1 212 ? 29.264  -2.670  42.924  1.00 53.41  ? 211  LEU D CD1 1 
ATOM   8740  C CD2 . LEU D  1 212 ? 27.251  -3.549  41.718  1.00 52.37  ? 211  LEU D CD2 1 
ATOM   8741  N N   . ASP D  1 213 ? 31.246  -5.862  43.381  1.00 48.31  ? 212  ASP D N   1 
ATOM   8742  C CA  . ASP D  1 213 ? 31.245  -7.020  44.260  1.00 53.95  ? 212  ASP D CA  1 
ATOM   8743  C C   . ASP D  1 213 ? 29.829  -7.594  44.331  1.00 57.04  ? 212  ASP D C   1 
ATOM   8744  O O   . ASP D  1 213 ? 28.867  -6.846  44.508  1.00 51.54  ? 212  ASP D O   1 
ATOM   8745  C CB  . ASP D  1 213 ? 31.743  -6.600  45.650  1.00 61.59  ? 212  ASP D CB  1 
ATOM   8746  C CG  . ASP D  1 213 ? 31.549  -7.681  46.709  1.00 87.50  ? 212  ASP D CG  1 
ATOM   8747  O OD1 . ASP D  1 213 ? 31.372  -8.867  46.352  1.00 88.20  ? 212  ASP D OD1 1 
ATOM   8748  O OD2 . ASP D  1 213 ? 31.583  -7.338  47.913  1.00 88.24  ? 212  ASP D OD2 1 
ATOM   8749  N N   . PRO D  1 214 ? 29.695  -8.924  44.173  1.00 54.63  ? 213  PRO D N   1 
ATOM   8750  C CA  . PRO D  1 214 ? 28.375  -9.571  44.241  1.00 51.63  ? 213  PRO D CA  1 
ATOM   8751  C C   . PRO D  1 214 ? 27.591  -9.232  45.512  1.00 52.24  ? 213  PRO D C   1 
ATOM   8752  O O   . PRO D  1 214 ? 26.370  -9.098  45.444  1.00 44.57  ? 213  PRO D O   1 
ATOM   8753  C CB  . PRO D  1 214 ? 28.704  -11.076 44.175  1.00 52.16  ? 213  PRO D CB  1 
ATOM   8754  C CG  . PRO D  1 214 ? 30.207  -11.180 44.348  1.00 55.55  ? 213  PRO D CG  1 
ATOM   8755  C CD  . PRO D  1 214 ? 30.756  -9.889  43.838  1.00 57.10  ? 213  PRO D CD  1 
ATOM   8756  N N   . ASN D  1 215 ? 28.275  -9.081  46.641  1.00 47.14  ? 214  ASN D N   1 
ATOM   8757  C CA  . ASN D  1 215 ? 27.612  -8.697  47.887  1.00 42.45  ? 214  ASN D CA  1 
ATOM   8758  C C   . ASN D  1 215 ? 26.923  -7.337  47.818  1.00 50.70  ? 214  ASN D C   1 
ATOM   8759  O O   . ASN D  1 215 ? 26.011  -7.065  48.590  1.00 52.44  ? 214  ASN D O   1 
ATOM   8760  C CB  . ASN D  1 215 ? 28.612  -8.697  49.043  1.00 54.67  ? 214  ASN D CB  1 
ATOM   8761  C CG  . ASN D  1 215 ? 29.134  -10.087 49.366  1.00 69.31  ? 214  ASN D CG  1 
ATOM   8762  O OD1 . ASN D  1 215 ? 28.523  -11.102 49.005  1.00 56.94  ? 214  ASN D OD1 1 
ATOM   8763  N ND2 . ASN D  1 215 ? 30.264  -10.141 50.063  1.00 68.60  ? 214  ASN D ND2 1 
ATOM   8764  N N   . LYS D  1 216 ? 27.356  -6.484  46.897  1.00 49.42  ? 215  LYS D N   1 
ATOM   8765  C CA  . LYS D  1 216 ? 26.761  -5.157  46.750  1.00 57.30  ? 215  LYS D CA  1 
ATOM   8766  C C   . LYS D  1 216 ? 25.738  -5.105  45.622  1.00 55.26  ? 215  LYS D C   1 
ATOM   8767  O O   . LYS D  1 216 ? 25.251  -4.037  45.266  1.00 54.76  ? 215  LYS D O   1 
ATOM   8768  C CB  . LYS D  1 216 ? 27.850  -4.115  46.505  1.00 55.95  ? 215  LYS D CB  1 
ATOM   8769  C CG  . LYS D  1 216 ? 28.785  -3.914  47.688  1.00 64.31  ? 215  LYS D CG  1 
ATOM   8770  C CD  . LYS D  1 216 ? 29.777  -2.802  47.406  1.00 78.96  ? 215  LYS D CD  1 
ATOM   8771  C CE  . LYS D  1 216 ? 30.679  -2.547  48.601  1.00 86.60  ? 215  LYS D CE  1 
ATOM   8772  N NZ  . LYS D  1 216 ? 31.631  -1.432  48.347  1.00 95.87  ? 215  LYS D NZ  1 
ATOM   8773  N N   . ALA D  1 217 ? 25.417  -6.263  45.060  1.00 56.86  ? 216  ALA D N   1 
ATOM   8774  C CA  . ALA D  1 217 ? 24.413  -6.354  44.008  1.00 50.66  ? 216  ALA D CA  1 
ATOM   8775  C C   . ALA D  1 217 ? 23.280  -7.285  44.443  1.00 53.22  ? 216  ALA D C   1 
ATOM   8776  O O   . ALA D  1 217 ? 23.377  -7.961  45.471  1.00 55.16  ? 216  ALA D O   1 
ATOM   8777  C CB  . ALA D  1 217 ? 25.052  -6.858  42.730  1.00 50.13  ? 216  ALA D CB  1 
ATOM   8778  N N   . SER D  1 218 ? 22.201  -7.316  43.671  1.00 50.04  ? 217  SER D N   1 
ATOM   8779  C CA  . SER D  1 218 ? 21.086  -8.209  43.979  1.00 43.06  ? 217  SER D CA  1 
ATOM   8780  C C   . SER D  1 218 ? 21.600  -9.626  44.209  1.00 45.48  ? 217  SER D C   1 
ATOM   8781  O O   . SER D  1 218 ? 22.393  -10.136 43.421  1.00 38.20  ? 217  SER D O   1 
ATOM   8782  C CB  . SER D  1 218 ? 20.072  -8.208  42.837  1.00 47.08  ? 217  SER D CB  1 
ATOM   8783  O OG  . SER D  1 218 ? 19.165  -9.285  42.985  1.00 58.75  ? 217  SER D OG  1 
ATOM   8784  N N   . SER D  1 219 ? 21.152  -10.255 45.289  1.00 31.86  ? 218  SER D N   1 
ATOM   8785  C CA  . SER D  1 219 ? 21.618  -11.592 45.638  1.00 45.18  ? 218  SER D CA  1 
ATOM   8786  C C   . SER D  1 219 ? 21.204  -12.639 44.594  1.00 40.19  ? 218  SER D C   1 
ATOM   8787  O O   . SER D  1 219 ? 21.791  -13.720 44.530  1.00 41.84  ? 218  SER D O   1 
ATOM   8788  C CB  . SER D  1 219 ? 21.099  -12.002 47.028  1.00 42.50  ? 218  SER D CB  1 
ATOM   8789  O OG  . SER D  1 219 ? 19.684  -12.030 47.049  1.00 51.20  ? 218  SER D OG  1 
ATOM   8790  N N   . LEU D  1 220 ? 20.193  -12.329 43.784  1.00 41.14  ? 219  LEU D N   1 
ATOM   8791  C CA  . LEU D  1 220 ? 19.778  -13.239 42.721  1.00 38.64  ? 219  LEU D CA  1 
ATOM   8792  C C   . LEU D  1 220 ? 20.899  -13.419 41.700  1.00 49.77  ? 219  LEU D C   1 
ATOM   8793  O O   . LEU D  1 220 ? 20.990  -14.467 41.067  1.00 40.60  ? 219  LEU D O   1 
ATOM   8794  C CB  . LEU D  1 220 ? 18.536  -12.735 41.984  1.00 38.06  ? 219  LEU D CB  1 
ATOM   8795  C CG  . LEU D  1 220 ? 17.212  -12.604 42.739  1.00 53.19  ? 219  LEU D CG  1 
ATOM   8796  C CD1 . LEU D  1 220 ? 16.053  -12.913 41.797  1.00 41.33  ? 219  LEU D CD1 1 
ATOM   8797  C CD2 . LEU D  1 220 ? 17.161  -13.517 43.938  1.00 53.82  ? 219  LEU D CD2 1 
ATOM   8798  N N   . LEU D  1 221 ? 21.738  -12.398 41.534  1.00 32.04  ? 220  LEU D N   1 
ATOM   8799  C CA  . LEU D  1 221 ? 22.787  -12.441 40.521  1.00 40.06  ? 220  LEU D CA  1 
ATOM   8800  C C   . LEU D  1 221 ? 23.823  -13.516 40.822  1.00 41.99  ? 220  LEU D C   1 
ATOM   8801  O O   . LEU D  1 221 ? 24.323  -14.167 39.911  1.00 45.99  ? 220  LEU D O   1 
ATOM   8802  C CB  . LEU D  1 221 ? 23.474  -11.083 40.395  1.00 37.69  ? 220  LEU D CB  1 
ATOM   8803  C CG  . LEU D  1 221 ? 22.590  -9.962  39.853  1.00 39.73  ? 220  LEU D CG  1 
ATOM   8804  C CD1 . LEU D  1 221 ? 23.305  -8.626  39.975  1.00 40.90  ? 220  LEU D CD1 1 
ATOM   8805  C CD2 . LEU D  1 221 ? 22.178  -10.221 38.423  1.00 41.52  ? 220  LEU D CD2 1 
ATOM   8806  N N   . SER D  1 222 ? 24.144  -13.703 42.099  1.00 47.06  ? 221  SER D N   1 
ATOM   8807  C CA  . SER D  1 222 ? 25.171  -14.668 42.485  1.00 38.12  ? 221  SER D CA  1 
ATOM   8808  C C   . SER D  1 222 ? 24.565  -15.936 43.104  1.00 51.24  ? 221  SER D C   1 
ATOM   8809  O O   . SER D  1 222 ? 24.623  -17.026 42.514  1.00 53.62  ? 221  SER D O   1 
ATOM   8810  C CB  . SER D  1 222 ? 26.164  -14.022 43.454  1.00 39.68  ? 221  SER D CB  1 
ATOM   8811  O OG  . SER D  1 222 ? 25.487  -13.353 44.498  1.00 51.99  ? 221  SER D OG  1 
ATOM   8812  N N   . SER D  1 223 ? 23.975  -15.799 44.283  1.00 40.73  ? 222  SER D N   1 
ATOM   8813  C CA  . SER D  1 223 ? 23.428  -16.952 44.990  1.00 43.06  ? 222  SER D CA  1 
ATOM   8814  C C   . SER D  1 223 ? 22.241  -17.580 44.256  1.00 38.23  ? 222  SER D C   1 
ATOM   8815  O O   . SER D  1 223 ? 22.100  -18.798 44.223  1.00 48.28  ? 222  SER D O   1 
ATOM   8816  C CB  . SER D  1 223 ? 23.047  -16.560 46.412  1.00 43.84  ? 222  SER D CB  1 
ATOM   8817  O OG  . SER D  1 223 ? 24.223  -16.296 47.162  1.00 53.29  ? 222  SER D OG  1 
ATOM   8818  N N   . GLY D  1 224 ? 21.388  -16.765 43.658  1.00 36.55  ? 223  GLY D N   1 
ATOM   8819  C CA  . GLY D  1 224 ? 20.378  -17.302 42.767  1.00 35.77  ? 223  GLY D CA  1 
ATOM   8820  C C   . GLY D  1 224 ? 18.941  -17.130 43.209  1.00 43.86  ? 223  GLY D C   1 
ATOM   8821  O O   . GLY D  1 224 ? 18.645  -16.615 44.291  1.00 37.22  ? 223  GLY D O   1 
ATOM   8822  N N   . PHE D  1 225 ? 18.048  -17.600 42.348  1.00 33.30  ? 224  PHE D N   1 
ATOM   8823  C CA  . PHE D  1 225 ? 16.620  -17.417 42.505  1.00 33.60  ? 224  PHE D CA  1 
ATOM   8824  C C   . PHE D  1 225 ? 15.920  -18.740 42.849  1.00 41.80  ? 224  PHE D C   1 
ATOM   8825  O O   . PHE D  1 225 ? 16.224  -19.781 42.266  1.00 38.12  ? 224  PHE D O   1 
ATOM   8826  C CB  . PHE D  1 225 ? 16.058  -16.864 41.200  1.00 31.82  ? 224  PHE D CB  1 
ATOM   8827  C CG  . PHE D  1 225 ? 14.570  -16.880 41.136  1.00 39.49  ? 224  PHE D CG  1 
ATOM   8828  C CD1 . PHE D  1 225 ? 13.826  -16.023 41.926  1.00 40.67  ? 224  PHE D CD1 1 
ATOM   8829  C CD2 . PHE D  1 225 ? 13.910  -17.750 40.286  1.00 36.95  ? 224  PHE D CD2 1 
ATOM   8830  C CE1 . PHE D  1 225 ? 12.448  -16.027 41.874  1.00 42.33  ? 224  PHE D CE1 1 
ATOM   8831  C CE2 . PHE D  1 225 ? 12.531  -17.763 40.231  1.00 37.88  ? 224  PHE D CE2 1 
ATOM   8832  C CZ  . PHE D  1 225 ? 11.799  -16.897 41.026  1.00 44.99  ? 224  PHE D CZ  1 
ATOM   8833  N N   . SER D  1 226 ? 14.986  -18.689 43.794  1.00 34.29  ? 225  SER D N   1 
ATOM   8834  C CA  . SER D  1 226 ? 14.220  -19.864 44.197  1.00 36.48  ? 225  SER D CA  1 
ATOM   8835  C C   . SER D  1 226 ? 12.799  -19.771 43.668  1.00 36.28  ? 225  SER D C   1 
ATOM   8836  O O   . SER D  1 226 ? 11.987  -19.021 44.191  1.00 38.51  ? 225  SER D O   1 
ATOM   8837  C CB  . SER D  1 226 ? 14.187  -19.987 45.715  1.00 27.48  ? 225  SER D CB  1 
ATOM   8838  O OG  . SER D  1 226 ? 15.483  -20.201 46.224  1.00 35.30  ? 225  SER D OG  1 
ATOM   8839  N N   . PRO D  1 227 ? 12.491  -20.541 42.622  1.00 45.49  ? 226  PRO D N   1 
ATOM   8840  C CA  . PRO D  1 227 ? 11.129  -20.532 42.090  1.00 45.86  ? 226  PRO D CA  1 
ATOM   8841  C C   . PRO D  1 227 ? 10.116  -20.960 43.142  1.00 46.75  ? 226  PRO D C   1 
ATOM   8842  O O   . PRO D  1 227 ? 10.434  -21.755 44.034  1.00 42.97  ? 226  PRO D O   1 
ATOM   8843  C CB  . PRO D  1 227 ? 11.183  -21.584 40.978  1.00 37.12  ? 226  PRO D CB  1 
ATOM   8844  C CG  . PRO D  1 227 ? 12.634  -21.716 40.640  1.00 48.01  ? 226  PRO D CG  1 
ATOM   8845  C CD  . PRO D  1 227 ? 13.348  -21.517 41.930  1.00 38.38  ? 226  PRO D CD  1 
ATOM   8846  N N   . ASP D  1 228 ? 8.906   -20.428 43.036  1.00 45.31  ? 227  ASP D N   1 
ATOM   8847  C CA  . ASP D  1 228 ? 7.795   -20.885 43.864  1.00 49.03  ? 227  ASP D CA  1 
ATOM   8848  C C   . ASP D  1 228 ? 6.513   -20.723 43.067  1.00 41.26  ? 227  ASP D C   1 
ATOM   8849  O O   . ASP D  1 228 ? 5.712   -19.828 43.325  1.00 51.33  ? 227  ASP D O   1 
ATOM   8850  C CB  . ASP D  1 228 ? 7.704   -20.083 45.169  1.00 49.60  ? 227  ASP D CB  1 
ATOM   8851  C CG  . ASP D  1 228 ? 6.835   -20.772 46.216  1.00 72.50  ? 227  ASP D CG  1 
ATOM   8852  O OD1 . ASP D  1 228 ? 6.188   -21.786 45.875  1.00 67.75  ? 227  ASP D OD1 1 
ATOM   8853  O OD2 . ASP D  1 228 ? 6.800   -20.299 47.373  1.00 86.12  ? 227  ASP D OD2 1 
ATOM   8854  N N   . PHE D  1 229 ? 6.335   -21.589 42.083  1.00 38.14  ? 228  PHE D N   1 
ATOM   8855  C CA  . PHE D  1 229 ? 5.255   -21.448 41.126  1.00 33.93  ? 228  PHE D CA  1 
ATOM   8856  C C   . PHE D  1 229 ? 4.339   -22.650 41.235  1.00 30.04  ? 228  PHE D C   1 
