data_3AP3
# 
_entry.id   3AP3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3AP3         
RCSB  RCSB029522   
WWPDB D_1000029522 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3AP1 . unspecified 
PDB 3AP2 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3AP3 
_pdbx_database_status.recvd_initial_deposition_date   2010-10-09 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Teramoto, T.'     1  
'Fujikawa, Y.'     2  
'Kawaguchi, Y.'    3  
'Kurogi, K.'       4  
'Soejima, M.'      5  
'Adachi, R.'       6  
'Nakanishi, Y.'    7  
'Mishiro-Sato, E.' 8  
'Liu, M.-C.'       9  
'Sakakibara, Y.'   10 
'Suiko, M.'        11 
'Kimura, M.'       12 
'Kakuta, Y.'       13 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of human tyrosylprotein sulfotransferase-2 reveals the mechanism of protein tyrosine sulfation reaction.' 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_volume            4 
_citation.page_first                1572 
_citation.page_last                 1572 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23481380 
_citation.pdbx_database_id_DOI      10.1038/ncomms2593 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Teramoto, T.'     1  
primary 'Fujikawa, Y.'     2  
primary 'Kawaguchi, Y.'    3  
primary 'Kurogi, K.'       4  
primary 'Soejima, M.'      5  
primary 'Adachi, R.'       6  
primary 'Nakanishi, Y.'    7  
primary 'Mishiro-Sato, E.' 8  
primary 'Liu, M.C.'        9  
primary 'Sakakibara, Y.'   10 
primary 'Suiko, M.'        11 
primary 'Kimura, M.'       12 
primary 'Kakuta, Y.'       13 
# 
_cell.entry_id           3AP3 
_cell.length_a           71.432 
_cell.length_b           81.326 
_cell.length_c           226.659 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3AP3 
_symmetry.space_group_name_H-M             'P 2 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein-tyrosine sulfotransferase 2' 39638.688 4 2.8.2.20 ? 'UNP RESIDUES 43-377' ? 
2 non-polymer syn "ADENOSINE-3'-5'-DIPHOSPHATE"         427.201   4 ?        ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Tyrosylprotein sulfotransferase 2, TPST-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGVPRGSHMGAMRPEQEELVMVGTNHVVYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRI
IPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMV
RDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSD
AVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVI
NNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGVPRGSHMGAMRPEQEELVMVGTNHVVYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRI
IPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMV
RDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSD
AVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVI
NNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  VAL n 
1 15  PRO n 
1 16  ARG n 
1 17  GLY n 
1 18  SER n 
1 19  HIS n 
1 20  MET n 
1 21  GLY n 
1 22  ALA n 
1 23  MET n 
1 24  ARG n 
1 25  PRO n 
1 26  GLU n 
1 27  GLN n 
1 28  GLU n 
1 29  GLU n 
1 30  LEU n 
1 31  VAL n 
1 32  MET n 
1 33  VAL n 
1 34  GLY n 
1 35  THR n 
1 36  ASN n 
1 37  HIS n 
1 38  VAL n 
1 39  VAL n 
1 40  TYR n 
1 41  ARG n 
1 42  TYR n 
1 43  GLY n 
1 44  LYS n 
1 45  ALA n 
1 46  MET n 
1 47  PRO n 
1 48  LEU n 
1 49  ILE n 
1 50  PHE n 
1 51  VAL n 
1 52  GLY n 
1 53  GLY n 
1 54  VAL n 
1 55  PRO n 
1 56  ARG n 
1 57  SER n 
1 58  GLY n 
1 59  THR n 
1 60  THR n 
1 61  LEU n 
1 62  MET n 
1 63  ARG n 
1 64  ALA n 
1 65  MET n 
1 66  LEU n 
1 67  ASP n 
1 68  ALA n 
1 69  HIS n 
1 70  PRO n 
1 71  GLU n 
1 72  VAL n 
1 73  ARG n 
1 74  CYS n 
1 75  GLY n 
1 76  GLU n 
1 77  GLU n 
1 78  THR n 
1 79  ARG n 
1 80  ILE n 
1 81  ILE n 
1 82  PRO n 
1 83  ARG n 
1 84  VAL n 
1 85  LEU n 
1 86  ALA n 
1 87  MET n 
1 88  ARG n 
1 89  GLN n 
1 90  ALA n 
1 91  TRP n 
1 92  SER n 
1 93  LYS n 
1 94  SER n 
1 95  GLY n 
1 96  ARG n 
1 97  GLU n 
1 98  LYS n 
1 99  LEU n 
1 100 ARG n 
1 101 LEU n 
1 102 ASP n 
1 103 GLU n 
1 104 ALA n 
1 105 GLY n 
1 106 VAL n 
1 107 THR n 
1 108 ASP n 
1 109 GLU n 
1 110 VAL n 
1 111 LEU n 
1 112 ASP n 
1 113 ALA n 
1 114 ALA n 
1 115 MET n 
1 116 GLN n 
1 117 ALA n 
1 118 PHE n 
1 119 ILE n 
1 120 LEU n 
1 121 GLU n 
1 122 VAL n 
1 123 ILE n 
1 124 ALA n 
1 125 LYS n 
1 126 HIS n 
1 127 GLY n 
1 128 GLU n 
1 129 PRO n 
1 130 ALA n 
1 131 ARG n 
1 132 VAL n 
1 133 LEU n 
1 134 CYS n 
1 135 ASN n 
1 136 LYS n 
1 137 ASP n 
1 138 PRO n 
1 139 PHE n 
1 140 THR n 
1 141 LEU n 
1 142 LYS n 
1 143 SER n 
1 144 SER n 
1 145 VAL n 
1 146 TYR n 
1 147 LEU n 
1 148 SER n 
1 149 ARG n 
1 150 LEU n 
1 151 PHE n 
1 152 PRO n 
1 153 ASN n 
1 154 SER n 
1 155 LYS n 
1 156 PHE n 
1 157 LEU n 
1 158 LEU n 
1 159 MET n 
1 160 VAL n 
1 161 ARG n 
1 162 ASP n 
1 163 GLY n 
1 164 ARG n 
1 165 ALA n 
1 166 SER n 
1 167 VAL n 
1 168 HIS n 
1 169 SER n 
1 170 MET n 
1 171 ILE n 
1 172 THR n 
1 173 ARG n 
1 174 LYS n 
1 175 VAL n 
1 176 THR n 
1 177 ILE n 
1 178 ALA n 
1 179 GLY n 
1 180 PHE n 
1 181 ASP n 
1 182 LEU n 
1 183 SER n 
1 184 SER n 
1 185 TYR n 
1 186 ARG n 
1 187 ASP n 
1 188 CYS n 
1 189 LEU n 
1 190 THR n 
1 191 LYS n 
1 192 TRP n 
1 193 ASN n 
1 194 LYS n 
1 195 ALA n 
1 196 ILE n 
1 197 GLU n 
1 198 VAL n 
1 199 MET n 
1 200 TYR n 
1 201 ALA n 
1 202 GLN n 
1 203 CYS n 
1 204 MET n 
1 205 GLU n 
1 206 VAL n 
1 207 GLY n 
1 208 LYS n 
1 209 GLU n 
1 210 LYS n 
1 211 CYS n 
1 212 LEU n 
1 213 PRO n 
1 214 VAL n 
1 215 TYR n 
1 216 TYR n 
1 217 GLU n 
1 218 GLN n 
1 219 LEU n 
1 220 VAL n 
1 221 LEU n 
1 222 HIS n 
1 223 PRO n 
1 224 ARG n 
1 225 ARG n 
1 226 SER n 
1 227 LEU n 
1 228 LYS n 
1 229 LEU n 
1 230 ILE n 
1 231 LEU n 
1 232 ASP n 
1 233 PHE n 
1 234 LEU n 
1 235 GLY n 
1 236 ILE n 
1 237 ALA n 
1 238 TRP n 
1 239 SER n 
1 240 ASP n 
1 241 ALA n 
1 242 VAL n 
1 243 LEU n 
1 244 HIS n 
1 245 HIS n 
1 246 GLU n 
1 247 ASP n 
1 248 LEU n 
1 249 ILE n 
1 250 GLY n 
1 251 LYS n 
1 252 PRO n 
1 253 GLY n 
1 254 GLY n 
1 255 VAL n 
1 256 SER n 
1 257 LEU n 
1 258 SER n 
1 259 LYS n 
1 260 ILE n 
1 261 GLU n 
1 262 ARG n 
1 263 SER n 
1 264 THR n 
1 265 ASP n 
1 266 GLN n 
1 267 VAL n 
1 268 ILE n 
1 269 LYS n 
1 270 PRO n 
1 271 VAL n 
1 272 ASN n 
1 273 LEU n 
1 274 GLU n 
1 275 ALA n 
1 276 LEU n 
1 277 SER n 
1 278 LYS n 
1 279 TRP n 
1 280 THR n 
1 281 GLY n 
1 282 HIS n 
1 283 ILE n 
1 284 PRO n 
1 285 GLY n 
1 286 ASP n 
1 287 VAL n 
1 288 VAL n 
1 289 ARG n 
1 290 ASP n 
1 291 MET n 
1 292 ALA n 
1 293 GLN n 
1 294 ILE n 
1 295 ALA n 
1 296 PRO n 
1 297 MET n 
1 298 LEU n 
1 299 ALA n 
1 300 GLN n 
1 301 LEU n 
1 302 GLY n 
1 303 TYR n 
1 304 ASP n 
1 305 PRO n 
1 306 TYR n 
1 307 ALA n 
1 308 ASN n 
1 309 PRO n 
1 310 PRO n 
1 311 ASN n 
1 312 TYR n 
1 313 GLY n 
1 314 ASN n 
1 315 PRO n 
1 316 ASP n 
1 317 PRO n 
1 318 PHE n 
1 319 VAL n 
1 320 ILE n 
1 321 ASN n 
1 322 ASN n 
1 323 THR n 
1 324 GLN n 
1 325 ARG n 
1 326 VAL n 
1 327 LEU n 
1 328 LYS n 
1 329 GLY n 
1 330 ASP n 
1 331 TYR n 
1 332 LYS n 
1 333 THR n 
1 334 PRO n 
1 335 ALA n 
1 336 ASN n 
1 337 LEU n 
1 338 LYS n 
1 339 GLY n 
1 340 TYR n 
1 341 PHE n 
1 342 GLN n 
1 343 VAL n 
1 344 ASN n 
1 345 GLN n 
1 346 ASN n 
1 347 SER n 
1 348 THR n 
1 349 SER n 
1 350 SER n 
1 351 HIS n 
1 352 LEU n 
1 353 GLY n 
1 354 SER n 
1 355 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TPST2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TPST2_HUMAN 
_struct_ref.pdbx_db_accession          O60704 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLR
LDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGF
DLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKI
ERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGY
FQVNQNSTSSHLGSS
;
_struct_ref.pdbx_align_begin           43 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3AP3 A 21 ? 355 ? O60704 43 ? 377 ? 43 377 
2 1 3AP3 B 21 ? 355 ? O60704 43 ? 377 ? 43 377 
3 1 3AP3 C 21 ? 355 ? O60704 43 ? 377 ? 43 377 
4 1 3AP3 D 21 ? 355 ? O60704 43 ? 377 ? 43 377 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3AP3 MET A 1  ? UNP O60704 ?   ?  'EXPRESSION TAG' 23 1  
1 3AP3 GLY A 2  ? UNP O60704 ?   ?  'EXPRESSION TAG' 24 2  
1 3AP3 SER A 3  ? UNP O60704 ?   ?  'EXPRESSION TAG' 25 3  
1 3AP3 SER A 4  ? UNP O60704 ?   ?  'EXPRESSION TAG' 26 4  
1 3AP3 HIS A 5  ? UNP O60704 ?   ?  'EXPRESSION TAG' 27 5  
1 3AP3 HIS A 6  ? UNP O60704 ?   ?  'EXPRESSION TAG' 28 6  
1 3AP3 HIS A 7  ? UNP O60704 ?   ?  'EXPRESSION TAG' 29 7  
1 3AP3 HIS A 8  ? UNP O60704 ?   ?  'EXPRESSION TAG' 30 8  
1 3AP3 HIS A 9  ? UNP O60704 ?   ?  'EXPRESSION TAG' 31 9  
1 3AP3 HIS A 10 ? UNP O60704 ?   ?  'EXPRESSION TAG' 32 10 
1 3AP3 SER A 11 ? UNP O60704 ?   ?  'EXPRESSION TAG' 33 11 
1 3AP3 SER A 12 ? UNP O60704 ?   ?  'EXPRESSION TAG' 34 12 
1 3AP3 GLY A 13 ? UNP O60704 ?   ?  'EXPRESSION TAG' 35 13 
1 3AP3 VAL A 14 ? UNP O60704 ?   ?  'EXPRESSION TAG' 36 14 
1 3AP3 PRO A 15 ? UNP O60704 ?   ?  'EXPRESSION TAG' 37 15 
1 3AP3 ARG A 16 ? UNP O60704 ?   ?  'EXPRESSION TAG' 38 16 
1 3AP3 GLY A 17 ? UNP O60704 ?   ?  'EXPRESSION TAG' 39 17 
1 3AP3 SER A 18 ? UNP O60704 ?   ?  'EXPRESSION TAG' 40 18 
1 3AP3 HIS A 19 ? UNP O60704 ?   ?  'EXPRESSION TAG' 41 19 
1 3AP3 MET A 20 ? UNP O60704 ?   ?  'EXPRESSION TAG' 42 20 
1 3AP3 VAL A 39 ? UNP O60704 GLU 61 CONFLICT         61 21 
2 3AP3 MET B 1  ? UNP O60704 ?   ?  'EXPRESSION TAG' 23 22 
2 3AP3 GLY B 2  ? UNP O60704 ?   ?  'EXPRESSION TAG' 24 23 
2 3AP3 SER B 3  ? UNP O60704 ?   ?  'EXPRESSION TAG' 25 24 
2 3AP3 SER B 4  ? UNP O60704 ?   ?  'EXPRESSION TAG' 26 25 
2 3AP3 HIS B 5  ? UNP O60704 ?   ?  'EXPRESSION TAG' 27 26 
2 3AP3 HIS B 6  ? UNP O60704 ?   ?  'EXPRESSION TAG' 28 27 
2 3AP3 HIS B 7  ? UNP O60704 ?   ?  'EXPRESSION TAG' 29 28 
2 3AP3 HIS B 8  ? UNP O60704 ?   ?  'EXPRESSION TAG' 30 29 
2 3AP3 HIS B 9  ? UNP O60704 ?   ?  'EXPRESSION TAG' 31 30 
2 3AP3 HIS B 10 ? UNP O60704 ?   ?  'EXPRESSION TAG' 32 31 
2 3AP3 SER B 11 ? UNP O60704 ?   ?  'EXPRESSION TAG' 33 32 
2 3AP3 SER B 12 ? UNP O60704 ?   ?  'EXPRESSION TAG' 34 33 
2 3AP3 GLY B 13 ? UNP O60704 ?   ?  'EXPRESSION TAG' 35 34 
2 3AP3 VAL B 14 ? UNP O60704 ?   ?  'EXPRESSION TAG' 36 35 
2 3AP3 PRO B 15 ? UNP O60704 ?   ?  'EXPRESSION TAG' 37 36 
2 3AP3 ARG B 16 ? UNP O60704 ?   ?  'EXPRESSION TAG' 38 37 
2 3AP3 GLY B 17 ? UNP O60704 ?   ?  'EXPRESSION TAG' 39 38 
2 3AP3 SER B 18 ? UNP O60704 ?   ?  'EXPRESSION TAG' 40 39 
2 3AP3 HIS B 19 ? UNP O60704 ?   ?  'EXPRESSION TAG' 41 40 
2 3AP3 MET B 20 ? UNP O60704 ?   ?  'EXPRESSION TAG' 42 41 
2 3AP3 VAL B 39 ? UNP O60704 GLU 61 CONFLICT         61 42 
3 3AP3 MET C 1  ? UNP O60704 ?   ?  'EXPRESSION TAG' 23 43 
3 3AP3 GLY C 2  ? UNP O60704 ?   ?  'EXPRESSION TAG' 24 44 
3 3AP3 SER C 3  ? UNP O60704 ?   ?  'EXPRESSION TAG' 25 45 
3 3AP3 SER C 4  ? UNP O60704 ?   ?  'EXPRESSION TAG' 26 46 
3 3AP3 HIS C 5  ? UNP O60704 ?   ?  'EXPRESSION TAG' 27 47 
3 3AP3 HIS C 6  ? UNP O60704 ?   ?  'EXPRESSION TAG' 28 48 
3 3AP3 HIS C 7  ? UNP O60704 ?   ?  'EXPRESSION TAG' 29 49 
3 3AP3 HIS C 8  ? UNP O60704 ?   ?  'EXPRESSION TAG' 30 50 
3 3AP3 HIS C 9  ? UNP O60704 ?   ?  'EXPRESSION TAG' 31 51 
3 3AP3 HIS C 10 ? UNP O60704 ?   ?  'EXPRESSION TAG' 32 52 
3 3AP3 SER C 11 ? UNP O60704 ?   ?  'EXPRESSION TAG' 33 53 
3 3AP3 SER C 12 ? UNP O60704 ?   ?  'EXPRESSION TAG' 34 54 
3 3AP3 GLY C 13 ? UNP O60704 ?   ?  'EXPRESSION TAG' 35 55 
3 3AP3 VAL C 14 ? UNP O60704 ?   ?  'EXPRESSION TAG' 36 56 
3 3AP3 PRO C 15 ? UNP O60704 ?   ?  'EXPRESSION TAG' 37 57 
3 3AP3 ARG C 16 ? UNP O60704 ?   ?  'EXPRESSION TAG' 38 58 
3 3AP3 GLY C 17 ? UNP O60704 ?   ?  'EXPRESSION TAG' 39 59 
3 3AP3 SER C 18 ? UNP O60704 ?   ?  'EXPRESSION TAG' 40 60 
3 3AP3 HIS C 19 ? UNP O60704 ?   ?  'EXPRESSION TAG' 41 61 
3 3AP3 MET C 20 ? UNP O60704 ?   ?  'EXPRESSION TAG' 42 62 
3 3AP3 VAL C 39 ? UNP O60704 GLU 61 CONFLICT         61 63 
4 3AP3 MET D 1  ? UNP O60704 ?   ?  'EXPRESSION TAG' 23 64 
4 3AP3 GLY D 2  ? UNP O60704 ?   ?  'EXPRESSION TAG' 24 65 
4 3AP3 SER D 3  ? UNP O60704 ?   ?  'EXPRESSION TAG' 25 66 
4 3AP3 SER D 4  ? UNP O60704 ?   ?  'EXPRESSION TAG' 26 67 
4 3AP3 HIS D 5  ? UNP O60704 ?   ?  'EXPRESSION TAG' 27 68 
4 3AP3 HIS D 6  ? UNP O60704 ?   ?  'EXPRESSION TAG' 28 69 
4 3AP3 HIS D 7  ? UNP O60704 ?   ?  'EXPRESSION TAG' 29 70 
4 3AP3 HIS D 8  ? UNP O60704 ?   ?  'EXPRESSION TAG' 30 71 
4 3AP3 HIS D 9  ? UNP O60704 ?   ?  'EXPRESSION TAG' 31 72 
4 3AP3 HIS D 10 ? UNP O60704 ?   ?  'EXPRESSION TAG' 32 73 
4 3AP3 SER D 11 ? UNP O60704 ?   ?  'EXPRESSION TAG' 33 74 
4 3AP3 SER D 12 ? UNP O60704 ?   ?  'EXPRESSION TAG' 34 75 
4 3AP3 GLY D 13 ? UNP O60704 ?   ?  'EXPRESSION TAG' 35 76 
4 3AP3 VAL D 14 ? UNP O60704 ?   ?  'EXPRESSION TAG' 36 77 
4 3AP3 PRO D 15 ? UNP O60704 ?   ?  'EXPRESSION TAG' 37 78 
4 3AP3 ARG D 16 ? UNP O60704 ?   ?  'EXPRESSION TAG' 38 79 
4 3AP3 GLY D 17 ? UNP O60704 ?   ?  'EXPRESSION TAG' 39 80 
4 3AP3 SER D 18 ? UNP O60704 ?   ?  'EXPRESSION TAG' 40 81 
4 3AP3 HIS D 19 ? UNP O60704 ?   ?  'EXPRESSION TAG' 41 82 
4 3AP3 MET D 20 ? UNP O60704 ?   ?  'EXPRESSION TAG' 42 83 
4 3AP3 VAL D 39 ? UNP O60704 GLU 61 CONFLICT         61 84 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A3P 'RNA linking'       n "ADENOSINE-3'-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                       ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                     ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                    ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3AP3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.08 
_exptl_crystal.density_percent_sol   40.75 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            283.4 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'0.1M Tris-HCl, pH 7.0, 0.1M calcium acetate, 20 % polyethylene glycol 3000, VAPOR DIFFUSION, SITTING DROP, temperature 283.4K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-17A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-17A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     3AP3 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            3.5 
_reflns.number_obs                   11529 
_reflns.number_all                   11529 
_reflns.percent_possible_obs         68.1 
_reflns.pdbx_Rmerge_I_obs            0.164 
_reflns.pdbx_Rsym_value              0.165 
_reflns.pdbx_netI_over_sigmaI        16.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  3.5 
_reflns_shell.d_res_low                   3.56 
_reflns_shell.percent_possible_all        42.9 
_reflns_shell.Rmerge_I_obs                0.464 
_reflns_shell.pdbx_Rsym_value             0.464 
_reflns_shell.meanI_over_sigI_obs         3.0 
_reflns_shell.pdbx_redundancy             6.5 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           364 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3AP3 
_refine.ls_number_reflns_obs                     11066 
_refine.ls_number_reflns_all                     11066 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.50 
_refine.ls_d_res_high                            3.50 
_refine.ls_percent_reflns_obs                    67.08 
_refine.ls_R_factor_obs                          0.29398 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.29026 
_refine.ls_R_factor_R_free                       0.37090 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  583 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.902 
_refine.correlation_coeff_Fo_to_Fc_free          0.824 
_refine.B_iso_mean                               124.515 
_refine.aniso_B[1][1]                            -0.70 
_refine.aniso_B[2][2]                            0.65 
_refine.aniso_B[3][3]                            0.05 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      3AP1 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  1.371 
_refine.overall_SU_ML                            0.893 
_refine.overall_SU_B                             57.558 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9002 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         108 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               9110 
_refine_hist.d_res_high                       3.50 
_refine_hist.d_res_low                        48.50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 9357  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.329  1.992  ? 12698 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.626  5.000  ? 1145  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.562 22.809 ? 388   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.255 15.000 ? 1646  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.259 15.000 ? 82    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.081  0.200  ? 1413  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.021  ? 6935  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.331  1.500  ? 5723  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.655  2.000  ? 9260  'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.956  3.000  ? 3634  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.795  4.500  ? 3434  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 2125 0.22 0.50 'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 
1 B 2125 0.23 0.50 'medium positional' 1 2 'X-RAY DIFFRACTION' ? ? ? 
1 C 2125 0.21 0.50 'medium positional' 1 3 'X-RAY DIFFRACTION' ? ? ? 
1 D 2125 0.20 0.50 'medium positional' 1 4 'X-RAY DIFFRACTION' ? ? ? 
1 A 2125 0.34 2.00 'medium thermal'    1 5 'X-RAY DIFFRACTION' ? ? ? 
1 B 2125 0.48 2.00 'medium thermal'    1 6 'X-RAY DIFFRACTION' ? ? ? 
1 C 2125 0.27 2.00 'medium thermal'    1 7 'X-RAY DIFFRACTION' ? ? ? 
1 D 2125 0.30 2.00 'medium thermal'    1 8 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.500 
_refine_ls_shell.d_res_low                        3.590 
_refine_ls_shell.number_reflns_R_work             483 
_refine_ls_shell.R_factor_R_work                  0.366 
_refine_ls_shell.percent_reflns_obs               41.12 
_refine_ls_shell.R_factor_R_free                  0.434 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             31 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
3 C 1 
4 D 1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3AP3 
_struct.title                     'Crystal structure of human tyrosylprotein sulfotransferase-2 complexed with PAP' 
_struct.pdbx_descriptor           'Protein-tyrosine sulfotransferase 2 (E.C.2.8.2.20)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3AP3 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'sulfotransferase fold, transferase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 58  ? HIS A 69  ? GLY A 80  HIS A 91  1 ? 12 
HELX_P HELX_P2  2  ARG A 79  ? SER A 92  ? ARG A 101 SER A 114 1 ? 14 
HELX_P HELX_P3  3  THR A 107 ? GLY A 127 ? THR A 129 GLY A 149 1 ? 21 
HELX_P HELX_P4  4  PRO A 138 ? LYS A 142 ? PRO A 160 LYS A 164 5 ? 5  
HELX_P HELX_P5  5  SER A 143 ? PHE A 151 ? SER A 165 PHE A 173 1 ? 9  
HELX_P HELX_P6  6  ASP A 162 ? LYS A 174 ? ASP A 184 LYS A 196 1 ? 13 
HELX_P HELX_P7  7  SER A 184 ? GLY A 207 ? SER A 206 GLY A 229 1 ? 24 
HELX_P HELX_P8  8  TYR A 216 ? HIS A 222 ? TYR A 238 HIS A 244 1 ? 7  
HELX_P HELX_P9  9  HIS A 222 ? GLY A 235 ? HIS A 244 GLY A 257 1 ? 14 
HELX_P HELX_P10 10 SER A 239 ? ILE A 249 ? SER A 261 ILE A 271 5 ? 11 
HELX_P HELX_P11 11 PRO A 284 ? ASP A 290 ? PRO A 306 ASP A 312 1 ? 7  
HELX_P HELX_P12 12 ASP A 290 ? ALA A 295 ? ASP A 312 ALA A 317 1 ? 6  
HELX_P HELX_P13 13 ALA A 295 ? LEU A 301 ? ALA A 317 LEU A 323 1 ? 7  
HELX_P HELX_P14 14 ASP A 316 ? GLY A 329 ? ASP A 338 GLY A 351 1 ? 14 
HELX_P HELX_P15 15 GLY B 58  ? HIS B 69  ? GLY B 80  HIS B 91  1 ? 12 
HELX_P HELX_P16 16 ARG B 79  ? SER B 94  ? ARG B 101 SER B 116 1 ? 16 
HELX_P HELX_P17 17 GLY B 95  ? ALA B 104 ? GLY B 117 ALA B 126 1 ? 10 
HELX_P HELX_P18 18 THR B 107 ? HIS B 126 ? THR B 129 HIS B 148 1 ? 20 
HELX_P HELX_P19 19 PRO B 138 ? LYS B 142 ? PRO B 160 LYS B 164 5 ? 5  
HELX_P HELX_P20 20 SER B 143 ? PHE B 151 ? SER B 165 PHE B 173 1 ? 9  
HELX_P HELX_P21 21 ASP B 162 ? ARG B 173 ? ASP B 184 ARG B 195 1 ? 12 
HELX_P HELX_P22 22 SER B 184 ? GLY B 207 ? SER B 206 GLY B 229 1 ? 24 
HELX_P HELX_P23 23 TYR B 216 ? HIS B 222 ? TYR B 238 HIS B 244 1 ? 7  
HELX_P HELX_P24 24 HIS B 222 ? GLY B 235 ? HIS B 244 GLY B 257 1 ? 14 
HELX_P HELX_P25 25 SER B 239 ? ILE B 249 ? SER B 261 ILE B 271 5 ? 11 
HELX_P HELX_P26 26 PRO B 284 ? ASP B 290 ? PRO B 306 ASP B 312 1 ? 7  
HELX_P HELX_P27 27 ASP B 290 ? ALA B 295 ? ASP B 312 ALA B 317 1 ? 6  
HELX_P HELX_P28 28 ALA B 295 ? GLY B 302 ? ALA B 317 GLY B 324 1 ? 8  
HELX_P HELX_P29 29 ASP B 316 ? GLY B 329 ? ASP B 338 GLY B 351 1 ? 14 
HELX_P HELX_P30 30 GLY C 58  ? HIS C 69  ? GLY C 80  HIS C 91  1 ? 12 
HELX_P HELX_P31 31 ARG C 79  ? SER C 94  ? ARG C 101 SER C 116 1 ? 16 
HELX_P HELX_P32 32 GLY C 95  ? GLU C 103 ? GLY C 117 GLU C 125 1 ? 9  
HELX_P HELX_P33 33 THR C 107 ? HIS C 126 ? THR C 129 HIS C 148 1 ? 20 
HELX_P HELX_P34 34 PRO C 138 ? LYS C 142 ? PRO C 160 LYS C 164 5 ? 5  
HELX_P HELX_P35 35 SER C 143 ? PHE C 151 ? SER C 165 PHE C 173 1 ? 9  
HELX_P HELX_P36 36 ASP C 162 ? ARG C 173 ? ASP C 184 ARG C 195 1 ? 12 
HELX_P HELX_P37 37 SER C 184 ? GLY C 207 ? SER C 206 GLY C 229 1 ? 24 
HELX_P HELX_P38 38 TYR C 216 ? HIS C 222 ? TYR C 238 HIS C 244 1 ? 7  
HELX_P HELX_P39 39 HIS C 222 ? GLY C 235 ? HIS C 244 GLY C 257 1 ? 14 
HELX_P HELX_P40 40 SER C 239 ? LEU C 248 ? SER C 261 LEU C 270 5 ? 10 
HELX_P HELX_P41 41 ASN C 272 ? LEU C 276 ? ASN C 294 LEU C 298 5 ? 5  
HELX_P HELX_P42 42 PRO C 284 ? ASP C 290 ? PRO C 306 ASP C 312 1 ? 7  
HELX_P HELX_P43 43 ASP C 290 ? ALA C 295 ? ASP C 312 ALA C 317 1 ? 6  
HELX_P HELX_P44 44 ALA C 295 ? LEU C 301 ? ALA C 317 LEU C 323 1 ? 7  
HELX_P HELX_P45 45 ASP C 316 ? GLY C 329 ? ASP C 338 GLY C 351 1 ? 14 
HELX_P HELX_P46 46 GLY D 58  ? HIS D 69  ? GLY D 80  HIS D 91  1 ? 12 
HELX_P HELX_P47 47 ARG D 79  ? LYS D 93  ? ARG D 101 LYS D 115 1 ? 15 
HELX_P HELX_P48 48 GLU D 97  ? GLU D 103 ? GLU D 119 GLU D 125 1 ? 7  
HELX_P HELX_P49 49 THR D 107 ? GLY D 127 ? THR D 129 GLY D 149 1 ? 21 
HELX_P HELX_P50 50 PRO D 138 ? LYS D 142 ? PRO D 160 LYS D 164 5 ? 5  
HELX_P HELX_P51 51 SER D 143 ? PHE D 151 ? SER D 165 PHE D 173 1 ? 9  
HELX_P HELX_P52 52 ASP D 162 ? ARG D 173 ? ASP D 184 ARG D 195 1 ? 12 
HELX_P HELX_P53 53 SER D 184 ? GLY D 207 ? SER D 206 GLY D 229 1 ? 24 
HELX_P HELX_P54 54 TYR D 216 ? HIS D 222 ? TYR D 238 HIS D 244 1 ? 7  
HELX_P HELX_P55 55 HIS D 222 ? GLY D 235 ? HIS D 244 GLY D 257 1 ? 14 
HELX_P HELX_P56 56 SER D 239 ? ILE D 249 ? SER D 261 ILE D 271 5 ? 11 
HELX_P HELX_P57 57 PRO D 284 ? ASP D 290 ? PRO D 306 ASP D 312 1 ? 7  
HELX_P HELX_P58 58 ASP D 290 ? ALA D 295 ? ASP D 312 ALA D 317 1 ? 6  
HELX_P HELX_P59 59 ALA D 295 ? LEU D 301 ? ALA D 317 LEU D 323 1 ? 7  
HELX_P HELX_P60 60 ASP D 316 ? GLY D 329 ? ASP D 338 GLY D 351 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 74  SG ? ? ? 1_555 A CYS 134 SG ? ? A CYS 96  A CYS 156 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf2 disulf ? ? A CYS 203 SG ? ? ? 1_555 A CYS 211 SG ? ? A CYS 225 A CYS 233 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf3 disulf ? ? B CYS 74  SG ? ? ? 1_555 B CYS 134 SG ? ? B CYS 96  B CYS 156 1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf4 disulf ? ? B CYS 203 SG ? ? ? 1_555 B CYS 211 SG ? ? B CYS 225 B CYS 233 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf5 disulf ? ? C CYS 74  SG ? ? ? 1_555 C CYS 134 SG ? ? C CYS 96  C CYS 156 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf6 disulf ? ? C CYS 203 SG ? ? ? 1_555 C CYS 211 SG ? ? C CYS 225 C CYS 233 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf7 disulf ? ? D CYS 74  SG ? ? ? 1_555 D CYS 134 SG ? ? D CYS 96  D CYS 156 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf8 disulf ? ? D CYS 203 SG ? ? ? 1_555 D CYS 211 SG ? ? D CYS 225 D CYS 233 1_555 ? ? ? ? ? ? ? 2.032 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 308 A . ? ASN 330 A PRO 309 A ? PRO 331 A 1 -0.47 
2 ASN 308 B . ? ASN 330 B PRO 309 B ? PRO 331 B 1 1.26  
3 ASN 308 C . ? ASN 330 C PRO 309 C ? PRO 331 C 1 2.60  
4 ASN 308 D . ? ASN 330 D PRO 309 D ? PRO 331 D 1 -1.77 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
C 1 2 ? parallel 
C 2 3 ? parallel 
C 3 4 ? parallel 
C 4 5 ? parallel 
D 1 2 ? parallel 
D 2 3 ? parallel 
D 3 4 ? parallel 
D 4 5 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 72  ? ARG A 73  ? VAL A 94  ARG A 95  
A 2 VAL A 132 ? LYS A 136 ? VAL A 154 LYS A 158 
A 3 LEU A 48  ? GLY A 52  ? LEU A 70  GLY A 74  
A 4 LYS A 155 ? VAL A 160 ? LYS A 177 VAL A 182 
A 5 CYS A 211 ? TYR A 215 ? CYS A 233 TYR A 237 
B 1 VAL B 72  ? ARG B 73  ? VAL B 94  ARG B 95  
B 2 VAL B 132 ? LYS B 136 ? VAL B 154 LYS B 158 
B 3 LEU B 48  ? GLY B 52  ? LEU B 70  GLY B 74  
B 4 LYS B 155 ? VAL B 160 ? LYS B 177 VAL B 182 
B 5 CYS B 211 ? TYR B 215 ? CYS B 233 TYR B 237 
C 1 VAL C 72  ? ARG C 73  ? VAL C 94  ARG C 95  
C 2 VAL C 132 ? LYS C 136 ? VAL C 154 LYS C 158 
C 3 LEU C 48  ? GLY C 52  ? LEU C 70  GLY C 74  
C 4 LYS C 155 ? VAL C 160 ? LYS C 177 VAL C 182 
C 5 CYS C 211 ? TYR C 215 ? CYS C 233 TYR C 237 
D 1 VAL D 72  ? ARG D 73  ? VAL D 94  ARG D 95  
D 2 VAL D 132 ? LYS D 136 ? VAL D 154 LYS D 158 
D 3 LEU D 48  ? GLY D 52  ? LEU D 70  GLY D 74  
D 4 LYS D 155 ? VAL D 160 ? LYS D 177 VAL D 182 
D 5 CYS D 211 ? TYR D 215 ? CYS D 233 TYR D 237 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 73  ? N ARG A 95  O CYS A 134 ? O CYS A 156 
A 2 3 O ASN A 135 ? O ASN A 157 N ILE A 49  ? N ILE A 71  
A 3 4 N GLY A 52  ? N GLY A 74  O MET A 159 ? O MET A 181 
A 4 5 N PHE A 156 ? N PHE A 178 O LEU A 212 ? O LEU A 234 
B 1 2 N ARG B 73  ? N ARG B 95  O CYS B 134 ? O CYS B 156 
B 2 3 O ASN B 135 ? O ASN B 157 N ILE B 49  ? N ILE B 71  
B 3 4 N LEU B 48  ? N LEU B 70  O LYS B 155 ? O LYS B 177 
B 4 5 N LEU B 158 ? N LEU B 180 O VAL B 214 ? O VAL B 236 
C 1 2 N ARG C 73  ? N ARG C 95  O CYS C 134 ? O CYS C 156 
C 2 3 O ASN C 135 ? O ASN C 157 N ILE C 49  ? N ILE C 71  
C 3 4 N LEU C 48  ? N LEU C 70  O LYS C 155 ? O LYS C 177 
C 4 5 N VAL C 160 ? N VAL C 182 O VAL C 214 ? O VAL C 236 
D 1 2 N ARG D 73  ? N ARG D 95  O CYS D 134 ? O CYS D 156 
D 2 3 O ASN D 135 ? O ASN D 157 N ILE D 49  ? N ILE D 71  
D 3 4 N PHE D 50  ? N PHE D 72  O LEU D 157 ? O LEU D 179 
D 4 5 N LEU D 158 ? N LEU D 180 O VAL D 214 ? O VAL D 236 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE A3P A 1' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE A3P B 1' 
AC3 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE A3P C 1' 
AC4 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE A3P D 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 ARG A 56  ? ARG A 78  . ? 1_555 ? 
2  AC1 19 SER A 57  ? SER A 79  . ? 1_555 ? 
3  AC1 19 GLY A 58  ? GLY A 80  . ? 1_555 ? 
4  AC1 19 THR A 59  ? THR A 81  . ? 1_555 ? 
5  AC1 19 THR A 60  ? THR A 82  . ? 1_555 ? 
6  AC1 19 LEU A 61  ? LEU A 83  . ? 1_555 ? 
7  AC1 19 ARG A 161 ? ARG A 183 . ? 1_555 ? 
8  AC1 19 SER A 169 ? SER A 191 . ? 1_555 ? 
9  AC1 19 ARG A 173 ? ARG A 195 . ? 1_555 ? 
10 AC1 19 TYR A 216 ? TYR A 238 . ? 1_555 ? 
11 AC1 19 SER A 263 ? SER A 285 . ? 1_555 ? 
12 AC1 19 GLN A 266 ? GLN A 288 . ? 1_555 ? 
13 AC1 19 VAL A 267 ? VAL A 289 . ? 1_555 ? 
14 AC1 19 LYS A 269 ? LYS A 291 . ? 1_555 ? 
15 AC1 19 PRO A 270 ? PRO A 292 . ? 1_555 ? 
16 AC1 19 VAL A 271 ? VAL A 293 . ? 1_555 ? 
17 AC1 19 ASN A 272 ? ASN A 294 . ? 1_555 ? 
18 AC1 19 ALA A 275 ? ALA A 297 . ? 1_555 ? 
19 AC1 19 LYS A 278 ? LYS A 300 . ? 1_555 ? 
20 AC2 15 ARG B 56  ? ARG B 78  . ? 1_555 ? 
21 AC2 15 SER B 57  ? SER B 79  . ? 1_555 ? 
22 AC2 15 GLY B 58  ? GLY B 80  . ? 1_555 ? 
23 AC2 15 THR B 59  ? THR B 81  . ? 1_555 ? 
24 AC2 15 THR B 60  ? THR B 82  . ? 1_555 ? 
25 AC2 15 ARG B 161 ? ARG B 183 . ? 1_555 ? 
26 AC2 15 SER B 169 ? SER B 191 . ? 1_555 ? 
27 AC2 15 ARG B 173 ? ARG B 195 . ? 1_555 ? 
28 AC2 15 TYR B 216 ? TYR B 238 . ? 1_555 ? 
29 AC2 15 VAL B 267 ? VAL B 289 . ? 1_555 ? 
30 AC2 15 LYS B 269 ? LYS B 291 . ? 1_555 ? 
31 AC2 15 PRO B 270 ? PRO B 292 . ? 1_555 ? 
32 AC2 15 ASN B 272 ? ASN B 294 . ? 1_555 ? 
33 AC2 15 ALA B 275 ? ALA B 297 . ? 1_555 ? 
34 AC2 15 LYS B 278 ? LYS B 300 . ? 1_555 ? 
35 AC3 19 PRO C 55  ? PRO C 77  . ? 1_555 ? 
36 AC3 19 ARG C 56  ? ARG C 78  . ? 1_555 ? 
37 AC3 19 SER C 57  ? SER C 79  . ? 1_555 ? 
38 AC3 19 GLY C 58  ? GLY C 80  . ? 1_555 ? 
39 AC3 19 THR C 59  ? THR C 81  . ? 1_555 ? 
40 AC3 19 THR C 60  ? THR C 82  . ? 1_555 ? 
41 AC3 19 ARG C 161 ? ARG C 183 . ? 1_555 ? 
42 AC3 19 SER C 169 ? SER C 191 . ? 1_555 ? 
43 AC3 19 ARG C 173 ? ARG C 195 . ? 1_555 ? 
44 AC3 19 TYR C 216 ? TYR C 238 . ? 1_555 ? 
45 AC3 19 SER C 263 ? SER C 285 . ? 1_555 ? 
46 AC3 19 GLN C 266 ? GLN C 288 . ? 1_555 ? 
47 AC3 19 VAL C 267 ? VAL C 289 . ? 1_555 ? 
48 AC3 19 LYS C 269 ? LYS C 291 . ? 1_555 ? 
49 AC3 19 PRO C 270 ? PRO C 292 . ? 1_555 ? 
50 AC3 19 VAL C 271 ? VAL C 293 . ? 1_555 ? 
51 AC3 19 ASN C 272 ? ASN C 294 . ? 1_555 ? 
52 AC3 19 ALA C 275 ? ALA C 297 . ? 1_555 ? 
53 AC3 19 LYS C 278 ? LYS C 300 . ? 1_555 ? 
54 AC4 18 ARG D 56  ? ARG D 78  . ? 1_555 ? 
55 AC4 18 SER D 57  ? SER D 79  . ? 1_555 ? 
56 AC4 18 GLY D 58  ? GLY D 80  . ? 1_555 ? 
57 AC4 18 THR D 59  ? THR D 81  . ? 1_555 ? 
58 AC4 18 THR D 60  ? THR D 82  . ? 1_555 ? 
59 AC4 18 LEU D 61  ? LEU D 83  . ? 1_555 ? 
60 AC4 18 ARG D 161 ? ARG D 183 . ? 1_555 ? 
61 AC4 18 SER D 169 ? SER D 191 . ? 1_555 ? 
62 AC4 18 ARG D 173 ? ARG D 195 . ? 1_555 ? 
63 AC4 18 TYR D 216 ? TYR D 238 . ? 1_555 ? 
64 AC4 18 SER D 263 ? SER D 285 . ? 1_555 ? 
65 AC4 18 GLN D 266 ? GLN D 288 . ? 1_555 ? 
66 AC4 18 VAL D 267 ? VAL D 289 . ? 1_555 ? 
67 AC4 18 LYS D 269 ? LYS D 291 . ? 1_555 ? 
68 AC4 18 PRO D 270 ? PRO D 292 . ? 1_555 ? 
69 AC4 18 ASN D 272 ? ASN D 294 . ? 1_555 ? 
70 AC4 18 ALA D 275 ? ALA D 297 . ? 1_555 ? 
71 AC4 18 LYS D 278 ? LYS D 300 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3AP3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3AP3 
_atom_sites.fract_transf_matrix[1][1]   0.013999 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012296 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004412 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . VAL A 1 39  ? 20.346  -24.814 0.704   1.00 145.53 ? 61  VAL A N     1 
ATOM   2    C CA    . VAL A 1 39  ? 19.812  -25.527 -0.499  1.00 145.61 ? 61  VAL A CA    1 
ATOM   3    C C     . VAL A 1 39  ? 18.489  -26.226 -0.166  1.00 145.44 ? 61  VAL A C     1 
ATOM   4    O O     . VAL A 1 39  ? 18.487  -27.322 0.407   1.00 145.51 ? 61  VAL A O     1 
ATOM   5    C CB    . VAL A 1 39  ? 20.826  -26.564 -1.052  1.00 145.70 ? 61  VAL A CB    1 
ATOM   6    C CG1   . VAL A 1 39  ? 20.317  -27.171 -2.373  1.00 145.89 ? 61  VAL A CG1   1 
ATOM   7    C CG2   . VAL A 1 39  ? 22.199  -25.917 -1.252  1.00 145.95 ? 61  VAL A CG2   1 
ATOM   8    N N     . TYR A 1 40  ? 17.374  -25.582 -0.529  1.00 145.15 ? 62  TYR A N     1 
ATOM   9    C CA    . TYR A 1 40  ? 16.026  -26.101 -0.246  1.00 144.72 ? 62  TYR A CA    1 
ATOM   10   C C     . TYR A 1 40  ? 15.368  -26.768 -1.455  1.00 144.20 ? 62  TYR A C     1 
ATOM   11   O O     . TYR A 1 40  ? 15.225  -26.152 -2.524  1.00 144.22 ? 62  TYR A O     1 
ATOM   12   C CB    . TYR A 1 40  ? 15.104  -24.990 0.276   1.00 144.89 ? 62  TYR A CB    1 
ATOM   13   C CG    . TYR A 1 40  ? 15.497  -24.436 1.625   1.00 145.44 ? 62  TYR A CG    1 
ATOM   14   C CD1   . TYR A 1 40  ? 15.219  -25.142 2.802   1.00 146.10 ? 62  TYR A CD1   1 
ATOM   15   C CD2   . TYR A 1 40  ? 16.135  -23.200 1.731   1.00 146.00 ? 62  TYR A CD2   1 
ATOM   16   C CE1   . TYR A 1 40  ? 15.577  -24.631 4.053   1.00 146.54 ? 62  TYR A CE1   1 
ATOM   17   C CE2   . TYR A 1 40  ? 16.497  -22.677 2.977   1.00 146.56 ? 62  TYR A CE2   1 
ATOM   18   C CZ    . TYR A 1 40  ? 16.214  -23.398 4.133   1.00 146.66 ? 62  TYR A CZ    1 
ATOM   19   O OH    . TYR A 1 40  ? 16.570  -22.886 5.366   1.00 146.83 ? 62  TYR A OH    1 
ATOM   20   N N     . ARG A 1 41  ? 14.962  -28.024 -1.269  1.00 143.39 ? 63  ARG A N     1 
ATOM   21   C CA    . ARG A 1 41  ? 14.227  -28.762 -2.293  1.00 142.66 ? 63  ARG A CA    1 
ATOM   22   C C     . ARG A 1 41  ? 12.731  -28.624 -2.098  1.00 141.74 ? 63  ARG A C     1 
ATOM   23   O O     . ARG A 1 41  ? 12.256  -28.501 -0.968  1.00 141.78 ? 63  ARG A O     1 
ATOM   24   C CB    . ARG A 1 41  ? 14.620  -30.236 -2.299  1.00 142.90 ? 63  ARG A CB    1 
ATOM   25   C CG    . ARG A 1 41  ? 15.872  -30.494 -3.102  1.00 144.21 ? 63  ARG A CG    1 
ATOM   26   C CD    . ARG A 1 41  ? 15.948  -31.924 -3.590  1.00 146.31 ? 63  ARG A CD    1 
ATOM   27   N NE    . ARG A 1 41  ? 16.727  -32.014 -4.821  1.00 147.63 ? 63  ARG A NE    1 
ATOM   28   C CZ    . ARG A 1 41  ? 18.051  -31.915 -4.883  1.00 148.57 ? 63  ARG A CZ    1 
ATOM   29   N NH1   . ARG A 1 41  ? 18.767  -31.717 -3.782  1.00 149.23 ? 63  ARG A NH1   1 
ATOM   30   N NH2   . ARG A 1 41  ? 18.661  -32.012 -6.055  1.00 149.18 ? 63  ARG A NH2   1 
ATOM   31   N N     . TYR A 1 42  ? 11.992  -28.631 -3.205  1.00 140.51 ? 64  TYR A N     1 
ATOM   32   C CA    . TYR A 1 42  ? 10.537  -28.550 -3.149  1.00 139.10 ? 64  TYR A CA    1 
ATOM   33   C C     . TYR A 1 42  ? 9.900   -29.421 -4.211  1.00 138.24 ? 64  TYR A C     1 
ATOM   34   O O     . TYR A 1 42  ? 10.297  -29.382 -5.402  1.00 138.07 ? 64  TYR A O     1 
ATOM   35   C CB    . TYR A 1 42  ? 10.045  -27.099 -3.245  1.00 139.01 ? 64  TYR A CB    1 
ATOM   36   C CG    . TYR A 1 42  ? 10.244  -26.428 -4.584  1.00 138.60 ? 64  TYR A CG    1 
ATOM   37   C CD1   . TYR A 1 42  ? 9.147   -26.070 -5.361  1.00 138.31 ? 64  TYR A CD1   1 
ATOM   38   C CD2   . TYR A 1 42  ? 11.528  -26.133 -5.064  1.00 138.61 ? 64  TYR A CD2   1 
ATOM   39   C CE1   . TYR A 1 42  ? 9.316   -25.445 -6.581  1.00 137.97 ? 64  TYR A CE1   1 
ATOM   40   C CE2   . TYR A 1 42  ? 11.706  -25.511 -6.286  1.00 138.24 ? 64  TYR A CE2   1 
ATOM   41   C CZ    . TYR A 1 42  ? 10.593  -25.169 -7.034  1.00 137.81 ? 64  TYR A CZ    1 
ATOM   42   O OH    . TYR A 1 42  ? 10.753  -24.547 -8.241  1.00 137.70 ? 64  TYR A OH    1 
ATOM   43   N N     . GLY A 1 43  ? 8.921   -30.220 -3.750  1.00 137.29 ? 65  GLY A N     1 
ATOM   44   C CA    . GLY A 1 43  ? 8.207   -31.133 -4.616  1.00 136.17 ? 65  GLY A CA    1 
ATOM   45   C C     . GLY A 1 43  ? 6.773   -31.378 -4.189  1.00 135.44 ? 65  GLY A C     1 
ATOM   46   O O     . GLY A 1 43  ? 6.354   -31.026 -3.080  1.00 135.43 ? 65  GLY A O     1 
ATOM   47   N N     . LYS A 1 44  ? 6.030   -31.978 -5.111  1.00 134.57 ? 66  LYS A N     1 
ATOM   48   C CA    . LYS A 1 44  ? 4.692   -32.511 -4.904  1.00 133.71 ? 66  LYS A CA    1 
ATOM   49   C C     . LYS A 1 44  ? 4.397   -33.039 -3.488  1.00 132.77 ? 66  LYS A C     1 
ATOM   50   O O     . LYS A 1 44  ? 3.329   -32.773 -2.934  1.00 132.69 ? 66  LYS A O     1 
ATOM   51   C CB    . LYS A 1 44  ? 4.518   -33.654 -5.899  1.00 133.95 ? 66  LYS A CB    1 
ATOM   52   C CG    . LYS A 1 44  ? 3.353   -33.525 -6.853  1.00 135.16 ? 66  LYS A CG    1 
ATOM   53   C CD    . LYS A 1 44  ? 3.580   -34.448 -8.049  1.00 137.32 ? 66  LYS A CD    1 
ATOM   54   C CE    . LYS A 1 44  ? 3.550   -35.927 -7.642  1.00 138.55 ? 66  LYS A CE    1 
ATOM   55   N NZ    . LYS A 1 44  ? 4.187   -36.788 -8.698  1.00 139.64 ? 66  LYS A NZ    1 
ATOM   56   N N     . ALA A 1 45  ? 5.346   -33.781 -2.917  1.00 131.69 ? 67  ALA A N     1 
ATOM   57   C CA    . ALA A 1 45  ? 5.115   -34.571 -1.705  1.00 130.62 ? 67  ALA A CA    1 
ATOM   58   C C     . ALA A 1 45  ? 5.622   -33.938 -0.410  1.00 129.97 ? 67  ALA A C     1 
ATOM   59   O O     . ALA A 1 45  ? 5.635   -34.587 0.643   1.00 129.96 ? 67  ALA A O     1 
ATOM   60   C CB    . ALA A 1 45  ? 5.707   -35.969 -1.878  1.00 130.55 ? 67  ALA A CB    1 
ATOM   61   N N     . MET A 1 46  ? 6.026   -32.671 -0.485  1.00 129.14 ? 68  MET A N     1 
ATOM   62   C CA    . MET A 1 46  ? 6.587   -31.995 0.678   1.00 128.43 ? 68  MET A CA    1 
ATOM   63   C C     . MET A 1 46  ? 5.521   -31.602 1.717   1.00 127.89 ? 68  MET A C     1 
ATOM   64   O O     . MET A 1 46  ? 4.328   -31.529 1.394   1.00 127.83 ? 68  MET A O     1 
ATOM   65   C CB    . MET A 1 46  ? 7.376   -30.769 0.229   1.00 128.44 ? 68  MET A CB    1 
ATOM   66   C CG    . MET A 1 46  ? 6.512   -29.576 -0.124  1.00 128.37 ? 68  MET A CG    1 
ATOM   67   S SD    . MET A 1 46  ? 7.543   -28.164 -0.538  1.00 128.88 ? 68  MET A SD    1 
ATOM   68   C CE    . MET A 1 46  ? 8.361   -27.875 1.036   1.00 128.99 ? 68  MET A CE    1 
ATOM   69   N N     . PRO A 1 47  ? 5.952   -31.340 2.971   1.00 127.35 ? 69  PRO A N     1 
ATOM   70   C CA    . PRO A 1 47  ? 4.986   -30.950 3.987   1.00 126.87 ? 69  PRO A CA    1 
ATOM   71   C C     . PRO A 1 47  ? 4.624   -29.476 3.834   1.00 126.26 ? 69  PRO A C     1 
ATOM   72   O O     . PRO A 1 47  ? 5.504   -28.554 4.028   1.00 126.24 ? 69  PRO A O     1 
ATOM   73   C CB    . PRO A 1 47  ? 5.734   -31.199 5.304   1.00 126.97 ? 69  PRO A CB    1 
ATOM   74   C CG    . PRO A 1 47  ? 7.169   -30.996 4.965   1.00 127.11 ? 69  PRO A CG    1 
ATOM   75   C CD    . PRO A 1 47  ? 7.341   -31.297 3.483   1.00 127.36 ? 69  PRO A CD    1 
ATOM   76   N N     . LEU A 1 48  ? 3.320   -29.265 3.470   1.00 125.44 ? 70  LEU A N     1 
ATOM   77   C CA    . LEU A 1 48  ? 2.854   -27.910 3.278   1.00 124.63 ? 70  LEU A CA    1 
ATOM   78   C C     . LEU A 1 48  ? 1.777   -27.549 4.277   1.00 123.81 ? 70  LEU A C     1 
ATOM   79   O O     . LEU A 1 48  ? 1.132   -28.416 4.870   1.00 123.61 ? 70  LEU A O     1 
ATOM   80   C CB    . LEU A 1 48  ? 2.341   -27.718 1.854   1.00 124.94 ? 70  LEU A CB    1 
ATOM   81   C CG    . LEU A 1 48  ? 3.391   -27.841 0.747   1.00 125.43 ? 70  LEU A CG    1 
ATOM   82   C CD1   . LEU A 1 48  ? 2.714   -27.867 -0.614  1.00 125.93 ? 70  LEU A CD1   1 
ATOM   83   C CD2   . LEU A 1 48  ? 4.412   -26.712 0.826   1.00 126.05 ? 70  LEU A CD2   1 
ATOM   84   N N     . ILE A 1 49  ? 1.600   -26.251 4.469   1.00 122.83 ? 71  ILE A N     1 
ATOM   85   C CA    . ILE A 1 49  ? 0.595   -25.767 5.371   1.00 121.97 ? 71  ILE A CA    1 
ATOM   86   C C     . ILE A 1 49  ? -0.280  -24.797 4.632   1.00 121.49 ? 71  ILE A C     1 
ATOM   87   O O     . ILE A 1 49  ? 0.210   -23.873 3.987   1.00 121.37 ? 71  ILE A O     1 
ATOM   88   C CB    . ILE A 1 49  ? 1.210   -25.029 6.539   1.00 121.93 ? 71  ILE A CB    1 
ATOM   89   C CG1   . ILE A 1 49  ? 2.359   -25.835 7.133   1.00 121.95 ? 71  ILE A CG1   1 
ATOM   90   C CG2   . ILE A 1 49  ? 0.149   -24.741 7.587   1.00 121.94 ? 71  ILE A CG2   1 
ATOM   91   C CD1   . ILE A 1 49  ? 3.342   -24.988 7.911   1.00 122.39 ? 71  ILE A CD1   1 
ATOM   92   N N     . PHE A 1 50  ? -1.583  -25.012 4.732   1.00 120.91 ? 72  PHE A N     1 
ATOM   93   C CA    . PHE A 1 50  ? -2.524  -24.079 4.173   1.00 120.41 ? 72  PHE A CA    1 
ATOM   94   C C     . PHE A 1 50  ? -3.411  -23.556 5.260   1.00 120.20 ? 72  PHE A C     1 
ATOM   95   O O     . PHE A 1 50  ? -4.165  -24.310 5.896   1.00 120.10 ? 72  PHE A O     1 
ATOM   96   C CB    . PHE A 1 50  ? -3.355  -24.741 3.091   1.00 120.38 ? 72  PHE A CB    1 
ATOM   97   C CG    . PHE A 1 50  ? -2.557  -25.117 1.887   1.00 120.34 ? 72  PHE A CG    1 
ATOM   98   C CD1   . PHE A 1 50  ? -2.110  -24.139 0.992   1.00 120.13 ? 72  PHE A CD1   1 
ATOM   99   C CD2   . PHE A 1 50  ? -2.240  -26.450 1.644   1.00 120.32 ? 72  PHE A CD2   1 
ATOM   100  C CE1   . PHE A 1 50  ? -1.377  -24.486 -0.132  1.00 119.92 ? 72  PHE A CE1   1 
ATOM   101  C CE2   . PHE A 1 50  ? -1.504  -26.808 0.518   1.00 119.92 ? 72  PHE A CE2   1 
ATOM   102  C CZ    . PHE A 1 50  ? -1.068  -25.824 -0.370  1.00 119.89 ? 72  PHE A CZ    1 
ATOM   103  N N     . VAL A 1 51  ? -3.290  -22.253 5.482   1.00 120.05 ? 73  VAL A N     1 
ATOM   104  C CA    . VAL A 1 51  ? -4.128  -21.560 6.438   1.00 120.05 ? 73  VAL A CA    1 
ATOM   105  C C     . VAL A 1 51  ? -5.254  -20.912 5.667   1.00 120.01 ? 73  VAL A C     1 
ATOM   106  O O     . VAL A 1 51  ? -5.047  -20.454 4.532   1.00 120.09 ? 73  VAL A O     1 
ATOM   107  C CB    . VAL A 1 51  ? -3.357  -20.456 7.173   1.00 120.07 ? 73  VAL A CB    1 
ATOM   108  C CG1   . VAL A 1 51  ? -4.209  -19.864 8.296   1.00 120.15 ? 73  VAL A CG1   1 
ATOM   109  C CG2   . VAL A 1 51  ? -2.033  -20.985 7.711   1.00 120.25 ? 73  VAL A CG2   1 
ATOM   110  N N     . GLY A 1 52  ? -6.436  -20.869 6.286   1.00 119.85 ? 74  GLY A N     1 
ATOM   111  C CA    . GLY A 1 52  ? -7.597  -20.214 5.685   1.00 119.71 ? 74  GLY A CA    1 
ATOM   112  C C     . GLY A 1 52  ? -8.830  -20.032 6.556   1.00 119.38 ? 74  GLY A C     1 
ATOM   113  O O     . GLY A 1 52  ? -8.735  -20.007 7.787   1.00 119.38 ? 74  GLY A O     1 
ATOM   114  N N     . GLY A 1 53  ? -9.986  -19.920 5.889   1.00 119.11 ? 75  GLY A N     1 
ATOM   115  C CA    . GLY A 1 53  ? -11.254 -19.565 6.527   1.00 118.69 ? 75  GLY A CA    1 
ATOM   116  C C     . GLY A 1 53  ? -11.828 -18.300 5.913   1.00 118.35 ? 75  GLY A C     1 
ATOM   117  O O     . GLY A 1 53  ? -11.237 -17.715 5.012   1.00 118.44 ? 75  GLY A O     1 
ATOM   118  N N     . VAL A 1 54  ? -12.985 -17.870 6.394   1.00 118.01 ? 76  VAL A N     1 
ATOM   119  C CA    . VAL A 1 54  ? -13.567 -16.619 5.929   1.00 117.79 ? 76  VAL A CA    1 
ATOM   120  C C     . VAL A 1 54  ? -12.663 -15.476 6.361   1.00 117.57 ? 76  VAL A C     1 
ATOM   121  O O     . VAL A 1 54  ? -12.122 -15.501 7.462   1.00 117.49 ? 76  VAL A O     1 
ATOM   122  C CB    . VAL A 1 54  ? -15.000 -16.412 6.485   1.00 117.90 ? 76  VAL A CB    1 
ATOM   123  C CG1   . VAL A 1 54  ? -15.581 -15.031 6.104   1.00 117.67 ? 76  VAL A CG1   1 
ATOM   124  C CG2   . VAL A 1 54  ? -15.924 -17.530 6.009   1.00 118.08 ? 76  VAL A CG2   1 
ATOM   125  N N     . PRO A 1 55  ? -12.474 -14.483 5.479   1.00 117.48 ? 77  PRO A N     1 
ATOM   126  C CA    . PRO A 1 55  ? -11.740 -13.277 5.815   1.00 117.52 ? 77  PRO A CA    1 
ATOM   127  C C     . PRO A 1 55  ? -12.156 -12.698 7.157   1.00 117.55 ? 77  PRO A C     1 
ATOM   128  O O     . PRO A 1 55  ? -13.260 -12.951 7.638   1.00 117.64 ? 77  PRO A O     1 
ATOM   129  C CB    . PRO A 1 55  ? -12.147 -12.311 4.701   1.00 117.48 ? 77  PRO A CB    1 
ATOM   130  C CG    . PRO A 1 55  ? -12.337 -13.180 3.535   1.00 117.58 ? 77  PRO A CG    1 
ATOM   131  C CD    . PRO A 1 55  ? -12.819 -14.523 4.047   1.00 117.56 ? 77  PRO A CD    1 
ATOM   132  N N     . ARG A 1 56  ? -11.260 -11.917 7.743   1.00 117.62 ? 78  ARG A N     1 
ATOM   133  C CA    . ARG A 1 56  ? -11.476 -11.310 9.047   1.00 117.68 ? 78  ARG A CA    1 
ATOM   134  C C     . ARG A 1 56  ? -11.495 -12.351 10.164  1.00 117.58 ? 78  ARG A C     1 
ATOM   135  O O     . ARG A 1 56  ? -11.890 -12.043 11.299  1.00 117.72 ? 78  ARG A O     1 
ATOM   136  C CB    . ARG A 1 56  ? -12.743 -10.429 9.070   1.00 117.78 ? 78  ARG A CB    1 
ATOM   137  C CG    . ARG A 1 56  ? -12.891 -9.422  7.909   1.00 118.02 ? 78  ARG A CG    1 
ATOM   138  C CD    . ARG A 1 56  ? -11.578 -8.742  7.511   1.00 118.92 ? 78  ARG A CD    1 
ATOM   139  N NE    . ARG A 1 56  ? -10.983 -7.949  8.586   1.00 119.67 ? 78  ARG A NE    1 
ATOM   140  C CZ    . ARG A 1 56  ? -9.699  -7.606  8.643   1.00 119.68 ? 78  ARG A CZ    1 
ATOM   141  N NH1   . ARG A 1 56  ? -8.860  -8.000  7.693   1.00 119.85 ? 78  ARG A NH1   1 
ATOM   142  N NH2   . ARG A 1 56  ? -9.249  -6.883  9.659   1.00 119.17 ? 78  ARG A NH2   1 
ATOM   143  N N     . SER A 1 57  ? -11.061 -13.576 9.834   1.00 117.47 ? 79  SER A N     1 
ATOM   144  C CA    . SER A 1 57  ? -10.986 -14.672 10.806  1.00 117.45 ? 79  SER A CA    1 
ATOM   145  C C     . SER A 1 57  ? -9.579  -14.873 11.341  1.00 117.36 ? 79  SER A C     1 
ATOM   146  O O     . SER A 1 57  ? -9.131  -16.023 11.539  1.00 117.15 ? 79  SER A O     1 
ATOM   147  C CB    . SER A 1 57  ? -11.494 -15.973 10.198  1.00 117.44 ? 79  SER A CB    1 
ATOM   148  O OG    . SER A 1 57  ? -12.858 -15.845 9.856   1.00 117.73 ? 79  SER A OG    1 
ATOM   149  N N     . GLY A 1 58  ? -8.895  -13.737 11.573  1.00 117.41 ? 80  GLY A N     1 
ATOM   150  C CA    . GLY A 1 58  ? -7.556  -13.746 12.124  1.00 117.52 ? 80  GLY A CA    1 
ATOM   151  C C     . GLY A 1 58  ? -6.664  -14.719 11.398  1.00 117.67 ? 80  GLY A C     1 
ATOM   152  O O     . GLY A 1 58  ? -5.816  -15.357 12.007  1.00 117.77 ? 80  GLY A O     1 
ATOM   153  N N     . THR A 1 59  ? -6.868  -14.848 10.093  1.00 117.89 ? 81  THR A N     1 
ATOM   154  C CA    . THR A 1 59  ? -6.040  -15.734 9.283   1.00 118.13 ? 81  THR A CA    1 
ATOM   155  C C     . THR A 1 59  ? -4.625  -15.155 9.092   1.00 118.48 ? 81  THR A C     1 
ATOM   156  O O     . THR A 1 59  ? -3.634  -15.899 9.162   1.00 118.64 ? 81  THR A O     1 
ATOM   157  C CB    . THR A 1 59  ? -6.686  -16.044 7.921   1.00 118.01 ? 81  THR A CB    1 
ATOM   158  O OG1   . THR A 1 59  ? -6.965  -14.821 7.237   1.00 117.92 ? 81  THR A OG1   1 
ATOM   159  C CG2   . THR A 1 59  ? -7.970  -16.824 8.091   1.00 117.59 ? 81  THR A CG2   1 
ATOM   160  N N     . THR A 1 60  ? -4.536  -13.833 8.868   1.00 118.64 ? 82  THR A N     1 
ATOM   161  C CA    . THR A 1 60  ? -3.244  -13.132 8.800   1.00 118.65 ? 82  THR A CA    1 
ATOM   162  C C     . THR A 1 60  ? -2.475  -13.337 10.108  1.00 118.70 ? 82  THR A C     1 
ATOM   163  O O     . THR A 1 60  ? -1.290  -13.663 10.110  1.00 118.49 ? 82  THR A O     1 
ATOM   164  C CB    . THR A 1 60  ? -3.419  -11.613 8.549   1.00 118.65 ? 82  THR A CB    1 
ATOM   165  O OG1   . THR A 1 60  ? -4.475  -11.387 7.607   1.00 118.28 ? 82  THR A OG1   1 
ATOM   166  C CG2   . THR A 1 60  ? -2.134  -11.006 8.018   1.00 118.77 ? 82  THR A CG2   1 
ATOM   167  N N     . LEU A 1 61  ? -3.181  -13.148 11.217  1.00 118.83 ? 83  LEU A N     1 
ATOM   168  C CA    . LEU A 1 61  ? -2.650  -13.449 12.521  1.00 118.90 ? 83  LEU A CA    1 
ATOM   169  C C     . LEU A 1 61  ? -2.121  -14.871 12.530  1.00 119.07 ? 83  LEU A C     1 
ATOM   170  O O     . LEU A 1 61  ? -0.962  -15.081 12.821  1.00 119.37 ? 83  LEU A O     1 
ATOM   171  C CB    . LEU A 1 61  ? -3.733  -13.257 13.584  1.00 118.82 ? 83  LEU A CB    1 
ATOM   172  C CG    . LEU A 1 61  ? -3.368  -13.485 15.054  1.00 118.69 ? 83  LEU A CG    1 
ATOM   173  C CD1   . LEU A 1 61  ? -2.167  -12.623 15.478  1.00 118.60 ? 83  LEU A CD1   1 
ATOM   174  C CD2   . LEU A 1 61  ? -4.597  -13.261 15.947  1.00 117.50 ? 83  LEU A CD2   1 
ATOM   175  N N     . MET A 1 62  ? -2.953  -15.841 12.175  1.00 119.27 ? 84  MET A N     1 
ATOM   176  C CA    . MET A 1 62  ? -2.534  -17.230 12.225  1.00 119.58 ? 84  MET A CA    1 
ATOM   177  C C     . MET A 1 62  ? -1.239  -17.467 11.487  1.00 120.05 ? 84  MET A C     1 
ATOM   178  O O     . MET A 1 62  ? -0.308  -18.047 12.040  1.00 120.33 ? 84  MET A O     1 
ATOM   179  C CB    . MET A 1 62  ? -3.587  -18.147 11.634  1.00 119.55 ? 84  MET A CB    1 
ATOM   180  C CG    . MET A 1 62  ? -3.192  -19.605 11.690  1.00 119.44 ? 84  MET A CG    1 
ATOM   181  S SD    . MET A 1 62  ? -2.935  -20.133 13.381  1.00 119.06 ? 84  MET A SD    1 