ATOM   8857  O O   . PHE D  1 229 ? 4.784   -23.765 41.520  1.00 35.55  ? 228  PHE D O   1 
ATOM   8858  C CB  . PHE D  1 229 ? 5.826   -21.366 39.705  1.00 35.91  ? 228  PHE D CB  1 
ATOM   8859  C CG  . PHE D  1 229 ? 6.855   -20.281 39.517  1.00 38.44  ? 228  PHE D CG  1 
ATOM   8860  C CD1 . PHE D  1 229 ? 6.664   -19.013 40.048  1.00 35.10  ? 228  PHE D CD1 1 
ATOM   8861  C CD2 . PHE D  1 229 ? 8.023   -20.536 38.803  1.00 37.16  ? 228  PHE D CD2 1 
ATOM   8862  C CE1 . PHE D  1 229 ? 7.619   -18.015 39.869  1.00 38.65  ? 228  PHE D CE1 1 
ATOM   8863  C CE2 . PHE D  1 229 ? 8.977   -19.551 38.626  1.00 36.29  ? 228  PHE D CE2 1 
ATOM   8864  C CZ  . PHE D  1 229 ? 8.773   -18.281 39.157  1.00 30.44  ? 228  PHE D CZ  1 
ATOM   8865  N N   . ALA D  1 230 ? 3.058   -22.435 40.973  1.00 28.99  ? 229  ALA D N   1 
ATOM   8866  C CA  . ALA D  1 230 ? 2.077   -23.502 41.107  1.00 41.13  ? 229  ALA D CA  1 
ATOM   8867  C C   . ALA D  1 230 ? 1.343   -23.682 39.790  1.00 35.20  ? 229  ALA D C   1 
ATOM   8868  O O   . ALA D  1 230 ? 0.950   -22.705 39.150  1.00 32.25  ? 229  ALA D O   1 
ATOM   8869  C CB  . ALA D  1 230 ? 1.086   -23.174 42.233  1.00 25.25  ? 229  ALA D CB  1 
ATOM   8870  N N   . THR D  1 231 ? 1.166   -24.932 39.398  1.00 30.07  ? 230  THR D N   1 
ATOM   8871  C CA  . THR D  1 231 ? 0.430   -25.276 38.190  1.00 41.70  ? 230  THR D CA  1 
ATOM   8872  C C   . THR D  1 231 ? -0.648  -26.291 38.563  1.00 39.12  ? 230  THR D C   1 
ATOM   8873  O O   . THR D  1 231 ? -0.382  -27.264 39.261  1.00 35.58  ? 230  THR D O   1 
ATOM   8874  C CB  . THR D  1 231 ? 1.352   -25.917 37.133  1.00 40.23  ? 230  THR D CB  1 
ATOM   8875  O OG1 . THR D  1 231 ? 2.444   -25.036 36.851  1.00 49.40  ? 230  THR D OG1 1 
ATOM   8876  C CG2 . THR D  1 231 ? 0.580   -26.213 35.845  1.00 40.85  ? 230  THR D CG2 1 
ATOM   8877  N N   . VAL D  1 232 ? -1.867  -26.066 38.103  1.00 31.95  ? 231  VAL D N   1 
ATOM   8878  C CA  . VAL D  1 232 ? -2.925  -27.035 38.325  1.00 35.80  ? 231  VAL D CA  1 
ATOM   8879  C C   . VAL D  1 232 ? -3.248  -27.775 37.022  1.00 41.38  ? 231  VAL D C   1 
ATOM   8880  O O   . VAL D  1 232 ? -3.497  -27.167 35.988  1.00 40.83  ? 231  VAL D O   1 
ATOM   8881  C CB  . VAL D  1 232 ? -4.186  -26.359 38.857  1.00 36.93  ? 231  VAL D CB  1 
ATOM   8882  C CG1 . VAL D  1 232 ? -5.240  -27.411 39.190  1.00 30.29  ? 231  VAL D CG1 1 
ATOM   8883  C CG2 . VAL D  1 232 ? -3.844  -25.517 40.080  1.00 33.53  ? 231  VAL D CG2 1 
ATOM   8884  N N   . ILE D  1 233 ? -3.226  -29.095 37.085  1.00 30.09  ? 232  ILE D N   1 
ATOM   8885  C CA  . ILE D  1 233 ? -3.546  -29.927 35.943  1.00 36.20  ? 232  ILE D CA  1 
ATOM   8886  C C   . ILE D  1 233 ? -4.797  -30.756 36.230  1.00 40.19  ? 232  ILE D C   1 
ATOM   8887  O O   . ILE D  1 233 ? -4.880  -31.421 37.262  1.00 40.98  ? 232  ILE D O   1 
ATOM   8888  C CB  . ILE D  1 233 ? -2.364  -30.849 35.629  1.00 35.31  ? 232  ILE D CB  1 
ATOM   8889  C CG1 . ILE D  1 233 ? -1.142  -29.997 35.274  1.00 43.30  ? 232  ILE D CG1 1 
ATOM   8890  C CG2 . ILE D  1 233 ? -2.714  -31.780 34.513  1.00 34.85  ? 232  ILE D CG2 1 
ATOM   8891  C CD1 . ILE D  1 233 ? 0.138   -30.770 35.174  1.00 48.24  ? 232  ILE D CD1 1 
ATOM   8892  N N   . THR D  1 234 ? -5.775  -30.705 35.329  1.00 37.70  ? 233  THR D N   1 
ATOM   8893  C CA  . THR D  1 234 ? -7.019  -31.452 35.504  1.00 38.72  ? 233  THR D CA  1 
ATOM   8894  C C   . THR D  1 234 ? -7.078  -32.632 34.550  1.00 46.14  ? 233  THR D C   1 
ATOM   8895  O O   . THR D  1 234 ? -6.494  -32.597 33.471  1.00 44.86  ? 233  THR D O   1 
ATOM   8896  C CB  . THR D  1 234 ? -8.260  -30.560 35.271  1.00 44.21  ? 233  THR D CB  1 
ATOM   8897  O OG1 . THR D  1 234 ? -8.190  -29.962 33.972  1.00 56.57  ? 233  THR D OG1 1 
ATOM   8898  C CG2 . THR D  1 234 ? -8.337  -29.458 36.318  1.00 42.34  ? 233  THR D CG2 1 
ATOM   8899  N N   . MET D  1 235 ? -7.803  -33.673 34.948  1.00 43.51  ? 234  MET D N   1 
ATOM   8900  C CA  . MET D  1 235 ? -7.877  -34.911 34.176  1.00 33.89  ? 234  MET D CA  1 
ATOM   8901  C C   . MET D  1 235 ? -9.267  -35.525 34.315  1.00 44.62  ? 234  MET D C   1 
ATOM   8902  O O   . MET D  1 235 ? -9.743  -35.769 35.423  1.00 41.90  ? 234  MET D O   1 
ATOM   8903  C CB  . MET D  1 235 ? -6.825  -35.902 34.683  1.00 37.00  ? 234  MET D CB  1 
ATOM   8904  C CG  . MET D  1 235 ? -6.785  -37.220 33.937  1.00 54.76  ? 234  MET D CG  1 
ATOM   8905  S SD  . MET D  1 235 ? -6.314  -36.989 32.211  1.00 59.75  ? 234  MET D SD  1 
ATOM   8906  C CE  . MET D  1 235 ? -5.679  -38.611 31.824  1.00 53.83  ? 234  MET D CE  1 
ATOM   8907  N N   . ASP D  1 236 ? -9.912  -35.784 33.184  1.00 45.69  ? 235  ASP D N   1 
ATOM   8908  C CA  . ASP D  1 236 ? -11.206 -36.454 33.177  1.00 46.13  ? 235  ASP D CA  1 
ATOM   8909  C C   . ASP D  1 236 ? -11.054 -37.877 33.706  1.00 35.58  ? 235  ASP D C   1 
ATOM   8910  O O   . ASP D  1 236 ? -10.143 -38.603 33.312  1.00 43.43  ? 235  ASP D O   1 
ATOM   8911  C CB  . ASP D  1 236 ? -11.766 -36.491 31.756  1.00 50.51  ? 235  ASP D CB  1 
ATOM   8912  C CG  . ASP D  1 236 ? -13.257 -36.777 31.718  1.00 72.96  ? 235  ASP D CG  1 
ATOM   8913  O OD1 . ASP D  1 236 ? -13.717 -37.693 32.431  1.00 69.33  ? 235  ASP D OD1 1 
ATOM   8914  O OD2 . ASP D  1 236 ? -13.974 -36.076 30.973  1.00 90.65  ? 235  ASP D OD2 1 
ATOM   8915  N N   . ARG D  1 237 ? -11.949 -38.281 34.598  1.00 38.28  ? 236  ARG D N   1 
ATOM   8916  C CA  . ARG D  1 237 ? -11.877 -39.620 35.198  1.00 46.10  ? 236  ARG D CA  1 
ATOM   8917  C C   . ARG D  1 237 ? -12.155 -40.723 34.183  1.00 46.46  ? 236  ARG D C   1 
ATOM   8918  O O   . ARG D  1 237 ? -11.739 -41.862 34.379  1.00 44.43  ? 236  ARG D O   1 
ATOM   8919  C CB  . ARG D  1 237 ? -12.847 -39.752 36.382  1.00 42.58  ? 236  ARG D CB  1 
ATOM   8920  C CG  . ARG D  1 237 ? -12.457 -38.910 37.584  1.00 44.09  ? 236  ARG D CG  1 
ATOM   8921  C CD  . ARG D  1 237 ? -13.396 -39.120 38.760  1.00 42.09  ? 236  ARG D CD  1 
ATOM   8922  N NE  . ARG D  1 237 ? -13.060 -38.235 39.875  1.00 39.52  ? 236  ARG D NE  1 
ATOM   8923  C CZ  . ARG D  1 237 ? -13.543 -37.007 40.023  1.00 42.34  ? 236  ARG D CZ  1 
ATOM   8924  N NH1 . ARG D  1 237 ? -13.185 -36.266 41.066  1.00 40.35  ? 236  ARG D NH1 1 
ATOM   8925  N NH2 . ARG D  1 237 ? -14.390 -36.510 39.128  1.00 36.10  ? 236  ARG D NH2 1 
ATOM   8926  N N   . LYS D  1 238 ? -12.853 -40.379 33.103  1.00 42.78  ? 237  LYS D N   1 
ATOM   8927  C CA  . LYS D  1 238 ? -13.217 -41.339 32.064  1.00 43.22  ? 237  LYS D CA  1 
ATOM   8928  C C   . LYS D  1 238 ? -12.166 -41.465 30.954  1.00 55.74  ? 237  LYS D C   1 
ATOM   8929  O O   . LYS D  1 238 ? -12.310 -42.292 30.059  1.00 54.84  ? 237  LYS D O   1 
ATOM   8930  C CB  . LYS D  1 238 ? -14.552 -40.941 31.432  1.00 51.96  ? 237  LYS D CB  1 
ATOM   8931  C CG  . LYS D  1 238 ? -15.747 -41.054 32.365  1.00 58.41  ? 237  LYS D CG  1 
ATOM   8932  C CD  . LYS D  1 238 ? -16.063 -42.503 32.667  1.00 74.42  ? 237  LYS D CD  1 
ATOM   8933  C CE  . LYS D  1 238 ? -16.557 -43.230 31.433  1.00 76.17  ? 237  LYS D CE  1 
ATOM   8934  N NZ  . LYS D  1 238 ? -16.854 -44.654 31.728  1.00 80.79  ? 237  LYS D NZ  1 
ATOM   8935  N N   . ALA D  1 239 ? -11.119 -40.649 30.995  1.00 46.35  ? 238  ALA D N   1 
ATOM   8936  C CA  . ALA D  1 239 ? -10.075 -40.734 29.980  1.00 42.24  ? 238  ALA D CA  1 
ATOM   8937  C C   . ALA D  1 239 ? -9.526  -42.156 29.934  1.00 52.52  ? 238  ALA D C   1 
ATOM   8938  O O   . ALA D  1 239 ? -9.294  -42.771 30.971  1.00 52.89  ? 238  ALA D O   1 
ATOM   8939  C CB  . ALA D  1 239 ? -8.959  -39.739 30.270  1.00 41.76  ? 238  ALA D CB  1 
ATOM   8940  N N   . SER D  1 240 ? -9.314  -42.683 28.731  1.00 60.68  ? 239  SER D N   1 
ATOM   8941  C CA  . SER D  1 240 ? -8.865  -44.069 28.585  1.00 64.45  ? 239  SER D CA  1 
ATOM   8942  C C   . SER D  1 240 ? -7.434  -44.263 29.080  1.00 51.78  ? 239  SER D C   1 
ATOM   8943  O O   . SER D  1 240 ? -7.117  -45.267 29.703  1.00 64.65  ? 239  SER D O   1 
ATOM   8944  C CB  . SER D  1 240 ? -8.981  -44.525 27.131  1.00 64.57  ? 239  SER D CB  1 
ATOM   8945  O OG  . SER D  1 240 ? -8.323  -43.617 26.271  1.00 90.71  ? 239  SER D OG  1 
ATOM   8946  N N   . LYS D  1 241 ? -6.576  -43.289 28.817  1.00 59.02  ? 240  LYS D N   1 
ATOM   8947  C CA  . LYS D  1 241 ? -5.188  -43.353 29.254  1.00 57.99  ? 240  LYS D CA  1 
ATOM   8948  C C   . LYS D  1 241 ? -4.994  -42.526 30.529  1.00 55.16  ? 240  LYS D C   1 
ATOM   8949  O O   . LYS D  1 241 ? -5.039  -41.302 30.493  1.00 54.76  ? 240  LYS D O   1 
ATOM   8950  C CB  . LYS D  1 241 ? -4.282  -42.834 28.134  1.00 57.35  ? 240  LYS D CB  1 
ATOM   8951  C CG  . LYS D  1 241 ? -2.794  -42.850 28.454  1.00 62.30  ? 240  LYS D CG  1 
ATOM   8952  C CD  . LYS D  1 241 ? -1.972  -42.456 27.230  1.00 77.04  ? 240  LYS D CD  1 
ATOM   8953  C CE  . LYS D  1 241 ? -0.586  -41.949 27.606  1.00 79.59  ? 240  LYS D CE  1 
ATOM   8954  N NZ  . LYS D  1 241 ? 0.199   -42.943 28.389  1.00 94.13  ? 240  LYS D NZ  1 
ATOM   8955  N N   . GLN D  1 242 ? -4.781  -43.204 31.654  1.00 54.62  ? 241  GLN D N   1 
ATOM   8956  C CA  . GLN D  1 242 ? -4.709  -42.542 32.956  1.00 55.35  ? 241  GLN D CA  1 
ATOM   8957  C C   . GLN D  1 242 ? -3.267  -42.357 33.425  1.00 56.81  ? 241  GLN D C   1 
ATOM   8958  O O   . GLN D  1 242 ? -3.006  -42.205 34.621  1.00 47.87  ? 241  GLN D O   1 
ATOM   8959  C CB  . GLN D  1 242 ? -5.510  -43.326 34.001  1.00 51.19  ? 241  GLN D CB  1 
ATOM   8960  C CG  . GLN D  1 242 ? -7.021  -43.201 33.843  1.00 49.90  ? 241  GLN D CG  1 
ATOM   8961  C CD  . GLN D  1 242 ? -7.532  -41.819 34.209  1.00 54.12  ? 241  GLN D CD  1 
ATOM   8962  O OE1 . GLN D  1 242 ? -7.024  -41.186 35.134  1.00 58.31  ? 241  GLN D OE1 1 
ATOM   8963  N NE2 . GLN D  1 242 ? -8.537  -41.342 33.481  1.00 48.07  ? 241  GLN D NE2 1 
ATOM   8964  N N   . GLN D  1 243 ? -2.331  -42.377 32.478  1.00 49.31  ? 242  GLN D N   1 
ATOM   8965  C CA  . GLN D  1 243 ? -0.954  -41.986 32.756  1.00 52.99  ? 242  GLN D CA  1 
ATOM   8966  C C   . GLN D  1 243 ? -0.581  -40.848 31.815  1.00 57.48  ? 242  GLN D C   1 
ATOM   8967  O O   . GLN D  1 243 ? -0.971  -40.857 30.651  1.00 58.81  ? 242  GLN D O   1 
ATOM   8968  C CB  . GLN D  1 243 ? 0.006   -43.159 32.580  1.00 43.33  ? 242  GLN D CB  1 
ATOM   8969  C CG  . GLN D  1 243 ? -0.158  -44.260 33.619  1.00 63.13  ? 242  GLN D CG  1 
ATOM   8970  C CD  . GLN D  1 243 ? -1.426  -45.070 33.423  1.00 84.55  ? 242  GLN D CD  1 
ATOM   8971  O OE1 . GLN D  1 243 ? -1.824  -45.355 32.293  1.00 76.15  ? 242  GLN D OE1 1 
ATOM   8972  N NE2 . GLN D  1 243 ? -2.071  -45.440 34.525  1.00 71.43  ? 242  GLN D NE2 1 
ATOM   8973  N N   . THR D  1 244 ? 0.165   -39.872 32.325  1.00 42.76  ? 243  THR D N   1 
ATOM   8974  C CA  . THR D  1 244 ? 0.534   -38.688 31.552  1.00 43.10  ? 243  THR D CA  1 
ATOM   8975  C C   . THR D  1 244 ? 1.985   -38.327 31.814  1.00 46.34  ? 243  THR D C   1 
ATOM   8976  O O   . THR D  1 244 ? 2.411   -38.265 32.963  1.00 46.62  ? 243  THR D O   1 
ATOM   8977  C CB  . THR D  1 244 ? -0.327  -37.470 31.965  1.00 53.52  ? 243  THR D CB  1 
ATOM   8978  O OG1 . THR D  1 244 ? -1.717  -37.798 31.851  1.00 45.73  ? 243  THR D OG1 1 
ATOM   8979  C CG2 . THR D  1 244 ? -0.010  -36.264 31.096  1.00 51.01  ? 243  THR D CG2 1 
ATOM   8980  N N   . ASN D  1 245 ? 2.754   -38.084 30.760  1.00 51.89  ? 244  ASN D N   1 
ATOM   8981  C CA  . ASN D  1 245 ? 4.099   -37.561 30.936  1.00 45.31  ? 244  ASN D CA  1 
ATOM   8982  C C   . ASN D  1 245 ? 4.047   -36.036 30.997  1.00 42.60  ? 244  ASN D C   1 
ATOM   8983  O O   . ASN D  1 245 ? 3.180   -35.410 30.393  1.00 38.59  ? 244  ASN D O   1 
ATOM   8984  C CB  . ASN D  1 245 ? 5.013   -38.017 29.795  1.00 50.25  ? 244  ASN D CB  1 
ATOM   8985  C CG  . ASN D  1 245 ? 5.356   -39.495 29.878  1.00 61.62  ? 244  ASN D CG  1 
ATOM   8986  O OD1 . ASN D  1 245 ? 5.455   -40.062 30.965  1.00 57.90  ? 244  ASN D OD1 1 
ATOM   8987  N ND2 . ASN D  1 245 ? 5.537   -40.125 28.727  1.00 57.48  ? 244  ASN D ND2 1 
ATOM   8988  N N   . ILE D  1 246 ? 4.968   -35.437 31.735  1.00 34.65  ? 245  ILE D N   1 
ATOM   8989  C CA  . ILE D  1 246 ? 5.069   -33.986 31.769  1.00 36.68  ? 245  ILE D CA  1 
ATOM   8990  C C   . ILE D  1 246 ? 6.532   -33.588 31.846  1.00 40.51  ? 245  ILE D C   1 
ATOM   8991  O O   . ILE D  1 246 ? 7.313   -34.220 32.560  1.00 40.31  ? 245  ILE D O   1 
ATOM   8992  C CB  . ILE D  1 246 ? 4.294   -33.394 32.968  1.00 44.64  ? 245  ILE D CB  1 
ATOM   8993  C CG1 . ILE D  1 246 ? 4.233   -31.873 32.855  1.00 44.74  ? 245  ILE D CG1 1 
ATOM   8994  C CG2 . ILE D  1 246 ? 4.926   -33.810 34.295  1.00 33.71  ? 245  ILE D CG2 1 
ATOM   8995  C CD1 . ILE D  1 246 ? 3.403   -31.231 33.931  1.00 46.58  ? 245  ILE D CD1 1 
ATOM   8996  N N   . ASP D  1 247 ? 6.900   -32.556 31.093  1.00 34.86  ? 246  ASP D N   1 
ATOM   8997  C CA  . ASP D  1 247 ? 8.268   -32.049 31.108  1.00 47.05  ? 246  ASP D CA  1 
ATOM   8998  C C   . ASP D  1 247 ? 8.332   -30.777 31.926  1.00 38.96  ? 246  ASP D C   1 
ATOM   8999  O O   . ASP D  1 247 ? 7.478   -29.908 31.803  1.00 37.98  ? 246  ASP D O   1 
ATOM   9000  C CB  . ASP D  1 247 ? 8.761   -31.754 29.680  1.00 49.08  ? 246  ASP D CB  1 
ATOM   9001  C CG  . ASP D  1 247 ? 9.051   -33.019 28.881  1.00 75.95  ? 246  ASP D CG  1 
ATOM   9002  O OD1 . ASP D  1 247 ? 9.590   -33.984 29.470  1.00 72.61  ? 246  ASP D OD1 1 
ATOM   9003  O OD2 . ASP D  1 247 ? 8.741   -33.046 27.666  1.00 82.72  ? 246  ASP D OD2 1 
ATOM   9004  N N   . VAL D  1 248 ? 9.361   -30.674 32.753  1.00 48.94  ? 247  VAL D N   1 
ATOM   9005  C CA  . VAL D  1 248 ? 9.631   -29.457 33.504  1.00 41.17  ? 247  VAL D CA  1 
ATOM   9006  C C   . VAL D  1 248 ? 11.028  -28.970 33.131  1.00 52.99  ? 247  VAL D C   1 
ATOM   9007  O O   . VAL D  1 248 ? 12.002  -29.724 33.225  1.00 47.87  ? 247  VAL D O   1 
ATOM   9008  C CB  . VAL D  1 248 ? 9.568   -29.721 35.020  1.00 52.20  ? 247  VAL D CB  1 
ATOM   9009  C CG1 . VAL D  1 248 ? 9.851   -28.444 35.807  1.00 39.32  ? 247  VAL D CG1 1 
ATOM   9010  C CG2 . VAL D  1 248 ? 8.209   -30.298 35.400  1.00 44.94  ? 247  VAL D CG2 1 
ATOM   9011  N N   . ILE D  1 249 ? 11.122  -27.715 32.702  1.00 42.20  ? 248  ILE D N   1 
ATOM   9012  C CA  . ILE D  1 249 ? 12.391  -27.138 32.289  1.00 42.64  ? 248  ILE D CA  1 
ATOM   9013  C C   . ILE D  1 249 ? 12.739  -25.950 33.166  1.00 35.40  ? 248  ILE D C   1 
ATOM   9014  O O   . ILE D  1 249 ? 11.929  -25.055 33.340  1.00 36.54  ? 248  ILE D O   1 
ATOM   9015  C CB  . ILE D  1 249 ? 12.347  -26.664 30.800  1.00 49.39  ? 248  ILE D CB  1 
ATOM   9016  C CG1 . ILE D  1 249 ? 11.938  -27.814 29.873  1.00 56.18  ? 248  ILE D CG1 1 
ATOM   9017  C CG2 . ILE D  1 249 ? 13.690  -26.103 30.372  1.00 50.91  ? 248  ILE D CG2 1 
ATOM   9018  C CD1 . ILE D  1 249 ? 10.431  -28.025 29.784  1.00 62.50  ? 248  ILE D CD1 1 
ATOM   9019  N N   . TYR D  1 250 ? 13.948  -25.959 33.720  1.00 46.05  ? 249  TYR D N   1 
ATOM   9020  C CA  . TYR D  1 250 ? 14.531  -24.793 34.387  1.00 41.66  ? 249  TYR D CA  1 
ATOM   9021  C C   . TYR D  1 250 ? 15.590  -24.180 33.480  1.00 50.33  ? 249  TYR D C   1 
ATOM   9022  O O   . TYR D  1 250 ? 16.374  -24.901 32.868  1.00 45.49  ? 249  TYR D O   1 
ATOM   9023  C CB  . TYR D  1 250 ? 15.208  -25.213 35.691  1.00 37.27  ? 249  TYR D CB  1 
ATOM   9024  C CG  . TYR D  1 250 ? 14.264  -25.456 36.838  1.00 44.50  ? 249  TYR D CG  1 
ATOM   9025  C CD1 . TYR D  1 250 ? 14.604  -25.072 38.134  1.00 48.47  ? 249  TYR D CD1 1 
ATOM   9026  C CD2 . TYR D  1 250 ? 13.029  -26.063 36.633  1.00 50.81  ? 249  TYR D CD2 1 
ATOM   9027  C CE1 . TYR D  1 250 ? 13.738  -25.291 39.203  1.00 38.69  ? 249  TYR D CE1 1 
ATOM   9028  C CE2 . TYR D  1 250 ? 12.154  -26.286 37.688  1.00 47.26  ? 249  TYR D CE2 1 
ATOM   9029  C CZ  . TYR D  1 250 ? 12.515  -25.901 38.968  1.00 47.45  ? 249  TYR D CZ  1 
ATOM   9030  O OH  . TYR D  1 250 ? 11.642  -26.121 40.001  1.00 39.88  ? 249  TYR D OH  1 
ATOM   9031  N N   . GLU D  1 251 ? 15.649  -22.855 33.429  1.00 41.73  ? 250  GLU D N   1 
ATOM   9032  C CA  . GLU D  1 251 ? 16.527  -22.179 32.479  1.00 42.80  ? 250  GLU D CA  1 
ATOM   9033  C C   . GLU D  1 251 ? 17.180  -20.950 33.100  1.00 44.63  ? 250  GLU D C   1 
ATOM   9034  O O   . GLU D  1 251 ? 16.558  -20.223 33.871  1.00 40.62  ? 250  GLU D O   1 
ATOM   9035  C CB  . GLU D  1 251 ? 15.719  -21.785 31.231  1.00 47.14  ? 250  GLU D CB  1 
ATOM   9036  C CG  . GLU D  1 251 ? 16.519  -21.230 30.077  1.00 66.04  ? 250  GLU D CG  1 
ATOM   9037  C CD  . GLU D  1 251 ? 15.705  -21.171 28.786  1.00 91.76  ? 250  GLU D CD  1 
ATOM   9038  O OE1 . GLU D  1 251 ? 15.044  -22.181 28.444  1.00 89.69  ? 250  GLU D OE1 1 
ATOM   9039  O OE2 . GLU D  1 251 ? 15.721  -20.113 28.115  1.00 89.98  ? 250  GLU D OE2 1 
ATOM   9040  N N   . ARG D  1 252 ? 18.449  -20.749 32.779  1.00 42.44  ? 251  ARG D N   1 
ATOM   9041  C CA  . ARG D  1 252 ? 19.163  -19.538 33.126  1.00 38.53  ? 251  ARG D CA  1 
ATOM   9042  C C   . ARG D  1 252 ? 19.687  -18.873 31.848  1.00 46.65  ? 251  ARG D C   1 
ATOM   9043  O O   . ARG D  1 252 ? 20.404  -19.491 31.074  1.00 46.82  ? 251  ARG D O   1 
ATOM   9044  C CB  . ARG D  1 252 ? 20.340  -19.858 34.045  1.00 30.71  ? 251  ARG D CB  1 
ATOM   9045  C CG  . ARG D  1 252 ? 21.144  -18.605 34.434  1.00 35.54  ? 251  ARG D CG  1 
ATOM   9046  C CD  . ARG D  1 252 ? 22.543  -18.958 34.934  1.00 35.06  ? 251  ARG D CD  1 
ATOM   9047  N NE  . ARG D  1 252 ? 22.495  -19.776 36.141  1.00 45.32  ? 251  ARG D NE  1 
ATOM   9048  C CZ  . ARG D  1 252 ? 22.652  -21.095 36.179  1.00 43.71  ? 251  ARG D CZ  1 
ATOM   9049  N NH1 . ARG D  1 252 ? 22.580  -21.732 37.341  1.00 43.54  ? 251  ARG D NH1 1 
ATOM   9050  N NH2 . ARG D  1 252 ? 22.880  -21.777 35.066  1.00 46.55  ? 251  ARG D NH2 1 
ATOM   9051  N N   . VAL D  1 253 ? 19.319  -17.621 31.624  1.00 43.01  ? 252  VAL D N   1 
ATOM   9052  C CA  . VAL D  1 253 ? 19.852  -16.852 30.504  1.00 40.58  ? 252  VAL D CA  1 
ATOM   9053  C C   . VAL D  1 253 ? 20.895  -15.887 31.038  1.00 43.49  ? 252  VAL D C   1 
ATOM   9054  O O   . VAL D  1 253 ? 20.614  -15.126 31.954  1.00 39.99  ? 252  VAL D O   1 
ATOM   9055  C CB  . VAL D  1 253 ? 18.756  -16.044 29.799  1.00 38.52  ? 252  VAL D CB  1 
ATOM   9056  C CG1 . VAL D  1 253 ? 19.359  -15.186 28.698  1.00 40.99  ? 252  VAL D CG1 1 
ATOM   9057  C CG2 . VAL D  1 253 ? 17.691  -16.980 29.240  1.00 39.57  ? 252  VAL D CG2 1 
ATOM   9058  N N   . ARG D  1 254 ? 22.098  -15.938 30.477  1.00 45.11  ? 253  ARG D N   1 
ATOM   9059  C CA  . ARG D  1 254 ? 23.194  -15.102 30.938  1.00 43.85  ? 253  ARG D CA  1 
ATOM   9060  C C   . ARG D  1 254 ? 23.579  -14.037 29.916  1.00 48.00  ? 253  ARG D C   1 
ATOM   9061  O O   . ARG D  1 254 ? 23.677  -14.312 28.725  1.00 54.79  ? 253  ARG D O   1 
ATOM   9062  C CB  . ARG D  1 254 ? 24.404  -15.974 31.288  1.00 41.82  ? 253  ARG D CB  1 
ATOM   9063  C CG  . ARG D  1 254 ? 24.280  -16.658 32.645  1.00 57.14  ? 253  ARG D CG  1 
ATOM   9064  C CD  . ARG D  1 254 ? 25.468  -17.559 32.942  1.00 42.76  ? 253  ARG D CD  1 
ATOM   9065  N NE  . ARG D  1 254 ? 25.544  -18.643 31.982  1.00 69.33  ? 253  ARG D NE  1 
ATOM   9066  C CZ  . ARG D  1 254 ? 26.677  -19.215 31.579  1.00 92.95  ? 253  ARG D CZ  1 
ATOM   9067  N NH1 . ARG D  1 254 ? 26.646  -20.197 30.688  1.00 76.30  ? 253  ARG D NH1 1 
ATOM   9068  N NH2 . ARG D  1 254 ? 27.848  -18.813 32.058  1.00 79.34  ? 253  ARG D NH2 1 
ATOM   9069  N N   . ASP D  1 255 ? 23.768  -12.812 30.396  1.00 48.45  ? 254  ASP D N   1 
ATOM   9070  C CA  . ASP D  1 255 ? 24.310  -11.733 29.587  1.00 39.58  ? 254  ASP D CA  1 
ATOM   9071  C C   . ASP D  1 255 ? 25.814  -11.666 29.743  1.00 48.69  ? 254  ASP D C   1 
ATOM   9072  O O   . ASP D  1 255 ? 26.399  -12.285 30.646  1.00 43.23  ? 254  ASP D O   1 
ATOM   9073  C CB  . ASP D  1 255 ? 23.717  -10.387 30.007  1.00 39.04  ? 254  ASP D CB  1 
ATOM   9074  C CG  . ASP D  1 255 ? 22.350  -10.142 29.421  1.00 46.79  ? 254  ASP D CG  1 
ATOM   9075  O OD1 . ASP D  1 255 ? 21.898  -8.985  29.463  1.00 39.39  ? 254  ASP D OD1 1 
ATOM   9076  O OD2 . ASP D  1 255 ? 21.724  -11.101 28.929  1.00 42.16  ? 254  ASP D OD2 1 
ATOM   9077  N N   . ASP D  1 256 ? 26.422  -10.875 28.870  1.00 42.07  ? 255  ASP D N   1 
ATOM   9078  C CA  . ASP D  1 256 ? 27.862  -10.732 28.816  1.00 50.28  ? 255  ASP D CA  1 
ATOM   9079  C C   . ASP D  1 256 ? 28.178  -9.261  29.062  1.00 56.90  ? 255  ASP D C   1 
ATOM   9080  O O   . ASP D  1 256 ? 27.856  -8.405  28.249  1.00 47.42  ? 255  ASP D O   1 
ATOM   9081  C CB  . ASP D  1 256 ? 28.359  -11.182 27.440  1.00 61.63  ? 255  ASP D CB  1 
ATOM   9082  C CG  . ASP D  1 256 ? 29.870  -11.148 27.315  1.00 68.26  ? 255  ASP D CG  1 
ATOM   9083  O OD1 . ASP D  1 256 ? 30.571  -11.209 28.348  1.00 60.70  ? 255  ASP D OD1 1 
ATOM   9084  O OD2 . ASP D  1 256 ? 30.355  -11.075 26.166  1.00 60.90  ? 255  ASP D OD2 1 
ATOM   9085  N N   . TYR D  1 257 ? 28.771  -8.968  30.210  1.00 59.35  ? 256  TYR D N   1 
ATOM   9086  C CA  . TYR D  1 257 ? 29.127  -7.604  30.556  1.00 57.37  ? 256  TYR D CA  1 
ATOM   9087  C C   . TYR D  1 257 ? 30.635  -7.454  30.515  1.00 51.89  ? 256  TYR D C   1 
ATOM   9088  O O   . TYR D  1 257 ? 31.361  -8.132  31.241  1.00 53.73  ? 256  TYR D O   1 
ATOM   9089  C CB  . TYR D  1 257 ? 28.618  -7.263  31.950  1.00 50.48  ? 256  TYR D CB  1 
ATOM   9090  C CG  . TYR D  1 257 ? 28.945  -5.860  32.376  1.00 45.13  ? 256  TYR D CG  1 
ATOM   9091  C CD1 . TYR D  1 257 ? 30.007  -5.604  33.235  1.00 52.23  ? 256  TYR D CD1 1 