ATOM   182  C CE    . MET A 1 62  ? -1.163  -20.295 13.499  1.00 120.28 ? 84  MET A CE    1 
ATOM   183  N N     . ARG A 1 63  ? -1.176  -17.031 10.235  1.00 120.49 ? 85  ARG A N     1 
ATOM   184  C CA    . ARG A 1 63  ? 0.005   -17.314 9.426   1.00 121.06 ? 85  ARG A CA    1 
ATOM   185  C C     . ARG A 1 63  ? 1.234   -16.540 9.898   1.00 121.39 ? 85  ARG A C     1 
ATOM   186  O O     . ARG A 1 63  ? 2.346   -17.056 9.844   1.00 121.47 ? 85  ARG A O     1 
ATOM   187  C CB    . ARG A 1 63  ? -0.261  -17.096 7.928   1.00 121.10 ? 85  ARG A CB    1 
ATOM   188  C CG    . ARG A 1 63  ? -0.377  -15.647 7.474   1.00 121.20 ? 85  ARG A CG    1 
ATOM   189  C CD    . ARG A 1 63  ? 0.937   -15.102 6.916   1.00 120.53 ? 85  ARG A CD    1 
ATOM   190  N NE    . ARG A 1 63  ? 0.733   -13.728 6.427   1.00 120.54 ? 85  ARG A NE    1 
ATOM   191  C CZ    . ARG A 1 63  ? 1.715   -12.907 6.077   1.00 120.92 ? 85  ARG A CZ    1 
ATOM   192  N NH1   . ARG A 1 63  ? 2.996   -13.315 6.155   1.00 121.02 ? 85  ARG A NH1   1 
ATOM   193  N NH2   . ARG A 1 63  ? 1.412   -11.674 5.641   1.00 121.39 ? 85  ARG A NH2   1 
ATOM   194  N N     . ALA A 1 64  ? 1.027   -15.315 10.376  1.00 121.85 ? 86  ALA A N     1 
ATOM   195  C CA    . ALA A 1 64  ? 2.134   -14.474 10.836  1.00 122.33 ? 86  ALA A CA    1 
ATOM   196  C C     . ALA A 1 64  ? 2.967   -15.139 11.936  1.00 122.66 ? 86  ALA A C     1 
ATOM   197  O O     . ALA A 1 64  ? 4.183   -14.979 11.981  1.00 122.76 ? 86  ALA A O     1 
ATOM   198  C CB    . ALA A 1 64  ? 1.621   -13.116 11.297  1.00 122.34 ? 86  ALA A CB    1 
ATOM   199  N N     . MET A 1 65  ? 2.305   -15.892 12.811  1.00 123.17 ? 87  MET A N     1 
ATOM   200  C CA    . MET A 1 65  ? 2.975   -16.598 13.895  1.00 123.67 ? 87  MET A CA    1 
ATOM   201  C C     . MET A 1 65  ? 3.723   -17.810 13.367  1.00 123.81 ? 87  MET A C     1 
ATOM   202  O O     . MET A 1 65  ? 4.692   -18.258 13.972  1.00 123.88 ? 87  MET A O     1 
ATOM   203  C CB    . MET A 1 65  ? 1.979   -17.018 14.983  1.00 123.89 ? 87  MET A CB    1 
ATOM   204  C CG    . MET A 1 65  ? 1.537   -15.888 15.927  1.00 124.76 ? 87  MET A CG    1 
ATOM   205  S SD    . MET A 1 65  ? 0.425   -16.418 17.263  1.00 126.46 ? 87  MET A SD    1 
ATOM   206  C CE    . MET A 1 65  ? -0.947  -17.066 16.303  1.00 126.76 ? 87  MET A CE    1 
ATOM   207  N N     . LEU A 1 66  ? 3.277   -18.340 12.237  1.00 124.06 ? 88  LEU A N     1 
ATOM   208  C CA    . LEU A 1 66  ? 3.988   -19.442 11.609  1.00 124.53 ? 88  LEU A CA    1 
ATOM   209  C C     . LEU A 1 66  ? 5.210   -18.976 10.790  1.00 124.98 ? 88  LEU A C     1 
ATOM   210  O O     . LEU A 1 66  ? 6.206   -19.695 10.706  1.00 124.97 ? 88  LEU A O     1 
ATOM   211  C CB    . LEU A 1 66  ? 3.035   -20.272 10.757  1.00 124.46 ? 88  LEU A CB    1 
ATOM   212  C CG    . LEU A 1 66  ? 1.827   -20.869 11.475  1.00 124.27 ? 88  LEU A CG    1 
ATOM   213  C CD1   . LEU A 1 66  ? 0.778   -21.269 10.457  1.00 124.39 ? 88  LEU A CD1   1 
ATOM   214  C CD2   . LEU A 1 66  ? 2.234   -22.060 12.322  1.00 124.12 ? 88  LEU A CD2   1 
ATOM   215  N N     . ASP A 1 67  ? 5.129   -17.781 10.192  1.00 125.52 ? 89  ASP A N     1 
ATOM   216  C CA    . ASP A 1 67  ? 6.255   -17.163 9.457   1.00 126.00 ? 89  ASP A CA    1 
ATOM   217  C C     . ASP A 1 67  ? 7.443   -16.927 10.377  1.00 126.32 ? 89  ASP A C     1 
ATOM   218  O O     . ASP A 1 67  ? 8.598   -17.192 10.006  1.00 126.39 ? 89  ASP A O     1 
ATOM   219  C CB    . ASP A 1 67  ? 5.837   -15.821 8.828   1.00 126.02 ? 89  ASP A CB    1 
ATOM   220  C CG    . ASP A 1 67  ? 6.014   -15.795 7.290   1.00 126.40 ? 89  ASP A CG    1 
ATOM   221  O OD1   . ASP A 1 67  ? 7.177   -15.957 6.786   1.00 126.31 ? 89  ASP A OD1   1 
ATOM   222  O OD2   . ASP A 1 67  ? 4.989   -15.577 6.584   1.00 126.85 ? 89  ASP A OD2   1 
ATOM   223  N N     . ALA A 1 68  ? 7.125   -16.421 11.574  1.00 126.71 ? 90  ALA A N     1 
ATOM   224  C CA    . ALA A 1 68  ? 8.090   -16.119 12.620  1.00 127.16 ? 90  ALA A CA    1 
ATOM   225  C C     . ALA A 1 68  ? 8.939   -17.341 12.981  1.00 127.54 ? 90  ALA A C     1 
ATOM   226  O O     . ALA A 1 68  ? 10.140  -17.211 13.235  1.00 127.53 ? 90  ALA A O     1 
ATOM   227  C CB    . ALA A 1 68  ? 7.366   -15.581 13.844  1.00 127.13 ? 90  ALA A CB    1 
ATOM   228  N N     . HIS A 1 69  ? 8.305   -18.517 13.003  1.00 128.03 ? 91  HIS A N     1 
ATOM   229  C CA    . HIS A 1 69  ? 9.002   -19.789 13.142  1.00 128.48 ? 91  HIS A CA    1 
ATOM   230  C C     . HIS A 1 69  ? 10.083  -19.850 12.062  1.00 129.03 ? 91  HIS A C     1 
ATOM   231  O O     . HIS A 1 69  ? 9.818   -19.573 10.877  1.00 129.07 ? 91  HIS A O     1 
ATOM   232  C CB    . HIS A 1 69  ? 8.018   -20.951 12.988  1.00 128.41 ? 91  HIS A CB    1 
ATOM   233  C CG    . HIS A 1 69  ? 8.524   -22.259 13.520  1.00 128.21 ? 91  HIS A CG    1 
ATOM   234  N ND1   . HIS A 1 69  ? 9.526   -22.986 12.901  1.00 128.37 ? 91  HIS A ND1   1 
ATOM   235  C CD2   . HIS A 1 69  ? 8.136   -22.992 14.589  1.00 128.40 ? 91  HIS A CD2   1 
ATOM   236  C CE1   . HIS A 1 69  ? 9.745   -24.102 13.577  1.00 128.74 ? 91  HIS A CE1   1 
ATOM   237  N NE2   . HIS A 1 69  ? 8.914   -24.130 14.607  1.00 128.77 ? 91  HIS A NE2   1 
ATOM   238  N N     . PRO A 1 70  ? 11.317  -20.185 12.471  1.00 129.48 ? 92  PRO A N     1 
ATOM   239  C CA    . PRO A 1 70  ? 12.457  -20.189 11.563  1.00 129.76 ? 92  PRO A CA    1 
ATOM   240  C C     . PRO A 1 70  ? 12.246  -21.183 10.431  1.00 129.97 ? 92  PRO A C     1 
ATOM   241  O O     . PRO A 1 70  ? 12.442  -20.827 9.241   1.00 130.03 ? 92  PRO A O     1 
ATOM   242  C CB    . PRO A 1 70  ? 13.618  -20.639 12.460  1.00 129.81 ? 92  PRO A CB    1 
ATOM   243  C CG    . PRO A 1 70  ? 12.976  -21.382 13.579  1.00 129.69 ? 92  PRO A CG    1 
ATOM   244  C CD    . PRO A 1 70  ? 11.690  -20.662 13.816  1.00 129.59 ? 92  PRO A CD    1 
ATOM   245  N N     . GLU A 1 71  ? 11.816  -22.405 10.812  1.00 130.11 ? 93  GLU A N     1 
ATOM   246  C CA    . GLU A 1 71  ? 11.603  -23.487 9.859   1.00 130.24 ? 93  GLU A CA    1 
ATOM   247  C C     . GLU A 1 71  ? 10.436  -23.226 8.912   1.00 129.54 ? 93  GLU A C     1 
ATOM   248  O O     . GLU A 1 71  ? 10.183  -24.039 7.999   1.00 129.74 ? 93  GLU A O     1 
ATOM   249  C CB    . GLU A 1 71  ? 11.309  -24.793 10.593  1.00 130.65 ? 93  GLU A CB    1 
ATOM   250  C CG    . GLU A 1 71  ? 12.337  -25.228 11.611  1.00 133.12 ? 93  GLU A CG    1 
ATOM   251  C CD    . GLU A 1 71  ? 11.876  -26.457 12.359  1.00 136.46 ? 93  GLU A CD    1 
ATOM   252  O OE1   . GLU A 1 71  ? 11.446  -27.428 11.696  1.00 137.92 ? 93  GLU A OE1   1 
ATOM   253  O OE2   . GLU A 1 71  ? 11.930  -26.452 13.609  1.00 137.64 ? 93  GLU A OE2   1 
ATOM   254  N N     . VAL A 1 72  ? 9.700   -22.130 9.132   1.00 128.55 ? 94  VAL A N     1 
ATOM   255  C CA    . VAL A 1 72  ? 8.481   -21.928 8.363   1.00 127.53 ? 94  VAL A CA    1 
ATOM   256  C C     . VAL A 1 72  ? 8.335   -20.540 7.774   1.00 126.73 ? 94  VAL A C     1 
ATOM   257  O O     . VAL A 1 72  ? 8.773   -19.538 8.360   1.00 126.49 ? 94  VAL A O     1 
ATOM   258  C CB    . VAL A 1 72  ? 7.212   -22.289 9.168   1.00 127.66 ? 94  VAL A CB    1 
ATOM   259  C CG1   . VAL A 1 72  ? 5.974   -22.217 8.269   1.00 127.85 ? 94  VAL A CG1   1 
ATOM   260  C CG2   . VAL A 1 72  ? 7.327   -23.697 9.742   1.00 127.87 ? 94  VAL A CG2   1 
ATOM   261  N N     . ARG A 1 73  ? 7.717   -20.525 6.594   1.00 125.72 ? 95  ARG A N     1 
ATOM   262  C CA    . ARG A 1 73  ? 7.318   -19.313 5.910   1.00 124.87 ? 95  ARG A CA    1 
ATOM   263  C C     . ARG A 1 73  ? 5.953   -19.519 5.240   1.00 124.45 ? 95  ARG A C     1 
ATOM   264  O O     . ARG A 1 73  ? 5.707   -20.555 4.603   1.00 124.41 ? 95  ARG A O     1 
ATOM   265  C CB    . ARG A 1 73  ? 8.382   -18.927 4.884   1.00 124.79 ? 95  ARG A CB    1 
ATOM   266  C CG    . ARG A 1 73  ? 8.335   -17.474 4.421   1.00 124.51 ? 95  ARG A CG    1 
ATOM   267  C CD    . ARG A 1 73  ? 7.594   -17.334 3.103   1.00 124.40 ? 95  ARG A CD    1 
ATOM   268  N NE    . ARG A 1 73  ? 8.315   -17.976 2.005   1.00 124.00 ? 95  ARG A NE    1 
ATOM   269  C CZ    . ARG A 1 73  ? 7.746   -18.431 0.891   1.00 124.18 ? 95  ARG A CZ    1 
ATOM   270  N NH1   . ARG A 1 73  ? 8.494   -18.993 -0.049  1.00 124.27 ? 95  ARG A NH1   1 
ATOM   271  N NH2   . ARG A 1 73  ? 6.430   -18.327 0.714   1.00 124.97 ? 95  ARG A NH2   1 
ATOM   272  N N     . CYS A 1 74  ? 5.071   -18.530 5.415   1.00 123.78 ? 96  CYS A N     1 
ATOM   273  C CA    . CYS A 1 74  ? 3.776   -18.482 4.737   1.00 123.12 ? 96  CYS A CA    1 
ATOM   274  C C     . CYS A 1 74  ? 3.734   -17.335 3.757   1.00 122.68 ? 96  CYS A C     1 
ATOM   275  O O     . CYS A 1 74  ? 3.199   -17.468 2.651   1.00 122.62 ? 96  CYS A O     1 
ATOM   276  C CB    . CYS A 1 74  ? 2.642   -18.267 5.728   1.00 123.11 ? 96  CYS A CB    1 
ATOM   277  S SG    . CYS A 1 74  ? 2.382   -19.608 6.850   1.00 123.24 ? 96  CYS A SG    1 
ATOM   278  N N     . GLY A 1 75  ? 4.277   -16.195 4.194   1.00 122.20 ? 97  GLY A N     1 
ATOM   279  C CA    . GLY A 1 75  ? 4.218   -14.966 3.423   1.00 121.77 ? 97  GLY A CA    1 
ATOM   280  C C     . GLY A 1 75  ? 2.786   -14.510 3.218   1.00 121.48 ? 97  GLY A C     1 
ATOM   281  O O     . GLY A 1 75  ? 1.848   -15.077 3.791   1.00 121.58 ? 97  GLY A O     1 
ATOM   282  N N     . GLU A 1 76  ? 2.620   -13.499 2.371   1.00 121.09 ? 98  GLU A N     1 
ATOM   283  C CA    . GLU A 1 76  ? 1.337   -12.830 2.180   1.00 120.79 ? 98  GLU A CA    1 
ATOM   284  C C     . GLU A 1 76  ? 0.293   -13.691 1.459   1.00 120.49 ? 98  GLU A C     1 
ATOM   285  O O     . GLU A 1 76  ? 0.526   -14.874 1.170   1.00 120.30 ? 98  GLU A O     1 
ATOM   286  C CB    . GLU A 1 76  ? 1.543   -11.499 1.441   1.00 120.85 ? 98  GLU A CB    1 
ATOM   287  C CG    . GLU A 1 76  ? 2.425   -10.505 2.182   1.00 121.75 ? 98  GLU A CG    1 
ATOM   288  C CD    . GLU A 1 76  ? 3.920   -10.636 1.823   1.00 123.62 ? 98  GLU A CD    1 
ATOM   289  O OE1   . GLU A 1 76  ? 4.629   -9.586  1.751   1.00 124.38 ? 98  GLU A OE1   1 
ATOM   290  O OE2   . GLU A 1 76  ? 4.398   -11.775 1.606   1.00 124.36 ? 98  GLU A OE2   1 
ATOM   291  N N     . GLU A 1 77  ? -0.870  -13.084 1.214   1.00 120.25 ? 99  GLU A N     1 
ATOM   292  C CA    . GLU A 1 77  ? -1.913  -13.662 0.383   1.00 120.07 ? 99  GLU A CA    1 
ATOM   293  C C     . GLU A 1 77  ? -1.481  -13.572 -1.067  1.00 119.99 ? 99  GLU A C     1 
ATOM   294  O O     . GLU A 1 77  ? -1.065  -12.512 -1.519  1.00 119.97 ? 99  GLU A O     1 
ATOM   295  C CB    . GLU A 1 77  ? -3.208  -12.861 0.521   1.00 120.13 ? 99  GLU A CB    1 
ATOM   296  C CG    . GLU A 1 77  ? -3.928  -12.928 1.862   1.00 120.34 ? 99  GLU A CG    1 
ATOM   297  C CD    . GLU A 1 77  ? -5.387  -12.366 1.755   1.00 120.83 ? 99  GLU A CD    1 
ATOM   298  O OE1   . GLU A 1 77  ? -5.768  -11.771 0.687   1.00 120.94 ? 99  GLU A OE1   1 
ATOM   299  O OE2   . GLU A 1 77  ? -6.158  -12.513 2.735   1.00 120.36 ? 99  GLU A OE2   1 
ATOM   300  N N     . THR A 1 78  ? -1.609  -14.673 -1.802  1.00 119.97 ? 100 THR A N     1 
ATOM   301  C CA    . THR A 1 78  ? -1.226  -14.717 -3.214  1.00 120.02 ? 100 THR A CA    1 
ATOM   302  C C     . THR A 1 78  ? -2.265  -14.120 -4.177  1.00 120.19 ? 100 THR A C     1 
ATOM   303  O O     . THR A 1 78  ? -1.898  -13.518 -5.183  1.00 120.40 ? 100 THR A O     1 
ATOM   304  C CB    . THR A 1 78  ? -0.852  -16.148 -3.658  1.00 119.94 ? 100 THR A CB    1 
ATOM   305  O OG1   . THR A 1 78  ? -2.041  -16.899 -3.963  1.00 119.99 ? 100 THR A OG1   1 
ATOM   306  C CG2   . THR A 1 78  ? -0.070  -16.847 -2.561  1.00 119.79 ? 100 THR A CG2   1 
ATOM   307  N N     . ARG A 1 79  ? -3.552  -14.289 -3.873  1.00 120.32 ? 101 ARG A N     1 
ATOM   308  C CA    . ARG A 1 79  ? -4.649  -13.850 -4.743  1.00 120.53 ? 101 ARG A CA    1 
ATOM   309  C C     . ARG A 1 79  ? -4.792  -14.774 -5.924  1.00 120.39 ? 101 ARG A C     1 
ATOM   310  O O     . ARG A 1 79  ? -5.891  -15.014 -6.406  1.00 120.49 ? 101 ARG A O     1 
ATOM   311  C CB    . ARG A 1 79  ? -4.436  -12.429 -5.273  1.00 120.70 ? 101 ARG A CB    1 
ATOM   312  C CG    . ARG A 1 79  ? -4.225  -11.386 -4.214  1.00 122.19 ? 101 ARG A CG    1 
ATOM   313  C CD    . ARG A 1 79  ? -4.459  -10.010 -4.775  1.00 125.24 ? 101 ARG A CD    1 
ATOM   314  N NE    . ARG A 1 79  ? -5.369  -9.258  -3.913  1.00 128.26 ? 101 ARG A NE    1 
ATOM   315  C CZ    . ARG A 1 79  ? -6.696  -9.225  -4.060  1.00 129.67 ? 101 ARG A CZ    1 
ATOM   316  N NH1   . ARG A 1 79  ? -7.283  -9.894  -5.052  1.00 129.81 ? 101 ARG A NH1   1 
ATOM   317  N NH2   . ARG A 1 79  ? -7.438  -8.516  -3.215  1.00 130.58 ? 101 ARG A NH2   1 
ATOM   318  N N     . ILE A 1 80  ? -3.667  -15.282 -6.398  1.00 120.42 ? 102 ILE A N     1 
ATOM   319  C CA    . ILE A 1 80  ? -3.646  -16.012 -7.647  1.00 120.50 ? 102 ILE A CA    1 
ATOM   320  C C     . ILE A 1 80  ? -4.052  -17.459 -7.459  1.00 120.31 ? 102 ILE A C     1 
ATOM   321  O O     . ILE A 1 80  ? -4.720  -18.039 -8.314  1.00 120.34 ? 102 ILE A O     1 
ATOM   322  C CB    . ILE A 1 80  ? -2.269  -15.896 -8.376  1.00 120.54 ? 102 ILE A CB    1 
ATOM   323  C CG1   . ILE A 1 80  ? -2.462  -16.034 -9.892  1.00 121.19 ? 102 ILE A CG1   1 
ATOM   324  C CG2   . ILE A 1 80  ? -1.259  -16.925 -7.866  1.00 120.61 ? 102 ILE A CG2   1 
ATOM   325  C CD1   . ILE A 1 80  ? -3.514  -15.097 -10.407 1.00 122.37 ? 102 ILE A CD1   1 
ATOM   326  N N     . ILE A 1 81  ? -3.655  -18.035 -6.333  1.00 120.11 ? 103 ILE A N     1 
ATOM   327  C CA    . ILE A 1 81  ? -3.906  -19.439 -6.101  1.00 120.03 ? 103 ILE A CA    1 
ATOM   328  C C     . ILE A 1 81  ? -5.411  -19.717 -6.071  1.00 120.16 ? 103 ILE A C     1 
ATOM   329  O O     . ILE A 1 81  ? -5.889  -20.592 -6.798  1.00 120.22 ? 103 ILE A O     1 
ATOM   330  C CB    . ILE A 1 81  ? -3.176  -19.939 -4.855  1.00 119.84 ? 103 ILE A CB    1 
ATOM   331  C CG1   . ILE A 1 81  ? -1.673  -19.919 -5.118  1.00 119.67 ? 103 ILE A CG1   1 
ATOM   332  C CG2   . ILE A 1 81  ? -3.610  -21.347 -4.519  1.00 119.89 ? 103 ILE A CG2   1 
ATOM   333  C CD1   . ILE A 1 81  ? -0.829  -20.086 -3.889  1.00 119.92 ? 103 ILE A CD1   1 
ATOM   334  N N     . PRO A 1 82  ? -6.173  -18.945 -5.273  1.00 120.26 ? 104 PRO A N     1 
ATOM   335  C CA    . PRO A 1 82  ? -7.623  -19.159 -5.290  1.00 120.34 ? 104 PRO A CA    1 
ATOM   336  C C     . PRO A 1 82  ? -8.201  -18.957 -6.688  1.00 120.38 ? 104 PRO A C     1 
ATOM   337  O O     . PRO A 1 82  ? -9.048  -19.730 -7.141  1.00 120.25 ? 104 PRO A O     1 
ATOM   338  C CB    . PRO A 1 82  ? -8.153  -18.082 -4.333  1.00 120.37 ? 104 PRO A CB    1 
ATOM   339  C CG    . PRO A 1 82  ? -7.056  -17.079 -4.215  1.00 120.41 ? 104 PRO A CG    1 
ATOM   340  C CD    . PRO A 1 82  ? -5.786  -17.837 -4.379  1.00 120.24 ? 104 PRO A CD    1 
ATOM   341  N N     . ARG A 1 83  ? -7.707  -17.928 -7.363  1.00 120.48 ? 105 ARG A N     1 
ATOM   342  C CA    . ARG A 1 83  ? -8.168  -17.567 -8.676  1.00 120.75 ? 105 ARG A CA    1 
ATOM   343  C C     . ARG A 1 83  ? -8.030  -18.721 -9.654  1.00 120.42 ? 105 ARG A C     1 
ATOM   344  O O     . ARG A 1 83  ? -8.965  -19.010 -10.393 1.00 120.52 ? 105 ARG A O     1 
ATOM   345  C CB    . ARG A 1 83  ? -7.379  -16.374 -9.158  1.00 121.01 ? 105 ARG A CB    1 
ATOM   346  C CG    . ARG A 1 83  ? -8.015  -15.640 -10.287 1.00 123.23 ? 105 ARG A CG    1 
ATOM   347  C CD    . ARG A 1 83  ? -7.245  -14.374 -10.513 1.00 127.78 ? 105 ARG A CD    1 
ATOM   348  N NE    . ARG A 1 83  ? -7.252  -13.514 -9.319  1.00 130.88 ? 105 ARG A NE    1 
ATOM   349  C CZ    . ARG A 1 83  ? -8.059  -12.463 -9.166  1.00 132.76 ? 105 ARG A CZ    1 
ATOM   350  N NH1   . ARG A 1 83  ? -8.003  -11.730 -8.065  1.00 133.70 ? 105 ARG A NH1   1 
ATOM   351  N NH2   . ARG A 1 83  ? -8.920  -12.141 -10.137 1.00 133.96 ? 105 ARG A NH2   1 
ATOM   352  N N     . VAL A 1 84  ? -6.878  -19.388 -9.644  1.00 120.23 ? 106 VAL A N     1 
ATOM   353  C CA    . VAL A 1 84  ? -6.632  -20.512 -10.560 1.00 120.03 ? 106 VAL A CA    1 
ATOM   354  C C     . VAL A 1 84  ? -7.360  -21.783 -10.129 1.00 119.92 ? 106 VAL A C     1 
ATOM   355  O O     . VAL A 1 84  ? -7.568  -22.698 -10.937 1.00 119.84 ? 106 VAL A O     1 
ATOM   356  C CB    . VAL A 1 84  ? -5.117  -20.808 -10.766 1.00 119.99 ? 106 VAL A CB    1 
ATOM   357  C CG1   . VAL A 1 84  ? -4.408  -19.595 -11.374 1.00 120.07 ? 106 VAL A CG1   1 
ATOM   358  C CG2   . VAL A 1 84  ? -4.450  -21.246 -9.468  1.00 119.89 ? 106 VAL A CG2   1 
ATOM   359  N N     . LEU A 1 85  ? -7.743  -21.837 -8.855  1.00 119.89 ? 107 LEU A N     1 
ATOM   360  C CA    . LEU A 1 85  ? -8.552  -22.937 -8.365  1.00 119.83 ? 107 LEU A CA    1 
ATOM   361  C C     . LEU A 1 85  ? -10.004 -22.736 -8.781  1.00 120.21 ? 107 LEU A C     1 
ATOM   362  O O     . LEU A 1 85  ? -10.654 -23.677 -9.257  1.00 120.32 ? 107 LEU A O     1 
ATOM   363  C CB    . LEU A 1 85  ? -8.431  -23.049 -6.849  1.00 119.52 ? 107 LEU A CB    1 
ATOM   364  C CG    . LEU A 1 85  ? -7.112  -23.642 -6.349  1.00 118.74 ? 107 LEU A CG    1 
ATOM   365  C CD1   . LEU A 1 85  ? -6.867  -23.190 -4.935  1.00 118.00 ? 107 LEU A CD1   1 
ATOM   366  C CD2   . LEU A 1 85  ? -7.128  -25.156 -6.430  1.00 118.05 ? 107 LEU A CD2   1 
ATOM   367  N N     . ALA A 1 86  ? -10.497 -21.503 -8.613  1.00 120.58 ? 108 ALA A N     1 
ATOM   368  C CA    . ALA A 1 86  ? -11.845 -21.111 -9.045  1.00 120.99 ? 108 ALA A CA    1 
ATOM   369  C C     . ALA A 1 86  ? -12.129 -21.559 -10.479 1.00 121.46 ? 108 ALA A C     1 
ATOM   370  O O     . ALA A 1 86  ? -13.145 -22.197 -10.746 1.00 121.45 ? 108 ALA A O     1 
ATOM   371  C CB    . ALA A 1 86  ? -12.032 -19.607 -8.904  1.00 120.76 ? 108 ALA A CB    1 
ATOM   372  N N     . MET A 1 87  ? -11.212 -21.236 -11.388 1.00 122.18 ? 109 MET A N     1 
ATOM   373  C CA    . MET A 1 87  ? -11.292 -21.696 -12.772 1.00 123.04 ? 109 MET A CA    1 
ATOM   374  C C     . MET A 1 87  ? -11.113 -23.211 -12.863 1.00 123.48 ? 109 MET A C     1 
ATOM   375  O O     . MET A 1 87  ? -11.715 -23.844 -13.735 1.00 123.58 ? 109 MET A O     1 
ATOM   376  C CB    . MET A 1 87  ? -10.210 -21.049 -13.627 1.00 123.17 ? 109 MET A CB    1 
ATOM   377  C CG    . MET A 1 87  ? -10.200 -19.524 -13.721 1.00 124.05 ? 109 MET A CG    1 
ATOM   378  S SD    . MET A 1 87  ? -8.482  -18.949 -13.925 1.00 126.28 ? 109 MET A SD    1 
ATOM   379  C CE    . MET A 1 87  ? -7.645  -20.464 -14.490 1.00 124.56 ? 109 MET A CE    1 
ATOM   380  N N     . ARG A 1 88  ? -10.268 -23.778 -11.985 1.00 124.17 ? 110 ARG A N     1 
ATOM   381  C CA    . ARG A 1 88  ? -9.994  -25.220 -11.980 1.00 125.09 ? 110 ARG A CA    1 
ATOM   382  C C     . ARG A 1 88  ? -11.268 -25.963 -11.707 1.00 125.52 ? 110 ARG A C     1 
ATOM   383  O O     . ARG A 1 88  ? -11.623 -26.898 -12.420 1.00 125.65 ? 110 ARG A O     1 
ATOM   384  C CB    . ARG A 1 88  ? -8.986  -25.598 -11.005 1.00 125.25 ? 110 ARG A CB    1 
ATOM   385  C CG    . ARG A 1 88  ? -8.517  -27.046 -11.207 1.00 126.38 ? 110 ARG A CG    1 
ATOM   386  C CD    . ARG A 1 88  ? -9.550  -28.049 -10.441 1.00 127.85 ? 110 ARG A CD    1 
ATOM   387  N NE    . ARG A 1 88  ? -9.210  -29.396 -10.864 1.00 129.56 ? 110 ARG A NE    1 
ATOM   388  C CZ    . ARG A 1 88  ? -9.704  -29.976 -11.973 1.00 130.49 ? 110 ARG A CZ    1 
ATOM   389  N NH1   . ARG A 1 88  ? -9.309  -31.200 -12.322 1.00 130.78 ? 110 ARG A NH1   1 
ATOM   390  N NH2   . ARG A 1 88  ? -10.595 -29.340 -12.730 1.00 131.54 ? 110 ARG A NH2   1 
ATOM   391  N N     . GLN A 1 89  ? -11.925 -25.556 -10.632 1.00 126.27 ? 111 GLN A N     1 
ATOM   392  C CA    . GLN A 1 89  ? -13.260 -26.008 -10.329 1.00 127.28 ? 111 GLN A CA    1 
ATOM   393  C C     . GLN A 1 89  ? -14.105 -25.989 -11.603 1.00 127.47 ? 111 GLN A C     1 
ATOM   394  O O     . GLN A 1 89  ? -14.591 -27.031 -12.058 1.00 127.53 ? 111 GLN A O     1 
ATOM   395  C CB    . GLN A 1 89  ? -13.887 -25.076 -9.285  1.00 127.58 ? 111 GLN A CB    1 
ATOM   396  C CG    . GLN A 1 89  ? -15.360 -25.339 -8.995  1.00 129.44 ? 111 GLN A CG    1 
ATOM   397  C CD    . GLN A 1 89  ? -15.596 -26.720 -8.411  1.00 132.16 ? 111 GLN A CD    1 
ATOM   398  O OE1   . GLN A 1 89  ? -15.689 -26.849 -7.179  1.00 133.74 ? 111 GLN A OE1   1 
ATOM   399  N NE2   . GLN A 1 89  ? -15.521 -27.765 -9.288  1.00 133.14 ? 111 GLN A NE2   1 
ATOM   400  N N     . ALA A 1 90  ? -14.239 -24.792 -12.180 1.00 127.79 ? 112 ALA A N     1 
ATOM   401  C CA    . ALA A 1 90  ? -15.080 -24.539 -13.346 1.00 128.01 ? 112 ALA A CA    1 
ATOM   402  C C     . ALA A 1 90  ? -15.012 -25.599 -14.458 1.00 128.26 ? 112 ALA A C     1 
ATOM   403  O O     . ALA A 1 90  ? -16.055 -26.095 -14.882 1.00 128.48 ? 112 ALA A O     1 
ATOM   404  C CB    . ALA A 1 90  ? -14.827 -23.129 -13.903 1.00 127.94 ? 112 ALA A CB    1 
ATOM   405  N N     . TRP A 1 91  ? -13.810 -25.959 -14.913 1.00 128.54 ? 113 TRP A N     1 
ATOM   406  C CA    . TRP A 1 91  ? -13.667 -26.843 -16.091 1.00 128.85 ? 113 TRP A CA    1 
ATOM   407  C C     . TRP A 1 91  ? -14.096 -28.294 -15.867 1.00 129.21 ? 113 TRP A C     1 
ATOM   408  O O     . TRP A 1 91  ? -14.464 -28.993 -16.837 1.00 129.30 ? 113 TRP A O     1 
ATOM   409  C CB    . TRP A 1 91  ? -12.248 -26.779 -16.684 1.00 128.68 ? 113 TRP A CB    1 
ATOM   410  C CG    . TRP A 1 91  ? -11.775 -25.375 -16.919 1.00 128.17 ? 113 TRP A CG    1 
ATOM   411  C CD1   . TRP A 1 91  ? -12.422 -24.394 -17.642 1.00 127.40 ? 113 TRP A CD1   1 
ATOM   412  C CD2   . TRP A 1 91  ? -10.550 -24.783 -16.420 1.00 128.09 ? 113 TRP A CD2   1 
ATOM   413  N NE1   . TRP A 1 91  ? -11.678 -23.230 -17.619 1.00 127.63 ? 113 TRP A NE1   1 
ATOM   414  C CE2   . TRP A 1 91  ? -10.522 -23.439 -16.878 1.00 128.03 ? 113 TRP A CE2   1 
ATOM   415  C CE3   . TRP A 1 91  ? -9.470  -25.258 -15.622 1.00 127.90 ? 113 TRP A CE3   1 
ATOM   416  C CZ2   . TRP A 1 91  ? -9.443  -22.558 -16.572 1.00 127.58 ? 113 TRP A CZ2   1 
ATOM   417  C CZ3   . TRP A 1 91  ? -8.398  -24.379 -15.313 1.00 127.19 ? 113 TRP A CZ3   1 
ATOM   418  C CH2   . TRP A 1 91  ? -8.398  -23.049 -15.790 1.00 127.00 ? 113 TRP A CH2   1 
ATOM   419  N N     . SER A 1 92  ? -14.048 -28.747 -14.607 1.00 129.57 ? 114 SER A N     1 
ATOM   420  C CA    . SER A 1 92  ? -14.577 -30.064 -14.286 1.00 129.99 ? 114 SER A CA    1 
ATOM   421  C C     . SER A 1 92  ? -16.024 -29.977 -13.829 1.00 130.17 ? 114 SER A C     1 
ATOM   422  O O     . SER A 1 92  ? -16.806 -30.897 -14.059 1.00 130.31 ? 114 SER A O     1 
ATOM   423  C CB    . SER A 1 92  ? -13.732 -30.758 -13.225 1.00 130.05 ? 114 SER A CB    1 
ATOM   424  O OG    . SER A 1 92  ? -12.818 -31.643 -13.852 1.00 130.37 ? 114 SER A OG    1 
ATOM   425  N N     . GLU A 1 103 ? -11.467 -35.545 -24.632 1.00 129.14 ? 125 GLU A N     1 
ATOM   426  C CA    . GLU A 1 103 ? -11.193 -35.676 -26.066 1.00 129.30 ? 125 GLU A CA    1 
ATOM   427  C C     . GLU A 1 103 ? -9.860  -35.041 -26.478 1.00 128.88 ? 125 GLU A C     1 
ATOM   428  O O     . GLU A 1 103 ? -9.132  -35.579 -27.330 1.00 128.89 ? 125 GLU A O     1 
ATOM   429  C CB    . GLU A 1 103 ? -12.348 -35.091 -26.889 1.00 129.51 ? 125 GLU A CB    1 
ATOM   430  C CG    . GLU A 1 103 ? -13.454 -36.107 -27.190 1.00 131.50 ? 125 GLU A CG    1 
ATOM   431  C CD    . GLU A 1 103 ? -12.908 -37.361 -27.893 1.00 134.31 ? 125 GLU A CD    1 
ATOM   432  O OE1   . GLU A 1 103 ? -12.786 -38.424 -27.228 1.00 135.47 ? 125 GLU A OE1   1 
ATOM   433  O OE2   . GLU A 1 103 ? -12.578 -37.279 -29.101 1.00 135.43 ? 125 GLU A OE2   1 
ATOM   434  N N     . ALA A 1 104 ? -9.556  -33.900 -25.853 1.00 128.40 ? 126 ALA A N     1 
ATOM   435  C CA    . ALA A 1 104 ? -8.321  -33.147 -26.089 1.00 127.85 ? 126 ALA A CA    1 
ATOM   436  C C     . ALA A 1 104 ? -7.074  -33.839 -25.498 1.00 127.50 ? 126 ALA A C     1 
ATOM   437  O O     . ALA A 1 104 ? -5.939  -33.392 -25.733 1.00 127.43 ? 126 ALA A O     1 
ATOM   438  C CB    . ALA A 1 104 ? -8.473  -31.720 -25.529 1.00 127.76 ? 126 ALA A CB    1 
ATOM   439  N N     . GLY A 1 105 ? -7.296  -34.931 -24.752 1.00 127.04 ? 127 GLY A N     1 
ATOM   440  C CA    . GLY A 1 105 ? -6.243  -35.604 -23.981 1.00 126.55 ? 127 GLY A CA    1 
ATOM   441  C C     . GLY A 1 105 ? -6.026  -34.923 -22.632 1.00 126.28 ? 127 GLY A C     1 
ATOM   442  O O     . GLY A 1 105 ? -5.191  -35.364 -21.822 1.00 126.28 ? 127 GLY A O     1 
ATOM   443  N N     . VAL A 1 106 ? -6.787  -33.847 -22.403 1.00 125.93 ? 128 VAL A N     1 
ATOM   444  C CA    . VAL A 1 106 ? -6.687  -33.016 -21.199 1.00 125.48 ? 128 VAL A CA    1 
ATOM   445  C C     . VAL A 1 106 ? -7.519  -33.654 -20.066 1.00 125.45 ? 128 VAL A C     1 
ATOM   446  O O     . VAL A 1 106 ? -8.565  -33.113 -19.650 1.00 125.32 ? 128 VAL A O     1 
ATOM   447  C CB    . VAL A 1 106 ? -7.110  -31.525 -21.493 1.00 125.38 ? 128 VAL A CB    1 
ATOM   448  C CG1   . VAL A 1 106 ? -6.772  -30.612 -20.320 1.00 125.01 ? 128 VAL A CG1   1 
ATOM   449  C CG2   . VAL A 1 106 ? -6.432  -30.997 -22.764 1.00 125.03 ? 128 VAL A CG2   1 
ATOM   450  N N     . THR A 1 107 ? -7.039  -34.819 -19.589 1.00 125.49 ? 129 THR A N     1 
ATOM   451  C CA    . THR A 1 107 ? -7.718  -35.594 -18.540 1.00 125.59 ? 129 THR A CA    1 
ATOM   452  C C     . THR A 1 107 ? -7.501  -34.970 -17.158 1.00 125.95 ? 129 THR A C     1 
ATOM   453  O O     . THR A 1 107 ? -6.632  -34.108 -16.985 1.00 126.05 ? 129 THR A O     1 
ATOM   454  C CB    . THR A 1 107 ? -7.235  -37.083 -18.516 1.00 125.44 ? 129 THR A CB    1 
ATOM   455  O OG1   . THR A 1 107 ? -5.868  -37.153 -18.073 1.00 124.85 ? 129 THR A OG1   1 
ATOM   456  C CG2   . THR A 1 107 ? -7.347  -37.726 -19.901 1.00 125.27 ? 129 THR A CG2   1 
ATOM   457  N N     . ASP A 1 108 ? -8.290  -35.408 -16.179 1.00 126.30 ? 130 ASP A N     1 
ATOM   458  C CA    . ASP A 1 108 ? -8.117  -34.980 -14.789 1.00 126.75 ? 130 ASP A CA    1 
ATOM   459  C C     . ASP A 1 108 ? -6.638  -34.984 -14.362 1.00 126.73 ? 130 ASP A C     1 
ATOM   460  O O     . ASP A 1 108 ? -6.127  -33.986 -13.838 1.00 126.76 ? 130 ASP A O     1 
ATOM   461  C CB    . ASP A 1 108 ? -8.942  -35.874 -13.855 1.00 127.06 ? 130 ASP A CB    1 
ATOM   462  C CG    . ASP A 1 108 ? -10.454 -35.700 -14.045 1.00 128.16 ? 130 ASP A CG    1 
ATOM   463  O OD1   . ASP A 1 108 ? -10.945 -34.542 -14.099 1.00 129.72 ? 130 ASP A OD1   1 
ATOM   464  O OD2   . ASP A 1 108 ? -11.161 -36.730 -14.116 1.00 129.42 ? 130 ASP A OD2   1 
ATOM   465  N N     . GLU A 1 109 ? -5.965  -36.106 -14.625 1.00 126.75 ? 131 GLU A N     1 
ATOM   466  C CA    . GLU A 1 109 ? -4.554  -36.336 -14.274 1.00 126.87 ? 131 GLU A CA    1 
ATOM   467  C C     . GLU A 1 109 ? -3.614  -35.217 -14.727 1.00 126.22 ? 131 GLU A C     1 
ATOM   468  O O     . GLU A 1 109 ? -2.690  -34.831 -13.990 1.00 126.19 ? 131 GLU A O     1 
ATOM   469  C CB    . GLU A 1 109 ? -4.071  -37.670 -14.864 1.00 127.28 ? 131 GLU A CB    1 
ATOM   470  C CG    . GLU A 1 109 ? -4.975  -38.889 -14.559 1.00 129.44 ? 131 GLU A CG    1 
ATOM   471  C CD    . GLU A 1 109 ? -6.213  -38.974 -15.477 1.00 132.14 ? 131 GLU A CD    1 
ATOM   472  O OE1   . GLU A 1 109 ? -7.209  -38.253 -15.171 1.00 132.74 ? 131 GLU A OE1   1 
ATOM   473  O OE2   . GLU A 1 109 ? -6.194  -39.770 -16.498 1.00 133.53 ? 131 GLU A OE2   1 
ATOM   474  N N     . VAL A 1 110 ? -3.855  -34.713 -15.942 1.00 125.46 ? 132 VAL A N     1 
ATOM   475  C CA    . VAL A 1 110 ? -3.051  -33.633 -16.512 1.00 124.81 ? 132 VAL A CA    1 
ATOM   476  C C     . VAL A 1 110 ? -3.327  -32.296 -15.799 1.00 124.39 ? 132 VAL A C     1 
ATOM   477  O O     . VAL A 1 110 ? -2.404  -31.663 -15.274 1.00 124.35 ? 132 VAL A O     1 
ATOM   478  C CB    . VAL A 1 110 ? -3.255  -33.509 -18.059 1.00 124.84 ? 132 VAL A CB    1 
ATOM   479  C CG1   . VAL A 1 110 ? -2.308  -32.470 -18.660 1.00 124.55 ? 132 VAL A CG1   1 
ATOM   480  C CG2   . VAL A 1 110 ? -3.063  -34.866 -18.753 1.00 124.64 ? 132 VAL A CG2   1 
ATOM   481  N N     . LEU A 1 111 ? -4.594  -31.884 -15.773 1.00 123.78 ? 133 LEU A N     1 
ATOM   482  C CA    . LEU A 1 111 ? -4.998  -30.655 -15.100 1.00 123.47 ? 133 LEU A CA    1 
ATOM   483  C C     . LEU A 1 111 ? -4.393  -30.568 -13.715 1.00 123.37 ? 133 LEU A C     1 
ATOM   484  O O     . LEU A 1 111 ? -3.808  -29.552 -13.344 1.00 123.38 ? 133 LEU A O     1 
ATOM   485  C CB    . LEU A 1 111 ? -6.513  -30.604 -14.970 1.00 123.44 ? 133 LEU A CB    1 
ATOM   486  C CG    . LEU A 1 111 ? -7.279  -30.315 -16.258 1.00 123.66 ? 133 LEU A CG    1 
ATOM   487  C CD1   . LEU A 1 111 ? -8.767  -30.618 -16.059 1.00 124.25 ? 133 LEU A CD1   1 
ATOM   488  C CD2   . LEU A 1 111 ? -7.053  -28.872 -16.704 1.00 123.52 ? 133 LEU A CD2   1 
ATOM   489  N N     . ASP A 1 112 ? -4.538  -31.653 -12.962 1.00 123.24 ? 134 ASP A N     1 
ATOM   490  C CA    . ASP A 1 112 ? -4.000  -31.758 -11.617 1.00 123.13 ? 134 ASP A CA    1 
ATOM   491  C C     . ASP A 1 112 ? -2.481  -31.623 -11.622 1.00 122.90 ? 134 ASP A C     1 
ATOM   492  O O     . ASP A 1 112 ? -1.928  -30.814 -10.876 1.00 122.94 ? 134 ASP A O     1 
ATOM   493  C CB    . ASP A 1 112 ? -4.447  -33.077 -10.970 1.00 123.33 ? 134 ASP A CB    1 
ATOM   494  C CG    . ASP A 1 112 ? -5.948  -33.069 -10.579 1.00 123.72 ? 134 ASP A CG    1 
ATOM   495  O OD1   . ASP A 1 112 ? -6.671  -32.116 -10.946 1.00 124.38 ? 134 ASP A OD1   1 
ATOM   496  O OD2   . ASP A 1 112 ? -6.409  -34.018 -9.899  1.00 123.84 ? 134 ASP A OD2   1 
ATOM   497  N N     . ALA A 1 113 ? -1.816  -32.392 -12.485 1.00 122.53 ? 135 ALA A N     1 
ATOM   498  C CA    . ALA A 1 113 ? -0.370  -32.306 -12.639 1.00 122.19 ? 135 ALA A CA    1 
ATOM   499  C C     . ALA A 1 113 ? 0.043   -30.865 -12.903 1.00 122.01 ? 135 ALA A C     1 
ATOM   500  O O     . ALA A 1 113 ? 1.021   -30.372 -12.330 1.00 122.09 ? 135 ALA A O     1 
ATOM   501  C CB    . ALA A 1 113 ? 0.094   -33.209 -13.751 1.00 122.15 ? 135 ALA A CB    1 
ATOM   502  N N     . ALA A 1 114 ? -0.732  -30.196 -13.753 1.00 121.74 ? 136 ALA A N     1 
ATOM   503  C CA    . ALA A 1 114 ? -0.510  -28.801 -14.095 1.00 121.70 ? 136 ALA A CA    1 
ATOM   504  C C     . ALA A 1 114 ? -0.776  -27.882 -12.912 1.00 121.69 ? 136 ALA A C     1 
ATOM   505  O O     . ALA A 1 114 ? -0.058  -26.894 -12.711 1.00 121.75 ? 136 ALA A O     1 
ATOM   506  C CB    . ALA A 1 114 ? -1.387  -28.418 -15.261 1.00 121.78 ? 136 ALA A CB    1 
ATOM   507  N N     . MET A 1 115 ? -1.811  -28.206 -12.134 1.00 121.72 ? 137 MET A N     1 
ATOM   508  C CA    . MET A 1 115 ? -2.141  -27.425 -10.949 1.00 121.62 ? 137 MET A CA    1 
ATOM   509  C C     . MET A 1 115 ? -1.009  -27.509 -9.921  1.00 121.62 ? 137 MET A C     1 
ATOM   510  O O     . MET A 1 115 ? -0.494  -26.481 -9.486  1.00 121.54 ? 137 MET A O     1 
ATOM   511  C CB    . MET A 1 115 ? -3.482  -27.880 -10.351 1.00 121.58 ? 137 MET A CB    1 
ATOM   512  C CG    . MET A 1 115 ? -4.718  -27.545 -11.193 1.00 121.12 ? 137 MET A CG    1 
ATOM   513  S SD    . MET A 1 115 ? -5.002  -25.784 -11.491 1.00 120.26 ? 137 MET A SD    1 
ATOM   514  C CE    . MET A 1 115 ? -5.567  -25.196 -9.892  1.00 120.87 ? 137 MET A CE    1 
ATOM   515  N N     . GLN A 1 116 ? -0.622  -28.736 -9.567  1.00 121.68 ? 138 GLN A N     1 
ATOM   516  C CA    . GLN A 1 116 ? 0.492   -29.013 -8.652  1.00 121.81 ? 138 GLN A CA    1 
ATOM   517  C C     . GLN A 1 116 ? 1.620   -28.063 -8.928  1.00 121.58 ? 138 GLN A C     1 
ATOM   518  O O     . GLN A 1 116 ? 1.921   -27.170 -8.140  1.00 121.52 ? 138 GLN A O     1 
ATOM   519  C CB    . GLN A 1 116 ? 1.041   -30.419 -8.900  1.00 121.94 ? 138 GLN A CB    1 
ATOM   520  C CG    . GLN A 1 116 ? 0.181   -31.540 -8.386  1.00 123.32 ? 138 GLN A CG    1 
ATOM   521  C CD    . GLN A 1 116 ? 0.600   -32.899 -8.933  1.00 124.81 ? 138 GLN A CD    1 
ATOM   522  O OE1   . GLN A 1 116 ? 1.230   -32.997 -9.996  1.00 125.01 ? 138 GLN A OE1   1 
ATOM   523  N NE2   . GLN A 1 116 ? 0.245   -33.961 -8.204  1.00 125.90 ? 138 GLN A NE2   1 
ATOM   524  N N     . ALA A 1 117 ? 2.238   -28.289 -10.079 1.00 121.46 ? 139 ALA A N     1 
ATOM   525  C CA    . ALA A 1 117 ? 3.339   -27.488 -10.547 1.00 121.43 ? 139 ALA A CA    1 
ATOM   526  C C     . ALA A 1 117 ? 3.043   -25.998 -10.410 1.00 121.33 ? 139 ALA A C     1 
ATOM   527  O O     . ALA A 1 117 ? 3.873   -25.259 -9.888  1.00 121.39 ? 139 ALA A O     1 
ATOM   528  C CB    . ALA A 1 117 ? 3.670   -27.851 -11.997 1.00 121.61 ? 139 ALA A CB    1 
ATOM   529  N N     . PHE A 1 118 ? 1.861   -25.561 -10.852 1.00 121.23 ? 140 PHE A N     1 
ATOM   530  C CA    . PHE A 1 118 ? 1.556   -24.130 -10.862 1.00 121.11 ? 140 PHE A CA    1 
ATOM   531  C C     . PHE A 1 118 ? 1.652   -23.581 -9.461  1.00 121.14 ? 140 PHE A C     1 
ATOM   532  O O     . PHE A 1 118 ? 2.388   -22.620 -9.200  1.00 121.18 ? 140 PHE A O     1 
ATOM   533  C CB    . PHE A 1 118 ? 0.167   -23.813 -11.430 1.00 120.99 ? 140 PHE A CB    1 
ATOM   534  C CG    . PHE A 1 118 ? -0.118  -22.336 -11.505 1.00 120.84 ? 140 PHE A CG    1 
ATOM   535  C CD1   . PHE A 1 118 ? -0.011  -21.663 -12.722 1.00 120.74 ? 140 PHE A CD1   1 
ATOM   536  C CD2   . PHE A 1 118 ? -0.450  -21.609 -10.351 1.00 121.01 ? 140 PHE A CD2   1 
ATOM   537  C CE1   . PHE A 1 118 ? -0.253  -20.294 -12.796 1.00 120.76 ? 140 PHE A CE1   1 
ATOM   538  C CE2   . PHE A 1 118 ? -0.691  -20.241 -10.413 1.00 121.19 ? 140 PHE A CE2   1 
ATOM   539  C CZ    . PHE A 1 118 ? -0.592  -19.582 -11.640 1.00 121.11 ? 140 PHE A CZ    1 
ATOM   540  N N     . ILE A 1 119 ? 0.897   -24.210 -8.563  1.00 121.21 ? 141 ILE A N     1 
ATOM   541  C CA    . ILE A 1 119 ? 0.830   -23.769 -7.184  1.00 121.23 ? 141 ILE A CA    1 
ATOM   542  C C     . ILE A 1 119 ? 2.214   -23.845 -6.524  1.00 121.23 ? 141 ILE A C     1 
ATOM   543  O O     . ILE A 1 119 ? 2.703   -22.844 -5.998  1.00 121.15 ? 141 ILE A O     1 
ATOM   544  C CB    . ILE A 1 119 ? -0.257  -24.547 -6.403  1.00 121.23 ? 141 ILE A CB    1 
ATOM   545  C CG1   . ILE A 1 119 ? -1.617  -24.391 -7.107  1.00 121.05 ? 141 ILE A CG1   1 
ATOM   546  C CG2   . ILE A 1 119 ? -0.360  -24.022 -4.978  1.00 121.31 ? 141 ILE A CG2   1 
ATOM   547  C CD1   . ILE A 1 119 ? -2.642  -25.459 -6.767  1.00 120.64 ? 141 ILE A CD1   1 
ATOM   548  N N     . LEU A 1 120 ? 2.855   -25.011 -6.599  1.00 121.31 ? 142 LEU A N     1 
ATOM   549  C CA    . LEU A 1 120 ? 4.188   -25.201 -6.026  1.00 121.47 ? 142 LEU A CA    1 
ATOM   550  C C     . LEU A 1 120 ? 5.092   -24.012 -6.275  1.00 121.52 ? 142 LEU A C     1 
ATOM   551  O O     . LEU A 1 120 ? 5.647   -23.451 -5.341  1.00 121.51 ? 142 LEU A O     1 
ATOM   552  C CB    . LEU A 1 120 ? 4.846   -26.464 -6.579  1.00 121.56 ? 142 LEU A CB    1 
ATOM   553  C CG    . LEU A 1 120 ? 4.757   -27.721 -5.696  1.00 121.93 ? 142 LEU A CG    1 
ATOM   554  C CD1   . LEU A 1 120 ? 4.913   -28.968 -6.584  1.00 122.77 ? 142 LEU A CD1   1 
ATOM   555  C CD2   . LEU A 1 120 ? 5.661   -27.688 -4.569  1.00 122.28 ? 142 LEU A CD2   1 
ATOM   556  N N     . GLU A 1 121 ? 5.219   -23.627 -7.540  1.00 121.74 ? 143 GLU A N     1 
ATOM   557  C CA    . GLU A 1 121 ? 6.078   -22.520 -7.934  1.00 122.02 ? 143 GLU A CA    1 
ATOM   558  C C     . GLU A 1 121 ? 5.703   -21.243 -7.208  1.00 121.83 ? 143 GLU A C     1 
ATOM   559  O O     . GLU A 1 121 ? 6.559   -20.598 -6.618  1.00 121.95 ? 143 GLU A O     1 
ATOM   560  C CB    . GLU A 1 121 ? 6.023   -22.284 -9.447  1.00 122.33 ? 143 GLU A CB    1 
ATOM   561  C CG    . GLU A 1 121 ? 6.641   -23.392 -10.309 1.00 123.69 ? 143 GLU A CG    1 
ATOM   562  C CD    . GLU A 1 121 ? 8.159   -23.503 -10.167 1.00 125.26 ? 143 GLU A CD    1 
ATOM   563  O OE1   . GLU A 1 121 ? 8.850   -22.460 -10.020 1.00 125.90 ? 143 GLU A OE1   1 
ATOM   564  O OE2   . GLU A 1 121 ? 8.663   -24.646 -10.217 1.00 125.82 ? 143 GLU A OE2   1 
ATOM   565  N N     . VAL A 1 122 ? 4.423   -20.886 -7.237  1.00 121.74 ? 144 VAL A N     1 
ATOM   566  C CA    . VAL A 1 122 ? 3.984   -19.638 -6.614  1.00 121.73 ? 144 VAL A CA    1 
ATOM   567  C C     . VAL A 1 122 ? 4.470   -19.561 -5.170  1.00 121.82 ? 144 VAL A C     1 
ATOM   568  O O     . VAL A 1 122 ? 5.224   -18.648 -4.807  1.00 121.89 ? 144 VAL A O     1 
ATOM   569  C CB    . VAL A 1 122 ? 2.453   -19.428 -6.672  1.00 121.71 ? 144 VAL A CB    1 
ATOM   570  C CG1   . VAL A 1 122 ? 2.086   -18.053 -6.075  1.00 121.39 ? 144 VAL A CG1   1 
ATOM   571  C CG2   . VAL A 1 122 ? 1.936   -19.552 -8.120  1.00 121.53 ? 144 VAL A CG2   1 
ATOM   572  N N     . ILE A 1 123 ? 4.055   -20.542 -4.361  1.00 121.89 ? 145 ILE A N     1 
ATOM   573  C CA    . ILE A 1 123 ? 4.403   -20.577 -2.936  1.00 121.85 ? 145 ILE A CA    1 
ATOM   574  C C     . ILE A 1 123 ? 5.920   -20.559 -2.792  1.00 122.00 ? 145 ILE A C     1 
ATOM   575  O O     . ILE A 1 123 ? 6.462   -19.674 -2.111  1.00 122.03 ? 145 ILE A O     1 
ATOM   576  C CB    . ILE A 1 123 ? 3.767   -21.800 -2.182  1.00 121.77 ? 145 ILE A CB    1 
ATOM   577  C CG1   . ILE A 1 123 ? 2.256   -21.882 -2.481  1.00 121.68 ? 145 ILE A CG1   1 
ATOM   578  C CG2   . ILE A 1 123 ? 3.982   -21.675 -0.655  1.00 121.43 ? 145 ILE A CG2   1 
ATOM   579  C CD1   . ILE A 1 123 ? 1.547   -23.104 -1.893  1.00 120.93 ? 145 ILE A CD1   1 
ATOM   580  N N     . ALA A 1 124 ? 6.597   -21.508 -3.469  1.00 122.11 ? 146 ALA A N     1 
ATOM   581  C CA    . ALA A 1 124 ? 8.048   -21.583 -3.413  1.00 122.28 ? 146 ALA A CA    1 
ATOM   582  C C     . ALA A 1 124 ? 8.666   -20.223 -3.683  1.00 122.60 ? 146 ALA A C     1 
ATOM   583  O O     . ALA A 1 124 ? 9.489   -19.754 -2.908  1.00 122.70 ? 146 ALA A O     1 
ATOM   584  C CB    . ALA A 1 124 ? 8.574   -22.612 -4.392  1.00 122.13 ? 146 ALA A CB    1 
ATOM   585  N N     . LYS A 1 125 ? 8.232   -19.566 -4.752  1.00 123.11 ? 147 LYS A N     1 
ATOM   586  C CA    . LYS A 1 125 ? 8.947   -18.391 -5.233  1.00 123.84 ? 147 LYS A CA    1 
ATOM   587  C C     . LYS A 1 125 ? 8.471   -17.058 -4.683  1.00 124.08 ? 147 LYS A C     1 
ATOM   588  O O     . LYS A 1 125 ? 9.253   -16.112 -4.615  1.00 124.22 ? 147 LYS A O     1 
ATOM   589  C CB    . LYS A 1 125 ? 8.956   -18.338 -6.762  1.00 123.98 ? 147 LYS A CB    1 
ATOM   590  C CG    . LYS A 1 125 ? 9.372   -19.639 -7.458  1.00 124.99 ? 147 LYS A CG    1 
ATOM   591  C CD    . LYS A 1 125 ? 10.833  -20.000 -7.234  1.00 126.54 ? 147 LYS A CD    1 
ATOM   592  C CE    . LYS A 1 125 ? 11.131  -21.389 -7.787  1.00 127.32 ? 147 LYS A CE    1 
ATOM   593  N NZ    . LYS A 1 125 ? 11.014  -21.431 -9.274  1.00 127.55 ? 147 LYS A NZ    1 
ATOM   594  N N     . HIS A 1 126 ? 7.207   -16.964 -4.293  1.00 124.44 ? 148 HIS A N     1 
ATOM   595  C CA    . HIS A 1 126 ? 6.662   -15.662 -3.936  1.00 124.79 ? 148 HIS A CA    1 
ATOM   596  C C     . HIS A 1 126 ? 7.259   -15.063 -2.664  1.00 125.62 ? 148 HIS A C     1 
ATOM   597  O O     . HIS A 1 126 ? 7.081   -13.878 -2.404  1.00 125.64 ? 148 HIS A O     1 
ATOM   598  C CB    . HIS A 1 126 ? 5.135   -15.690 -3.882  1.00 124.43 ? 148 HIS A CB    1 
ATOM   599  C CG    . HIS A 1 126 ? 4.579   -16.084 -2.551  1.00 123.00 ? 148 HIS A CG    1 
ATOM   600  N ND1   . HIS A 1 126 ? 4.016   -15.172 -1.684  1.00 121.63 ? 148 HIS A ND1   1 
ATOM   601  C CD2   . HIS A 1 126 ? 4.491   -17.290 -1.940  1.00 121.48 ? 148 HIS A CD2   1 
ATOM   602  C CE1   . HIS A 1 126 ? 3.606   -15.800 -0.596  1.00 121.16 ? 148 HIS A CE1   1 
ATOM   603  N NE2   . HIS A 1 126 ? 3.880   -17.085 -0.726  1.00 120.91 ? 148 HIS A NE2   1 
ATOM   604  N N     . GLY A 1 127 ? 7.979   -15.873 -1.890  1.00 126.59 ? 149 GLY A N     1 
ATOM   605  C CA    . GLY A 1 127 ? 8.606   -15.400 -0.649  1.00 128.08 ? 149 GLY A CA    1 
ATOM   606  C C     . GLY A 1 127 ? 9.975   -16.006 -0.376  1.00 129.06 ? 149 GLY A C     1 
ATOM   607  O O     . GLY A 1 127 ? 10.477  -16.806 -1.189  1.00 129.17 ? 149 GLY A O     1 
ATOM   608  N N     . GLU A 1 128 ? 10.580  -15.615 0.760   1.00 129.93 ? 150 GLU A N     1 
ATOM   609  C CA    . GLU A 1 128 ? 11.853  -16.180 1.214   1.00 130.96 ? 150 GLU A CA    1 
ATOM   610  C C     . GLU A 1 128 ? 11.750  -17.696 1.402   1.00 131.04 ? 150 GLU A C     1 
ATOM   611  O O     . GLU A 1 128 ? 10.694  -18.200 1.763   1.00 131.21 ? 150 GLU A O     1 
ATOM   612  C CB    . GLU A 1 128 ? 12.249  -15.568 2.551   1.00 131.40 ? 150 GLU A CB    1 
ATOM   613  C CG    . GLU A 1 128 ? 12.969  -14.226 2.481   1.00 133.98 ? 150 GLU A CG    1 
ATOM   614  C CD    . GLU A 1 128 ? 13.545  -13.856 3.858   1.00 137.45 ? 150 GLU A CD    1 
ATOM   615  O OE1   . GLU A 1 128 ? 14.580  -14.466 4.259   1.00 138.87 ? 150 GLU A OE1   1 
ATOM   616  O OE2   . GLU A 1 128 ? 12.960  -12.969 4.545   1.00 138.64 ? 150 GLU A OE2   1 
ATOM   617  N N     . PRO A 1 129 ? 12.849  -18.433 1.174   1.00 131.25 ? 151 PRO A N     1 
ATOM   618  C CA    . PRO A 1 129 ? 12.769  -19.892 1.305   1.00 131.33 ? 151 PRO A CA    1 
ATOM   619  C C     . PRO A 1 129 ? 12.750  -20.371 2.754   1.00 131.33 ? 151 PRO A C     1 
ATOM   620  O O     . PRO A 1 129 ? 13.035  -19.585 3.671   1.00 131.37 ? 151 PRO A O     1 
ATOM   621  C CB    . PRO A 1 129 ? 14.039  -20.384 0.597   1.00 131.46 ? 151 PRO A CB    1 
ATOM   622  C CG    . PRO A 1 129 ? 14.989  -19.247 0.693   1.00 131.56 ? 151 PRO A CG    1 
ATOM   623  C CD    . PRO A 1 129 ? 14.164  -17.985 0.676   1.00 131.35 ? 151 PRO A CD    1 
ATOM   624  N N     . ALA A 1 130 ? 12.408  -21.663 2.939   1.00 131.29 ? 152 ALA A N     1 
ATOM   625  C CA    . ALA A 1 130 ? 12.372  -22.302 4.252   1.00 131.29 ? 152 ALA A CA    1 
ATOM   626  C C     . ALA A 1 130 ? 12.333  -23.825 4.072   1.00 131.26 ? 152 ALA A C     1 
ATOM   627  O O     . ALA A 1 130 ? 12.261  -24.315 2.933   1.00 131.24 ? 152 ALA A O     1 
ATOM   628  C CB    . ALA A 1 130 ? 11.152  -21.820 5.040   1.00 131.43 ? 152 ALA A CB    1 
ATOM   629  N N     . ARG A 1 131 ? 12.388  -24.570 5.185   1.00 131.20 ? 153 ARG A N     1 
ATOM   630  C CA    . ARG A 1 131 ? 12.265  -26.031 5.125   1.00 131.19 ? 153 ARG A CA    1 
ATOM   631  C C     . ARG A 1 131 ? 10.793  -26.485 5.092   1.00 130.54 ? 153 ARG A C     1 
ATOM   632  O O     . ARG A 1 131 ? 10.473  -27.493 4.448   1.00 130.63 ? 153 ARG A O     1 
ATOM   633  C CB    . ARG A 1 131 ? 13.021  -26.702 6.284   1.00 131.65 ? 153 ARG A CB    1 
ATOM   634  C CG    . ARG A 1 131 ? 13.169  -28.213 6.132   1.00 133.68 ? 153 ARG A CG    1 
ATOM   635  C CD    . ARG A 1 131 ? 13.531  -28.872 7.449   1.00 137.79 ? 153 ARG A CD    1 
ATOM   636  N NE    . ARG A 1 131 ? 12.517  -28.643 8.496   1.00 141.09 ? 153 ARG A NE    1 
ATOM   637  C CZ    . ARG A 1 131 ? 11.403  -29.368 8.652   1.00 142.58 ? 153 ARG A CZ    1 
ATOM   638  N NH1   . ARG A 1 131 ? 11.127  -30.377 7.817   1.00 143.45 ? 153 ARG A NH1   1 
ATOM   639  N NH2   . ARG A 1 131 ? 10.559  -29.077 9.645   1.00 143.10 ? 153 ARG A NH2   1 
ATOM   640  N N     . VAL A 1 132 ? 9.912   -25.756 5.791   1.00 129.65 ? 154 VAL A N     1 
ATOM   641  C CA    . VAL A 1 132 ? 8.461   -26.007 5.728   1.00 128.55 ? 154 VAL A CA    1 
ATOM   642  C C     . VAL A 1 132 ? 7.737   -24.814 5.120   1.00 127.65 ? 154 VAL A C     1 
ATOM   643  O O     . VAL A 1 132 ? 7.794   -23.695 5.649   1.00 127.50 ? 154 VAL A O     1 
ATOM   644  C CB    . VAL A 1 132 ? 7.833   -26.299 7.103   1.00 128.62 ? 154 VAL A CB    1 
ATOM   645  C CG1   . VAL A 1 132 ? 6.442   -26.887 6.924   1.00 128.67 ? 154 VAL A CG1   1 
ATOM   646  C CG2   . VAL A 1 132 ? 8.693   -27.250 7.904   1.00 128.76 ? 154 VAL A CG2   1 
ATOM   647  N N     . LEU A 1 133 ? 7.049   -25.060 4.013   1.00 126.49 ? 155 LEU A N     1 
ATOM   648  C CA    . LEU A 1 133 ? 6.373   -23.987 3.314   1.00 125.37 ? 155 LEU A CA    1 
ATOM   649  C C     . LEU A 1 133 ? 4.900   -23.975 3.597   1.00 124.64 ? 155 LEU A C     1 
ATOM   650  O O     . LEU A 1 133 ? 4.264   -25.017 3.743   1.00 124.40 ? 155 LEU A O     1 
ATOM   651  C CB    . LEU A 1 133 ? 6.624   -24.055 1.811   1.00 125.42 ? 155 LEU A CB    1 
ATOM   652  C CG    . LEU A 1 133 ? 7.891   -23.325 1.292   1.00 125.02 ? 155 LEU A CG    1 
ATOM   653  C CD1   . LEU A 1 133 ? 8.109   -23.603 -0.197  1.00 124.88 ? 155 LEU A CD1   1 
ATOM   654  C CD2   . LEU A 1 133 ? 7.812   -21.801 1.567   1.00 124.33 ? 155 LEU A CD2   1 
ATOM   655  N N     . CYS A 1 134 ? 4.372   -22.766 3.670   1.00 123.90 ? 156 CYS A N     1 
ATOM   656  C CA    . CYS A 1 134 ? 2.985   -22.556 3.983   1.00 123.36 ? 156 CYS A CA    1 
ATOM   657  C C     . CYS A 1 134 ? 2.404   -21.434 3.135   1.00 123.03 ? 156 CYS A C     1 
ATOM   658  O O     . CYS A 1 134 ? 3.135   -20.558 2.670   1.00 123.02 ? 156 CYS A O     1 
ATOM   659  C CB    . CYS A 1 134 ? 2.847   -22.200 5.449   1.00 123.31 ? 156 CYS A CB    1 
ATOM   660  S SG    . CYS A 1 134 ? 1.524   -21.051 5.718   1.00 123.10 ? 156 CYS A SG    1 
ATOM   661  N N     . ASN A 1 135 ? 1.085   -21.462 2.953   1.00 122.49 ? 157 ASN A N     1 
ATOM   662  C CA    . ASN A 1 135 ? 0.382   -20.446 2.180   1.00 121.91 ? 157 ASN A CA    1 
ATOM   663  C C     . ASN A 1 135 ? -0.932  -20.034 2.821   1.00 121.47 ? 157 ASN A C     1 
ATOM   664  O O     . ASN A 1 135 ? -1.731  -20.891 3.270   1.00 121.37 ? 157 ASN A O     1 
ATOM   665  C CB    . ASN A 1 135 ? 0.109   -20.947 0.758   1.00 121.99 ? 157 ASN A CB    1 
ATOM   666  C CG    . ASN A 1 135 ? -0.769  -19.992 -0.028  1.00 122.05 ? 157 ASN A CG    1 
ATOM   667  O OD1   . ASN A 1 135 ? -1.978  -20.256 -0.222  1.00 122.52 ? 157 ASN A OD1   1 
ATOM   668  N ND2   . ASN A 1 135 ? -0.175  -18.863 -0.457  1.00 121.45 ? 157 ASN A ND2   1 
ATOM   669  N N     . LYS A 1 136 ? -1.164  -18.717 2.834   1.00 120.96 ? 158 LYS A N     1 
ATOM   670  C CA    . LYS A 1 136 ? -2.416  -18.199 3.358   1.00 120.54 ? 158 LYS A CA    1 
ATOM   671  C C     . LYS A 1 136 ? -3.217  -17.391 2.346   1.00 120.34 ? 158 LYS A C     1 
ATOM   672  O O     . LYS A 1 136 ? -2.872  -16.249 2.020   1.00 120.25 ? 158 LYS A O     1 
ATOM   673  C CB    . LYS A 1 136 ? -2.168  -17.370 4.614   1.00 120.54 ? 158 LYS A CB    1 
ATOM   674  C CG    . LYS A 1 136 ? -3.409  -17.173 5.481   1.00 120.08 ? 158 LYS A CG    1 
ATOM   675  C CD    . LYS A 1 136 ? -4.314  -16.045 4.981   1.00 119.75 ? 158 LYS A CD    1 
ATOM   676  C CE    . LYS A 1 136 ? -3.669  -14.670 5.165   1.00 119.83 ? 158 LYS A CE    1 
ATOM   677  N NZ    . LYS A 1 136 ? -4.683  -13.557 5.102   1.00 119.92 ? 158 LYS A NZ    1 
ATOM   678  N N     . ASP A 1 137 ? -4.295  -18.005 1.868   1.00 120.08 ? 159 ASP A N     1 
ATOM   679  C CA    . ASP A 1 137 ? -5.291  -17.325 1.059   1.00 120.00 ? 159 ASP A CA    1 
ATOM   680  C C     . ASP A 1 137 ? -6.679  -17.785 1.456   1.00 119.80 ? 159 ASP A C     1 
ATOM   681  O O     . ASP A 1 137 ? -7.086  -18.900 1.119   1.00 119.85 ? 159 ASP A O     1 
ATOM   682  C CB    . ASP A 1 137 ? -5.060  -17.579 -0.420  1.00 120.12 ? 159 ASP A CB    1 
ATOM   683  C CG    . ASP A 1 137 ? -4.244  -16.498 -1.059  1.00 120.77 ? 159 ASP A CG    1 
ATOM   684  O OD1   . ASP A 1 137 ? -4.766  -15.364 -1.198  1.00 121.15 ? 159 ASP A OD1   1 
ATOM   685  O OD2   . ASP A 1 137 ? -3.081  -16.788 -1.419  1.00 122.02 ? 159 ASP A OD2   1 
ATOM   686  N N     . PRO A 1 138 ? -7.424  -16.913 2.158   1.00 119.51 ? 160 PRO A N     1 
ATOM   687  C CA    . PRO A 1 138 ? -8.643  -17.335 2.821   1.00 119.28 ? 160 PRO A CA    1 
ATOM   688  C C     . PRO A 1 138 ? -9.402  -18.431 2.066   1.00 119.25 ? 160 PRO A C     1 
ATOM   689  O O     . PRO A 1 138 ? -9.579  -19.530 2.604   1.00 119.08 ? 160 PRO A O     1 
ATOM   690  C CB    . PRO A 1 138 ? -9.442  -16.035 2.908   1.00 119.27 ? 160 PRO A CB    1 
ATOM   691  C CG    . PRO A 1 138 ? -8.391  -14.997 3.094   1.00 119.05 ? 160 PRO A CG    1 
ATOM   692  C CD    . PRO A 1 138 ? -7.240  -15.449 2.236   1.00 119.42 ? 160 PRO A CD    1 
ATOM   693  N N     . PHE A 1 139 ? -9.792  -18.168 0.817   1.00 119.32 ? 161 PHE A N     1 
ATOM   694  C CA    . PHE A 1 139 ? -10.763 -19.038 0.164   1.00 119.51 ? 161 PHE A CA    1 
ATOM   695  C C     . PHE A 1 139 ? -10.245 -20.379 -0.346  1.00 119.57 ? 161 PHE A C     1 
ATOM   696  O O     . PHE A 1 139 ? -11.015 -21.197 -0.829  1.00 119.48 ? 161 PHE A O     1 
ATOM   697  C CB    . PHE A 1 139 ? -11.542 -18.277 -0.899  1.00 119.51 ? 161 PHE A CB    1 
ATOM   698  C CG    . PHE A 1 139 ? -12.605 -17.389 -0.327  1.00 119.83 ? 161 PHE A CG    1 
ATOM   699  C CD1   . PHE A 1 139 ? -13.851 -17.924 0.054   1.00 119.79 ? 161 PHE A CD1   1 
ATOM   700  C CD2   . PHE A 1 139 ? -12.358 -16.017 -0.147  1.00 120.10 ? 161 PHE A CD2   1 
ATOM   701  C CE1   . PHE A 1 139 ? -14.842 -17.104 0.591   1.00 119.94 ? 161 PHE A CE1   1 
ATOM   702  C CE2   . PHE A 1 139 ? -13.345 -15.188 0.391   1.00 120.11 ? 161 PHE A CE2   1 
ATOM   703  C CZ    . PHE A 1 139 ? -14.588 -15.732 0.760   1.00 119.99 ? 161 PHE A CZ    1 
ATOM   704  N N     . THR A 1 140 ? -8.947  -20.611 -0.203  1.00 119.81 ? 162 THR A N     1 
ATOM   705  C CA    . THR A 1 140 ? -8.353  -21.888 -0.582  1.00 120.20 ? 162 THR A CA    1 
ATOM   706  C C     . THR A 1 140 ? -9.025  -23.049 0.126   1.00 120.42 ? 162 THR A C     1 
ATOM   707  O O     . THR A 1 140 ? -9.307  -24.089 -0.466  1.00 120.33 ? 162 THR A O     1 
ATOM   708  C CB    . THR A 1 140 ? -6.874  -21.935 -0.206  1.00 120.19 ? 162 THR A CB    1 
ATOM   709  O OG1   . THR A 1 140 ? -6.730  -21.531 1.164   1.00 120.20 ? 162 THR A OG1   1 
ATOM   710  C CG2   . THR A 1 140 ? -6.069  -21.002 -1.095  1.00 120.48 ? 162 THR A CG2   1 
ATOM   711  N N     . LEU A 1 141 ? -9.285  -22.851 1.406   1.00 120.93 ? 163 LEU A N     1 
ATOM   712  C CA    . LEU A 1 141 ? -9.866  -23.882 2.232   1.00 121.58 ? 163 LEU A CA    1 
ATOM   713  C C     . LEU A 1 141 ? -11.189 -24.356 1.658   1.00 121.92 ? 163 LEU A C     1 
ATOM   714  O O     . LEU A 1 141 ? -11.761 -25.334 2.129   1.00 122.02 ? 163 LEU A O     1 
ATOM   715  C CB    . LEU A 1 141 ? -10.039 -23.358 3.660   1.00 121.68 ? 163 LEU A CB    1 
ATOM   716  C CG    . LEU A 1 141 ? -8.836  -23.435 4.627   1.00 122.32 ? 163 LEU A CG    1 
ATOM   717  C CD1   . LEU A 1 141 ? -8.936  -24.631 5.575   1.00 122.81 ? 163 LEU A CD1   1 
ATOM   718  C CD2   . LEU A 1 141 ? -7.447  -23.425 3.938   1.00 122.41 ? 163 LEU A CD2   1 
ATOM   719  N N     . LYS A 1 142 ? -11.663 -23.657 0.628   1.00 122.38 ? 164 LYS A N     1 
ATOM   720  C CA    . LYS A 1 142 ? -12.849 -24.072 -0.109  1.00 122.85 ? 164 LYS A CA    1 
ATOM   721  C C     . LYS A 1 142 ? -12.594 -25.347 -0.901  1.00 122.69 ? 164 LYS A C     1 
ATOM   722  O O     . LYS A 1 142 ? -13.508 -26.150 -1.115  1.00 122.66 ? 164 LYS A O     1 
ATOM   723  C CB    . LYS A 1 142 ? -13.316 -22.974 -1.080  1.00 123.13 ? 164 LYS A CB    1 
ATOM   724  C CG    . LYS A 1 142 ? -13.947 -21.738 -0.435  1.00 124.83 ? 164 LYS A CG    1 
ATOM   725  C CD    . LYS A 1 142 ? -14.953 -21.053 -1.382  1.00 127.87 ? 164 LYS A CD    1 
ATOM   726  C CE    . LYS A 1 142 ? -16.299 -21.809 -1.434  1.00 129.81 ? 164 LYS A CE    1 
ATOM   727  N NZ    . LYS A 1 142 ? -17.436 -21.011 -2.014  1.00 131.35 ? 164 LYS A NZ    1 
ATOM   728  N N     . SER A 1 143 ? -11.352 -25.526 -1.342  1.00 122.58 ? 165 SER A N     1 
ATOM   729  C CA    . SER A 1 143 ? -11.036 -26.590 -2.279  1.00 122.38 ? 165 SER A CA    1 
ATOM   730  C C     . SER A 1 143 ? -10.182 -27.637 -1.619  1.00 122.33 ? 165 SER A C     1 
ATOM   731  O O     . SER A 1 143 ? -9.691  -28.562 -2.280  1.00 122.16 ? 165 SER A O     1 
ATOM   732  C CB    . SER A 1 143 ? -10.292 -26.010 -3.472  1.00 122.33 ? 165 SER A CB    1 
ATOM   733  O OG    . SER A 1 143 ? -10.829 -24.740 -3.820  1.00 122.35 ? 165 SER A OG    1 
ATOM   734  N N     . SER A 1 144 ? -10.030 -27.492 -0.300  1.00 122.48 ? 166 SER A N     1 
ATOM   735  C CA    . SER A 1 144 ? -9.099  -28.308 0.471   1.00 122.76 ? 166 SER A CA    1 
ATOM   736  C C     . SER A 1 144 ? -9.118  -29.821 0.187   1.00 122.80 ? 166 SER A C     1 
ATOM   737  O O     . SER A 1 144 ? -8.059  -30.454 0.152   1.00 122.88 ? 166 SER A O     1 
ATOM   738  C CB    . SER A 1 144 ? -9.287  -28.039 1.960   1.00 122.78 ? 166 SER A CB    1 
ATOM   739  O OG    . SER A 1 144 ? -10.659 -28.101 2.301   1.00 123.27 ? 166 SER A OG    1 
ATOM   740  N N     . VAL A 1 145 ? -10.300 -30.404 -0.011  1.00 122.86 ? 167 VAL A N     1 
ATOM   741  C CA    . VAL A 1 145 ? -10.388 -31.830 -0.357  1.00 122.89 ? 167 VAL A CA    1 
ATOM   742  C C     . VAL A 1 145 ? -9.512  -32.100 -1.574  1.00 123.07 ? 167 VAL A C     1 
ATOM   743  O O     . VAL A 1 145 ? -8.649  -32.992 -1.548  1.00 123.09 ? 167 VAL A O     1 
ATOM   744  C CB    . VAL A 1 145 ? -11.848 -32.294 -0.598  1.00 122.83 ? 167 VAL A CB    1 
ATOM   745  C CG1   . VAL A 1 145 ? -11.901 -33.604 -1.381  1.00 122.43 ? 167 VAL A CG1   1 
ATOM   746  C CG2   . VAL A 1 145 ? -12.565 -32.452 0.728   1.00 122.81 ? 167 VAL A CG2   1 
ATOM   747  N N     . TYR A 1 146 ? -9.724  -31.299 -2.623  1.00 123.22 ? 168 TYR A N     1 
ATOM   748  C CA    . TYR A 1 146 ? -8.893  -31.353 -3.815  1.00 123.42 ? 168 TYR A CA    1 
ATOM   749  C C     . TYR A 1 146 ? -7.421  -31.153 -3.448  1.00 123.59 ? 168 TYR A C     1 
ATOM   750  O O     . TYR A 1 146 ? -6.577  -31.994 -3.769  1.00 123.59 ? 168 TYR A O     1 
ATOM   751  C CB    . TYR A 1 146 ? -9.358  -30.294 -4.815  1.00 123.37 ? 168 TYR A CB    1 
ATOM   752  C CG    . TYR A 1 146 ? -8.559  -30.200 -6.100  1.00 123.40 ? 168 TYR A CG    1 
ATOM   753  C CD1   . TYR A 1 146 ? -8.423  -31.309 -6.949  1.00 123.70 ? 168 TYR A CD1   1 
ATOM   754  C CD2   . TYR A 1 146 ? -7.977  -28.988 -6.490  1.00 123.23 ? 168 TYR A CD2   1 
ATOM   755  C CE1   . TYR A 1 146 ? -7.708  -31.220 -8.144  1.00 123.57 ? 168 TYR A CE1   1 
ATOM   756  C CE2   . TYR A 1 146 ? -7.264  -28.888 -7.685  1.00 123.38 ? 168 TYR A CE2   1 
ATOM   757  C CZ    . TYR A 1 146 ? -7.134  -30.010 -8.502  1.00 123.49 ? 168 TYR A CZ    1 
ATOM   758  O OH    . TYR A 1 146 ? -6.433  -29.925 -9.682  1.00 123.81 ? 168 TYR A OH    1 
ATOM   759  N N     . LEU A 1 147 ? -7.131  -30.057 -2.745  1.00 123.77 ? 169 LEU A N     1 
ATOM   760  C CA    . LEU A 1 147 ? -5.765  -29.713 -2.368  1.00 123.85 ? 169 LEU A CA    1 
ATOM   761  C C     . LEU A 1 147 ? -5.047  -30.873 -1.704  1.00 124.34 ? 169 LEU A C     1 
ATOM   762  O O     . LEU A 1 147 ? -3.858  -31.069 -1.936  1.00 124.41 ? 169 LEU A O     1 
ATOM   763  C CB    . LEU A 1 147 ? -5.746  -28.479 -1.465  1.00 123.60 ? 169 LEU A CB    1 
ATOM   764  C CG    . LEU A 1 147 ? -5.397  -27.099 -2.043  1.00 123.12 ? 169 LEU A CG    1 
ATOM   765  C CD1   . LEU A 1 147 ? -5.853  -26.924 -3.500  1.00 123.23 ? 169 LEU A CD1   1 
ATOM   766  C CD2   . LEU A 1 147 ? -6.008  -26.005 -1.156  1.00 122.92 ? 169 LEU A CD2   1 
ATOM   767  N N     . SER A 1 148 ? -5.777  -31.652 -0.903  1.00 125.06 ? 170 SER A N     1 
ATOM   768  C CA    . SER A 1 148 ? -5.192  -32.788 -0.188  1.00 125.81 ? 170 SER A CA    1 
ATOM   769  C C     . SER A 1 148 ? -4.819  -33.927 -1.114  1.00 126.19 ? 170 SER A C     1 
ATOM   770  O O     . SER A 1 148 ? -3.882  -34.682 -0.844  1.00 126.28 ? 170 SER A O     1 
ATOM   771  C CB    . SER A 1 148 ? -6.148  -33.318 0.876   1.00 125.86 ? 170 SER A CB    1 
ATOM   772  O OG    . SER A 1 148 ? -5.666  -34.555 1.385   1.00 126.25 ? 170 SER A OG    1 
ATOM   773  N N     . ARG A 1 149 ? -5.575  -34.062 -2.194  1.00 126.66 ? 171 ARG A N     1 
ATOM   774  C CA    . ARG A 1 149 ? -5.291  -35.079 -3.183  1.00 127.17 ? 171 ARG A CA    1 
ATOM   775  C C     . ARG A 1 149 ? -4.039  -34.730 -3.976  1.00 126.72 ? 171 ARG A C     1 
ATOM   776  O O     . ARG A 1 149 ? -3.247  -35.609 -4.301  1.00 126.71 ? 171 ARG A O     1 
ATOM   777  C CB    . ARG A 1 149 ? -6.481  -35.255 -4.114  1.00 127.72 ? 171 ARG A CB    1 
ATOM   778  C CG    . ARG A 1 149 ? -7.729  -35.713 -3.398  1.00 130.00 ? 171 ARG A CG    1 
ATOM   779  C CD    . ARG A 1 149 ? -8.668  -36.419 -4.360  1.00 134.43 ? 171 ARG A CD    1 
ATOM   780  N NE    . ARG A 1 149 ? -9.818  -37.000 -3.664  1.00 137.75 ? 171 ARG A NE    1 
ATOM   781  C CZ    . ARG A 1 149 ? -11.026 -36.433 -3.583  1.00 139.39 ? 171 ARG A CZ    1 
ATOM   782  N NH1   . ARG A 1 149 ? -11.260 -35.259 -4.164  1.00 140.16 ? 171 ARG A NH1   1 
ATOM   783  N NH2   . ARG A 1 149 ? -12.010 -37.046 -2.928  1.00 139.91 ? 171 ARG A NH2   1 
ATOM   784  N N     . LEU A 1 150 ? -3.868  -33.445 -4.277  1.00 126.29 ? 172 LEU A N     1 
ATOM   785  C CA    . LEU A 1 150 ? -2.690  -32.956 -4.990  1.00 125.88 ? 172 LEU A CA    1 
ATOM   786  C C     . LEU A 1 150 ? -1.401  -33.108 -4.189  1.00 125.68 ? 172 LEU A C     1 
ATOM   787  O O     . LEU A 1 150 ? -0.370  -33.529 -4.722  1.00 125.53 ? 172 LEU A O     1 
ATOM   788  C CB    . LEU A 1 150 ? -2.854  -31.478 -5.336  1.00 125.83 ? 172 LEU A CB    1 
ATOM   789  C CG    . LEU A 1 150 ? -3.761  -31.005 -6.464  1.00 125.72 ? 172 LEU A CG    1 
ATOM   790  C CD1   . LEU A 1 150 ? -3.433  -29.546 -6.761  1.00 125.71 ? 172 LEU A CD1   1 
ATOM   791  C CD2   . LEU A 1 150 ? -3.576  -31.851 -7.706  1.00 125.79 ? 172 LEU A CD2   1 
ATOM   792  N N     . PHE A 1 151 ? -1.469  -32.738 -2.908  1.00 125.44 ? 173 PHE A N     1 
ATOM   793  C CA    . PHE A 1 151 ? -0.295  -32.670 -2.056  1.00 125.07 ? 173 PHE A CA    1 
ATOM   794  C C     . PHE A 1 151 ? -0.543  -33.503 -0.808  1.00 125.08 ? 173 PHE A C     1 
ATOM   795  O O     . PHE A 1 151 ? -0.817  -32.960 0.268   1.00 125.15 ? 173 PHE A O     1 
ATOM   796  C CB    . PHE A 1 151 ? 0.023   -31.211 -1.721  1.00 124.95 ? 173 PHE A CB    1 
ATOM   797  C CG    . PHE A 1 151 ? -0.133  -30.274 -2.908  1.00 124.41 ? 173 PHE A CG    1 
ATOM   798  C CD1   . PHE A 1 151 ? 0.789   -30.308 -3.986  1.00 124.14 ? 173 PHE A CD1   1 
ATOM   799  C CD2   . PHE A 1 151 ? -1.210  -29.367 -2.957  1.00 123.97 ? 173 PHE A CD2   1 
ATOM   800  C CE1   . PHE A 1 151 ? 0.648   -29.448 -5.096  1.00 123.98 ? 173 PHE A CE1   1 
ATOM   801  C CE2   . PHE A 1 151 ? -1.360  -28.501 -4.065  1.00 123.59 ? 173 PHE A CE2   1 
ATOM   802  C CZ    . PHE A 1 151 ? -0.428  -28.545 -5.135  1.00 123.64 ? 173 PHE A CZ    1 
ATOM   803  N N     . PRO A 1 152 ? -0.449  -34.841 -0.960  1.00 125.01 ? 174 PRO A N     1 
ATOM   804  C CA    . PRO A 1 152 ? -0.858  -35.834 0.039   1.00 124.96 ? 174 PRO A CA    1 
ATOM   805  C C     . PRO A 1 152 ? -0.183  -35.689 1.408   1.00 124.82 ? 174 PRO A C     1 
ATOM   806  O O     . PRO A 1 152 ? -0.513  -36.440 2.336   1.00 124.85 ? 174 PRO A O     1 
ATOM   807  C CB    . PRO A 1 152 ? -0.465  -37.167 -0.622  1.00 124.98 ? 174 PRO A CB    1 
ATOM   808  C CG    . PRO A 1 152 ? -0.458  -36.878 -2.089  1.00 125.02 ? 174 PRO A CG    1 
ATOM   809  C CD    . PRO A 1 152 ? 0.115   -35.499 -2.175  1.00 124.99 ? 174 PRO A CD    1 
ATOM   810  N N     . ASN A 1 153 ? 0.735   -34.730 1.537   1.00 124.53 ? 175 ASN A N     1 
ATOM   811  C CA    . ASN A 1 153 ? 1.357   -34.460 2.828   1.00 124.30 ? 175 ASN A CA    1 
ATOM   812  C C     . ASN A 1 153 ? 1.189   -33.028 3.298   1.00 123.92 ? 175 ASN A C     1 
ATOM   813  O O     . ASN A 1 153 ? 1.841   -32.586 4.241   1.00 123.86 ? 175 ASN A O     1 
ATOM   814  C CB    . ASN A 1 153 ? 2.827   -34.869 2.811   1.00 124.54 ? 175 ASN A CB    1 
ATOM   815  C CG    . ASN A 1 153 ? 3.009   -36.351 2.554   1.00 125.02 ? 175 ASN A CG    1 
ATOM   816  O OD1   . ASN A 1 153 ? 4.007   -36.756 1.957   1.00 126.15 ? 175 ASN A OD1   1 
ATOM   817  N ND2   . ASN A 1 153 ? 2.035   -37.166 2.992   1.00 125.15 ? 175 ASN A ND2   1 
ATOM   818  N N     . SER A 1 154 ? 0.299   -32.303 2.638   1.00 123.54 ? 176 SER A N     1 
ATOM   819  C CA    . SER A 1 154 ? -0.086  -30.987 3.108   1.00 123.18 ? 176 SER A CA    1 
ATOM   820  C C     . SER A 1 154 ? -1.066  -31.109 4.270   1.00 122.90 ? 176 SER A C     1 
ATOM   821  O O     . SER A 1 154 ? -1.788  -32.105 4.398   1.00 122.71 ? 176 SER A O     1 
ATOM   822  C CB    . SER A 1 154 ? -0.710  -30.174 1.978   1.00 123.21 ? 176 SER A CB    1 
ATOM   823  O OG    . SER A 1 154 ? -1.853  -30.827 1.463   1.00 123.18 ? 176 SER A OG    1 
ATOM   824  N N     . LYS A 1 155 ? -1.071  -30.087 5.118   1.00 122.64 ? 177 LYS A N     1 
ATOM   825  C CA    . LYS A 1 155 ? -1.988  -30.015 6.249   1.00 122.40 ? 177 LYS A CA    1 
ATOM   826  C C     . LYS A 1 155 ? -2.760  -28.703 6.220   1.00 121.74 ? 177 LYS A C     1 
ATOM   827  O O     . LYS A 1 155 ? -2.356  -27.740 5.556   1.00 121.70 ? 177 LYS A O     1 
ATOM   828  C CB    . LYS A 1 155 ? -1.232  -30.150 7.571   1.00 122.69 ? 177 LYS A CB    1 
ATOM   829  C CG    . LYS A 1 155 ? -0.543  -31.491 7.788   1.00 123.94 ? 177 LYS A CG    1 
ATOM   830  C CD    . LYS A 1 155 ? -1.497  -32.551 8.330   1.00 126.14 ? 177 LYS A CD    1 
ATOM   831  C CE    . LYS A 1 155 ? -0.922  -33.225 9.576   1.00 127.66 ? 177 LYS A CE    1 
ATOM   832  N NZ    . LYS A 1 155 ? 0.451   -33.785 9.390   1.00 128.98 ? 177 LYS A NZ    1 
ATOM   833  N N     . PHE A 1 156 ? -3.869  -28.665 6.947   1.00 120.92 ? 178 PHE A N     1 
ATOM   834  C CA    . PHE A 1 156 ? -4.770  -27.546 6.831   1.00 120.32 ? 178 PHE A CA    1 
ATOM   835  C C     . PHE A 1 156 ? -5.257  -27.038 8.159   1.00 120.06 ? 178 PHE A C     1 
ATOM   836  O O     . PHE A 1 156 ? -5.712  -27.803 9.010   1.00 119.93 ? 178 PHE A O     1 
ATOM   837  C CB    . PHE A 1 156 ? -5.976  -27.938 6.003   1.00 120.38 ? 178 PHE A CB    1 
ATOM   838  C CG    . PHE A 1 156 ? -5.653  -28.318 4.592   1.00 120.15 ? 178 PHE A CG    1 
ATOM   839  C CD1   . PHE A 1 156 ? -5.773  -27.388 3.568   1.00 119.60 ? 178 PHE A CD1   1 
ATOM   840  C CD2   . PHE A 1 156 ? -5.260  -29.618 4.280   1.00 120.02 ? 178 PHE A CD2   1 
ATOM   841  C CE1   . PHE A 1 156 ? -5.496  -27.742 2.259   1.00 119.34 ? 178 PHE A CE1   1 
ATOM   842  C CE2   . PHE A 1 156 ? -4.976  -29.981 2.973   1.00 119.68 ? 178 PHE A CE2   1 
ATOM   843  C CZ    . PHE A 1 156 ? -5.094  -29.042 1.961   1.00 119.43 ? 178 PHE A CZ    1 
ATOM   844  N N     . LEU A 1 157 ? -5.181  -25.724 8.308   1.00 119.77 ? 179 LEU A N     1 
ATOM   845  C CA    . LEU A 1 157 ? -5.714  -25.052 9.475   1.00 119.50 ? 179 LEU A CA    1 
ATOM   846  C C     . LEU A 1 157 ? -6.855  -24.154 9.035   1.00 119.31 ? 179 LEU A C     1 
ATOM   847  O O     . LEU A 1 157 ? -6.680  -23.278 8.178   1.00 119.31 ? 179 LEU A O     1 
ATOM   848  C CB    . LEU A 1 157 ? -4.625  -24.241 10.189  1.00 119.53 ? 179 LEU A CB    1 
ATOM   849  C CG    . LEU A 1 157 ? -3.250  -24.900 10.452  1.00 119.32 ? 179 LEU A CG    1 
ATOM   850  C CD1   . LEU A 1 157 ? -2.382  -23.914 11.291  1.00 119.20 ? 179 LEU A CD1   1 
ATOM   851  C CD2   . LEU A 1 157 ? -3.363  -26.304 11.172  1.00 119.20 ? 179 LEU A CD2   1 
ATOM   852  N N     . LEU A 1 158 ? -8.023  -24.392 9.623   1.00 118.96 ? 180 LEU A N     1 
ATOM   853  C CA    . LEU A 1 158 ? -9.224  -23.673 9.259   1.00 118.70 ? 180 LEU A CA    1 
ATOM   854  C C     . LEU A 1 158 ? -9.635  -22.705 10.368  1.00 118.56 ? 180 LEU A C     1 
ATOM   855  O O     . LEU A 1 158 ? -10.125 -23.126 11.414  1.00 118.57 ? 180 LEU A O     1 
ATOM   856  C CB    . LEU A 1 158 ? -10.327 -24.679 8.959   1.00 118.65 ? 180 LEU A CB    1 
ATOM   857  C CG    . LEU A 1 158 ? -11.703 -24.168 8.515   1.00 118.90 ? 180 LEU A CG    1 
ATOM   858  C CD1   . LEU A 1 158 ? -11.594 -23.222 7.325   1.00 119.24 ? 180 LEU A CD1   1 
ATOM   859  C CD2   . LEU A 1 158 ? -12.576 -25.352 8.146   1.00 119.05 ? 180 LEU A CD2   1 
ATOM   860  N N     . MET A 1 159 ? -9.426  -21.412 10.123  1.00 118.55 ? 181 MET A N     1 
ATOM   861  C CA    . MET A 1 159 ? -9.678  -20.358 11.111  1.00 118.61 ? 181 MET A CA    1 
ATOM   862  C C     . MET A 1 159 ? -11.147 -20.130 11.322  1.00 118.58 ? 181 MET A C     1 
ATOM   863  O O     . MET A 1 159 ? -11.841 -19.691 10.405  1.00 118.60 ? 181 MET A O     1 
ATOM   864  C CB    . MET A 1 159 ? -9.058  -19.026 10.690  1.00 118.68 ? 181 MET A CB    1 
ATOM   865  C CG    . MET A 1 159 ? -7.548  -18.970 10.796  1.00 119.03 ? 181 MET A CG    1 
ATOM   866  S SD    . MET A 1 159 ? -6.961  -19.421 12.435  1.00 118.40 ? 181 MET A SD    1 
ATOM   867  C CE    . MET A 1 159 ? -7.652  -18.085 13.413  1.00 118.39 ? 181 MET A CE    1 
ATOM   868  N N     . VAL A 1 160 ? -11.604 -20.403 12.544  1.00 118.66 ? 182 VAL A N     1 
ATOM   869  C CA    . VAL A 1 160 ? -13.013 -20.256 12.906  1.00 118.52 ? 182 VAL A CA    1 
ATOM   870  C C     . VAL A 1 160 ? -13.189 -19.093 13.880  1.00 118.45 ? 182 VAL A C     1 
ATOM   871  O O     . VAL A 1 160 ? -12.768 -19.173 15.035  1.00 118.72 ? 182 VAL A O     1 
ATOM   872  C CB    . VAL A 1 160 ? -13.583 -21.559 13.537  1.00 118.48 ? 182 VAL A CB    1 
ATOM   873  C CG1   . VAL A 1 160 ? -15.051 -21.389 13.858  1.00 118.43 ? 182 VAL A CG1   1 
ATOM   874  C CG2   . VAL A 1 160 ? -13.382 -22.756 12.604  1.00 118.31 ? 182 VAL A CG2   1 
ATOM   875  N N     . ARG A 1 161 ? -13.801 -18.013 13.409  1.00 118.20 ? 183 ARG A N     1 
ATOM   876  C CA    . ARG A 1 161 ? -14.071 -16.863 14.257  1.00 118.19 ? 183 ARG A CA    1 
ATOM   877  C C     . ARG A 1 161 ? -15.571 -16.590 14.307  1.00 118.31 ? 183 ARG A C     1 
ATOM   878  O O     . ARG A 1 161 ? -16.272 -16.791 13.312  1.00 118.56 ? 183 ARG A O     1 
ATOM   879  C CB    . ARG A 1 161 ? -13.320 -15.640 13.739  1.00 118.04 ? 183 ARG A CB    1 
ATOM   880  C CG    . ARG A 1 161 ? -13.261 -14.475 14.717  1.00 118.13 ? 183 ARG A CG    1 
ATOM   881  C CD    . ARG A 1 161 ? -12.493 -13.311 14.128  1.00 118.35 ? 183 ARG A CD    1 
ATOM   882  N NE    . ARG A 1 161 ? -12.544 -12.128 14.979  1.00 118.81 ? 183 ARG A NE    1 
ATOM   883  C CZ    . ARG A 1 161 ? -12.277 -10.889 14.573  1.00 119.31 ? 183 ARG A CZ    1 
ATOM   884  N NH1   . ARG A 1 161 ? -11.940 -10.632 13.311  1.00 119.33 ? 183 ARG A NH1   1 
ATOM   885  N NH2   . ARG A 1 161 ? -12.360 -9.893  15.441  1.00 119.58 ? 183 ARG A NH2   1 
ATOM   886  N N     . ASP A 1 162 ? -16.066 -16.154 15.466  1.00 118.20 ? 184 ASP A N     1 
ATOM   887  C CA    . ASP A 1 162 ? -17.453 -15.724 15.585  1.00 118.02 ? 184 ASP A CA    1 
ATOM   888  C C     . ASP A 1 162 ? -17.758 -14.837 14.381  1.00 117.76 ? 184 ASP A C     1 
ATOM   889  O O     . ASP A 1 162 ? -17.209 -13.739 14.261  1.00 117.61 ? 184 ASP A O     1 
ATOM   890  C CB    . ASP A 1 162 ? -17.660 -14.952 16.896  1.00 118.20 ? 184 ASP A CB    1 
ATOM   891  C CG    . ASP A 1 162 ? -19.118 -14.929 17.352  1.00 118.64 ? 184 ASP A CG    1 
ATOM   892  O OD1   . ASP A 1 162 ? -20.040 -14.856 16.503  1.00 119.53 ? 184 ASP A OD1   1 
ATOM   893  O OD2   . ASP A 1 162 ? -19.344 -14.973 18.581  1.00 118.74 ? 184 ASP A OD2   1 
ATOM   894  N N     . GLY A 1 163 ? -18.601 -15.337 13.473  1.00 117.48 ? 185 GLY A N     1 
ATOM   895  C CA    . GLY A 1 163 ? -18.962 -14.603 12.260  1.00 117.20 ? 185 GLY A CA    1 
ATOM   896  C C     . GLY A 1 163 ? -19.504 -13.221 12.535  1.00 117.08 ? 185 GLY A C     1 
ATOM   897  O O     . GLY A 1 163 ? -19.459 -12.345 11.677  1.00 116.82 ? 185 GLY A O     1 
ATOM   898  N N     . ARG A 1 164 ? -20.015 -13.046 13.751  1.00 117.20 ? 186 ARG A N     1 
ATOM   899  C CA    . ARG A 1 164 ? -20.503 -11.763 14.247  1.00 117.37 ? 186 ARG A CA    1 
ATOM   900  C C     . ARG A 1 164 ? -19.353 -10.783 14.375  1.00 117.30 ? 186 ARG A C     1 
ATOM   901  O O     . ARG A 1 164 ? -19.503 -9.584  14.137  1.00 117.26 ? 186 ARG A O     1 
ATOM   902  C CB    . ARG A 1 164 ? -21.219 -11.957 15.592  1.00 117.40 ? 186 ARG A CB    1 
ATOM   903  C CG    . ARG A 1 164 ? -22.584 -12.624 15.422  1.00 117.92 ? 186 ARG A CG    1 
ATOM   904  C CD    . ARG A 1 164 ? -23.304 -12.926 16.720  1.00 118.36 ? 186 ARG A CD    1 
ATOM   905  N NE    . ARG A 1 164 ? -22.716 -14.060 17.431  1.00 118.97 ? 186 ARG A NE    1 
ATOM   906  C CZ    . ARG A 1 164 ? -23.303 -14.702 18.444  1.00 119.52 ? 186 ARG A CZ    1 
ATOM   907  N NH1   . ARG A 1 164 ? -24.509 -14.333 18.873  1.00 120.31 ? 186 ARG A NH1   1 
ATOM   908  N NH2   . ARG A 1 164 ? -22.682 -15.722 19.028  1.00 119.74 ? 186 ARG A NH2   1 
ATOM   909  N N     . ALA A 1 165 ? -18.197 -11.315 14.742  1.00 117.24 ? 187 ALA A N     1 
ATOM   910  C CA    . ALA A 1 165 ? -16.986 -10.540 14.746  1.00 117.13 ? 187 ALA A CA    1 
ATOM   911  C C     . ALA A 1 165 ? -16.519 -10.346 13.301  1.00 117.09 ? 187 ALA A C     1 
ATOM   912  O O     . ALA A 1 165 ? -16.226 -9.215  12.883  1.00 117.11 ? 187 ALA A O     1 
ATOM   913  C CB    . ALA A 1 165 ? -15.922 -11.230 15.580  1.00 117.21 ? 187 ALA A CB    1 
ATOM   914  N N     . SER A 1 166 ? -16.476 -11.441 12.536  1.00 117.00 ? 188 SER A N     1 
ATOM   915  C CA    . SER A 1 166 ? -16.044 -11.387 11.138  1.00 116.96 ? 188 SER A CA    1 
ATOM   916  C C     . SER A 1 166 ? -16.837 -10.364 10.362  1.00 117.07 ? 188 SER A C     1 
ATOM   917  O O     . SER A 1 166 ? -16.268 -9.481  9.725   1.00 117.04 ? 188 SER A O     1 
ATOM   918  C CB    . SER A 1 166 ? -16.203 -12.744 10.449  1.00 116.84 ? 188 SER A CB    1 
ATOM   919  O OG    . SER A 1 166 ? -15.461 -13.745 11.106  1.00 116.90 ? 188 SER A OG    1 
ATOM   920  N N     . VAL A 1 167 ? -18.160 -10.491 10.431  1.00 117.28 ? 189 VAL A N     1 
ATOM   921  C CA    . VAL A 1 167 ? -19.073 -9.687  9.620   1.00 117.33 ? 189 VAL A CA    1 
ATOM   922  C C     . VAL A 1 167 ? -19.070 -8.224  10.059  1.00 117.41 ? 189 VAL A C     1 
ATOM   923  O O     . VAL A 1 167 ? -19.134 -7.311  9.229   1.00 117.23 ? 189 VAL A O     1 
ATOM   924  C CB    . VAL A 1 167 ? -20.501 -10.298 9.597   1.00 117.26 ? 189 VAL A CB    1 
ATOM   925  C CG1   . VAL A 1 167 ? -21.532 -9.275  9.173   1.00 117.36 ? 189 VAL A CG1   1 
ATOM   926  C CG2   . VAL A 1 167 ? -20.549 -11.515 8.667   1.00 116.90 ? 189 VAL A CG2   1 
ATOM   927  N N     . HIS A 1 168 ? -18.977 -8.006  11.366  1.00 117.71 ? 190 HIS A N     1 
ATOM   928  C CA    . HIS A 1 168 ? -18.790 -6.661  11.877  1.00 118.15 ? 190 HIS A CA    1 
ATOM   929  C C     . HIS A 1 168 ? -17.520 -6.102  11.253  1.00 117.99 ? 190 HIS A C     1 
ATOM   930  O O     . HIS A 1 168 ? -17.554 -5.075  10.562  1.00 118.00 ? 190 HIS A O     1 
ATOM   931  C CB    . HIS A 1 168 ? -18.700 -6.650  13.409  1.00 118.34 ? 190 HIS A CB    1 
ATOM   932  C CG    . HIS A 1 168 ? -18.393 -5.300  13.984  1.00 119.64 ? 190 HIS A CG    1 
ATOM   933  N ND1   . HIS A 1 168 ? -19.287 -4.249  13.945  1.00 120.94 ? 190 HIS A ND1   1 
ATOM   934  C CD2   . HIS A 1 168 ? -17.288 -4.828  14.612  1.00 120.96 ? 190 HIS A CD2   1 
ATOM   935  C CE1   . HIS A 1 168 ? -18.748 -3.190  14.528  1.00 121.60 ? 190 HIS A CE1   1 
ATOM   936  N NE2   . HIS A 1 168 ? -17.535 -3.515  14.940  1.00 121.70 ? 190 HIS A NE2   1 
ATOM   937  N N     . SER A 1 169 ? -16.417 -6.818  11.469  1.00 117.97 ? 191 SER A N     1 
ATOM   938  C CA    . SER A 1 169 ? -15.107 -6.409  10.977  1.00 118.03 ? 191 SER A CA    1 
ATOM   939  C C     . SER A 1 169 ? -15.185 -5.944  9.521   1.00 118.16 ? 191 SER A C     1 
ATOM   940  O O     . SER A 1 169 ? -14.825 -4.806  9.202   1.00 118.07 ? 191 SER A O     1 
ATOM   941  C CB    . SER A 1 169 ? -14.094 -7.551  11.152  1.00 117.97 ? 191 SER A CB    1 
ATOM   942  O OG    . SER A 1 169 ? -12.782 -7.171  10.730  1.00 117.89 ? 191 SER A OG    1 
ATOM   943  N N     . MET A 1 170 ? -15.699 -6.810  8.653   1.00 118.37 ? 192 MET A N     1 
ATOM   944  C CA    . MET A 1 170 ? -15.750 -6.498  7.229   1.00 118.57 ? 192 MET A CA    1 
ATOM   945  C C     . MET A 1 170 ? -16.713 -5.359  6.913   1.00 118.82 ? 192 MET A C     1 
ATOM   946  O O     . MET A 1 170 ? -16.520 -4.651  5.928   1.00 118.91 ? 192 MET A O     1 
ATOM   947  C CB    . MET A 1 170 ? -16.057 -7.737  6.382   1.00 118.46 ? 192 MET A CB    1 
ATOM   948  C CG    . MET A 1 170 ? -17.430 -8.326  6.551   1.00 118.16 ? 192 MET A CG    1 
ATOM   949  S SD    . MET A 1 170 ? -17.625 -9.750  5.475   1.00 118.36 ? 192 MET A SD    1 
ATOM   950  C CE    . MET A 1 170 ? -16.567 -10.962 6.277   1.00 118.28 ? 192 MET A CE    1 
ATOM   951  N N     . ILE A 1 171 ? -17.734 -5.179  7.747   1.00 119.17 ? 193 ILE A N     1 
ATOM   952  C CA    . ILE A 1 171 ? -18.694 -4.105  7.520   1.00 119.55 ? 193 ILE A CA    1 
ATOM   953  C C     . ILE A 1 171 ? -18.122 -2.753  7.923   1.00 119.91 ? 193 ILE A C     1 
ATOM   954  O O     . ILE A 1 171 ? -18.198 -1.786  7.164   1.00 120.12 ? 193 ILE A O     1 
ATOM   955  C CB    . ILE A 1 171 ? -20.061 -4.390  8.174   1.00 119.40 ? 193 ILE A CB    1 
ATOM   956  C CG1   . ILE A 1 171 ? -20.842 -5.351  7.276   1.00 119.45 ? 193 ILE A CG1   1 
ATOM   957  C CG2   . ILE A 1 171 ? -20.855 -3.104  8.351   1.00 119.41 ? 193 ILE A CG2   1 
ATOM   958  C CD1   . ILE A 1 171 ? -22.084 -5.919  7.873   1.00 119.17 ? 193 ILE A CD1   1 
ATOM   959  N N     . THR A 1 172 ? -17.520 -2.690  9.100   1.00 120.33 ? 194 THR A N     1 
ATOM   960  C CA    . THR A 1 172 ? -16.965 -1.435  9.569   1.00 120.89 ? 194 THR A CA    1 
ATOM   961  C C     . THR A 1 172 ? -15.695 -1.073  8.818   1.00 120.91 ? 194 THR A C     1 
ATOM   962  O O     . THR A 1 172 ? -15.424 0.103   8.596   1.00 121.04 ? 194 THR A O     1 
ATOM   963  C CB    . THR A 1 172 ? -16.657 -1.482  11.067  1.00 121.08 ? 194 THR A CB    1 
ATOM   964  O OG1   . THR A 1 172 ? -15.827 -2.615  11.350  1.00 121.71 ? 194 THR A OG1   1 
ATOM   965  C CG2   . THR A 1 172 ? -17.946 -1.583  11.869  1.00 121.51 ? 194 THR A CG2   1 
ATOM   966  N N     . ARG A 1 173 ? -14.922 -2.082  8.423   1.00 120.96 ? 195 ARG A N     1 
ATOM   967  C CA    . ARG A 1 173 ? -13.631 -1.827  7.790   1.00 121.06 ? 195 ARG A CA    1 
ATOM   968  C C     . ARG A 1 173 ? -13.723 -1.644  6.268   1.00 121.00 ? 195 ARG A C     1 
ATOM   969  O O     . ARG A 1 173 ? -12.728 -1.305  5.633   1.00 121.13 ? 195 ARG A O     1 
ATOM   970  C CB    . ARG A 1 173 ? -12.600 -2.910  8.162   1.00 121.17 ? 195 ARG A CB    1 
ATOM   971  C CG    . ARG A 1 173 ? -12.054 -2.826  9.587   1.00 121.03 ? 195 ARG A CG    1 
ATOM   972  C CD    . ARG A 1 173 ? -10.865 -3.765  9.784   1.00 121.03 ? 195 ARG A CD    1 
ATOM   973  N NE    . ARG A 1 173 ? -10.623 -4.076  11.202  1.00 121.53 ? 195 ARG A NE    1 
ATOM   974  C CZ    . ARG A 1 173 ? -9.850  -3.355  12.026  1.00 121.21 ? 195 ARG A CZ    1 
ATOM   975  N NH1   . ARG A 1 173 ? -9.232  -2.264  11.581  1.00 121.72 ? 195 ARG A NH1   1 
ATOM   976  N NH2   . ARG A 1 173 ? -9.692  -3.722  13.297  1.00 119.96 ? 195 ARG A NH2   1 
ATOM   977  N N     . LYS A 1 174 ? -14.911 -1.857  5.699   1.00 120.73 ? 196 LYS A N     1 
ATOM   978  C CA    . LYS A 1 174 ? -15.166 -1.721  4.243   1.00 120.53 ? 196 LYS A CA    1 
ATOM   979  C C     . LYS A 1 174 ? -14.460 -2.738  3.332   1.00 120.39 ? 196 LYS A C     1 
ATOM   980  O O     . LYS A 1 174 ? -14.160 -2.436  2.170   1.00 120.34 ? 196 LYS A O     1 
ATOM   981  C CB    . LYS A 1 174 ? -14.900 -0.293  3.742   1.00 120.50 ? 196 LYS A CB    1 
ATOM   982  C CG    . LYS A 1 174 ? -16.152 0.464   3.323   1.00 120.49 ? 196 LYS A CG    1 
ATOM   983  C CD    . LYS A 1 174 ? -16.837 1.129   4.499   1.00 120.23 ? 196 LYS A CD    1 
ATOM   984  C CE    . LYS A 1 174 ? -16.167 2.449   4.840   1.00 120.54 ? 196 LYS A CE    1 
ATOM   985  N NZ    . LYS A 1 174 ? -16.571 2.937   6.184   1.00 120.88 ? 196 LYS A NZ    1 
ATOM   986  N N     . VAL A 1 175 ? -14.237 -3.942  3.850   1.00 120.26 ? 197 VAL A N     1 
ATOM   987  C CA    . VAL A 1 175 ? -13.496 -4.983  3.132   1.00 120.22 ? 197 VAL A CA    1 
ATOM   988  C C     . VAL A 1 175 ? -14.357 -5.761  2.118   1.00 120.12 ? 197 VAL A C     1 
ATOM   989  O O     . VAL A 1 175 ? -14.929 -6.804  2.440   1.00 120.07 ? 197 VAL A O     1 
ATOM   990  C CB    . VAL A 1 175 ? -12.810 -5.964  4.122   1.00 120.21 ? 197 VAL A CB    1 
ATOM   991  C CG1   . VAL A 1 175 ? -11.766 -6.813  3.399   1.00 120.56 ? 197 VAL A CG1   1 
ATOM   992  C CG2   . VAL A 1 175 ? -12.162 -5.202  5.279   1.00 120.05 ? 197 VAL A CG2   1 
ATOM   993  N N     . THR A 1 176 ? -14.429 -5.258  0.890   1.00 120.11 ? 198 THR A N     1 
ATOM   994  C CA    . THR A 1 176 ? -15.188 -5.925  -0.172  1.00 120.28 ? 198 THR A CA    1 
ATOM   995  C C     . THR A 1 176 ? -14.666 -7.337  -0.496  1.00 120.38 ? 198 THR A C     1 
ATOM   996  O O     . THR A 1 176 ? -13.475 -7.516  -0.808  1.00 120.37 ? 198 THR A O     1 
ATOM   997  C CB    . THR A 1 176 ? -15.247 -5.070  -1.469  1.00 120.33 ? 198 THR A CB    1 
ATOM   998  O OG1   . THR A 1 176 ? -14.225 -4.057  -1.424  1.00 120.01 ? 198 THR A OG1   1 
ATOM   999  C CG2   . THR A 1 176 ? -16.624 -4.402  -1.620  1.00 120.41 ? 198 THR A CG2   1 
ATOM   1000 N N     . ILE A 1 177 ? -15.571 -8.326  -0.412  1.00 120.52 ? 199 ILE A N     1 
ATOM   1001 C CA    . ILE A 1 177 ? -15.250 -9.730  -0.738  1.00 120.54 ? 199 ILE A CA    1 
ATOM   1002 C C     . ILE A 1 177 ? -16.180 -10.290 -1.842  1.00 120.99 ? 199 ILE A C     1 
ATOM   1003 O O     . ILE A 1 177 ? -17.097 -9.570  -2.322  1.00 120.87 ? 199 ILE A O     1 
ATOM   1004 C CB    . ILE A 1 177 ? -15.293 -10.637 0.532   1.00 120.34 ? 199 ILE A CB    1 
ATOM   1005 C CG1   . ILE A 1 177 ? -14.403 -10.044 1.659   1.00 119.97 ? 199 ILE A CG1   1 
ATOM   1006 C CG2   . ILE A 1 177 ? -14.856 -12.088 0.197   1.00 119.72 ? 199 ILE A CG2   1 
ATOM   1007 C CD1   . ILE A 1 177 ? -14.814 -10.474 3.056   1.00 119.57 ? 199 ILE A CD1   1 
ATOM   1008 N N     . ALA A 1 178 ? -15.931 -11.561 -2.225  1.00 121.62 ? 200 ALA A N     1 
ATOM   1009 C CA    . ALA A 1 178 ? -16.669 -12.269 -3.287  1.00 122.27 ? 200 ALA A CA    1 
ATOM   1010 C C     . ALA A 1 178 ? -18.169 -12.478 -3.011  1.00 122.79 ? 200 ALA A C     1 
ATOM   1011 O O     . ALA A 1 178 ? -18.582 -13.553 -2.547  1.00 123.08 ? 200 ALA A O     1 
ATOM   1012 C CB    . ALA A 1 178 ? -15.983 -13.614 -3.606  1.00 122.09 ? 200 ALA A CB    1 
ATOM   1013 N N     . GLY A 1 179 ? -18.973 -11.451 -3.305  1.00 123.23 ? 201 GLY A N     1 
ATOM   1014 C CA    . GLY A 1 179 ? -20.436 -11.509 -3.146  1.00 123.65 ? 201 GLY A CA    1 
ATOM   1015 C C     . GLY A 1 179 ? -20.990 -10.914 -1.856  1.00 123.93 ? 201 GLY A C     1 
ATOM   1016 O O     . GLY A 1 179 ? -22.212 -10.750 -1.707  1.00 124.11 ? 201 GLY A O     1 
ATOM   1017 N N     . PHE A 1 180 ? -20.091 -10.588 -0.927  1.00 124.01 ? 202 PHE A N     1 
ATOM   1018 C CA    . PHE A 1 180 ? -20.463 -10.049 0.381   1.00 124.12 ? 202 PHE A CA    1 
ATOM   1019 C C     . PHE A 1 180 ? -20.863 -8.573  0.280   1.00 124.07 ? 202 PHE A C     1 
ATOM   1020 O O     . PHE A 1 180 ? -20.013 -7.676  0.203   1.00 123.97 ? 202 PHE A O     1 
ATOM   1021 C CB    . PHE A 1 180 ? -19.330 -10.276 1.400   1.00 124.20 ? 202 PHE A CB    1 
ATOM   1022 C CG    . PHE A 1 180 ? -19.141 -11.731 1.798   1.00 124.44 ? 202 PHE A CG    1 
ATOM   1023 C CD1   . PHE A 1 180 ? -18.933 -12.723 0.829   1.00 124.66 ? 202 PHE A CD1   1 
ATOM   1024 C CD2   . PHE A 1 180 ? -19.159 -12.107 3.141   1.00 124.28 ? 202 PHE A CD2   1 
ATOM   1025 C CE1   . PHE A 1 180 ? -18.758 -14.065 1.190   1.00 124.62 ? 202 PHE A CE1   1 
ATOM   1026 C CE2   . PHE A 1 180 ? -18.983 -13.447 3.515   1.00 124.23 ? 202 PHE A CE2   1 
ATOM   1027 C CZ    . PHE A 1 180 ? -18.784 -14.427 2.537   1.00 124.44 ? 202 PHE A CZ    1 
ATOM   1028 N N     . ASP A 1 181 ? -22.176 -8.348  0.257   1.00 124.08 ? 203 ASP A N     1 
ATOM   1029 C CA    . ASP A 1 181 ? -22.759 -7.014  0.129   1.00 124.05 ? 203 ASP A CA    1 
ATOM   1030 C C     . ASP A 1 181 ? -22.706 -6.288  1.473   1.00 123.93 ? 203 ASP A C     1 
ATOM   1031 O O     . ASP A 1 181 ? -23.394 -6.672  2.420   1.00 124.00 ? 203 ASP A O     1 
ATOM   1032 C CB    . ASP A 1 181 ? -24.204 -7.118  -0.385  1.00 124.07 ? 203 ASP A CB    1 
ATOM   1033 C CG    . ASP A 1 181 ? -24.786 -5.774  -0.803  1.00 124.19 ? 203 ASP A CG    1 
ATOM   1034 O OD1   . ASP A 1 181 ? -24.013 -4.843  -1.121  1.00 124.21 ? 203 ASP A OD1   1 
ATOM   1035 O OD2   . ASP A 1 181 ? -26.028 -5.649  -0.823  1.00 124.80 ? 203 ASP A OD2   1 
ATOM   1036 N N     . LEU A 1 182 ? -21.896 -5.232  1.536   1.00 123.69 ? 204 LEU A N     1 
ATOM   1037 C CA    . LEU A 1 182 ? -21.580 -4.532  2.787   1.00 123.58 ? 204 LEU A CA    1 
ATOM   1038 C C     . LEU A 1 182 ? -22.743 -3.774  3.439   1.00 123.28 ? 204 LEU A C     1 
ATOM   1039 O O     . LEU A 1 182 ? -22.650 -3.351  4.604   1.00 123.22 ? 204 LEU A O     1 
ATOM   1040 C CB    . LEU A 1 182 ? -20.399 -3.586  2.559   1.00 123.77 ? 204 LEU A CB    1 
ATOM   1041 C CG    . LEU A 1 182 ? -19.096 -4.243  2.067   1.00 124.70 ? 204 LEU A CG    1 
ATOM   1042 C CD1   . LEU A 1 182 ? -18.067 -3.182  1.599   1.00 125.68 ? 204 LEU A CD1   1 
ATOM   1043 C CD2   . LEU A 1 182 ? -18.477 -5.186  3.137   1.00 125.20 ? 204 LEU A CD2   1 
ATOM   1044 N N     . SER A 1 183 ? -23.837 -3.639  2.685   1.00 122.99 ? 205 SER A N     1 
ATOM   1045 C CA    . SER A 1 183 ? -25.005 -2.826  3.063   1.00 122.62 ? 205 SER A CA    1 
ATOM   1046 C C     . SER A 1 183 ? -26.000 -3.486  4.049   1.00 122.11 ? 205 SER A C     1 
ATOM   1047 O O     . SER A 1 183 ? -26.836 -2.805  4.663   1.00 122.05 ? 205 SER A O     1 
ATOM   1048 C CB    . SER A 1 183 ? -25.741 -2.395  1.786   1.00 122.77 ? 205 SER A CB    1 
ATOM   1049 O OG    . SER A 1 183 ? -24.829 -2.212  0.707   1.00 123.10 ? 205 SER A OG    1 
ATOM   1050 N N     . SER A 1 184 ? -25.905 -4.807  4.192   1.00 121.36 ? 206 SER A N     1 
ATOM   1051 C CA    . SER A 1 184 ? -26.806 -5.556  5.054   1.00 120.53 ? 206 SER A CA    1 
ATOM   1052 C C     . SER A 1 184 ? -26.050 -6.602  5.854   1.00 120.14 ? 206 SER A C     1 
ATOM   1053 O O     . SER A 1 184 ? -25.422 -7.505  5.283   1.00 119.92 ? 206 SER A O     1 
ATOM   1054 C CB    . SER A 1 184 ? -27.891 -6.233  4.218   1.00 120.49 ? 206 SER A CB    1 
ATOM   1055 O OG    . SER A 1 184 ? -28.465 -7.313  4.937   1.00 120.26 ? 206 SER A OG    1 
ATOM   1056 N N     . TYR A 1 185 ? -26.119 -6.473  7.178   1.00 119.81 ? 207 TYR A N     1 
ATOM   1057 C CA    . TYR A 1 185 ? -25.589 -7.495  8.079   1.00 119.54 ? 207 TYR A CA    1 
ATOM   1058 C C     . TYR A 1 185 ? -26.209 -8.855  7.747   1.00 119.47 ? 207 TYR A C     1 
ATOM   1059 O O     . TYR A 1 185 ? -25.504 -9.873  7.691   1.00 119.37 ? 207 TYR A O     1 
ATOM   1060 C CB    . TYR A 1 185 ? -25.864 -7.119  9.537   1.00 119.30 ? 207 TYR A CB    1 
ATOM   1061 C CG    . TYR A 1 185 ? -24.848 -6.178  10.150  1.00 119.25 ? 207 TYR A CG    1 
ATOM   1062 C CD1   . TYR A 1 185 ? -23.940 -6.637  11.108  1.00 119.21 ? 207 TYR A CD1   1 
ATOM   1063 C CD2   . TYR A 1 185 ? -24.798 -4.826  9.785   1.00 119.40 ? 207 TYR A CD2   1 
ATOM   1064 C CE1   . TYR A 1 185 ? -23.000 -5.780  11.690  1.00 119.57 ? 207 TYR A CE1   1 
ATOM   1065 C CE2   . TYR A 1 185 ? -23.854 -3.958  10.361  1.00 119.68 ? 207 TYR A CE2   1 
ATOM   1066 C CZ    . TYR A 1 185 ? -22.960 -4.446  11.314  1.00 119.62 ? 207 TYR A CZ    1 
ATOM   1067 O OH    . TYR A 1 185 ? -22.027 -3.613  11.898  1.00 119.49 ? 207 TYR A OH    1 
ATOM   1068 N N     . ARG A 1 186 ? -27.527 -8.840  7.498   1.00 119.46 ? 208 ARG A N     1 
ATOM   1069 C CA    . ARG A 1 186 ? -28.314 -10.040 7.166   1.00 119.25 ? 208 ARG A CA    1 
ATOM   1070 C C     . ARG A 1 186 ? -27.691 -10.779 5.995   1.00 119.06 ? 208 ARG A C     1 
ATOM   1071 O O     . ARG A 1 186 ? -27.458 -11.990 6.057   1.00 119.03 ? 208 ARG A O     1 
ATOM   1072 C CB    . ARG A 1 186 ? -29.777 -9.673  6.860   1.00 119.16 ? 208 ARG A CB    1 
ATOM   1073 C CG    . ARG A 1 186 ? -30.669 -10.866 6.484   1.00 119.27 ? 208 ARG A CG    1 
ATOM   1074 C CD    . ARG A 1 186 ? -32.154 -10.508 6.508   1.00 119.51 ? 208 ARG A CD    1 
ATOM   1075 N NE    . ARG A 1 186 ? -32.590 -10.112 7.845   1.00 119.51 ? 208 ARG A NE    1 
ATOM   1076 C CZ    . ARG A 1 186 ? -33.046 -10.951 8.772   1.00 119.46 ? 208 ARG A CZ    1 
ATOM   1077 N NH1   . ARG A 1 186 ? -33.143 -12.252 8.516   1.00 119.32 ? 208 ARG A NH1   1 
ATOM   1078 N NH2   . ARG A 1 186 ? -33.410 -10.484 9.958   1.00 119.42 ? 208 ARG A NH2   1 
ATOM   1079 N N     . ASP A 1 187 ? -27.415 -10.026 4.937   1.00 118.82 ? 209 ASP A N     1 
ATOM   1080 C CA    . ASP A 1 187 ? -26.737 -10.548 3.780   1.00 118.60 ? 209 ASP A CA    1 
ATOM   1081 C C     . ASP A 1 187 ? -25.429 -11.198 4.234   1.00 118.34 ? 209 ASP A C     1 
ATOM   1082 O O     . ASP A 1 187 ? -25.244 -12.433 4.124   1.00 118.25 ? 209 ASP A O     1 
ATOM   1083 C CB    . ASP A 1 187 ? -26.489 -9.408  2.769   1.00 118.73 ? 209 ASP A CB    1 
ATOM   1084 C CG    . ASP A 1 187 ? -25.622 -9.842  1.600   1.00 119.46 ? 209 ASP A CG    1 
ATOM   1085 O OD1   . ASP A 1 187 ? -26.180 -10.306 0.580   1.00 120.49 ? 209 ASP A OD1   1 
ATOM   1086 O OD2   . ASP A 1 187 ? -24.380 -9.731  1.696   1.00 119.72 ? 209 ASP A OD2   1 
ATOM   1087 N N     . CYS A 1 188 ? -24.548 -10.370 4.794   1.00 118.17 ? 210 CYS A N     1 
ATOM   1088 C CA    . CYS A 1 188 ? -23.190 -10.791 5.139   1.00 118.15 ? 210 CYS A CA    1 
ATOM   1089 C C     . CYS A 1 188 ? -23.145 -12.075 5.942   1.00 118.03 ? 210 CYS A C     1 
ATOM   1090 O O     . CYS A 1 188 ? -22.293 -12.933 5.718   1.00 117.97 ? 210 CYS A O     1 
ATOM   1091 C CB    . CYS A 1 188 ? -22.483 -9.693  5.928   1.00 118.15 ? 210 CYS A CB    1 
ATOM   1092 S SG    . CYS A 1 188 ? -22.079 -8.240  4.958   1.00 118.56 ? 210 CYS A SG    1 
ATOM   1093 N N     . LEU A 1 189 ? -24.075 -12.190 6.879   1.00 117.97 ? 211 LEU A N     1 
ATOM   1094 C CA    . LEU A 1 189 ? -24.085 -13.290 7.822   1.00 117.99 ? 211 LEU A CA    1 
ATOM   1095 C C     . LEU A 1 189 ? -24.554 -14.572 7.168   1.00 117.98 ? 211 LEU A C     1 
ATOM   1096 O O     . LEU A 1 189 ? -23.993 -15.647 7.398   1.00 117.89 ? 211 LEU A O     1 
ATOM   1097 C CB    . LEU A 1 189 ? -24.956 -12.918 9.014   1.00 117.95 ? 211 LEU A CB    1 
ATOM   1098 C CG    . LEU A 1 189 ? -24.203 -11.914 9.899   1.00 118.22 ? 211 LEU A CG    1 
ATOM   1099 C CD1   . LEU A 1 189 ? -25.109 -10.918 10.597  1.00 118.13 ? 211 LEU A CD1   1 
ATOM   1100 C CD2   . LEU A 1 189 ? -23.355 -12.677 10.912  1.00 119.12 ? 211 LEU A CD2   1 
ATOM   1101 N N     . THR A 1 190 ? -25.581 -14.442 6.334   1.00 118.08 ? 212 THR A N     1 
ATOM   1102 C CA    . THR A 1 190 ? -26.048 -15.547 5.527   1.00 118.10 ? 212 THR A CA    1 
ATOM   1103 C C     . THR A 1 190 ? -24.866 -16.046 4.730   1.00 118.00 ? 212 THR A C     1 
ATOM   1104 O O     . THR A 1 190 ? -24.613 -17.248 4.647   1.00 118.00 ? 212 THR A O     1 
ATOM   1105 C CB    . THR A 1 190 ? -27.126 -15.071 4.556   1.00 118.09 ? 212 THR A CB    1 
ATOM   1106 O OG1   . THR A 1 190 ? -28.149 -14.387 5.290   1.00 118.23 ? 212 THR A OG1   1 
ATOM   1107 C CG2   . THR A 1 190 ? -27.728 -16.247 3.807   1.00 118.40 ? 212 THR A CG2   1 
ATOM   1108 N N     . LYS A 1 191 ? -24.131 -15.090 4.173   1.00 117.99 ? 213 LYS A N     1 
ATOM   1109 C CA    . LYS A 1 191 ? -23.036 -15.373 3.274   1.00 118.07 ? 213 LYS A CA    1 
ATOM   1110 C C     . LYS A 1 191 ? -21.930 -16.092 4.031   1.00 118.02 ? 213 LYS A C     1 
ATOM   1111 O O     . LYS A 1 191 ? -21.547 -17.216 3.674   1.00 117.91 ? 213 LYS A O     1 
ATOM   1112 C CB    . LYS A 1 191 ? -22.529 -14.065 2.663   1.00 118.12 ? 213 LYS A CB    1 
ATOM   1113 C CG    . LYS A 1 191 ? -22.359 -14.109 1.150   1.00 118.24 ? 213 LYS A CG    1 
ATOM   1114 C CD    . LYS A 1 191 ? -23.614 -13.616 0.410   1.00 118.39 ? 213 LYS A CD    1 
ATOM   1115 C CE    . LYS A 1 191 ? -24.003 -14.599 -0.707  1.00 118.71 ? 213 LYS A CE    1 
ATOM   1116 N NZ    . LYS A 1 191 ? -24.516 -13.954 -1.976  1.00 117.78 ? 213 LYS A NZ    1 
ATOM   1117 N N     . TRP A 1 192 ? -21.441 -15.441 5.088   1.00 118.01 ? 214 TRP A N     1 
ATOM   1118 C CA    . TRP A 1 192 ? -20.491 -16.036 6.021   1.00 118.07 ? 214 TRP A CA    1 
ATOM   1119 C C     . TRP A 1 192 ? -20.935 -17.456 6.294   1.00 118.06 ? 214 TRP A C     1 
ATOM   1120 O O     . TRP A 1 192 ? -20.147 -18.399 6.230   1.00 117.83 ? 214 TRP A O     1 
ATOM   1121 C CB    . TRP A 1 192 ? -20.470 -15.235 7.333   1.00 118.14 ? 214 TRP A CB    1 
ATOM   1122 C CG    . TRP A 1 192 ? -19.670 -15.863 8.464   1.00 118.71 ? 214 TRP A CG    1 
ATOM   1123 C CD1   . TRP A 1 192 ? -18.330 -15.730 8.686   1.00 119.24 ? 214 TRP A CD1   1 
ATOM   1124 C CD2   . TRP A 1 192 ? -20.167 -16.701 9.531   1.00 119.49 ? 214 TRP A CD2   1 
ATOM   1125 N NE1   . TRP A 1 192 ? -17.955 -16.436 9.810   1.00 119.55 ? 214 TRP A NE1   1 
ATOM   1126 C CE2   . TRP A 1 192 ? -19.059 -17.044 10.347  1.00 119.59 ? 214 TRP A CE2   1 
ATOM   1127 C CE3   . TRP A 1 192 ? -21.438 -17.198 9.873   1.00 119.80 ? 214 TRP A CE3   1 
ATOM   1128 C CZ2   . TRP A 1 192 ? -19.181 -17.861 11.488  1.00 119.51 ? 214 TRP A CZ2   1 
ATOM   1129 C CZ3   . TRP A 1 192 ? -21.559 -18.016 11.010  1.00 119.50 ? 214 TRP A CZ3   1 
ATOM   1130 C CH2   . TRP A 1 192 ? -20.433 -18.334 11.801  1.00 119.67 ? 214 TRP A CH2   1 
ATOM   1131 N N     . ASN A 1 193 ? -22.229 -17.584 6.572   1.00 118.35 ? 215 ASN A N     1 
ATOM   1132 C CA    . ASN A 1 193 ? -22.816 -18.843 6.949   1.00 118.65 ? 215 ASN A CA    1 
ATOM   1133 C C     . ASN A 1 193 ? -22.610 -19.880 5.864   1.00 118.92 ? 215 ASN A C     1 
ATOM   1134 O O     . ASN A 1 193 ? -21.981 -20.911 6.100   1.00 118.91 ? 215 ASN A O     1 
ATOM   1135 C CB    . ASN A 1 193 ? -24.293 -18.662 7.274   1.00 118.45 ? 215 ASN A CB    1 
ATOM   1136 C CG    . ASN A 1 193 ? -24.951 -19.946 7.688   1.00 118.61 ? 215 ASN A CG    1 
ATOM   1137 O OD1   . ASN A 1 193 ? -25.613 -20.597 6.883   1.00 119.49 ? 215 ASN A OD1   1 
ATOM   1138 N ND2   . ASN A 1 193 ? -24.759 -20.336 8.944   1.00 118.10 ? 215 ASN A ND2   1 
ATOM   1139 N N     . LYS A 1 194 ? -23.111 -19.593 4.669   1.00 119.39 ? 216 LYS A N     1 
ATOM   1140 C CA    . LYS A 1 194 ? -22.909 -20.497 3.558   1.00 120.06 ? 216 LYS A CA    1 
ATOM   1141 C C     . LYS A 1 194 ? -21.431 -20.821 3.444   1.00 120.07 ? 216 LYS A C     1 
ATOM   1142 O O     . LYS A 1 194 ? -21.046 -21.994 3.411   1.00 120.30 ? 216 LYS A O     1 
ATOM   1143 C CB    . LYS A 1 194 ? -23.407 -19.894 2.244   1.00 120.31 ? 216 LYS A CB    1 
ATOM   1144 C CG    . LYS A 1 194 ? -23.452 -20.905 1.095   1.00 122.49 ? 216 LYS A CG    1 
ATOM   1145 C CD    . LYS A 1 194 ? -24.393 -22.080 1.432   1.00 126.82 ? 216 LYS A CD    1 
ATOM   1146 C CE    . LYS A 1 194 ? -24.547 -23.065 0.272   1.00 128.90 ? 216 LYS A CE    1 
ATOM   1147 N NZ    . LYS A 1 194 ? -23.386 -24.038 0.214   1.00 130.62 ? 216 LYS A NZ    1 
ATOM   1148 N N     . ALA A 1 195 ? -20.610 -19.773 3.411   1.00 119.99 ? 217 ALA A N     1 
ATOM   1149 C CA    . ALA A 1 195 ? -19.175 -19.921 3.227   1.00 119.78 ? 217 ALA A CA    1 
ATOM   1150 C C     . ALA A 1 195 ? -18.609 -20.942 4.199   1.00 119.71 ? 217 ALA A C     1 
ATOM   1151 O O     . ALA A 1 195 ? -18.119 -22.000 3.788   1.00 119.65 ? 217 ALA A O     1 
ATOM   1152 C CB    . ALA A 1 195 ? -18.477 -18.579 3.382   1.00 119.69 ? 217 ALA A CB    1 
ATOM   1153 N N     . ILE A 1 196 ? -18.731 -20.637 5.489   1.00 119.84 ? 218 ILE A N     1 
ATOM   1154 C CA    . ILE A 1 196 ? -18.080 -21.414 6.539   1.00 120.13 ? 218 ILE A CA    1 
ATOM   1155 C C     . ILE A 1 196 ? -18.522 -22.883 6.522   1.00 120.20 ? 218 ILE A C     1 
ATOM   1156 O O     . ILE A 1 196 ? -17.701 -23.809 6.702   1.00 119.96 ? 218 ILE A O     1 
ATOM   1157 C CB    . ILE A 1 196 ? -18.268 -20.713 7.941   1.00 120.21 ? 218 ILE A CB    1 
ATOM   1158 C CG1   . ILE A 1 196 ? -17.058 -20.932 8.879   1.00 120.69 ? 218 ILE A CG1   1 
ATOM   1159 C CG2   . ILE A 1 196 ? -19.645 -20.978 8.574   1.00 120.08 ? 218 ILE A CG2   1 
ATOM   1160 C CD1   . ILE A 1 196 ? -16.787 -22.361 9.308   1.00 122.20 ? 218 ILE A CD1   1 
ATOM   1161 N N     . GLU A 1 197 ? -19.818 -23.076 6.260   1.00 120.54 ? 219 GLU A N     1 
ATOM   1162 C CA    . GLU A 1 197 ? -20.437 -24.393 6.238   1.00 120.95 ? 219 GLU A CA    1 
ATOM   1163 C C     . GLU A 1 197 ? -19.672 -25.322 5.302   1.00 120.76 ? 219 GLU A C     1 
ATOM   1164 O O     . GLU A 1 197 ? -19.417 -26.487 5.619   1.00 120.57 ? 219 GLU A O     1 
ATOM   1165 C CB    . GLU A 1 197 ? -21.891 -24.241 5.790   1.00 121.14 ? 219 GLU A CB    1 
ATOM   1166 C CG    . GLU A 1 197 ? -22.582 -25.522 5.364   1.00 123.03 ? 219 GLU A CG    1 
ATOM   1167 C CD    . GLU A 1 197 ? -23.680 -25.266 4.348   1.00 125.58 ? 219 GLU A CD    1 
ATOM   1168 O OE1   . GLU A 1 197 ? -24.649 -24.554 4.691   1.00 127.08 ? 219 GLU A OE1   1 
ATOM   1169 O OE2   . GLU A 1 197 ? -23.574 -25.773 3.206   1.00 126.72 ? 219 GLU A OE2   1 
ATOM   1170 N N     . VAL A 1 198 ? -19.293 -24.776 4.156   1.00 120.81 ? 220 VAL A N     1 
ATOM   1171 C CA    . VAL A 1 198 ? -18.637 -25.539 3.119   1.00 121.01 ? 220 VAL A CA    1 
ATOM   1172 C C     . VAL A 1 198 ? -17.226 -25.927 3.545   1.00 121.14 ? 220 VAL A C     1 
ATOM   1173 O O     . VAL A 1 198 ? -16.905 -27.110 3.634   1.00 120.90 ? 220 VAL A O     1 
ATOM   1174 C CB    . VAL A 1 198 ? -18.627 -24.746 1.792   1.00 121.02 ? 220 VAL A CB    1 
ATOM   1175 C CG1   . VAL A 1 198 ? -17.815 -25.482 0.717   1.00 121.12 ? 220 VAL A CG1   1 
ATOM   1176 C CG2   . VAL A 1 198 ? -20.070 -24.525 1.305   1.00 121.03 ? 220 VAL A CG2   1 
ATOM   1177 N N     . MET A 1 199 ? -16.397 -24.921 3.823   1.00 121.64 ? 221 MET A N     1 
ATOM   1178 C CA    . MET A 1 199 ? -15.010 -25.140 4.220   1.00 122.23 ? 221 MET A CA    1 
ATOM   1179 C C     . MET A 1 199 ? -14.921 -26.177 5.340   1.00 122.56 ? 221 MET A C     1 
ATOM   1180 O O     . MET A 1 199 ? -14.002 -27.003 5.355   1.00 122.35 ? 221 MET A O     1 
ATOM   1181 C CB    . MET A 1 199 ? -14.363 -23.826 4.676   1.00 122.35 ? 221 MET A CB    1 
ATOM   1182 C CG    . MET A 1 199 ? -14.154 -22.763 3.592   1.00 122.89 ? 221 MET A CG    1 
ATOM   1183 S SD    . MET A 1 199 ? -13.694 -21.170 4.326   1.00 124.44 ? 221 MET A SD    1 
ATOM   1184 C CE    . MET A 1 199 ? -13.402 -20.150 2.892   1.00 125.51 ? 221 MET A CE    1 
ATOM   1185 N N     . TYR A 1 200 ? -15.881 -26.126 6.271   1.00 123.11 ? 222 TYR A N     1 
ATOM   1186 C CA    . TYR A 1 200 ? -15.929 -27.072 7.383   1.00 123.70 ? 222 TYR A CA    1 
ATOM   1187 C C     . TYR A 1 200 ? -16.257 -28.464 6.869   1.00 123.79 ? 222 TYR A C     1 
ATOM   1188 O O     . TYR A 1 200 ? -15.589 -29.437 7.230   1.00 123.68 ? 222 TYR A O     1 