ATOM   9092  C CD2 . TYR D  1 257 ? 28.201  -4.786  31.910  1.00 43.11  ? 256  TYR D CD2 1 
ATOM   9093  C CE1 . TYR D  1 257 ? 30.309  -4.315  33.630  1.00 52.07  ? 256  TYR D CE1 1 
ATOM   9094  C CE2 . TYR D  1 257 ? 28.495  -3.492  32.297  1.00 50.51  ? 256  TYR D CE2 1 
ATOM   9095  C CZ  . TYR D  1 257 ? 29.549  -3.260  33.156  1.00 52.94  ? 256  TYR D CZ  1 
ATOM   9096  O OH  . TYR D  1 257 ? 29.839  -1.968  33.541  1.00 64.70  ? 256  TYR D OH  1 
ATOM   9097  N N   . GLN D  1 258 ? 31.107  -6.561  29.661  1.00 54.30  ? 257  GLN D N   1 
ATOM   9098  C CA  . GLN D  1 258 ? 32.537  -6.361  29.497  1.00 61.17  ? 257  GLN D CA  1 
ATOM   9099  C C   . GLN D  1 258 ? 32.927  -4.933  29.821  1.00 60.22  ? 257  GLN D C   1 
ATOM   9100  O O   . GLN D  1 258 ? 32.194  -3.986  29.534  1.00 51.19  ? 257  GLN D O   1 
ATOM   9101  C CB  . GLN D  1 258 ? 32.950  -6.708  28.070  1.00 66.79  ? 257  GLN D CB  1 
ATOM   9102  C CG  . GLN D  1 258 ? 32.704  -8.167  27.721  1.00 58.38  ? 257  GLN D CG  1 
ATOM   9103  C CD  . GLN D  1 258 ? 33.117  -8.513  26.302  1.00 80.15  ? 257  GLN D CD  1 
ATOM   9104  O OE1 . GLN D  1 258 ? 32.779  -7.803  25.353  1.00 65.98  ? 257  GLN D OE1 1 
ATOM   9105  N NE2 . GLN D  1 258 ? 33.853  -9.611  26.151  1.00 73.41  ? 257  GLN D NE2 1 
ATOM   9106  N N   . LEU D  1 259 ? 34.073  -4.778  30.458  1.00 42.44  ? 258  LEU D N   1 
ATOM   9107  C CA  . LEU D  1 259 ? 34.637  -3.457  30.606  1.00 78.46  ? 258  LEU D CA  1 
ATOM   9108  C C   . LEU D  1 259 ? 36.054  -3.452  30.027  1.00 79.76  ? 258  LEU D C   1 
ATOM   9109  O O   . LEU D  1 259 ? 36.709  -4.491  29.918  1.00 66.64  ? 258  LEU D O   1 
ATOM   9110  C CB  . LEU D  1 259 ? 34.571  -2.996  32.067  1.00 54.50  ? 258  LEU D CB  1 
ATOM   9111  C CG  . LEU D  1 259 ? 34.923  -4.018  33.145  1.00 79.96  ? 258  LEU D CG  1 
ATOM   9112  C CD1 . LEU D  1 259 ? 36.413  -4.302  33.135  1.00 86.72  ? 258  LEU D CD1 1 
ATOM   9113  C CD2 . LEU D  1 259 ? 34.475  -3.527  34.518  1.00 57.10  ? 258  LEU D CD2 1 
ATOM   9114  N N   . HIS D  1 260 ? 36.508  -2.283  29.603  1.00 73.47  ? 259  HIS D N   1 
ATOM   9115  C CA  . HIS D  1 260 ? 37.851  -2.161  29.065  1.00 79.75  ? 259  HIS D CA  1 
ATOM   9116  C C   . HIS D  1 260 ? 38.387  -0.771  29.345  1.00 68.98  ? 259  HIS D C   1 
ATOM   9117  O O   . HIS D  1 260 ? 37.631  0.207   29.391  1.00 60.10  ? 259  HIS D O   1 
ATOM   9118  C CB  . HIS D  1 260 ? 37.865  -2.452  27.566  1.00 63.89  ? 259  HIS D CB  1 
ATOM   9119  C CG  . HIS D  1 260 ? 37.015  -1.520  26.765  1.00 88.08  ? 259  HIS D CG  1 
ATOM   9120  N ND1 . HIS D  1 260 ? 35.735  -1.838  26.369  1.00 94.89  ? 259  HIS D ND1 1 
ATOM   9121  C CD2 . HIS D  1 260 ? 37.262  -0.277  26.288  1.00 94.03  ? 259  HIS D CD2 1 
ATOM   9122  C CE1 . HIS D  1 260 ? 35.228  -0.830  25.680  1.00 104.48 ? 259  HIS D CE1 1 
ATOM   9123  N NE2 . HIS D  1 260 ? 36.135  0.130   25.617  1.00 89.96  ? 259  HIS D NE2 1 
ATOM   9124  N N   . TRP D  1 261 ? 39.695  -0.701  29.558  1.00 70.11  ? 260  TRP D N   1 
ATOM   9125  C CA  . TRP D  1 261 ? 40.369  0.560   29.816  1.00 83.81  ? 260  TRP D CA  1 
ATOM   9126  C C   . TRP D  1 261 ? 40.498  1.344   28.525  1.00 76.04  ? 260  TRP D C   1 
ATOM   9127  O O   . TRP D  1 261 ? 41.241  0.958   27.623  1.00 80.17  ? 260  TRP D O   1 
ATOM   9128  C CB  . TRP D  1 261 ? 41.751  0.317   30.424  1.00 82.61  ? 260  TRP D CB  1 
ATOM   9129  C CG  . TRP D  1 261 ? 42.482  1.573   30.777  1.00 88.90  ? 260  TRP D CG  1 
ATOM   9130  C CD1 . TRP D  1 261 ? 43.665  2.007   30.258  1.00 91.59  ? 260  TRP D CD1 1 
ATOM   9131  C CD2 . TRP D  1 261 ? 42.076  2.562   31.730  1.00 88.99  ? 260  TRP D CD2 1 
ATOM   9132  N NE1 . TRP D  1 261 ? 44.023  3.202   30.830  1.00 82.92  ? 260  TRP D NE1 1 
ATOM   9133  C CE2 . TRP D  1 261 ? 43.062  3.565   31.737  1.00 89.89  ? 260  TRP D CE2 1 
ATOM   9134  C CE3 . TRP D  1 261 ? 40.972  2.696   32.579  1.00 75.08  ? 260  TRP D CE3 1 
ATOM   9135  C CZ2 . TRP D  1 261 ? 42.980  4.686   32.557  1.00 87.10  ? 260  TRP D CZ2 1 
ATOM   9136  C CZ3 . TRP D  1 261 ? 40.892  3.808   33.392  1.00 77.61  ? 260  TRP D CZ3 1 
ATOM   9137  C CH2 . TRP D  1 261 ? 41.889  4.788   33.377  1.00 84.94  ? 260  TRP D CH2 1 
ATOM   9138  N N   . THR D  1 262 ? 39.725  2.417   28.430  1.00 73.86  ? 261  THR D N   1 
ATOM   9139  C CA  . THR D  1 262 ? 39.911  3.414   27.394  1.00 92.70  ? 261  THR D CA  1 
ATOM   9140  C C   . THR D  1 262 ? 41.186  4.164   27.761  1.00 98.51  ? 261  THR D C   1 
ATOM   9141  O O   . THR D  1 262 ? 41.679  4.044   28.884  1.00 100.18 ? 261  THR D O   1 
ATOM   9142  C CB  . THR D  1 262 ? 38.683  4.359   27.312  1.00 90.92  ? 261  THR D CB  1 
ATOM   9143  O OG1 . THR D  1 262 ? 37.666  3.746   26.511  1.00 89.95  ? 261  THR D OG1 1 
ATOM   9144  C CG2 . THR D  1 262 ? 39.038  5.707   26.709  1.00 79.34  ? 261  THR D CG2 1 
ATOM   9145  N N   . SER D  1 263 ? 41.739  4.910   26.816  1.00 96.81  ? 262  SER D N   1 
ATOM   9146  C CA  . SER D  1 263 ? 42.934  5.698   27.085  1.00 95.98  ? 262  SER D CA  1 
ATOM   9147  C C   . SER D  1 263 ? 42.811  6.466   28.401  1.00 88.61  ? 262  SER D C   1 
ATOM   9148  O O   . SER D  1 263 ? 43.800  6.664   29.105  1.00 89.50  ? 262  SER D O   1 
ATOM   9149  C CB  . SER D  1 263 ? 43.171  6.678   25.941  1.00 79.27  ? 262  SER D CB  1 
ATOM   9150  O OG  . SER D  1 263 ? 42.070  7.559   25.802  1.00 91.13  ? 262  SER D OG  1 
ATOM   9151  N N   . THR D  1 264 ? 41.588  6.874   28.733  1.00 93.20  ? 263  THR D N   1 
ATOM   9152  C CA  . THR D  1 264 ? 41.343  7.775   29.854  1.00 94.39  ? 263  THR D CA  1 
ATOM   9153  C C   . THR D  1 264 ? 40.499  7.166   30.987  1.00 98.49  ? 263  THR D C   1 
ATOM   9154  O O   . THR D  1 264 ? 40.793  7.386   32.163  1.00 89.78  ? 263  THR D O   1 
ATOM   9155  C CB  . THR D  1 264 ? 40.643  9.051   29.360  1.00 105.88 ? 263  THR D CB  1 
ATOM   9156  O OG1 . THR D  1 264 ? 39.543  8.691   28.516  1.00 96.34  ? 263  THR D OG1 1 
ATOM   9157  C CG2 . THR D  1 264 ? 41.607  9.918   28.568  1.00 111.96 ? 263  THR D CG2 1 
ATOM   9158  N N   . ASN D  1 265 ? 39.457  6.412   30.641  1.00 76.44  ? 264  ASN D N   1 
ATOM   9159  C CA  . ASN D  1 265 ? 38.546  5.863   31.649  1.00 77.74  ? 264  ASN D CA  1 
ATOM   9160  C C   . ASN D  1 265 ? 38.044  4.455   31.332  1.00 77.03  ? 264  ASN D C   1 
ATOM   9161  O O   . ASN D  1 265 ? 38.253  3.940   30.240  1.00 72.47  ? 264  ASN D O   1 
ATOM   9162  C CB  . ASN D  1 265 ? 37.339  6.782   31.805  1.00 67.54  ? 264  ASN D CB  1 
ATOM   9163  C CG  . ASN D  1 265 ? 36.565  6.948   30.511  1.00 87.86  ? 264  ASN D CG  1 
ATOM   9164  O OD1 . ASN D  1 265 ? 36.802  7.882   29.747  1.00 98.47  ? 264  ASN D OD1 1 
ATOM   9165  N ND2 . ASN D  1 265 ? 35.636  6.037   30.257  1.00 78.30  ? 264  ASN D ND2 1 
ATOM   9166  N N   . TRP D  1 266 ? 37.368  3.836   32.292  1.00 76.88  ? 265  TRP D N   1 
ATOM   9167  C CA  . TRP D  1 266 ? 36.751  2.533   32.055  1.00 70.64  ? 265  TRP D CA  1 
ATOM   9168  C C   . TRP D  1 266 ? 35.432  2.679   31.281  1.00 48.96  ? 265  TRP D C   1 
ATOM   9169  O O   . TRP D  1 266 ? 34.666  3.612   31.500  1.00 65.20  ? 265  TRP D O   1 
ATOM   9170  C CB  . TRP D  1 266 ? 36.495  1.813   33.376  1.00 68.81  ? 265  TRP D CB  1 
ATOM   9171  C CG  . TRP D  1 266 ? 37.729  1.317   34.091  1.00 47.53  ? 265  TRP D CG  1 
ATOM   9172  C CD1 . TRP D  1 266 ? 38.268  1.828   35.237  1.00 54.70  ? 265  TRP D CD1 1 
ATOM   9173  C CD2 . TRP D  1 266 ? 38.552  0.196   33.726  1.00 55.04  ? 265  TRP D CD2 1 
ATOM   9174  N NE1 . TRP D  1 266 ? 39.377  1.102   35.603  1.00 64.31  ? 265  TRP D NE1 1 
ATOM   9175  C CE2 . TRP D  1 266 ? 39.574  0.096   34.695  1.00 48.29  ? 265  TRP D CE2 1 
ATOM   9176  C CE3 . TRP D  1 266 ? 38.525  -0.731  32.679  1.00 42.65  ? 265  TRP D CE3 1 
ATOM   9177  C CZ2 . TRP D  1 266 ? 40.558  -0.892  34.646  1.00 55.23  ? 265  TRP D CZ2 1 
ATOM   9178  C CZ3 . TRP D  1 266 ? 39.505  -1.711  32.631  1.00 61.67  ? 265  TRP D CZ3 1 
ATOM   9179  C CH2 . TRP D  1 266 ? 40.507  -1.785  33.609  1.00 56.68  ? 265  TRP D CH2 1 
ATOM   9180  N N   . LYS D  1 267 ? 35.174  1.749   30.372  1.00 54.68  ? 266  LYS D N   1 
ATOM   9181  C CA  . LYS D  1 267 ? 33.947  1.771   29.590  1.00 61.90  ? 266  LYS D CA  1 
ATOM   9182  C C   . LYS D  1 267 ? 33.333  0.376   29.596  1.00 64.44  ? 266  LYS D C   1 
ATOM   9183  O O   . LYS D  1 267 ? 34.040  -0.614  29.413  1.00 57.25  ? 266  LYS D O   1 
ATOM   9184  C CB  . LYS D  1 267 ? 34.245  2.211   28.160  1.00 54.46  ? 266  LYS D CB  1 
ATOM   9185  C CG  . LYS D  1 267 ? 33.016  2.580   27.353  1.00 73.05  ? 266  LYS D CG  1 
ATOM   9186  C CD  . LYS D  1 267 ? 33.391  3.197   26.016  1.00 67.83  ? 266  LYS D CD  1 
ATOM   9187  C CE  . LYS D  1 267 ? 32.165  3.734   25.286  1.00 78.06  ? 266  LYS D CE  1 
ATOM   9188  N NZ  . LYS D  1 267 ? 32.513  4.391   23.986  1.00 85.15  ? 266  LYS D NZ  1 
ATOM   9189  N N   . GLY D  1 268 ? 32.022  0.298   29.813  1.00 67.38  ? 267  GLY D N   1 
ATOM   9190  C CA  . GLY D  1 268 ? 31.344  -0.985  29.894  1.00 62.49  ? 267  GLY D CA  1 
ATOM   9191  C C   . GLY D  1 268 ? 30.393  -1.223  28.734  1.00 59.09  ? 267  GLY D C   1 
ATOM   9192  O O   . GLY D  1 268 ? 29.815  -0.282  28.188  1.00 54.59  ? 267  GLY D O   1 
ATOM   9193  N N   . THR D  1 269 ? 30.245  -2.484  28.343  1.00 40.53  ? 268  THR D N   1 
ATOM   9194  C CA  . THR D  1 269 ? 29.254  -2.866  27.347  1.00 59.93  ? 268  THR D CA  1 
ATOM   9195  C C   . THR D  1 269 ? 28.531  -4.127  27.799  1.00 52.49  ? 268  THR D C   1 
ATOM   9196  O O   . THR D  1 269 ? 29.101  -4.964  28.499  1.00 47.00  ? 268  THR D O   1 
ATOM   9197  C CB  . THR D  1 269 ? 29.899  -3.135  25.972  1.00 65.04  ? 268  THR D CB  1 
ATOM   9198  O OG1 . THR D  1 269 ? 30.814  -4.236  26.074  1.00 69.37  ? 268  THR D OG1 1 
ATOM   9199  C CG2 . THR D  1 269 ? 30.638  -1.895  25.468  1.00 66.59  ? 268  THR D CG2 1 
ATOM   9200  N N   . ASN D  1 270 ? 27.281  -4.273  27.382  1.00 50.08  ? 269  ASN D N   1 
ATOM   9201  C CA  . ASN D  1 270 ? 26.522  -5.460  27.730  1.00 54.18  ? 269  ASN D CA  1 
ATOM   9202  C C   . ASN D  1 270 ? 25.870  -6.103  26.519  1.00 42.99  ? 269  ASN D C   1 
ATOM   9203  O O   . ASN D  1 270 ? 25.115  -5.462  25.795  1.00 53.36  ? 269  ASN D O   1 
ATOM   9204  C CB  . ASN D  1 270 ? 25.460  -5.122  28.773  1.00 54.90  ? 269  ASN D CB  1 
ATOM   9205  C CG  . ASN D  1 270 ? 24.721  -6.351  29.260  1.00 52.44  ? 269  ASN D CG  1 
ATOM   9206  O OD1 . ASN D  1 270 ? 25.242  -7.108  30.069  1.00 43.76  ? 269  ASN D OD1 1 
ATOM   9207  N ND2 . ASN D  1 270 ? 23.509  -6.558  28.761  1.00 42.27  ? 269  ASN D ND2 1 
ATOM   9208  N N   . THR D  1 271 ? 26.164  -7.380  26.316  1.00 39.31  ? 270  THR D N   1 
ATOM   9209  C CA  . THR D  1 271 ? 25.563  -8.158  25.242  1.00 59.19  ? 270  THR D CA  1 