ATOM   1189 C CB    . TYR A 1 200 ? -16.957 -26.634 8.428   1.00 123.91 ? 222 TYR A CB    1 
ATOM   1190 C CG    . TYR A 1 200 ? -16.868 -27.365 9.763   1.00 125.23 ? 222 TYR A CG    1 
ATOM   1191 C CD1   . TYR A 1 200 ? -15.949 -26.972 10.736  1.00 126.57 ? 222 TYR A CD1   1 
ATOM   1192 C CD2   . TYR A 1 200 ? -17.722 -28.432 10.065  1.00 126.59 ? 222 TYR A CD2   1 
ATOM   1193 C CE1   . TYR A 1 200 ? -15.869 -27.627 11.971  1.00 127.77 ? 222 TYR A CE1   1 
ATOM   1194 C CE2   . TYR A 1 200 ? -17.650 -29.094 11.300  1.00 127.69 ? 222 TYR A CE2   1 
ATOM   1195 C CZ    . TYR A 1 200 ? -16.720 -28.685 12.244  1.00 128.10 ? 222 TYR A CZ    1 
ATOM   1196 O OH    . TYR A 1 200 ? -16.636 -29.327 13.460  1.00 128.98 ? 222 TYR A OH    1 
ATOM   1197 N N     . ALA A 1 201 ? -17.282 -28.547 6.019   1.00 124.05 ? 223 ALA A N     1 
ATOM   1198 C CA    . ALA A 1 201 ? -17.677 -29.811 5.408   1.00 124.31 ? 223 ALA A CA    1 
ATOM   1199 C C     . ALA A 1 201 ? -16.447 -30.455 4.779   1.00 124.52 ? 223 ALA A C     1 
ATOM   1200 O O     . ALA A 1 201 ? -16.140 -31.628 5.032   1.00 124.55 ? 223 ALA A O     1 
ATOM   1201 C CB    . ALA A 1 201 ? -18.772 -29.585 4.373   1.00 124.22 ? 223 ALA A CB    1 
ATOM   1202 N N     . GLN A 1 202 ? -15.735 -29.654 3.988   1.00 124.76 ? 224 GLN A N     1 
ATOM   1203 C CA    . GLN A 1 202 ? -14.456 -30.039 3.415   1.00 124.99 ? 224 GLN A CA    1 
ATOM   1204 C C     . GLN A 1 202 ? -13.519 -30.552 4.502   1.00 125.08 ? 224 GLN A C     1 
ATOM   1205 O O     . GLN A 1 202 ? -13.109 -31.717 4.489   1.00 124.92 ? 224 GLN A O     1 
ATOM   1206 C CB    . GLN A 1 202 ? -13.826 -28.833 2.717   1.00 125.06 ? 224 GLN A CB    1 
ATOM   1207 C CG    . GLN A 1 202 ? -14.500 -28.417 1.418   1.00 125.16 ? 224 GLN A CG    1 
ATOM   1208 C CD    . GLN A 1 202 ? -13.799 -28.980 0.179   1.00 125.32 ? 224 GLN A CD    1 
ATOM   1209 O OE1   . GLN A 1 202 ? -12.645 -28.637 -0.119  1.00 125.15 ? 224 GLN A OE1   1 
ATOM   1210 N NE2   . GLN A 1 202 ? -14.505 -29.840 -0.557  1.00 125.71 ? 224 GLN A NE2   1 
ATOM   1211 N N     . CYS A 1 203 ? -13.209 -29.675 5.452   1.00 125.43 ? 225 CYS A N     1 
ATOM   1212 C CA    . CYS A 1 203 ? -12.288 -29.988 6.535   1.00 126.00 ? 225 CYS A CA    1 
ATOM   1213 C C     . CYS A 1 203 ? -12.626 -31.311 7.220   1.00 126.57 ? 225 CYS A C     1 
ATOM   1214 O O     . CYS A 1 203 ? -11.722 -32.067 7.604   1.00 126.56 ? 225 CYS A O     1 
ATOM   1215 C CB    . CYS A 1 203 ? -12.301 -28.849 7.549   1.00 125.89 ? 225 CYS A CB    1 
ATOM   1216 S SG    . CYS A 1 203 ? -11.260 -29.105 8.978   1.00 125.38 ? 225 CYS A SG    1 
ATOM   1217 N N     . MET A 1 204 ? -13.930 -31.576 7.354   1.00 127.22 ? 226 MET A N     1 
ATOM   1218 C CA    . MET A 1 204 ? -14.440 -32.788 7.995   1.00 127.89 ? 226 MET A CA    1 
ATOM   1219 C C     . MET A 1 204 ? -14.243 -34.009 7.122   1.00 128.26 ? 226 MET A C     1 
ATOM   1220 O O     . MET A 1 204 ? -13.805 -35.061 7.594   1.00 128.28 ? 226 MET A O     1 
ATOM   1221 C CB    . MET A 1 204 ? -15.923 -32.638 8.330   1.00 127.95 ? 226 MET A CB    1 
ATOM   1222 C CG    . MET A 1 204 ? -16.221 -31.814 9.572   1.00 128.50 ? 226 MET A CG    1 
ATOM   1223 S SD    . MET A 1 204 ? -15.484 -32.459 11.103  1.00 129.52 ? 226 MET A SD    1 
ATOM   1224 C CE    . MET A 1 204 ? -13.934 -31.531 11.161  1.00 129.88 ? 226 MET A CE    1 
ATOM   1225 N N     . GLU A 1 205 ? -14.581 -33.865 5.846   1.00 128.80 ? 227 GLU A N     1 
ATOM   1226 C CA    . GLU A 1 205 ? -14.351 -34.919 4.886   1.00 129.46 ? 227 GLU A CA    1 
ATOM   1227 C C     . GLU A 1 205 ? -12.868 -35.235 4.910   1.00 129.54 ? 227 GLU A C     1 
ATOM   1228 O O     . GLU A 1 205 ? -12.467 -36.398 5.013   1.00 129.57 ? 227 GLU A O     1 
ATOM   1229 C CB    . GLU A 1 205 ? -14.775 -34.447 3.502   1.00 129.65 ? 227 GLU A CB    1 
ATOM   1230 C CG    . GLU A 1 205 ? -14.929 -35.560 2.485   1.00 131.14 ? 227 GLU A CG    1 
ATOM   1231 C CD    . GLU A 1 205 ? -15.705 -35.117 1.245   1.00 133.11 ? 227 GLU A CD    1 
ATOM   1232 O OE1   . GLU A 1 205 ? -15.280 -35.487 0.120   1.00 133.89 ? 227 GLU A OE1   1 
ATOM   1233 O OE2   . GLU A 1 205 ? -16.738 -34.396 1.394   1.00 133.96 ? 227 GLU A OE2   1 
ATOM   1234 N N     . VAL A 1 206 ? -12.069 -34.172 4.854   1.00 129.78 ? 228 VAL A N     1 
ATOM   1235 C CA    . VAL A 1 206 ? -10.619 -34.254 4.863   1.00 130.06 ? 228 VAL A CA    1 
ATOM   1236 C C     . VAL A 1 206 ? -10.120 -35.173 5.961   1.00 130.23 ? 228 VAL A C     1 
ATOM   1237 O O     . VAL A 1 206 ? -9.353  -36.107 5.705   1.00 130.23 ? 228 VAL A O     1 
ATOM   1238 C CB    . VAL A 1 206 ? -9.995  -32.848 5.012   1.00 130.04 ? 228 VAL A CB    1 
ATOM   1239 C CG1   . VAL A 1 206 ? -8.629  -32.924 5.656   1.00 130.18 ? 228 VAL A CG1   1 
ATOM   1240 C CG2   . VAL A 1 206 ? -9.904  -32.174 3.641   1.00 130.41 ? 228 VAL A CG2   1 
ATOM   1241 N N     . GLY A 1 207 ? -10.570 -34.908 7.182   1.00 130.55 ? 229 GLY A N     1 
ATOM   1242 C CA    . GLY A 1 207 ? -10.187 -35.733 8.310   1.00 131.10 ? 229 GLY A CA    1 
ATOM   1243 C C     . GLY A 1 207 ? -9.367  -35.013 9.362   1.00 131.42 ? 229 GLY A C     1 
ATOM   1244 O O     . GLY A 1 207 ? -8.560  -34.123 9.053   1.00 131.49 ? 229 GLY A O     1 
ATOM   1245 N N     . LYS A 1 208 ? -9.577  -35.439 10.608  1.00 131.65 ? 230 LYS A N     1 
ATOM   1246 C CA    . LYS A 1 208 ? -8.946  -34.872 11.800  1.00 131.86 ? 230 LYS A CA    1 
ATOM   1247 C C     . LYS A 1 208 ? -7.430  -34.873 11.662  1.00 131.50 ? 230 LYS A C     1 
ATOM   1248 O O     . LYS A 1 208 ? -6.740  -34.035 12.243  1.00 131.50 ? 230 LYS A O     1 
ATOM   1249 C CB    . LYS A 1 208 ? -9.384  -35.662 13.052  1.00 132.21 ? 230 LYS A CB    1 
ATOM   1250 C CG    . LYS A 1 208 ? -10.921 -35.889 13.159  1.00 133.87 ? 230 LYS A CG    1 
ATOM   1251 C CD    . LYS A 1 208 ? -11.352 -36.810 14.321  1.00 136.41 ? 230 LYS A CD    1 
ATOM   1252 C CE    . LYS A 1 208 ? -12.301 -36.123 15.325  1.00 137.46 ? 230 LYS A CE    1 
ATOM   1253 N NZ    . LYS A 1 208 ? -11.588 -35.389 16.415  1.00 138.68 ? 230 LYS A NZ    1 
ATOM   1254 N N     . GLU A 1 209 ? -6.937  -35.808 10.856  1.00 131.16 ? 231 GLU A N     1 
ATOM   1255 C CA    . GLU A 1 209 ? -5.519  -36.031 10.659  1.00 130.90 ? 231 GLU A CA    1 
ATOM   1256 C C     . GLU A 1 209 ? -4.852  -34.958 9.807   1.00 130.01 ? 231 GLU A C     1 
ATOM   1257 O O     . GLU A 1 209 ? -3.671  -34.654 9.996   1.00 130.01 ? 231 GLU A O     1 
ATOM   1258 C CB    . GLU A 1 209 ? -5.337  -37.377 9.989   1.00 131.34 ? 231 GLU A CB    1 
ATOM   1259 C CG    . GLU A 1 209 ? -3.960  -37.954 10.148  1.00 133.85 ? 231 GLU A CG    1 
ATOM   1260 C CD    . GLU A 1 209 ? -3.957  -39.436 9.893   1.00 137.15 ? 231 GLU A CD    1 
ATOM   1261 O OE1   . GLU A 1 209 ? -3.179  -39.880 9.013   1.00 138.34 ? 231 GLU A OE1   1 
ATOM   1262 O OE2   . GLU A 1 209 ? -4.750  -40.149 10.561  1.00 138.48 ? 231 GLU A OE2   1 
ATOM   1263 N N     . LYS A 1 210 ? -5.601  -34.395 8.864   1.00 128.91 ? 232 LYS A N     1 
ATOM   1264 C CA    . LYS A 1 210 ? -5.033  -33.415 7.944   1.00 127.91 ? 232 LYS A CA    1 
ATOM   1265 C C     . LYS A 1 210 ? -5.557  -31.993 8.169   1.00 126.99 ? 232 LYS A C     1 
ATOM   1266 O O     . LYS A 1 210 ? -4.879  -31.012 7.838   1.00 126.76 ? 232 LYS A O     1 
ATOM   1267 C CB    . LYS A 1 210 ? -5.248  -33.861 6.489   1.00 128.13 ? 232 LYS A CB    1 
ATOM   1268 C CG    . LYS A 1 210 ? -4.313  -34.979 6.015   1.00 128.45 ? 232 LYS A CG    1 
ATOM   1269 C CD    . LYS A 1 210 ? -4.754  -35.484 4.646   1.00 129.33 ? 232 LYS A CD    1 
ATOM   1270 C CE    . LYS A 1 210 ? -3.694  -36.321 3.971   1.00 129.74 ? 232 LYS A CE    1 
ATOM   1271 N NZ    . LYS A 1 210 ? -2.567  -35.462 3.458   1.00 129.72 ? 232 LYS A NZ    1 
ATOM   1272 N N     . CYS A 1 211 ? -6.752  -31.887 8.742   1.00 125.96 ? 233 CYS A N     1 
ATOM   1273 C CA    . CYS A 1 211 ? -7.362  -30.588 8.985   1.00 125.05 ? 233 CYS A CA    1 
ATOM   1274 C C     . CYS A 1 211 ? -7.623  -30.347 10.457  1.00 124.28 ? 233 CYS A C     1 
ATOM   1275 O O     . CYS A 1 211 ? -8.155  -31.212 11.166  1.00 123.99 ? 233 CYS A O     1 
ATOM   1276 C CB    . CYS A 1 211 ? -8.671  -30.441 8.206   1.00 125.23 ? 233 CYS A CB    1 
ATOM   1277 S SG    . CYS A 1 211 ? -9.373  -28.778 8.287   1.00 125.71 ? 233 CYS A SG    1 
ATOM   1278 N N     . LEU A 1 212 ? -7.258  -29.149 10.898  1.00 123.58 ? 234 LEU A N     1 
ATOM   1279 C CA    . LEU A 1 212 ? -7.422  -28.760 12.284  1.00 123.04 ? 234 LEU A CA    1 
ATOM   1280 C C     . LEU A 1 212 ? -8.160  -27.440 12.356  1.00 122.47 ? 234 LEU A C     1 
ATOM   1281 O O     . LEU A 1 212 ? -7.697  -26.437 11.813  1.00 122.51 ? 234 LEU A O     1 
ATOM   1282 C CB    . LEU A 1 212 ? -6.064  -28.597 12.951  1.00 123.18 ? 234 LEU A CB    1 
ATOM   1283 C CG    . LEU A 1 212 ? -5.882  -28.723 14.467  1.00 123.55 ? 234 LEU A CG    1 
ATOM   1284 C CD1   . LEU A 1 212 ? -4.853  -27.696 14.906  1.00 123.79 ? 234 LEU A CD1   1 
ATOM   1285 C CD2   . LEU A 1 212 ? -7.164  -28.563 15.294  1.00 124.18 ? 234 LEU A CD2   1 
ATOM   1286 N N     . PRO A 1 213 ? -9.315  -27.436 13.028  1.00 121.91 ? 235 PRO A N     1 
ATOM   1287 C CA    . PRO A 1 213 ? -10.071 -26.205 13.205  1.00 121.57 ? 235 PRO A CA    1 
ATOM   1288 C C     . PRO A 1 213 ? -9.401  -25.351 14.254  1.00 121.17 ? 235 PRO A C     1 
ATOM   1289 O O     . PRO A 1 213 ? -8.909  -25.878 15.253  1.00 121.03 ? 235 PRO A O     1 
ATOM   1290 C CB    . PRO A 1 213 ? -11.426 -26.692 13.722  1.00 121.72 ? 235 PRO A CB    1 
ATOM   1291 C CG    . PRO A 1 213 ? -11.435 -28.196 13.515  1.00 121.93 ? 235 PRO A CG    1 
ATOM   1292 C CD    . PRO A 1 213 ? -10.021 -28.618 13.590  1.00 121.83 ? 235 PRO A CD    1 
ATOM   1293 N N     . VAL A 1 214 ? -9.384  -24.037 14.025  1.00 120.86 ? 236 VAL A N     1 
ATOM   1294 C CA    . VAL A 1 214 ? -8.619  -23.148 14.882  1.00 120.68 ? 236 VAL A CA    1 
ATOM   1295 C C     . VAL A 1 214 ? -9.435  -21.936 15.303  1.00 120.56 ? 236 VAL A C     1 
ATOM   1296 O O     . VAL A 1 214 ? -9.691  -21.026 14.518  1.00 120.29 ? 236 VAL A O     1 
ATOM   1297 C CB    . VAL A 1 214 ? -7.297  -22.721 14.207  1.00 120.72 ? 236 VAL A CB    1 
ATOM   1298 C CG1   . VAL A 1 214 ? -6.466  -21.868 15.160  1.00 120.90 ? 236 VAL A CG1   1 
ATOM   1299 C CG2   . VAL A 1 214 ? -6.495  -23.951 13.764  1.00 120.60 ? 236 VAL A CG2   1 
ATOM   1300 N N     . TYR A 1 215 ? -9.824  -21.935 16.569  1.00 120.77 ? 237 TYR A N     1 
ATOM   1301 C CA    . TYR A 1 215 ? -10.715 -20.913 17.086  1.00 120.99 ? 237 TYR A CA    1 
ATOM   1302 C C     . TYR A 1 215 ? -9.971  -19.647 17.455  1.00 120.47 ? 237 TYR A C     1 
ATOM   1303 O O     . TYR A 1 215 ? -9.236  -19.610 18.439  1.00 120.44 ? 237 TYR A O     1 
ATOM   1304 C CB    . TYR A 1 215 ? -11.551 -21.459 18.251  1.00 121.38 ? 237 TYR A CB    1 
ATOM   1305 C CG    . TYR A 1 215 ? -12.528 -22.511 17.784  1.00 123.07 ? 237 TYR A CG    1 
ATOM   1306 C CD1   . TYR A 1 215 ? -13.767 -22.144 17.231  1.00 124.88 ? 237 TYR A CD1   1 
ATOM   1307 C CD2   . TYR A 1 215 ? -12.197 -23.869 17.851  1.00 124.85 ? 237 TYR A CD2   1 
ATOM   1308 C CE1   . TYR A 1 215 ? -14.659 -23.102 16.781  1.00 126.41 ? 237 TYR A CE1   1 
ATOM   1309 C CE2   . TYR A 1 215 ? -13.082 -24.834 17.399  1.00 126.38 ? 237 TYR A CE2   1 
ATOM   1310 C CZ    . TYR A 1 215 ? -14.308 -24.442 16.866  1.00 126.88 ? 237 TYR A CZ    1 
ATOM   1311 O OH    . TYR A 1 215 ? -15.189 -25.394 16.421  1.00 128.12 ? 237 TYR A OH    1 
ATOM   1312 N N     . TYR A 1 216 ? -10.174 -18.620 16.634  1.00 119.92 ? 238 TYR A N     1 
ATOM   1313 C CA    . TYR A 1 216 ? -9.558  -17.320 16.818  1.00 119.65 ? 238 TYR A CA    1 
ATOM   1314 C C     . TYR A 1 216 ? -9.572  -16.843 18.252  1.00 120.01 ? 238 TYR A C     1 
ATOM   1315 O O     . TYR A 1 216 ? -8.564  -16.359 18.753  1.00 120.21 ? 238 TYR A O     1 
ATOM   1316 C CB    . TYR A 1 216 ? -10.263 -16.284 15.964  1.00 119.38 ? 238 TYR A CB    1 
ATOM   1317 C CG    . TYR A 1 216 ? -9.856  -14.862 16.266  1.00 118.66 ? 238 TYR A CG    1 
ATOM   1318 C CD1   . TYR A 1 216 ? -8.747  -14.289 15.646  1.00 118.58 ? 238 TYR A CD1   1 
ATOM   1319 C CD2   . TYR A 1 216 ? -10.587 -14.085 17.155  1.00 118.27 ? 238 TYR A CD2   1 
ATOM   1320 C CE1   . TYR A 1 216 ? -8.376  -12.981 15.907  1.00 118.29 ? 238 TYR A CE1   1 
ATOM   1321 C CE2   . TYR A 1 216 ? -10.222 -12.779 17.426  1.00 118.18 ? 238 TYR A CE2   1 
ATOM   1322 C CZ    . TYR A 1 216 ? -9.117  -12.234 16.798  1.00 118.09 ? 238 TYR A CZ    1 
ATOM   1323 O OH    . TYR A 1 216 ? -8.751  -10.939 17.067  1.00 118.35 ? 238 TYR A OH    1 
ATOM   1324 N N     . GLU A 1 217 ? -10.721 -16.949 18.909  1.00 120.52 ? 239 GLU A N     1 
ATOM   1325 C CA    . GLU A 1 217 ? -10.835 -16.445 20.274  1.00 120.87 ? 239 GLU A CA    1 
ATOM   1326 C C     . GLU A 1 217 ? -10.106 -17.330 21.270  1.00 121.15 ? 239 GLU A C     1 
ATOM   1327 O O     . GLU A 1 217 ? -9.544  -16.824 22.239  1.00 121.20 ? 239 GLU A O     1 
ATOM   1328 C CB    . GLU A 1 217 ? -12.287 -16.146 20.692  1.00 120.77 ? 239 GLU A CB    1 
ATOM   1329 C CG    . GLU A 1 217 ? -13.341 -17.162 20.260  1.00 120.74 ? 239 GLU A CG    1 
ATOM   1330 C CD    . GLU A 1 217 ? -13.826 -16.952 18.814  1.00 120.28 ? 239 GLU A CD    1 
ATOM   1331 O OE1   . GLU A 1 217 ? -13.777 -17.936 18.023  1.00 120.31 ? 239 GLU A OE1   1 
ATOM   1332 O OE2   . GLU A 1 217 ? -14.250 -15.817 18.468  1.00 119.93 ? 239 GLU A OE2   1 
ATOM   1333 N N     . GLN A 1 218 ? -10.089 -18.640 21.005  1.00 121.58 ? 240 GLN A N     1 
ATOM   1334 C CA    . GLN A 1 218 ? -9.264  -19.582 21.773  1.00 122.18 ? 240 GLN A CA    1 
ATOM   1335 C C     . GLN A 1 218 ? -7.787  -19.242 21.633  1.00 122.27 ? 240 GLN A C     1 
ATOM   1336 O O     . GLN A 1 218 ? -7.006  -19.386 22.576  1.00 122.26 ? 240 GLN A O     1 
ATOM   1337 C CB    . GLN A 1 218 ? -9.497  -21.030 21.319  1.00 122.28 ? 240 GLN A CB    1 
ATOM   1338 C CG    . GLN A 1 218 ? -10.786 -21.640 21.816  1.00 123.45 ? 240 GLN A CG    1 
ATOM   1339 C CD    . GLN A 1 218 ? -11.129 -21.209 23.251  1.00 125.27 ? 240 GLN A CD    1 
ATOM   1340 O OE1   . GLN A 1 218 ? -12.136 -20.514 23.484  1.00 126.61 ? 240 GLN A OE1   1 
ATOM   1341 N NE2   . GLN A 1 218 ? -10.283 -21.582 24.221  1.00 125.60 ? 240 GLN A NE2   1 
ATOM   1342 N N     . LEU A 1 219 ? -7.422  -18.792 20.439  1.00 122.44 ? 241 LEU A N     1 
ATOM   1343 C CA    . LEU A 1 219 ? -6.064  -18.404 20.126  1.00 122.59 ? 241 LEU A CA    1 
ATOM   1344 C C     . LEU A 1 219 ? -5.693  -17.106 20.840  1.00 122.57 ? 241 LEU A C     1 
ATOM   1345 O O     . LEU A 1 219 ? -4.645  -17.040 21.489  1.00 122.65 ? 241 LEU A O     1 
ATOM   1346 C CB    . LEU A 1 219 ? -5.923  -18.231 18.613  1.00 122.82 ? 241 LEU A CB    1 
ATOM   1347 C CG    . LEU A 1 219 ? -4.613  -18.397 17.828  1.00 123.34 ? 241 LEU A CG    1 
ATOM   1348 C CD1   . LEU A 1 219 ? -4.656  -17.468 16.619  1.00 123.85 ? 241 LEU A CD1   1 
ATOM   1349 C CD2   . LEU A 1 219 ? -3.354  -18.137 18.640  1.00 124.01 ? 241 LEU A CD2   1 
ATOM   1350 N N     . VAL A 1 220 ? -6.546  -16.084 20.724  1.00 122.58 ? 242 VAL A N     1 
ATOM   1351 C CA    . VAL A 1 220 ? -6.264  -14.760 21.304  1.00 122.74 ? 242 VAL A CA    1 
ATOM   1352 C C     . VAL A 1 220 ? -6.103  -14.827 22.823  1.00 122.95 ? 242 VAL A C     1 
ATOM   1353 O O     . VAL A 1 220 ? -5.204  -14.200 23.391  1.00 122.96 ? 242 VAL A O     1 
ATOM   1354 C CB    . VAL A 1 220 ? -7.341  -13.704 20.921  1.00 122.66 ? 242 VAL A CB    1 
ATOM   1355 C CG1   . VAL A 1 220 ? -7.236  -12.463 21.807  1.00 122.62 ? 242 VAL A CG1   1 
ATOM   1356 C CG2   . VAL A 1 220 ? -7.195  -13.305 19.466  1.00 122.58 ? 242 VAL A CG2   1 
ATOM   1357 N N     . LEU A 1 221 ? -6.970  -15.612 23.460  1.00 123.17 ? 243 LEU A N     1 
ATOM   1358 C CA    . LEU A 1 221 ? -6.925  -15.832 24.902  1.00 123.37 ? 243 LEU A CA    1 
ATOM   1359 C C     . LEU A 1 221 ? -5.757  -16.714 25.357  1.00 123.52 ? 243 LEU A C     1 
ATOM   1360 O O     . LEU A 1 221 ? -5.005  -16.321 26.244  1.00 123.38 ? 243 LEU A O     1 
ATOM   1361 C CB    . LEU A 1 221 ? -8.244  -16.445 25.387  1.00 123.42 ? 243 LEU A CB    1 
ATOM   1362 C CG    . LEU A 1 221 ? -9.533  -15.617 25.303  1.00 123.45 ? 243 LEU A CG    1 
ATOM   1363 C CD1   . LEU A 1 221 ? -10.745 -16.518 25.515  1.00 123.54 ? 243 LEU A CD1   1 
ATOM   1364 C CD2   . LEU A 1 221 ? -9.539  -14.471 26.307  1.00 123.38 ? 243 LEU A CD2   1 
ATOM   1365 N N     . HIS A 1 222 ? -5.621  -17.902 24.760  1.00 123.87 ? 244 HIS A N     1 
ATOM   1366 C CA    . HIS A 1 222 ? -4.595  -18.872 25.169  1.00 124.23 ? 244 HIS A CA    1 
ATOM   1367 C C     . HIS A 1 222 ? -3.599  -19.177 24.044  1.00 124.45 ? 244 HIS A C     1 
ATOM   1368 O O     . HIS A 1 222 ? -3.511  -20.327 23.581  1.00 124.39 ? 244 HIS A O     1 
ATOM   1369 C CB    . HIS A 1 222 ? -5.238  -20.179 25.656  1.00 124.27 ? 244 HIS A CB    1 
ATOM   1370 C CG    . HIS A 1 222 ? -6.435  -19.984 26.536  1.00 124.83 ? 244 HIS A CG    1 
ATOM   1371 N ND1   . HIS A 1 222 ? -6.335  -19.728 27.887  1.00 125.18 ? 244 HIS A ND1   1 
ATOM   1372 C CD2   . HIS A 1 222 ? -7.761  -20.022 26.257  1.00 125.26 ? 244 HIS A CD2   1 
ATOM   1373 C CE1   . HIS A 1 222 ? -7.548  -19.609 28.401  1.00 125.45 ? 244 HIS A CE1   1 
ATOM   1374 N NE2   . HIS A 1 222 ? -8.431  -19.783 27.434  1.00 125.41 ? 244 HIS A NE2   1 
ATOM   1375 N N     . PRO A 1 223 ? -2.829  -18.155 23.610  1.00 124.75 ? 245 PRO A N     1 
ATOM   1376 C CA    . PRO A 1 223 ? -1.952  -18.389 22.476  1.00 125.15 ? 245 PRO A CA    1 
ATOM   1377 C C     . PRO A 1 223 ? -0.963  -19.527 22.736  1.00 125.65 ? 245 PRO A C     1 
ATOM   1378 O O     . PRO A 1 223 ? -0.746  -20.377 21.847  1.00 125.71 ? 245 PRO A O     1 
ATOM   1379 C CB    . PRO A 1 223 ? -1.236  -17.042 22.297  1.00 125.11 ? 245 PRO A CB    1 
ATOM   1380 C CG    . PRO A 1 223 ? -1.362  -16.352 23.586  1.00 124.86 ? 245 PRO A CG    1 
ATOM   1381 C CD    . PRO A 1 223 ? -2.637  -16.804 24.188  1.00 124.71 ? 245 PRO A CD    1 
ATOM   1382 N N     . ARG A 1 224 ? -0.407  -19.558 23.956  1.00 126.21 ? 246 ARG A N     1 
ATOM   1383 C CA    . ARG A 1 224 ? 0.607   -20.542 24.311  1.00 126.86 ? 246 ARG A CA    1 
ATOM   1384 C C     . ARG A 1 224 ? 0.083   -21.975 24.178  1.00 126.74 ? 246 ARG A C     1 
ATOM   1385 O O     . ARG A 1 224 ? 0.693   -22.806 23.497  1.00 126.76 ? 246 ARG A O     1 
ATOM   1386 C CB    . ARG A 1 224 ? 1.175   -20.269 25.712  1.00 127.21 ? 246 ARG A CB    1 
ATOM   1387 C CG    . ARG A 1 224 ? 2.407   -21.111 26.011  1.00 129.17 ? 246 ARG A CG    1 
ATOM   1388 C CD    . ARG A 1 224 ? 3.245   -20.628 27.202  1.00 131.88 ? 246 ARG A CD    1 
ATOM   1389 N NE    . ARG A 1 224 ? 4.437   -21.473 27.324  1.00 134.17 ? 246 ARG A NE    1 
ATOM   1390 C CZ    . ARG A 1 224 ? 5.626   -21.195 26.750  1.00 135.42 ? 246 ARG A CZ    1 
ATOM   1391 N NH1   . ARG A 1 224 ? 5.819   -20.068 26.026  1.00 136.08 ? 246 ARG A NH1   1 
ATOM   1392 N NH2   . ARG A 1 224 ? 6.632   -22.045 26.911  1.00 136.39 ? 246 ARG A NH2   1 
ATOM   1393 N N     . ARG A 1 225 ? -1.048  -22.252 24.819  1.00 126.71 ? 247 ARG A N     1 
ATOM   1394 C CA    A ARG A 1 225 ? -1.655  -23.566 24.706  0.50 126.75 ? 247 ARG A CA    1 
ATOM   1395 C CA    B ARG A 1 225 ? -1.695  -23.549 24.712  0.50 126.77 ? 247 ARG A CA    1 
ATOM   1396 C C     . ARG A 1 225 ? -1.958  -23.842 23.238  1.00 126.64 ? 247 ARG A C     1 
ATOM   1397 O O     . ARG A 1 225 ? -1.586  -24.901 22.719  1.00 126.69 ? 247 ARG A O     1 
ATOM   1398 C CB    A ARG A 1 225 ? -2.917  -23.671 25.571  0.50 126.90 ? 247 ARG A CB    1 
ATOM   1399 C CB    B ARG A 1 225 ? -3.011  -23.536 25.499  0.50 126.93 ? 247 ARG A CB    1 
ATOM   1400 C CG    A ARG A 1 225 ? -3.615  -25.038 25.526  0.50 127.52 ? 247 ARG A CG    1 
ATOM   1401 C CG    B ARG A 1 225 ? -3.735  -24.900 25.566  0.50 127.65 ? 247 ARG A CG    1 
ATOM   1402 C CD    A ARG A 1 225 ? -2.624  -26.198 25.634  0.50 128.54 ? 247 ARG A CD    1 
ATOM   1403 C CD    B ARG A 1 225 ? -5.148  -24.730 26.138  0.50 128.78 ? 247 ARG A CD    1 
ATOM   1404 N NE    A ARG A 1 225 ? -3.252  -27.487 25.327  0.50 129.00 ? 247 ARG A NE    1 
ATOM   1405 N NE    B ARG A 1 225 ? -5.138  -23.925 27.381  0.50 129.58 ? 247 ARG A NE    1 
ATOM   1406 C CZ    A ARG A 1 225 ? -3.404  -28.478 26.205  0.50 129.10 ? 247 ARG A CZ    1 
ATOM   1407 C CZ    B ARG A 1 225 ? -6.287  -23.574 28.035  0.50 129.94 ? 247 ARG A CZ    1 
ATOM   1408 N NH1   A ARG A 1 225 ? -2.959  -28.337 27.449  0.50 129.18 ? 247 ARG A NH1   1 
ATOM   1409 N NH1   B ARG A 1 225 ? -7.551  -23.658 27.567  0.50 130.04 ? 247 ARG A NH1   1 
ATOM   1410 N NH2   A ARG A 1 225 ? -3.990  -29.614 25.837  0.50 129.02 ? 247 ARG A NH2   1 
ATOM   1411 N NH2   B ARG A 1 225 ? -6.171  -22.835 29.158  0.50 130.21 ? 247 ARG A NH2   1 
ATOM   1412 N N     . SER A 1 226 ? -2.593  -22.874 22.576  1.00 126.33 ? 248 SER A N     1 
ATOM   1413 C CA    . SER A 1 226 ? -3.015  -23.010 21.191  1.00 125.92 ? 248 SER A CA    1 
ATOM   1414 C C     . SER A 1 226 ? -1.903  -23.508 20.294  1.00 125.75 ? 248 SER A C     1 
ATOM   1415 O O     . SER A 1 226 ? -1.947  -24.641 19.794  1.00 125.63 ? 248 SER A O     1 
ATOM   1416 C CB    . SER A 1 226 ? -3.570  -21.681 20.662  1.00 125.90 ? 248 SER A CB    1 
ATOM   1417 O OG    . SER A 1 226 ? -4.689  -21.248 21.418  1.00 125.73 ? 248 SER A OG    1 
ATOM   1418 N N     . LEU A 1 227 ? -0.888  -22.664 20.116  1.00 125.62 ? 249 LEU A N     1 
ATOM   1419 C CA    . LEU A 1 227 ? 0.146   -22.949 19.149  1.00 125.68 ? 249 LEU A CA    1 
ATOM   1420 C C     . LEU A 1 227 ? 0.748   -24.314 19.367  1.00 125.90 ? 249 LEU A C     1 
ATOM   1421 O O     . LEU A 1 227 ? 0.926   -25.091 18.390  1.00 125.84 ? 249 LEU A O     1 
ATOM   1422 C CB    . LEU A 1 227 ? 1.213   -21.867 19.184  1.00 125.53 ? 249 LEU A CB    1 
ATOM   1423 C CG    . LEU A 1 227 ? 0.977   -20.745 18.167  1.00 125.38 ? 249 LEU A CG    1 
ATOM   1424 C CD1   . LEU A 1 227 ? 0.793   -21.297 16.735  1.00 125.35 ? 249 LEU A CD1   1 
ATOM   1425 C CD2   . LEU A 1 227 ? -0.210  -19.871 18.559  1.00 125.21 ? 249 LEU A CD2   1 
ATOM   1426 N N     . LYS A 1 228 ? 1.024   -24.607 20.653  1.00 126.31 ? 250 LYS A N     1 
ATOM   1427 C CA    . LYS A 1 228 ? 1.533   -25.911 21.042  1.00 126.85 ? 250 LYS A CA    1 
ATOM   1428 C C     . LYS A 1 228 ? 0.822   -27.016 20.265  1.00 126.79 ? 250 LYS A C     1 
ATOM   1429 O O     . LYS A 1 228 ? 1.447   -27.734 19.472  1.00 126.81 ? 250 LYS A O     1 
ATOM   1430 C CB    . LYS A 1 228 ? 1.367   -26.125 22.555  1.00 127.14 ? 250 LYS A CB    1 
ATOM   1431 C CG    . LYS A 1 228 ? 2.464   -25.480 23.409  1.00 128.52 ? 250 LYS A CG    1 
ATOM   1432 C CD    . LYS A 1 228 ? 2.308   -25.868 24.879  1.00 131.15 ? 250 LYS A CD    1 
ATOM   1433 C CE    . LYS A 1 228 ? 3.453   -25.302 25.733  1.00 132.73 ? 250 LYS A CE    1 
ATOM   1434 N NZ    . LYS A 1 228 ? 4.801   -25.885 25.415  1.00 134.10 ? 250 LYS A NZ    1 
ATOM   1435 N N     . LEU A 1 229 ? -0.495  -27.121 20.471  1.00 126.73 ? 251 LEU A N     1 
ATOM   1436 C CA    . LEU A 1 229 ? -1.286  -28.192 19.870  1.00 126.59 ? 251 LEU A CA    1 
ATOM   1437 C C     . LEU A 1 229 ? -1.236  -28.100 18.349  1.00 126.20 ? 251 LEU A C     1 
ATOM   1438 O O     . LEU A 1 229 ? -1.177  -29.124 17.656  1.00 126.11 ? 251 LEU A O     1 
ATOM   1439 C CB    . LEU A 1 229 ? -2.743  -28.129 20.368  1.00 126.83 ? 251 LEU A CB    1 
ATOM   1440 C CG    . LEU A 1 229 ? -2.942  -28.110 21.901  1.00 127.68 ? 251 LEU A CG    1 
ATOM   1441 C CD1   . LEU A 1 229 ? -4.398  -27.775 22.255  1.00 128.75 ? 251 LEU A CD1   1 
ATOM   1442 C CD2   . LEU A 1 229 ? -2.643  -29.428 22.636  1.00 128.32 ? 251 LEU A CD2   1 
ATOM   1443 N N     . ILE A 1 230 ? -1.243  -26.857 17.847  1.00 125.81 ? 252 ILE A N     1 
ATOM   1444 C CA    . ILE A 1 230 ? -1.253  -26.586 16.418  1.00 125.46 ? 252 ILE A CA    1 
ATOM   1445 C C     . ILE A 1 230 ? -0.060  -27.250 15.777  1.00 125.49 ? 252 ILE A C     1 
ATOM   1446 O O     . ILE A 1 230 ? -0.191  -28.150 14.944  1.00 125.27 ? 252 ILE A O     1 
ATOM   1447 C CB    . ILE A 1 230 ? -1.214  -25.064 16.146  1.00 125.30 ? 252 ILE A CB    1 
ATOM   1448 C CG1   . ILE A 1 230 ? -2.582  -24.427 16.479  1.00 124.74 ? 252 ILE A CG1   1 
ATOM   1449 C CG2   . ILE A 1 230 ? -0.842  -24.798 14.686  1.00 125.11 ? 252 ILE A CG2   1 
ATOM   1450 C CD1   . ILE A 1 230 ? -2.546  -22.916 16.692  1.00 123.55 ? 252 ILE A CD1   1 
ATOM   1451 N N     . LEU A 1 231 ? 1.111   -26.813 16.206  1.00 125.65 ? 253 LEU A N     1 
ATOM   1452 C CA    . LEU A 1 231 ? 2.334   -27.326 15.658  1.00 125.93 ? 253 LEU A CA    1 
ATOM   1453 C C     . LEU A 1 231 ? 2.406   -28.825 15.910  1.00 126.27 ? 253 LEU A C     1 
ATOM   1454 O O     . LEU A 1 231 ? 3.019   -29.544 15.128  1.00 126.20 ? 253 LEU A O     1 
ATOM   1455 C CB    . LEU A 1 231 ? 3.516   -26.585 16.278  1.00 125.90 ? 253 LEU A CB    1 
ATOM   1456 C CG    . LEU A 1 231 ? 3.315   -25.016 16.220  1.00 125.78 ? 253 LEU A CG    1 
ATOM   1457 C CD1   . LEU A 1 231 ? 4.238   -24.285 17.319  1.00 126.12 ? 253 LEU A CD1   1 
ATOM   1458 C CD2   . LEU A 1 231 ? 3.831   -24.453 14.840  1.00 125.98 ? 253 LEU A CD2   1 
ATOM   1459 N N     . ASP A 1 232 ? 1.754   -29.291 16.980  1.00 126.76 ? 254 ASP A N     1 
ATOM   1460 C CA    . ASP A 1 232 ? 1.752   -30.722 17.322  1.00 127.26 ? 254 ASP A CA    1 
ATOM   1461 C C     . ASP A 1 232 ? 0.984   -31.485 16.263  1.00 127.00 ? 254 ASP A C     1 
ATOM   1462 O O     . ASP A 1 232 ? 1.476   -32.472 15.695  1.00 126.93 ? 254 ASP A O     1 
ATOM   1463 C CB    . ASP A 1 232 ? 1.129   -30.996 18.705  1.00 127.68 ? 254 ASP A CB    1 
ATOM   1464 C CG    . ASP A 1 232 ? 1.402   -32.422 19.185  1.00 129.14 ? 254 ASP A CG    1 
ATOM   1465 O OD1   . ASP A 1 232 ? 0.869   -33.386 18.587  1.00 130.66 ? 254 ASP A OD1   1 
ATOM   1466 O OD2   . ASP A 1 232 ? 2.161   -32.579 20.169  1.00 131.40 ? 254 ASP A OD2   1 
ATOM   1467 N N     . PHE A 1 233 ? -0.228  -31.014 16.006  1.00 126.80 ? 255 PHE A N     1 
ATOM   1468 C CA    . PHE A 1 233 ? -1.010  -31.511 14.899  1.00 126.74 ? 255 PHE A CA    1 
ATOM   1469 C C     . PHE A 1 233 ? -0.181  -31.419 13.620  1.00 126.88 ? 255 PHE A C     1 
ATOM   1470 O O     . PHE A 1 233 ? -0.208  -32.321 12.775  1.00 126.79 ? 255 PHE A O     1 
ATOM   1471 C CB    . PHE A 1 233 ? -2.279  -30.677 14.757  1.00 126.67 ? 255 PHE A CB    1 
ATOM   1472 C CG    . PHE A 1 233 ? -2.866  -30.694 13.367  1.00 126.15 ? 255 PHE A CG    1 
ATOM   1473 C CD1   . PHE A 1 233 ? -2.645  -29.632 12.486  1.00 125.59 ? 255 PHE A CD1   1 
ATOM   1474 C CD2   . PHE A 1 233 ? -3.626  -31.777 12.935  1.00 125.45 ? 255 PHE A CD2   1 
ATOM   1475 C CE1   . PHE A 1 233 ? -3.180  -29.645 11.199  1.00 125.08 ? 255 PHE A CE1   1 
ATOM   1476 C CE2   . PHE A 1 233 ? -4.163  -31.799 11.655  1.00 125.21 ? 255 PHE A CE2   1 
ATOM   1477 C CZ    . PHE A 1 233 ? -3.939  -30.730 10.785  1.00 125.12 ? 255 PHE A CZ    1 
ATOM   1478 N N     . LEU A 1 234 ? 0.553   -30.316 13.493  1.00 127.06 ? 256 LEU A N     1 
ATOM   1479 C CA    . LEU A 1 234 ? 1.419   -30.090 12.347  1.00 127.25 ? 256 LEU A CA    1 
ATOM   1480 C C     . LEU A 1 234 ? 2.638   -31.011 12.357  1.00 127.61 ? 256 LEU A C     1 
ATOM   1481 O O     . LEU A 1 234 ? 3.173   -31.346 11.302  1.00 127.70 ? 256 LEU A O     1 
ATOM   1482 C CB    . LEU A 1 234 ? 1.865   -28.626 12.303  1.00 127.09 ? 256 LEU A CB    1 
ATOM   1483 C CG    . LEU A 1 234 ? 0.786   -27.567 12.068  1.00 126.63 ? 256 LEU A CG    1 
ATOM   1484 C CD1   . LEU A 1 234 ? 1.379   -26.173 12.204  1.00 125.96 ? 256 LEU A CD1   1 
ATOM   1485 C CD2   . LEU A 1 234 ? 0.126   -27.746 10.703  1.00 126.25 ? 256 LEU A CD2   1 
ATOM   1486 N N     . GLY A 1 235 ? 3.069   -31.417 13.547  1.00 127.98 ? 257 GLY A N     1 
ATOM   1487 C CA    . GLY A 1 235 ? 4.248   -32.267 13.688  1.00 128.46 ? 257 GLY A CA    1 
ATOM   1488 C C     . GLY A 1 235 ? 5.573   -31.542 13.470  1.00 128.75 ? 257 GLY A C     1 
ATOM   1489 O O     . GLY A 1 235 ? 6.476   -32.086 12.815  1.00 128.76 ? 257 GLY A O     1 
ATOM   1490 N N     . ILE A 1 236 ? 5.684   -30.317 14.019  1.00 129.13 ? 258 ILE A N     1 
ATOM   1491 C CA    . ILE A 1 236 ? 6.941   -29.534 14.006  1.00 129.47 ? 258 ILE A CA    1 
ATOM   1492 C C     . ILE A 1 236 ? 7.400   -29.217 15.443  1.00 129.67 ? 258 ILE A C     1 
ATOM   1493 O O     . ILE A 1 236 ? 6.573   -29.015 16.335  1.00 129.82 ? 258 ILE A O     1 
ATOM   1494 C CB    . ILE A 1 236 ? 6.800   -28.223 13.156  1.00 129.48 ? 258 ILE A CB    1 
ATOM   1495 C CG1   . ILE A 1 236 ? 6.565   -28.573 11.679  1.00 129.58 ? 258 ILE A CG1   1 
ATOM   1496 C CG2   . ILE A 1 236 ? 8.034   -27.309 13.300  1.00 129.41 ? 258 ILE A CG2   1 
ATOM   1497 C CD1   . ILE A 1 236 ? 5.996   -27.430 10.840  1.00 130.06 ? 258 ILE A CD1   1 
ATOM   1498 N N     . ALA A 1 237 ? 8.715   -29.186 15.659  1.00 129.78 ? 259 ALA A N     1 
ATOM   1499 C CA    . ALA A 1 237 ? 9.293   -28.953 16.985  1.00 129.77 ? 259 ALA A CA    1 
ATOM   1500 C C     . ALA A 1 237 ? 9.003   -27.550 17.498  1.00 129.75 ? 259 ALA A C     1 
ATOM   1501 O O     . ALA A 1 237 ? 8.939   -26.597 16.714  1.00 129.71 ? 259 ALA A O     1 
ATOM   1502 C CB    . ALA A 1 237 ? 10.783  -29.197 16.948  1.00 129.87 ? 259 ALA A CB    1 
ATOM   1503 N N     . TRP A 1 238 ? 8.842   -27.431 18.819  1.00 129.75 ? 260 TRP A N     1 
ATOM   1504 C CA    . TRP A 1 238 ? 8.441   -26.164 19.433  1.00 129.74 ? 260 TRP A CA    1 
ATOM   1505 C C     . TRP A 1 238 ? 9.424   -25.014 19.211  1.00 129.47 ? 260 TRP A C     1 
ATOM   1506 O O     . TRP A 1 238 ? 10.641  -25.202 19.227  1.00 129.47 ? 260 TRP A O     1 
ATOM   1507 C CB    . TRP A 1 238 ? 8.179   -26.308 20.939  1.00 129.84 ? 260 TRP A CB    1 
ATOM   1508 C CG    . TRP A 1 238 ? 8.035   -24.962 21.595  1.00 130.37 ? 260 TRP A CG    1 
ATOM   1509 C CD1   . TRP A 1 238 ? 9.031   -24.216 22.176  1.00 130.62 ? 260 TRP A CD1   1 
ATOM   1510 C CD2   . TRP A 1 238 ? 6.838   -24.176 21.683  1.00 131.10 ? 260 TRP A CD2   1 
ATOM   1511 N NE1   . TRP A 1 238 ? 8.524   -23.025 22.636  1.00 130.92 ? 260 TRP A NE1   1 
ATOM   1512 C CE2   . TRP A 1 238 ? 7.180   -22.973 22.351  1.00 131.33 ? 260 TRP A CE2   1 
ATOM   1513 C CE3   . TRP A 1 238 ? 5.503   -24.376 21.278  1.00 131.44 ? 260 TRP A CE3   1 
ATOM   1514 C CZ2   . TRP A 1 238 ? 6.233   -21.971 22.626  1.00 131.57 ? 260 TRP A CZ2   1 
ATOM   1515 C CZ3   . TRP A 1 238 ? 4.559   -23.376 21.549  1.00 131.76 ? 260 TRP A CZ3   1 
ATOM   1516 C CH2   . TRP A 1 238 ? 4.933   -22.190 22.219  1.00 131.67 ? 260 TRP A CH2   1 
ATOM   1517 N N     . SER A 1 239 ? 8.853   -23.824 19.011  1.00 129.11 ? 261 SER A N     1 
ATOM   1518 C CA    . SER A 1 239 ? 9.580   -22.569 19.068  1.00 128.77 ? 261 SER A CA    1 
ATOM   1519 C C     . SER A 1 239 ? 8.716   -21.535 19.769  1.00 128.71 ? 261 SER A C     1 
ATOM   1520 O O     . SER A 1 239 ? 7.541   -21.390 19.462  1.00 128.72 ? 261 SER A O     1 
ATOM   1521 C CB    . SER A 1 239 ? 9.891   -22.066 17.676  1.00 128.68 ? 261 SER A CB    1 
ATOM   1522 O OG    . SER A 1 239 ? 10.092  -20.602 17.711  1.00 128.48 ? 261 SER A OG    1 
ATOM   1523 N N     . ASP A 1 240 ? 9.312   -20.801 20.701  1.00 128.75 ? 262 ASP A N     1 
ATOM   1524 C CA    . ASP A 1 240 ? 8.600   -19.763 21.446  1.00 128.64 ? 262 ASP A CA    1 
ATOM   1525 C C     . ASP A 1 240 ? 8.386   -18.490 20.613  1.00 128.24 ? 262 ASP A C     1 
ATOM   1526 O O     . ASP A 1 240 ? 7.545   -17.653 20.953  1.00 128.02 ? 262 ASP A O     1 
ATOM   1527 C CB    . ASP A 1 240 ? 9.386   -19.440 22.725  1.00 128.99 ? 262 ASP A CB    1 
ATOM   1528 C CG    . ASP A 1 240 ? 8.785   -18.300 23.499  1.00 129.79 ? 262 ASP A CG    1 
ATOM   1529 O OD1   . ASP A 1 240 ? 7.856   -18.528 24.194  1.00 130.46 ? 262 ASP A OD1   1 
ATOM   1530 O OD2   . ASP A 1 240 ? 9.309   -17.174 23.400  1.00 131.41 ? 262 ASP A OD2   1 
ATOM   1531 N N     . ALA A 1 241 ? 9.150   -18.352 19.526  1.00 127.89 ? 263 ALA A N     1 
ATOM   1532 C CA    . ALA A 1 241 ? 9.101   -17.163 18.661  1.00 127.63 ? 263 ALA A CA    1 
ATOM   1533 C C     . ALA A 1 241 ? 7.668   -16.846 18.261  1.00 127.46 ? 263 ALA A C     1 
ATOM   1534 O O     . ALA A 1 241 ? 7.284   -15.681 18.079  1.00 127.42 ? 263 ALA A O     1 
ATOM   1535 C CB    . ALA A 1 241 ? 9.973   -17.363 17.419  1.00 127.44 ? 263 ALA A CB    1 
ATOM   1536 N N     . VAL A 1 242 ? 6.889   -17.918 18.134  1.00 127.24 ? 264 VAL A N     1 
ATOM   1537 C CA    . VAL A 1 242 ? 5.489   -17.860 17.760  1.00 126.98 ? 264 VAL A CA    1 
ATOM   1538 C C     . VAL A 1 242 ? 4.766   -16.744 18.498  1.00 126.85 ? 264 VAL A C     1 
ATOM   1539 O O     . VAL A 1 242 ? 4.006   -15.969 17.909  1.00 126.57 ? 264 VAL A O     1 
ATOM   1540 C CB    . VAL A 1 242 ? 4.832   -19.235 18.030  1.00 126.99 ? 264 VAL A CB    1 
ATOM   1541 C CG1   . VAL A 1 242 ? 3.555   -19.100 18.836  1.00 126.95 ? 264 VAL A CG1   1 
ATOM   1542 C CG2   . VAL A 1 242 ? 4.607   -19.986 16.722  1.00 126.92 ? 264 VAL A CG2   1 
ATOM   1543 N N     . LEU A 1 243 ? 5.046   -16.646 19.789  1.00 126.91 ? 265 LEU A N     1 
ATOM   1544 C CA    . LEU A 1 243 ? 4.328   -15.721 20.633  1.00 127.12 ? 265 LEU A CA    1 
ATOM   1545 C C     . LEU A 1 243 ? 4.893   -14.317 20.474  1.00 127.18 ? 265 LEU A C     1 
ATOM   1546 O O     . LEU A 1 243 ? 4.308   -13.338 20.955  1.00 127.18 ? 265 LEU A O     1 
ATOM   1547 C CB    . LEU A 1 243 ? 4.400   -16.194 22.088  1.00 127.18 ? 265 LEU A CB    1 
ATOM   1548 C CG    . LEU A 1 243 ? 3.966   -17.652 22.315  1.00 127.33 ? 265 LEU A CG    1 
ATOM   1549 C CD1   . LEU A 1 243 ? 4.630   -18.264 23.542  1.00 127.89 ? 265 LEU A CD1   1 
ATOM   1550 C CD2   . LEU A 1 243 ? 2.446   -17.768 22.422  1.00 127.91 ? 265 LEU A CD2   1 
ATOM   1551 N N     . HIS A 1 244 ? 6.030   -14.232 19.783  1.00 127.24 ? 266 HIS A N     1 
ATOM   1552 C CA    . HIS A 1 244 ? 6.736   -12.973 19.610  1.00 127.35 ? 266 HIS A CA    1 
ATOM   1553 C C     . HIS A 1 244 ? 6.820   -12.597 18.151  1.00 127.29 ? 266 HIS A C     1 
ATOM   1554 O O     . HIS A 1 244 ? 7.787   -11.979 17.706  1.00 127.13 ? 266 HIS A O     1 
ATOM   1555 C CB    . HIS A 1 244 ? 8.131   -13.077 20.194  1.00 127.48 ? 266 HIS A CB    1 
ATOM   1556 C CG    . HIS A 1 244 ? 8.136   -13.353 21.656  1.00 127.82 ? 266 HIS A CG    1 
ATOM   1557 N ND1   . HIS A 1 244 ? 8.044   -12.353 22.598  1.00 128.30 ? 266 HIS A ND1   1 
ATOM   1558 C CD2   . HIS A 1 244 ? 8.194   -14.517 22.341  1.00 128.21 ? 266 HIS A CD2   1 
ATOM   1559 C CE1   . HIS A 1 244 ? 8.060   -12.890 23.805  1.00 128.73 ? 266 HIS A CE1   1 
ATOM   1560 N NE2   . HIS A 1 244 ? 8.148   -14.202 23.676  1.00 128.68 ? 266 HIS A NE2   1 
ATOM   1561 N N     . HIS A 1 245 ? 5.786   -12.964 17.409  1.00 127.40 ? 267 HIS A N     1 
ATOM   1562 C CA    . HIS A 1 245 ? 5.727   -12.628 16.008  1.00 127.58 ? 267 HIS A CA    1 
ATOM   1563 C C     . HIS A 1 245 ? 6.001   -11.141 15.783  1.00 127.82 ? 267 HIS A C     1 
ATOM   1564 O O     . HIS A 1 245 ? 6.768   -10.783 14.892  1.00 127.81 ? 267 HIS A O     1 
ATOM   1565 C CB    . HIS A 1 245 ? 4.379   -13.046 15.419  1.00 127.56 ? 267 HIS A CB    1 
ATOM   1566 C CG    . HIS A 1 245 ? 3.218   -12.241 15.913  1.00 127.20 ? 267 HIS A CG    1 
ATOM   1567 N ND1   . HIS A 1 245 ? 2.675   -11.198 15.187  1.00 126.86 ? 267 HIS A ND1   1 
ATOM   1568 C CD2   . HIS A 1 245 ? 2.492   -12.328 17.054  1.00 127.14 ? 267 HIS A CD2   1 
ATOM   1569 C CE1   . HIS A 1 245 ? 1.663   -10.680 15.859  1.00 126.64 ? 267 HIS A CE1   1 
ATOM   1570 N NE2   . HIS A 1 245 ? 1.531   -11.347 16.995  1.00 127.12 ? 267 HIS A NE2   1 
ATOM   1571 N N     . GLU A 1 246 ? 5.407   -10.291 16.619  1.00 128.26 ? 268 GLU A N     1 
ATOM   1572 C CA    . GLU A 1 246 ? 5.505   -8.836  16.486  1.00 128.83 ? 268 GLU A CA    1 
ATOM   1573 C C     . GLU A 1 246 ? 6.941   -8.381  16.314  1.00 129.20 ? 268 GLU A C     1 
ATOM   1574 O O     . GLU A 1 246 ? 7.214   -7.342  15.709  1.00 129.00 ? 268 GLU A O     1 
ATOM   1575 C CB    . GLU A 1 246 ? 4.881   -8.143  17.712  1.00 128.91 ? 268 GLU A CB    1 
ATOM   1576 C CG    . GLU A 1 246 ? 5.698   -8.227  19.035  1.00 129.35 ? 268 GLU A CG    1 
ATOM   1577 C CD    . GLU A 1 246 ? 5.549   -9.552  19.797  1.00 129.91 ? 268 GLU A CD    1 
ATOM   1578 O OE1   . GLU A 1 246 ? 6.170   -9.683  20.902  1.00 129.67 ? 268 GLU A OE1   1 
ATOM   1579 O OE2   . GLU A 1 246 ? 4.815   -10.457 19.303  1.00 130.42 ? 268 GLU A OE2   1 
ATOM   1580 N N     . ASP A 1 247 ? 7.849   -9.186  16.856  1.00 129.98 ? 269 ASP A N     1 
ATOM   1581 C CA    . ASP A 1 247 ? 9.266   -8.867  16.887  1.00 130.83 ? 269 ASP A CA    1 
ATOM   1582 C C     . ASP A 1 247 ? 10.029  -9.396  15.661  1.00 131.23 ? 269 ASP A C     1 
ATOM   1583 O O     . ASP A 1 247 ? 11.263  -9.270  15.597  1.00 131.36 ? 269 ASP A O     1 
ATOM   1584 C CB    . ASP A 1 247 ? 9.907   -9.385  18.195  1.00 130.85 ? 269 ASP A CB    1 
ATOM   1585 C CG    . ASP A 1 247 ? 9.456   -8.598  19.454  1.00 131.30 ? 269 ASP A CG    1 
ATOM   1586 O OD1   . ASP A 1 247 ? 9.141   -7.384  19.366  1.00 131.26 ? 269 ASP A OD1   1 
ATOM   1587 O OD2   . ASP A 1 247 ? 9.436   -9.202  20.556  1.00 132.08 ? 269 ASP A OD2   1 
ATOM   1588 N N     . LEU A 1 248 ? 9.304   -9.967  14.687  1.00 131.83 ? 270 LEU A N     1 
ATOM   1589 C CA    . LEU A 1 248 ? 9.950   -10.586 13.515  1.00 132.34 ? 270 LEU A CA    1 
ATOM   1590 C C     . LEU A 1 248 ? 9.454   -10.090 12.136  1.00 132.84 ? 270 LEU A C     1 
ATOM   1591 O O     . LEU A 1 248 ? 9.641   -10.768 11.122  1.00 132.83 ? 270 LEU A O     1 
ATOM   1592 C CB    . LEU A 1 248 ? 9.887   -12.121 13.617  1.00 132.22 ? 270 LEU A CB    1 
ATOM   1593 C CG    . LEU A 1 248 ? 10.805  -12.769 14.665  1.00 131.91 ? 270 LEU A CG    1 
ATOM   1594 C CD1   . LEU A 1 248 ? 10.545  -14.256 14.779  1.00 131.87 ? 270 LEU A CD1   1 
ATOM   1595 C CD2   . LEU A 1 248 ? 12.256  -12.547 14.308  1.00 132.03 ? 270 LEU A CD2   1 
ATOM   1596 N N     . ILE A 1 249 ? 8.857   -8.899  12.102  1.00 133.55 ? 271 ILE A N     1 
ATOM   1597 C CA    . ILE A 1 249 ? 8.288   -8.338  10.865  1.00 134.26 ? 271 ILE A CA    1 
ATOM   1598 C C     . ILE A 1 249 ? 9.359   -7.660  10.020  1.00 134.64 ? 271 ILE A C     1 
ATOM   1599 O O     . ILE A 1 249 ? 10.137  -6.850  10.522  1.00 134.69 ? 271 ILE A O     1 
ATOM   1600 C CB    . ILE A 1 249 ? 7.144   -7.333  11.169  1.00 134.31 ? 271 ILE A CB    1 
ATOM   1601 C CG1   . ILE A 1 249 ? 5.914   -8.074  11.701  1.00 134.79 ? 271 ILE A CG1   1 
ATOM   1602 C CG2   . ILE A 1 249 ? 6.757   -6.546  9.929   1.00 134.21 ? 271 ILE A CG2   1 
ATOM   1603 C CD1   . ILE A 1 249 ? 5.174   -7.332  12.830  1.00 135.73 ? 271 ILE A CD1   1 
ATOM   1604 N N     . GLY A 1 250 ? 9.381   -7.989  8.728   1.00 135.21 ? 272 GLY A N     1 
ATOM   1605 C CA    . GLY A 1 250 ? 10.373  -7.443  7.805   1.00 135.73 ? 272 GLY A CA    1 
ATOM   1606 C C     . GLY A 1 250 ? 11.754  -8.010  8.076   1.00 135.98 ? 272 GLY A C     1 
ATOM   1607 O O     . GLY A 1 250 ? 12.731  -7.640  7.423   1.00 136.08 ? 272 GLY A O     1 
ATOM   1608 N N     . LYS A 1 251 ? 11.830  -8.909  9.054   1.00 136.18 ? 273 LYS A N     1 
ATOM   1609 C CA    . LYS A 1 251 ? 13.071  -9.577  9.375   1.00 136.39 ? 273 LYS A CA    1 
ATOM   1610 C C     . LYS A 1 251 ? 13.094  -10.920 8.669   1.00 136.13 ? 273 LYS A C     1 
ATOM   1611 O O     . LYS A 1 251 ? 12.046  -11.556 8.501   1.00 136.20 ? 273 LYS A O     1 
ATOM   1612 C CB    . LYS A 1 251 ? 13.211  -9.782  10.881  1.00 136.68 ? 273 LYS A CB    1 
ATOM   1613 C CG    . LYS A 1 251 ? 12.822  -8.576  11.717  1.00 137.84 ? 273 LYS A CG    1 
ATOM   1614 C CD    . LYS A 1 251 ? 13.370  -8.683  13.129  1.00 139.65 ? 273 LYS A CD    1 
ATOM   1615 C CE    . LYS A 1 251 ? 14.451  -7.630  13.388  1.00 140.77 ? 273 LYS A CE    1 
ATOM   1616 N NZ    . LYS A 1 251 ? 13.847  -6.262  13.523  1.00 141.44 ? 273 LYS A NZ    1 
ATOM   1617 N N     . PRO A 1 252 ? 14.292  -11.347 8.239   1.00 135.80 ? 274 PRO A N     1 
ATOM   1618 C CA    . PRO A 1 252 ? 14.532  -12.624 7.564   1.00 135.42 ? 274 PRO A CA    1 
ATOM   1619 C C     . PRO A 1 252 ? 14.139  -13.845 8.402   1.00 134.84 ? 274 PRO A C     1 
ATOM   1620 O O     . PRO A 1 252 ? 14.155  -13.758 9.655   1.00 134.87 ? 274 PRO A O     1 
ATOM   1621 C CB    . PRO A 1 252 ? 16.042  -12.599 7.326   1.00 135.58 ? 274 PRO A CB    1 
ATOM   1622 C CG    . PRO A 1 252 ? 16.368  -11.149 7.225   1.00 135.88 ? 274 PRO A CG    1 
ATOM   1623 C CD    . PRO A 1 252 ? 15.494  -10.490 8.232   1.00 135.81 ? 274 PRO A CD    1 
ATOM   1624 N N     . GLY A 1 253 ? 13.784  -14.967 7.699   1.00 134.13 ? 275 GLY A N     1 
ATOM   1625 C CA    . GLY A 1 253 ? 13.314  -16.198 8.356   1.00 133.07 ? 275 GLY A CA    1 
ATOM   1626 C C     . GLY A 1 253 ? 11.920  -16.034 8.952   1.00 132.29 ? 275 GLY A C     1 
ATOM   1627 O O     . GLY A 1 253 ? 11.199  -17.013 9.215   1.00 132.06 ? 275 GLY A O     1 
ATOM   1628 N N     . GLY A 1 254 ? 11.547  -14.773 9.141   1.00 131.56 ? 276 GLY A N     1 
ATOM   1629 C CA    . GLY A 1 254 ? 10.359  -14.421 9.873   1.00 130.67 ? 276 GLY A CA    1 
ATOM   1630 C C     . GLY A 1 254 ? 9.199   -14.043 8.991   1.00 130.01 ? 276 GLY A C     1 
ATOM   1631 O O     . GLY A 1 254 ? 8.856   -14.772 8.059   1.00 129.88 ? 276 GLY A O     1 
ATOM   1632 N N     . VAL A 1 255 ? 8.622   -12.875 9.294   1.00 129.48 ? 277 VAL A N     1 
ATOM   1633 C CA    . VAL A 1 255 ? 7.283   -12.505 8.846   1.00 128.79 ? 277 VAL A CA    1 
ATOM   1634 C C     . VAL A 1 255 ? 7.291   -11.382 7.814   1.00 128.51 ? 277 VAL A C     1 
ATOM   1635 O O     . VAL A 1 255 ? 7.729   -10.261 8.089   1.00 128.43 ? 277 VAL A O     1 
ATOM   1636 C CB    . VAL A 1 255 ? 6.401   -12.095 10.049  1.00 128.72 ? 277 VAL A CB    1 
ATOM   1637 C CG1   . VAL A 1 255 ? 4.939   -12.131 9.671   1.00 128.60 ? 277 VAL A CG1   1 
ATOM   1638 C CG2   . VAL A 1 255 ? 6.660   -13.006 11.252  1.00 128.48 ? 277 VAL A CG2   1 
ATOM   1639 N N     . SER A 1 256 ? 6.781   -11.700 6.627   1.00 128.26 ? 278 SER A N     1 
ATOM   1640 C CA    . SER A 1 256 ? 6.724   -10.759 5.512   1.00 128.15 ? 278 SER A CA    1 
ATOM   1641 C C     . SER A 1 256 ? 5.292   -10.219 5.269   1.00 127.92 ? 278 SER A C     1 
ATOM   1642 O O     . SER A 1 256 ? 4.374   -10.998 4.946   1.00 127.77 ? 278 SER A O     1 
ATOM   1643 C CB    . SER A 1 256 ? 7.289   -11.438 4.258   1.00 128.22 ? 278 SER A CB    1 
ATOM   1644 O OG    . SER A 1 256 ? 7.628   -10.489 3.254   1.00 128.48 ? 278 SER A OG    1 
ATOM   1645 N N     . LEU A 1 257 ? 5.116   -8.891  5.418   1.00 127.64 ? 279 LEU A N     1 
ATOM   1646 C CA    . LEU A 1 257 ? 3.786   -8.261  5.377   1.00 127.44 ? 279 LEU A CA    1 
ATOM   1647 C C     . LEU A 1 257 ? 3.513   -7.373  4.170   1.00 127.48 ? 279 LEU A C     1 
ATOM   1648 O O     . LEU A 1 257 ? 4.336   -6.515  3.821   1.00 127.53 ? 279 LEU A O     1 
ATOM   1649 C CB    . LEU A 1 257 ? 3.544   -7.420  6.637   1.00 127.36 ? 279 LEU A CB    1 
ATOM   1650 C CG    . LEU A 1 257 ? 3.275   -8.107  7.993   1.00 127.05 ? 279 LEU A CG    1 
ATOM   1651 C CD1   . LEU A 1 257 ? 2.917   -7.065  9.030   1.00 126.47 ? 279 LEU A CD1   1 
ATOM   1652 C CD2   . LEU A 1 257 ? 2.167   -9.161  7.908   1.00 126.73 ? 279 LEU A CD2   1 
ATOM   1653 N N     . SER A 1 258 ? 2.332   -7.575  3.570   1.00 127.48 ? 280 SER A N     1 
ATOM   1654 C CA    . SER A 1 258 ? 1.815   -6.724  2.499   1.00 127.47 ? 280 SER A CA    1 
ATOM   1655 C C     . SER A 1 258 ? 1.274   -5.428  3.081   1.00 127.56 ? 280 SER A C     1 
ATOM   1656 O O     . SER A 1 258 ? 0.358   -5.459  3.903   1.00 127.62 ? 280 SER A O     1 
ATOM   1657 C CB    . SER A 1 258 ? 0.689   -7.445  1.760   1.00 127.37 ? 280 SER A CB    1 
ATOM   1658 O OG    . SER A 1 258 ? -0.263  -6.480  1.195   1.00 127.43 ? 280 SER A OG    1 
ATOM   1659 N N     . LYS A 1 259 ? 1.816   -4.292  2.641   1.00 127.66 ? 281 LYS A N     1 
ATOM   1660 C CA    . LYS A 1 259 ? 1.411   -3.001  3.203   1.00 127.84 ? 281 LYS A CA    1 
ATOM   1661 C C     . LYS A 1 259 ? 0.087   -2.471  2.619   1.00 127.31 ? 281 LYS A C     1 
ATOM   1662 O O     . LYS A 1 259 ? -0.341  -1.330  2.917   1.00 127.37 ? 281 LYS A O     1 
ATOM   1663 C CB    . LYS A 1 259 ? 2.536   -1.951  3.085   1.00 128.21 ? 281 LYS A CB    1 
ATOM   1664 C CG    . LYS A 1 259 ? 2.292   -0.880  2.033   1.00 130.24 ? 281 LYS A CG    1 
ATOM   1665 C CD    . LYS A 1 259 ? 3.032   0.420   2.355   1.00 133.73 ? 281 LYS A CD    1 
ATOM   1666 C CE    . LYS A 1 259 ? 2.905   1.395   1.184   1.00 135.73 ? 281 LYS A CE    1 
ATOM   1667 N NZ    . LYS A 1 259 ? 4.138   1.487   0.306   1.00 137.15 ? 281 LYS A NZ    1 
ATOM   1668 N N     . ILE A 1 260 ? -0.562  -3.288  1.789   1.00 126.71 ? 282 ILE A N     1 
ATOM   1669 C CA    . ILE A 1 260 ? -1.918  -2.959  1.360   1.00 126.32 ? 282 ILE A CA    1 
ATOM   1670 C C     . ILE A 1 260 ? -2.934  -4.036  1.717   1.00 125.96 ? 282 ILE A C     1 
ATOM   1671 O O     . ILE A 1 260 ? -4.125  -3.859  1.479   1.00 125.96 ? 282 ILE A O     1 
ATOM   1672 C CB    . ILE A 1 260 ? -2.029  -2.589  -0.142  1.00 126.40 ? 282 ILE A CB    1 
ATOM   1673 C CG1   . ILE A 1 260 ? -1.775  -3.827  -1.078  1.00 126.40 ? 282 ILE A CG1   1 
ATOM   1674 C CG2   . ILE A 1 260 ? -1.123  -1.416  -0.475  1.00 126.60 ? 282 ILE A CG2   1 
ATOM   1675 C CD1   . ILE A 1 260 ? -1.839  -3.477  -2.567  1.00 126.19 ? 282 ILE A CD1   1 
ATOM   1676 N N     . GLU A 1 261 ? -2.471  -5.146  2.285   1.00 125.51 ? 283 GLU A N     1 
ATOM   1677 C CA    . GLU A 1 261 ? -3.395  -6.128  2.843   1.00 125.15 ? 283 GLU A CA    1 
ATOM   1678 C C     . GLU A 1 261 ? -4.099  -5.541  4.063   1.00 124.99 ? 283 GLU A C     1 
ATOM   1679 O O     . GLU A 1 261 ? -3.502  -4.753  4.812   1.00 124.95 ? 283 GLU A O     1 
ATOM   1680 C CB    . GLU A 1 261 ? -2.677  -7.421  3.198   1.00 125.10 ? 283 GLU A CB    1 
ATOM   1681 C CG    . GLU A 1 261 ? -2.740  -8.459  2.090   1.00 124.95 ? 283 GLU A CG    1 
ATOM   1682 C CD    . GLU A 1 261 ? -2.003  -9.729  2.457   1.00 125.25 ? 283 GLU A CD    1 
ATOM   1683 O OE1   . GLU A 1 261 ? -1.901  -10.052 3.670   1.00 125.53 ? 283 GLU A OE1   1 
ATOM   1684 O OE2   . GLU A 1 261 ? -1.522  -10.409 1.526   1.00 125.33 ? 283 GLU A OE2   1 
ATOM   1685 N N     . ARG A 1 262 ? -5.364  -5.920  4.254   1.00 124.74 ? 284 ARG A N     1 
ATOM   1686 C CA    . ARG A 1 262 ? -6.228  -5.232  5.215   1.00 124.51 ? 284 ARG A CA    1 
ATOM   1687 C C     . ARG A 1 262 ? -5.907  -5.525  6.672   1.00 123.97 ? 284 ARG A C     1 
ATOM   1688 O O     . ARG A 1 262 ? -5.824  -4.563  7.514   1.00 123.87 ? 284 ARG A O     1 
ATOM   1689 C CB    . ARG A 1 262 ? -7.703  -5.500  4.913   1.00 124.71 ? 284 ARG A CB    1 
ATOM   1690 C CG    . ARG A 1 262 ? -8.109  -5.101  3.501   1.00 126.35 ? 284 ARG A CG    1 
ATOM   1691 C CD    . ARG A 1 262 ? -7.867  -3.612  3.240   1.00 129.38 ? 284 ARG A CD    1 
ATOM   1692 N NE    . ARG A 1 262 ? -9.083  -2.808  3.457   1.00 132.11 ? 284 ARG A NE    1 