ATOM   9210  C C   . THR D  1 271 ? 24.459  -9.035  25.824  1.00 49.25  ? 270  THR D C   1 
ATOM   9211  O O   . THR D  1 271 ? 24.693  -9.822  26.741  1.00 49.13  ? 270  THR D O   1 
ATOM   9212  C CB  . THR D  1 271 ? 26.606  -9.049  24.548  1.00 54.78  ? 270  THR D CB  1 
ATOM   9213  O OG1 . THR D  1 271 ? 27.734  -8.255  24.166  1.00 63.83  ? 270  THR D OG1 1 
ATOM   9214  C CG2 . THR D  1 271 ? 26.007  -9.724  23.317  1.00 58.43  ? 270  THR D CG2 1 
ATOM   9215  N N   . LYS D  1 272 ? 23.253  -8.885  25.294  1.00 36.86  ? 271  LYS D N   1 
ATOM   9216  C CA  . LYS D  1 272 ? 22.093  -9.623  25.774  1.00 45.36  ? 271  LYS D CA  1 
ATOM   9217  C C   . LYS D  1 272 ? 22.045  -11.071 25.298  1.00 53.66  ? 271  LYS D C   1 
ATOM   9218  O O   . LYS D  1 272 ? 22.441  -11.386 24.170  1.00 61.80  ? 271  LYS D O   1 
ATOM   9219  C CB  . LYS D  1 272 ? 20.821  -8.930  25.310  1.00 45.00  ? 271  LYS D CB  1 
ATOM   9220  C CG  . LYS D  1 272 ? 20.670  -7.514  25.815  1.00 48.08  ? 271  LYS D CG  1 
ATOM   9221  C CD  . LYS D  1 272 ? 19.383  -6.922  25.282  1.00 57.34  ? 271  LYS D CD  1 
ATOM   9222  C CE  . LYS D  1 272 ? 19.197  -5.497  25.713  1.00 56.91  ? 271  LYS D CE  1 
ATOM   9223  N NZ  . LYS D  1 272 ? 17.912  -4.967  25.189  1.00 80.03  ? 271  LYS D NZ  1 
ATOM   9224  N N   . ASP D  1 273 ? 21.552  -11.940 26.180  1.00 58.09  ? 272  ASP D N   1 
ATOM   9225  C CA  . ASP D  1 273 ? 21.260  -13.333 25.855  1.00 54.20  ? 272  ASP D CA  1 
ATOM   9226  C C   . ASP D  1 273 ? 22.419  -14.038 25.143  1.00 53.95  ? 272  ASP D C   1 
ATOM   9227  O O   . ASP D  1 273 ? 22.225  -14.691 24.126  1.00 55.97  ? 272  ASP D O   1 
ATOM   9228  C CB  . ASP D  1 273 ? 19.996  -13.402 24.995  1.00 51.57  ? 272  ASP D CB  1 
ATOM   9229  C CG  . ASP D  1 273 ? 18.847  -12.587 25.581  1.00 71.32  ? 272  ASP D CG  1 
ATOM   9230  O OD1 . ASP D  1 273 ? 18.882  -12.287 26.790  1.00 61.30  ? 272  ASP D OD1 1 
ATOM   9231  O OD2 . ASP D  1 273 ? 17.905  -12.246 24.835  1.00 83.91  ? 272  ASP D OD2 1 
ATOM   9232  N N   . LYS D  1 274 ? 23.616  -13.903 25.700  1.00 53.74  ? 273  LYS D N   1 
ATOM   9233  C CA  . LYS D  1 274 ? 24.795  -14.546 25.161  1.00 54.10  ? 273  LYS D CA  1 
ATOM   9234  C C   . LYS D  1 274 ? 24.712  -16.061 25.346  1.00 65.79  ? 273  LYS D C   1 
ATOM   9235  O O   . LYS D  1 274 ? 24.833  -16.816 24.380  1.00 66.76  ? 273  LYS D O   1 
ATOM   9236  C CB  . LYS D  1 274 ? 26.037  -14.003 25.862  1.00 61.93  ? 273  LYS D CB  1 
ATOM   9237  C CG  . LYS D  1 274 ? 27.353  -14.491 25.282  1.00 69.28  ? 273  LYS D CG  1 
ATOM   9238  C CD  . LYS D  1 274 ? 27.807  -13.626 24.131  1.00 69.51  ? 273  LYS D CD  1 
ATOM   9239  C CE  . LYS D  1 274 ? 29.237  -13.962 23.738  1.00 82.69  ? 273  LYS D CE  1 
ATOM   9240  N NZ  . LYS D  1 274 ? 29.786  -13.021 22.727  1.00 99.98  ? 273  LYS D NZ  1 
ATOM   9241  N N   . TRP D  1 275 ? 24.509  -16.504 26.585  1.00 47.31  ? 274  TRP D N   1 
ATOM   9242  C CA  . TRP D  1 275 ? 24.448  -17.937 26.868  1.00 48.65  ? 274  TRP D CA  1 
ATOM   9243  C C   . TRP D  1 275 ? 23.104  -18.354 27.453  1.00 46.88  ? 274  TRP D C   1 
ATOM   9244  O O   . TRP D  1 275 ? 22.388  -17.542 28.029  1.00 54.47  ? 274  TRP D O   1 
ATOM   9245  C CB  . TRP D  1 275 ? 25.570  -18.330 27.825  1.00 50.13  ? 274  TRP D CB  1 
ATOM   9246  C CG  . TRP D  1 275 ? 26.928  -17.947 27.340  1.00 66.76  ? 274  TRP D CG  1 
ATOM   9247  C CD1 . TRP D  1 275 ? 27.691  -18.614 26.431  1.00 56.56  ? 274  TRP D CD1 1 
ATOM   9248  C CD2 . TRP D  1 275 ? 27.691  -16.804 27.744  1.00 64.35  ? 274  TRP D CD2 1 
ATOM   9249  N NE1 . TRP D  1 275 ? 28.883  -17.959 26.242  1.00 59.58  ? 274  TRP D NE1 1 
ATOM   9250  C CE2 . TRP D  1 275 ? 28.907  -16.843 27.036  1.00 66.90  ? 274  TRP D CE2 1 
ATOM   9251  C CE3 . TRP D  1 275 ? 27.463  -15.752 28.632  1.00 47.02  ? 274  TRP D CE3 1 
ATOM   9252  C CZ2 . TRP D  1 275 ? 29.892  -15.871 27.191  1.00 54.50  ? 274  TRP D CZ2 1 
ATOM   9253  C CZ3 . TRP D  1 275 ? 28.446  -14.787 28.783  1.00 56.54  ? 274  TRP D CZ3 1 
ATOM   9254  C CH2 . TRP D  1 275 ? 29.644  -14.856 28.069  1.00 56.30  ? 274  TRP D CH2 1 
ATOM   9255  N N   . THR D  1 276 ? 22.768  -19.628 27.303  1.00 52.95  ? 275  THR D N   1 
ATOM   9256  C CA  . THR D  1 276 ? 21.553  -20.182 27.881  1.00 43.96  ? 275  THR D CA  1 
ATOM   9257  C C   . THR D  1 276 ? 21.845  -21.562 28.454  1.00 57.53  ? 275  THR D C   1 
ATOM   9258  O O   . THR D  1 276 ? 22.417  -22.409 27.782  1.00 57.16  ? 275  THR D O   1 
ATOM   9259  C CB  . THR D  1 276 ? 20.434  -20.300 26.841  1.00 53.90  ? 275  THR D CB  1 
ATOM   9260  O OG1 . THR D  1 276 ? 20.031  -18.990 26.425  1.00 58.34  ? 275  THR D OG1 1 
ATOM   9261  C CG2 . THR D  1 276 ? 19.239  -21.018 27.420  1.00 59.39  ? 275  THR D CG2 1 
ATOM   9262  N N   . ASP D  1 277 ? 21.468  -21.765 29.711  1.00 46.12  ? 276  ASP D N   1 
ATOM   9263  C CA  . ASP D  1 277 ? 21.610  -23.048 30.375  1.00 47.06  ? 276  ASP D CA  1 
ATOM   9264  C C   . ASP D  1 277 ? 20.221  -23.644 30.589  1.00 50.49  ? 276  ASP D C   1 
ATOM   9265  O O   . ASP D  1 277 ? 19.344  -23.016 31.171  1.00 46.80  ? 276  ASP D O   1 
ATOM   9266  C CB  . ASP D  1 277 ? 22.335  -22.867 31.711  1.00 46.36  ? 276  ASP D CB  1 
ATOM   9267  C CG  . ASP D  1 277 ? 23.655  -22.114 31.562  1.00 78.03  ? 276  ASP D CG  1 
ATOM   9268  O OD1 . ASP D  1 277 ? 24.354  -22.368 30.555  1.00 75.69  ? 276  ASP D OD1 1 
ATOM   9269  O OD2 . ASP D  1 277 ? 23.995  -21.270 32.433  1.00 57.34  ? 276  ASP D OD2 1 
ATOM   9270  N N   . ARG D  1 278 ? 20.021  -24.859 30.107  1.00 47.77  ? 277  ARG D N   1 
ATOM   9271  C CA  . ARG D  1 278 ? 18.701  -25.468 30.100  1.00 42.58  ? 277  ARG D CA  1 
ATOM   9272  C C   . ARG D  1 278 ? 18.770  -26.837 30.756  1.00 45.04  ? 277  ARG D C   1 
ATOM   9273  O O   . ARG D  1 278 ? 19.612  -27.657 30.411  1.00 45.64  ? 277  ARG D O   1 
ATOM   9274  C CB  . ARG D  1 278 ? 18.210  -25.597 28.666  1.00 56.58  ? 277  ARG D CB  1 
ATOM   9275  C CG  . ARG D  1 278 ? 16.733  -25.395 28.483  1.00 68.12  ? 277  ARG D CG  1 
ATOM   9276  C CD  . ARG D  1 278 ? 16.401  -25.122 27.029  1.00 74.64  ? 277  ARG D CD  1 
ATOM   9277  N NE  . ARG D  1 278 ? 14.992  -24.799 26.850  1.00 73.89  ? 277  ARG D NE  1 
ATOM   9278  C CZ  . ARG D  1 278 ? 14.041  -25.696 26.617  1.00 82.30  ? 277  ARG D CZ  1 
ATOM   9279  N NH1 . ARG D  1 278 ? 12.786  -25.300 26.473  1.00 79.89  ? 277  ARG D NH1 1 
ATOM   9280  N NH2 . ARG D  1 278 ? 14.341  -26.985 26.527  1.00 98.93  ? 277  ARG D NH2 1 
ATOM   9281  N N   . SER D  1 279 ? 17.897  -27.070 31.731  1.00 48.08  ? 278  SER D N   1 
ATOM   9282  C CA  . SER D  1 279 ? 17.877  -28.340 32.448  1.00 48.48  ? 278  SER D CA  1 
ATOM   9283  C C   . SER D  1 279 ? 16.455  -28.905 32.458  1.00 53.39  ? 278  SER D C   1 
ATOM   9284  O O   . SER D  1 279 ? 15.523  -28.255 32.916  1.00 55.06  ? 278  SER D O   1 
ATOM   9285  C CB  . SER D  1 279 ? 18.401  -28.149 33.868  1.00 46.67  ? 278  SER D CB  1 
ATOM   9286  O OG  . SER D  1 279 ? 18.590  -29.397 34.505  1.00 55.04  ? 278  SER D OG  1 
ATOM   9287  N N   . SER D  1 280 ? 16.290  -30.112 31.938  1.00 48.87  ? 279  SER D N   1 
ATOM   9288  C CA  . SER D  1 280 ? 14.964  -30.684 31.753  1.00 48.10  ? 279  SER D CA  1 
ATOM   9289  C C   . SER D  1 280 ? 14.806  -31.983 32.529  1.00 57.74  ? 279  SER D C   1 
ATOM   9290  O O   . SER D  1 280 ? 15.765  -32.733 32.715  1.00 57.90  ? 279  SER D O   1 
ATOM   9291  C CB  . SER D  1 280 ? 14.698  -30.972 30.273  1.00 56.98  ? 279  SER D CB  1 
ATOM   9292  O OG  . SER D  1 280 ? 14.750  -29.790 29.497  1.00 92.70  ? 279  SER D OG  1 
ATOM   9293  N N   . GLU D  1 281 ? 13.583  -32.239 32.978  1.00 43.40  ? 280  GLU D N   1 
ATOM   9294  C CA  . GLU D  1 281 ? 13.230  -33.520 33.562  1.00 45.89  ? 280  GLU D CA  1 
ATOM   9295  C C   . GLU D  1 281 ? 11.897  -33.941 32.979  1.00 45.27  ? 280  GLU D C   1 
ATOM   9296  O O   . GLU D  1 281 ? 11.055  -33.108 32.648  1.00 44.79  ? 280  GLU D O   1 
ATOM   9297  C CB  . GLU D  1 281 ? 13.102  -33.425 35.082  1.00 50.90  ? 280  GLU D CB  1 
ATOM   9298  C CG  . GLU D  1 281 ? 14.335  -32.912 35.777  1.00 62.26  ? 280  GLU D CG  1 
ATOM   9299  C CD  . GLU D  1 281 ? 15.494  -33.882 35.736  1.00 78.97  ? 280  GLU D CD  1 
ATOM   9300  O OE1 . GLU D  1 281 ? 16.648  -33.418 35.867  1.00 74.67  ? 280  GLU D OE1 1 
ATOM   9301  O OE2 . GLU D  1 281 ? 15.256  -35.103 35.587  1.00 72.30  ? 280  GLU D OE2 1 
ATOM   9302  N N   . ARG D  1 282 ? 11.705  -35.241 32.843  1.00 42.62  ? 281  ARG D N   1 
ATOM   9303  C CA  . ARG D  1 282 ? 10.419  -35.757 32.427  1.00 46.58  ? 281  ARG D CA  1 
ATOM   9304  C C   . ARG D  1 282 ? 9.863   -36.605 33.567  1.00 41.97  ? 281  ARG D C   1 
ATOM   9305  O O   . ARG D  1 282 ? 10.567  -37.444 34.130  1.00 39.93  ? 281  ARG D O   1 
ATOM   9306  C CB  . ARG D  1 282 ? 10.545  -36.582 31.145  1.00 48.30  ? 281  ARG D CB  1 
ATOM   9307  C CG  . ARG D  1 282 ? 9.246   -37.250 30.745  1.00 63.38  ? 281  ARG D CG  1 
ATOM   9308  C CD  . ARG D  1 282 ? 9.278   -37.755 29.318  1.00 66.16  ? 281  ARG D CD  1 
ATOM   9309  N NE  . ARG D  1 282 ? 9.335   -36.652 28.370  1.00 68.49  ? 281  ARG D NE  1 
ATOM   9310  C CZ  . ARG D  1 282 ? 9.214   -36.785 27.056  1.00 89.63  ? 281  ARG D CZ  1 
ATOM   9311  N NH1 . ARG D  1 282 ? 9.283   -35.716 26.274  1.00 87.29  ? 281  ARG D NH1 1 
ATOM   9312  N NH2 . ARG D  1 282 ? 9.021   -37.984 26.522  1.00 90.31  ? 281  ARG D NH2 1 
ATOM   9313  N N   . TYR D  1 283 ? 8.603   -36.375 33.906  1.00 39.41  ? 282  TYR D N   1 
ATOM   9314  C CA  . TYR D  1 283 ? 7.969   -37.094 35.004  1.00 45.93  ? 282  TYR D CA  1 
ATOM   9315  C C   . TYR D  1 283 ? 6.784   -37.872 34.484  1.00 38.85  ? 282  TYR D C   1 
ATOM   9316  O O   . TYR D  1 283 ? 6.164   -37.506 33.482  1.00 42.43  ? 282  TYR D O   1 
ATOM   9317  C CB  . TYR D  1 283 ? 7.491   -36.132 36.095  1.00 36.89  ? 282  TYR D CB  1 
ATOM   9318  C CG  . TYR D  1 283 ? 8.581   -35.302 36.721  1.00 38.60  ? 282  TYR D CG  1 
ATOM   9319  C CD1 . TYR D  1 283 ? 8.886   -34.033 36.234  1.00 42.36  ? 282  TYR D CD1 1 
ATOM   9320  C CD2 . TYR D  1 283 ? 9.307   -35.781 37.804  1.00 34.72  ? 282  TYR D CD2 1 
ATOM   9321  C CE1 . TYR D  1 283 ? 9.884   -33.262 36.820  1.00 40.80  ? 282  TYR D CE1 1 
ATOM   9322  C CE2 . TYR D  1 283 ? 10.311  -35.020 38.390  1.00 37.36  ? 282  TYR D CE2 1 
ATOM   9323  C CZ  . TYR D  1 283 ? 10.587  -33.761 37.899  1.00 36.94  ? 282  TYR D CZ  1 
ATOM   9324  O OH  . TYR D  1 283 ? 11.580  -33.013 38.483  1.00 49.16  ? 282  TYR D OH  1 
ATOM   9325  N N   . LYS D  1 284 ? 6.471   -38.952 35.174  1.00 29.38  ? 283  LYS D N   1 
ATOM   9326  C CA  . LYS D  1 284 ? 5.276   -39.706 34.883  1.00 38.71  ? 283  LYS D CA  1 