ATOM   1693 C CZ    . ARG A 1 262 ? -9.274  -1.968  4.494   1.00 133.33 ? 284 ARG A CZ    1 
ATOM   1694 N NH1   . ARG A 1 262 ? -8.325  -1.791  5.439   1.00 133.77 ? 284 ARG A NH1   1 
ATOM   1695 N NH2   . ARG A 1 262 ? -10.424 -1.295  4.575   1.00 134.28 ? 284 ARG A NH2   1 
ATOM   1696 N N     . SER A 1 263 ? -5.747  -6.841  6.972   1.00 123.45 ? 285 SER A N     1 
ATOM   1697 C CA    . SER A 1 263 ? -5.337  -7.232  8.316   1.00 122.92 ? 285 SER A CA    1 
ATOM   1698 C C     . SER A 1 263 ? -3.841  -7.143  8.468   1.00 122.60 ? 285 SER A C     1 
ATOM   1699 O O     . SER A 1 263 ? -3.139  -8.152  8.556   1.00 122.33 ? 285 SER A O     1 
ATOM   1700 C CB    . SER A 1 263 ? -5.820  -8.630  8.667   1.00 122.96 ? 285 SER A CB    1 
ATOM   1701 O OG    . SER A 1 263 ? -6.943  -8.536  9.516   1.00 122.77 ? 285 SER A OG    1 
ATOM   1702 N N     . THR A 1 264 ? -3.366  -5.907  8.496   1.00 122.37 ? 286 THR A N     1 
ATOM   1703 C CA    . THR A 1 264 ? -1.962  -5.645  8.680   1.00 122.37 ? 286 THR A CA    1 
ATOM   1704 C C     . THR A 1 264 ? -1.782  -4.826  9.953   1.00 122.19 ? 286 THR A C     1 
ATOM   1705 O O     . THR A 1 264 ? -1.231  -5.322  10.932  1.00 122.19 ? 286 THR A O     1 
ATOM   1706 C CB    . THR A 1 264 ? -1.332  -4.975  7.418   1.00 122.50 ? 286 THR A CB    1 
ATOM   1707 O OG1   . THR A 1 264 ? -1.196  -5.949  6.370   1.00 122.60 ? 286 THR A OG1   1 
ATOM   1708 C CG2   . THR A 1 264 ? 0.041   -4.373  7.718   1.00 122.56 ? 286 THR A CG2   1 
ATOM   1709 N N     . ASP A 1 265 ? -2.285  -3.596  9.959   1.00 122.04 ? 287 ASP A N     1 
ATOM   1710 C CA    . ASP A 1 265 ? -2.029  -2.680  11.065  1.00 122.02 ? 287 ASP A CA    1 
ATOM   1711 C C     . ASP A 1 265 ? -2.491  -3.210  12.422  1.00 122.15 ? 287 ASP A C     1 
ATOM   1712 O O     . ASP A 1 265 ? -2.241  -2.572  13.448  1.00 122.12 ? 287 ASP A O     1 
ATOM   1713 C CB    . ASP A 1 265 ? -2.645  -1.318  10.777  1.00 121.89 ? 287 ASP A CB    1 
ATOM   1714 C CG    . ASP A 1 265 ? -4.095  -1.416  10.396  1.00 121.91 ? 287 ASP A CG    1 
ATOM   1715 O OD1   . ASP A 1 265 ? -4.952  -1.443  11.308  1.00 121.71 ? 287 ASP A OD1   1 
ATOM   1716 O OD2   . ASP A 1 265 ? -4.371  -1.474  9.179   1.00 121.93 ? 287 ASP A OD2   1 
ATOM   1717 N N     . GLN A 1 266 ? -3.153  -4.374  12.415  1.00 122.39 ? 288 GLN A N     1 
ATOM   1718 C CA    . GLN A 1 266 ? -3.517  -5.099  13.645  1.00 122.58 ? 288 GLN A CA    1 
ATOM   1719 C C     . GLN A 1 266 ? -2.552  -6.245  13.995  1.00 122.88 ? 288 GLN A C     1 
ATOM   1720 O O     . GLN A 1 266 ? -2.365  -6.555  15.179  1.00 122.82 ? 288 GLN A O     1 
ATOM   1721 C CB    . GLN A 1 266 ? -4.953  -5.643  13.593  1.00 122.42 ? 288 GLN A CB    1 
ATOM   1722 C CG    . GLN A 1 266 ? -6.037  -4.614  13.351  1.00 121.74 ? 288 GLN A CG    1 
ATOM   1723 C CD    . GLN A 1 266 ? -6.619  -4.728  11.966  1.00 120.67 ? 288 GLN A CD    1 
ATOM   1724 O OE1   . GLN A 1 266 ? -6.159  -4.073  11.039  1.00 120.54 ? 288 GLN A OE1   1 
ATOM   1725 N NE2   . GLN A 1 266 ? -7.622  -5.582  11.810  1.00 120.26 ? 288 GLN A NE2   1 
ATOM   1726 N N     . VAL A 1 267 ? -1.975  -6.882  12.967  1.00 123.23 ? 289 VAL A N     1 
ATOM   1727 C CA    . VAL A 1 267 ? -0.991  -7.974  13.134  1.00 123.59 ? 289 VAL A CA    1 
ATOM   1728 C C     . VAL A 1 267 ? 0.380   -7.436  13.567  1.00 123.82 ? 289 VAL A C     1 
ATOM   1729 O O     . VAL A 1 267 ? 1.207   -8.185  14.109  1.00 123.77 ? 289 VAL A O     1 
ATOM   1730 C CB    . VAL A 1 267 ? -0.856  -8.856  11.840  1.00 123.62 ? 289 VAL A CB    1 
ATOM   1731 C CG1   . VAL A 1 267 ? 0.483   -9.590  11.787  1.00 123.74 ? 289 VAL A CG1   1 
ATOM   1732 C CG2   . VAL A 1 267 ? -1.980  -9.864  11.734  1.00 123.62 ? 289 VAL A CG2   1 
ATOM   1733 N N     . ILE A 1 268 ? 0.610   -6.140  13.324  1.00 124.13 ? 290 ILE A N     1 
ATOM   1734 C CA    . ILE A 1 268 ? 1.856   -5.474  13.731  1.00 124.46 ? 290 ILE A CA    1 
ATOM   1735 C C     . ILE A 1 268 ? 2.051   -5.527  15.246  1.00 124.53 ? 290 ILE A C     1 
ATOM   1736 O O     . ILE A 1 268 ? 3.179   -5.656  15.731  1.00 124.66 ? 290 ILE A O     1 
ATOM   1737 C CB    . ILE A 1 268 ? 1.969   -3.996  13.201  1.00 124.55 ? 290 ILE A CB    1 
ATOM   1738 C CG1   . ILE A 1 268 ? 0.846   -3.088  13.768  1.00 124.90 ? 290 ILE A CG1   1 
ATOM   1739 C CG2   . ILE A 1 268 ? 1.991   -3.959  11.646  1.00 124.64 ? 290 ILE A CG2   1 
ATOM   1740 C CD1   . ILE A 1 268 ? 1.062   -1.592  13.445  1.00 125.45 ? 290 ILE A CD1   1 
ATOM   1741 N N     . LYS A 1 269 ? 0.938   -5.437  15.975  1.00 124.61 ? 291 LYS A N     1 
ATOM   1742 C CA    . LYS A 1 269 ? 0.918   -5.612  17.428  1.00 124.61 ? 291 LYS A CA    1 
ATOM   1743 C C     . LYS A 1 269 ? 0.920   -7.108  17.769  1.00 124.29 ? 291 LYS A C     1 
ATOM   1744 O O     . LYS A 1 269 ? 0.526   -7.938  16.941  1.00 124.41 ? 291 LYS A O     1 
ATOM   1745 C CB    . LYS A 1 269 ? -0.328  -4.950  18.028  1.00 124.76 ? 291 LYS A CB    1 
ATOM   1746 C CG    . LYS A 1 269 ? -0.329  -3.432  17.941  1.00 125.62 ? 291 LYS A CG    1 
ATOM   1747 C CD    . LYS A 1 269 ? -1.742  -2.885  17.999  1.00 127.16 ? 291 LYS A CD    1 
ATOM   1748 C CE    . LYS A 1 269 ? -2.525  -3.256  16.737  1.00 128.30 ? 291 LYS A CE    1 
ATOM   1749 N NZ    . LYS A 1 269 ? -3.984  -2.977  16.855  1.00 129.38 ? 291 LYS A NZ    1 
ATOM   1750 N N     . PRO A 1 270 ? 1.375   -7.461  18.986  1.00 123.93 ? 292 PRO A N     1 
ATOM   1751 C CA    . PRO A 1 270 ? 1.300   -8.851  19.449  1.00 123.57 ? 292 PRO A CA    1 
ATOM   1752 C C     . PRO A 1 270 ? -0.137  -9.294  19.717  1.00 123.10 ? 292 PRO A C     1 
ATOM   1753 O O     . PRO A 1 270 ? -1.048  -8.452  19.795  1.00 122.92 ? 292 PRO A O     1 
ATOM   1754 C CB    . PRO A 1 270 ? 2.097   -8.827  20.761  1.00 123.64 ? 292 PRO A CB    1 
ATOM   1755 C CG    . PRO A 1 270 ? 2.064   -7.394  21.196  1.00 123.99 ? 292 PRO A CG    1 
ATOM   1756 C CD    . PRO A 1 270 ? 2.125   -6.610  19.929  1.00 123.92 ? 292 PRO A CD    1 
ATOM   1757 N N     . VAL A 1 271 ? -0.317  -10.611 19.844  1.00 122.66 ? 293 VAL A N     1 
ATOM   1758 C CA    . VAL A 1 271 ? -1.606  -11.207 20.158  1.00 122.36 ? 293 VAL A CA    1 
ATOM   1759 C C     . VAL A 1 271 ? -2.324  -10.363 21.210  1.00 122.43 ? 293 VAL A C     1 
ATOM   1760 O O     . VAL A 1 271 ? -1.967  -10.407 22.392  1.00 122.54 ? 293 VAL A O     1 
ATOM   1761 C CB    . VAL A 1 271 ? -1.416  -12.650 20.682  1.00 122.30 ? 293 VAL A CB    1 
ATOM   1762 C CG1   . VAL A 1 271 ? -2.759  -13.282 21.075  1.00 122.08 ? 293 VAL A CG1   1 
ATOM   1763 C CG2   . VAL A 1 271 ? -0.691  -13.495 19.640  1.00 121.89 ? 293 VAL A CG2   1 
ATOM   1764 N N     . ASN A 1 272 ? -3.305  -9.569  20.774  1.00 122.33 ? 294 ASN A N     1 
ATOM   1765 C CA    . ASN A 1 272 ? -4.098  -8.758  21.705  1.00 122.32 ? 294 ASN A CA    1 
ATOM   1766 C C     . ASN A 1 272 ? -5.605  -9.010  21.663  1.00 122.51 ? 294 ASN A C     1 
ATOM   1767 O O     . ASN A 1 272 ? -6.145  -9.524  20.679  1.00 122.46 ? 294 ASN A O     1 
ATOM   1768 C CB    . ASN A 1 272 ? -3.772  -7.260  21.605  1.00 122.11 ? 294 ASN A CB    1 
ATOM   1769 C CG    . ASN A 1 272 ? -4.263  -6.638  20.327  1.00 121.66 ? 294 ASN A CG    1 
ATOM   1770 O OD1   . ASN A 1 272 ? -3.574  -6.664  19.311  1.00 121.54 ? 294 ASN A OD1   1 
ATOM   1771 N ND2   . ASN A 1 272 ? -5.451  -6.048  20.373  1.00 121.11 ? 294 ASN A ND2   1 
ATOM   1772 N N     . LEU A 1 273 ? -6.269  -8.635  22.750  1.00 122.77 ? 295 LEU A N     1 
ATOM   1773 C CA    . LEU A 1 273 ? -7.635  -9.050  22.993  1.00 123.14 ? 295 LEU A CA    1 
ATOM   1774 C C     . LEU A 1 273 ? -8.662  -8.098  22.395  1.00 123.35 ? 295 LEU A C     1 
ATOM   1775 O O     . LEU A 1 273 ? -9.823  -8.494  22.185  1.00 123.56 ? 295 LEU A O     1 
ATOM   1776 C CB    . LEU A 1 273 ? -7.883  -9.171  24.504  1.00 123.31 ? 295 LEU A CB    1 
ATOM   1777 C CG    . LEU A 1 273 ? -7.077  -10.128 25.399  1.00 123.76 ? 295 LEU A CG    1 
ATOM   1778 C CD1   . LEU A 1 273 ? -7.300  -9.775  26.898  1.00 124.18 ? 295 LEU A CD1   1 
ATOM   1779 C CD2   . LEU A 1 273 ? -7.409  -11.613 25.123  1.00 124.13 ? 295 LEU A CD2   1 
ATOM   1780 N N     . GLU A 1 274 ? -8.243  -6.853  22.112  1.00 123.48 ? 296 GLU A N     1 
ATOM   1781 C CA    . GLU A 1 274 ? -9.193  -5.770  21.830  1.00 123.80 ? 296 GLU A CA    1 
ATOM   1782 C C     . GLU A 1 274 ? -10.306 -6.096  20.844  1.00 123.54 ? 296 GLU A C     1 
ATOM   1783 O O     . GLU A 1 274 ? -11.390 -5.515  20.916  1.00 123.53 ? 296 GLU A O     1 
ATOM   1784 C CB    . GLU A 1 274 ? -8.452  -4.529  21.373  1.00 124.03 ? 296 GLU A CB    1 
ATOM   1785 C CG    . GLU A 1 274 ? -7.485  -4.018  22.411  1.00 125.86 ? 296 GLU A CG    1 
ATOM   1786 C CD    . GLU A 1 274 ? -6.968  -2.639  22.082  1.00 128.38 ? 296 GLU A CD    1 
ATOM   1787 O OE1   . GLU A 1 274 ? -7.789  -1.694  22.005  1.00 129.49 ? 296 GLU A OE1   1 
ATOM   1788 O OE2   . GLU A 1 274 ? -5.738  -2.499  21.907  1.00 129.57 ? 296 GLU A OE2   1 
ATOM   1789 N N     . ALA A 1 275 ? -10.039 -7.037  19.945  1.00 123.49 ? 297 ALA A N     1 
ATOM   1790 C CA    . ALA A 1 275 ? -10.969 -7.365  18.868  1.00 123.57 ? 297 ALA A CA    1 
ATOM   1791 C C     . ALA A 1 275 ? -12.099 -8.344  19.244  1.00 123.57 ? 297 ALA A C     1 
ATOM   1792 O O     . ALA A 1 275 ? -13.198 -8.299  18.637  1.00 123.78 ? 297 ALA A O     1 
ATOM   1793 C CB    . ALA A 1 275 ? -10.198 -7.879  17.648  1.00 123.52 ? 297 ALA A CB    1 
ATOM   1794 N N     . LEU A 1 276 ? -11.837 -9.218  20.236  1.00 123.25 ? 298 LEU A N     1 
ATOM   1795 C CA    . LEU A 1 276 ? -12.735 -10.348 20.494  1.00 122.95 ? 298 LEU A CA    1 
ATOM   1796 C C     . LEU A 1 276 ? -14.213 -9.983  20.419  1.00 122.75 ? 298 LEU A C     1 
ATOM   1797 O O     . LEU A 1 276 ? -14.987 -10.651 19.733  1.00 122.63 ? 298 LEU A O     1 
ATOM   1798 C CB    . LEU A 1 276 ? -12.416 -10.994 21.844  1.00 122.93 ? 298 LEU A CB    1 
ATOM   1799 C CG    . LEU A 1 276 ? -11.062 -11.700 21.953  1.00 123.19 ? 298 LEU A CG    1 
ATOM   1800 C CD1   . LEU A 1 276 ? -10.805 -12.148 23.376  1.00 123.48 ? 298 LEU A CD1   1 
ATOM   1801 C CD2   . LEU A 1 276 ? -10.991 -12.883 21.009  1.00 123.59 ? 298 LEU A CD2   1 
ATOM   1802 N N     . SER A 1 277 ? -14.584 -8.893  21.091  1.00 122.62 ? 299 SER A N     1 
ATOM   1803 C CA    . SER A 1 277 ? -15.984 -8.628  21.376  1.00 122.61 ? 299 SER A CA    1 
ATOM   1804 C C     . SER A 1 277 ? -16.450 -7.213  21.052  1.00 122.47 ? 299 SER A C     1 
ATOM   1805 O O     . SER A 1 277 ? -17.584 -6.859  21.366  1.00 122.73 ? 299 SER A O     1 
ATOM   1806 C CB    . SER A 1 277 ? -16.276 -8.925  22.857  1.00 122.72 ? 299 SER A CB    1 
ATOM   1807 O OG    . SER A 1 277 ? -16.004 -10.286 23.185  1.00 123.11 ? 299 SER A OG    1 
ATOM   1808 N N     . LYS A 1 278 ? -15.608 -6.395  20.430  1.00 122.09 ? 300 LYS A N     1 
ATOM   1809 C CA    . LYS A 1 278 ? -16.039 -5.030  20.101  1.00 121.79 ? 300 LYS A CA    1 
ATOM   1810 C C     . LYS A 1 278 ? -17.294 -5.006  19.188  1.00 121.55 ? 300 LYS A C     1 
ATOM   1811 O O     . LYS A 1 278 ? -17.924 -3.960  19.002  1.00 121.37 ? 300 LYS A O     1 
ATOM   1812 C CB    . LYS A 1 278 ? -14.884 -4.222  19.502  1.00 121.69 ? 300 LYS A CB    1 
ATOM   1813 C CG    . LYS A 1 278 ? -14.414 -4.740  18.163  1.00 121.77 ? 300 LYS A CG    1 
ATOM   1814 C CD    . LYS A 1 278 ? -13.365 -3.812  17.524  1.00 121.68 ? 300 LYS A CD    1 
ATOM   1815 C CE    . LYS A 1 278 ? -13.042 -4.305  16.126  1.00 121.49 ? 300 LYS A CE    1 
ATOM   1816 N NZ    . LYS A 1 278 ? -11.714 -3.823  15.676  1.00 121.71 ? 300 LYS A NZ    1 
ATOM   1817 N N     . TRP A 1 279 ? -17.656 -6.172  18.651  1.00 121.29 ? 301 TRP A N     1 
ATOM   1818 C CA    . TRP A 1 279 ? -18.789 -6.293  17.747  1.00 121.19 ? 301 TRP A CA    1 
ATOM   1819 C C     . TRP A 1 279 ? -20.120 -6.160  18.472  1.00 121.56 ? 301 TRP A C     1 
ATOM   1820 O O     . TRP A 1 279 ? -21.079 -5.611  17.920  1.00 121.69 ? 301 TRP A O     1 
ATOM   1821 C CB    . TRP A 1 279 ? -18.736 -7.618  16.960  1.00 120.99 ? 301 TRP A CB    1 
ATOM   1822 C CG    . TRP A 1 279 ? -18.897 -8.868  17.786  1.00 119.79 ? 301 TRP A CG    1 
ATOM   1823 C CD1   . TRP A 1 279 ? -17.902 -9.633  18.325  1.00 119.12 ? 301 TRP A CD1   1 
ATOM   1824 C CD2   . TRP A 1 279 ? -20.125 -9.507  18.145  1.00 118.72 ? 301 TRP A CD2   1 
ATOM   1825 N NE1   . TRP A 1 279 ? -18.431 -10.706 19.002  1.00 118.42 ? 301 TRP A NE1   1 
ATOM   1826 C CE2   . TRP A 1 279 ? -19.796 -10.651 18.910  1.00 118.40 ? 301 TRP A CE2   1 
ATOM   1827 C CE3   . TRP A 1 279 ? -21.474 -9.219  17.901  1.00 118.44 ? 301 TRP A CE3   1 
ATOM   1828 C CZ2   . TRP A 1 279 ? -20.765 -11.507 19.438  1.00 118.17 ? 301 TRP A CZ2   1 
ATOM   1829 C CZ3   . TRP A 1 279 ? -22.438 -10.069 18.427  1.00 118.04 ? 301 TRP A CZ3   1 
ATOM   1830 C CH2   . TRP A 1 279 ? -22.077 -11.200 19.188  1.00 117.80 ? 301 TRP A CH2   1 
ATOM   1831 N N     . THR A 1 280 ? -20.183 -6.667  19.700  1.00 121.86 ? 302 THR A N     1 
ATOM   1832 C CA    . THR A 1 280 ? -21.447 -6.704  20.433  1.00 122.23 ? 302 THR A CA    1 
ATOM   1833 C C     . THR A 1 280 ? -22.008 -5.307  20.707  1.00 122.49 ? 302 THR A C     1 
ATOM   1834 O O     . THR A 1 280 ? -21.285 -4.405  21.132  1.00 122.47 ? 302 THR A O     1 
ATOM   1835 C CB    . THR A 1 280 ? -21.396 -7.610  21.712  1.00 122.15 ? 302 THR A CB    1 
ATOM   1836 O OG1   . THR A 1 280 ? -22.585 -7.396  22.507  1.00 122.51 ? 302 THR A OG1   1 
ATOM   1837 C CG2   . THR A 1 280 ? -20.173 -7.292  22.569  1.00 122.07 ? 302 THR A CG2   1 
ATOM   1838 N N     . GLY A 1 281 ? -23.297 -5.144  20.418  1.00 122.85 ? 303 GLY A N     1 
ATOM   1839 C CA    . GLY A 1 281 ? -23.978 -3.866  20.545  1.00 123.14 ? 303 GLY A CA    1 
ATOM   1840 C C     . GLY A 1 281 ? -24.307 -3.271  19.188  1.00 123.39 ? 303 GLY A C     1 
ATOM   1841 O O     . GLY A 1 281 ? -25.264 -2.509  19.065  1.00 123.46 ? 303 GLY A O     1 
ATOM   1842 N N     . HIS A 1 282 ? -23.522 -3.639  18.172  1.00 123.64 ? 304 HIS A N     1 
ATOM   1843 C CA    . HIS A 1 282 ? -23.587 -3.016  16.837  1.00 123.95 ? 304 HIS A CA    1 
ATOM   1844 C C     . HIS A 1 282 ? -24.586 -3.678  15.868  1.00 123.40 ? 304 HIS A C     1 
ATOM   1845 O O     . HIS A 1 282 ? -24.981 -3.086  14.837  1.00 123.32 ? 304 HIS A O     1 
ATOM   1846 C CB    . HIS A 1 282 ? -22.178 -2.916  16.204  1.00 124.41 ? 304 HIS A CB    1 
ATOM   1847 C CG    . HIS A 1 282 ? -21.160 -2.221  17.070  1.00 126.35 ? 304 HIS A CG    1 
ATOM   1848 N ND1   . HIS A 1 282 ? -20.651 -0.954  16.777  1.00 128.07 ? 304 HIS A ND1   1 
ATOM   1849 C CD2   . HIS A 1 282 ? -20.557 -2.614  18.220  1.00 128.15 ? 304 HIS A CD2   1 
ATOM   1850 C CE1   . HIS A 1 282 ? -19.791 -0.594  17.716  1.00 129.14 ? 304 HIS A CE1   1 
ATOM   1851 N NE2   . HIS A 1 282 ? -19.712 -1.584  18.601  1.00 129.04 ? 304 HIS A NE2   1 
ATOM   1852 N N     . ILE A 1 283 ? -24.997 -4.900  16.220  1.00 122.79 ? 305 ILE A N     1 
ATOM   1853 C CA    . ILE A 1 283 ? -25.899 -5.696  15.389  1.00 122.13 ? 305 ILE A CA    1 
ATOM   1854 C C     . ILE A 1 283 ? -27.312 -5.111  15.390  1.00 121.88 ? 305 ILE A C     1 
ATOM   1855 O O     . ILE A 1 283 ? -27.844 -4.784  16.462  1.00 121.87 ? 305 ILE A O     1 
ATOM   1856 C CB    . ILE A 1 283 ? -25.973 -7.176  15.880  1.00 122.08 ? 305 ILE A CB    1 
ATOM   1857 C CG1   . ILE A 1 283 ? -24.612 -7.666  16.412  1.00 121.89 ? 305 ILE A CG1   1 
ATOM   1858 C CG2   . ILE A 1 283 ? -26.565 -8.095  14.797  1.00 121.55 ? 305 ILE A CG2   1 
ATOM   1859 C CD1   . ILE A 1 283 ? -23.511 -7.799  15.346  1.00 122.14 ? 305 ILE A CD1   1 
ATOM   1860 N N     . PRO A 1 284 ? -27.923 -4.967  14.193  1.00 121.50 ? 306 PRO A N     1 
ATOM   1861 C CA    . PRO A 1 284 ? -29.335 -4.591  14.067  1.00 121.26 ? 306 PRO A CA    1 
ATOM   1862 C C     . PRO A 1 284 ? -30.220 -5.530  14.875  1.00 121.05 ? 306 PRO A C     1 
ATOM   1863 O O     . PRO A 1 284 ? -30.128 -6.746  14.712  1.00 121.16 ? 306 PRO A O     1 
ATOM   1864 C CB    . PRO A 1 284 ? -29.613 -4.784  12.577  1.00 121.11 ? 306 PRO A CB    1 
ATOM   1865 C CG    . PRO A 1 284 ? -28.321 -4.544  11.930  1.00 121.29 ? 306 PRO A CG    1 
ATOM   1866 C CD    . PRO A 1 284 ? -27.265 -5.044  12.877  1.00 121.44 ? 306 PRO A CD    1 
ATOM   1867 N N     . GLY A 1 285 ? -31.059 -4.967  15.740  1.00 120.74 ? 307 GLY A N     1 
ATOM   1868 C CA    . GLY A 1 285 ? -31.921 -5.760  16.612  1.00 120.40 ? 307 GLY A CA    1 
ATOM   1869 C C     . GLY A 1 285 ? -32.562 -6.949  15.922  1.00 120.22 ? 307 GLY A C     1 
ATOM   1870 O O     . GLY A 1 285 ? -32.484 -8.073  16.416  1.00 120.07 ? 307 GLY A O     1 
ATOM   1871 N N     . ASP A 1 286 ? -33.179 -6.698  14.768  1.00 120.03 ? 308 ASP A N     1 
ATOM   1872 C CA    . ASP A 1 286 ? -33.895 -7.727  14.010  1.00 119.95 ? 308 ASP A CA    1 
ATOM   1873 C C     . ASP A 1 286 ? -32.993 -8.870  13.575  1.00 119.75 ? 308 ASP A C     1 
ATOM   1874 O O     . ASP A 1 286 ? -33.442 -10.004 13.375  1.00 119.53 ? 308 ASP A O     1 
ATOM   1875 C CB    . ASP A 1 286 ? -34.529 -7.106  12.774  1.00 120.13 ? 308 ASP A CB    1 
ATOM   1876 C CG    . ASP A 1 286 ? -33.517 -6.390  11.902  1.00 120.60 ? 308 ASP A CG    1 
ATOM   1877 O OD1   . ASP A 1 286 ? -32.904 -5.410  12.392  1.00 121.34 ? 308 ASP A OD1   1 
ATOM   1878 O OD2   . ASP A 1 286 ? -33.338 -6.814  10.733  1.00 121.18 ? 308 ASP A OD2   1 
ATOM   1879 N N     . VAL A 1 287 ? -31.716 -8.551  13.409  1.00 119.80 ? 309 VAL A N     1 
ATOM   1880 C CA    . VAL A 1 287 ? -30.717 -9.541  13.055  1.00 119.91 ? 309 VAL A CA    1 
ATOM   1881 C C     . VAL A 1 287 ? -30.393 -10.363 14.305  1.00 120.04 ? 309 VAL A C     1 
ATOM   1882 O O     . VAL A 1 287 ? -30.397 -11.602 14.266  1.00 119.85 ? 309 VAL A O     1 
ATOM   1883 C CB    . VAL A 1 287 ? -29.455 -8.869  12.466  1.00 119.78 ? 309 VAL A CB    1 
ATOM   1884 C CG1   . VAL A 1 287 ? -28.411 -9.895  12.160  1.00 119.94 ? 309 VAL A CG1   1 
ATOM   1885 C CG2   . VAL A 1 287 ? -29.794 -8.077  11.211  1.00 119.49 ? 309 VAL A CG2   1 
ATOM   1886 N N     . VAL A 1 288 ? -30.147 -9.649  15.409  1.00 120.38 ? 310 VAL A N     1 
ATOM   1887 C CA    . VAL A 1 288 ? -29.955 -10.246 16.736  1.00 120.77 ? 310 VAL A CA    1 
ATOM   1888 C C     . VAL A 1 288 ? -31.095 -11.219 17.025  1.00 121.11 ? 310 VAL A C     1 
ATOM   1889 O O     . VAL A 1 288 ? -30.944 -12.217 17.744  1.00 121.12 ? 310 VAL A O     1 
ATOM   1890 C CB    . VAL A 1 288 ? -29.973 -9.170  17.857  1.00 120.65 ? 310 VAL A CB    1 
ATOM   1891 C CG1   . VAL A 1 288 ? -29.415 -9.749  19.149  1.00 120.49 ? 310 VAL A CG1   1 
ATOM   1892 C CG2   . VAL A 1 288 ? -29.190 -7.933  17.455  1.00 120.56 ? 310 VAL A CG2   1 
ATOM   1893 N N     . ARG A 1 289 ? -32.241 -10.888 16.442  1.00 121.47 ? 311 ARG A N     1 
ATOM   1894 C CA    . ARG A 1 289 ? -33.480 -11.599 16.631  1.00 121.87 ? 311 ARG A CA    1 
ATOM   1895 C C     . ARG A 1 289 ? -33.455 -12.878 15.781  1.00 121.79 ? 311 ARG A C     1 
ATOM   1896 O O     . ARG A 1 289 ? -33.590 -13.994 16.307  1.00 121.80 ? 311 ARG A O     1 
ATOM   1897 C CB    . ARG A 1 289 ? -34.617 -10.641 16.237  1.00 122.10 ? 311 ARG A CB    1 
ATOM   1898 C CG    . ARG A 1 289 ? -36.030 -10.961 16.771  1.00 123.08 ? 311 ARG A CG    1 
ATOM   1899 C CD    . ARG A 1 289 ? -37.090 -10.065 16.071  1.00 124.16 ? 311 ARG A CD    1 
ATOM   1900 N NE    . ARG A 1 289 ? -37.224 -10.394 14.622  1.00 124.83 ? 311 ARG A NE    1 
ATOM   1901 C CZ    . ARG A 1 289 ? -37.638 -9.556  13.664  1.00 124.75 ? 311 ARG A CZ    1 
ATOM   1902 N NH1   . ARG A 1 289 ? -37.710 -9.985  12.392  1.00 125.01 ? 311 ARG A NH1   1 
ATOM   1903 N NH2   . ARG A 1 289 ? -37.966 -8.295  13.959  1.00 124.65 ? 311 ARG A NH2   1 
ATOM   1904 N N     . ASP A 1 290 ? -33.234 -12.717 14.476  1.00 121.73 ? 312 ASP A N     1 
ATOM   1905 C CA    . ASP A 1 290 ? -33.247 -13.849 13.556  1.00 121.78 ? 312 ASP A CA    1 
ATOM   1906 C C     . ASP A 1 290 ? -31.933 -14.591 13.574  1.00 121.70 ? 312 ASP A C     1 
ATOM   1907 O O     . ASP A 1 290 ? -31.648 -15.381 12.680  1.00 121.63 ? 312 ASP A O     1 
ATOM   1908 C CB    . ASP A 1 290 ? -33.523 -13.378 12.130  1.00 121.89 ? 312 ASP A CB    1 
ATOM   1909 C CG    . ASP A 1 290 ? -34.814 -12.624 12.009  1.00 122.23 ? 312 ASP A CG    1 
ATOM   1910 O OD1   . ASP A 1 290 ? -35.730 -12.861 12.828  1.00 122.97 ? 312 ASP A OD1   1 
ATOM   1911 O OD2   . ASP A 1 290 ? -34.919 -11.793 11.089  1.00 122.29 ? 312 ASP A OD2   1 
ATOM   1912 N N     . MET A 1 291 ? -31.142 -14.345 14.606  1.00 121.68 ? 313 MET A N     1 
ATOM   1913 C CA    . MET A 1 291 ? -29.778 -14.831 14.655  1.00 121.82 ? 313 MET A CA    1 
ATOM   1914 C C     . MET A 1 291 ? -29.580 -16.313 14.303  1.00 122.04 ? 313 MET A C     1 
ATOM   1915 O O     . MET A 1 291 ? -28.686 -16.634 13.531  1.00 122.34 ? 313 MET A O     1 
ATOM   1916 C CB    . MET A 1 291 ? -29.136 -14.493 16.002  1.00 121.81 ? 313 MET A CB    1 
ATOM   1917 C CG    . MET A 1 291 ? -27.614 -14.460 15.963  1.00 121.64 ? 313 MET A CG    1 
ATOM   1918 S SD    . MET A 1 291 ? -26.951 -13.616 14.504  1.00 121.56 ? 313 MET A SD    1 
ATOM   1919 C CE    . MET A 1 291 ? -27.161 -11.895 14.973  1.00 120.56 ? 313 MET A CE    1 
ATOM   1920 N N     . ALA A 1 292 ? -30.399 -17.211 14.842  1.00 122.29 ? 314 ALA A N     1 
ATOM   1921 C CA    . ALA A 1 292 ? -30.177 -18.654 14.626  1.00 122.55 ? 314 ALA A CA    1 
ATOM   1922 C C     . ALA A 1 292 ? -30.729 -19.196 13.290  1.00 122.77 ? 314 ALA A C     1 
ATOM   1923 O O     . ALA A 1 292 ? -30.374 -20.311 12.883  1.00 122.72 ? 314 ALA A O     1 
ATOM   1924 C CB    . ALA A 1 292 ? -30.711 -19.470 15.813  1.00 122.70 ? 314 ALA A CB    1 
ATOM   1925 N N     . GLN A 1 293 ? -31.603 -18.419 12.635  1.00 123.04 ? 315 GLN A N     1 
ATOM   1926 C CA    . GLN A 1 293 ? -32.103 -18.730 11.286  1.00 123.39 ? 315 GLN A CA    1 
ATOM   1927 C C     . GLN A 1 293 ? -31.059 -18.335 10.259  1.00 123.21 ? 315 GLN A C     1 
ATOM   1928 O O     . GLN A 1 293 ? -30.741 -19.117 9.358   1.00 123.22 ? 315 GLN A O     1 
ATOM   1929 C CB    . GLN A 1 293 ? -33.410 -17.978 10.953  1.00 123.68 ? 315 GLN A CB    1 
ATOM   1930 C CG    . GLN A 1 293 ? -34.671 -18.491 11.631  1.00 124.83 ? 315 GLN A CG    1 
ATOM   1931 C CD    . GLN A 1 293 ? -34.694 -18.179 13.134  1.00 126.81 ? 315 GLN A CD    1 
ATOM   1932 O OE1   . GLN A 1 293 ? -34.710 -19.099 13.994  1.00 128.17 ? 315 GLN A OE1   1 
ATOM   1933 N NE2   . GLN A 1 293 ? -34.634 -16.883 13.467  1.00 127.13 ? 315 GLN A NE2   1 
ATOM   1934 N N     . ILE A 1 294 ? -30.545 -17.110 10.398  1.00 122.97 ? 316 ILE A N     1 
ATOM   1935 C CA    . ILE A 1 294 ? -29.533 -16.562 9.492   1.00 122.66 ? 316 ILE A CA    1 
ATOM   1936 C C     . ILE A 1 294 ? -28.212 -17.338 9.602   1.00 122.57 ? 316 ILE A C     1 
ATOM   1937 O O     . ILE A 1 294 ? -27.522 -17.527 8.598   1.00 122.71 ? 316 ILE A O     1 
ATOM   1938 C CB    . ILE A 1 294 ? -29.284 -15.039 9.735   1.00 122.61 ? 316 ILE A CB    1 
ATOM   1939 C CG1   . ILE A 1 294 ? -30.616 -14.270 9.841   1.00 122.51 ? 316 ILE A CG1   1 
ATOM   1940 C CG2   . ILE A 1 294 ? -28.398 -14.440 8.618   1.00 122.31 ? 316 ILE A CG2   1 
ATOM   1941 C CD1   . ILE A 1 294 ? -30.498 -12.906 10.525  1.00 122.08 ? 316 ILE A CD1   1 
ATOM   1942 N N     . ALA A 1 295 ? -27.872 -17.794 10.811  1.00 122.38 ? 317 ALA A N     1 
ATOM   1943 C CA    . ALA A 1 295 ? -26.617 -18.510 11.029  1.00 122.18 ? 317 ALA A CA    1 
ATOM   1944 C C     . ALA A 1 295 ? -26.744 -19.737 11.939  1.00 122.08 ? 317 ALA A C     1 
ATOM   1945 O O     . ALA A 1 295 ? -26.325 -19.685 13.099  1.00 122.05 ? 317 ALA A O     1 
ATOM   1946 C CB    . ALA A 1 295 ? -25.561 -17.556 11.563  1.00 122.26 ? 317 ALA A CB    1 
ATOM   1947 N N     . PRO A 1 296 ? -27.307 -20.851 11.412  1.00 122.03 ? 318 PRO A N     1 
ATOM   1948 C CA    . PRO A 1 296 ? -27.390 -22.091 12.186  1.00 122.14 ? 318 PRO A CA    1 
ATOM   1949 C C     . PRO A 1 296 ? -26.015 -22.704 12.436  1.00 122.29 ? 318 PRO A C     1 
ATOM   1950 O O     . PRO A 1 296 ? -25.865 -23.537 13.333  1.00 122.35 ? 318 PRO A O     1 
ATOM   1951 C CB    . PRO A 1 296 ? -28.225 -23.011 11.291  1.00 122.03 ? 318 PRO A CB    1 
ATOM   1952 C CG    . PRO A 1 296 ? -28.034 -22.486 9.935   1.00 121.90 ? 318 PRO A CG    1 
ATOM   1953 C CD    . PRO A 1 296 ? -27.937 -21.006 10.087  1.00 121.97 ? 318 PRO A CD    1 
ATOM   1954 N N     . MET A 1 297 ? -25.027 -22.285 11.647  1.00 122.44 ? 319 MET A N     1 
ATOM   1955 C CA    . MET A 1 297 ? -23.636 -22.694 11.846  1.00 122.52 ? 319 MET A CA    1 
ATOM   1956 C C     . MET A 1 297 ? -23.099 -22.261 13.203  1.00 122.51 ? 319 MET A C     1 
ATOM   1957 O O     . MET A 1 297 ? -22.460 -23.057 13.902  1.00 122.31 ? 319 MET A O     1 
ATOM   1958 C CB    . MET A 1 297 ? -22.735 -22.146 10.735  1.00 122.53 ? 319 MET A CB    1 
ATOM   1959 C CG    . MET A 1 297 ? -22.802 -22.932 9.442   1.00 122.71 ? 319 MET A CG    1 
ATOM   1960 S SD    . MET A 1 297 ? -22.780 -24.710 9.721   1.00 123.42 ? 319 MET A SD    1 
ATOM   1961 C CE    . MET A 1 297 ? -21.098 -24.958 10.319  1.00 123.08 ? 319 MET A CE    1 
ATOM   1962 N N     . LEU A 1 298 ? -23.362 -21.001 13.562  1.00 122.63 ? 320 LEU A N     1 
ATOM   1963 C CA    . LEU A 1 298 ? -22.990 -20.481 14.866  1.00 122.86 ? 320 LEU A CA    1 
ATOM   1964 C C     . LEU A 1 298 ? -23.138 -21.601 15.870  1.00 123.48 ? 320 LEU A C     1 
ATOM   1965 O O     . LEU A 1 298 ? -22.151 -22.051 16.455  1.00 123.68 ? 320 LEU A O     1 
ATOM   1966 C CB    . LEU A 1 298 ? -23.882 -19.302 15.272  1.00 122.51 ? 320 LEU A CB    1 
ATOM   1967 C CG    . LEU A 1 298 ? -23.523 -17.904 14.760  1.00 121.70 ? 320 LEU A CG    1 
ATOM   1968 C CD1   . LEU A 1 298 ? -24.636 -16.960 15.114  1.00 120.97 ? 320 LEU A CD1   1 
ATOM   1969 C CD2   . LEU A 1 298 ? -22.233 -17.397 15.373  1.00 121.12 ? 320 LEU A CD2   1 
ATOM   1970 N N     . ALA A 1 299 ? -24.375 -22.069 16.033  1.00 124.08 ? 321 ALA A N     1 
ATOM   1971 C CA    . ALA A 1 299 ? -24.703 -23.123 16.988  1.00 124.74 ? 321 ALA A CA    1 
ATOM   1972 C C     . ALA A 1 299 ? -23.843 -24.383 16.832  1.00 125.25 ? 321 ALA A C     1 
ATOM   1973 O O     . ALA A 1 299 ? -23.272 -24.878 17.810  1.00 125.34 ? 321 ALA A O     1 
ATOM   1974 C CB    . ALA A 1 299 ? -26.172 -23.467 16.891  1.00 124.73 ? 321 ALA A CB    1 
ATOM   1975 N N     . GLN A 1 300 ? -23.739 -24.882 15.603  1.00 125.78 ? 322 GLN A N     1 
ATOM   1976 C CA    . GLN A 1 300 ? -23.025 -26.124 15.331  1.00 126.43 ? 322 GLN A CA    1 
ATOM   1977 C C     . GLN A 1 300 ? -21.584 -26.030 15.769  1.00 126.13 ? 322 GLN A C     1 
ATOM   1978 O O     . GLN A 1 300 ? -21.027 -26.974 16.346  1.00 126.13 ? 322 GLN A O     1 
ATOM   1979 C CB    . GLN A 1 300 ? -23.071 -26.443 13.839  1.00 126.88 ? 322 GLN A CB    1 
ATOM   1980 C CG    . GLN A 1 300 ? -24.472 -26.697 13.339  1.00 129.72 ? 322 GLN A CG    1 
ATOM   1981 C CD    . GLN A 1 300 ? -24.494 -27.721 12.229  1.00 133.22 ? 322 GLN A CD    1 
ATOM   1982 O OE1   . GLN A 1 300 ? -24.959 -27.419 11.128  1.00 134.94 ? 322 GLN A OE1   1 
ATOM   1983 N NE2   . GLN A 1 300 ? -23.977 -28.945 12.505  1.00 134.55 ? 322 GLN A NE2   1 
ATOM   1984 N N     . LEU A 1 301 ? -20.992 -24.874 15.487  1.00 125.99 ? 323 LEU A N     1 
ATOM   1985 C CA    . LEU A 1 301 ? -19.604 -24.605 15.836  1.00 125.82 ? 323 LEU A CA    1 
ATOM   1986 C C     . LEU A 1 301 ? -19.439 -24.323 17.332  1.00 125.64 ? 323 LEU A C     1 
ATOM   1987 O O     . LEU A 1 301 ? -18.317 -24.124 17.813  1.00 125.62 ? 323 LEU A O     1 
ATOM   1988 C CB    . LEU A 1 301 ? -19.073 -23.422 15.014  1.00 125.87 ? 323 LEU A CB    1 
ATOM   1989 C CG    . LEU A 1 301 ? -18.978 -23.552 13.487  1.00 125.68 ? 323 LEU A CG    1 
ATOM   1990 C CD1   . LEU A 1 301 ? -18.672 -22.201 12.843  1.00 125.41 ? 323 LEU A CD1   1 
ATOM   1991 C CD2   . LEU A 1 301 ? -17.956 -24.608 13.063  1.00 125.51 ? 323 LEU A CD2   1 
ATOM   1992 N N     . GLY A 1 302 ? -20.562 -24.303 18.053  1.00 125.38 ? 324 GLY A N     1 
ATOM   1993 C CA    . GLY A 1 302 ? -20.572 -24.028 19.488  1.00 125.14 ? 324 GLY A CA    1 
ATOM   1994 C C     . GLY A 1 302 ? -20.678 -22.552 19.837  1.00 124.97 ? 324 GLY A C     1 
ATOM   1995 O O     . GLY A 1 302 ? -20.480 -22.179 21.007  1.00 125.02 ? 324 GLY A O     1 
ATOM   1996 N N     . TYR A 1 303 ? -20.966 -21.706 18.824  1.00 124.77 ? 325 TYR A N     1 
ATOM   1997 C CA    . TYR A 1 303 ? -21.238 -20.288 19.062  1.00 124.60 ? 325 TYR A CA    1 
ATOM   1998 C C     . TYR A 1 303 ? -22.723 -20.113 19.359  1.00 124.90 ? 325 TYR A C     1 
ATOM   1999 O O     . TYR A 1 303 ? -23.568 -20.317 18.484  1.00 124.95 ? 325 TYR A O     1 
ATOM   2000 C CB    . TYR A 1 303 ? -20.834 -19.421 17.858  1.00 124.30 ? 325 TYR A CB    1 
ATOM   2001 C CG    . TYR A 1 303 ? -19.346 -19.349 17.581  1.00 123.09 ? 325 TYR A CG    1 
ATOM   2002 C CD1   . TYR A 1 303 ? -18.514 -18.489 18.314  1.00 122.16 ? 325 TYR A CD1   1 
ATOM   2003 C CD2   . TYR A 1 303 ? -18.774 -20.126 16.573  1.00 121.75 ? 325 TYR A CD2   1 
ATOM   2004 C CE1   . TYR A 1 303 ? -17.151 -18.421 18.055  1.00 121.47 ? 325 TYR A CE1   1 
ATOM   2005 C CE2   . TYR A 1 303 ? -17.418 -20.065 16.310  1.00 120.95 ? 325 TYR A CE2   1 
ATOM   2006 C CZ    . TYR A 1 303 ? -16.612 -19.211 17.050  1.00 120.90 ? 325 TYR A CZ    1 
ATOM   2007 O OH    . TYR A 1 303 ? -15.265 -19.153 16.790  1.00 120.25 ? 325 TYR A OH    1 
ATOM   2008 N N     . ASP A 1 304 ? -23.033 -19.749 20.601  1.00 125.21 ? 326 ASP A N     1 
ATOM   2009 C CA    . ASP A 1 304 ? -24.416 -19.530 21.027  1.00 125.43 ? 326 ASP A CA    1 
ATOM   2010 C C     . ASP A 1 304 ? -24.967 -18.284 20.334  1.00 125.48 ? 326 ASP A C     1 
ATOM   2011 O O     . ASP A 1 304 ? -24.660 -17.150 20.745  1.00 125.47 ? 326 ASP A O     1 
ATOM   2012 C CB    . ASP A 1 304 ? -24.494 -19.393 22.558  1.00 125.50 ? 326 ASP A CB    1 
ATOM   2013 C CG    . ASP A 1 304 ? -25.927 -19.397 23.094  1.00 125.57 ? 326 ASP A CG    1 
ATOM   2014 O OD1   . ASP A 1 304 ? -26.090 -19.556 24.326  1.00 126.11 ? 326 ASP A OD1   1 
ATOM   2015 O OD2   . ASP A 1 304 ? -26.885 -19.245 22.307  1.00 125.32 ? 326 ASP A OD2   1 
ATOM   2016 N N     . PRO A 1 305 ? -25.791 -18.495 19.279  1.00 125.57 ? 327 PRO A N     1 
ATOM   2017 C CA    . PRO A 1 305 ? -26.281 -17.387 18.447  1.00 125.76 ? 327 PRO A CA    1 
ATOM   2018 C C     . PRO A 1 305 ? -26.982 -16.278 19.251  1.00 126.07 ? 327 PRO A C     1 
ATOM   2019 O O     . PRO A 1 305 ? -26.997 -15.107 18.834  1.00 125.86 ? 327 PRO A O     1 
ATOM   2020 C CB    . PRO A 1 305 ? -27.258 -18.074 17.478  1.00 125.68 ? 327 PRO A CB    1 
ATOM   2021 C CG    . PRO A 1 305 ? -27.568 -19.406 18.091  1.00 125.56 ? 327 PRO A CG    1 
ATOM   2022 C CD    . PRO A 1 305 ? -26.368 -19.802 18.863  1.00 125.48 ? 327 PRO A CD    1 
ATOM   2023 N N     . TYR A 1 306 ? -27.532 -16.649 20.409  1.00 126.62 ? 328 TYR A N     1 
ATOM   2024 C CA    . TYR A 1 306 ? -28.336 -15.721 21.211  1.00 127.19 ? 328 TYR A CA    1 
ATOM   2025 C C     . TYR A 1 306 ? -27.557 -15.119 22.367  1.00 126.98 ? 328 TYR A C     1 
ATOM   2026 O O     . TYR A 1 306 ? -28.057 -14.216 23.056  1.00 127.06 ? 328 TYR A O     1 
ATOM   2027 C CB    . TYR A 1 306 ? -29.630 -16.394 21.704  1.00 127.56 ? 328 TYR A CB    1 
ATOM   2028 C CG    . TYR A 1 306 ? -30.591 -16.697 20.576  1.00 128.99 ? 328 TYR A CG    1 
ATOM   2029 C CD1   . TYR A 1 306 ? -31.098 -15.595 19.780  1.00 130.37 ? 328 TYR A CD1   1 
ATOM   2030 C CD2   . TYR A 1 306 ? -30.994 -18.079 20.303  1.00 130.50 ? 328 TYR A CD2   1 
ATOM   2031 C CE1   . TYR A 1 306 ? -31.972 -15.849 18.742  1.00 131.66 ? 328 TYR A CE1   1 
ATOM   2032 C CE2   . TYR A 1 306 ? -31.875 -18.352 19.262  1.00 131.70 ? 328 TYR A CE2   1 
ATOM   2033 C CZ    . TYR A 1 306 ? -32.361 -17.225 18.488  1.00 132.26 ? 328 TYR A CZ    1 
ATOM   2034 O OH    . TYR A 1 306 ? -33.244 -17.450 17.460  1.00 133.00 ? 328 TYR A OH    1 
ATOM   2035 N N     . ALA A 1 307 ? -26.337 -15.628 22.580  1.00 126.71 ? 329 ALA A N     1 
ATOM   2036 C CA    . ALA A 1 307 ? -25.427 -15.027 23.541  1.00 126.46 ? 329 ALA A CA    1 
ATOM   2037 C C     . ALA A 1 307 ? -24.899 -13.782 22.868  1.00 126.26 ? 329 ALA A C     1 
ATOM   2038 O O     . ALA A 1 307 ? -24.531 -13.825 21.691  1.00 126.30 ? 329 ALA A O     1 
ATOM   2039 C CB    . ALA A 1 307 ? -24.307 -15.984 23.884  1.00 126.38 ? 329 ALA A CB    1 
ATOM   2040 N N     . ASN A 1 308 ? -24.897 -12.670 23.602  1.00 126.10 ? 330 ASN A N     1 
ATOM   2041 C CA    . ASN A 1 308 ? -24.623 -11.376 22.989  1.00 126.08 ? 330 ASN A CA    1 
ATOM   2042 C C     . ASN A 1 308 ? -23.663 -10.490 23.796  1.00 125.83 ? 330 ASN A C     1 
ATOM   2043 O O     . ASN A 1 308 ? -24.089 -9.488  24.375  1.00 125.88 ? 330 ASN A O     1 
ATOM   2044 C CB    . ASN A 1 308 ? -25.955 -10.655 22.701  1.00 126.22 ? 330 ASN A CB    1 
ATOM   2045 C CG    . ASN A 1 308 ? -26.674 -11.189 21.456  1.00 126.85 ? 330 ASN A CG    1 
ATOM   2046 O OD1   . ASN A 1 308 ? -26.645 -10.546 20.398  1.00 128.13 ? 330 ASN A OD1   1 
ATOM   2047 N ND2   . ASN A 1 308 ? -27.307 -12.368 21.568  1.00 127.05 ? 330 ASN A ND2   1 
ATOM   2048 N N     . PRO A 1 309 ? -22.359 -10.840 23.828  1.00 125.55 ? 331 PRO A N     1 
ATOM   2049 C CA    . PRO A 1 309 ? -21.665 -11.974 23.207  1.00 125.38 ? 331 PRO A CA    1 
ATOM   2050 C C     . PRO A 1 309 ? -21.813 -13.263 24.030  1.00 125.21 ? 331 PRO A C     1 
ATOM   2051 O O     . PRO A 1 309 ? -22.511 -13.239 25.037  1.00 125.40 ? 331 PRO A O     1 
ATOM   2052 C CB    . PRO A 1 309 ? -20.216 -11.509 23.208  1.00 125.34 ? 331 PRO A CB    1 
ATOM   2053 C CG    . PRO A 1 309 ? -20.106 -10.648 24.389  1.00 125.34 ? 331 PRO A CG    1 
ATOM   2054 C CD    . PRO A 1 309 ? -21.413 -9.949  24.542  1.00 125.49 ? 331 PRO A CD    1 
ATOM   2055 N N     . PRO A 1 310 ? -21.208 -14.394 23.588  1.00 124.92 ? 332 PRO A N     1 
ATOM   2056 C CA    . PRO A 1 310 ? -21.064 -15.499 24.545  1.00 124.74 ? 332 PRO A CA    1 
ATOM   2057 C C     . PRO A 1 310 ? -19.982 -15.164 25.558  1.00 124.56 ? 332 PRO A C     1 
ATOM   2058 O O     . PRO A 1 310 ? -19.405 -14.076 25.497  1.00 124.61 ? 332 PRO A O     1 
ATOM   2059 C CB    . PRO A 1 310 ? -20.615 -16.676 23.669  1.00 124.64 ? 332 PRO A CB    1 
ATOM   2060 C CG    . PRO A 1 310 ? -21.042 -16.329 22.306  1.00 124.73 ? 332 PRO A CG    1 
ATOM   2061 C CD    . PRO A 1 310 ? -20.946 -14.838 22.207  1.00 124.91 ? 332 PRO A CD    1 
ATOM   2062 N N     . ASN A 1 311 ? -19.715 -16.066 26.498  1.00 124.35 ? 333 ASN A N     1 
ATOM   2063 C CA    . ASN A 1 311 ? -18.483 -15.945 27.261  1.00 124.28 ? 333 ASN A CA    1 
ATOM   2064 C C     . ASN A 1 311 ? -17.441 -16.840 26.604  1.00 124.21 ? 333 ASN A C     1 
ATOM   2065 O O     . ASN A 1 311 ? -17.549 -18.075 26.636  1.00 124.16 ? 333 ASN A O     1 
ATOM   2066 C CB    . ASN A 1 311 ? -18.672 -16.281 28.747  1.00 124.31 ? 333 ASN A CB    1 
ATOM   2067 C CG    . ASN A 1 311 ? -17.411 -15.978 29.596  1.00 124.45 ? 333 ASN A CG    1 
ATOM   2068 O OD1   . ASN A 1 311 ? -17.171 -16.633 30.619  1.00 124.68 ? 333 ASN A OD1   1 
ATOM   2069 N ND2   . ASN A 1 311 ? -16.607 -14.990 29.169  1.00 123.78 ? 333 ASN A ND2   1 
ATOM   2070 N N     . TYR A 1 312 ? -16.449 -16.200 25.982  1.00 124.16 ? 334 TYR A N     1 
ATOM   2071 C CA    . TYR A 1 312 ? -15.428 -16.909 25.213  1.00 124.10 ? 334 TYR A CA    1 
ATOM   2072 C C     . TYR A 1 312 ? -14.405 -17.606 26.115  1.00 124.25 ? 334 TYR A C     1 
ATOM   2073 O O     . TYR A 1 312 ? -13.928 -18.701 25.802  1.00 124.12 ? 334 TYR A O     1 
ATOM   2074 C CB    . TYR A 1 312 ? -14.725 -15.952 24.247  1.00 123.94 ? 334 TYR A CB    1 
ATOM   2075 C CG    . TYR A 1 312 ? -15.598 -15.370 23.146  1.00 123.38 ? 334 TYR A CG    1 
ATOM   2076 C CD1   . TYR A 1 312 ? -16.385 -16.192 22.330  1.00 122.95 ? 334 TYR A CD1   1 
ATOM   2077 C CD2   . TYR A 1 312 ? -15.601 -13.996 22.892  1.00 123.08 ? 334 TYR A CD2   1 
ATOM   2078 C CE1   . TYR A 1 312 ? -17.178 -15.652 21.301  1.00 122.99 ? 334 TYR A CE1   1 
ATOM   2079 C CE2   . TYR A 1 312 ? -16.383 -13.445 21.866  1.00 123.06 ? 334 TYR A CE2   1 
ATOM   2080 C CZ    . TYR A 1 312 ? -17.171 -14.277 21.072  1.00 123.05 ? 334 TYR A CZ    1 
ATOM   2081 O OH    . TYR A 1 312 ? -17.945 -13.733 20.057  1.00 122.68 ? 334 TYR A OH    1 
ATOM   2082 N N     . GLY A 1 313 ? -14.082 -16.965 27.236  1.00 124.45 ? 335 GLY A N     1 
ATOM   2083 C CA    . GLY A 1 313 ? -13.154 -17.524 28.214  1.00 124.84 ? 335 GLY A CA    1 
ATOM   2084 C C     . GLY A 1 313 ? -12.428 -16.456 29.022  1.00 125.20 ? 335 GLY A C     1 
ATOM   2085 O O     . GLY A 1 313 ? -12.865 -15.296 29.092  1.00 125.26 ? 335 GLY A O     1 
ATOM   2086 N N     . ASN A 1 314 ? -11.314 -16.853 29.633  1.00 125.50 ? 336 ASN A N     1 
ATOM   2087 C CA    . ASN A 1 314 ? -10.511 -15.949 30.455  1.00 125.79 ? 336 ASN A CA    1 
ATOM   2088 C C     . ASN A 1 314 ? -9.059  -15.850 29.975  1.00 125.77 ? 336 ASN A C     1 
ATOM   2089 O O     . ASN A 1 314 ? -8.416  -16.880 29.717  1.00 125.71 ? 336 ASN A O     1 
ATOM   2090 C CB    . ASN A 1 314 ? -10.579 -16.357 31.935  1.00 125.96 ? 336 ASN A CB    1 
ATOM   2091 C CG    . ASN A 1 314 ? -11.950 -16.089 32.558  1.00 126.39 ? 336 ASN A CG    1 
ATOM   2092 O OD1   . ASN A 1 314 ? -12.496 -14.988 32.454  1.00 127.07 ? 336 ASN A OD1   1 
ATOM   2093 N ND2   . ASN A 1 314 ? -12.503 -17.099 33.218  1.00 126.90 ? 336 ASN A ND2   1 
ATOM   2094 N N     . PRO A 1 315 ? -8.544  -14.607 29.852  1.00 125.83 ? 337 PRO A N     1 
ATOM   2095 C CA    . PRO A 1 315 ? -7.218  -14.348 29.258  1.00 126.06 ? 337 PRO A CA    1 
ATOM   2096 C C     . PRO A 1 315 ? -5.996  -14.849 30.066  1.00 126.20 ? 337 PRO A C     1 
ATOM   2097 O O     . PRO A 1 315 ? -6.019  -14.821 31.297  1.00 126.20 ? 337 PRO A O     1 
ATOM   2098 C CB    . PRO A 1 315 ? -7.192  -12.813 29.115  1.00 126.14 ? 337 PRO A CB    1 
ATOM   2099 C CG    . PRO A 1 315 ? -8.241  -12.298 30.075  1.00 125.74 ? 337 PRO A CG    1 
ATOM   2100 C CD    . PRO A 1 315 ? -9.286  -13.356 30.143  1.00 125.65 ? 337 PRO A CD    1 
ATOM   2101 N N     . ASP A 1 316 ? -4.950  -15.309 29.367  1.00 126.32 ? 338 ASP A N     1 
ATOM   2102 C CA    . ASP A 1 316 ? -3.652  -15.600 29.996  1.00 126.40 ? 338 ASP A CA    1 
ATOM   2103 C C     . ASP A 1 316 ? -2.987  -14.286 30.384  1.00 126.13 ? 338 ASP A C     1 
ATOM   2104 O O     . ASP A 1 316 ? -3.246  -13.255 29.740  1.00 126.16 ? 338 ASP A O     1 
ATOM   2105 C CB    . ASP A 1 316 ? -2.705  -16.358 29.049  1.00 126.71 ? 338 ASP A CB    1 
ATOM   2106 C CG    . ASP A 1 316 ? -2.964  -17.890 29.020  1.00 127.55 ? 338 ASP A CG    1 
ATOM   2107 O OD1   . ASP A 1 316 ? -3.614  -18.454 29.851  1.00 128.13 ? 338 ASP A OD1   1 
ATOM   2108 O OD2   . ASP A 1 316 ? -2.502  -18.530 28.033  1.00 128.57 ? 338 ASP A OD2   1 
ATOM   2109 N N     . PRO A 1 317 ? -2.107  -14.316 31.422  1.00 125.83 ? 339 PRO A N     1 
ATOM   2110 C CA    . PRO A 1 317 ? -1.452  -13.086 31.844  1.00 125.58 ? 339 PRO A CA    1 
ATOM   2111 C C     . PRO A 1 317 ? -0.708  -12.499 30.664  1.00 125.49 ? 339 PRO A C     1 
ATOM   2112 O O     . PRO A 1 317 ? -0.745  -11.282 30.447  1.00 125.43 ? 339 PRO A O     1 
ATOM   2113 C CB    . PRO A 1 317 ? -0.453  -13.568 32.907  1.00 125.54 ? 339 PRO A CB    1 
ATOM   2114 C CG    . PRO A 1 317 ? -1.028  -14.860 33.424  1.00 125.78 ? 339 PRO A CG    1 
ATOM   2115 C CD    . PRO A 1 317 ? -1.670  -15.520 32.236  1.00 125.84 ? 339 PRO A CD    1 
ATOM   2116 N N     . PHE A 1 318 ? -0.069  -13.386 29.900  1.00 125.49 ? 340 PHE A N     1 
ATOM   2117 C CA    . PHE A 1 318 ? 0.688   -13.024 28.709  1.00 125.58 ? 340 PHE A CA    1 
ATOM   2118 C C     . PHE A 1 318 ? -0.073  -12.033 27.836  1.00 125.48 ? 340 PHE A C     1 
ATOM   2119 O O     . PHE A 1 318 ? 0.437   -10.950 27.523  1.00 125.35 ? 340 PHE A O     1 
ATOM   2120 C CB    . PHE A 1 318 ? 1.071   -14.289 27.916  1.00 125.74 ? 340 PHE A CB    1 
ATOM   2121 C CG    . PHE A 1 318 ? 1.734   -14.014 26.581  1.00 126.50 ? 340 PHE A CG    1 
ATOM   2122 C CD1   . PHE A 1 318 ? 1.312   -14.730 25.431  1.00 127.15 ? 340 PHE A CD1   1 
ATOM   2123 C CD2   . PHE A 1 318 ? 2.780   -13.044 26.475  1.00 127.43 ? 340 PHE A CD2   1 
ATOM   2124 C CE1   . PHE A 1 318 ? 1.915   -14.480 24.196  1.00 127.45 ? 340 PHE A CE1   1 
ATOM   2125 C CE2   . PHE A 1 318 ? 3.384   -12.786 25.243  1.00 127.81 ? 340 PHE A CE2   1 
ATOM   2126 C CZ    . PHE A 1 318 ? 2.952   -13.510 24.105  1.00 127.67 ? 340 PHE A CZ    1 
ATOM   2127 N N     . VAL A 1 319 ? -1.305  -12.401 27.482  1.00 125.43 ? 341 VAL A N     1 
ATOM   2128 C CA    . VAL A 1 319 ? -2.111  -11.631 26.541  1.00 125.34 ? 341 VAL A CA    1 
ATOM   2129 C C     . VAL A 1 319 ? -2.526  -10.301 27.136  1.00 125.16 ? 341 VAL A C     1 
ATOM   2130 O O     . VAL A 1 319 ? -2.430  -9.257  26.481  1.00 125.03 ? 341 VAL A O     1 
ATOM   2131 C CB    . VAL A 1 319 ? -3.377  -12.393 26.109  1.00 125.39 ? 341 VAL A CB    1 
ATOM   2132 C CG1   . VAL A 1 319 ? -3.827  -11.906 24.743  1.00 125.70 ? 341 VAL A CG1   1 
ATOM   2133 C CG2   . VAL A 1 319 ? -3.117  -13.882 26.064  1.00 125.56 ? 341 VAL A CG2   1 
ATOM   2134 N N     . ILE A 1 320 ? -2.994  -10.350 28.381  1.00 125.10 ? 342 ILE A N     1 
ATOM   2135 C CA    . ILE A 1 320 ? -3.389  -9.143  29.080  1.00 125.07 ? 342 ILE A CA    1 
ATOM   2136 C C     . ILE A 1 320 ? -2.236  -8.152  29.003  1.00 125.14 ? 342 ILE A C     1 
ATOM   2137 O O     . ILE A 1 320 ? -2.394  -7.041  28.478  1.00 125.09 ? 342 ILE A O     1 
ATOM   2138 C CB    . ILE A 1 320 ? -3.802  -9.432  30.540  1.00 125.03 ? 342 ILE A CB    1 
ATOM   2139 C CG1   . ILE A 1 320 ? -4.994  -10.397 30.564  1.00 124.81 ? 342 ILE A CG1   1 
ATOM   2140 C CG2   . ILE A 1 320 ? -4.155  -8.132  31.266  1.00 125.00 ? 342 ILE A CG2   1 
ATOM   2141 C CD1   . ILE A 1 320 ? -5.229  -11.089 31.893  1.00 124.71 ? 342 ILE A CD1   1 
ATOM   2142 N N     . ASN A 1 321 ? -1.067  -8.583  29.478  1.00 125.26 ? 343 ASN A N     1 
ATOM   2143 C CA    . ASN A 1 321 ? 0.113   -7.737  29.463  1.00 125.43 ? 343 ASN A CA    1 
ATOM   2144 C C     . ASN A 1 321 ? 0.421   -7.201  28.083  1.00 125.11 ? 343 ASN A C     1 
ATOM   2145 O O     . ASN A 1 321 ? 0.788   -6.035  27.938  1.00 125.21 ? 343 ASN A O     1 
ATOM   2146 C CB    . ASN A 1 321 ? 1.317   -8.466  30.054  1.00 125.78 ? 343 ASN A CB    1 
ATOM   2147 C CG    . ASN A 1 321 ? 1.340   -8.396  31.594  1.00 127.26 ? 343 ASN A CG    1 
ATOM   2148 O OD1   . ASN A 1 321 ? 0.365   -7.936  32.201  1.00 128.93 ? 343 ASN A OD1   1 
ATOM   2149 N ND2   . ASN A 1 321 ? 2.455   -8.847  32.234  1.00 128.58 ? 343 ASN A ND2   1 
ATOM   2150 N N     . ASN A 1 322 ? 0.250   -8.043  27.070  1.00 124.70 ? 344 ASN A N     1 
ATOM   2151 C CA    . ASN A 1 322 ? 0.432   -7.595  25.703  1.00 124.34 ? 344 ASN A CA    1 
ATOM   2152 C C     . ASN A 1 322 ? -0.540  -6.463  25.391  1.00 124.12 ? 344 ASN A C     1 
ATOM   2153 O O     . ASN A 1 322 ? -0.133  -5.396  24.928  1.00 123.88 ? 344 ASN A O     1 
ATOM   2154 C CB    . ASN A 1 322 ? 0.267   -8.763  24.727  1.00 124.42 ? 344 ASN A CB    1 
ATOM   2155 C CG    . ASN A 1 322 ? 1.324   -9.857  24.927  1.00 124.55 ? 344 ASN A CG    1 
ATOM   2156 O OD1   . ASN A 1 322 ? 2.264   -9.709  25.712  1.00 124.42 ? 344 ASN A OD1   1 
ATOM   2157 N ND2   . ASN A 1 322 ? 1.166   -10.963 24.209  1.00 125.02 ? 344 ASN A ND2   1 
ATOM   2158 N N     . THR A 1 323 ? -1.817  -6.691  25.700  1.00 123.97 ? 345 THR A N     1 
ATOM   2159 C CA    . THR A 1 323 ? -2.882  -5.741  25.398  1.00 123.86 ? 345 THR A CA    1 
ATOM   2160 C C     . THR A 1 323 ? -2.584  -4.412  26.036  1.00 124.06 ? 345 THR A C     1 
ATOM   2161 O O     . THR A 1 323 ? -2.749  -3.360  25.422  1.00 123.94 ? 345 THR A O     1 
ATOM   2162 C CB    . THR A 1 323 ? -4.218  -6.222  25.941  1.00 123.71 ? 345 THR A CB    1 
ATOM   2163 O OG1   . THR A 1 323 ? -4.335  -7.634  25.698  1.00 123.42 ? 345 THR A OG1   1 
ATOM   2164 C CG2   . THR A 1 323 ? -5.376  -5.474  25.256  1.00 123.52 ? 345 THR A CG2   1 
ATOM   2165 N N     . GLN A 1 324 ? -2.147  -4.481  27.289  1.00 124.46 ? 346 GLN A N     1 
ATOM   2166 C CA    . GLN A 1 324 ? -1.747  -3.301  28.016  1.00 125.03 ? 346 GLN A CA    1 
ATOM   2167 C C     . GLN A 1 324 ? -0.696  -2.572  27.195  1.00 125.38 ? 346 GLN A C     1 
ATOM   2168 O O     . GLN A 1 324 ? -0.865  -1.380  26.854  1.00 125.41 ? 346 GLN A O     1 
ATOM   2169 C CB    . GLN A 1 324 ? -1.193  -3.683  29.401  1.00 125.07 ? 346 GLN A CB    1 
ATOM   2170 C CG    . GLN A 1 324 ? -2.256  -4.134  30.410  1.00 125.21 ? 346 GLN A CG    1 
ATOM   2171 C CD    . GLN A 1 324 ? -3.249  -3.033  30.754  1.00 125.44 ? 346 GLN A CD    1 
ATOM   2172 O OE1   . GLN A 1 324 ? -2.859  -1.859  30.878  1.00 125.76 ? 346 GLN A OE1   1 
ATOM   2173 N NE2   . GLN A 1 324 ? -4.538  -3.406  30.911  1.00 124.97 ? 346 GLN A NE2   1 
ATOM   2174 N N     . ARG A 1 325 ? 0.367   -3.304  26.848  1.00 125.86 ? 347 ARG A N     1 
ATOM   2175 C CA    . ARG A 1 325 ? 1.448   -2.738  26.056  1.00 126.50 ? 347 ARG A CA    1 
ATOM   2176 C C     . ARG A 1 325 ? 0.883   -2.023  24.846  1.00 126.74 ? 347 ARG A C     1 
ATOM   2177 O O     . ARG A 1 325 ? 1.408   -0.986  24.437  1.00 126.94 ? 347 ARG A O     1 
ATOM   2178 C CB    . ARG A 1 325 ? 2.427   -3.814  25.589  1.00 126.60 ? 347 ARG A CB    1 
ATOM   2179 C CG    . ARG A 1 325 ? 3.424   -4.257  26.655  1.00 127.69 ? 347 ARG A CG    1 
ATOM   2180 C CD    . ARG A 1 325 ? 4.766   -4.683  26.032  1.00 129.57 ? 347 ARG A CD    1 
ATOM   2181 N NE    . ARG A 1 325 ? 4.606   -5.547  24.855  1.00 130.76 ? 347 ARG A NE    1 
ATOM   2182 C CZ    . ARG A 1 325 ? 4.432   -6.873  24.897  1.00 131.51 ? 347 ARG A CZ    1 
ATOM   2183 N NH1   . ARG A 1 325 ? 4.382   -7.530  26.061  1.00 131.92 ? 347 ARG A NH1   1 
ATOM   2184 N NH2   . ARG A 1 325 ? 4.307   -7.551  23.763  1.00 131.71 ? 347 ARG A NH2   1 
ATOM   2185 N N     . VAL A 1 326 ? -0.193  -2.576  24.286  1.00 126.97 ? 348 VAL A N     1 
ATOM   2186 C CA    . VAL A 1 326 ? -0.780  -2.033  23.071  1.00 127.22 ? 348 VAL A CA    1 
ATOM   2187 C C     . VAL A 1 326 ? -1.400  -0.665  23.340  1.00 127.64 ? 348 VAL A C     1 
ATOM   2188 O O     . VAL A 1 326 ? -1.228  0.273   22.567  1.00 127.46 ? 348 VAL A O     1 
ATOM   2189 C CB    . VAL A 1 326 ? -1.798  -3.009  22.456  1.00 127.09 ? 348 VAL A CB    1 
ATOM   2190 C CG1   . VAL A 1 326 ? -2.644  -2.308  21.431  1.00 127.02 ? 348 VAL A CG1   1 
ATOM   2191 C CG2   . VAL A 1 326 ? -1.083  -4.204  21.829  1.00 126.92 ? 348 VAL A CG2   1 
ATOM   2192 N N     . LEU A 1 327 ? -2.089  -0.550  24.464  1.00 128.49 ? 349 LEU A N     1 
ATOM   2193 C CA    . LEU A 1 327 ? -2.740  0.698   24.828  1.00 129.51 ? 349 LEU A CA    1 
ATOM   2194 C C     . LEU A 1 327 ? -1.736  1.802   25.129  1.00 130.73 ? 349 LEU A C     1 
ATOM   2195 O O     . LEU A 1 327 ? -2.013  2.991   24.926  1.00 130.59 ? 349 LEU A O     1 
ATOM   2196 C CB    . LEU A 1 327 ? -3.645  0.456   26.025  1.00 129.07 ? 349 LEU A CB    1 
ATOM   2197 C CG    . LEU A 1 327 ? -4.548  -0.767  25.749  1.00 128.10 ? 349 LEU A CG    1 
ATOM   2198 C CD1   . LEU A 1 327 ? -5.090  -1.344  27.037  1.00 127.09 ? 349 LEU A CD1   1 
ATOM   2199 C CD2   . LEU A 1 327 ? -5.675  -0.384  24.777  1.00 126.96 ? 349 LEU A CD2   1 
ATOM   2200 N N     . LYS A 1 328 ? -0.563  1.388   25.605  1.00 132.56 ? 350 LYS A N     1 
ATOM   2201 C CA    . LYS A 1 328 ? 0.522   2.314   25.938  1.00 134.49 ? 350 LYS A CA    1 
ATOM   2202 C C     . LYS A 1 328 ? 1.232   2.887   24.695  1.00 135.60 ? 350 LYS A C     1 
ATOM   2203 O O     . LYS A 1 328 ? 1.925   3.908   24.783  1.00 135.81 ? 350 LYS A O     1 
ATOM   2204 C CB    . LYS A 1 328 ? 1.537   1.642   26.885  1.00 134.53 ? 350 LYS A CB    1 
ATOM   2205 C CG    . LYS A 1 328 ? 1.098   1.570   28.351  1.00 135.25 ? 350 LYS A CG    1 
ATOM   2206 C CD    . LYS A 1 328 ? 1.897   0.535   29.147  1.00 136.34 ? 350 LYS A CD    1 
ATOM   2207 C CE    . LYS A 1 328 ? 1.328   0.394   30.609  1.00 137.07 ? 350 LYS A CE    1 
ATOM   2208 N NZ    . LYS A 1 328 ? 1.829   -0.853  31.270  1.00 137.43 ? 350 LYS A NZ    1 
ATOM   2209 N N     . GLY A 1 329 ? 1.067   2.225   23.550  1.00 136.85 ? 351 GLY A N     1 
ATOM   2210 C CA    . GLY A 1 329 ? 1.673   2.680   22.294  1.00 138.40 ? 351 GLY A CA    1 
ATOM   2211 C C     . GLY A 1 329 ? 3.060   2.132   21.982  1.00 139.51 ? 351 GLY A C     1 
ATOM   2212 O O     . GLY A 1 329 ? 3.911   2.854   21.444  1.00 139.72 ? 351 GLY A O     1 
ATOM   2213 N N     . ASP A 1 330 ? 3.286   0.859   22.314  1.00 140.47 ? 352 ASP A N     1 
ATOM   2214 C CA    . ASP A 1 330 ? 4.536   0.162   21.983  1.00 141.31 ? 352 ASP A CA    1 
ATOM   2215 C C     . ASP A 1 330 ? 4.525   -0.248  20.512  1.00 141.37 ? 352 ASP A C     1 
ATOM   2216 O O     . ASP A 1 330 ? 5.480   0.082   19.760  1.00 141.51 ? 352 ASP A O     1 
ATOM   2217 C CB    . ASP A 1 330 ? 4.729   -1.084  22.867  1.00 141.67 ? 352 ASP A CB    1 
ATOM   2218 C CG    . ASP A 1 330 ? 4.957   -0.746  24.347  1.00 142.72 ? 352 ASP A CG    1 
ATOM   2219 O OD1   . ASP A 1 330 ? 4.871   0.449   24.731  1.00 143.89 ? 352 ASP A OD1   1 
ATOM   2220 O OD2   . ASP A 1 330 ? 5.220   -1.689  25.135  1.00 143.58 ? 352 ASP A OD2   1 
ATOM   2221 N N     . VAL B 1 39  ? 13.086  -43.470 -22.305 1.00 145.46 ? 61  VAL B N     1 
ATOM   2222 C CA    . VAL B 1 39  ? 12.956  -42.452 -21.177 1.00 145.50 ? 61  VAL B CA    1 
ATOM   2223 C C     . VAL B 1 39  ? 13.125  -41.042 -21.740 1.00 145.21 ? 61  VAL B C     1 
ATOM   2224 O O     . VAL B 1 39  ? 14.230  -40.640 -22.110 1.00 145.19 ? 61  VAL B O     1 
ATOM   2225 C CB    . VAL B 1 39  ? 14.018  -42.694 -20.029 1.00 145.65 ? 61  VAL B CB    1 
ATOM   2226 C CG1   . VAL B 1 39  ? 13.863  -41.650 -18.878 1.00 145.81 ? 61  VAL B CG1   1 
ATOM   2227 C CG2   . VAL B 1 39  ? 13.893  -44.115 -19.483 1.00 145.94 ? 61  VAL B CG2   1 
ATOM   2228 N N     . TYR B 1 40  ? 12.021  -40.300 -21.809 1.00 144.83 ? 62  TYR B N     1 
ATOM   2229 C CA    . TYR B 1 40  ? 12.052  -38.924 -22.297 1.00 144.43 ? 62  TYR B CA    1 
ATOM   2230 C C     . TYR B 1 40  ? 11.995  -37.919 -21.154 1.00 143.84 ? 62  TYR B C     1 
ATOM   2231 O O     . TYR B 1 40  ? 11.103  -37.958 -20.297 1.00 143.90 ? 62  TYR B O     1 
ATOM   2232 C CB    . TYR B 1 40  ? 10.927  -38.656 -23.305 1.00 144.72 ? 62  TYR B CB    1 
ATOM   2233 C CG    . TYR B 1 40  ? 11.021  -39.460 -24.596 1.00 145.42 ? 62  TYR B CG    1 
ATOM   2234 C CD1   . TYR B 1 40  ? 11.776  -38.995 -25.691 1.00 145.82 ? 62  TYR B CD1   1 
ATOM   2235 C CD2   . TYR B 1 40  ? 10.342  -40.679 -24.728 1.00 146.12 ? 62  TYR B CD2   1 
ATOM   2236 C CE1   . TYR B 1 40  ? 11.862  -39.733 -26.879 1.00 145.93 ? 62  TYR B CE1   1 
ATOM   2237 C CE2   . TYR B 1 40  ? 10.423  -41.422 -25.910 1.00 146.42 ? 62  TYR B CE2   1 
ATOM   2238 C CZ    . TYR B 1 40  ? 11.183  -40.942 -26.978 1.00 146.24 ? 62  TYR B CZ    1 
ATOM   2239 O OH    . TYR B 1 40  ? 11.256  -41.678 -28.140 1.00 146.38 ? 62  TYR B OH    1 
ATOM   2240 N N     . ARG B 1 41  ? 12.970  -37.022 -21.148 1.00 143.00 ? 63  ARG B N     1 
ATOM   2241 C CA    . ARG B 1 41  ? 13.007  -35.946 -20.186 1.00 142.18 ? 63  ARG B CA    1 
ATOM   2242 C C     . ARG B 1 41  ? 12.379  -34.702 -20.764 1.00 141.17 ? 63  ARG B C     1 
ATOM   2243 O O     . ARG B 1 41  ? 12.157  -34.613 -21.996 1.00 141.13 ? 63  ARG B O     1 
ATOM   2244 C CB    . ARG B 1 41  ? 14.439  -35.649 -19.794 1.00 142.45 ? 63  ARG B CB    1 
ATOM   2245 C CG    . ARG B 1 41  ? 14.922  -36.505 -18.675 1.00 143.82 ? 63  ARG B CG    1 
ATOM   2246 C CD    . ARG B 1 41  ? 16.118  -35.851 -18.022 1.00 146.53 ? 63  ARG B CD    1 
ATOM   2247 N NE    . ARG B 1 41  ? 16.252  -36.276 -16.631 1.00 148.44 ? 63  ARG B NE    1 
ATOM   2248 C CZ    . ARG B 1 41  ? 16.879  -37.390 -16.232 1.00 149.43 ? 63  ARG B CZ    1 
ATOM   2249 N NH1   . ARG B 1 41  ? 17.448  -38.207 -17.118 1.00 149.77 ? 63  ARG B NH1   1 
ATOM   2250 N NH2   . ARG B 1 41  ? 16.935  -37.687 -14.939 1.00 150.07 ? 63  ARG B NH2   1 
ATOM   2251 N N     . TYR B 1 42  ? 12.108  -33.734 -19.859 1.00 139.87 ? 64  TYR B N     1 
ATOM   2252 C CA    . TYR B 1 42  ? 11.516  -32.479 -20.269 1.00 138.59 ? 64  TYR B CA    1 
ATOM   2253 C C     . TYR B 1 42  ? 11.869  -31.357 -19.300 1.00 137.59 ? 64  TYR B C     1 
ATOM   2254 O O     . TYR B 1 42  ? 12.137  -31.608 -18.108 1.00 137.56 ? 64  TYR B O     1 
ATOM   2255 C CB    . TYR B 1 42  ? 9.999   -32.645 -20.432 1.00 138.71 ? 64  TYR B CB    1 
ATOM   2256 C CG    . TYR B 1 42  ? 9.216   -33.063 -19.181 1.00 139.04 ? 64  TYR B CG    1 
ATOM   2257 C CD1   . TYR B 1 42  ? 8.105   -32.272 -18.754 1.00 139.03 ? 64  TYR B CD1   1 
ATOM   2258 C CD2   . TYR B 1 42  ? 9.507   -34.262 -18.446 1.00 139.12 ? 64  TYR B CD2   1 
ATOM   2259 C CE1   . TYR B 1 42  ? 7.357   -32.641 -17.625 1.00 138.75 ? 64  TYR B CE1   1 
ATOM   2260 C CE2   . TYR B 1 42  ? 8.681   -34.639 -17.306 1.00 138.88 ? 64  TYR B CE2   1 
ATOM   2261 C CZ    . TYR B 1 42  ? 7.709   -33.820 -16.910 1.00 138.74 ? 64  TYR B CZ    1 
ATOM   2262 O OH    . TYR B 1 42  ? 6.959   -34.163 -15.806 1.00 138.77 ? 64  TYR B OH    1 
ATOM   2263 N N     . GLY B 1 43  ? 11.889  -30.125 -19.826 1.00 136.39 ? 65  GLY B N     1 
ATOM   2264 C CA    . GLY B 1 43  ? 12.235  -28.965 -19.019 1.00 135.05 ? 65  GLY B CA    1 
ATOM   2265 C C     . GLY B 1 43  ? 12.125  -27.669 -19.785 1.00 134.22 ? 65  GLY B C     1 
ATOM   2266 O O     . GLY B 1 43  ? 12.185  -27.649 -21.014 1.00 134.25 ? 65  GLY B O     1 
ATOM   2267 N N     . LYS B 1 44  ? 11.955  -26.589 -19.031 1.00 133.46 ? 66  LYS B N     1 
ATOM   2268 C CA    . LYS B 1 44  ? 11.868  -25.211 -19.519 1.00 132.94 ? 66  LYS B CA    1 
ATOM   2269 C C     . LYS B 1 44  ? 12.479  -24.925 -20.887 1.00 132.21 ? 66  LYS B C     1 
ATOM   2270 O O     . LYS B 1 44  ? 11.907  -24.203 -21.704 1.00 132.07 ? 66  LYS B O     1 
ATOM   2271 C CB    . LYS B 1 44  ? 12.607  -24.338 -18.519 1.00 133.30 ? 66  LYS B CB    1 
ATOM   2272 C CG    . LYS B 1 44  ? 11.999  -22.958 -18.262 1.00 134.64 ? 66  LYS B CG    1 
ATOM   2273 C CD    . LYS B 1 44  ? 12.263  -22.587 -16.799 1.00 137.00 ? 66  LYS B CD    1 
ATOM   2274 C CE    . LYS B 1 44  ? 13.686  -22.085 -16.588 1.00 138.30 ? 66  LYS B CE    1 
ATOM   2275 N NZ    . LYS B 1 44  ? 14.061  -22.147 -15.138 1.00 139.65 ? 66  LYS B NZ    1 
ATOM   2276 N N     . ALA B 1 45  ? 13.661  -25.488 -21.111 1.00 131.47 ? 67  ALA B N     1 
ATOM   2277 C CA    . ALA B 1 45  ? 14.545  -25.054 -22.187 1.00 130.62 ? 67  ALA B CA    1 
ATOM   2278 C C     . ALA B 1 45  ? 14.545  -25.979 -23.385 1.00 130.01 ? 67  ALA B C     1 
ATOM   2279 O O     . ALA B 1 45  ? 15.239  -25.716 -24.362 1.00 129.96 ? 67  ALA B O     1 
ATOM   2280 C CB    . ALA B 1 45  ? 15.954  -24.927 -21.655 1.00 130.65 ? 67  ALA B CB    1 
ATOM   2281 N N     . MET B 1 46  ? 13.785  -27.071 -23.312 1.00 129.23 ? 68  MET B N     1 
ATOM   2282 C CA    . MET B 1 46  ? 13.779  -28.028 -24.402 1.00 128.56 ? 68  MET B CA    1 
ATOM   2283 C C     . MET B 1 46  ? 13.278  -27.361 -25.704 1.00 128.04 ? 68  MET B C     1 
ATOM   2284 O O     . MET B 1 46  ? 12.866  -26.168 -25.677 1.00 127.89 ? 68  MET B O     1 
ATOM   2285 C CB    . MET B 1 46  ? 12.994  -29.289 -24.015 1.00 128.61 ? 68  MET B CB    1 
ATOM   2286 C CG    . MET B 1 46  ? 11.482  -29.121 -23.926 1.00 128.85 ? 68  MET B CG    1 
ATOM   2287 S SD    . MET B 1 46  ? 10.622  -30.673 -23.522 1.00 129.11 ? 68  MET B SD    1 
ATOM   2288 C CE    . MET B 1 46  ? 11.141  -31.743 -24.881 1.00 128.99 ? 68  MET B CE    1 
ATOM   2289 N N     . PRO B 1 47  ? 13.360  -28.109 -26.849 1.00 127.49 ? 69  PRO B N     1 
ATOM   2290 C CA    . PRO B 1 47  ? 12.972  -27.529 -28.120 1.00 126.92 ? 69  PRO B CA    1 
ATOM   2291 C C     . PRO B 1 47  ? 11.508  -27.798 -28.385 1.00 126.26 ? 69  PRO B C     1 
ATOM   2292 O O     . PRO B 1 47  ? 11.113  -28.957 -28.654 1.00 126.24 ? 69  PRO B O     1 
ATOM   2293 C CB    . PRO B 1 47  ? 13.844  -28.287 -29.124 1.00 127.13 ? 69  PRO B CB    1 
ATOM   2294 C CG    . PRO B 1 47  ? 14.077  -29.647 -28.492 1.00 127.34 ? 69  PRO B CG    1 
ATOM   2295 C CD    . PRO B 1 47  ? 13.793  -29.523 -27.013 1.00 127.54 ? 69  PRO B CD    1 
ATOM   2296 N N     . LEU B 1 48  ? 10.704  -26.724 -28.290 1.00 125.51 ? 70  LEU B N     1 
ATOM   2297 C CA    . LEU B 1 48  ? 9.273   -26.862 -28.468 1.00 124.66 ? 70  LEU B CA    1 
ATOM   2298 C C     . LEU B 1 48  ? 8.843   -26.302 -29.801 1.00 123.93 ? 70  LEU B C     1 
ATOM   2299 O O     . LEU B 1 48  ? 9.462   -25.362 -30.324 1.00 123.77 ? 70  LEU B O     1 
ATOM   2300 C CB    . LEU B 1 48  ? 8.517   -26.167 -27.337 1.00 124.78 ? 70  LEU B CB    1 
ATOM   2301 C CG    . LEU B 1 48  ? 8.501   -26.921 -26.001 1.00 125.11 ? 70  LEU B CG    1 
ATOM   2302 C CD1   . LEU B 1 48  ? 8.076   -25.993 -24.872 1.00 125.75 ? 70  LEU B CD1   1 
ATOM   2303 C CD2   . LEU B 1 48  ? 7.633   -28.195 -26.062 1.00 125.55 ? 70  LEU B CD2   1 
ATOM   2304 N N     . ILE B 1 49  ? 7.787   -26.903 -30.354 1.00 123.08 ? 71  ILE B N     1 
ATOM   2305 C CA    . ILE B 1 49  ? 7.149   -26.361 -31.541 1.00 122.19 ? 71  ILE B CA    1 
ATOM   2306 C C     . ILE B 1 49  ? 5.789   -25.816 -31.174 1.00 121.59 ? 71  ILE B C     1 
ATOM   2307 O O     . ILE B 1 49  ? 4.937   -26.521 -30.623 1.00 121.13 ? 71  ILE B O     1 
ATOM   2308 C CB    . ILE B 1 49  ? 6.949   -27.401 -32.660 1.00 122.17 ? 71  ILE B CB    1 
ATOM   2309 C CG1   . ILE B 1 49  ? 8.176   -28.323 -32.794 1.00 122.21 ? 71  ILE B CG1   1 
ATOM   2310 C CG2   . ILE B 1 49  ? 6.647   -26.686 -33.981 1.00 121.77 ? 71  ILE B CG2   1 
ATOM   2311 C CD1   . ILE B 1 49  ? 7.868   -29.626 -33.517 1.00 122.37 ? 71  ILE B CD1   1 
ATOM   2312 N N     . PHE B 1 50  ? 5.603   -24.544 -31.488 1.00 121.00 ? 72  PHE B N     1 
ATOM   2313 C CA    . PHE B 1 50  ? 4.310   -23.943 -31.377 1.00 120.61 ? 72  PHE B CA    1 
ATOM   2314 C C     . PHE B 1 50  ? 3.747   -23.758 -32.762 1.00 120.36 ? 72  PHE B C     1 
ATOM   2315 O O     . PHE B 1 50  ? 4.349   -23.101 -33.617 1.00 120.22 ? 72  PHE B O     1 
ATOM   2316 C CB    . PHE B 1 50  ? 4.384   -22.612 -30.633 1.00 120.65 ? 72  PHE B CB    1 
ATOM   2317 C CG    . PHE B 1 50  ? 4.536   -22.768 -29.148 1.00 120.56 ? 72  PHE B CG    1 
ATOM   2318 C CD1   . PHE B 1 50  ? 3.482   -23.240 -28.367 1.00 120.60 ? 72  PHE B CD1   1 
ATOM   2319 C CD2   . PHE B 1 50  ? 5.730   -22.442 -28.524 1.00 120.67 ? 72  PHE B CD2   1 
ATOM   2320 C CE1   . PHE B 1 50  ? 3.622   -23.391 -26.986 1.00 120.46 ? 72  PHE B CE1   1 
ATOM   2321 C CE2   . PHE B 1 50  ? 5.877   -22.584 -27.142 1.00 120.79 ? 72  PHE B CE2   1 
ATOM   2322 C CZ    . PHE B 1 50  ? 4.821   -23.060 -26.372 1.00 120.49 ? 72  PHE B CZ    1 
ATOM   2323 N N     . VAL B 1 51  ? 2.598   -24.386 -32.974 1.00 120.17 ? 73  VAL B N     1 
ATOM   2324 C CA    . VAL B 1 51  ? 1.808   -24.162 -34.157 1.00 120.14 ? 73  VAL B CA    1 
ATOM   2325 C C     . VAL B 1 51  ? 0.669   -23.246 -33.757 1.00 120.11 ? 73  VAL B C     1 
ATOM   2326 O O     . VAL B 1 51  ? 0.150   -23.316 -32.632 1.00 120.06 ? 73  VAL B O     1 
ATOM   2327 C CB    . VAL B 1 51  ? 1.255   -25.480 -34.727 1.00 120.14 ? 73  VAL B CB    1 
ATOM   2328 C CG1   . VAL B 1 51  ? 0.629   -25.253 -36.107 1.00 120.20 ? 73  VAL B CG1   1 
ATOM   2329 C CG2   . VAL B 1 51  ? 2.365   -26.529 -34.809 1.00 120.40 ? 73  VAL B CG2   1 
ATOM   2330 N N     . GLY B 1 52  ? 0.302   -22.364 -34.677 1.00 120.22 ? 74  GLY B N     1 
ATOM   2331 C CA    . GLY B 1 52  ? -0.833  -21.476 -34.460 1.00 120.36 ? 74  GLY B CA    1 
ATOM   2332 C C     . GLY B 1 52  ? -1.215  -20.680 -35.697 1.00 120.33 ? 74  GLY B C     1 
ATOM   2333 O O     . GLY B 1 52  ? -0.723  -20.947 -36.806 1.00 120.38 ? 74  GLY B O     1 
ATOM   2334 N N     . GLY B 1 53  ? -2.086  -19.691 -35.487 1.00 120.14 ? 75  GLY B N     1 
ATOM   2335 C CA    . GLY B 1 53  ? -2.647  -18.870 -36.560 1.00 119.80 ? 75  GLY B CA    1 
ATOM   2336 C C     . GLY B 1 53  ? -4.164  -18.863 -36.486 1.00 119.54 ? 75  GLY B C     1 
ATOM   2337 O O     . GLY B 1 53  ? -4.752  -19.642 -35.717 1.00 119.54 ? 75  GLY B O     1 
ATOM   2338 N N     . VAL B 1 54  ? -4.791  -17.984 -37.276 1.00 119.30 ? 76  VAL B N     1 
ATOM   2339 C CA    . VAL B 1 54  ? -6.259  -17.908 -37.366 1.00 119.01 ? 76  VAL B CA    1 
ATOM   2340 C C     . VAL B 1 54  ? -6.817  -19.285 -37.812 1.00 118.95 ? 76  VAL B C     1 
ATOM   2341 O O     . VAL B 1 54  ? -6.344  -19.842 -38.807 1.00 118.73 ? 76  VAL B O     1 
ATOM   2342 C CB    . VAL B 1 54  ? -6.732  -16.727 -38.300 1.00 118.96 ? 76  VAL B CB    1 
ATOM   2343 C CG1   . VAL B 1 54  ? -8.257  -16.545 -38.262 1.00 118.71 ? 76  VAL B CG1   1 
ATOM   2344 C CG2   . VAL B 1 54  ? -6.037  -15.407 -37.925 1.00 118.62 ? 76  VAL B CG2   1 
ATOM   2345 N N     . PRO B 1 55  ? -7.791  -19.854 -37.049 1.00 118.95 ? 77  PRO B N     1 
ATOM   2346 C CA    . PRO B 1 55  ? -8.405  -21.146 -37.382 1.00 118.90 ? 77  PRO B CA    1 
ATOM   2347 C C     . PRO B 1 55  ? -8.923  -21.168 -38.807 1.00 118.95 ? 77  PRO B C     1 
ATOM   2348 O O     . PRO B 1 55  ? -9.124  -20.112 -39.420 1.00 119.11 ? 77  PRO B O     1 
ATOM   2349 C CB    . PRO B 1 55  ? -9.593  -21.234 -36.420 1.00 118.77 ? 77  PRO B CB    1 
ATOM   2350 C CG    . PRO B 1 55  ? -9.173  -20.464 -35.252 1.00 119.00 ? 77  PRO B CG    1 
ATOM   2351 C CD    . PRO B 1 55  ? -8.335  -19.320 -35.785 1.00 119.06 ? 77  PRO B CD    1 
ATOM   2352 N N     . ARG B 1 56  ? -9.152  -22.374 -39.318 1.00 118.90 ? 78  ARG B N     1 
ATOM   2353 C CA    . ARG B 1 56  ? -9.463  -22.593 -40.732 1.00 118.80 ? 78  ARG B CA    1 
ATOM   2354 C C     . ARG B 1 56  ? -8.292  -22.176 -41.649 1.00 118.60 ? 78  ARG B C     1 
ATOM   2355 O O     . ARG B 1 56  ? -8.501  -21.855 -42.821 1.00 118.52 ? 78  ARG B O     1 
ATOM   2356 C CB    . ARG B 1 56  ? -10.791 -21.917 -41.151 1.00 118.96 ? 78  ARG B CB    1 
ATOM   2357 C CG    . ARG B 1 56  ? -11.989 -21.940 -40.135 1.00 119.20 ? 78  ARG B CG    1 
ATOM   2358 C CD    . ARG B 1 56  ? -12.343 -23.321 -39.526 1.00 120.18 ? 78  ARG B CD    1 
ATOM   2359 N NE    . ARG B 1 56  ? -12.481 -24.389 -40.524 1.00 121.15 ? 78  ARG B NE    1 
ATOM   2360 C CZ    . ARG B 1 56  ? -12.239 -25.683 -40.286 1.00 121.65 ? 78  ARG B CZ    1 
ATOM   2361 N NH1   . ARG B 1 56  ? -11.845 -26.091 -39.077 1.00 121.93 ? 78  ARG B NH1   1 
ATOM   2362 N NH2   . ARG B 1 56  ? -12.374 -26.577 -41.264 1.00 121.32 ? 78  ARG B NH2   1 
ATOM   2363 N N     . SER B 1 57  ? -7.071  -22.186 -41.104 1.00 118.37 ? 79  SER B N     1 
ATOM   2364 C CA    . SER B 1 57  ? -5.873  -21.873 -41.877 1.00 118.35 ? 79  SER B CA    1 
ATOM   2365 C C     . SER B 1 57  ? -4.957  -23.093 -42.085 1.00 118.46 ? 79  SER B C     1 
ATOM   2366 O O     . SER B 1 57  ? -3.764  -22.940 -42.401 1.00 118.67 ? 79  SER B O     1 
ATOM   2367 C CB    . SER B 1 57  ? -5.103  -20.709 -41.243 1.00 118.30 ? 79  SER B CB    1 
ATOM   2368 O OG    . SER B 1 57  ? -5.863  -19.514 -41.258 1.00 118.06 ? 79  SER B OG    1 
ATOM   2369 N N     . GLY B 1 58  ? -5.523  -24.295 -41.920 1.00 118.43 ? 80  GLY B N     1 
ATOM   2370 C CA    . GLY B 1 58  ? -4.787  -25.546 -42.138 1.00 118.50 ? 80  GLY B CA    1 
ATOM   2371 C C     . GLY B 1 58  ? -3.801  -25.883 -41.035 1.00 118.61 ? 80  GLY B C     1 
ATOM   2372 O O     . GLY B 1 58  ? -2.836  -26.626 -41.255 1.00 118.65 ? 80  GLY B O     1 
ATOM   2373 N N     . THR B 1 59  ? -4.032  -25.326 -39.847 1.00 118.72 ? 81  THR B N     1 
ATOM   2374 C CA    . THR B 1 59  ? -3.177  -25.604 -38.695 1.00 118.91 ? 81  THR B CA    1 
ATOM   2375 C C     . THR B 1 59  ? -3.189  -27.108 -38.348 1.00 119.10 ? 81  THR B C     1 
ATOM   2376 O O     . THR B 1 59  ? -2.155  -27.651 -37.922 1.00 119.00 ? 81  THR B O     1 
ATOM   2377 C CB    . THR B 1 59  ? -3.510  -24.685 -37.449 1.00 118.96 ? 81  THR B CB    1 
ATOM   2378 O OG1   . THR B 1 59  ? -4.906  -24.758 -37.102 1.00 118.88 ? 81  THR B OG1   1 
ATOM   2379 C CG2   . THR B 1 59  ? -3.156  -23.225 -37.727 1.00 118.71 ? 81  THR B CG2   1 
ATOM   2380 N N     . THR B 1 60  ? -4.342  -27.767 -38.565 1.00 119.27 ? 82  THR B N     1 
ATOM   2381 C CA    . THR B 1 60  ? -4.515  -29.207 -38.272 1.00 119.31 ? 82  THR B CA    1 
ATOM   2382 C C     . THR B 1 60  ? -3.667  -29.993 -39.233 1.00 119.21 ? 82  THR B C     1 
ATOM   2383 O O     . THR B 1 60  ? -2.946  -30.898 -38.831 1.00 119.21 ? 82  THR B O     1 
ATOM   2384 C CB    . THR B 1 60  ? -5.991  -29.734 -38.368 1.00 119.22 ? 82  THR B CB    1 
ATOM   2385 O OG1   . THR B 1 60  ? -6.889  -28.829 -37.727 1.00 119.39 ? 82  THR B OG1   1 
ATOM   2386 C CG2   . THR B 1 60  ? -6.132  -31.097 -37.684 1.00 119.06 ? 82  THR B CG2   1 
ATOM   2387 N N     . LEU B 1 61  ? -3.751  -29.636 -40.504 1.00 119.19 ? 83  LEU B N     1 
ATOM   2388 C CA    . LEU B 1 61  ? -2.863  -30.225 -41.479 1.00 119.58 ? 83  LEU B CA    1 
ATOM   2389 C C     . LEU B 1 61  ? -1.418  -30.079 -40.996 1.00 120.00 ? 83  LEU B C     1 
ATOM   2390 O O     . LEU B 1 61  ? -0.703  -31.078 -40.813 1.00 120.15 ? 83  LEU B O     1 
ATOM   2391 C CB    . LEU B 1 61  ? -3.036  -29.555 -42.849 1.00 119.60 ? 83  LEU B CB    1 
ATOM   2392 C CG    . LEU B 1 61  ? -2.112  -29.998 -44.011 1.00 119.09 ? 83  LEU B CG    1 
ATOM   2393 C CD1   . LEU B 1 61  ? -2.373  -31.458 -44.422 1.00 118.71 ? 83  LEU B CD1   1 
ATOM   2394 C CD2   . LEU B 1 61  ? -2.227  -29.074 -45.232 1.00 118.24 ? 83  LEU B CD2   1 
ATOM   2395 N N     . MET B 1 62  ? -1.005  -28.830 -40.770 1.00 120.27 ? 84  MET B N     1 
ATOM   2396 C CA    . MET B 1 62  ? 0.368   -28.530 -40.396 1.00 120.33 ? 84  MET B CA    1 
ATOM   2397 C C     . MET B 1 62  ? 0.803   -29.488 -39.317 1.00 120.34 ? 84  MET B C     1 
ATOM   2398 O O     . MET B 1 62  ? 1.755   -30.240 -39.492 1.00 120.14 ? 84  MET B O     1 
ATOM   2399 C CB    . MET B 1 62  ? 0.497   -27.085 -39.913 1.00 120.33 ? 84  MET B CB    1 
ATOM   2400 C CG    . MET B 1 62  ? 1.936   -26.601 -39.749 1.00 120.72 ? 84  MET B CG    1 
ATOM   2401 S SD    . MET B 1 62  ? 2.948   -26.728 -41.250 1.00 121.20 ? 84  MET B SD    1 
ATOM   2402 C CE    . MET B 1 62  ? 3.920   -28.192 -40.883 1.00 121.28 ? 84  MET B CE    1 
ATOM   2403 N N     . ARG B 1 63  ? 0.061   -29.491 -38.221 1.00 120.75 ? 85  ARG B N     1 
ATOM   2404 C CA    . ARG B 1 63  ? 0.425   -30.304 -37.080 1.00 121.44 ? 85  ARG B CA    1 
ATOM   2405 C C     . ARG B 1 63  ? 0.303   -31.799 -37.366 1.00 121.81 ? 85  ARG B C     1 
ATOM   2406 O O     . ARG B 1 63  ? 1.135   -32.592 -36.913 1.00 121.87 ? 85  ARG B O     1 
ATOM   2407 C CB    . ARG B 1 63  ? -0.367  -29.880 -35.831 1.00 121.52 ? 85  ARG B CB    1 
ATOM   2408 C CG    . ARG B 1 63  ? -1.777  -30.422 -35.713 1.00 121.24 ? 85  ARG B CG    1 
ATOM   2409 C CD    . ARG B 1 63  ? -1.748  -31.786 -35.064 1.00 120.85 ? 85  ARG B CD    1 
ATOM   2410 N NE    . ARG B 1 63  ? -3.048  -32.142 -34.506 1.00 121.46 ? 85  ARG B NE    1 
ATOM   2411 C CZ    . ARG B 1 63  ? -3.374  -33.373 -34.128 1.00 121.72 ? 85  ARG B CZ    1 
ATOM   2412 N NH1   . ARG B 1 63  ? -2.486  -34.376 -34.260 1.00 121.42 ? 85  ARG B NH1   1 
ATOM   2413 N NH2   . ARG B 1 63  ? -4.591  -33.598 -33.618 1.00 121.91 ? 85  ARG B NH2   1 
ATOM   2414 N N     . ALA B 1 64  ? -0.724  -32.174 -38.125 1.00 122.27 ? 86  ALA B N     1 
ATOM   2415 C CA    . ALA B 1 64  ? -0.962  -33.575 -38.451 1.00 122.79 ? 86  ALA B CA    1 
ATOM   2416 C C     . ALA B 1 64  ? 0.269   -34.160 -39.109 1.00 123.19 ? 86  ALA B C     1 
ATOM   2417 O O     . ALA B 1 64  ? 0.701   -35.260 -38.767 1.00 123.32 ? 86  ALA B O     1 
ATOM   2418 C CB    . ALA B 1 64  ? -2.156  -33.721 -39.360 1.00 122.76 ? 86  ALA B CB    1 
ATOM   2419 N N     . MET B 1 65  ? 0.845   -33.403 -40.039 1.00 123.64 ? 87  MET B N     1 
ATOM   2420 C CA    . MET B 1 65  ? 2.058   -33.833 -40.718 1.00 124.15 ? 87  MET B CA    1 
ATOM   2421 C C     . MET B 1 65  ? 3.263   -33.869 -39.770 1.00 124.33 ? 87  MET B C     1 
ATOM   2422 O O     . MET B 1 65  ? 4.181   -34.674 -39.947 1.00 124.41 ? 87  MET B O     1 
ATOM   2423 C CB    . MET B 1 65  ? 2.335   -32.952 -41.939 1.00 124.27 ? 87  MET B CB    1 
ATOM   2424 C CG    . MET B 1 65  ? 1.448   -33.260 -43.160 1.00 124.65 ? 87  MET B CG    1 
ATOM   2425 S SD    . MET B 1 65  ? 1.900   -32.326 -44.648 1.00 125.50 ? 87  MET B SD    1 
ATOM   2426 C CE    . MET B 1 65  ? 1.615   -30.636 -44.075 1.00 126.56 ? 87  MET B CE    1 
ATOM   2427 N N     . LEU B 1 66  ? 3.246   -33.011 -38.754 1.00 124.55 ? 88  LEU B N     1 
ATOM   2428 C CA    . LEU B 1 66  ? 4.334   -32.971 -37.796 1.00 124.87 ? 88  LEU B CA    1 
ATOM   2429 C C     . LEU B 1 66  ? 4.307   -34.207 -36.905 1.00 125.25 ? 88  LEU B C     1 
ATOM   2430 O O     . LEU B 1 66  ? 5.354   -34.831 -36.669 1.00 125.37 ? 88  LEU B O     1 
ATOM   2431 C CB    . LEU B 1 66  ? 4.273   -31.674 -36.966 1.00 124.84 ? 88  LEU B CB    1 
ATOM   2432 C CG    . LEU B 1 66  ? 4.534   -30.359 -37.723 1.00 124.85 ? 88  LEU B CG    1 
ATOM   2433 C CD1   . LEU B 1 66  ? 4.267   -29.134 -36.857 1.00 124.68 ? 88  LEU B CD1   1 
ATOM   2434 C CD2   . LEU B 1 66  ? 5.958   -30.309 -38.251 1.00 125.30 ? 88  LEU B CD2   1 
ATOM   2435 N N     . ASP B 1 67  ? 3.105   -34.563 -36.433 1.00 125.69 ? 89  ASP B N     1 
ATOM   2436 C CA    . ASP B 1 67  ? 2.903   -35.721 -35.550 1.00 126.14 ? 89  ASP B CA    1 
ATOM   2437 C C     . ASP B 1 67  ? 3.371   -37.022 -36.172 1.00 126.45 ? 89  ASP B C     1 
ATOM   2438 O O     . ASP B 1 67  ? 3.873   -37.918 -35.477 1.00 126.27 ? 89  ASP B O     1 
ATOM   2439 C CB    . ASP B 1 67  ? 1.426   -35.855 -35.201 1.00 126.16 ? 89  ASP B CB    1 
ATOM   2440 C CG    . ASP B 1 67  ? 1.155   -35.653 -33.730 1.00 126.53 ? 89  ASP B CG    1 
ATOM   2441 O OD1   . ASP B 1 67  ? 1.868   -36.277 -32.900 1.00 126.37 ? 89  ASP B OD1   1 
ATOM   2442 O OD2   . ASP B 1 67  ? 0.212   -34.888 -33.408 1.00 127.15 ? 89  ASP B OD2   1 
ATOM   2443 N N     . ALA B 1 68  ? 3.182   -37.101 -37.489 1.00 126.94 ? 90  ALA B N     1 
ATOM   2444 C CA    . ALA B 1 68  ? 3.566   -38.246 -38.298 1.00 127.54 ? 90  ALA B CA    1 
ATOM   2445 C C     . ALA B 1 68  ? 5.047   -38.566 -38.144 1.00 127.98 ? 90  ALA B C     1 
ATOM   2446 O O     . ALA B 1 68  ? 5.430   -39.738 -38.117 1.00 128.09 ? 90  ALA B O     1 
ATOM   2447 C CB    . ALA B 1 68  ? 3.229   -37.986 -39.754 1.00 127.47 ? 90  ALA B CB    1 
ATOM   2448 N N     . HIS B 1 69  ? 5.870   -37.522 -38.041 1.00 128.50 ? 91  HIS B N     1 
ATOM   2449 C CA    . HIS B 1 69  ? 7.295   -37.678 -37.764 1.00 129.10 ? 91  HIS B CA    1 
ATOM   2450 C C     . HIS B 1 69  ? 7.468   -38.557 -36.518 1.00 129.47 ? 91  HIS B C     1 
ATOM   2451 O O     . HIS B 1 69  ? 6.754   -38.365 -35.523 1.00 129.64 ? 91  HIS B O     1 
ATOM   2452 C CB    . HIS B 1 69  ? 7.944   -36.306 -37.562 1.00 129.12 ? 91  HIS B CB    1 
ATOM   2453 C CG    . HIS B 1 69  ? 9.392   -36.256 -37.951 1.00 129.33 ? 91  HIS B CG    1 
ATOM   2454 N ND1   . HIS B 1 69  ? 10.402  -36.693 -37.110 1.00 129.61 ? 91  HIS B ND1   1 
ATOM   2455 C CD2   . HIS B 1 69  ? 10.002  -35.810 -39.088 1.00 129.50 ? 91  HIS B CD2   1 
ATOM   2456 C CE1   . HIS B 1 69  ? 11.572  -36.522 -37.712 1.00 130.13 ? 91  HIS B CE1   1 
ATOM   2457 N NE2   . HIS B 1 69  ? 11.357  -35.989 -38.914 1.00 130.13 ? 91  HIS B NE2   1 
ATOM   2458 N N     . PRO B 1 70  ? 8.378   -39.552 -36.581 1.00 129.73 ? 92  PRO B N     1 
ATOM   2459 C CA    . PRO B 1 70  ? 8.570   -40.451 -35.438 1.00 129.97 ? 92  PRO B CA    1 
ATOM   2460 C C     . PRO B 1 70  ? 9.183   -39.744 -34.227 1.00 130.19 ? 92  PRO B C     1 
ATOM   2461 O O     . PRO B 1 70  ? 8.900   -40.124 -33.088 1.00 130.26 ? 92  PRO B O     1 
ATOM   2462 C CB    . PRO B 1 70  ? 9.514   -41.531 -35.984 1.00 129.96 ? 92  PRO B CB    1 
ATOM   2463 C CG    . PRO B 1 70  ? 10.172  -40.915 -37.165 1.00 130.02 ? 92  PRO B CG    1 
ATOM   2464 C CD    . PRO B 1 70  ? 9.184   -39.958 -37.747 1.00 129.68 ? 92  PRO B CD    1 
ATOM   2465 N N     . GLU B 1 71  ? 9.987   -38.710 -34.486 1.00 130.42 ? 93  GLU B N     1 
ATOM   2466 C CA    . GLU B 1 71  ? 10.633  -37.910 -33.435 1.00 130.70 ? 93  GLU B CA    1 
ATOM   2467 C C     . GLU B 1 71  ? 9.695   -36.891 -32.767 1.00 130.00 ? 93  GLU B C     1 
ATOM   2468 O O     . GLU B 1 71  ? 10.002  -36.398 -31.672 1.00 130.08 ? 93  GLU B O     1 
ATOM   2469 C CB    . GLU B 1 71  ? 11.849  -37.146 -33.995 1.00 131.24 ? 93  GLU B CB    1 
ATOM   2470 C CG    . GLU B 1 71  ? 13.040  -37.987 -34.468 1.00 133.66 ? 93  GLU B CG    1 
ATOM   2471 C CD    . GLU B 1 71  ? 14.213  -37.121 -34.957 1.00 136.78 ? 93  GLU B CD    1 
ATOM   2472 O OE1   . GLU B 1 71  ? 14.938  -36.513 -34.085 1.00 138.35 ? 93  GLU B OE1   1 
ATOM   2473 O OE2   . GLU B 1 71  ? 14.417  -37.054 -36.215 1.00 137.96 ? 93  GLU B OE2   1 
ATOM   2474 N N     . VAL B 1 72  ? 8.570   -36.580 -33.424 1.00 129.11 ? 94  VAL B N     1 
ATOM   2475 C CA    . VAL B 1 72  ? 7.698   -35.446 -33.042 1.00 128.06 ? 94  VAL B CA    1 
ATOM   2476 C C     . VAL B 1 72  ? 6.279   -35.863 -32.582 1.00 127.38 ? 94  VAL B C     1 
ATOM   2477 O O     . VAL B 1 72  ? 5.718   -36.868 -33.064 1.00 127.32 ? 94  VAL B O     1 
ATOM   2478 C CB    . VAL B 1 72  ? 7.586   -34.386 -34.214 1.00 128.04 ? 94  VAL B CB    1 
ATOM   2479 C CG1   . VAL B 1 72  ? 6.917   -33.091 -33.742 1.00 127.78 ? 94  VAL B CG1   1 
ATOM   2480 C CG2   . VAL B 1 72  ? 8.956   -34.063 -34.822 1.00 127.90 ? 94  VAL B CG2   1 
ATOM   2481 N N     . ARG B 1 73  ? 5.723   -35.077 -31.648 1.00 126.41 ? 95  ARG B N     1 
ATOM   2482 C CA    . ARG B 1 73  ? 4.312   -35.169 -31.239 1.00 125.28 ? 95  ARG B CA    1 
ATOM   2483 C C     . ARG B 1 73  ? 3.733   -33.789 -30.890 1.00 124.64 ? 95  ARG B C     1 
ATOM   2484 O O     . ARG B 1 73  ? 4.253   -33.088 -30.020 1.00 124.40 ? 95  ARG B O     1 
ATOM   2485 C CB    . ARG B 1 73  ? 4.149   -36.146 -30.068 1.00 125.11 ? 95  ARG B CB    1 
ATOM   2486 C CG    . ARG B 1 73  ? 2.738   -36.648 -29.832 1.00 124.39 ? 95  ARG B CG    1 
ATOM   2487 C CD    . ARG B 1 73  ? 2.024   -35.773 -28.832 1.00 124.24 ? 95  ARG B CD    1 
ATOM   2488 N NE    . ARG B 1 73  ? 2.684   -35.824 -27.518 1.00 124.27 ? 95  ARG B NE    1 
ATOM   2489 C CZ    . ARG B 1 73  ? 2.601   -34.878 -26.584 1.00 124.07 ? 95  ARG B CZ    1 
ATOM   2490 N NH1   . ARG B 1 73  ? 3.256   -35.049 -25.430 1.00 123.93 ? 95  ARG B NH1   1 
ATOM   2491 N NH2   . ARG B 1 73  ? 1.885   -33.761 -26.796 1.00 123.62 ? 95  ARG B NH2   1 
ATOM   2492 N N     . CYS B 1 74  ? 2.670   -33.405 -31.596 1.00 123.97 ? 96  CYS B N     1 
ATOM   2493 C CA    . CYS B 1 74  ? 1.924   -32.187 -31.280 1.00 123.53 ? 96  CYS B CA    1 
ATOM   2494 C C     . CYS B 1 74  ? 0.679   -32.517 -30.475 1.00 123.29 ? 96  CYS B C     1 
ATOM   2495 O O     . CYS B 1 74  ? 0.406   -31.890 -29.441 1.00 123.21 ? 96  CYS B O     1 
ATOM   2496 C CB    . CYS B 1 74  ? 1.475   -31.454 -32.542 1.00 123.49 ? 96  CYS B CB    1 
ATOM   2497 S SG    . CYS B 1 74  ? 2.753   -30.709 -33.511 1.00 123.45 ? 96  CYS B SG    1 
ATOM   2498 N N     . GLY B 1 75  ? -0.084  -33.490 -30.981 1.00 122.98 ? 97  GLY B N     1 
ATOM   2499 C CA    . GLY B 1 75  ? -1.370  -33.879 -30.400 1.00 122.61 ? 97  GLY B CA    1 
ATOM   2500 C C     . GLY B 1 75  ? -2.509  -32.918 -30.738 1.00 122.34 ? 97  GLY B C     1 
ATOM   2501 O O     . GLY B 1 75  ? -2.421  -32.090 -31.680 1.00 122.35 ? 97  GLY B O     1 
ATOM   2502 N N     . GLU B 1 76  ? -3.578  -33.027 -29.946 1.00 121.96 ? 98  GLU B N     1 
ATOM   2503 C CA    . GLU B 1 76  ? -4.787  -32.237 -30.154 1.00 121.68 ? 98  GLU B CA    1 
ATOM   2504 C C     . GLU B 1 76  ? -4.642  -30.817 -29.617 1.00 121.25 ? 98  GLU B C     1 
ATOM   2505 O O     . GLU B 1 76  ? -3.629  -30.474 -29.007 1.00 121.09 ? 98  GLU B O     1 
ATOM   2506 C CB    . GLU B 1 76  ? -5.978  -32.925 -29.477 1.00 121.82 ? 98  GLU B CB    1 
ATOM   2507 C CG    . GLU B 1 76  ? -6.370  -34.261 -30.104 1.00 122.61 ? 98  GLU B CG    1 
ATOM   2508 C CD    . GLU B 1 76  ? -5.590  -35.453 -29.551 1.00 123.72 ? 98  GLU B CD    1 
ATOM   2509 O OE1   . GLU B 1 76  ? -6.075  -36.590 -29.754 1.00 124.51 ? 98  GLU B OE1   1 
ATOM   2510 O OE2   . GLU B 1 76  ? -4.513  -35.269 -28.926 1.00 123.31 ? 98  GLU B OE2   1 
ATOM   2511 N N     . GLU B 1 77  ? -5.658  -29.992 -29.869 1.00 120.86 ? 99  GLU B N     1 
ATOM   2512 C CA    . GLU B 1 77  ? -5.780  -28.699 -29.211 1.00 120.54 ? 99  GLU B CA    1 
ATOM   2513 C C     . GLU B 1 77  ? -6.081  -29.013 -27.752 1.00 120.44 ? 99  GLU B C     1 
ATOM   2514 O O     . GLU B 1 77  ? -6.876  -29.902 -27.457 1.00 120.39 ? 99  GLU B O     1 
ATOM   2515 C CB    . GLU B 1 77  ? -6.901  -27.851 -29.846 1.00 120.44 ? 99  GLU B CB    1 
ATOM   2516 C CG    . GLU B 1 77  ? -6.601  -27.359 -31.289 1.00 120.66 ? 99  GLU B CG    1 
ATOM   2517 C CD    . GLU B 1 77  ? -7.771  -26.624 -31.981 1.00 120.87 ? 99  GLU B CD    1 
ATOM   2518 O OE1   . GLU B 1 77  ? -8.888  -26.582 -31.418 1.00 121.53 ? 99  GLU B OE1   1 
ATOM   2519 O OE2   . GLU B 1 77  ? -7.578  -26.092 -33.104 1.00 120.30 ? 99  GLU B OE2   1 
ATOM   2520 N N     . THR B 1 78  ? -5.413  -28.316 -26.844 1.00 120.50 ? 100 THR B N     1 
ATOM   2521 C CA    . THR B 1 78  ? -5.589  -28.560 -25.420 1.00 120.65 ? 100 THR B CA    1 
ATOM   2522 C C     . THR B 1 78  ? -6.748  -27.740 -24.897 1.00 120.83 ? 100 THR B C     1 
ATOM   2523 O O     . THR B 1 78  ? -7.478  -28.194 -24.005 1.00 120.80 ? 100 THR B O     1 
ATOM   2524 C CB    . THR B 1 78  ? -4.350  -28.153 -24.633 1.00 120.68 ? 100 THR B CB    1 
ATOM   2525 O OG1   . THR B 1 78  ? -4.185  -26.729 -24.725 1.00 120.97 ? 100 THR B OG1   1 
ATOM   2526 C CG2   . THR B 1 78  ? -3.112  -28.851 -25.182 1.00 120.69 ? 100 THR B CG2   1 
ATOM   2527 N N     . ARG B 1 79  ? -6.889  -26.523 -25.455 1.00 121.15 ? 101 ARG B N     1 
ATOM   2528 C CA    . ARG B 1 79  ? -7.949  -25.560 -25.081 1.00 121.61 ? 101 ARG B CA    1 
ATOM   2529 C C     . ARG B 1 79  ? -7.653  -24.762 -23.792 1.00 121.44 ? 101 ARG B C     1 
ATOM   2530 O O     . ARG B 1 79  ? -8.126  -23.625 -23.598 1.00 121.46 ? 101 ARG B O     1 
ATOM   2531 C CB    . ARG B 1 79  ? -9.320  -26.257 -24.969 1.00 121.85 ? 101 ARG B CB    1 
ATOM   2532 C CG    . ARG B 1 79  ? -9.791  -26.946 -26.252 1.00 123.18 ? 101 ARG B CG    1 
ATOM   2533 C CD    . ARG B 1 79  ? -11.189 -27.515 -26.033 1.00 126.35 ? 101 ARG B CD    1 
ATOM   2534 N NE    . ARG B 1 79  ? -12.075 -27.193 -27.159 1.00 129.13 ? 101 ARG B NE    1 
ATOM   2535 C CZ    . ARG B 1 79  ? -12.674 -26.011 -27.340 1.00 130.66 ? 101 ARG B CZ    1 
ATOM   2536 N NH1   . ARG B 1 79  ? -12.482 -25.003 -26.472 1.00 131.03 ? 101 ARG B NH1   1 
ATOM   2537 N NH2   . ARG B 1 79  ? -13.467 -25.828 -28.400 1.00 131.77 ? 101 ARG B NH2   1 
ATOM   2538 N N     . ILE B 1 80  ? -6.862  -25.372 -22.917 1.00 121.14 ? 102 ILE B N     1 
ATOM   2539 C CA    . ILE B 1 80  ? -6.613  -24.809 -21.610 1.00 120.84 ? 102 ILE B CA    1 
ATOM   2540 C C     . ILE B 1 80  ? -5.465  -23.805 -21.590 1.00 120.59 ? 102 ILE B C     1 
ATOM   2541 O O     . ILE B 1 80  ? -5.524  -22.794 -20.885 1.00 120.51 ? 102 ILE B O     1 
ATOM   2542 C CB    . ILE B 1 80  ? -6.364  -25.936 -20.588 1.00 120.90 ? 102 ILE B CB    1 
ATOM   2543 C CG1   . ILE B 1 80  ? -6.367  -25.364 -19.172 1.00 121.24 ? 102 ILE B CG1   1 
ATOM   2544 C CG2   . ILE B 1 80  ? -5.090  -26.723 -20.916 1.00 120.89 ? 102 ILE B CG2   1 
ATOM   2545 C CD1   . ILE B 1 80  ? -7.668  -24.686 -18.848 1.00 123.01 ? 102 ILE B CD1   1 
ATOM   2546 N N     . ILE B 1 81  ? -4.417  -24.103 -22.358 1.00 120.39 ? 103 ILE B N     1 
ATOM   2547 C CA    . ILE B 1 81  ? -3.199  -23.311 -22.336 1.00 120.22 ? 103 ILE B CA    1 
ATOM   2548 C C     . ILE B 1 81  ? -3.538  -21.885 -22.720 1.00 120.11 ? 103 ILE B C     1 
ATOM   2549 O O     . ILE B 1 81  ? -3.290  -20.964 -21.948 1.00 119.84 ? 103 ILE B O     1 
ATOM   2550 C CB    . ILE B 1 81  ? -2.124  -23.898 -23.285 1.00 120.32 ? 103 ILE B CB    1 
ATOM   2551 C CG1   . ILE B 1 81  ? -1.630  -25.264 -22.768 1.00 120.22 ? 103 ILE B CG1   1 
ATOM   2552 C CG2   . ILE B 1 81  ? -0.970  -22.913 -23.476 1.00 120.35 ? 103 ILE B CG2   1 
ATOM   2553 C CD1   . ILE B 1 81  ? -0.877  -26.104 -23.814 1.00 120.42 ? 103 ILE B CD1   1 
ATOM   2554 N N     . PRO B 1 82  ? -4.143  -21.696 -23.905 1.00 120.22 ? 104 PRO B N     1 
ATOM   2555 C CA    . PRO B 1 82  ? -4.412  -20.312 -24.266 1.00 120.39 ? 104 PRO B CA    1 
ATOM   2556 C C     . PRO B 1 82  ? -5.305  -19.676 -23.198 1.00 120.44 ? 104 PRO B C     1 
ATOM   2557 O O     . PRO B 1 82  ? -5.193  -18.476 -22.917 1.00 120.36 ? 104 PRO B O     1 
ATOM   2558 C CB    . PRO B 1 82  ? -5.140  -20.426 -25.628 1.00 120.59 ? 104 PRO B CB    1 
ATOM   2559 C CG    . PRO B 1 82  ? -5.635  -21.853 -25.690 1.00 120.57 ? 104 PRO B CG    1 
ATOM   2560 C CD    . PRO B 1 82  ? -4.640  -22.651 -24.917 1.00 120.22 ? 104 PRO B CD    1 
ATOM   2561 N N     . ARG B 1 83  ? -6.147  -20.506 -22.589 1.00 120.52 ? 105 ARG B N     1 
ATOM   2562 C CA    . ARG B 1 83  ? -7.101  -20.069 -21.592 1.00 120.85 ? 105 ARG B CA    1 
ATOM   2563 C C     . ARG B 1 83  ? -6.381  -19.391 -20.440 1.00 120.43 ? 105 ARG B C     1 
ATOM   2564 O O     . ARG B 1 83  ? -6.679  -18.247 -20.088 1.00 120.19 ? 105 ARG B O     1 
ATOM   2565 C CB    . ARG B 1 83  ? -7.878  -21.282 -21.092 1.00 121.28 ? 105 ARG B CB    1 
ATOM   2566 C CG    . ARG B 1 83  ? -9.096  -20.944 -20.261 1.00 123.90 ? 105 ARG B CG    1 
ATOM   2567 C CD    . ARG B 1 83  ? -9.988  -22.168 -20.064 1.00 127.96 ? 105 ARG B CD    1 
ATOM   2568 N NE    . ARG B 1 83  ? -10.578 -22.667 -21.308 1.00 130.94 ? 105 ARG B NE    1 
ATOM   2569 C CZ    . ARG B 1 83  ? -11.701 -22.175 -21.868 1.00 132.36 ? 105 ARG B CZ    1 
ATOM   2570 N NH1   . ARG B 1 83  ? -12.161 -22.693 -22.997 1.00 133.37 ? 105 ARG B NH1   1 
ATOM   2571 N NH2   . ARG B 1 83  ? -12.362 -21.162 -21.303 1.00 133.22 ? 105 ARG B NH2   1 
ATOM   2572 N N     . VAL B 1 84  ? -5.407  -20.102 -19.881 1.00 120.23 ? 106 VAL B N     1 
ATOM   2573 C CA    . VAL B 1 84  ? -4.674  -19.630 -18.710 1.00 119.94 ? 106 VAL B CA    1 
ATOM   2574 C C     . VAL B 1 84  ? -3.820  -18.418 -19.036 1.00 119.77 ? 106 VAL B C     1 
ATOM   2575 O O     . VAL B 1 84  ? -3.674  -17.508 -18.201 1.00 119.58 ? 106 VAL B O     1 
ATOM   2576 C CB    . VAL B 1 84  ? -3.822  -20.754 -18.098 1.00 119.86 ? 106 VAL B CB    1 
ATOM   2577 C CG1   . VAL B 1 84  ? -4.724  -21.868 -17.631 1.00 119.87 ? 106 VAL B CG1   1 
ATOM   2578 C CG2   . VAL B 1 84  ? -2.847  -21.306 -19.113 1.00 120.16 ? 106 VAL B CG2   1 
ATOM   2579 N N     . LEU B 1 85  ? -3.285  -18.412 -20.267 1.00 119.72 ? 107 LEU B N     1 
ATOM   2580 C CA    . LEU B 1 85  ? -2.474  -17.315 -20.763 1.00 119.76 ? 107 LEU B CA    1 
ATOM   2581 C C     . LEU B 1 85  ? -3.274  -16.036 -20.718 1.00 119.97 ? 107 LEU B C     1 
ATOM   2582 O O     . LEU B 1 85  ? -2.833  -15.030 -20.170 1.00 119.68 ? 107 LEU B O     1 
ATOM   2583 C CB    . LEU B 1 85  ? -2.061  -17.585 -22.211 1.00 119.75 ? 107 LEU B CB    1 
ATOM   2584 C CG    . LEU B 1 85  ? -1.022  -18.677 -22.525 1.00 119.35 ? 107 LEU B CG    1 
ATOM   2585 C CD1   . LEU B 1 85  ? -1.190  -19.156 -23.970 1.00 118.79 ? 107 LEU B CD1   1 
ATOM   2586 C CD2   . LEU B 1 85  ? 0.409   -18.175 -22.277 1.00 118.86 ? 107 LEU B CD2   1 
ATOM   2587 N N     . ALA B 1 86  ? -4.462  -16.093 -21.307 1.00 120.49 ? 108 ALA B N     1 
ATOM   2588 C CA    . ALA B 1 86  ? -5.335  -14.942 -21.386 1.00 121.04 ? 108 ALA B CA    1 
ATOM   2589 C C     . ALA B 1 86  ? -5.491  -14.338 -20.005 1.00 121.45 ? 108 ALA B C     1 
ATOM   2590 O O     . ALA B 1 86  ? -5.410  -13.124 -19.845 1.00 121.43 ? 108 ALA B O     1 
ATOM   2591 C CB    . ALA B 1 86  ? -6.681  -15.342 -21.953 1.00 121.10 ? 108 ALA B CB    1 
ATOM   2592 N N     . MET B 1 87  ? -5.684  -15.199 -19.010 1.00 122.11 ? 109 MET B N     1 
ATOM   2593 C CA    . MET B 1 87  ? -5.876  -14.761 -17.633 1.00 122.92 ? 109 MET B CA    1 
ATOM   2594 C C     . MET B 1 87  ? -4.626  -14.128 -17.118 1.00 123.17 ? 109 MET B C     1 
ATOM   2595 O O     . MET B 1 87  ? -4.654  -13.025 -16.571 1.00 122.91 ? 109 MET B O     1 
ATOM   2596 C CB    . MET B 1 87  ? -6.163  -15.949 -16.749 1.00 123.07 ? 109 MET B CB    1 
ATOM   2597 C CG    . MET B 1 87  ? -7.397  -16.721 -17.119 1.00 124.42 ? 109 MET B CG    1 
ATOM   2598 S SD    . MET B 1 87  ? -7.089  -18.476 -16.825 1.00 126.72 ? 109 MET B SD    1 
ATOM   2599 C CE    . MET B 1 87  ? -5.557  -18.407 -15.798 1.00 125.39 ? 109 MET B CE    1 
ATOM   2600 N N     . ARG B 1 88  ? -3.525  -14.854 -17.281 1.00 124.02 ? 110 ARG B N     1 
ATOM   2601 C CA    . ARG B 1 88  ? -2.239  -14.339 -16.876 1.00 125.07 ? 110 ARG B CA    1 
ATOM   2602 C C     . ARG B 1 88  ? -2.049  -12.965 -17.510 1.00 125.54 ? 110 ARG B C     1 
ATOM   2603 O O     . ARG B 1 88  ? -1.641  -12.020 -16.833 1.00 125.40 ? 110 ARG B O     1 
ATOM   2604 C CB    . ARG B 1 88  ? -1.124  -15.318 -17.262 1.00 125.30 ? 110 ARG B CB    1 
ATOM   2605 C CG    . ARG B 1 88  ? 0.227   -15.035 -16.664 1.00 126.14 ? 110 ARG B CG    1 
ATOM   2606 C CD    . ARG B 1 88  ? 1.077   -14.158 -17.538 1.00 128.22 ? 110 ARG B CD    1 
ATOM   2607 N NE    . ARG B 1 88  ? 2.336   -13.763 -16.921 1.00 129.54 ? 110 ARG B NE    1 
ATOM   2608 C CZ    . ARG B 1 88  ? 2.469   -12.743 -16.079 1.00 130.25 ? 110 ARG B CZ    1 
ATOM   2609 N NH1   . ARG B 1 88  ? 3.660   -12.456 -15.577 1.00 130.53 ? 110 ARG B NH1   1 
ATOM   2610 N NH2   . ARG B 1 88  ? 1.416   -12.011 -15.737 1.00 130.80 ? 110 ARG B NH2   1 
ATOM   2611 N N     . GLN B 1 89  ? -2.377  -12.861 -18.799 1.00 126.32 ? 111 GLN B N     1 
ATOM   2612 C CA    . GLN B 1 89  ? -2.337  -11.587 -19.504 1.00 127.16 ? 111 GLN B CA    1 
ATOM   2613 C C     . GLN B 1 89  ? -3.102  -10.554 -18.697 1.00 127.14 ? 111 GLN B C     1 
ATOM   2614 O O     . GLN B 1 89  ? -2.544  -9.543  -18.279 1.00 127.08 ? 111 GLN B O     1 
ATOM   2615 C CB    . GLN B 1 89  ? -2.934  -11.719 -20.912 1.00 127.44 ? 111 GLN B CB    1 
ATOM   2616 C CG    . GLN B 1 89  ? -3.203  -10.383 -21.633 1.00 129.66 ? 111 GLN B CG    1 
ATOM   2617 C CD    . GLN B 1 89  ? -1.928  -9.662  -22.081 1.00 132.77 ? 111 GLN B CD    1 
ATOM   2618 O OE1   . GLN B 1 89  ? -1.634  -9.595  -23.279 1.00 134.16 ? 111 GLN B OE1   1 
ATOM   2619 N NE2   . GLN B 1 89  ? -1.166  -9.118  -21.120 1.00 134.08 ? 111 GLN B NE2   1 
ATOM   2620 N N     . ALA B 1 90  ? -4.372  -10.856 -18.452 1.00 127.31 ? 112 ALA B N     1 
ATOM   2621 C CA    . ALA B 1 90  ? -5.278  -9.968  -17.748 1.00 127.43 ? 112 ALA B CA    1 
ATOM   2622 C C     . ALA B 1 90  ? -4.668  -9.445  -16.464 1.00 127.50 ? 112 ALA B C     1 
ATOM   2623 O O     . ALA B 1 90  ? -4.671  -8.242  -16.214 1.00 127.38 ? 112 ALA B O     1 
ATOM   2624 C CB    . ALA B 1 90  ? -6.580  -10.685 -17.458 1.00 127.50 ? 112 ALA B CB    1 
ATOM   2625 N N     . TRP B 1 91  ? -4.131  -10.353 -15.658 1.00 127.70 ? 113 TRP B N     1 
ATOM   2626 C CA    . TRP B 1 91  ? -3.589  -9.961  -14.376 1.00 128.09 ? 113 TRP B CA    1 
ATOM   2627 C C     . TRP B 1 91  ? -2.524  -8.907  -14.541 1.00 128.63 ? 113 TRP B C     1 
ATOM   2628 O O     . TRP B 1 91  ? -2.537  -7.894  -13.839 1.00 128.72 ? 113 TRP B O     1 
ATOM   2629 C CB    . TRP B 1 91  ? -3.002  -11.166 -13.656 1.00 127.95 ? 113 TRP B CB    1 
ATOM   2630 C CG    . TRP B 1 91  ? -3.995  -12.228 -13.464 1.00 127.51 ? 113 TRP B CG    1 
ATOM   2631 C CD1   . TRP B 1 91  ? -5.325  -12.057 -13.279 1.00 127.23 ? 113 TRP B CD1   1 
ATOM   2632 C CD2   . TRP B 1 91  ? -3.756  -13.644 -13.423 1.00 127.30 ? 113 TRP B CD2   1 
ATOM   2633 N NE1   . TRP B 1 91  ? -5.942  -13.276 -13.135 1.00 127.38 ? 113 TRP B NE1   1 
ATOM   2634 C CE2   . TRP B 1 91  ? -5.003  -14.271 -13.214 1.00 127.14 ? 113 TRP B CE2   1 
ATOM   2635 C CE3   . TRP B 1 91  ? -2.613  -14.445 -13.543 1.00 127.42 ? 113 TRP B CE3   1 
ATOM   2636 C CZ2   . TRP B 1 91  ? -5.147  -15.668 -13.122 1.00 126.79 ? 113 TRP B CZ2   1 
ATOM   2637 C CZ3   . TRP B 1 91  ? -2.755  -15.839 -13.454 1.00 127.35 ? 113 TRP B CZ3   1 
ATOM   2638 C CH2   . TRP B 1 91  ? -4.017  -16.432 -13.239 1.00 126.74 ? 113 TRP B CH2   1 
ATOM   2639 N N     . SER B 1 92  ? -1.599  -9.146  -15.469 1.00 129.22 ? 114 SER B N     1 
ATOM   2640 C CA    . SER B 1 92  ? -0.566  -8.165  -15.757 1.00 129.56 ? 114 SER B CA    1 
ATOM   2641 C C     . SER B 1 92  ? -1.187  -6.992  -16.476 1.00 129.38 ? 114 SER B C     1 
ATOM   2642 O O     . SER B 1 92  ? -0.807  -5.847  -16.229 1.00 129.57 ? 114 SER B O     1 
ATOM   2643 C CB    . SER B 1 92  ? 0.575   -8.760  -16.584 1.00 129.83 ? 114 SER B CB    1 
ATOM   2644 O OG    . SER B 1 92  ? 1.640   -9.185  -15.743 1.00 130.49 ? 114 SER B OG    1 
ATOM   2645 N N     . LYS B 1 93  ? -2.159  -7.281  -17.347 1.00 128.82 ? 115 LYS B N     1 
ATOM   2646 C CA    . LYS B 1 93  ? -2.856  -6.235  -18.094 1.00 128.30 ? 115 LYS B CA    1 
ATOM   2647 C C     . LYS B 1 93  ? -3.692  -5.355  -17.153 1.00 127.90 ? 115 LYS B C     1 
ATOM   2648 O O     . LYS B 1 93  ? -4.231  -4.325  -17.558 1.00 127.90 ? 115 LYS B O     1 
ATOM   2649 C CB    . LYS B 1 93  ? -3.686  -6.825  -19.248 1.00 128.26 ? 115 LYS B CB    1 
ATOM   2650 C CG    . LYS B 1 93  ? -4.131  -5.798  -20.300 1.00 127.98 ? 115 LYS B CG    1 
ATOM   2651 C CD    . LYS B 1 93  ? -4.206  -6.393  -21.705 1.00 127.73 ? 115 LYS B CD    1 
ATOM   2652 C CE    . LYS B 1 93  ? -2.911  -6.160  -22.493 1.00 127.77 ? 115 LYS B CE    1 
ATOM   2653 N NZ    . LYS B 1 93  ? -2.834  -4.780  -23.088 1.00 127.64 ? 115 LYS B NZ    1 
ATOM   2654 N N     . SER B 1 94  ? -3.771  -5.751  -15.888 1.00 127.39 ? 116 SER B N     1 
ATOM   2655 C CA    . SER B 1 94  ? -4.373  -4.900  -14.872 1.00 127.00 ? 116 SER B CA    1 
ATOM   2656 C C     . SER B 1 94  ? -3.410  -3.791  -14.436 1.00 126.59 ? 116 SER B C     1 
ATOM   2657 O O     . SER B 1 94  ? -2.202  -3.863  -14.706 1.00 126.63 ? 116 SER B O     1 
ATOM   2658 C CB    . SER B 1 94  ? -4.789  -5.736  -13.663 1.00 127.08 ? 116 SER B CB    1 
ATOM   2659 O OG    . SER B 1 94  ? -4.859  -4.919  -12.485 1.00 127.27 ? 116 SER B OG    1 
ATOM   2660 N N     . GLY B 1 95  ? -3.952  -2.773  -13.763 1.00 125.98 ? 117 GLY B N     1 
ATOM   2661 C CA    . GLY B 1 95  ? -3.138  -1.725  -13.154 1.00 125.23 ? 117 GLY B CA    1 
ATOM   2662 C C     . GLY B 1 95  ? -3.061  -1.881  -11.648 1.00 124.72 ? 117 GLY B C     1 
ATOM   2663 O O     . GLY B 1 95  ? -2.008  -1.678  -11.049 1.00 124.61 ? 117 GLY B O     1 
ATOM   2664 N N     . ARG B 1 96  ? -4.188  -2.257  -11.045 1.00 124.35 ? 118 ARG B N     1 
ATOM   2665 C CA    . ARG B 1 96  ? -4.347  -2.330  -9.585  1.00 124.00 ? 118 ARG B CA    1 
ATOM   2666 C C     . ARG B 1 96  ? -3.941  -3.683  -8.998  1.00 123.59 ? 118 ARG B C     1 
ATOM   2667 O O     . ARG B 1 96  ? -3.384  -3.742  -7.893  1.00 123.54 ? 118 ARG B O     1 
ATOM   2668 C CB    . ARG B 1 96  ? -5.804  -2.009  -9.206  1.00 124.14 ? 118 ARG B CB    1 
ATOM   2669 C CG    . ARG B 1 96  ? -6.093  -1.714  -7.712  1.00 124.40 ? 118 ARG B CG    1 
ATOM   2670 C CD    . ARG B 1 96  ? -6.656  -2.933  -6.944  1.00 124.48 ? 118 ARG B CD    1 
ATOM   2671 N NE    . ARG B 1 96  ? -7.975  -2.689  -6.334  1.00 124.09 ? 118 ARG B NE    1 
ATOM   2672 C CZ    . ARG B 1 96  ? -8.198  -2.015  -5.202  1.00 123.54 ? 118 ARG B CZ    1 
ATOM   2673 N NH1   . ARG B 1 96  ? -7.198  -1.473  -4.515  1.00 122.94 ? 118 ARG B NH1   1 
ATOM   2674 N NH2   . ARG B 1 96  ? -9.440  -1.874  -4.758  1.00 122.95 ? 118 ARG B NH2   1 
ATOM   2675 N N     . GLU B 1 97  ? -4.238  -4.761  -9.728  1.00 123.09 ? 119 GLU B N     1 
ATOM   2676 C CA    . GLU B 1 97  ? -3.919  -6.121  -9.279  1.00 122.65 ? 119 GLU B CA    1 
ATOM   2677 C C     . GLU B 1 97  ? -2.405  -6.407  -9.353  1.00 122.51 ? 119 GLU B C     1 
ATOM   2678 O O     . GLU B 1 97  ? -1.866  -7.121  -8.502  1.00 122.51 ? 119 GLU B O     1 
ATOM   2679 C CB    . GLU B 1 97  ? -4.758  -7.161  -10.052 1.00 122.55 ? 119 GLU B CB    1 
ATOM   2680 C CG    . GLU B 1 97  ? -4.472  -8.655  -9.763  1.00 122.06 ? 119 GLU B CG    1 
ATOM   2681 C CD    . GLU B 1 97  ? -5.161  -9.221  -8.514  1.00 121.39 ? 119 GLU B CD    1 
ATOM   2682 O OE1   . GLU B 1 97  ? -5.677  -8.445  -7.680  1.00 121.64 ? 119 GLU B OE1   1 
ATOM   2683 O OE2   . GLU B 1 97  ? -5.176  -10.466 -8.365  1.00 120.71 ? 119 GLU B OE2   1 
ATOM   2684 N N     . LYS B 1 98  ? -1.717  -5.842  -10.347 1.00 122.07 ? 120 LYS B N     1 
ATOM   2685 C CA    . LYS B 1 98  ? -0.268  -6.000  -10.413 1.00 121.59 ? 120 LYS B CA    1 
ATOM   2686 C C     . LYS B 1 98  ? 0.346   -5.435  -9.144  1.00 121.14 ? 120 LYS B C     1 
ATOM   2687 O O     . LYS B 1 98  ? 1.026   -6.152  -8.414  1.00 121.13 ? 120 LYS B O     1 
ATOM   2688 C CB    . LYS B 1 98  ? 0.336   -5.335  -11.657 1.00 121.83 ? 120 LYS B CB    1 
ATOM   2689 C CG    . LYS B 1 98  ? 1.804   -5.730  -11.905 1.00 122.03 ? 120 LYS B CG    1 
ATOM   2690 C CD    . LYS B 1 98  ? 2.324   -5.244  -13.247 1.00 122.05 ? 120 LYS B CD    1 
ATOM   2691 C CE    . LYS B 1 98  ? 3.676   -5.875  -13.573 1.00 122.45 ? 120 LYS B CE    1 
ATOM   2692 N NZ    . LYS B 1 98  ? 4.732   -5.532  -12.560 1.00 122.70 ? 120 LYS B NZ    1 
ATOM   2693 N N     . LEU B 1 99  ? 0.075   -4.159  -8.875  1.00 120.65 ? 121 LEU B N     1 
ATOM   2694 C CA    . LEU B 1 99  ? 0.553   -3.509  -7.662  1.00 120.30 ? 121 LEU B CA    1 
ATOM   2695 C C     . LEU B 1 99  ? 0.353   -4.462  -6.508  1.00 119.97 ? 121 LEU B C     1 
ATOM   2696 O O     . LEU B 1 99  ? 1.295   -4.774  -5.776  1.00 119.89 ? 121 LEU B O     1 
ATOM   2697 C CB    . LEU B 1 99  ? -0.218  -2.216  -7.392  1.00 120.34 ? 121 LEU B CB    1 
ATOM   2698 C CG    . LEU B 1 99  ? 0.503   -1.148  -6.555  1.00 120.41 ? 121 LEU B CG    1 
ATOM   2699 C CD1   . LEU B 1 99  ? -0.245  0.183   -6.674  1.00 120.17 ? 121 LEU B CD1   1 