ATOM   9327  C C   . LYS D  1 284 ? 4.236   -39.390 35.957  1.00 41.55  ? 283  LYS D C   1 
ATOM   9328  O O   . LYS D  1 284 ? 4.498   -39.504 37.156  1.00 37.64  ? 283  LYS D O   1 
ATOM   9329  C CB  . LYS D  1 284 ? 5.597   -41.199 34.861  1.00 40.13  ? 283  LYS D CB  1 
ATOM   9330  C CG  . LYS D  1 284 ? 4.404   -42.094 34.575  1.00 52.09  ? 283  LYS D CG  1 
ATOM   9331  C CD  . LYS D  1 284 ? 4.782   -43.571 34.685  1.00 58.48  ? 283  LYS D CD  1 
ATOM   9332  C CE  . LYS D  1 284 ? 3.592   -44.478 34.418  1.00 80.56  ? 283  LYS D CE  1 
ATOM   9333  N NZ  . LYS D  1 284 ? 3.955   -45.922 34.507  1.00 92.15  ? 283  LYS D NZ  1 
ATOM   9334  N N   . ILE D  1 285 ? 3.068   -38.958 35.511  1.00 36.30  ? 284  ILE D N   1 
ATOM   9335  C CA  . ILE D  1 285 ? 1.921   -38.767 36.380  1.00 40.28  ? 284  ILE D CA  1 
ATOM   9336  C C   . ILE D  1 285 ? 1.019   -39.985 36.267  1.00 45.02  ? 284  ILE D C   1 
ATOM   9337  O O   . ILE D  1 285 ? 0.434   -40.235 35.215  1.00 42.44  ? 284  ILE D O   1 
ATOM   9338  C CB  . ILE D  1 285 ? 1.105   -37.544 35.964  1.00 34.27  ? 284  ILE D CB  1 
ATOM   9339  C CG1 . ILE D  1 285 ? 1.977   -36.284 36.016  1.00 33.83  ? 284  ILE D CG1 1 
ATOM   9340  C CG2 . ILE D  1 285 ? -0.121  -37.407 36.862  1.00 33.31  ? 284  ILE D CG2 1 
ATOM   9341  C CD1 . ILE D  1 285 ? 1.314   -35.053 35.414  1.00 35.00  ? 284  ILE D CD1 1 
ATOM   9342  N N   . ASP D  1 286 ? 0.916   -40.752 37.344  1.00 36.30  ? 285  ASP D N   1 
ATOM   9343  C CA  . ASP D  1 286 ? -0.009  -41.877 37.385  1.00 36.86  ? 285  ASP D CA  1 
ATOM   9344  C C   . ASP D  1 286 ? -1.281  -41.467 38.133  1.00 39.96  ? 285  ASP D C   1 
ATOM   9345  O O   . ASP D  1 286 ? -1.296  -41.431 39.363  1.00 36.64  ? 285  ASP D O   1 
ATOM   9346  C CB  . ASP D  1 286 ? 0.648   -43.071 38.081  1.00 42.23  ? 285  ASP D CB  1 
ATOM   9347  C CG  . ASP D  1 286 ? -0.152  -44.351 37.920  1.00 65.02  ? 285  ASP D CG  1 
ATOM   9348  O OD1 . ASP D  1 286 ? -1.370  -44.260 37.639  1.00 55.53  ? 285  ASP D OD1 1 
ATOM   9349  O OD2 . ASP D  1 286 ? 0.440   -45.447 38.063  1.00 73.28  ? 285  ASP D OD2 1 
ATOM   9350  N N   . TRP D  1 287 ? -2.338  -41.161 37.383  1.00 42.47  ? 286  TRP D N   1 
ATOM   9351  C CA  . TRP D  1 287 ? -3.576  -40.645 37.957  1.00 40.28  ? 286  TRP D CA  1 
ATOM   9352  C C   . TRP D  1 287 ? -4.343  -41.689 38.770  1.00 50.33  ? 286  TRP D C   1 
ATOM   9353  O O   . TRP D  1 287 ? -5.166  -41.336 39.610  1.00 47.12  ? 286  TRP D O   1 
ATOM   9354  C CB  . TRP D  1 287 ? -4.494  -40.104 36.855  1.00 38.81  ? 286  TRP D CB  1 
ATOM   9355  C CG  . TRP D  1 287 ? -3.960  -38.897 36.142  1.00 44.23  ? 286  TRP D CG  1 
ATOM   9356  C CD1 . TRP D  1 287 ? -3.268  -38.887 34.965  1.00 45.55  ? 286  TRP D CD1 1 
ATOM   9357  C CD2 . TRP D  1 287 ? -4.069  -37.526 36.553  1.00 39.44  ? 286  TRP D CD2 1 
ATOM   9358  N NE1 . TRP D  1 287 ? -2.943  -37.599 34.617  1.00 47.80  ? 286  TRP D NE1 1 
ATOM   9359  C CE2 . TRP D  1 287 ? -3.419  -36.745 35.574  1.00 43.37  ? 286  TRP D CE2 1 
ATOM   9360  C CE3 . TRP D  1 287 ? -4.650  -36.885 37.653  1.00 38.82  ? 286  TRP D CE3 1 
ATOM   9361  C CZ2 . TRP D  1 287 ? -3.338  -35.352 35.655  1.00 41.52  ? 286  TRP D CZ2 1 
ATOM   9362  C CZ3 . TRP D  1 287 ? -4.571  -35.506 37.737  1.00 37.96  ? 286  TRP D CZ3 1 
ATOM   9363  C CH2 . TRP D  1 287 ? -3.920  -34.750 36.738  1.00 37.43  ? 286  TRP D CH2 1 
ATOM   9364  N N   . GLU D  1 288 ? -4.090  -42.967 38.510  1.00 46.84  ? 287  GLU D N   1 
ATOM   9365  C CA  . GLU D  1 288 ? -4.802  -44.040 39.205  1.00 49.56  ? 287  GLU D CA  1 
ATOM   9366  C C   . GLU D  1 288 ? -4.152  -44.361 40.545  1.00 41.01  ? 287  GLU D C   1 
ATOM   9367  O O   . GLU D  1 288 ? -4.843  -44.512 41.543  1.00 52.71  ? 287  GLU D O   1 
ATOM   9368  C CB  . GLU D  1 288 ? -4.892  -45.294 38.322  1.00 47.71  ? 287  GLU D CB  1 
ATOM   9369  C CG  . GLU D  1 288 ? -5.868  -45.124 37.165  1.00 50.66  ? 287  GLU D CG  1 
ATOM   9370  C CD  . GLU D  1 288 ? -5.704  -46.172 36.075  1.00 77.26  ? 287  GLU D CD  1 
ATOM   9371  O OE1 . GLU D  1 288 ? -4.572  -46.685 35.892  1.00 71.67  ? 287  GLU D OE1 1 
ATOM   9372  O OE2 . GLU D  1 288 ? -6.713  -46.476 35.395  1.00 64.00  ? 287  GLU D OE2 1 
ATOM   9373  N N   . LYS D  1 289 ? -2.827  -44.450 40.571  1.00 40.96  ? 288  LYS D N   1 
ATOM   9374  C CA  . LYS D  1 289 ? -2.107  -44.637 41.828  1.00 47.88  ? 288  LYS D CA  1 
ATOM   9375  C C   . LYS D  1 289 ? -1.923  -43.315 42.579  1.00 45.43  ? 288  LYS D C   1 
ATOM   9376  O O   . LYS D  1 289 ? -1.543  -43.304 43.749  1.00 38.92  ? 288  LYS D O   1 
ATOM   9377  C CB  . LYS D  1 289 ? -0.737  -45.274 41.569  1.00 51.71  ? 288  LYS D CB  1 
ATOM   9378  C CG  . LYS D  1 289 ? -0.814  -46.677 40.996  1.00 70.44  ? 288  LYS D CG  1 
ATOM   9379  C CD  . LYS D  1 289 ? 0.564   -47.251 40.712  1.00 84.59  ? 288  LYS D CD  1 
ATOM   9380  C CE  . LYS D  1 289 ? 1.393   -47.384 41.980  1.00 94.77  ? 288  LYS D CE  1 
ATOM   9381  N NZ  . LYS D  1 289 ? 2.744   -47.959 41.708  1.00 97.99  ? 288  LYS D NZ  1 
ATOM   9382  N N   . GLU D  1 290 ? -2.193  -42.206 41.895  1.00 47.45  ? 289  GLU D N   1 
ATOM   9383  C CA  . GLU D  1 290 ? -1.943  -40.883 42.452  1.00 49.79  ? 289  GLU D CA  1 
ATOM   9384  C C   . GLU D  1 290 ? -0.504  -40.785 42.938  1.00 49.66  ? 289  GLU D C   1 
ATOM   9385  O O   . GLU D  1 290 ? -0.246  -40.500 44.113  1.00 39.27  ? 289  GLU D O   1 
ATOM   9386  C CB  . GLU D  1 290 ? -2.931  -40.566 43.583  1.00 42.61  ? 289  GLU D CB  1 
ATOM   9387  C CG  . GLU D  1 290 ? -4.354  -40.383 43.075  1.00 39.66  ? 289  GLU D CG  1 
ATOM   9388  C CD  . GLU D  1 290 ? -5.327  -39.982 44.159  1.00 66.49  ? 289  GLU D CD  1 
ATOM   9389  O OE1 . GLU D  1 290 ? -4.984  -40.111 45.354  1.00 82.27  ? 289  GLU D OE1 1 
ATOM   9390  O OE2 . GLU D  1 290 ? -6.440  -39.534 43.814  1.00 80.09  ? 289  GLU D OE2 1 
ATOM   9391  N N   . GLU D  1 291 ? 0.432   -41.043 42.026  1.00 38.48  ? 290  GLU D N   1 
ATOM   9392  C CA  . GLU D  1 291 ? 1.834   -40.788 42.304  1.00 43.30  ? 290  GLU D CA  1 
ATOM   9393  C C   . GLU D  1 291 ? 2.525   -40.190 41.093  1.00 48.51  ? 290  GLU D C   1 
ATOM   9394  O O   . GLU D  1 291 ? 2.050   -40.292 39.967  1.00 40.64  ? 290  GLU D O   1 
ATOM   9395  C CB  . GLU D  1 291 ? 2.549   -42.059 42.745  1.00 50.44  ? 290  GLU D CB  1 
ATOM   9396  C CG  . GLU D  1 291 ? 2.688   -43.096 41.673  1.00 67.62  ? 290  GLU D CG  1 
ATOM   9397  C CD  . GLU D  1 291 ? 3.287   -44.387 42.204  1.00 95.10  ? 290  GLU D CD  1 
ATOM   9398  O OE1 . GLU D  1 291 ? 2.988   -44.747 43.365  1.00 92.19  ? 290  GLU D OE1 1 
ATOM   9399  O OE2 . GLU D  1 291 ? 4.059   -45.038 41.467  1.00 87.54  ? 290  GLU D OE2 1 
ATOM   9400  N N   . MET D  1 292 ? 3.655   -39.550 41.348  1.00 39.14  ? 291  MET D N   1 
ATOM   9401  C CA  . MET D  1 292 ? 4.414   -38.887 40.316  1.00 39.73  ? 291  MET D CA  1 
ATOM   9402  C C   . MET D  1 292 ? 5.849   -39.341 40.497  1.00 45.52  ? 291  MET D C   1 
ATOM   9403  O O   . MET D  1 292 ? 6.355   -39.350 41.614  1.00 36.71  ? 291  MET D O   1 
ATOM   9404  C CB  . MET D  1 292 ? 4.289   -37.375 40.491  1.00 40.29  ? 291  MET D CB  1 
ATOM   9405  C CG  . MET D  1 292 ? 4.684   -36.557 39.290  1.00 51.55  ? 291  MET D CG  1 
ATOM   9406  S SD  . MET D  1 292 ? 4.189   -34.837 39.503  1.00 46.47  ? 291  MET D SD  1 
ATOM   9407  C CE  . MET D  1 292 ? 4.989   -34.132 38.055  1.00 42.82  ? 291  MET D CE  1 
ATOM   9408  N N   . THR D  1 293 ? 6.498   -39.745 39.409  1.00 38.64  ? 292  THR D N   1 
ATOM   9409  C CA  . THR D  1 293 ? 7.870   -40.236 39.491  1.00 48.76  ? 292  THR D CA  1 
ATOM   9410  C C   . THR D  1 293 ? 8.731   -39.664 38.369  1.00 44.30  ? 292  THR D C   1 
ATOM   9411  O O   . THR D  1 293 ? 8.231   -39.298 37.308  1.00 40.20  ? 292  THR D O   1 
ATOM   9412  C CB  . THR D  1 293 ? 7.916   -41.776 39.418  1.00 49.81  ? 292  THR D CB  1 
ATOM   9413  O OG1 . THR D  1 293 ? 7.254   -42.218 38.225  1.00 50.24  ? 292  THR D OG1 1 
ATOM   9414  C CG2 . THR D  1 293 ? 7.240   -42.393 40.635  1.00 50.66  ? 292  THR D CG2 1 
ATOM   9415  N N   . ASN D  1 294 ? 10.031  -39.583 38.612  1.00 41.33  ? 293  ASN D N   1 
ATOM   9416  C CA  . ASN D  1 294 ? 10.964  -39.137 37.588  1.00 44.08  ? 293  ASN D CA  1 
ATOM   9417  C C   . ASN D  1 294 ? 11.293  -40.308 36.663  1.00 46.86  ? 293  ASN D C   1 
ATOM   9418  O O   . ASN D  1 294 ? 11.715  -41.361 37.140  1.00 43.28  ? 293  ASN D O   1 
ATOM   9419  C CB  . ASN D  1 294 ? 12.240  -38.608 38.246  1.00 46.07  ? 293  ASN D CB  1 
ATOM   9420  C CG  . ASN D  1 294 ? 13.097  -37.797 37.293  1.00 52.02  ? 293  ASN D CG  1 
ATOM   9421  O OD1 . ASN D  1 294 ? 13.128  -38.060 36.092  1.00 52.94  ? 293  ASN D OD1 1 
ATOM   9422  N ND2 . ASN D  1 294 ? 13.792  -36.800 37.823  1.00 52.90  ? 293  ASN D ND2 1 
ATOM   9423  N N   . LEU D  1 295 ? 11.076  -40.157 35.355  1.00 45.40  ? 294  LEU D N   1 
ATOM   9424  C CA  . LEU D  1 295 ? 11.388  -41.252 34.421  1.00 62.39  ? 294  LEU D CA  1 
ATOM   9425  C C   . LEU D  1 295 ? 12.889  -41.529 34.344  1.00 45.33  ? 294  LEU D C   1 
ATOM   9426  O O   . LEU D  1 295 ? 13.308  -42.499 33.741  1.00 49.21  ? 294  LEU D O   1 
ATOM   9427  C CB  . LEU D  1 295 ? 10.804  -40.996 33.036  1.00 45.58  ? 294  LEU D CB  1 
ATOM   9428  C CG  . LEU D  1 295 ? 9.275   -41.084 33.018  1.00 38.00  ? 294  LEU D CG  1 
ATOM   9429  C CD1 . LEU D  1 295 ? 8.716   -40.735 31.643  1.00 56.18  ? 294  LEU D CD1 1 
ATOM   9430  C CD2 . LEU D  1 295 ? 8.814   -42.474 33.448  1.00 59.41  ? 294  LEU D CD2 1 
ATOM   9431  N N   . GLU D  1 296 ? 13.675  -40.672 34.990  1.00 60.06  ? 295  GLU D N   1 
ATOM   9432  C CA  . GLU D  1 296 ? 15.080  -40.941 35.314  1.00 79.82  ? 295  GLU D CA  1 
ATOM   9433  C C   . GLU D  1 296 ? 15.999  -40.203 34.363  1.00 52.81  ? 295  GLU D C   1 
ATOM   9434  O O   . GLU D  1 296 ? 16.582  -39.185 34.736  1.00 83.81  ? 295  GLU D O   1 
ATOM   9435  C CB  . GLU D  1 296 ? 15.406  -42.446 35.332  1.00 57.65  ? 295  GLU D CB  1 
ATOM   9436  C CG  . GLU D  1 296 ? 16.223  -42.885 36.555  1.00 88.80  ? 295  GLU D CG  1 
ATOM   9437  C CD  . GLU D  1 296 ? 17.493  -43.641 36.190  1.00 89.00  ? 295  GLU D CD  1 
ATOM   9438  O OE1 . GLU D  1 296 ? 18.060  -43.364 35.114  1.00 82.00  ? 295  GLU D OE1 1 
ATOM   9439  O OE2 . GLU D  1 296 ? 17.925  -44.512 36.979  1.00 70.78  ? 295  GLU D OE2 1 
ATOM   9440  N N   . ALA E  1 2   ? -21.403 -5.031  57.127  1.00 68.34  ? 1    ALA E N   1 
ATOM   9441  C CA  . ALA E  1 2   ? -21.179 -6.410  57.651  1.00 79.17  ? 1    ALA E CA  1 
ATOM   9442  C C   . ALA E  1 2   ? -22.197 -6.735  58.738  1.00 72.07  ? 1    ALA E C   1 
ATOM   9443  O O   . ALA E  1 2   ? -22.741 -5.833  59.375  1.00 67.94  ? 1    ALA E O   1 
ATOM   9444  C CB  . ALA E  1 2   ? -19.764 -6.548  58.194  1.00 74.83  ? 1    ALA E CB  1 