ATOM   2700 C CD2   . LEU B 1 99  ? 0.701   -1.537  -5.076  1.00 120.15 ? 121 LEU B CD2   1 
ATOM   2701 N N     . ARG B 1 100 ? -0.885  -4.920  -6.367  1.00 119.57 ? 122 ARG B N     1 
ATOM   2702 C CA    . ARG B 1 100 ? -1.211  -5.942  -5.410  1.00 119.51 ? 122 ARG B CA    1 
ATOM   2703 C C     . ARG B 1 100 ? -0.243  -7.105  -5.553  1.00 119.66 ? 122 ARG B C     1 
ATOM   2704 O O     . ARG B 1 100 ? 0.588   -7.323  -4.687  1.00 119.67 ? 122 ARG B O     1 
ATOM   2705 C CB    . ARG B 1 100 ? -2.649  -6.427  -5.603  1.00 119.49 ? 122 ARG B CB    1 
ATOM   2706 C CG    . ARG B 1 100 ? -3.732  -5.567  -4.944  1.00 119.13 ? 122 ARG B CG    1 
ATOM   2707 C CD    . ARG B 1 100 ? -5.002  -6.391  -4.740  1.00 117.52 ? 122 ARG B CD    1 
ATOM   2708 N NE    . ARG B 1 100 ? -6.027  -5.720  -3.949  1.00 116.35 ? 122 ARG B NE    1 
ATOM   2709 C CZ    . ARG B 1 100 ? -7.280  -5.530  -4.358  1.00 116.72 ? 122 ARG B CZ    1 
ATOM   2710 N NH1   . ARG B 1 100 ? -7.676  -5.969  -5.554  1.00 116.63 ? 122 ARG B NH1   1 
ATOM   2711 N NH2   . ARG B 1 100 ? -8.147  -4.910  -3.566  1.00 116.59 ? 122 ARG B NH2   1 
ATOM   2712 N N     . LEU B 1 101 ? -0.323  -7.825  -6.665  1.00 120.06 ? 123 LEU B N     1 
ATOM   2713 C CA    . LEU B 1 101 ? 0.404   -9.085  -6.810  1.00 120.57 ? 123 LEU B CA    1 
ATOM   2714 C C     . LEU B 1 101 ? 1.905   -9.020  -6.511  1.00 121.18 ? 123 LEU B C     1 
ATOM   2715 O O     . LEU B 1 101 ? 2.441   -9.930  -5.886  1.00 121.20 ? 123 LEU B O     1 
ATOM   2716 C CB    . LEU B 1 101 ? 0.162   -9.696  -8.191  1.00 120.46 ? 123 LEU B CB    1 
ATOM   2717 C CG    . LEU B 1 101 ? -1.127  -10.492 -8.420  1.00 119.78 ? 123 LEU B CG    1 
ATOM   2718 C CD1   . LEU B 1 101 ? -1.405  -10.557 -9.901  1.00 119.75 ? 123 LEU B CD1   1 
ATOM   2719 C CD2   . LEU B 1 101 ? -1.047  -11.900 -7.842  1.00 118.66 ? 123 LEU B CD2   1 
ATOM   2720 N N     . ASP B 1 102 ? 2.579   -7.959  -6.954  1.00 122.02 ? 124 ASP B N     1 
ATOM   2721 C CA    . ASP B 1 102 ? 4.019   -7.814  -6.713  1.00 122.87 ? 124 ASP B CA    1 
ATOM   2722 C C     . ASP B 1 102 ? 4.307   -7.768  -5.213  1.00 123.62 ? 124 ASP B C     1 
ATOM   2723 O O     . ASP B 1 102 ? 5.143   -8.525  -4.698  1.00 123.47 ? 124 ASP B O     1 
ATOM   2724 C CB    . ASP B 1 102 ? 4.564   -6.566  -7.419  1.00 122.74 ? 124 ASP B CB    1 
ATOM   2725 C CG    . ASP B 1 102 ? 4.814   -6.792  -8.905  1.00 122.43 ? 124 ASP B CG    1 
ATOM   2726 O OD1   . ASP B 1 102 ? 5.497   -7.779  -9.260  1.00 121.99 ? 124 ASP B OD1   1 
ATOM   2727 O OD2   . ASP B 1 102 ? 4.340   -5.971  -9.720  1.00 121.82 ? 124 ASP B OD2   1 
ATOM   2728 N N     . GLU B 1 103 ? 3.574   -6.890  -4.523  1.00 124.87 ? 125 GLU B N     1 
ATOM   2729 C CA    . GLU B 1 103 ? 3.634   -6.752  -3.073  1.00 125.92 ? 125 GLU B CA    1 
ATOM   2730 C C     . GLU B 1 103 ? 3.580   -8.068  -2.302  1.00 125.79 ? 125 GLU B C     1 
ATOM   2731 O O     . GLU B 1 103 ? 4.156   -8.221  -1.257  1.00 125.85 ? 125 GLU B O     1 
ATOM   2732 C CB    . GLU B 1 103 ? 2.484   -5.866  -2.631  1.00 126.51 ? 125 GLU B CB    1 
ATOM   2733 C CG    . GLU B 1 103 ? 2.837   -4.430  -2.703  1.00 129.05 ? 125 GLU B CG    1 
ATOM   2734 C CD    . GLU B 1 103 ? 3.892   -4.103  -1.688  1.00 132.23 ? 125 GLU B CD    1 
ATOM   2735 O OE1   . GLU B 1 103 ? 4.942   -3.542  -2.090  1.00 133.71 ? 125 GLU B OE1   1 
ATOM   2736 O OE2   . GLU B 1 103 ? 3.660   -4.428  -0.486  1.00 133.78 ? 125 GLU B OE2   1 
ATOM   2737 N N     . ALA B 1 104 ? 2.805   -9.013  -2.830  1.00 125.74 ? 126 ALA B N     1 
ATOM   2738 C CA    . ALA B 1 104 ? 2.612   -10.315 -2.200  1.00 125.46 ? 126 ALA B CA    1 
ATOM   2739 C C     . ALA B 1 104 ? 3.832   -11.176 -2.379  1.00 125.15 ? 126 ALA B C     1 
ATOM   2740 O O     . ALA B 1 104 ? 3.840   -12.284 -1.832  1.00 124.91 ? 126 ALA B O     1 
ATOM   2741 C CB    . ALA B 1 104 ? 1.400   -11.003 -2.812  1.00 125.72 ? 126 ALA B CB    1 
ATOM   2742 N N     . GLY B 1 105 ? 4.796   -10.650 -3.157  1.00 124.88 ? 127 GLY B N     1 
ATOM   2743 C CA    . GLY B 1 105 ? 5.944   -11.417 -3.593  1.00 124.65 ? 127 GLY B CA    1 
ATOM   2744 C C     . GLY B 1 105 ? 5.644   -12.226 -4.843  1.00 124.63 ? 127 GLY B C     1 
ATOM   2745 O O     . GLY B 1 105 ? 6.467   -13.026 -5.277  1.00 124.55 ? 127 GLY B O     1 
ATOM   2746 N N     . VAL B 1 106 ? 4.461   -12.024 -5.421  1.00 124.68 ? 128 VAL B N     1 
ATOM   2747 C CA    . VAL B 1 106 ? 4.073   -12.725 -6.644  1.00 124.49 ? 128 VAL B CA    1 
ATOM   2748 C C     . VAL B 1 106 ? 4.402   -11.816 -7.832  1.00 124.59 ? 128 VAL B C     1 
ATOM   2749 O O     . VAL B 1 106 ? 3.565   -11.029 -8.294  1.00 124.53 ? 128 VAL B O     1 
ATOM   2750 C CB    . VAL B 1 106 ? 2.579   -13.139 -6.635  1.00 124.35 ? 128 VAL B CB    1 
ATOM   2751 C CG1   . VAL B 1 106 ? 2.294   -14.103 -7.751  1.00 124.50 ? 128 VAL B CG1   1 
ATOM   2752 C CG2   . VAL B 1 106 ? 2.215   -13.798 -5.320  1.00 124.29 ? 128 VAL B CG2   1 
ATOM   2753 N N     . THR B 1 107 ? 5.649   -11.927 -8.306  1.00 124.77 ? 129 THR B N     1 
ATOM   2754 C CA    . THR B 1 107 ? 6.150   -11.098 -9.406  1.00 124.94 ? 129 THR B CA    1 
ATOM   2755 C C     . THR B 1 107 ? 6.065   -11.819 -10.739 1.00 125.18 ? 129 THR B C     1 
ATOM   2756 O O     . THR B 1 107 ? 5.771   -13.018 -10.800 1.00 125.17 ? 129 THR B O     1 
ATOM   2757 C CB    . THR B 1 107 ? 7.621   -10.710 -9.196  1.00 124.83 ? 129 THR B CB    1 
ATOM   2758 O OG1   . THR B 1 107 ? 8.393   -11.904 -9.007  1.00 124.43 ? 129 THR B OG1   1 
ATOM   2759 C CG2   . THR B 1 107 ? 7.785   -9.796  -7.992  1.00 125.03 ? 129 THR B CG2   1 
ATOM   2760 N N     . ASP B 1 108 ? 6.343   -11.071 -11.805 1.00 125.45 ? 130 ASP B N     1 
ATOM   2761 C CA    . ASP B 1 108 ? 6.411   -11.626 -13.137 1.00 125.89 ? 130 ASP B CA    1 
ATOM   2762 C C     . ASP B 1 108 ? 7.119   -12.966 -13.129 1.00 125.90 ? 130 ASP B C     1 
ATOM   2763 O O     . ASP B 1 108 ? 6.548   -13.978 -13.542 1.00 125.92 ? 130 ASP B O     1 
ATOM   2764 C CB    . ASP B 1 108 ? 7.142   -10.654 -14.047 1.00 126.19 ? 130 ASP B CB    1 
ATOM   2765 C CG    . ASP B 1 108 ? 6.358   -9.379  -14.266 1.00 127.21 ? 130 ASP B CG    1 
ATOM   2766 O OD1   . ASP B 1 108 ? 5.244   -9.494  -14.873 1.00 128.61 ? 130 ASP B OD1   1 
ATOM   2767 O OD2   . ASP B 1 108 ? 6.854   -8.259  -13.840 1.00 128.46 ? 130 ASP B OD2   1 
ATOM   2768 N N     . GLU B 1 109 ? 8.356   -12.961 -12.618 1.00 125.95 ? 131 GLU B N     1 
ATOM   2769 C CA    . GLU B 1 109 ? 9.204   -14.147 -12.583 1.00 126.02 ? 131 GLU B CA    1 
ATOM   2770 C C     . GLU B 1 109 ? 8.437   -15.367 -12.075 1.00 125.33 ? 131 GLU B C     1 
ATOM   2771 O O     . GLU B 1 109 ? 8.379   -16.405 -12.755 1.00 125.17 ? 131 GLU B O     1 
ATOM   2772 C CB    . GLU B 1 109 ? 10.441  -13.892 -11.709 1.00 126.48 ? 131 GLU B CB    1 
ATOM   2773 C CG    . GLU B 1 109 ? 11.260  -12.636 -12.074 1.00 128.83 ? 131 GLU B CG    1 
ATOM   2774 C CD    . GLU B 1 109 ? 10.726  -11.348 -11.432 1.00 131.85 ? 131 GLU B CD    1 
ATOM   2775 O OE1   . GLU B 1 109 ? 9.608   -10.899 -11.790 1.00 132.86 ? 131 GLU B OE1   1 
ATOM   2776 O OE2   . GLU B 1 109 ? 11.435  -10.773 -10.577 1.00 133.31 ? 131 GLU B OE2   1 
ATOM   2777 N N     . VAL B 1 110 ? 7.837   -15.228 -10.886 1.00 124.62 ? 132 VAL B N     1 
ATOM   2778 C CA    . VAL B 1 110 ? 7.093   -16.316 -10.288 1.00 123.98 ? 132 VAL B CA    1 
ATOM   2779 C C     . VAL B 1 110 ? 6.016   -16.726 -11.273 1.00 123.63 ? 132 VAL B C     1 
ATOM   2780 O O     . VAL B 1 110 ? 5.969   -17.872 -11.709 1.00 123.54 ? 132 VAL B O     1 
ATOM   2781 C CB    . VAL B 1 110 ? 6.450   -15.907 -8.946  1.00 124.03 ? 132 VAL B CB    1 
ATOM   2782 C CG1   . VAL B 1 110 ? 5.958   -17.148 -8.216  1.00 124.14 ? 132 VAL B CG1   1 
ATOM   2783 C CG2   . VAL B 1 110 ? 7.447   -15.154 -8.060  1.00 123.92 ? 132 VAL B CG2   1 
ATOM   2784 N N     . LEU B 1 111 ? 5.172   -15.766 -11.642 1.00 123.20 ? 133 LEU B N     1 
ATOM   2785 C CA    . LEU B 1 111 ? 4.094   -16.011 -12.579 1.00 122.85 ? 133 LEU B CA    1 
ATOM   2786 C C     . LEU B 1 111 ? 4.641   -16.846 -13.697 1.00 122.54 ? 133 LEU B C     1 
ATOM   2787 O O     . LEU B 1 111 ? 4.216   -17.972 -13.938 1.00 122.24 ? 133 LEU B O     1 
ATOM   2788 C CB    . LEU B 1 111 ? 3.567   -14.688 -13.133 1.00 122.97 ? 133 LEU B CB    1 
ATOM   2789 C CG    . LEU B 1 111 ? 2.678   -13.869 -12.190 1.00 123.15 ? 133 LEU B CG    1 
ATOM   2790 C CD1   . LEU B 1 111 ? 2.663   -12.382 -12.551 1.00 123.67 ? 133 LEU B CD1   1 
ATOM   2791 C CD2   . LEU B 1 111 ? 1.253   -14.432 -12.136 1.00 123.40 ? 133 LEU B CD2   1 
ATOM   2792 N N     . ASP B 1 112 ? 5.637   -16.284 -14.351 1.00 122.49 ? 134 ASP B N     1 
ATOM   2793 C CA    . ASP B 1 112 ? 6.254   -16.939 -15.456 1.00 122.62 ? 134 ASP B CA    1 
ATOM   2794 C C     . ASP B 1 112 ? 6.664   -18.334 -15.037 1.00 122.50 ? 134 ASP B C     1 
ATOM   2795 O O     . ASP B 1 112 ? 6.296   -19.309 -15.695 1.00 122.54 ? 134 ASP B O     1 
ATOM   2796 C CB    . ASP B 1 112 ? 7.431   -16.102 -15.932 1.00 122.74 ? 134 ASP B CB    1 
ATOM   2797 C CG    . ASP B 1 112 ? 7.020   -14.639 -16.207 1.00 123.09 ? 134 ASP B CG    1 
ATOM   2798 O OD1   . ASP B 1 112 ? 5.840   -14.283 -15.970 1.00 123.68 ? 134 ASP B OD1   1 
ATOM   2799 O OD2   . ASP B 1 112 ? 7.866   -13.838 -16.654 1.00 123.69 ? 134 ASP B OD2   1 
ATOM   2800 N N     . ALA B 1 113 ? 7.370   -18.428 -13.911 1.00 122.28 ? 135 ALA B N     1 
ATOM   2801 C CA    . ALA B 1 113 ? 7.815   -19.716 -13.401 1.00 122.11 ? 135 ALA B CA    1 
ATOM   2802 C C     . ALA B 1 113 ? 6.643   -20.680 -13.354 1.00 122.03 ? 135 ALA B C     1 
ATOM   2803 O O     . ALA B 1 113 ? 6.740   -21.825 -13.805 1.00 122.04 ? 135 ALA B O     1 
ATOM   2804 C CB    . ALA B 1 113 ? 8.436   -19.562 -12.031 1.00 122.07 ? 135 ALA B CB    1 
ATOM   2805 N N     . ALA B 1 114 ? 5.523   -20.198 -12.835 1.00 121.88 ? 136 ALA B N     1 
ATOM   2806 C CA    . ALA B 1 114 ? 4.351   -21.031 -12.701 1.00 121.81 ? 136 ALA B CA    1 
ATOM   2807 C C     . ALA B 1 114 ? 3.843   -21.387 -14.083 1.00 121.81 ? 136 ALA B C     1 
ATOM   2808 O O     . ALA B 1 114 ? 3.624   -22.567 -14.397 1.00 121.78 ? 136 ALA B O     1 
ATOM   2809 C CB    . ALA B 1 114 ? 3.297   -20.312 -11.913 1.00 121.90 ? 136 ALA B CB    1 
ATOM   2810 N N     . MET B 1 115 ? 3.686   -20.358 -14.914 1.00 121.78 ? 137 MET B N     1 
ATOM   2811 C CA    . MET B 1 115 ? 3.210   -20.545 -16.266 1.00 121.79 ? 137 MET B CA    1 
ATOM   2812 C C     . MET B 1 115 ? 3.949   -21.706 -16.897 1.00 121.82 ? 137 MET B C     1 
ATOM   2813 O O     . MET B 1 115 ? 3.340   -22.689 -17.315 1.00 121.83 ? 137 MET B O     1 
ATOM   2814 C CB    . MET B 1 115 ? 3.403   -19.265 -17.076 1.00 121.82 ? 137 MET B CB    1 
ATOM   2815 C CG    . MET B 1 115 ? 2.407   -18.170 -16.738 1.00 121.81 ? 137 MET B CG    1 
ATOM   2816 S SD    . MET B 1 115 ? 0.689   -18.716 -16.866 1.00 121.74 ? 137 MET B SD    1 
ATOM   2817 C CE    . MET B 1 115 ? 0.432   -18.737 -18.638 1.00 121.53 ? 137 MET B CE    1 
ATOM   2818 N N     . GLN B 1 116 ? 5.270   -21.590 -16.923 1.00 121.79 ? 138 GLN B N     1 
ATOM   2819 C CA    . GLN B 1 116 ? 6.137   -22.633 -17.429 1.00 121.89 ? 138 GLN B CA    1 
ATOM   2820 C C     . GLN B 1 116 ? 5.705   -23.995 -16.918 1.00 121.49 ? 138 GLN B C     1 
ATOM   2821 O O     . GLN B 1 116 ? 5.182   -24.826 -17.676 1.00 121.34 ? 138 GLN B O     1 
ATOM   2822 C CB    . GLN B 1 116 ? 7.565   -22.359 -16.974 1.00 122.20 ? 138 GLN B CB    1 
ATOM   2823 C CG    . GLN B 1 116 ? 8.140   -21.039 -17.496 1.00 123.91 ? 138 GLN B CG    1 
ATOM   2824 C CD    . GLN B 1 116 ? 9.462   -20.677 -16.826 1.00 126.13 ? 138 GLN B CD    1 
ATOM   2825 O OE1   . GLN B 1 116 ? 9.668   -20.934 -15.633 1.00 126.95 ? 138 GLN B OE1   1 
ATOM   2826 N NE2   . GLN B 1 116 ? 10.368  -20.075 -17.598 1.00 127.01 ? 138 GLN B NE2   1 
ATOM   2827 N N     . ALA B 1 117 ? 5.916   -24.197 -15.616 1.00 121.16 ? 139 ALA B N     1 
ATOM   2828 C CA    . ALA B 1 117 ? 5.649   -25.460 -14.960 1.00 120.93 ? 139 ALA B CA    1 
ATOM   2829 C C     . ALA B 1 117 ? 4.312   -25.988 -15.414 1.00 120.89 ? 139 ALA B C     1 
ATOM   2830 O O     . ALA B 1 117 ? 4.194   -27.145 -15.808 1.00 120.93 ? 139 ALA B O     1 
ATOM   2831 C CB    . ALA B 1 117 ? 5.658   -25.267 -13.476 1.00 120.86 ? 139 ALA B CB    1 
ATOM   2832 N N     . PHE B 1 118 ? 3.319   -25.107 -15.382 1.00 120.84 ? 140 PHE B N     1 
ATOM   2833 C CA    . PHE B 1 118 ? 1.973   -25.427 -15.803 1.00 120.90 ? 140 PHE B CA    1 
ATOM   2834 C C     . PHE B 1 118 ? 1.978   -25.908 -17.252 1.00 120.82 ? 140 PHE B C     1 
ATOM   2835 O O     . PHE B 1 118 ? 1.776   -27.099 -17.524 1.00 120.84 ? 140 PHE B O     1 
ATOM   2836 C CB    . PHE B 1 118 ? 1.075   -24.192 -15.636 1.00 121.06 ? 140 PHE B CB    1 
ATOM   2837 C CG    . PHE B 1 118 ? -0.405  -24.475 -15.780 1.00 121.54 ? 140 PHE B CG    1 
ATOM   2838 C CD1   . PHE B 1 118 ? -1.182  -24.810 -14.666 1.00 121.40 ? 140 PHE B CD1   1 
ATOM   2839 C CD2   . PHE B 1 118 ? -1.026  -24.393 -17.031 1.00 122.02 ? 140 PHE B CD2   1 
ATOM   2840 C CE1   . PHE B 1 118 ? -2.544  -25.070 -14.800 1.00 121.42 ? 140 PHE B CE1   1 
ATOM   2841 C CE2   . PHE B 1 118 ? -2.390  -24.652 -17.175 1.00 122.18 ? 140 PHE B CE2   1 
ATOM   2842 C CZ    . PHE B 1 118 ? -3.148  -24.990 -16.101 1.00 122.06 ? 140 PHE B CZ    1 
ATOM   2843 N N     . ILE B 1 119 ? 2.240   -24.990 -18.179 1.00 120.64 ? 141 ILE B N     1 
ATOM   2844 C CA    . ILE B 1 119 ? 2.129   -25.308 -19.589 1.00 120.54 ? 141 ILE B CA    1 
ATOM   2845 C C     . ILE B 1 119 ? 2.890   -26.582 -19.892 1.00 120.67 ? 141 ILE B C     1 
ATOM   2846 O O     . ILE B 1 119 ? 2.382   -27.477 -20.570 1.00 120.61 ? 141 ILE B O     1 
ATOM   2847 C CB    . ILE B 1 119 ? 2.599   -24.148 -20.471 1.00 120.44 ? 141 ILE B CB    1 
ATOM   2848 C CG1   . ILE B 1 119 ? 1.776   -22.894 -20.142 1.00 120.27 ? 141 ILE B CG1   1 
ATOM   2849 C CG2   . ILE B 1 119 ? 2.443   -24.519 -21.940 1.00 120.28 ? 141 ILE B CG2   1 
ATOM   2850 C CD1   . ILE B 1 119 ? 2.330   -21.594 -20.689 1.00 119.90 ? 141 ILE B CD1   1 
ATOM   2851 N N     . LEU B 1 120 ? 4.093   -26.671 -19.342 1.00 120.97 ? 142 LEU B N     1 
ATOM   2852 C CA    . LEU B 1 120 ? 4.930   -27.823 -19.559 1.00 121.49 ? 142 LEU B CA    1 
ATOM   2853 C C     . LEU B 1 120 ? 4.170   -29.106 -19.352 1.00 121.56 ? 142 LEU B C     1 
ATOM   2854 O O     . LEU B 1 120 ? 4.001   -29.905 -20.290 1.00 121.79 ? 142 LEU B O     1 
ATOM   2855 C CB    . LEU B 1 120 ? 6.123   -27.786 -18.618 1.00 121.74 ? 142 LEU B CB    1 
ATOM   2856 C CG    . LEU B 1 120 ? 7.327   -27.032 -19.181 1.00 122.67 ? 142 LEU B CG    1 
ATOM   2857 C CD1   . LEU B 1 120 ? 8.407   -26.917 -18.111 1.00 123.85 ? 142 LEU B CD1   1 
ATOM   2858 C CD2   . LEU B 1 120 ? 7.866   -27.717 -20.451 1.00 123.50 ? 142 LEU B CD2   1 
ATOM   2859 N N     . GLU B 1 121 ? 3.695   -29.287 -18.123 1.00 121.59 ? 143 GLU B N     1 
ATOM   2860 C CA    . GLU B 1 121 ? 3.013   -30.501 -17.746 1.00 121.76 ? 143 GLU B CA    1 
ATOM   2861 C C     . GLU B 1 121 ? 1.989   -30.909 -18.773 1.00 121.66 ? 143 GLU B C     1 
ATOM   2862 O O     . GLU B 1 121 ? 2.024   -32.032 -19.278 1.00 121.72 ? 143 GLU B O     1 
ATOM   2863 C CB    . GLU B 1 121 ? 2.330   -30.301 -16.410 1.00 122.06 ? 143 GLU B CB    1 
ATOM   2864 C CG    . GLU B 1 121 ? 3.286   -30.310 -15.253 1.00 123.23 ? 143 GLU B CG    1 
ATOM   2865 C CD    . GLU B 1 121 ? 4.116   -31.579 -15.205 1.00 124.51 ? 143 GLU B CD    1 
ATOM   2866 O OE1   . GLU B 1 121 ? 3.709   -32.642 -15.816 1.00 124.95 ? 143 GLU B OE1   1 
ATOM   2867 O OE2   . GLU B 1 121 ? 5.185   -31.507 -14.548 1.00 125.14 ? 143 GLU B OE2   1 
ATOM   2868 N N     . VAL B 1 122 ? 1.086   -29.984 -19.088 1.00 121.55 ? 144 VAL B N     1 
ATOM   2869 C CA    . VAL B 1 122 ? 0.051   -30.241 -20.071 1.00 121.46 ? 144 VAL B CA    1 
ATOM   2870 C C     . VAL B 1 122 ? 0.716   -30.859 -21.286 1.00 121.37 ? 144 VAL B C     1 
ATOM   2871 O O     . VAL B 1 122 ? 0.446   -32.010 -21.632 1.00 121.27 ? 144 VAL B O     1 
ATOM   2872 C CB    . VAL B 1 122 ? -0.725  -28.950 -20.440 1.00 121.54 ? 144 VAL B CB    1 
ATOM   2873 C CG1   . VAL B 1 122 ? -1.620  -29.164 -21.683 1.00 121.45 ? 144 VAL B CG1   1 
ATOM   2874 C CG2   . VAL B 1 122 ? -1.559  -28.478 -19.237 1.00 121.37 ? 144 VAL B CG2   1 
ATOM   2875 N N     . ILE B 1 123 ? 1.635   -30.108 -21.880 1.00 121.31 ? 145 ILE B N     1 
ATOM   2876 C CA    . ILE B 1 123 ? 2.265   -30.516 -23.115 1.00 121.40 ? 145 ILE B CA    1 
ATOM   2877 C C     . ILE B 1 123 ? 2.962   -31.867 -22.974 1.00 121.51 ? 145 ILE B C     1 
ATOM   2878 O O     . ILE B 1 123 ? 2.942   -32.694 -23.909 1.00 121.78 ? 145 ILE B O     1 
ATOM   2879 C CB    . ILE B 1 123 ? 3.225   -29.441 -23.636 1.00 121.26 ? 145 ILE B CB    1 
ATOM   2880 C CG1   . ILE B 1 123 ? 2.479   -28.103 -23.775 1.00 121.06 ? 145 ILE B CG1   1 
ATOM   2881 C CG2   . ILE B 1 123 ? 3.806   -29.864 -24.973 1.00 121.55 ? 145 ILE B CG2   1 
ATOM   2882 C CD1   . ILE B 1 123 ? 3.273   -26.999 -24.448 1.00 120.49 ? 145 ILE B CD1   1 
ATOM   2883 N N     . ALA B 1 124 ? 3.544   -32.101 -21.799 1.00 121.61 ? 146 ALA B N     1 
ATOM   2884 C CA    . ALA B 1 124 ? 4.265   -33.337 -21.568 1.00 121.98 ? 146 ALA B CA    1 
ATOM   2885 C C     . ALA B 1 124 ? 3.349   -34.531 -21.441 1.00 122.36 ? 146 ALA B C     1 
ATOM   2886 O O     . ALA B 1 124 ? 3.731   -35.649 -21.830 1.00 122.45 ? 146 ALA B O     1 
ATOM   2887 C CB    . ALA B 1 124 ? 5.095   -33.221 -20.340 1.00 121.98 ? 146 ALA B CB    1 
ATOM   2888 N N     . LYS B 1 125 ? 2.141   -34.297 -20.900 1.00 122.93 ? 147 LYS B N     1 
ATOM   2889 C CA    . LYS B 1 125 ? 1.318   -35.408 -20.456 1.00 123.73 ? 147 LYS B CA    1 
ATOM   2890 C C     . LYS B 1 125 ? 0.160   -35.732 -21.373 1.00 124.08 ? 147 LYS B C     1 
ATOM   2891 O O     . LYS B 1 125 ? -0.245  -36.892 -21.469 1.00 123.99 ? 147 LYS B O     1 
ATOM   2892 C CB    . LYS B 1 125 ? 0.789   -35.146 -19.048 1.00 123.94 ? 147 LYS B CB    1 
ATOM   2893 C CG    . LYS B 1 125 ? 1.866   -34.921 -18.000 1.00 125.08 ? 147 LYS B CG    1 
ATOM   2894 C CD    . LYS B 1 125 ? 2.733   -36.155 -17.816 1.00 127.20 ? 147 LYS B CD    1 
ATOM   2895 C CE    . LYS B 1 125 ? 4.038   -35.814 -17.096 1.00 128.06 ? 147 LYS B CE    1 
ATOM   2896 N NZ    . LYS B 1 125 ? 3.823   -35.488 -15.652 1.00 128.43 ? 147 LYS B NZ    1 
ATOM   2897 N N     . HIS B 1 126 ? -0.363  -34.713 -22.051 1.00 124.79 ? 148 HIS B N     1 
ATOM   2898 C CA    . HIS B 1 126 ? -1.621  -34.843 -22.808 1.00 125.55 ? 148 HIS B CA    1 
ATOM   2899 C C     . HIS B 1 126 ? -1.629  -35.899 -23.939 1.00 126.29 ? 148 HIS B C     1 
ATOM   2900 O O     . HIS B 1 126 ? -2.705  -36.419 -24.308 1.00 126.38 ? 148 HIS B O     1 
ATOM   2901 C CB    . HIS B 1 126 ? -2.164  -33.459 -23.267 1.00 125.36 ? 148 HIS B CB    1 
ATOM   2902 C CG    . HIS B 1 126 ? -1.693  -33.012 -24.625 1.00 124.72 ? 148 HIS B CG    1 
ATOM   2903 N ND1   . HIS B 1 126 ? -2.584  -32.820 -25.684 1.00 124.42 ? 148 HIS B ND1   1 
ATOM   2904 C CD2   . HIS B 1 126 ? -0.434  -32.691 -25.091 1.00 123.79 ? 148 HIS B CD2   1 
ATOM   2905 C CE1   . HIS B 1 126 ? -1.892  -32.423 -26.747 1.00 123.79 ? 148 HIS B CE1   1 
ATOM   2906 N NE2   . HIS B 1 126 ? -0.585  -32.334 -26.413 1.00 123.51 ? 148 HIS B NE2   1 
ATOM   2907 N N     . GLY B 1 127 ? -0.442  -36.221 -24.466 1.00 127.05 ? 149 GLY B N     1 
ATOM   2908 C CA    . GLY B 1 127 ? -0.329  -37.175 -25.568 1.00 128.27 ? 149 GLY B CA    1 
ATOM   2909 C C     . GLY B 1 127 ? 0.710   -38.249 -25.328 1.00 129.21 ? 149 GLY B C     1 
ATOM   2910 O O     . GLY B 1 127 ? 1.085   -38.517 -24.162 1.00 129.27 ? 149 GLY B O     1 
ATOM   2911 N N     . GLU B 1 128 ? 1.165   -38.868 -26.437 1.00 130.20 ? 150 GLU B N     1 
ATOM   2912 C CA    . GLU B 1 128 ? 2.275   -39.814 -26.387 1.00 131.27 ? 150 GLU B CA    1 
ATOM   2913 C C     . GLU B 1 128 ? 3.588   -39.089 -26.134 1.00 131.42 ? 150 GLU B C     1 
ATOM   2914 O O     . GLU B 1 128 ? 3.751   -37.944 -26.560 1.00 131.47 ? 150 GLU B O     1 
ATOM   2915 C CB    . GLU B 1 128 ? 2.394   -40.566 -27.702 1.00 131.57 ? 150 GLU B CB    1 
ATOM   2916 C CG    . GLU B 1 128 ? 1.578   -41.843 -27.772 1.00 133.88 ? 150 GLU B CG    1 
ATOM   2917 C CD    . GLU B 1 128 ? 2.022   -42.715 -28.933 1.00 137.07 ? 150 GLU B CD    1 
ATOM   2918 O OE1   . GLU B 1 128 ? 3.116   -43.330 -28.844 1.00 138.45 ? 150 GLU B OE1   1 
ATOM   2919 O OE2   . GLU B 1 128 ? 1.279   -42.782 -29.938 1.00 138.24 ? 150 GLU B OE2   1 
ATOM   2920 N N     . PRO B 1 129 ? 4.534   -39.754 -25.443 1.00 131.69 ? 151 PRO B N     1 
ATOM   2921 C CA    . PRO B 1 129 ? 5.863   -39.150 -25.295 1.00 131.77 ? 151 PRO B CA    1 
ATOM   2922 C C     . PRO B 1 129 ? 6.595   -39.060 -26.639 1.00 131.69 ? 151 PRO B C     1 
ATOM   2923 O O     . PRO B 1 129 ? 6.413   -39.928 -27.504 1.00 131.60 ? 151 PRO B O     1 
ATOM   2924 C CB    . PRO B 1 129 ? 6.594   -40.106 -24.329 1.00 131.79 ? 151 PRO B CB    1 
ATOM   2925 C CG    . PRO B 1 129 ? 5.835   -41.391 -24.388 1.00 131.87 ? 151 PRO B CG    1 
ATOM   2926 C CD    . PRO B 1 129 ? 4.411   -41.027 -24.704 1.00 131.78 ? 151 PRO B CD    1 
ATOM   2927 N N     . ALA B 1 130 ? 7.391   -38.000 -26.801 1.00 131.57 ? 152 ALA B N     1 
ATOM   2928 C CA    . ALA B 1 130 ? 8.172   -37.760 -28.014 1.00 131.52 ? 152 ALA B CA    1 
ATOM   2929 C C     . ALA B 1 130 ? 9.495   -37.073 -27.672 1.00 131.49 ? 152 ALA B C     1 
ATOM   2930 O O     . ALA B 1 130 ? 9.629   -36.489 -26.593 1.00 131.52 ? 152 ALA B O     1 
ATOM   2931 C CB    . ALA B 1 130 ? 7.370   -36.924 -29.003 1.00 131.47 ? 152 ALA B CB    1 
ATOM   2932 N N     . ARG B 1 131 ? 10.467  -37.149 -28.585 1.00 131.31 ? 153 ARG B N     1 
ATOM   2933 C CA    . ARG B 1 131 ? 11.740  -36.452 -28.409 1.00 131.24 ? 153 ARG B CA    1 
ATOM   2934 C C     . ARG B 1 131 ? 11.580  -34.934 -28.573 1.00 130.47 ? 153 ARG B C     1 
ATOM   2935 O O     . ARG B 1 131 ? 12.127  -34.148 -27.794 1.00 130.64 ? 153 ARG B O     1 
ATOM   2936 C CB    . ARG B 1 131 ? 12.812  -36.992 -29.364 1.00 131.73 ? 153 ARG B CB    1 
ATOM   2937 C CG    . ARG B 1 131 ? 14.243  -36.603 -28.933 1.00 133.78 ? 153 ARG B CG    1 
ATOM   2938 C CD    . ARG B 1 131 ? 15.309  -36.946 -29.969 1.00 137.38 ? 153 ARG B CD    1 
ATOM   2939 N NE    . ARG B 1 131 ? 15.201  -36.169 -31.210 1.00 140.33 ? 153 ARG B NE    1 
ATOM   2940 C CZ    . ARG B 1 131 ? 15.319  -34.837 -31.292 1.00 142.02 ? 153 ARG B CZ    1 
ATOM   2941 N NH1   . ARG B 1 131 ? 15.530  -34.083 -30.201 1.00 143.23 ? 153 ARG B NH1   1 
ATOM   2942 N NH2   . ARG B 1 131 ? 15.209  -34.249 -32.477 1.00 142.67 ? 153 ARG B NH2   1 
ATOM   2943 N N     . VAL B 1 132 ? 10.842  -34.526 -29.596 1.00 129.49 ? 154 VAL B N     1 
ATOM   2944 C CA    . VAL B 1 132 ? 10.483  -33.125 -29.751 1.00 128.63 ? 154 VAL B CA    1 
ATOM   2945 C C     . VAL B 1 132 ? 9.003   -33.004 -29.493 1.00 127.91 ? 154 VAL B C     1 
ATOM   2946 O O     . VAL B 1 132 ? 8.192   -33.722 -30.085 1.00 128.01 ? 154 VAL B O     1 
ATOM   2947 C CB    . VAL B 1 132 ? 10.775  -32.584 -31.167 1.00 128.69 ? 154 VAL B CB    1 
ATOM   2948 C CG1   . VAL B 1 132 ? 10.414  -31.102 -31.249 1.00 128.56 ? 154 VAL B CG1   1 
ATOM   2949 C CG2   . VAL B 1 132 ? 12.247  -32.782 -31.520 1.00 129.29 ? 154 VAL B CG2   1 
ATOM   2950 N N     . LEU B 1 133 ? 8.635   -32.102 -28.602 1.00 126.85 ? 155 LEU B N     1 
ATOM   2951 C CA    . LEU B 1 133 ? 7.227   -31.913 -28.356 1.00 125.70 ? 155 LEU B CA    1 
ATOM   2952 C C     . LEU B 1 133 ? 6.730   -30.639 -29.010 1.00 124.99 ? 155 LEU B C     1 
ATOM   2953 O O     . LEU B 1 133 ? 7.437   -29.625 -29.086 1.00 124.75 ? 155 LEU B O     1 
ATOM   2954 C CB    . LEU B 1 133 ? 6.899   -31.972 -26.858 1.00 125.70 ? 155 LEU B CB    1 
ATOM   2955 C CG    . LEU B 1 133 ? 7.150   -33.358 -26.186 1.00 125.45 ? 155 LEU B CG    1 
ATOM   2956 C CD1   . LEU B 1 133 ? 6.861   -33.235 -24.679 1.00 125.50 ? 155 LEU B CD1   1 
ATOM   2957 C CD2   . LEU B 1 133 ? 6.293   -34.530 -26.801 1.00 125.14 ? 155 LEU B CD2   1 
ATOM   2958 N N     . CYS B 1 134 ? 5.505   -30.732 -29.511 1.00 124.19 ? 156 CYS B N     1 
ATOM   2959 C CA    . CYS B 1 134 ? 4.849   -29.621 -30.147 1.00 123.45 ? 156 CYS B CA    1 
ATOM   2960 C C     . CYS B 1 134 ? 3.408   -29.512 -29.669 1.00 123.11 ? 156 CYS B C     1 
ATOM   2961 O O     . CYS B 1 134 ? 2.833   -30.472 -29.149 1.00 123.07 ? 156 CYS B O     1 
ATOM   2962 C CB    . CYS B 1 134 ? 4.862   -29.819 -31.645 1.00 123.40 ? 156 CYS B CB    1 
ATOM   2963 S SG    . CYS B 1 134 ? 3.396   -29.159 -32.390 1.00 123.37 ? 156 CYS B SG    1 
ATOM   2964 N N     . ASN B 1 135 ? 2.826   -28.333 -29.858 1.00 122.64 ? 157 ASN B N     1 
ATOM   2965 C CA    . ASN B 1 135 ? 1.444   -28.079 -29.473 1.00 122.09 ? 157 ASN B CA    1 
ATOM   2966 C C     . ASN B 1 135 ? 0.736   -27.280 -30.547 1.00 121.70 ? 157 ASN B C     1 
ATOM   2967 O O     . ASN B 1 135 ? 1.372   -26.513 -31.280 1.00 121.87 ? 157 ASN B O     1 
ATOM   2968 C CB    . ASN B 1 135 ? 1.401   -27.312 -28.156 1.00 122.12 ? 157 ASN B CB    1 
ATOM   2969 C CG    . ASN B 1 135 ? 0.025   -26.769 -27.845 1.00 122.30 ? 157 ASN B CG    1 
ATOM   2970 O OD1   . ASN B 1 135 ? -0.324  -25.654 -28.260 1.00 122.78 ? 157 ASN B OD1   1 
ATOM   2971 N ND2   . ASN B 1 135 ? -0.778  -27.562 -27.131 1.00 122.16 ? 157 ASN B ND2   1 
ATOM   2972 N N     . LYS B 1 136 ? -0.583  -27.451 -30.631 1.00 121.14 ? 158 LYS B N     1 
ATOM   2973 C CA    . LYS B 1 136 ? -1.371  -26.687 -31.582 1.00 120.54 ? 158 LYS B CA    1 
ATOM   2974 C C     . LYS B 1 136 ? -2.660  -26.173 -30.969 1.00 120.25 ? 158 LYS B C     1 
ATOM   2975 O O     . LYS B 1 136 ? -3.578  -26.947 -30.743 1.00 119.98 ? 158 LYS B O     1 
ATOM   2976 C CB    . LYS B 1 136 ? -1.670  -27.531 -32.819 1.00 120.45 ? 158 LYS B CB    1 
ATOM   2977 C CG    . LYS B 1 136 ? -2.142  -26.720 -34.018 1.00 120.01 ? 158 LYS B CG    1 
ATOM   2978 C CD    . LYS B 1 136 ? -3.638  -26.447 -33.984 1.00 118.81 ? 158 LYS B CD    1 
ATOM   2979 C CE    . LYS B 1 136 ? -4.429  -27.726 -34.199 1.00 118.12 ? 158 LYS B CE    1 
ATOM   2980 N NZ    . LYS B 1 136 ? -5.838  -27.420 -34.551 1.00 117.80 ? 158 LYS B NZ    1 
ATOM   2981 N N     . ASP B 1 137 ? -2.700  -24.866 -30.703 1.00 120.18 ? 159 ASP B N     1 
ATOM   2982 C CA    . ASP B 1 137 ? -3.906  -24.154 -30.245 1.00 120.21 ? 159 ASP B CA    1 
ATOM   2983 C C     . ASP B 1 137 ? -3.951  -22.760 -30.863 1.00 120.13 ? 159 ASP B C     1 
ATOM   2984 O O     . ASP B 1 137 ? -3.240  -21.864 -30.393 1.00 120.23 ? 159 ASP B O     1 
ATOM   2985 C CB    . ASP B 1 137 ? -3.918  -24.017 -28.723 1.00 120.25 ? 159 ASP B CB    1 
ATOM   2986 C CG    . ASP B 1 137 ? -4.699  -25.116 -28.047 1.00 120.77 ? 159 ASP B CG    1 
ATOM   2987 O OD1   . ASP B 1 137 ? -5.945  -25.140 -28.194 1.00 120.71 ? 159 ASP B OD1   1 
ATOM   2988 O OD2   . ASP B 1 137 ? -4.063  -25.943 -27.353 1.00 121.34 ? 159 ASP B OD2   1 
ATOM   2989 N N     . PRO B 1 138 ? -4.812  -22.559 -31.889 1.00 120.04 ? 160 PRO B N     1 
ATOM   2990 C CA    . PRO B 1 138 ? -4.718  -21.414 -32.805 1.00 119.94 ? 160 PRO B CA    1 
ATOM   2991 C C     . PRO B 1 138 ? -4.168  -20.128 -32.168 1.00 120.01 ? 160 PRO B C     1 
ATOM   2992 O O     . PRO B 1 138 ? -3.086  -19.656 -32.558 1.00 119.99 ? 160 PRO B O     1 
ATOM   2993 C CB    . PRO B 1 138 ? -6.167  -21.231 -33.277 1.00 119.73 ? 160 PRO B CB    1 
ATOM   2994 C CG    . PRO B 1 138 ? -6.712  -22.599 -33.291 1.00 119.69 ? 160 PRO B CG    1 
ATOM   2995 C CD    . PRO B 1 138 ? -6.087  -23.287 -32.089 1.00 119.96 ? 160 PRO B CD    1 
ATOM   2996 N N     . PHE B 1 139 ? -4.880  -19.605 -31.166 1.00 120.08 ? 161 PHE B N     1 
ATOM   2997 C CA    . PHE B 1 139 ? -4.592  -18.274 -30.620 1.00 120.15 ? 161 PHE B CA    1 
ATOM   2998 C C     . PHE B 1 139 ? -3.307  -18.180 -29.794 1.00 120.20 ? 161 PHE B C     1 
ATOM   2999 O O     . PHE B 1 139 ? -2.849  -17.071 -29.484 1.00 120.20 ? 161 PHE B O     1 
ATOM   3000 C CB    . PHE B 1 139 ? -5.796  -17.718 -29.826 1.00 120.13 ? 161 PHE B CB    1 
ATOM   3001 C CG    . PHE B 1 139 ? -6.932  -17.213 -30.706 1.00 120.41 ? 161 PHE B CG    1 
ATOM   3002 C CD1   . PHE B 1 139 ? -6.757  -16.078 -31.510 1.00 120.41 ? 161 PHE B CD1   1 
ATOM   3003 C CD2   . PHE B 1 139 ? -8.180  -17.874 -30.734 1.00 120.46 ? 161 PHE B CD2   1 
ATOM   3004 C CE1   . PHE B 1 139 ? -7.812  -15.604 -32.333 1.00 120.53 ? 161 PHE B CE1   1 
ATOM   3005 C CE2   . PHE B 1 139 ? -9.238  -17.412 -31.599 1.00 120.44 ? 161 PHE B CE2   1 
ATOM   3006 C CZ    . PHE B 1 139 ? -9.055  -16.273 -32.362 1.00 120.41 ? 161 PHE B CZ    1 
ATOM   3007 N N     . THR B 1 140 ? -2.718  -19.332 -29.458 1.00 120.33 ? 162 THR B N     1 
ATOM   3008 C CA    . THR B 1 140 ? -1.431  -19.340 -28.762 1.00 120.42 ? 162 THR B CA    1 
ATOM   3009 C C     . THR B 1 140 ? -0.509  -18.301 -29.377 1.00 120.78 ? 162 THR B C     1 
ATOM   3010 O O     . THR B 1 140 ? 0.045   -17.461 -28.672 1.00 120.90 ? 162 THR B O     1 
ATOM   3011 C CB    . THR B 1 140 ? -0.734  -20.717 -28.825 1.00 120.31 ? 162 THR B CB    1 
ATOM   3012 O OG1   . THR B 1 140 ? -0.664  -21.171 -30.195 1.00 119.80 ? 162 THR B OG1   1 
ATOM   3013 C CG2   . THR B 1 140 ? -1.489  -21.717 -27.974 1.00 120.15 ? 162 THR B CG2   1 
ATOM   3014 N N     . LEU B 1 141 ? -0.388  -18.333 -30.699 1.00 121.23 ? 163 LEU B N     1 
ATOM   3015 C CA    . LEU B 1 141 ? 0.514   -17.437 -31.418 1.00 121.80 ? 163 LEU B CA    1 
ATOM   3016 C C     . LEU B 1 141 ? 0.227   -15.931 -31.239 1.00 122.15 ? 163 LEU B C     1 
ATOM   3017 O O     . LEU B 1 141 ? 0.946   -15.088 -31.788 1.00 122.13 ? 163 LEU B O     1 
ATOM   3018 C CB    . LEU B 1 141 ? 0.547   -17.829 -32.901 1.00 121.89 ? 163 LEU B CB    1 
ATOM   3019 C CG    . LEU B 1 141 ? 1.453   -18.992 -33.338 1.00 121.87 ? 163 LEU B CG    1 
ATOM   3020 C CD1   . LEU B 1 141 ? 2.854   -18.467 -33.675 1.00 122.03 ? 163 LEU B CD1   1 
ATOM   3021 C CD2   . LEU B 1 141 ? 1.529   -20.122 -32.296 1.00 121.58 ? 163 LEU B CD2   1 
ATOM   3022 N N     . LYS B 1 142 ? -0.808  -15.599 -30.466 1.00 122.63 ? 164 LYS B N     1 
ATOM   3023 C CA    . LYS B 1 142 ? -1.087  -14.203 -30.112 1.00 123.23 ? 164 LYS B CA    1 
ATOM   3024 C C     . LYS B 1 142 ? -0.112  -13.687 -29.061 1.00 123.27 ? 164 LYS B C     1 
ATOM   3025 O O     . LYS B 1 142 ? 0.053   -12.473 -28.896 1.00 123.29 ? 164 LYS B O     1 
ATOM   3026 C CB    . LYS B 1 142 ? -2.512  -14.034 -29.592 1.00 123.37 ? 164 LYS B CB    1 
ATOM   3027 C CG    . LYS B 1 142 ? -3.593  -14.157 -30.655 1.00 124.92 ? 164 LYS B CG    1 
ATOM   3028 C CD    . LYS B 1 142 ? -4.914  -13.544 -30.198 1.00 127.58 ? 164 LYS B CD    1 
ATOM   3029 C CE    . LYS B 1 142 ? -4.932  -12.025 -30.404 1.00 129.27 ? 164 LYS B CE    1 
ATOM   3030 N NZ    . LYS B 1 142 ? -6.296  -11.442 -30.223 1.00 130.48 ? 164 LYS B NZ    1 
ATOM   3031 N N     . SER B 1 143 ? 0.529   -14.624 -28.358 1.00 123.47 ? 165 SER B N     1 
ATOM   3032 C CA    . SER B 1 143 ? 1.418   -14.311 -27.227 1.00 123.45 ? 165 SER B CA    1 
ATOM   3033 C C     . SER B 1 143 ? 2.841   -14.893 -27.375 1.00 123.38 ? 165 SER B C     1 
ATOM   3034 O O     . SER B 1 143 ? 3.571   -15.033 -26.384 1.00 123.27 ? 165 SER B O     1 
ATOM   3035 C CB    . SER B 1 143 ? 0.783   -14.800 -25.909 1.00 123.45 ? 165 SER B CB    1 
ATOM   3036 O OG    . SER B 1 143 ? -0.623  -14.642 -25.932 1.00 123.32 ? 165 SER B OG    1 
ATOM   3037 N N     . SER B 1 144 ? 3.232   -15.216 -28.611 1.00 123.35 ? 166 SER B N     1 
ATOM   3038 C CA    . SER B 1 144 ? 4.532   -15.843 -28.876 1.00 123.39 ? 166 SER B CA    1 
ATOM   3039 C C     . SER B 1 144 ? 5.698   -15.062 -28.259 1.00 123.27 ? 166 SER B C     1 
ATOM   3040 O O     . SER B 1 144 ? 6.644   -15.669 -27.747 1.00 123.23 ? 166 SER B O     1 
ATOM   3041 C CB    . SER B 1 144 ? 4.747   -16.107 -30.382 1.00 123.44 ? 166 SER B CB    1 
ATOM   3042 O OG    . SER B 1 144 ? 4.455   -14.973 -31.188 1.00 123.99 ? 166 SER B OG    1 
ATOM   3043 N N     . VAL B 1 145 ? 5.608   -13.728 -28.287 1.00 123.12 ? 167 VAL B N     1 
ATOM   3044 C CA    . VAL B 1 145 ? 6.616   -12.857 -27.671 1.00 122.96 ? 167 VAL B CA    1 
ATOM   3045 C C     . VAL B 1 145 ? 6.887   -13.357 -26.269 1.00 122.97 ? 167 VAL B C     1 
ATOM   3046 O O     . VAL B 1 145 ? 8.034   -13.613 -25.899 1.00 123.01 ? 167 VAL B O     1 
ATOM   3047 C CB    . VAL B 1 145 ? 6.156   -11.367 -27.624 1.00 122.85 ? 167 VAL B CB    1 
ATOM   3048 C CG1   . VAL B 1 145 ? 6.973   -10.573 -26.615 1.00 122.65 ? 167 VAL B CG1   1 
ATOM   3049 C CG2   . VAL B 1 145 ? 6.296   -10.728 -28.989 1.00 122.92 ? 167 VAL B CG2   1 
ATOM   3050 N N     . TYR B 1 146 ? 5.809   -13.516 -25.512 1.00 123.06 ? 168 TYR B N     1 
ATOM   3051 C CA    . TYR B 1 146 ? 5.881   -13.984 -24.146 1.00 123.24 ? 168 TYR B CA    1 
ATOM   3052 C C     . TYR B 1 146 ? 6.260   -15.466 -24.091 1.00 123.31 ? 168 TYR B C     1 
ATOM   3053 O O     . TYR B 1 146 ? 7.066   -15.866 -23.245 1.00 123.34 ? 168 TYR B O     1 
ATOM   3054 C CB    . TYR B 1 146 ? 4.546   -13.708 -23.451 1.00 123.27 ? 168 TYR B CB    1 
ATOM   3055 C CG    . TYR B 1 146 ? 4.435   -14.221 -22.030 1.00 123.70 ? 168 TYR B CG    1 
ATOM   3056 C CD1   . TYR B 1 146 ? 5.123   -13.611 -20.978 1.00 123.72 ? 168 TYR B CD1   1 
ATOM   3057 C CD2   . TYR B 1 146 ? 3.611   -15.310 -21.731 1.00 123.96 ? 168 TYR B CD2   1 
ATOM   3058 C CE1   . TYR B 1 146 ? 5.001   -14.090 -19.663 1.00 123.80 ? 168 TYR B CE1   1 
ATOM   3059 C CE2   . TYR B 1 146 ? 3.486   -15.794 -20.424 1.00 123.91 ? 168 TYR B CE2   1 
ATOM   3060 C CZ    . TYR B 1 146 ? 4.179   -15.184 -19.397 1.00 123.73 ? 168 TYR B CZ    1 
ATOM   3061 O OH    . TYR B 1 146 ? 4.044   -15.678 -18.116 1.00 123.87 ? 168 TYR B OH    1 
ATOM   3062 N N     . LEU B 1 147 ? 5.699   -16.268 -24.998 1.00 123.53 ? 169 LEU B N     1 
ATOM   3063 C CA    . LEU B 1 147 ? 5.997   -17.700 -25.064 1.00 123.92 ? 169 LEU B CA    1 
ATOM   3064 C C     . LEU B 1 147 ? 7.478   -17.973 -25.234 1.00 124.47 ? 169 LEU B C     1 
ATOM   3065 O O     . LEU B 1 147 ? 8.049   -18.839 -24.564 1.00 124.54 ? 169 LEU B O     1 
ATOM   3066 C CB    . LEU B 1 147 ? 5.241   -18.338 -26.224 1.00 123.88 ? 169 LEU B CB    1 
ATOM   3067 C CG    . LEU B 1 147 ? 4.098   -19.317 -25.957 1.00 123.56 ? 169 LEU B CG    1 
ATOM   3068 C CD1   . LEU B 1 147 ? 3.419   -19.002 -24.645 1.00 123.77 ? 169 LEU B CD1   1 
ATOM   3069 C CD2   . LEU B 1 147 ? 3.098   -19.289 -27.111 1.00 122.95 ? 169 LEU B CD2   1 
ATOM   3070 N N     . SER B 1 148 ? 8.092   -17.223 -26.141 1.00 125.14 ? 170 SER B N     1 
ATOM   3071 C CA    . SER B 1 148 ? 9.505   -17.360 -26.434 1.00 125.75 ? 170 SER B CA    1 
ATOM   3072 C C     . SER B 1 148 ? 10.361  -16.991 -25.244 1.00 126.01 ? 170 SER B C     1 
ATOM   3073 O O     . SER B 1 148 ? 11.416  -17.579 -25.045 1.00 126.22 ? 170 SER B O     1 
ATOM   3074 C CB    . SER B 1 148 ? 9.887   -16.488 -27.613 1.00 125.83 ? 170 SER B CB    1 
ATOM   3075 O OG    . SER B 1 148 ? 11.296  -16.448 -27.732 1.00 126.53 ? 170 SER B OG    1 
ATOM   3076 N N     . ARG B 1 149 ? 9.913   -16.004 -24.472 1.00 126.45 ? 171 ARG B N     1 
ATOM   3077 C CA    . ARG B 1 149 ? 10.559  -15.665 -23.207 1.00 126.90 ? 171 ARG B CA    1 
ATOM   3078 C C     . ARG B 1 149 ? 10.467  -16.823 -22.234 1.00 126.47 ? 171 ARG B C     1 
ATOM   3079 O O     . ARG B 1 149 ? 11.397  -17.056 -21.476 1.00 126.55 ? 171 ARG B O     1 
ATOM   3080 C CB    . ARG B 1 149 ? 9.930   -14.430 -22.566 1.00 127.32 ? 171 ARG B CB    1 
ATOM   3081 C CG    . ARG B 1 149 ? 10.263  -13.145 -23.282 1.00 129.65 ? 171 ARG B CG    1 
ATOM   3082 C CD    . ARG B 1 149 ? 10.098  -11.957 -22.296 1.00 133.98 ? 171 ARG B CD    1 
ATOM   3083 N NE    . ARG B 1 149 ? 10.412  -10.681 -22.961 1.00 137.24 ? 171 ARG B NE    1 
ATOM   3084 C CZ    . ARG B 1 149 ? 9.486   -9.891  -23.513 1.00 138.89 ? 171 ARG B CZ    1 
ATOM   3085 N NH1   . ARG B 1 149 ? 8.163   -10.228 -23.487 1.00 139.36 ? 171 ARG B NH1   1 
ATOM   3086 N NH2   . ARG B 1 149 ? 9.889   -8.751  -24.170 1.00 139.91 ? 171 ARG B NH2   1 
ATOM   3087 N N     . LEU B 1 150 ? 9.350   -17.548 -22.267 1.00 126.04 ? 172 LEU B N     1 
ATOM   3088 C CA    . LEU B 1 150 ? 9.159   -18.687 -21.381 1.00 125.69 ? 172 LEU B CA    1 
ATOM   3089 C C     . LEU B 1 150 ? 9.951   -19.913 -21.816 1.00 125.44 ? 172 LEU B C     1 
ATOM   3090 O O     . LEU B 1 150 ? 10.448  -20.669 -20.978 1.00 125.46 ? 172 LEU B O     1 
ATOM   3091 C CB    . LEU B 1 150 ? 7.675   -19.056 -21.259 1.00 125.83 ? 172 LEU B CB    1 
ATOM   3092 C CG    . LEU B 1 150 ? 6.681   -18.276 -20.379 1.00 125.89 ? 172 LEU B CG    1 
ATOM   3093 C CD1   . LEU B 1 150 ? 5.395   -19.072 -20.226 1.00 125.50 ? 172 LEU B CD1   1 
ATOM   3094 C CD2   . LEU B 1 150 ? 7.223   -17.944 -19.000 1.00 126.13 ? 172 LEU B CD2   1 
ATOM   3095 N N     . PHE B 1 151 ? 10.063  -20.123 -23.121 1.00 125.10 ? 173 PHE B N     1 
ATOM   3096 C CA    . PHE B 1 151 ? 10.756  -21.306 -23.611 1.00 125.01 ? 173 PHE B CA    1 
ATOM   3097 C C     . PHE B 1 151 ? 11.824  -20.934 -24.617 1.00 125.07 ? 173 PHE B C     1 
ATOM   3098 O O     . PHE B 1 151 ? 11.579  -20.930 -25.824 1.00 125.27 ? 173 PHE B O     1 
ATOM   3099 C CB    . PHE B 1 151 ? 9.766   -22.292 -24.202 1.00 124.89 ? 173 PHE B CB    1 
ATOM   3100 C CG    . PHE B 1 151 ? 8.637   -22.610 -23.290 1.00 124.43 ? 173 PHE B CG    1 
ATOM   3101 C CD1   . PHE B 1 151 ? 8.792   -23.553 -22.278 1.00 124.06 ? 173 PHE B CD1   1 
ATOM   3102 C CD2   . PHE B 1 151 ? 7.419   -21.958 -23.428 1.00 124.09 ? 173 PHE B CD2   1 
ATOM   3103 C CE1   . PHE B 1 151 ? 7.745   -23.852 -21.423 1.00 123.76 ? 173 PHE B CE1   1 
ATOM   3104 C CE2   . PHE B 1 151 ? 6.367   -22.247 -22.577 1.00 123.81 ? 173 PHE B CE2   1 
ATOM   3105 C CZ    . PHE B 1 151 ? 6.531   -23.197 -21.568 1.00 123.71 ? 173 PHE B CZ    1 
ATOM   3106 N N     . PRO B 1 152 ? 13.030  -20.639 -24.114 1.00 124.96 ? 174 PRO B N     1 
ATOM   3107 C CA    . PRO B 1 152 ? 14.063  -19.963 -24.890 1.00 124.81 ? 174 PRO B CA    1 
ATOM   3108 C C     . PRO B 1 152 ? 14.505  -20.734 -26.124 1.00 124.60 ? 174 PRO B C     1 
ATOM   3109 O O     . PRO B 1 152 ? 15.219  -20.182 -26.957 1.00 124.65 ? 174 PRO B O     1 
ATOM   3110 C CB    . PRO B 1 152 ? 15.214  -19.830 -23.889 1.00 124.98 ? 174 PRO B CB    1 
ATOM   3111 C CG    . PRO B 1 152 ? 14.553  -19.959 -22.534 1.00 124.93 ? 174 PRO B CG    1 
ATOM   3112 C CD    . PRO B 1 152 ? 13.496  -20.970 -22.756 1.00 124.84 ? 174 PRO B CD    1 
ATOM   3113 N N     . ASN B 1 153 ? 14.075  -21.989 -26.242 1.00 124.28 ? 175 ASN B N     1 
ATOM   3114 C CA    . ASN B 1 153 ? 14.434  -22.801 -27.394 1.00 124.03 ? 175 ASN B CA    1 
ATOM   3115 C C     . ASN B 1 153 ? 13.230  -23.307 -28.153 1.00 123.62 ? 175 ASN B C     1 
ATOM   3116 O O     . ASN B 1 153 ? 13.328  -24.224 -28.962 1.00 123.46 ? 175 ASN B O     1 
ATOM   3117 C CB    . ASN B 1 153 ? 15.353  -23.943 -26.976 1.00 124.25 ? 175 ASN B CB    1 
ATOM   3118 C CG    . ASN B 1 153 ? 16.670  -23.443 -26.408 1.00 124.61 ? 175 ASN B CG    1 
ATOM   3119 O OD1   . ASN B 1 153 ? 17.220  -24.051 -25.495 1.00 125.64 ? 175 ASN B OD1   1 
ATOM   3120 N ND2   . ASN B 1 153 ? 17.174  -22.323 -26.939 1.00 124.66 ? 175 ASN B ND2   1 
ATOM   3121 N N     . SER B 1 154 ? 12.091  -22.683 -27.892 1.00 123.29 ? 176 SER B N     1 
ATOM   3122 C CA    . SER B 1 154 ? 10.870  -22.993 -28.612 1.00 122.87 ? 176 SER B CA    1 
ATOM   3123 C C     . SER B 1 154 ? 10.872  -22.328 -29.965 1.00 122.56 ? 176 SER B C     1 
ATOM   3124 O O     . SER B 1 154 ? 11.394  -21.224 -30.123 1.00 122.45 ? 176 SER B O     1 
ATOM   3125 C CB    . SER B 1 154 ? 9.657   -22.492 -27.842 1.00 122.85 ? 176 SER B CB    1 
ATOM   3126 O OG    . SER B 1 154 ? 9.658   -21.062 -27.809 1.00 122.71 ? 176 SER B OG    1 
ATOM   3127 N N     . LYS B 1 155 ? 10.257  -23.004 -30.927 1.00 122.25 ? 177 LYS B N     1 
ATOM   3128 C CA    . LYS B 1 155 ? 10.059  -22.466 -32.260 1.00 122.02 ? 177 LYS B CA    1 
ATOM   3129 C C     . LYS B 1 155 ? 8.569   -22.274 -32.567 1.00 121.45 ? 177 LYS B C     1 
ATOM   3130 O O     . LYS B 1 155 ? 7.701   -22.926 -31.979 1.00 121.16 ? 177 LYS B O     1 
ATOM   3131 C CB    . LYS B 1 155 ? 10.719  -23.361 -33.318 1.00 122.26 ? 177 LYS B CB    1 
ATOM   3132 C CG    . LYS B 1 155 ? 12.268  -23.363 -33.330 1.00 123.50 ? 177 LYS B CG    1 
ATOM   3133 C CD    . LYS B 1 155 ? 12.859  -22.124 -34.056 1.00 125.77 ? 177 LYS B CD    1 
ATOM   3134 C CE    . LYS B 1 155 ? 13.894  -22.475 -35.163 1.00 126.58 ? 177 LYS B CE    1 
ATOM   3135 N NZ    . LYS B 1 155 ? 15.069  -23.328 -34.577 1.00 127.74 ? 177 LYS B NZ    1 
ATOM   3136 N N     . PHE B 1 156 ? 8.290   -21.377 -33.508 1.00 120.98 ? 178 PHE B N     1 
ATOM   3137 C CA    . PHE B 1 156 ? 6.925   -20.986 -33.852 1.00 120.41 ? 178 PHE B CA    1 
ATOM   3138 C C     . PHE B 1 156 ? 6.635   -21.020 -35.367 1.00 120.26 ? 178 PHE B C     1 
ATOM   3139 O O     . PHE B 1 156 ? 7.351   -20.396 -36.164 1.00 120.11 ? 178 PHE B O     1 
ATOM   3140 C CB    . PHE B 1 156 ? 6.654   -19.576 -33.323 1.00 120.30 ? 178 PHE B CB    1 
ATOM   3141 C CG    . PHE B 1 156 ? 6.747   -19.455 -31.838 1.00 119.65 ? 178 PHE B CG    1 
ATOM   3142 C CD1   . PHE B 1 156 ? 5.604   -19.543 -31.054 1.00 119.04 ? 178 PHE B CD1   1 
ATOM   3143 C CD2   . PHE B 1 156 ? 7.969   -19.229 -31.222 1.00 119.76 ? 178 PHE B CD2   1 
ATOM   3144 C CE1   . PHE B 1 156 ? 5.671   -19.423 -29.678 1.00 118.67 ? 178 PHE B CE1   1 
ATOM   3145 C CE2   . PHE B 1 156 ? 8.051   -19.112 -29.837 1.00 119.91 ? 178 PHE B CE2   1 
ATOM   3146 C CZ    . PHE B 1 156 ? 6.893   -19.210 -29.065 1.00 119.05 ? 178 PHE B CZ    1 
ATOM   3147 N N     . LEU B 1 157 ? 5.579   -21.744 -35.748 1.00 119.97 ? 179 LEU B N     1 
ATOM   3148 C CA    . LEU B 1 157 ? 5.076   -21.757 -37.129 1.00 119.75 ? 179 LEU B CA    1 
ATOM   3149 C C     . LEU B 1 157 ? 3.754   -21.002 -37.236 1.00 119.65 ? 179 LEU B C     1 
ATOM   3150 O O     . LEU B 1 157 ? 2.724   -21.453 -36.705 1.00 119.68 ? 179 LEU B O     1 
ATOM   3151 C CB    . LEU B 1 157 ? 4.875   -23.188 -37.645 1.00 119.66 ? 179 LEU B CB    1 
ATOM   3152 C CG    . LEU B 1 157 ? 6.069   -24.146 -37.792 1.00 119.53 ? 179 LEU B CG    1 
ATOM   3153 C CD1   . LEU B 1 157 ? 5.529   -25.579 -37.974 1.00 119.03 ? 179 LEU B CD1   1 
ATOM   3154 C CD2   . LEU B 1 157 ? 7.008   -23.730 -38.950 1.00 119.33 ? 179 LEU B CD2   1 
ATOM   3155 N N     . LEU B 1 158 ? 3.789   -19.854 -37.918 1.00 119.48 ? 180 LEU B N     1 
ATOM   3156 C CA    . LEU B 1 158 ? 2.588   -19.043 -38.149 1.00 119.34 ? 180 LEU B CA    1 
ATOM   3157 C C     . LEU B 1 158 ? 1.933   -19.412 -39.487 1.00 119.36 ? 180 LEU B C     1 
ATOM   3158 O O     . LEU B 1 158 ? 2.379   -18.950 -40.546 1.00 119.45 ? 180 LEU B O     1 
ATOM   3159 C CB    . LEU B 1 158 ? 2.925   -17.537 -38.098 1.00 119.24 ? 180 LEU B CB    1 
ATOM   3160 C CG    . LEU B 1 158 ? 1.810   -16.496 -38.303 1.00 118.96 ? 180 LEU B CG    1 
ATOM   3161 C CD1   . LEU B 1 158 ? 0.833   -16.493 -37.101 1.00 119.13 ? 180 LEU B CD1   1 
ATOM   3162 C CD2   . LEU B 1 158 ? 2.409   -15.085 -38.536 1.00 118.58 ? 180 LEU B CD2   1 
ATOM   3163 N N     . MET B 1 159 ? 0.887   -20.248 -39.433 1.00 119.25 ? 181 MET B N     1 
ATOM   3164 C CA    . MET B 1 159 ? 0.115   -20.628 -40.631 1.00 118.98 ? 181 MET B CA    1 
ATOM   3165 C C     . MET B 1 159 ? -0.599  -19.413 -41.236 1.00 118.94 ? 181 MET B C     1 
ATOM   3166 O O     . MET B 1 159 ? -1.399  -18.746 -40.570 1.00 118.85 ? 181 MET B O     1 
ATOM   3167 C CB    . MET B 1 159 ? -0.909  -21.733 -40.318 1.00 118.88 ? 181 MET B CB    1 
ATOM   3168 C CG    . MET B 1 159 ? -0.320  -23.067 -39.875 1.00 118.38 ? 181 MET B CG    1 
ATOM   3169 S SD    . MET B 1 159 ? 0.827   -23.741 -41.067 1.00 116.41 ? 181 MET B SD    1 
ATOM   3170 C CE    . MET B 1 159 ? -0.285  -24.128 -42.412 1.00 118.24 ? 181 MET B CE    1 
ATOM   3171 N N     . VAL B 1 160 ? -0.298  -19.127 -42.499 1.00 118.92 ? 182 VAL B N     1 
ATOM   3172 C CA    . VAL B 1 160 ? -0.902  -17.985 -43.194 1.00 119.01 ? 182 VAL B CA    1 
ATOM   3173 C C     . VAL B 1 160 ? -1.725  -18.422 -44.427 1.00 119.15 ? 182 VAL B C     1 
ATOM   3174 O O     . VAL B 1 160 ? -1.166  -18.758 -45.493 1.00 119.17 ? 182 VAL B O     1 
ATOM   3175 C CB    . VAL B 1 160 ? 0.160   -16.895 -43.560 1.00 118.99 ? 182 VAL B CB    1 
ATOM   3176 C CG1   . VAL B 1 160 ? -0.477  -15.727 -44.312 1.00 118.74 ? 182 VAL B CG1   1 
ATOM   3177 C CG2   . VAL B 1 160 ? 0.874   -16.390 -42.300 1.00 119.08 ? 182 VAL B CG2   1 
ATOM   3178 N N     . ARG B 1 161 ? -3.057  -18.424 -44.254 1.00 119.25 ? 183 ARG B N     1 
ATOM   3179 C CA    . ARG B 1 161 ? -3.991  -18.733 -45.335 1.00 119.12 ? 183 ARG B CA    1 
ATOM   3180 C C     . ARG B 1 161 ? -4.786  -17.492 -45.693 1.00 119.02 ? 183 ARG B C     1 
ATOM   3181 O O     . ARG B 1 161 ? -5.302  -16.792 -44.786 1.00 118.87 ? 183 ARG B O     1 
ATOM   3182 C CB    . ARG B 1 161 ? -4.951  -19.835 -44.905 1.00 119.12 ? 183 ARG B CB    1 
ATOM   3183 C CG    . ARG B 1 161 ? -5.860  -20.328 -46.013 1.00 119.19 ? 183 ARG B CG    1 
ATOM   3184 C CD    . ARG B 1 161 ? -6.827  -21.320 -45.437 1.00 119.61 ? 183 ARG B CD    1 
ATOM   3185 N NE    . ARG B 1 161 ? -7.826  -21.752 -46.418 1.00 120.04 ? 183 ARG B NE    1 
ATOM   3186 C CZ    . ARG B 1 161 ? -8.953  -22.388 -46.110 1.00 120.44 ? 183 ARG B CZ    1 
ATOM   3187 N NH1   . ARG B 1 161 ? -9.229  -22.671 -44.834 1.00 119.84 ? 183 ARG B NH1   1 
ATOM   3188 N NH2   . ARG B 1 161 ? -9.808  -22.735 -47.086 1.00 120.62 ? 183 ARG B NH2   1 
ATOM   3189 N N     . ASP B 1 162 ? -4.887  -17.227 -47.011 1.00 118.92 ? 184 ASP B N     1 
ATOM   3190 C CA    . ASP B 1 162 ? -5.701  -16.124 -47.501 1.00 118.88 ? 184 ASP B CA    1 
ATOM   3191 C C     . ASP B 1 162 ? -7.001  -16.096 -46.694 1.00 118.78 ? 184 ASP B C     1 
ATOM   3192 O O     . ASP B 1 162 ? -7.686  -17.122 -46.555 1.00 118.74 ? 184 ASP B O     1 
ATOM   3193 C CB    . ASP B 1 162 ? -5.990  -16.277 -49.005 1.00 118.98 ? 184 ASP B CB    1 
ATOM   3194 C CG    . ASP B 1 162 ? -6.559  -14.999 -49.628 1.00 119.32 ? 184 ASP B CG    1 
ATOM   3195 O OD1   . ASP B 1 162 ? -7.071  -14.137 -48.885 1.00 119.65 ? 184 ASP B OD1   1 
ATOM   3196 O OD2   . ASP B 1 162 ? -6.511  -14.862 -50.876 1.00 120.03 ? 184 ASP B OD2   1 
ATOM   3197 N N     . GLY B 1 163 ? -7.305  -14.917 -46.141 1.00 118.66 ? 185 GLY B N     1 
ATOM   3198 C CA    . GLY B 1 163 ? -8.455  -14.723 -45.259 1.00 118.48 ? 185 GLY B CA    1 
ATOM   3199 C C     . GLY B 1 163 ? -9.811  -14.975 -45.888 1.00 118.38 ? 185 GLY B C     1 
ATOM   3200 O O     . GLY B 1 163 ? -10.766 -15.322 -45.194 1.00 118.38 ? 185 GLY B O     1 
ATOM   3201 N N     . ARG B 1 164 ? -9.901  -14.797 -47.202 1.00 118.31 ? 186 ARG B N     1 
ATOM   3202 C CA    . ARG B 1 164 ? -11.134 -15.096 -47.929 1.00 118.40 ? 186 ARG B CA    1 
ATOM   3203 C C     . ARG B 1 164 ? -11.506 -16.597 -47.885 1.00 118.43 ? 186 ARG B C     1 