ATOM   9445  N N   . ASP E  1 3   ? -22.451 -8.024  58.946  1.00 53.09  ? 2    ASP E N   1 
ATOM   9446  C CA  . ASP E  1 3   ? -23.436 -8.458  59.923  1.00 54.62  ? 2    ASP E CA  1 
ATOM   9447  C C   . ASP E  1 3   ? -23.136 -7.851  61.291  1.00 50.84  ? 2    ASP E C   1 
ATOM   9448  O O   . ASP E  1 3   ? -24.047 -7.468  62.020  1.00 44.24  ? 2    ASP E O   1 
ATOM   9449  C CB  . ASP E  1 3   ? -23.468 -9.986  60.016  1.00 56.02  ? 2    ASP E CB  1 
ATOM   9450  C CG  . ASP E  1 3   ? -23.962 -10.645 58.730  1.00 81.52  ? 2    ASP E CG  1 
ATOM   9451  O OD1 . ASP E  1 3   ? -23.705 -10.090 57.640  1.00 96.39  ? 2    ASP E OD1 1 
ATOM   9452  O OD2 . ASP E  1 3   ? -24.602 -11.718 58.804  1.00 71.31  ? 2    ASP E OD2 1 
ATOM   9453  N N   . SER E  1 4   ? -21.854 -7.752  61.629  1.00 44.07  ? 3    SER E N   1 
ATOM   9454  C CA  . SER E  1 4   ? -21.444 -7.216  62.924  1.00 58.15  ? 3    SER E CA  1 
ATOM   9455  C C   . SER E  1 4   ? -21.891 -5.762  63.127  1.00 56.57  ? 3    SER E C   1 
ATOM   9456  O O   . SER E  1 4   ? -22.198 -5.348  64.248  1.00 61.05  ? 3    SER E O   1 
ATOM   9457  C CB  . SER E  1 4   ? -19.927 -7.321  63.075  1.00 61.14  ? 3    SER E CB  1 
ATOM   9458  O OG  . SER E  1 4   ? -19.268 -6.723  61.971  1.00 72.46  ? 3    SER E OG  1 
ATOM   9459  N N   . ASP E  1 5   ? -21.935 -4.992  62.044  1.00 44.08  ? 4    ASP E N   1 
ATOM   9460  C CA  . ASP E  1 5   ? -22.377 -3.600  62.113  1.00 51.63  ? 4    ASP E CA  1 
ATOM   9461  C C   . ASP E  1 5   ? -23.861 -3.469  62.444  1.00 52.45  ? 4    ASP E C   1 
ATOM   9462  O O   . ASP E  1 5   ? -24.316 -2.413  62.876  1.00 49.04  ? 4    ASP E O   1 
ATOM   9463  C CB  . ASP E  1 5   ? -22.082 -2.880  60.796  1.00 59.27  ? 4    ASP E CB  1 
ATOM   9464  C CG  . ASP E  1 5   ? -20.605 -2.852  60.473  1.00 59.77  ? 4    ASP E CG  1 
ATOM   9465  O OD1 . ASP E  1 5   ? -19.868 -2.135  61.179  1.00 61.07  ? 4    ASP E OD1 1 
ATOM   9466  O OD2 . ASP E  1 5   ? -20.182 -3.547  59.524  1.00 69.73  ? 4    ASP E OD2 1 
ATOM   9467  N N   . ILE E  1 6   ? -24.616 -4.541  62.245  1.00 45.97  ? 5    ILE E N   1 
ATOM   9468  C CA  . ILE E  1 6   ? -26.036 -4.531  62.571  1.00 42.47  ? 5    ILE E CA  1 
ATOM   9469  C C   . ILE E  1 6   ? -26.357 -5.575  63.641  1.00 43.84  ? 5    ILE E C   1 
ATOM   9470  O O   . ILE E  1 6   ? -27.445 -6.152  63.664  1.00 49.29  ? 5    ILE E O   1 
ATOM   9471  C CB  . ILE E  1 6   ? -26.897 -4.733  61.310  1.00 44.57  ? 5    ILE E CB  1 
ATOM   9472  C CG1 . ILE E  1 6   ? -26.482 -6.002  60.570  1.00 40.20  ? 5    ILE E CG1 1 
ATOM   9473  C CG2 . ILE E  1 6   ? -26.749 -3.526  60.370  1.00 43.76  ? 5    ILE E CG2 1 
ATOM   9474  C CD1 . ILE E  1 6   ? -27.339 -6.288  59.356  1.00 40.86  ? 5    ILE E CD1 1 
ATOM   9475  N N   . ASN E  1 7   ? -25.394 -5.807  64.529  1.00 39.17  ? 6    ASN E N   1 
ATOM   9476  C CA  . ASN E  1 7   ? -25.601 -6.655  65.707  1.00 51.30  ? 6    ASN E CA  1 
ATOM   9477  C C   . ASN E  1 7   ? -26.041 -8.083  65.393  1.00 42.53  ? 6    ASN E C   1 
ATOM   9478  O O   . ASN E  1 7   ? -26.810 -8.685  66.141  1.00 44.57  ? 6    ASN E O   1 
ATOM   9479  C CB  . ASN E  1 7   ? -26.618 -5.999  66.647  1.00 39.78  ? 6    ASN E CB  1 
ATOM   9480  C CG  . ASN E  1 7   ? -26.216 -4.588  67.039  1.00 59.85  ? 6    ASN E CG  1 
ATOM   9481  O OD1 . ASN E  1 7   ? -26.906 -3.618  66.724  1.00 49.46  ? 6    ASN E OD1 1 
ATOM   9482  N ND2 . ASN E  1 7   ? -25.086 -4.468  67.722  1.00 49.95  ? 6    ASN E ND2 1 
ATOM   9483  N N   . ILE E  1 8   ? -25.542 -8.627  64.291  1.00 50.27  ? 7    ILE E N   1 
ATOM   9484  C CA  . ILE E  1 8   ? -25.867 -9.996  63.902  1.00 46.67  ? 7    ILE E CA  1 
ATOM   9485  C C   . ILE E  1 8   ? -24.585 -10.810 63.824  1.00 50.14  ? 7    ILE E C   1 
ATOM   9486  O O   . ILE E  1 8   ? -23.571 -10.326 63.318  1.00 44.19  ? 7    ILE E O   1 
ATOM   9487  C CB  . ILE E  1 8   ? -26.601 -10.024 62.551  1.00 43.51  ? 7    ILE E CB  1 
ATOM   9488  C CG1 . ILE E  1 8   ? -27.967 -9.346  62.684  1.00 50.17  ? 7    ILE E CG1 1 
ATOM   9489  C CG2 . ILE E  1 8   ? -26.781 -11.440 62.076  1.00 47.70  ? 7    ILE E CG2 1 
ATOM   9490  C CD1 . ILE E  1 8   ? -28.683 -9.158  61.371  1.00 48.69  ? 7    ILE E CD1 1 
ATOM   9491  N N   . LYS E  1 9   ? -24.627 -12.030 64.353  1.00 47.95  ? 8    LYS E N   1 
ATOM   9492  C CA  . LYS E  1 9   ? -23.483 -12.935 64.311  1.00 47.96  ? 8    LYS E CA  1 
ATOM   9493  C C   . LYS E  1 9   ? -22.940 -12.998 62.894  1.00 44.49  ? 8    LYS E C   1 
ATOM   9494  O O   . LYS E  1 9   ? -23.698 -13.165 61.941  1.00 51.86  ? 8    LYS E O   1 
ATOM   9495  C CB  . LYS E  1 9   ? -23.894 -14.346 64.756  1.00 57.38  ? 8    LYS E CB  1 
ATOM   9496  C CG  . LYS E  1 9   ? -23.194 -14.857 66.010  1.00 79.06  ? 8    LYS E CG  1 
ATOM   9497  C CD  . LYS E  1 9   ? -24.089 -14.758 67.237  1.00 74.55  ? 8    LYS E CD  1 
ATOM   9498  C CE  . LYS E  1 9   ? -23.421 -15.357 68.467  1.00 77.55  ? 8    LYS E CE  1 
ATOM   9499  N NZ  . LYS E  1 9   ? -24.302 -15.301 69.670  1.00 74.29  ? 8    LYS E NZ  1 
ATOM   9500  N N   . THR E  1 10  ? -21.627 -12.863 62.752  1.00 38.71  ? 9    THR E N   1 
ATOM   9501  C CA  . THR E  1 10  ? -20.990 -12.934 61.442  1.00 45.97  ? 9    THR E CA  1 
ATOM   9502  C C   . THR E  1 10  ? -21.334 -14.235 60.704  1.00 55.58  ? 9    THR E C   1 
ATOM   9503  O O   . THR E  1 10  ? -21.305 -15.322 61.288  1.00 47.20  ? 9    THR E O   1 
ATOM   9504  C CB  . THR E  1 10  ? -19.456 -12.817 61.570  1.00 57.78  ? 9    THR E CB  1 
ATOM   9505  O OG1 . THR E  1 10  ? -19.122 -11.608 62.265  1.00 72.89  ? 9    THR E OG1 1 
ATOM   9506  C CG2 . THR E  1 10  ? -18.805 -12.798 60.203  1.00 50.73  ? 9    THR E CG2 1 
ATOM   9507  N N   . GLY E  1 11  ? -21.667 -14.108 59.421  1.00 57.13  ? 10   GLY E N   1 
ATOM   9508  C CA  . GLY E  1 11  ? -21.950 -15.256 58.576  1.00 46.97  ? 10   GLY E CA  1 
ATOM   9509  C C   . GLY E  1 11  ? -23.383 -15.757 58.637  1.00 51.84  ? 10   GLY E C   1 
ATOM   9510  O O   . GLY E  1 11  ? -23.773 -16.610 57.839  1.00 55.02  ? 10   GLY E O   1 
ATOM   9511  N N   . THR E  1 12  ? -24.168 -15.222 59.571  1.00 51.36  ? 11   THR E N   1 
ATOM   9512  C CA  . THR E  1 12  ? -25.549 -15.663 59.778  1.00 54.23  ? 11   THR E CA  1 
ATOM   9513  C C   . THR E  1 12  ? -26.412 -15.579 58.513  1.00 52.08  ? 11   THR E C   1 
ATOM   9514  O O   . THR E  1 12  ? -27.229 -16.457 58.248  1.00 52.66  ? 11   THR E O   1 
ATOM   9515  C CB  . THR E  1 12  ? -26.236 -14.841 60.895  1.00 49.23  ? 11   THR E CB  1 
ATOM   9516  O OG1 . THR E  1 12  ? -25.582 -15.079 62.145  1.00 62.49  ? 11   THR E OG1 1 
ATOM   9517  C CG2 . THR E  1 12  ? -27.705 -15.228 61.027  1.00 50.74  ? 11   THR E CG2 1 
ATOM   9518  N N   . THR E  1 13  ? -26.237 -14.518 57.736  1.00 44.10  ? 12   THR E N   1 
ATOM   9519  C CA  . THR E  1 13  ? -27.093 -14.295 56.577  1.00 52.02  ? 12   THR E CA  1 
ATOM   9520  C C   . THR E  1 13  ? -26.503 -14.793 55.252  1.00 50.26  ? 12   THR E C   1 
ATOM   9521  O O   . THR E  1 13  ? -27.158 -14.688 54.222  1.00 63.47  ? 12   THR E O   1 
ATOM   9522  C CB  . THR E  1 13  ? -27.415 -12.801 56.407  1.00 55.76  ? 12   THR E CB  1 
ATOM   9523  O OG1 . THR E  1 13  ? -26.219 -12.084 56.080  1.00 51.72  ? 12   THR E OG1 1 
ATOM   9524  C CG2 . THR E  1 13  ? -28.039 -12.231 57.680  1.00 42.39  ? 12   THR E CG2 1 
ATOM   9525  N N   . ASP E  1 14  ? -25.273 -15.303 55.260  1.00 44.77  ? 13   ASP E N   1 
ATOM   9526  C CA  . ASP E  1 14  ? -24.673 -15.873 54.042  1.00 52.01  ? 13   ASP E CA  1 
ATOM   9527  C C   . ASP E  1 14  ? -25.304 -17.207 53.633  1.00 51.69  ? 13   ASP E C   1 
ATOM   9528  O O   . ASP E  1 14  ? -25.867 -17.926 54.461  1.00 47.16  ? 13   ASP E O   1 
ATOM   9529  C CB  . ASP E  1 14  ? -23.161 -16.068 54.205  1.00 39.39  ? 13   ASP E CB  1 
ATOM   9530  C CG  . ASP E  1 14  ? -22.409 -14.755 54.250  1.00 75.83  ? 13   ASP E CG  1 
ATOM   9531  O OD1 . ASP E  1 14  ? -23.030 -13.712 53.945  1.00 68.45  ? 13   ASP E OD1 1 
ATOM   9532  O OD2 . ASP E  1 14  ? -21.201 -14.770 54.581  1.00 85.26  ? 13   ASP E OD2 1 
ATOM   9533  N N   . ILE E  1 15  ? -25.190 -17.533 52.350  1.00 45.05  ? 14   ILE E N   1 
ATOM   9534  C CA  . ILE E  1 15  ? -25.781 -18.743 51.801  1.00 41.28  ? 14   ILE E CA  1 
ATOM   9535  C C   . ILE E  1 15  ? -24.726 -19.828 51.810  1.00 51.73  ? 14   ILE E C   1 
ATOM   9536  O O   . ILE E  1 15  ? -23.531 -19.526 51.761  1.00 50.91  ? 14   ILE E O   1 
ATOM   9537  C CB  . ILE E  1 15  ? -26.211 -18.519 50.335  1.00 52.75  ? 14   ILE E CB  1 
ATOM   9538  C CG1 . ILE E  1 15  ? -27.143 -17.319 50.215  1.00 66.89  ? 14   ILE E CG1 1 
ATOM   9539  C CG2 . ILE E  1 15  ? -26.903 -19.736 49.772  1.00 63.01  ? 14   ILE E CG2 1 
ATOM   9540  C CD1 . ILE E  1 15  ? -27.417 -16.936 48.770  1.00 76.39  ? 14   ILE E CD1 1 
ATOM   9541  N N   . GLY E  1 16  ? -25.148 -21.088 51.862  1.00 56.17  ? 15   GLY E N   1 
ATOM   9542  C CA  . GLY E  1 16  ? -24.246 -22.176 51.527  1.00 59.07  ? 15   GLY E CA  1 
ATOM   9543  C C   . GLY E  1 16  ? -23.955 -23.175 52.625  1.00 86.06  ? 15   GLY E C   1 
ATOM   9544  O O   . GLY E  1 16  ? -23.339 -24.212 52.371  1.00 77.32  ? 15   GLY E O   1 
ATOM   9545  N N   . SER E  1 17  ? -24.381 -22.879 53.846  1.00 53.52  ? 16   SER E N   1 
ATOM   9546  C CA  . SER E  1 17  ? -24.122 -23.796 54.950  1.00 85.58  ? 16   SER E CA  1 
ATOM   9547  C C   . SER E  1 17  ? -25.037 -25.024 54.880  1.00 83.86  ? 16   SER E C   1 
ATOM   9548  O O   . SER E  1 17  ? -26.186 -24.932 54.443  1.00 85.99  ? 16   SER E O   1 
ATOM   9549  C CB  . SER E  1 17  ? -24.289 -23.077 56.290  1.00 84.38  ? 16   SER E CB  1 
ATOM   9550  O OG  . SER E  1 17  ? -25.600 -22.560 56.428  1.00 100.40 ? 16   SER E OG  1 
ATOM   9551  N N   . ASN E  1 18  ? -24.512 -26.173 55.300  1.00 74.22  ? 17   ASN E N   1 
ATOM   9552  C CA  . ASN E  1 18  ? -25.292 -27.409 55.388  1.00 74.82  ? 17   ASN E CA  1 
ATOM   9553  C C   . ASN E  1 18  ? -25.727 -27.953 54.020  1.00 87.63  ? 17   ASN E C   1 
ATOM   9554  O O   . ASN E  1 18  ? -26.821 -28.521 53.874  1.00 57.83  ? 17   ASN E O   1 
ATOM   9555  C CB  . ASN E  1 18  ? -26.516 -27.195 56.287  1.00 90.29  ? 17   ASN E CB  1 
ATOM   9556  C CG  . ASN E  1 18  ? -26.777 -28.375 57.211  1.00 104.37 ? 17   ASN E CG  1 
ATOM   9557  O OD1 . ASN E  1 18  ? -26.124 -28.522 58.245  1.00 112.64 ? 17   ASN E OD1 1 
ATOM   9558  N ND2 . ASN E  1 18  ? -27.738 -29.219 56.843  1.00 96.24  ? 17   ASN E ND2 1 
ATOM   9559  N N   . THR E  1 19  ? -24.863 -27.795 53.022  1.00 71.11  ? 18   THR E N   1 
ATOM   9560  C CA  . THR E  1 19  ? -25.182 -28.262 51.680  1.00 66.14  ? 18   THR E CA  1 
ATOM   9561  C C   . THR E  1 19  ? -23.950 -28.851 50.969  1.00 77.84  ? 18   THR E C   1 
ATOM   9562  O O   . THR E  1 19  ? -22.810 -28.419 51.174  1.00 59.43  ? 18   THR E O   1 
ATOM   9563  C CB  . THR E  1 19  ? -25.861 -27.134 50.816  1.00 74.33  ? 18   THR E CB  1 
ATOM   9564  O OG1 . THR E  1 19  ? -25.103 -26.892 49.623  1.00 69.51  ? 18   THR E OG1 1 
ATOM   9565  C CG2 . THR E  1 19  ? -26.008 -25.825 51.600  1.00 41.67  ? 18   THR E CG2 1 
ATOM   9566  N N   . THR E  1 20  ? -24.192 -29.870 50.155  1.00 63.88  ? 19   THR E N   1 
ATOM   9567  C CA  . THR E  1 20  ? -23.149 -30.437 49.314  1.00 51.55  ? 19   THR E CA  1 
ATOM   9568  C C   . THR E  1 20  ? -23.057 -29.603 48.043  1.00 51.69  ? 19   THR E C   1 
ATOM   9569  O O   . THR E  1 20  ? -24.068 -29.330 47.391  1.00 56.64  ? 19   THR E O   1 
ATOM   9570  C CB  . THR E  1 20  ? -23.450 -31.907 48.962  1.00 49.46  ? 19   THR E CB  1 
ATOM   9571  O OG1 . THR E  1 20  ? -23.482 -32.687 50.163  1.00 71.58  ? 19   THR E OG1 1 
ATOM   9572  C CG2 . THR E  1 20  ? -22.393 -32.472 48.029  1.00 48.30  ? 19   THR E CG2 1 
ATOM   9573  N N   . VAL E  1 21  ? -21.847 -29.177 47.706  1.00 40.89  ? 20   VAL E N   1 
ATOM   9574  C CA  . VAL E  1 21  ? -21.648 -28.298 46.557  1.00 43.67  ? 20   VAL E CA  1 
ATOM   9575  C C   . VAL E  1 21  ? -20.952 -29.060 45.435  1.00 38.89  ? 20   VAL E C   1 
ATOM   9576  O O   . VAL E  1 21  ? -19.921 -29.701 45.664  1.00 45.67  ? 20   VAL E O   1 
ATOM   9577  C CB  . VAL E  1 21  ? -20.813 -27.069 46.947  1.00 40.07  ? 20   VAL E CB  1 
ATOM   9578  C CG1 . VAL E  1 21  ? -20.473 -26.231 45.724  1.00 40.50  ? 20   VAL E CG1 1 
ATOM   9579  C CG2 . VAL E  1 21  ? -21.555 -26.250 47.969  1.00 38.74  ? 20   VAL E CG2 1 
ATOM   9580  N N   . LYS E  1 22  ? -21.527 -29.006 44.234  1.00 40.70  ? 21   LYS E N   1 
ATOM   9581  C CA  . LYS E  1 22  ? -20.927 -29.646 43.062  1.00 46.00  ? 21   LYS E CA  1 
ATOM   9582  C C   . LYS E  1 22  ? -20.157 -28.613 42.246  1.00 41.61  ? 21   LYS E C   1 
ATOM   9583  O O   . LYS E  1 22  ? -20.678 -27.551 41.936  1.00 42.37  ? 21   LYS E O   1 
ATOM   9584  C CB  . LYS E  1 22  ? -22.002 -30.279 42.177  1.00 41.94  ? 21   LYS E CB  1 
ATOM   9585  C CG  . LYS E  1 22  ? -22.809 -31.346 42.853  1.00 46.16  ? 21   LYS E CG  1 
ATOM   9586  C CD  . LYS E  1 22  ? -21.978 -32.575 43.104  1.00 57.42  ? 21   LYS E CD  1 
ATOM   9587  C CE  . LYS E  1 22  ? -22.847 -33.713 43.592  1.00 75.35  ? 21   LYS E CE  1 
ATOM   9588  N NZ  . LYS E  1 22  ? -22.074 -34.978 43.690  1.00 80.63  ? 21   LYS E NZ  1 
ATOM   9589  N N   . THR E  1 23  ? -18.917 -28.929 41.897  1.00 33.51  ? 22   THR E N   1 
ATOM   9590  C CA  . THR E  1 23  ? -18.058 -27.975 41.214  1.00 36.89  ? 22   THR E CA  1 
ATOM   9591  C C   . THR E  1 23  ? -17.442 -28.634 39.985  1.00 43.94  ? 22   THR E C   1 
ATOM   9592  O O   . THR E  1 23  ? -17.464 -29.858 39.842  1.00 39.22  ? 22   THR E O   1 
ATOM   9593  C CB  . THR E  1 23  ? -16.932 -27.486 42.132  1.00 41.52  ? 22   THR E CB  1 
ATOM   9594  O OG1 . THR E  1 23  ? -16.126 -28.602 42.527  1.00 43.31  ? 22   THR E OG1 1 
ATOM   9595  C CG2 . THR E  1 23  ? -17.505 -26.802 43.384  1.00 37.10  ? 22   THR E CG2 1 
ATOM   9596  N N   . GLY E  1 24  ? -16.884 -27.820 39.099  1.00 39.91  ? 23   GLY E N   1 
ATOM   9597  C CA  . GLY E  1 24  ? -16.248 -28.346 37.908  1.00 41.88  ? 23   GLY E CA  1 
ATOM   9598  C C   . GLY E  1 24  ? -15.319 -27.355 37.234  1.00 39.88  ? 23   GLY E C   1 
ATOM   9599  O O   . GLY E  1 24  ? -15.407 -26.146 37.437  1.00 37.08  ? 23   GLY E O   1 
ATOM   9600  N N   . ASP E  1 25  ? -14.411 -27.892 36.433  1.00 36.22  ? 24   ASP E N   1 
ATOM   9601  C CA  . ASP E  1 25  ? -13.521 -27.094 35.604  1.00 41.49  ? 24   ASP E CA  1 
ATOM   9602  C C   . ASP E  1 25  ? -13.776 -27.435 34.142  1.00 46.43  ? 24   ASP E C   1 
ATOM   9603  O O   . ASP E  1 25  ? -13.851 -28.608 33.790  1.00 38.51  ? 24   ASP E O   1 
ATOM   9604  C CB  . ASP E  1 25  ? -12.065 -27.414 35.944  1.00 44.51  ? 24   ASP E CB  1 
ATOM   9605  C CG  . ASP E  1 25  ? -11.558 -26.630 37.139  1.00 70.79  ? 24   ASP E CG  1 
ATOM   9606  O OD1 . ASP E  1 25  ? -11.768 -25.400 37.160  1.00 78.71  ? 24   ASP E OD1 1 
ATOM   9607  O OD2 . ASP E  1 25  ? -10.955 -27.238 38.058  1.00 68.28  ? 24   ASP E OD2 1 
ATOM   9608  N N   . LEU E  1 26  ? -13.911 -26.411 33.303  1.00 43.57  ? 25   LEU E N   1 
ATOM   9609  C CA  . LEU E  1 26  ? -13.997 -26.594 31.855  1.00 40.97  ? 25   LEU E CA  1 
ATOM   9610  C C   . LEU E  1 26  ? -12.916 -25.741 31.202  1.00 44.89  ? 25   LEU E C   1 
ATOM   9611  O O   . LEU E  1 26  ? -12.916 -24.524 31.334  1.00 41.57  ? 25   LEU E O   1 
ATOM   9612  C CB  . LEU E  1 26  ? -15.380 -26.193 31.341  1.00 36.56  ? 25   LEU E CB  1 
ATOM   9613  C CG  . LEU E  1 26  ? -16.535 -26.975 31.977  1.00 45.66  ? 25   LEU E CG  1 
ATOM   9614  C CD1 . LEU E  1 26  ? -17.865 -26.403 31.543  1.00 47.31  ? 25   LEU E CD1 1 
ATOM   9615  C CD2 . LEU E  1 26  ? -16.450 -28.464 31.623  1.00 42.00  ? 25   LEU E CD2 1 
ATOM   9616  N N   . VAL E  1 27  ? -11.986 -26.393 30.516  1.00 40.12  ? 26   VAL E N   1 
ATOM   9617  C CA  . VAL E  1 27  ? -10.850 -25.705 29.925  1.00 46.64  ? 26   VAL E CA  1 
ATOM   9618  C C   . VAL E  1 27  ? -10.832 -25.869 28.415  1.00 45.97  ? 26   VAL E C   1 
ATOM   9619  O O   . VAL E  1 27  ? -11.014 -26.961 27.908  1.00 37.12  ? 26   VAL E O   1 
ATOM   9620  C CB  . VAL E  1 27  ? -9.538  -26.279 30.474  1.00 48.24  ? 26   VAL E CB  1 
ATOM   9621  C CG1 . VAL E  1 27  ? -8.341  -25.644 29.778  1.00 40.71  ? 26   VAL E CG1 1 
ATOM   9622  C CG2 . VAL E  1 27  ? -9.464  -26.062 31.970  1.00 46.58  ? 26   VAL E CG2 1 
ATOM   9623  N N   . THR E  1 28  ? -10.603 -24.775 27.702  1.00 43.16  ? 27   THR E N   1 
ATOM   9624  C CA  . THR E  1 28  ? -10.418 -24.829 26.260  1.00 52.54  ? 27   THR E CA  1 
ATOM   9625  C C   . THR E  1 28  ? -9.353  -23.812 25.839  1.00 49.97  ? 27   THR E C   1 
ATOM   9626  O O   . THR E  1 28  ? -9.265  -22.724 26.406  1.00 48.13  ? 27   THR E O   1 
ATOM   9627  C CB  . THR E  1 28  ? -11.748 -24.563 25.510  1.00 52.76  ? 27   THR E CB  1 
ATOM   9628  O OG1 . THR E  1 28  ? -11.508 -24.536 24.098  1.00 80.02  ? 27   THR E OG1 1 
ATOM   9629  C CG2 . THR E  1 28  ? -12.349 -23.244 25.934  1.00 48.15  ? 27   THR E CG2 1 
ATOM   9630  N N   . TYR E  1 29  ? -8.533  -24.173 24.858  1.00 45.23  ? 28   TYR E N   1 
ATOM   9631  C CA  . TYR E  1 29  ? -7.548  -23.242 24.334  1.00 43.56  ? 28   TYR E CA  1 
ATOM   9632  C C   . TYR E  1 29  ? -7.851  -22.883 22.879  1.00 51.23  ? 28   TYR E C   1 
ATOM   9633  O O   . TYR E  1 29  ? -7.939  -23.755 22.025  1.00 48.12  ? 28   TYR E O   1 
ATOM   9634  C CB  . TYR E  1 29  ? -6.140  -23.815 24.446  1.00 38.93  ? 28   TYR E CB  1 
ATOM   9635  C CG  . TYR E  1 29  ? -5.099  -22.867 23.891  1.00 47.54  ? 28   TYR E CG  1 
ATOM   9636  C CD1 . TYR E  1 29  ? -4.847  -21.651 24.510  1.00 42.54  ? 28   TYR E CD1 1 
ATOM   9637  C CD2 . TYR E  1 29  ? -4.385  -23.175 22.737  1.00 46.80  ? 28   TYR E CD2 1 
ATOM   9638  C CE1 . TYR E  1 29  ? -3.905  -20.766 24.007  1.00 41.73  ? 28   TYR E CE1 1 
ATOM   9639  C CE2 . TYR E  1 29  ? -3.433  -22.293 22.224  1.00 49.03  ? 28   TYR E CE2 1 
ATOM   9640  C CZ  . TYR E  1 29  ? -3.205  -21.089 22.867  1.00 50.37  ? 28   TYR E CZ  1 
ATOM   9641  O OH  . TYR E  1 29  ? -2.274  -20.208 22.377  1.00 48.00  ? 28   TYR E OH  1 
ATOM   9642  N N   . ASP E  1 30  ? -8.022  -21.593 22.615  1.00 43.04  ? 29   ASP E N   1 
ATOM   9643  C CA  . ASP E  1 30  ? -8.259  -21.099 21.271  1.00 43.21  ? 29   ASP E CA  1 
ATOM   9644  C C   . ASP E  1 30  ? -6.925  -20.652 20.669  1.00 49.84  ? 29   ASP E C   1 
ATOM   9645  O O   . ASP E  1 30  ? -6.398  -19.589 21.001  1.00 45.60  ? 29   ASP E O   1 
ATOM   9646  C CB  . ASP E  1 30  ? -9.245  -19.930 21.298  1.00 39.53  ? 29   ASP E CB  1 
ATOM   9647  C CG  . ASP E  1 30  ? -9.556  -19.397 19.912  1.00 60.03  ? 29   ASP E CG  1 
ATOM   9648  O OD1 . ASP E  1 30  ? -10.634 -18.795 19.744  1.00 50.96  ? 29   ASP E OD1 1 
ATOM   9649  O OD2 . ASP E  1 30  ? -8.730  -19.588 18.988  1.00 54.29  ? 29   ASP E OD2 1 
ATOM   9650  N N   . LYS E  1 31  ? -6.394  -21.475 19.779  1.00 45.92  ? 30   LYS E N   1 
ATOM   9651  C CA  . LYS E  1 31  ? -5.071  -21.267 19.206  1.00 53.57  ? 30   LYS E CA  1 
ATOM   9652  C C   . LYS E  1 31  ? -5.027  -20.017 18.332  1.00 55.42  ? 30   LYS E C   1 
ATOM   9653  O O   . LYS E  1 31  ? -4.105  -19.209 18.452  1.00 51.06  ? 30   LYS E O   1 
ATOM   9654  C CB  . LYS E  1 31  ? -4.678  -22.499 18.386  1.00 62.46  ? 30   LYS E CB  1 
ATOM   9655  C CG  . LYS E  1 31  ? -3.188  -22.643 18.143  1.00 73.02  ? 30   LYS E CG  1 
ATOM   9656  C CD  . LYS E  1 31  ? -2.877  -23.998 17.518  1.00 106.79 ? 30   LYS E CD  1 
ATOM   9657  C CE  . LYS E  1 31  ? -1.385  -24.277 17.500  1.00 108.74 ? 30   LYS E CE  1 
ATOM   9658  N NZ  . LYS E  1 31  ? -0.644  -23.269 16.701  1.00 96.98  ? 30   LYS E NZ  1 
ATOM   9659  N N   . GLU E  1 32  ? -6.033  -19.856 17.473  1.00 53.74  ? 31   GLU E N   1 
ATOM   9660  C CA  . GLU E  1 32  ? -6.093  -18.726 16.548  1.00 64.91  ? 31   GLU E CA  1 
ATOM   9661  C C   . GLU E  1 32  ? -6.049  -17.397 17.280  1.00 63.05  ? 31   GLU E C   1 
ATOM   9662  O O   . GLU E  1 32  ? -5.405  -16.451 16.826  1.00 61.12  ? 31   GLU E O   1 
ATOM   9663  C CB  . GLU E  1 32  ? -7.364  -18.779 15.688  1.00 69.30  ? 31   GLU E CB  1 
ATOM   9664  C CG  . GLU E  1 32  ? -7.200  -19.494 14.351  1.00 100.16 ? 31   GLU E CG  1 
ATOM   9665  C CD  . GLU E  1 32  ? -7.284  -21.011 14.471  1.00 130.01 ? 31   GLU E CD  1 
ATOM   9666  O OE1 . GLU E  1 32  ? -7.476  -21.519 15.599  1.00 112.68 ? 31   GLU E OE1 1 
ATOM   9667  O OE2 . GLU E  1 32  ? -7.163  -21.695 13.430  1.00 137.49 ? 31   GLU E OE2 1 
ATOM   9668  N N   . ASN E  1 33  ? -6.741  -17.320 18.412  1.00 54.04  ? 32   ASN E N   1 
ATOM   9669  C CA  . ASN E  1 33  ? -6.886  -16.051 19.122  1.00 48.23  ? 32   ASN E CA  1 
ATOM   9670  C C   . ASN E  1 33  ? -5.958  -15.921 20.331  1.00 36.45  ? 32   ASN E C   1 
ATOM   9671  O O   . ASN E  1 33  ? -5.940  -14.886 20.978  1.00 51.01  ? 32   ASN E O   1 
ATOM   9672  C CB  . ASN E  1 33  ? -8.340  -15.843 19.544  1.00 49.11  ? 32   ASN E CB  1 
ATOM   9673  C CG  . ASN E  1 33  ? -9.251  -15.569 18.368  1.00 59.26  ? 32   ASN E CG  1 
ATOM   9674  O OD1 . ASN E  1 33  ? -8.993  -14.669 17.570  1.00 56.60  ? 32   ASN E OD1 1 
ATOM   9675  N ND2 . ASN E  1 33  ? -10.325 -16.350 18.248  1.00 55.00  ? 32   ASN E ND2 1 
ATOM   9676  N N   . GLY E  1 34  ? -5.192  -16.969 20.625  1.00 42.87  ? 33   GLY E N   1 
ATOM   9677  C CA  . GLY E  1 34  ? -4.280  -16.968 21.760  1.00 49.60  ? 33   GLY E CA  1 
ATOM   9678  C C   . GLY E  1 34  ? -4.983  -16.747 23.096  1.00 58.82  ? 33   GLY E C   1 
ATOM   9679  O O   . GLY E  1 34  ? -4.631  -15.844 23.868  1.00 46.70  ? 33   GLY E O   1 
ATOM   968