ATOM   3204 O O     . ARG B 1 164 ? -12.691 -16.935 -47.871 1.00 118.65 ? 186 ARG B O     1 
ATOM   3205 C CB    . ARG B 1 164 ? -11.064 -14.558 -49.369 1.00 118.32 ? 186 ARG B CB    1 
ATOM   3206 C CG    . ARG B 1 164 ? -11.130 -13.019 -49.466 1.00 118.43 ? 186 ARG B CG    1 
ATOM   3207 C CD    . ARG B 1 164 ? -10.763 -12.490 -50.854 1.00 118.39 ? 186 ARG B CD    1 
ATOM   3208 N NE    . ARG B 1 164 ? -9.340  -12.668 -51.162 1.00 119.09 ? 186 ARG B NE    1 
ATOM   3209 C CZ    . ARG B 1 164 ? -8.756  -12.235 -52.282 1.00 119.81 ? 186 ARG B CZ    1 
ATOM   3210 N NH1   . ARG B 1 164 ? -9.477  -11.589 -53.217 1.00 120.14 ? 186 ARG B NH1   1 
ATOM   3211 N NH2   . ARG B 1 164 ? -7.449  -12.445 -52.468 1.00 119.96 ? 186 ARG B NH2   1 
ATOM   3212 N N     . ALA B 1 165 ? -10.502 -17.479 -47.834 1.00 118.33 ? 187 ALA B N     1 
ATOM   3213 C CA    . ALA B 1 165 ? -10.718 -18.938 -47.760 1.00 118.14 ? 187 ALA B CA    1 
ATOM   3214 C C     . ALA B 1 165 ? -10.991 -19.447 -46.338 1.00 118.04 ? 187 ALA B C     1 
ATOM   3215 O O     . ALA B 1 165 ? -11.714 -20.442 -46.151 1.00 117.82 ? 187 ALA B O     1 
ATOM   3216 C CB    . ALA B 1 165 ? -9.538  -19.680 -48.370 1.00 118.10 ? 187 ALA B CB    1 
ATOM   3217 N N     . SER B 1 166 ? -10.388 -18.770 -45.352 1.00 118.10 ? 188 SER B N     1 
ATOM   3218 C CA    . SER B 1 166 ? -10.655 -19.031 -43.934 1.00 118.35 ? 188 SER B CA    1 
ATOM   3219 C C     . SER B 1 166 ? -12.066 -18.521 -43.513 1.00 118.48 ? 188 SER B C     1 
ATOM   3220 O O     . SER B 1 166 ? -12.844 -19.276 -42.897 1.00 118.51 ? 188 SER B O     1 
ATOM   3221 C CB    . SER B 1 166 ? -9.555  -18.401 -43.033 1.00 118.30 ? 188 SER B CB    1 
ATOM   3222 O OG    . SER B 1 166 ? -8.242  -18.820 -43.382 1.00 118.38 ? 188 SER B OG    1 
ATOM   3223 N N     . VAL B 1 167 ? -12.375 -17.249 -43.844 1.00 118.41 ? 189 VAL B N     1 
ATOM   3224 C CA    . VAL B 1 167 ? -13.631 -16.574 -43.441 1.00 118.10 ? 189 VAL B CA    1 
ATOM   3225 C C     . VAL B 1 167 ? -14.828 -17.291 -44.047 1.00 118.21 ? 189 VAL B C     1 
ATOM   3226 O O     . VAL B 1 167 ? -15.865 -17.443 -43.401 1.00 118.17 ? 189 VAL B O     1 
ATOM   3227 C CB    . VAL B 1 167 ? -13.632 -15.047 -43.793 1.00 117.95 ? 189 VAL B CB    1 
ATOM   3228 C CG1   . VAL B 1 167 ? -15.031 -14.514 -43.979 1.00 117.72 ? 189 VAL B CG1   1 
ATOM   3229 C CG2   . VAL B 1 167 ? -12.924 -14.253 -42.712 1.00 117.52 ? 189 VAL B CG2   1 
ATOM   3230 N N     . HIS B 1 168 ? -14.657 -17.742 -45.287 1.00 118.34 ? 190 HIS B N     1 
ATOM   3231 C CA    . HIS B 1 168 ? -15.612 -18.631 -45.934 1.00 118.66 ? 190 HIS B CA    1 
ATOM   3232 C C     . HIS B 1 168 ? -15.713 -19.987 -45.236 1.00 118.38 ? 190 HIS B C     1 
ATOM   3233 O O     . HIS B 1 168 ? -16.811 -20.440 -44.905 1.00 118.30 ? 190 HIS B O     1 
ATOM   3234 C CB    . HIS B 1 168 ? -15.210 -18.854 -47.388 1.00 119.05 ? 190 HIS B CB    1 
ATOM   3235 C CG    . HIS B 1 168 ? -15.946 -19.997 -48.036 1.00 120.61 ? 190 HIS B CG    1 
ATOM   3236 N ND1   . HIS B 1 168 ? -17.258 -19.886 -48.472 1.00 122.06 ? 190 HIS B ND1   1 
ATOM   3237 C CD2   . HIS B 1 168 ? -15.559 -21.277 -48.315 1.00 121.94 ? 190 HIS B CD2   1 
ATOM   3238 C CE1   . HIS B 1 168 ? -17.642 -21.043 -49.008 1.00 122.78 ? 190 HIS B CE1   1 
ATOM   3239 N NE2   . HIS B 1 168 ? -16.632 -21.905 -48.922 1.00 122.76 ? 190 HIS B NE2   1 
ATOM   3240 N N     . SER B 1 169 ? -14.565 -20.639 -45.046 1.00 118.20 ? 191 SER B N     1 
ATOM   3241 C CA    . SER B 1 169 ? -14.507 -21.908 -44.349 1.00 117.99 ? 191 SER B CA    1 
ATOM   3242 C C     . SER B 1 169 ? -15.285 -21.790 -43.057 1.00 118.30 ? 191 SER B C     1 
ATOM   3243 O O     . SER B 1 169 ? -16.204 -22.569 -42.821 1.00 118.20 ? 191 SER B O     1 
ATOM   3244 C CB    . SER B 1 169 ? -13.067 -22.285 -44.042 1.00 117.81 ? 191 SER B CB    1 
ATOM   3245 O OG    . SER B 1 169 ? -13.029 -23.281 -43.032 1.00 117.11 ? 191 SER B OG    1 
ATOM   3246 N N     . MET B 1 170 ? -14.928 -20.789 -42.246 1.00 118.79 ? 192 MET B N     1 
ATOM   3247 C CA    . MET B 1 170 ? -15.544 -20.571 -40.921 1.00 119.41 ? 192 MET B CA    1 
ATOM   3248 C C     . MET B 1 170 ? -17.040 -20.181 -40.948 1.00 119.50 ? 192 MET B C     1 
ATOM   3249 O O     . MET B 1 170 ? -17.797 -20.526 -40.028 1.00 119.39 ? 192 MET B O     1 
ATOM   3250 C CB    . MET B 1 170 ? -14.707 -19.591 -40.052 1.00 119.62 ? 192 MET B CB    1 
ATOM   3251 C CG    . MET B 1 170 ? -14.611 -18.111 -40.528 1.00 120.11 ? 192 MET B CG    1 
ATOM   3252 S SD    . MET B 1 170 ? -13.812 -16.943 -39.358 1.00 122.07 ? 192 MET B SD    1 
ATOM   3253 C CE    . MET B 1 170 ? -12.084 -17.466 -39.388 1.00 120.50 ? 192 MET B CE    1 
ATOM   3254 N N     . ILE B 1 171 ? -17.451 -19.476 -42.002 1.00 119.76 ? 193 ILE B N     1 
ATOM   3255 C CA    . ILE B 1 171 ? -18.849 -19.077 -42.178 1.00 120.07 ? 193 ILE B CA    1 
ATOM   3256 C C     . ILE B 1 171 ? -19.716 -20.274 -42.604 1.00 120.42 ? 193 ILE B C     1 
ATOM   3257 O O     . ILE B 1 171 ? -20.775 -20.522 -42.018 1.00 120.50 ? 193 ILE B O     1 
ATOM   3258 C CB    . ILE B 1 171 ? -18.976 -17.846 -43.136 1.00 119.91 ? 193 ILE B CB    1 
ATOM   3259 C CG1   . ILE B 1 171 ? -18.821 -16.550 -42.318 1.00 119.88 ? 193 ILE B CG1   1 
ATOM   3260 C CG2   . ILE B 1 171 ? -20.313 -17.838 -43.859 1.00 119.74 ? 193 ILE B CG2   1 
ATOM   3261 C CD1   . ILE B 1 171 ? -18.547 -15.320 -43.133 1.00 119.23 ? 193 ILE B CD1   1 
ATOM   3262 N N     . THR B 1 172 ? -19.235 -21.030 -43.591 1.00 120.88 ? 194 THR B N     1 
ATOM   3263 C CA    . THR B 1 172 ? -19.965 -22.176 -44.140 1.00 121.34 ? 194 THR B CA    1 
ATOM   3264 C C     . THR B 1 172 ? -20.030 -23.401 -43.210 1.00 121.50 ? 194 THR B C     1 
ATOM   3265 O O     . THR B 1 172 ? -21.072 -24.061 -43.109 1.00 121.55 ? 194 THR B O     1 
ATOM   3266 C CB    . THR B 1 172 ? -19.380 -22.584 -45.500 1.00 121.34 ? 194 THR B CB    1 
ATOM   3267 O OG1   . THR B 1 172 ? -17.962 -22.758 -45.380 1.00 121.88 ? 194 THR B OG1   1 
ATOM   3268 C CG2   . THR B 1 172 ? -19.653 -21.498 -46.514 1.00 121.60 ? 194 THR B CG2   1 
ATOM   3269 N N     . ARG B 1 173 ? -18.922 -23.700 -42.532 1.00 121.73 ? 195 ARG B N     1 
ATOM   3270 C CA    . ARG B 1 173 ? -18.857 -24.872 -41.655 1.00 121.75 ? 195 ARG B CA    1 
ATOM   3271 C C     . ARG B 1 173 ? -19.626 -24.666 -40.346 1.00 121.70 ? 195 ARG B C     1 
ATOM   3272 O O     . ARG B 1 173 ? -19.813 -25.605 -39.568 1.00 121.67 ? 195 ARG B O     1 
ATOM   3273 C CB    . ARG B 1 173 ? -17.397 -25.262 -41.372 1.00 121.67 ? 195 ARG B CB    1 
ATOM   3274 C CG    . ARG B 1 173 ? -16.674 -25.857 -42.575 1.00 121.61 ? 195 ARG B CG    1 
ATOM   3275 C CD    . ARG B 1 173 ? -15.313 -26.381 -42.156 1.00 121.81 ? 195 ARG B CD    1 
ATOM   3276 N NE    . ARG B 1 173 ? -14.471 -26.821 -43.283 1.00 121.91 ? 195 ARG B NE    1 
ATOM   3277 C CZ    . ARG B 1 173 ? -14.460 -28.058 -43.797 1.00 121.98 ? 195 ARG B CZ    1 
ATOM   3278 N NH1   . ARG B 1 173 ? -15.267 -28.994 -43.304 1.00 122.33 ? 195 ARG B NH1   1 
ATOM   3279 N NH2   . ARG B 1 173 ? -13.650 -28.359 -44.816 1.00 121.27 ? 195 ARG B NH2   1 
ATOM   3280 N N     . ILE B 1 177 ? -15.779 -18.949 -32.877 1.00 121.09 ? 199 ILE B N     1 
ATOM   3281 C CA    . ILE B 1 177 ? -14.515 -18.503 -32.272 1.00 121.33 ? 199 ILE B CA    1 
ATOM   3282 C C     . ILE B 1 177 ? -14.736 -17.275 -31.377 1.00 122.00 ? 199 ILE B C     1 
ATOM   3283 O O     . ILE B 1 177 ? -15.647 -16.477 -31.619 1.00 121.83 ? 199 ILE B O     1 
ATOM   3284 C CB    . ILE B 1 177 ? -13.424 -18.182 -33.348 1.00 121.03 ? 199 ILE B CB    1 
ATOM   3285 C CG1   . ILE B 1 177 ? -13.079 -19.417 -34.178 1.00 120.53 ? 199 ILE B CG1   1 
ATOM   3286 C CG2   . ILE B 1 177 ? -12.154 -17.663 -32.706 1.00 120.18 ? 199 ILE B CG2   1 
ATOM   3287 C CD1   . ILE B 1 177 ? -12.567 -19.082 -35.567 1.00 120.06 ? 199 ILE B CD1   1 
ATOM   3288 N N     . ALA B 1 178 ? -13.889 -17.143 -30.350 1.00 123.13 ? 200 ALA B N     1 
ATOM   3289 C CA    . ALA B 1 178 ? -13.880 -15.999 -29.414 1.00 124.11 ? 200 ALA B CA    1 
ATOM   3290 C C     . ALA B 1 178 ? -13.391 -14.682 -30.042 1.00 124.81 ? 200 ALA B C     1 
ATOM   3291 O O     . ALA B 1 178 ? -12.173 -14.437 -30.157 1.00 124.90 ? 200 ALA B O     1 
ATOM   3292 C CB    . ALA B 1 178 ? -13.043 -16.334 -28.164 1.00 124.09 ? 200 ALA B CB    1 
ATOM   3293 N N     . GLY B 1 179 ? -14.352 -13.838 -30.422 1.00 125.45 ? 201 GLY B N     1 
ATOM   3294 C CA    . GLY B 1 179 ? -14.071 -12.577 -31.100 1.00 126.33 ? 201 GLY B CA    1 
ATOM   3295 C C     . GLY B 1 179 ? -14.891 -12.363 -32.366 1.00 127.01 ? 201 GLY B C     1 
ATOM   3296 O O     . GLY B 1 179 ? -15.224 -11.220 -32.698 1.00 127.25 ? 201 GLY B O     1 
ATOM   3297 N N     . PHE B 1 180 ? -15.244 -13.458 -33.051 1.00 127.58 ? 202 PHE B N     1 
ATOM   3298 C CA    . PHE B 1 180 ? -15.856 -13.424 -34.406 1.00 128.22 ? 202 PHE B CA    1 
ATOM   3299 C C     . PHE B 1 180 ? -17.433 -13.424 -34.465 1.00 128.43 ? 202 PHE B C     1 
ATOM   3300 O O     . PHE B 1 180 ? -18.087 -13.911 -33.535 1.00 128.57 ? 202 PHE B O     1 
ATOM   3301 C CB    . PHE B 1 180 ? -15.261 -14.570 -35.265 1.00 128.33 ? 202 PHE B CB    1 
ATOM   3302 C CG    . PHE B 1 180 ? -13.727 -14.537 -35.413 1.00 128.61 ? 202 PHE B CG    1 
ATOM   3303 C CD1   . PHE B 1 180 ? -12.883 -14.610 -34.291 1.00 128.32 ? 202 PHE B CD1   1 
ATOM   3304 C CD2   . PHE B 1 180 ? -13.135 -14.485 -36.696 1.00 128.77 ? 202 PHE B CD2   1 
ATOM   3305 C CE1   . PHE B 1 180 ? -11.484 -14.594 -34.437 1.00 128.50 ? 202 PHE B CE1   1 
ATOM   3306 C CE2   . PHE B 1 180 ? -11.737 -14.472 -36.856 1.00 128.34 ? 202 PHE B CE2   1 
ATOM   3307 C CZ    . PHE B 1 180 ? -10.912 -14.526 -35.724 1.00 128.57 ? 202 PHE B CZ    1 
ATOM   3308 N N     . ASP B 1 181 ? -18.023 -12.881 -35.547 1.00 128.57 ? 203 ASP B N     1 
ATOM   3309 C CA    . ASP B 1 181 ? -19.511 -12.760 -35.727 1.00 128.69 ? 203 ASP B CA    1 
ATOM   3310 C C     . ASP B 1 181 ? -20.102 -13.691 -36.822 1.00 128.62 ? 203 ASP B C     1 
ATOM   3311 O O     . ASP B 1 181 ? -19.584 -13.740 -37.959 1.00 128.80 ? 203 ASP B O     1 
ATOM   3312 C CB    . ASP B 1 181 ? -19.930 -11.271 -35.936 1.00 128.81 ? 203 ASP B CB    1 
ATOM   3313 C CG    . ASP B 1 181 ? -21.191 -11.094 -36.835 1.00 129.42 ? 203 ASP B CG    1 
ATOM   3314 O OD1   . ASP B 1 181 ? -22.305 -11.514 -36.424 1.00 130.37 ? 203 ASP B OD1   1 
ATOM   3315 O OD2   . ASP B 1 181 ? -21.076 -10.486 -37.936 1.00 128.76 ? 203 ASP B OD2   1 
ATOM   3316 N N     . LEU B 1 182 ? -21.206 -14.384 -36.475 1.00 128.22 ? 204 LEU B N     1 
ATOM   3317 C CA    . LEU B 1 182 ? -21.780 -15.491 -37.288 1.00 127.62 ? 204 LEU B CA    1 
ATOM   3318 C C     . LEU B 1 182 ? -22.665 -15.119 -38.498 1.00 127.11 ? 204 LEU B C     1 
ATOM   3319 O O     . LEU B 1 182 ? -23.120 -16.024 -39.216 1.00 127.22 ? 204 LEU B O     1 
ATOM   3320 C CB    . LEU B 1 182 ? -22.543 -16.491 -36.382 1.00 127.66 ? 204 LEU B CB    1 
ATOM   3321 C CG    . LEU B 1 182 ? -21.752 -17.443 -35.457 1.00 127.57 ? 204 LEU B CG    1 
ATOM   3322 C CD1   . LEU B 1 182 ? -22.609 -17.802 -34.247 1.00 127.73 ? 204 LEU B CD1   1 
ATOM   3323 C CD2   . LEU B 1 182 ? -21.271 -18.706 -36.189 1.00 127.35 ? 204 LEU B CD2   1 
ATOM   3324 N N     . SER B 1 183 ? -22.892 -13.822 -38.738 1.00 126.30 ? 205 SER B N     1 
ATOM   3325 C CA    . SER B 1 183 ? -23.797 -13.382 -39.829 1.00 125.47 ? 205 SER B CA    1 
ATOM   3326 C C     . SER B 1 183 ? -23.292 -12.276 -40.789 1.00 124.59 ? 205 SER B C     1 
ATOM   3327 O O     . SER B 1 183 ? -24.083 -11.709 -41.568 1.00 124.43 ? 205 SER B O     1 
ATOM   3328 C CB    . SER B 1 183 ? -25.190 -13.035 -39.272 1.00 125.66 ? 205 SER B CB    1 
ATOM   3329 O OG    . SER B 1 183 ? -25.863 -14.207 -38.808 1.00 125.91 ? 205 SER B OG    1 
ATOM   3330 N N     . SER B 1 184 ? -21.988 -11.987 -40.745 1.00 123.28 ? 206 SER B N     1 
ATOM   3331 C CA    . SER B 1 184 ? -21.376 -11.019 -41.672 1.00 122.18 ? 206 SER B CA    1 
ATOM   3332 C C     . SER B 1 184 ? -19.997 -11.459 -42.201 1.00 121.48 ? 206 SER B C     1 
ATOM   3333 O O     . SER B 1 184 ? -19.104 -11.856 -41.412 1.00 121.14 ? 206 SER B O     1 
ATOM   3334 C CB    . SER B 1 184 ? -21.299 -9.615  -41.032 1.00 122.16 ? 206 SER B CB    1 
ATOM   3335 O OG    . SER B 1 184 ? -20.637 -8.671  -41.901 1.00 121.88 ? 206 SER B OG    1 
ATOM   3336 N N     . TYR B 1 185 ? -19.843 -11.395 -43.535 1.00 120.75 ? 207 TYR B N     1 
ATOM   3337 C CA    . TYR B 1 185 ? -18.533 -11.577 -44.161 1.00 120.35 ? 207 TYR B CA    1 
ATOM   3338 C C     . TYR B 1 185 ? -17.640 -10.374 -43.879 1.00 120.18 ? 207 TYR B C     1 
ATOM   3339 O O     . TYR B 1 185 ? -16.452 -10.532 -43.513 1.00 120.29 ? 207 TYR B O     1 
ATOM   3340 C CB    . TYR B 1 185 ? -18.663 -11.807 -45.665 1.00 120.13 ? 207 TYR B CB    1 
ATOM   3341 C CG    . TYR B 1 185 ? -18.739 -13.279 -46.028 1.00 120.24 ? 207 TYR B CG    1 
ATOM   3342 C CD1   . TYR B 1 185 ? -17.606 -13.977 -46.465 1.00 120.30 ? 207 TYR B CD1   1 
ATOM   3343 C CD2   . TYR B 1 185 ? -19.943 -13.982 -45.928 1.00 120.62 ? 207 TYR B CD2   1 
ATOM   3344 C CE1   . TYR B 1 185 ? -17.675 -15.342 -46.800 1.00 120.60 ? 207 TYR B CE1   1 
ATOM   3345 C CE2   . TYR B 1 185 ? -20.022 -15.345 -46.264 1.00 120.79 ? 207 TYR B CE2   1 
ATOM   3346 C CZ    . TYR B 1 185 ? -18.885 -16.018 -46.696 1.00 120.50 ? 207 TYR B CZ    1 
ATOM   3347 O OH    . TYR B 1 185 ? -18.963 -17.360 -47.026 1.00 120.14 ? 207 TYR B OH    1 
ATOM   3348 N N     . ARG B 1 186 ? -18.224 -9.182  -44.035 1.00 119.79 ? 208 ARG B N     1 
ATOM   3349 C CA    . ARG B 1 186 ? -17.577 -7.933  -43.635 1.00 119.51 ? 208 ARG B CA    1 
ATOM   3350 C C     . ARG B 1 186 ? -16.964 -7.965  -42.211 1.00 119.37 ? 208 ARG B C     1 
ATOM   3351 O O     . ARG B 1 186 ? -15.803 -7.575  -42.021 1.00 119.30 ? 208 ARG B O     1 
ATOM   3352 C CB    . ARG B 1 186 ? -18.563 -6.779  -43.760 1.00 119.39 ? 208 ARG B CB    1 
ATOM   3353 C CG    . ARG B 1 186 ? -17.978 -5.452  -43.335 1.00 119.42 ? 208 ARG B CG    1 
ATOM   3354 C CD    . ARG B 1 186 ? -18.843 -4.315  -43.789 1.00 119.82 ? 208 ARG B CD    1 
ATOM   3355 N NE    . ARG B 1 186 ? -18.977 -4.289  -45.244 1.00 120.23 ? 208 ARG B NE    1 
ATOM   3356 C CZ    . ARG B 1 186 ? -18.188 -3.601  -46.068 1.00 120.15 ? 208 ARG B CZ    1 
ATOM   3357 N NH1   . ARG B 1 186 ? -17.189 -2.864  -45.589 1.00 119.73 ? 208 ARG B NH1   1 
ATOM   3358 N NH2   . ARG B 1 186 ? -18.405 -3.648  -47.379 1.00 119.80 ? 208 ARG B NH2   1 
ATOM   3359 N N     . ASP B 1 187 ? -17.738 -8.428  -41.226 1.00 119.08 ? 209 ASP B N     1 
ATOM   3360 C CA    . ASP B 1 187 ? -17.239 -8.559  -39.854 1.00 119.04 ? 209 ASP B CA    1 
ATOM   3361 C C     . ASP B 1 187 ? -16.162 -9.642  -39.702 1.00 118.91 ? 209 ASP B C     1 
ATOM   3362 O O     . ASP B 1 187 ? -15.167 -9.418  -39.007 1.00 118.89 ? 209 ASP B O     1 
ATOM   3363 C CB    . ASP B 1 187 ? -18.390 -8.812  -38.859 1.00 119.27 ? 209 ASP B CB    1 
ATOM   3364 C CG    . ASP B 1 187 ? -17.892 -9.114  -37.425 1.00 119.82 ? 209 ASP B CG    1 
ATOM   3365 O OD1   . ASP B 1 187 ? -18.069 -8.246  -36.525 1.00 119.81 ? 209 ASP B OD1   1 
ATOM   3366 O OD2   . ASP B 1 187 ? -17.318 -10.225 -37.199 1.00 120.21 ? 209 ASP B OD2   1 
ATOM   3367 N N     . CYS B 1 188 ? -16.382 -10.810 -40.323 1.00 118.81 ? 210 CYS B N     1 
ATOM   3368 C CA    . CYS B 1 188 ? -15.462 -11.971 -40.230 1.00 118.67 ? 210 CYS B CA    1 
ATOM   3369 C C     . CYS B 1 188 ? -14.046 -11.657 -40.727 1.00 118.58 ? 210 CYS B C     1 
ATOM   3370 O O     . CYS B 1 188 ? -13.041 -12.056 -40.110 1.00 118.40 ? 210 CYS B O     1 
ATOM   3371 C CB    . CYS B 1 188 ? -16.028 -13.179 -40.998 1.00 118.57 ? 210 CYS B CB    1 
ATOM   3372 S SG    . CYS B 1 188 ? -17.236 -14.171 -40.080 1.00 118.22 ? 210 CYS B SG    1 
ATOM   3373 N N     . LEU B 1 189 ? -13.991 -10.935 -41.843 1.00 118.45 ? 211 LEU B N     1 
ATOM   3374 C CA    . LEU B 1 189 ? -12.738 -10.513 -42.443 1.00 118.54 ? 211 LEU B CA    1 
ATOM   3375 C C     . LEU B 1 189 ? -11.997 -9.448  -41.620 1.00 118.59 ? 211 LEU B C     1 
ATOM   3376 O O     . LEU B 1 189 ? -10.848 -9.682  -41.196 1.00 118.60 ? 211 LEU B O     1 
ATOM   3377 C CB    . LEU B 1 189 ? -12.976 -10.059 -43.884 1.00 118.50 ? 211 LEU B CB    1 
ATOM   3378 C CG    . LEU B 1 189 ? -13.129 -11.237 -44.853 1.00 118.71 ? 211 LEU B CG    1 
ATOM   3379 C CD1   . LEU B 1 189 ? -14.075 -10.893 -45.976 1.00 118.90 ? 211 LEU B CD1   1 
ATOM   3380 C CD2   . LEU B 1 189 ? -11.777 -11.633 -45.427 1.00 119.14 ? 211 LEU B CD2   1 
ATOM   3381 N N     . THR B 1 190 ? -12.647 -8.296  -41.387 1.00 118.69 ? 212 THR B N     1 
ATOM   3382 C CA    . THR B 1 190 ? -12.096 -7.249  -40.508 1.00 118.80 ? 212 THR B CA    1 
ATOM   3383 C C     . THR B 1 190 ? -11.431 -7.874  -39.271 1.00 118.81 ? 212 THR B C     1 
ATOM   3384 O O     . THR B 1 190 ? -10.369 -7.419  -38.810 1.00 118.72 ? 212 THR B O     1 
ATOM   3385 C CB    . THR B 1 190 ? -13.207 -6.253  -40.035 1.00 118.89 ? 212 THR B CB    1 
ATOM   3386 O OG1   . THR B 1 190 ? -13.970 -5.796  -41.164 1.00 118.86 ? 212 THR B OG1   1 
ATOM   3387 C CG2   . THR B 1 190 ? -12.602 -5.043  -39.290 1.00 118.79 ? 212 THR B CG2   1 
ATOM   3388 N N     . LYS B 1 191 ? -12.077 -8.926  -38.763 1.00 118.92 ? 213 LYS B N     1 
ATOM   3389 C CA    . LYS B 1 191 ? -11.663 -9.632  -37.553 1.00 119.01 ? 213 LYS B CA    1 
ATOM   3390 C C     . LYS B 1 191 ? -10.482 -10.551 -37.829 1.00 119.03 ? 213 LYS B C     1 
ATOM   3391 O O     . LYS B 1 191 ? -9.476  -10.504 -37.105 1.00 119.10 ? 213 LYS B O     1 
ATOM   3392 C CB    . LYS B 1 191 ? -12.830 -10.447 -36.979 1.00 119.05 ? 213 LYS B CB    1 
ATOM   3393 C CG    . LYS B 1 191 ? -12.899 -10.419 -35.456 1.00 119.12 ? 213 LYS B CG    1 
ATOM   3394 C CD    . LYS B 1 191 ? -13.723 -9.215  -34.946 1.00 119.23 ? 213 LYS B CD    1 
ATOM   3395 C CE    . LYS B 1 191 ? -13.123 -8.711  -33.567 1.00 118.98 ? 213 LYS B CE    1 
ATOM   3396 N NZ    . LYS B 1 191 ? -14.343 -8.136  -32.749 1.00 118.47 ? 213 LYS B NZ    1 
ATOM   3397 N N     . TRP B 1 192 ? -10.611 -11.388 -38.864 1.00 118.94 ? 214 TRP B N     1 
ATOM   3398 C CA    . TRP B 1 192 ? -9.479  -12.151 -39.388 1.00 118.90 ? 214 TRP B CA    1 
ATOM   3399 C C     . TRP B 1 192 ? -8.279  -11.212 -39.499 1.00 118.86 ? 214 TRP B C     1 
ATOM   3400 O O     . TRP B 1 192 ? -7.175  -11.538 -39.048 1.00 118.57 ? 214 TRP B O     1 
ATOM   3401 C CB    . TRP B 1 192 ? -9.819  -12.733 -40.764 1.00 118.87 ? 214 TRP B CB    1 
ATOM   3402 C CG    . TRP B 1 192 ? -8.622  -13.258 -41.503 1.00 118.87 ? 214 TRP B CG    1 
ATOM   3403 C CD1   . TRP B 1 192 ? -8.142  -14.535 -41.467 1.00 118.98 ? 214 TRP B CD1   1 
ATOM   3404 C CD2   . TRP B 1 192 ? -7.744  -12.516 -42.377 1.00 118.82 ? 214 TRP B CD2   1 
ATOM   3405 N NE1   . TRP B 1 192 ? -7.025  -14.641 -42.265 1.00 119.37 ? 214 TRP B NE1   1 
ATOM   3406 C CE2   . TRP B 1 192 ? -6.757  -13.417 -42.832 1.00 119.10 ? 214 TRP B CE2   1 
ATOM   3407 C CE3   . TRP B 1 192 ? -7.698  -11.181 -42.819 1.00 118.60 ? 214 TRP B CE3   1 
ATOM   3408 C CZ2   . TRP B 1 192 ? -5.734  -13.028 -43.714 1.00 119.25 ? 214 TRP B CZ2   1 
ATOM   3409 C CZ3   . TRP B 1 192 ? -6.680  -10.792 -43.689 1.00 118.77 ? 214 TRP B CZ3   1 
ATOM   3410 C CH2   . TRP B 1 192 ? -5.714  -11.715 -44.131 1.00 119.10 ? 214 TRP B CH2   1 
ATOM   3411 N N     . ASN B 1 193 ? -8.546  -10.044 -40.090 1.00 118.99 ? 215 ASN B N     1 
ATOM   3412 C CA    . ASN B 1 193 ? -7.591  -8.967  -40.297 1.00 119.24 ? 215 ASN B CA    1 
ATOM   3413 C C     . ASN B 1 193 ? -6.894  -8.519  -39.015 1.00 119.62 ? 215 ASN B C     1 
ATOM   3414 O O     . ASN B 1 193 ? -5.668  -8.630  -38.898 1.00 119.80 ? 215 ASN B O     1 
ATOM   3415 C CB    . ASN B 1 193 ? -8.292  -7.776  -40.954 1.00 119.01 ? 215 ASN B CB    1 
ATOM   3416 C CG    . ASN B 1 193 ? -7.371  -6.598  -41.148 1.00 118.84 ? 215 ASN B CG    1 
ATOM   3417 O OD1   . ASN B 1 193 ? -7.362  -5.653  -40.349 1.00 119.02 ? 215 ASN B OD1   1 
ATOM   3418 N ND2   . ASN B 1 193 ? -6.567  -6.656  -42.202 1.00 118.13 ? 215 ASN B ND2   1 
ATOM   3419 N N     . LYS B 1 194 ? -7.664  -8.012  -38.058 1.00 119.93 ? 216 LYS B N     1 
ATOM   3420 C CA    . LYS B 1 194 ? -7.078  -7.570  -36.806 1.00 120.49 ? 216 LYS B CA    1 
ATOM   3421 C C     . LYS B 1 194 ? -6.243  -8.693  -36.175 1.00 120.39 ? 216 LYS B C     1 
ATOM   3422 O O     . LYS B 1 194 ? -5.099  -8.460  -35.772 1.00 120.33 ? 216 LYS B O     1 
ATOM   3423 C CB    . LYS B 1 194 ? -8.158  -7.052  -35.853 1.00 120.76 ? 216 LYS B CB    1 
ATOM   3424 C CG    . LYS B 1 194 ? -7.639  -6.101  -34.765 1.00 122.70 ? 216 LYS B CG    1 
ATOM   3425 C CD    . LYS B 1 194 ? -6.977  -4.837  -35.365 1.00 126.62 ? 216 LYS B CD    1 
ATOM   3426 C CE    . LYS B 1 194 ? -6.312  -3.981  -34.278 1.00 129.17 ? 216 LYS B CE    1 
ATOM   3427 N NZ    . LYS B 1 194 ? -5.095  -4.616  -33.648 1.00 131.28 ? 216 LYS B NZ    1 
ATOM   3428 N N     . ALA B 1 195 ? -6.806  -9.908  -36.147 1.00 120.44 ? 217 ALA B N     1 
ATOM   3429 C CA    . ALA B 1 195 ? -6.175  -11.101 -35.545 1.00 120.52 ? 217 ALA B CA    1 
ATOM   3430 C C     . ALA B 1 195 ? -4.827  -11.499 -36.165 1.00 120.63 ? 217 ALA B C     1 
ATOM   3431 O O     . ALA B 1 195 ? -3.832  -11.730 -35.450 1.00 120.56 ? 217 ALA B O     1 
ATOM   3432 C CB    . ALA B 1 195 ? -7.144  -12.294 -35.583 1.00 120.42 ? 217 ALA B CB    1 
ATOM   3433 N N     . ILE B 1 196 ? -4.806  -11.589 -37.492 1.00 120.79 ? 218 ILE B N     1 
ATOM   3434 C CA    . ILE B 1 196 ? -3.595  -11.944 -38.222 1.00 120.96 ? 218 ILE B CA    1 
ATOM   3435 C C     . ILE B 1 196 ? -2.575  -10.794 -38.204 1.00 121.00 ? 218 ILE B C     1 
ATOM   3436 O O     . ILE B 1 196 ? -1.374  -11.038 -38.283 1.00 121.12 ? 218 ILE B O     1 
ATOM   3437 C CB    . ILE B 1 196 ? -3.919  -12.435 -39.677 1.00 121.09 ? 218 ILE B CB    1 
ATOM   3438 C CG1   . ILE B 1 196 ? -3.221  -13.782 -39.999 1.00 121.51 ? 218 ILE B CG1   1 
ATOM   3439 C CG2   . ILE B 1 196 ? -3.698  -11.328 -40.750 1.00 121.01 ? 218 ILE B CG2   1 
ATOM   3440 C CD1   . ILE B 1 196 ? -1.716  -13.674 -40.332 1.00 123.24 ? 218 ILE B CD1   1 
ATOM   3441 N N     . GLU B 1 197 ? -3.054  -9.555  -38.078 1.00 121.11 ? 219 GLU B N     1 
ATOM   3442 C CA    . GLU B 1 197 ? -2.183  -8.379  -37.974 1.00 121.44 ? 219 GLU B CA    1 
ATOM   3443 C C     . GLU B 1 197 ? -1.330  -8.409  -36.690 1.00 121.32 ? 219 GLU B C     1 
ATOM   3444 O O     . GLU B 1 197 ? -0.179  -7.949  -36.681 1.00 121.22 ? 219 GLU B O     1 
ATOM   3445 C CB    . GLU B 1 197 ? -3.024  -7.101  -38.047 1.00 121.56 ? 219 GLU B CB    1 
ATOM   3446 C CG    . GLU B 1 197 ? -2.270  -5.799  -37.823 1.00 123.27 ? 219 GLU B CG    1 
ATOM   3447 C CD    . GLU B 1 197 ? -3.153  -4.752  -37.171 1.00 125.90 ? 219 GLU B CD    1 
ATOM   3448 O OE1   . GLU B 1 197 ? -4.179  -4.373  -37.787 1.00 127.35 ? 219 GLU B OE1   1 
ATOM   3449 O OE2   . GLU B 1 197 ? -2.833  -4.312  -36.039 1.00 127.06 ? 219 GLU B OE2   1 
ATOM   3450 N N     . VAL B 1 198 ? -1.898  -8.970  -35.622 1.00 121.35 ? 220 VAL B N     1 
ATOM   3451 C CA    . VAL B 1 198 ? -1.214  -9.076  -34.335 1.00 121.44 ? 220 VAL B CA    1 
ATOM   3452 C C     . VAL B 1 198 ? -0.187  -10.218 -34.314 1.00 121.70 ? 220 VAL B C     1 
ATOM   3453 O O     . VAL B 1 198 ? 0.983   -9.997  -33.986 1.00 121.79 ? 220 VAL B O     1 
ATOM   3454 C CB    . VAL B 1 198 ? -2.232  -9.212  -33.170 1.00 121.39 ? 220 VAL B CB    1 
ATOM   3455 C CG1   . VAL B 1 198 ? -1.533  -9.579  -31.861 1.00 121.52 ? 220 VAL B CG1   1 
ATOM   3456 C CG2   . VAL B 1 198 ? -3.005  -7.909  -32.992 1.00 121.19 ? 220 VAL B CG2   1 
ATOM   3457 N N     . MET B 1 199 ? -0.628  -11.426 -34.669 1.00 122.09 ? 221 MET B N     1 
ATOM   3458 C CA    . MET B 1 199 ? 0.230   -12.622 -34.693 1.00 122.66 ? 221 MET B CA    1 
ATOM   3459 C C     . MET B 1 199 ? 1.501   -12.467 -35.530 1.00 122.90 ? 221 MET B C     1 
ATOM   3460 O O     . MET B 1 199 ? 2.539   -13.058 -35.216 1.00 122.82 ? 221 MET B O     1 
ATOM   3461 C CB    . MET B 1 199 ? -0.551  -13.809 -35.237 1.00 122.69 ? 221 MET B CB    1 
ATOM   3462 C CG    . MET B 1 199 ? -1.753  -14.183 -34.425 1.00 123.35 ? 221 MET B CG    1 
ATOM   3463 S SD    . MET B 1 199 ? -2.660  -15.430 -35.320 1.00 124.65 ? 221 MET B SD    1 
ATOM   3464 C CE    . MET B 1 199 ? -3.736  -16.028 -34.018 1.00 126.57 ? 221 MET B CE    1 
ATOM   3465 N N     . TYR B 1 200 ? 1.393   -11.688 -36.603 1.00 123.34 ? 222 TYR B N     1 
ATOM   3466 C CA    . TYR B 1 200 ? 2.502   -11.408 -37.503 1.00 124.01 ? 222 TYR B CA    1 
ATOM   3467 C C     . TYR B 1 200 ? 3.496   -10.432 -36.867 1.00 124.06 ? 222 TYR B C     1 
ATOM   3468 O O     . TYR B 1 200 ? 4.700   -10.702 -36.868 1.00 124.29 ? 222 TYR B O     1 
ATOM   3469 C CB    . TYR B 1 200 ? 1.969   -10.868 -38.840 1.00 124.34 ? 222 TYR B CB    1 
ATOM   3470 C CG    . TYR B 1 200 ? 2.926   -10.936 -40.040 1.00 125.88 ? 222 TYR B CG    1 
ATOM   3471 C CD1   . TYR B 1 200 ? 3.221   -12.163 -40.654 1.00 127.10 ? 222 TYR B CD1   1 
ATOM   3472 C CD2   . TYR B 1 200 ? 3.498   -9.761  -40.591 1.00 126.97 ? 222 TYR B CD2   1 
ATOM   3473 C CE1   . TYR B 1 200 ? 4.079   -12.225 -41.761 1.00 127.99 ? 222 TYR B CE1   1 
ATOM   3474 C CE2   . TYR B 1 200 ? 4.354   -9.813  -41.696 1.00 127.85 ? 222 TYR B CE2   1 
ATOM   3475 C CZ    . TYR B 1 200 ? 4.637   -11.048 -42.277 1.00 128.48 ? 222 TYR B CZ    1 
ATOM   3476 O OH    . TYR B 1 200 ? 5.483   -11.116 -43.370 1.00 129.75 ? 222 TYR B OH    1 
ATOM   3477 N N     . ALA B 1 201 ? 3.003   -9.315  -36.320 1.00 124.11 ? 223 ALA B N     1 
ATOM   3478 C CA    . ALA B 1 201 ? 3.861   -8.345  -35.612 1.00 124.24 ? 223 ALA B CA    1 
ATOM   3479 C C     . ALA B 1 201 ? 4.635   -9.034  -34.481 1.00 124.37 ? 223 ALA B C     1 
ATOM   3480 O O     . ALA B 1 201 ? 5.836   -8.785  -34.277 1.00 124.26 ? 223 ALA B O     1 
ATOM   3481 C CB    . ALA B 1 201 ? 3.035   -7.184  -35.071 1.00 124.19 ? 223 ALA B CB    1 
ATOM   3482 N N     . GLN B 1 202 ? 3.923   -9.905  -33.766 1.00 124.58 ? 224 GLN B N     1 
ATOM   3483 C CA    . GLN B 1 202 ? 4.510   -10.830 -32.813 1.00 124.87 ? 224 GLN B CA    1 
ATOM   3484 C C     . GLN B 1 202 ? 5.601   -11.665 -33.499 1.00 125.15 ? 224 GLN B C     1 
ATOM   3485 O O     . GLN B 1 202 ? 6.782   -11.551 -33.158 1.00 125.26 ? 224 GLN B O     1 
ATOM   3486 C CB    . GLN B 1 202 ? 3.417   -11.728 -32.211 1.00 124.84 ? 224 GLN B CB    1 
ATOM   3487 C CG    . GLN B 1 202 ? 2.465   -11.025 -31.229 1.00 124.64 ? 224 GLN B CG    1 
ATOM   3488 C CD    . GLN B 1 202 ? 2.964   -11.050 -29.784 1.00 124.85 ? 224 GLN B CD    1 
ATOM   3489 O OE1   . GLN B 1 202 ? 3.171   -12.120 -29.197 1.00 124.47 ? 224 GLN B OE1   1 
ATOM   3490 N NE2   . GLN B 1 202 ? 3.151   -9.864  -29.203 1.00 125.12 ? 224 GLN B NE2   1 
ATOM   3491 N N     . CYS B 1 203 ? 5.207   -12.471 -34.483 1.00 125.44 ? 225 CYS B N     1 
ATOM   3492 C CA    . CYS B 1 203 ? 6.148   -13.283 -35.244 1.00 125.92 ? 225 CYS B CA    1 
ATOM   3493 C C     . CYS B 1 203 ? 7.349   -12.485 -35.751 1.00 126.36 ? 225 CYS B C     1 
ATOM   3494 O O     . CYS B 1 203 ? 8.443   -13.034 -35.893 1.00 126.36 ? 225 CYS B O     1 
ATOM   3495 C CB    . CYS B 1 203 ? 5.437   -13.925 -36.427 1.00 125.86 ? 225 CYS B CB    1 
ATOM   3496 S SG    . CYS B 1 203 ? 6.468   -15.034 -37.363 1.00 125.99 ? 225 CYS B SG    1 
ATOM   3497 N N     . MET B 1 204 ? 7.133   -11.196 -36.019 1.00 127.04 ? 226 MET B N     1 
ATOM   3498 C CA    . MET B 1 204 ? 8.166   -10.322 -36.585 1.00 127.93 ? 226 MET B CA    1 
ATOM   3499 C C     . MET B 1 204 ? 9.140   -9.795  -35.542 1.00 128.36 ? 226 MET B C     1 
ATOM   3500 O O     . MET B 1 204 ? 10.355  -9.754  -35.767 1.00 128.51 ? 226 MET B O     1 
ATOM   3501 C CB    . MET B 1 204 ? 7.540   -9.157  -37.365 1.00 128.00 ? 226 MET B CB    1 
ATOM   3502 C CG    . MET B 1 204 ? 7.140   -9.504  -38.809 1.00 128.73 ? 226 MET B CG    1 
ATOM   3503 S SD    . MET B 1 204 ? 8.451   -10.303 -39.799 1.00 130.20 ? 226 MET B SD    1 
ATOM   3504 C CE    . MET B 1 204 ? 8.125   -12.063 -39.540 1.00 129.89 ? 226 MET B CE    1 
ATOM   3505 N N     . GLU B 1 205 ? 8.602   -9.381  -34.403 1.00 128.87 ? 227 GLU B N     1 
ATOM   3506 C CA    . GLU B 1 205 ? 9.426   -8.962  -33.283 1.00 129.33 ? 227 GLU B CA    1 
ATOM   3507 C C     . GLU B 1 205 ? 10.213  -10.170 -32.779 1.00 129.26 ? 227 GLU B C     1 
ATOM   3508 O O     . GLU B 1 205 ? 11.390  -10.054 -32.439 1.00 129.15 ? 227 GLU B O     1 
ATOM   3509 C CB    . GLU B 1 205 ? 8.517   -8.437  -32.191 1.00 129.52 ? 227 GLU B CB    1 
ATOM   3510 C CG    . GLU B 1 205 ? 9.133   -7.388  -31.279 1.00 130.91 ? 227 GLU B CG    1 
ATOM   3511 C CD    . GLU B 1 205 ? 8.095   -6.908  -30.290 1.00 133.29 ? 227 GLU B CD    1 
ATOM   3512 O OE1   . GLU B 1 205 ? 8.346   -6.976  -29.066 1.00 134.28 ? 227 GLU B OE1   1 
ATOM   3513 O OE2   . GLU B 1 205 ? 7.003   -6.492  -30.741 1.00 134.35 ? 227 GLU B OE2   1 
ATOM   3514 N N     . VAL B 1 206 ? 9.542   -11.325 -32.763 1.00 129.40 ? 228 VAL B N     1 
ATOM   3515 C CA    . VAL B 1 206 ? 10.132  -12.614 -32.398 1.00 129.60 ? 228 VAL B CA    1 
ATOM   3516 C C     . VAL B 1 206 ? 11.462  -12.838 -33.112 1.00 129.85 ? 228 VAL B C     1 
ATOM   3517 O O     . VAL B 1 206 ? 12.475  -13.110 -32.469 1.00 129.91 ? 228 VAL B O     1 
ATOM   3518 C CB    . VAL B 1 206 ? 9.135   -13.793 -32.677 1.00 129.51 ? 228 VAL B CB    1 
ATOM   3519 C CG1   . VAL B 1 206 ? 9.881   -15.116 -32.775 1.00 129.46 ? 228 VAL B CG1   1 
ATOM   3520 C CG2   . VAL B 1 206 ? 8.056   -13.869 -31.572 1.00 129.48 ? 228 VAL B CG2   1 
ATOM   3521 N N     . GLY B 1 207 ? 11.456  -12.707 -34.437 1.00 130.19 ? 229 GLY B N     1 
ATOM   3522 C CA    . GLY B 1 207 ? 12.673  -12.882 -35.229 1.00 130.58 ? 229 GLY B CA    1 
ATOM   3523 C C     . GLY B 1 207 ? 12.594  -14.076 -36.156 1.00 130.79 ? 229 GLY B C     1 
ATOM   3524 O O     . GLY B 1 207 ? 12.129  -15.152 -35.761 1.00 130.83 ? 229 GLY B O     1 
ATOM   3525 N N     . LYS B 1 208 ? 13.066  -13.877 -37.391 1.00 130.99 ? 230 LYS B N     1 
ATOM   3526 C CA    . LYS B 1 208 ? 12.986  -14.888 -38.442 1.00 131.35 ? 230 LYS B CA    1 
ATOM   3527 C C     . LYS B 1 208 ? 13.444  -16.233 -37.901 1.00 131.10 ? 230 LYS B C     1 
ATOM   3528 O O     . LYS B 1 208 ? 12.934  -17.297 -38.294 1.00 130.93 ? 230 LYS B O     1 
ATOM   3529 C CB    . LYS B 1 208 ? 13.863  -14.469 -39.631 1.00 131.65 ? 230 LYS B CB    1 
ATOM   3530 C CG    . LYS B 1 208 ? 13.792  -12.949 -39.954 1.00 133.33 ? 230 LYS B CG    1 
ATOM   3531 C CD    . LYS B 1 208 ? 14.800  -12.524 -41.027 1.00 136.17 ? 230 LYS B CD    1 
ATOM   3532 C CE    . LYS B 1 208 ? 14.124  -12.230 -42.375 1.00 137.70 ? 230 LYS B CE    1 
ATOM   3533 N NZ    . LYS B 1 208 ? 14.036  -13.409 -43.288 1.00 138.84 ? 230 LYS B NZ    1 
ATOM   3534 N N     . GLU B 1 209 ? 14.395  -16.148 -36.966 1.00 130.98 ? 231 GLU B N     1 
ATOM   3535 C CA    . GLU B 1 209 ? 15.110  -17.294 -36.438 1.00 130.96 ? 231 GLU B CA    1 
ATOM   3536 C C     . GLU B 1 209 ? 14.226  -18.146 -35.542 1.00 130.14 ? 231 GLU B C     1 
ATOM   3537 O O     . GLU B 1 209 ? 14.397  -19.364 -35.467 1.00 130.18 ? 231 GLU B O     1 
ATOM   3538 C CB    . GLU B 1 209 ? 16.323  -16.802 -35.653 1.00 131.34 ? 231 GLU B CB    1 
ATOM   3539 C CG    . GLU B 1 209 ? 17.471  -17.783 -35.571 1.00 133.88 ? 231 GLU B CG    1 
ATOM   3540 C CD    . GLU B 1 209 ? 18.728  -17.115 -35.045 1.00 137.49 ? 231 GLU B CD    1 
ATOM   3541 O OE1   . GLU B 1 209 ? 19.145  -17.424 -33.901 1.00 139.17 ? 231 GLU B OE1   1 
ATOM   3542 O OE2   . GLU B 1 209 ? 19.292  -16.263 -35.770 1.00 138.84 ? 231 GLU B OE2   1 
ATOM   3543 N N     . LYS B 1 210 ? 13.289  -17.497 -34.859 1.00 129.14 ? 232 LYS B N     1 
ATOM   3544 C CA    . LYS B 1 210 ? 12.385  -18.198 -33.968 1.00 128.25 ? 232 LYS B CA    1 
ATOM   3545 C C     . LYS B 1 210 ? 11.021  -18.400 -34.608 1.00 127.51 ? 232 LYS B C     1 
ATOM   3546 O O     . LYS B 1 210 ? 10.335  -19.380 -34.308 1.00 127.50 ? 232 LYS B O     1 
ATOM   3547 C CB    . LYS B 1 210 ? 12.223  -17.437 -32.654 1.00 128.39 ? 232 LYS B CB    1 
ATOM   3548 C CG    . LYS B 1 210 ? 13.312  -17.690 -31.606 1.00 128.75 ? 232 LYS B CG    1 
ATOM   3549 C CD    . LYS B 1 210 ? 12.987  -16.925 -30.314 1.00 129.53 ? 232 LYS B CD    1 
ATOM   3550 C CE    . LYS B 1 210 ? 13.867  -17.321 -29.121 1.00 129.85 ? 232 LYS B CE    1 
ATOM   3551 N NZ    . LYS B 1 210 ? 13.530  -18.640 -28.500 1.00 130.15 ? 232 LYS B NZ    1 
ATOM   3552 N N     . CYS B 1 211 ? 10.628  -17.479 -35.486 1.00 126.56 ? 233 CYS B N     1 
ATOM   3553 C CA    . CYS B 1 211 ? 9.298   -17.537 -36.089 1.00 125.62 ? 233 CYS B CA    1 
ATOM   3554 C C     . CYS B 1 211 ? 9.306   -17.581 -37.617 1.00 125.08 ? 233 CYS B C     1 
ATOM   3555 O O     . CYS B 1 211 ? 9.965   -16.762 -38.273 1.00 124.96 ? 233 CYS B O     1 
ATOM   3556 C CB    . CYS B 1 211 ? 8.424   -16.393 -35.588 1.00 125.56 ? 233 CYS B CB    1 
ATOM   3557 S SG    . CYS B 1 211 ? 6.720   -16.575 -36.079 1.00 125.27 ? 233 CYS B SG    1 
ATOM   3558 N N     . LEU B 1 212 ? 8.546   -18.538 -38.159 1.00 124.35 ? 234 LEU B N     1 
ATOM   3559 C CA    . LEU B 1 212 ? 8.489   -18.821 -39.601 1.00 123.57 ? 234 LEU B CA    1 
ATOM   3560 C C     . LEU B 1 212 ? 7.048   -18.798 -40.098 1.00 122.92 ? 234 LEU B C     1 
ATOM   3561 O O     . LEU B 1 212 ? 6.267   -19.708 -39.760 1.00 122.85 ? 234 LEU B O     1 
ATOM   3562 C CB    . LEU B 1 212 ? 9.057   -20.222 -39.891 1.00 123.68 ? 234 LEU B CB    1 
ATOM   3563 C CG    . LEU B 1 212 ? 9.556   -20.666 -41.288 1.00 123.83 ? 234 LEU B CG    1 
ATOM   3564 C CD1   . LEU B 1 212 ? 8.951   -22.034 -41.651 1.00 123.96 ? 234 LEU B CD1   1 
ATOM   3565 C CD2   . LEU B 1 212 ? 9.249   -19.666 -42.391 1.00 124.43 ? 234 LEU B CD2   1 
ATOM   3566 N N     . PRO B 1 213 ? 6.691   -17.765 -40.900 1.00 122.31 ? 235 PRO B N     1 
ATOM   3567 C CA    . PRO B 1 213 ? 5.404   -17.758 -41.614 1.00 121.91 ? 235 PRO B CA    1 
ATOM   3568 C C     . PRO B 1 213 ? 5.309   -18.929 -42.605 1.00 121.60 ? 235 PRO B C     1 
ATOM   3569 O O     . PRO B 1 213 ? 6.189   -19.085 -43.456 1.00 121.45 ? 235 PRO B O     1 
ATOM   3570 C CB    . PRO B 1 213 ? 5.412   -16.409 -42.346 1.00 121.81 ? 235 PRO B CB    1 
ATOM   3571 C CG    . PRO B 1 213 ? 6.353   -15.550 -41.549 1.00 121.83 ? 235 PRO B CG    1 
ATOM   3572 C CD    . PRO B 1 213 ? 7.424   -16.478 -41.057 1.00 122.14 ? 235 PRO B CD    1 
ATOM   3573 N N     . VAL B 1 214 ? 4.263   -19.756 -42.471 1.00 121.38 ? 236 VAL B N     1 
ATOM   3574 C CA    . VAL B 1 214 ? 4.090   -20.943 -43.322 1.00 121.19 ? 236 VAL B CA    1 
ATOM   3575 C C     . VAL B 1 214 ? 2.802   -20.815 -44.146 1.00 121.34 ? 236 VAL B C     1 
ATOM   3576 O O     . VAL B 1 214 ? 1.695   -20.883 -43.592 1.00 121.21 ? 236 VAL B O     1 
ATOM   3577 C CB    . VAL B 1 214 ? 4.092   -22.262 -42.487 1.00 121.13 ? 236 VAL B CB    1 
ATOM   3578 C CG1   . VAL B 1 214 ? 3.716   -23.468 -43.345 1.00 120.77 ? 236 VAL B CG1   1 
ATOM   3579 C CG2   . VAL B 1 214 ? 5.454   -22.481 -41.825 1.00 121.01 ? 236 VAL B CG2   1 
ATOM   3580 N N     . TYR B 1 215 ? 2.972   -20.628 -45.462 1.00 121.47 ? 237 TYR B N     1 
ATOM   3581 C CA    . TYR B 1 215 ? 1.875   -20.358 -46.401 1.00 121.57 ? 237 TYR B CA    1 
ATOM   3582 C C     . TYR B 1 215 ? 1.121   -21.606 -46.832 1.00 121.26 ? 237 TYR B C     1 
ATOM   3583 O O     . TYR B 1 215 ? 1.668   -22.483 -47.501 1.00 120.99 ? 237 TYR B O     1 
ATOM   3584 C CB    . TYR B 1 215 ? 2.376   -19.588 -47.620 1.00 121.84 ? 237 TYR B CB    1 
ATOM   3585 C CG    . TYR B 1 215 ? 2.647   -18.134 -47.327 1.00 123.71 ? 237 TYR B CG    1 
ATOM   3586 C CD1   . TYR B 1 215 ? 1.641   -17.179 -47.467 1.00 125.59 ? 237 TYR B CD1   1 
ATOM   3587 C CD2   . TYR B 1 215 ? 3.905   -17.709 -46.901 1.00 125.62 ? 237 TYR B CD2   1 
ATOM   3588 C CE1   . TYR B 1 215 ? 1.878   -15.838 -47.197 1.00 127.19 ? 237 TYR B CE1   1 
ATOM   3589 C CE2   . TYR B 1 215 ? 4.153   -16.369 -46.626 1.00 127.26 ? 237 TYR B CE2   1 
ATOM   3590 C CZ    . TYR B 1 215 ? 3.132   -15.441 -46.778 1.00 127.90 ? 237 TYR B CZ    1 
ATOM   3591 O OH    . TYR B 1 215 ? 3.358   -14.113 -46.516 1.00 129.38 ? 237 TYR B OH    1 
ATOM   3592 N N     . TYR B 1 216 ? -0.154  -21.644 -46.430 1.00 121.26 ? 238 TYR B N     1 
ATOM   3593 C CA    . TYR B 1 216 ? -1.081  -22.773 -46.628 1.00 121.09 ? 238 TYR B CA    1 
ATOM   3594 C C     . TYR B 1 216 ? -1.104  -23.258 -48.075 1.00 121.17 ? 238 TYR B C     1 
ATOM   3595 O O     . TYR B 1 216 ? -0.946  -24.453 -48.356 1.00 121.20 ? 238 TYR B O     1 
ATOM   3596 C CB    . TYR B 1 216 ? -2.509  -22.389 -46.160 1.00 120.76 ? 238 TYR B CB    1 
ATOM   3597 C CG    . TYR B 1 216 ? -3.566  -23.436 -46.477 1.00 119.97 ? 238 TYR B CG    1 
ATOM   3598 C CD1   . TYR B 1 216 ? -3.775  -24.541 -45.621 1.00 119.54 ? 238 TYR B CD1   1 
ATOM   3599 C CD2   . TYR B 1 216 ? -4.350  -23.329 -47.636 1.00 118.76 ? 238 TYR B CD2   1 
ATOM   3600 C CE1   . TYR B 1 216 ? -4.736  -25.516 -45.912 1.00 119.08 ? 238 TYR B CE1   1 
ATOM   3601 C CE2   . TYR B 1 216 ? -5.314  -24.300 -47.932 1.00 118.48 ? 238 TYR B CE2   1 
ATOM   3602 C CZ    . TYR B 1 216 ? -5.501  -25.390 -47.062 1.00 118.51 ? 238 TYR B CZ    1 
ATOM   3603 O OH    . TYR B 1 216 ? -6.446  -26.364 -47.331 1.00 118.31 ? 238 TYR B OH    1 
ATOM   3604 N N     . GLU B 1 217 ? -1.303  -22.309 -48.979 1.00 121.20 ? 239 GLU B N     1 
ATOM   3605 C CA    . GLU B 1 217 ? -1.362  -22.594 -50.389 1.00 121.26 ? 239 GLU B CA    1 
ATOM   3606 C C     . GLU B 1 217 ? -0.030  -23.115 -50.909 1.00 121.44 ? 239 GLU B C     1 
ATOM   3607 O O     . GLU B 1 217 ? -0.002  -24.024 -51.732 1.00 121.36 ? 239 GLU B O     1 
ATOM   3608 C CB    . GLU B 1 217 ? -1.889  -21.379 -51.184 1.00 121.26 ? 239 GLU B CB    1 
ATOM   3609 C CG    . GLU B 1 217 ? -1.615  -19.996 -50.535 1.00 121.16 ? 239 GLU B CG    1 
ATOM   3610 C CD    . GLU B 1 217 ? -2.394  -19.783 -49.217 1.00 121.17 ? 239 GLU B CD    1 
ATOM   3611 O OE1   . GLU B 1 217 ? -1.730  -19.428 -48.213 1.00 121.13 ? 239 GLU B OE1   1 
ATOM   3612 O OE2   . GLU B 1 217 ? -3.646  -19.977 -49.168 1.00 121.14 ? 239 GLU B OE2   1 
ATOM   3613 N N     . GLN B 1 218 ? 1.072   -22.571 -50.397 1.00 121.84 ? 240 GLN B N     1 
ATOM   3614 C CA    . GLN B 1 218 ? 2.402   -23.078 -50.751 1.00 122.27 ? 240 GLN B CA    1 
ATOM   3615 C C     . GLN B 1 218 ? 2.613   -24.496 -50.254 1.00 122.24 ? 240 GLN B C     1 
ATOM   3616 O O     . GLN B 1 218 ? 3.147   -25.342 -50.979 1.00 122.01 ? 240 GLN B O     1 
ATOM   3617 C CB    . GLN B 1 218 ? 3.513   -22.167 -50.218 1.00 122.46 ? 240 GLN B CB    1 
ATOM   3618 C CG    . GLN B 1 218 ? 3.549   -20.797 -50.869 1.00 123.68 ? 240 GLN B CG    1 
ATOM   3619 C CD    . GLN B 1 218 ? 3.036   -20.824 -52.298 1.00 125.67 ? 240 GLN B CD    1 
ATOM   3620 O OE1   . GLN B 1 218 ? 2.029   -20.185 -52.616 1.00 126.96 ? 240 GLN B OE1   1 
ATOM   3621 N NE2   . GLN B 1 218 ? 3.708   -21.590 -53.163 1.00 126.18 ? 240 GLN B NE2   1 
ATOM   3622 N N     . LEU B 1 219 ? 2.179   -24.733 -49.010 1.00 122.53 ? 241 LEU B N     1 
ATOM   3623 C CA    . LEU B 1 219 ? 2.286   -26.031 -48.349 1.00 122.72 ? 241 LEU B CA    1 
ATOM   3624 C C     . LEU B 1 219 ? 1.496   -27.089 -49.107 1.00 122.81 ? 241 LEU B C     1 
ATOM   3625 O O     . LEU B 1 219 ? 2.029   -28.145 -49.453 1.00 122.71 ? 241 LEU B O     1 
ATOM   3626 C CB    . LEU B 1 219 ? 1.757   -25.933 -46.912 1.00 122.70 ? 241 LEU B CB    1 
ATOM   3627 C CG    . LEU B 1 219 ? 2.155   -26.952 -45.836 1.00 122.94 ? 241 LEU B CG    1 
ATOM   3628 C CD1   . LEU B 1 219 ? 1.117   -26.880 -44.705 1.00 123.59 ? 241 LEU B CD1   1 
ATOM   3629 C CD2   . LEU B 1 219 ? 2.254   -28.399 -46.383 1.00 123.39 ? 241 LEU B CD2   1 
ATOM   3630 N N     . VAL B 1 220 ? 0.219   -26.793 -49.348 1.00 123.00 ? 242 VAL B N     1 
ATOM   3631 C CA    . VAL B 1 220 ? -0.672  -27.710 -50.047 1.00 123.03 ? 242 VAL B CA    1 
ATOM   3632 C C     . VAL B 1 220 ? -0.156  -27.959 -51.472 1.00 123.28 ? 242 VAL B C     1 
ATOM   3633 O O     . VAL B 1 220 ? -0.055  -29.115 -51.894 1.00 123.28 ? 242 VAL B O     1 
ATOM   3634 C CB    . VAL B 1 220 ? -2.155  -27.224 -50.001 1.00 122.91 ? 242 VAL B CB    1 
ATOM   3635 C CG1   . VAL B 1 220 ? -3.040  -28.044 -50.928 1.00 122.76 ? 242 VAL B CG1   1 
ATOM   3636 C CG2   . VAL B 1 220 ? -2.689  -27.293 -48.571 1.00 122.52 ? 242 VAL B CG2   1 
ATOM   3637 N N     . LEU B 1 221 ? 0.204   -26.883 -52.184 1.00 123.59 ? 243 LEU B N     1 
ATOM   3638 C CA    . LEU B 1 221 ? 0.788   -26.992 -53.534 1.00 124.01 ? 243 LEU B CA    1 
ATOM   3639 C C     . LEU B 1 221 ? 2.108   -27.762 -53.535 1.00 124.37 ? 243 LEU B C     1 
ATOM   3640 O O     . LEU B 1 221 ? 2.292   -28.716 -54.307 1.00 124.44 ? 243 LEU B O     1 
ATOM   3641 C CB    . LEU B 1 221 ? 1.049   -25.611 -54.164 1.00 123.90 ? 243 LEU B CB    1 
ATOM   3642 C CG    . LEU B 1 221 ? -0.007  -24.706 -54.830 1.00 123.75 ? 243 LEU B CG    1 
ATOM   3643 C CD1   . LEU B 1 221 ? 0.673   -23.384 -55.201 1.00 123.26 ? 243 LEU B CD1   1 
ATOM   3644 C CD2   . LEU B 1 221 ? -0.647  -25.340 -56.064 1.00 123.56 ? 243 LEU B CD2   1 
ATOM   3645 N N     . HIS B 1 222 ? 3.026   -27.331 -52.671 1.00 124.68 ? 244 HIS B N     1 
ATOM   3646 C CA    . HIS B 1 222 ? 4.378   -27.871 -52.650 1.00 124.98 ? 244 HIS B CA    1 
ATOM   3647 C C     . HIS B 1 222 ? 4.675   -28.474 -51.272 1.00 125.29 ? 244 HIS B C     1 
ATOM   3648 O O     . HIS B 1 222 ? 5.362   -27.840 -50.451 1.00 125.49 ? 244 HIS B O     1 
ATOM   3649 C CB    . HIS B 1 222 ? 5.384   -26.771 -53.018 1.00 124.90 ? 244 HIS B CB    1 
ATOM   3650 C CG    . HIS B 1 222 ? 4.902   -25.862 -54.113 1.00 124.95 ? 244 HIS B CG    1 
ATOM   3651 N ND1   . HIS B 1 222 ? 5.003   -26.188 -55.453 1.00 125.14 ? 244 HIS B ND1   1 
ATOM   3652 C CD2   . HIS B 1 222 ? 4.297   -24.646 -54.065 1.00 124.95 ? 244 HIS B CD2   1 
ATOM   3653 C CE1   . HIS B 1 222 ? 4.491   -25.208 -56.185 1.00 125.10 ? 244 HIS B CE1   1 
ATOM   3654 N NE2   . HIS B 1 222 ? 4.053   -24.262 -55.367 1.00 125.14 ? 244 HIS B NE2   1 
ATOM   3655 N N     . PRO B 1 223 ? 4.164   -29.705 -51.015 1.00 125.48 ? 245 PRO B N     1 
ATOM   3656 C CA    . PRO B 1 223 ? 4.300   -30.282 -49.678 1.00 125.69 ? 245 PRO B CA    1 
ATOM   3657 C C     . PRO B 1 223 ? 5.735   -30.707 -49.359 1.00 126.03 ? 245 PRO B C     1 
ATOM   3658 O O     . PRO B 1 223 ? 6.188   -30.518 -48.233 1.00 126.02 ? 245 PRO B O     1 
ATOM   3659 C CB    . PRO B 1 223 ? 3.355   -31.487 -49.721 1.00 125.66 ? 245 PRO B CB    1 
ATOM   3660 C CG    . PRO B 1 223 ? 3.332   -31.897 -51.152 1.00 125.47 ? 245 PRO B CG    1 
ATOM   3661 C CD    . PRO B 1 223 ? 3.545   -30.660 -51.974 1.00 125.39 ? 245 PRO B CD    1 
ATOM   3662 N N     . ARG B 1 224 ? 6.442   -31.252 -50.347 1.00 126.54 ? 246 ARG B N     1 
ATOM   3663 C CA    . ARG B 1 224 ? 7.830   -31.676 -50.166 1.00 127.11 ? 246 ARG B CA    1 
ATOM   3664 C C     . ARG B 1 224 ? 8.792   -30.488 -49.993 1.00 126.97 ? 246 ARG B C     1 
ATOM   3665 O O     . ARG B 1 224 ? 9.762   -30.584 -49.211 1.00 126.81 ? 246 ARG B O     1 
ATOM   3666 C CB    . ARG B 1 224 ? 8.264   -32.567 -51.332 1.00 127.44 ? 246 ARG B CB    1 
ATOM   3667 C CG    . ARG B 1 224 ? 9.555   -33.310 -51.076 1.00 129.18 ? 246 ARG B CG    1 
ATOM   3668 C CD    . ARG B 1 224 ? 9.969   -34.164 -52.288 1.00 132.23 ? 246 ARG B CD    1 
ATOM   3669 N NE    . ARG B 1 224 ? 11.239  -34.847 -52.025 1.00 134.91 ? 246 ARG B NE    1 
ATOM   3670 C CZ    . ARG B 1 224 ? 11.349  -36.009 -51.382 1.00 136.35 ? 246 ARG B CZ    1 
ATOM   3671 N NH1   . ARG B 1 224 ? 10.260  -36.641 -50.936 1.00 137.26 ? 246 ARG B NH1   1 
ATOM   3672 N NH2   . ARG B 1 224 ? 12.550  -36.543 -51.184 1.00 136.93 ? 246 ARG B NH2   1 
ATOM   3673 N N     . ARG B 1 225 ? 8.506   -29.383 -50.721 1.00 127.04 ? 247 ARG B N     1 
ATOM   3674 C CA    A ARG B 1 225 ? 9.319   -28.166 -50.653 0.50 127.04 ? 247 ARG B CA    1 
ATOM   3675 C CA    B ARG B 1 225 ? 9.316   -28.164 -50.646 0.50 127.06 ? 247 ARG B CA    1 
ATOM   3676 C C     . ARG B 1 225 ? 9.156   -27.473 -49.296 1.00 126.91 ? 247 ARG B C     1 
ATOM   3677 O O     . ARG B 1 225 ? 10.147  -27.175 -48.624 1.00 126.96 ? 247 ARG B O     1 
ATOM   3678 C CB    A ARG B 1 225 ? 8.970   -27.209 -51.816 0.50 127.15 ? 247 ARG B CB    1 
ATOM   3679 C CB    B ARG B 1 225 ? 8.965   -27.187 -51.778 0.50 127.19 ? 247 ARG B CB    1 
ATOM   3680 C CG    A ARG B 1 225 ? 9.884   -25.979 -51.935 0.50 127.65 ? 247 ARG B CG    1 
ATOM   3681 C CG    B ARG B 1 225 ? 9.844   -25.921 -51.788 0.50 127.79 ? 247 ARG B CG    1 
ATOM   3682 C CD    A ARG B 1 225 ? 11.397  -26.373 -51.934 0.50 128.53 ? 247 ARG B CD    1 
ATOM   3683 C CD    B ARG B 1 225 ? 9.312   -24.876 -52.750 0.50 128.75 ? 247 ARG B CD    1 
ATOM   3684 N NE    A ARG B 1 225 ? 12.270  -25.222 -51.708 0.50 129.00 ? 247 ARG B NE    1 
ATOM   3685 N NE    B ARG B 1 225 ? 9.272   -25.383 -54.127 0.50 129.38 ? 247 ARG B NE    1 
ATOM   3686 C CZ    A ARG B 1 225 ? 13.108  -24.724 -52.504 0.50 129.20 ? 247 ARG B CZ    1 
ATOM   3687 C CZ    B ARG B 1 225 ? 8.773   -24.686 -55.195 0.50 129.73 ? 247 ARG B CZ    1 
ATOM   3688 N NH1   A ARG B 1 225 ? 13.306  -25.281 -53.586 0.50 129.31 ? 247 ARG B NH1   1 
ATOM   3689 N NH1   B ARG B 1 225 ? 8.262   -23.499 -55.041 0.50 129.97 ? 247 ARG B NH1   1 
ATOM   3690 N NH2   A ARG B 1 225 ? 13.865  -23.675 -52.190 0.50 129.24 ? 247 ARG B NH2   1 
ATOM   3691 N NH2   B ARG B 1 225 ? 8.771   -25.289 -56.415 0.50 129.94 ? 247 ARG B NH2   1 
ATOM   3692 N N     . SER B 1 226 ? 7.905   -27.223 -48.906 1.00 126.70 ? 248 SER B N     1 
ATOM   3693 C CA    . SER B 1 226 ? 7.591   -26.571 -47.624 1.00 126.54 ? 248 SER B CA    1 
ATOM   3694 C C     . SER B 1 226 ? 8.154   -27.333 -46.413 1.00 126.43 ? 248 SER B C     1 
ATOM   3695 O O     . SER B 1 226 ? 8.846   -26.742 -45.585 1.00 126.39 ? 248 SER B O     1 
ATOM   3696 C CB    . SER B 1 226 ? 6.077   -26.371 -47.474 1.00 126.44 ? 248 SER B CB    1 
ATOM   3697 O OG    . SER B 1 226 ? 5.575   -25.530 -48.503 1.00 126.58 ? 248 SER B OG    1 
ATOM   3698 N N     . LEU B 1 227 ? 7.875   -28.640 -46.339 1.00 126.31 ? 249 LEU B N     1 
ATOM   3699 C CA    . LEU B 1 227 ? 8.375   -29.520 -45.265 1.00 126.26 ? 249 LEU B CA    1 
ATOM   3700 C C     . LEU B 1 227 ? 9.889   -29.637 -45.185 1.00 126.51 ? 249 LEU B C     1 
ATOM   3701 O O     . LEU B 1 227 ? 10.450  -29.814 -44.090 1.00 126.65 ? 249 LEU B O     1 
ATOM   3702 C CB    . LEU B 1 227 ? 7.782   -30.925 -45.383 1.00 126.03 ? 249 LEU B CB    1 
ATOM   3703 C CG    . LEU B 1 227 ? 6.501   -31.205 -44.598 1.00 125.92 ? 249 LEU B CG    1 
ATOM   3704 C CD1   . LEU B 1 227 ? 6.683   -31.016 -43.094 1.00 125.83 ? 249 LEU B CD1   1 
ATOM   3705 C CD2   . LEU B 1 227 ? 5.296   -30.419 -45.113 1.00 125.96 ? 249 LEU B CD2   1 
ATOM   3706 N N     . LYS B 1 228 ? 10.554  -29.564 -46.338 1.00 126.76 ? 250 LYS B N     1 
ATOM   3707 C CA    . LYS B 1 228 ? 11.995  -29.476 -46.331 1.00 127.18 ? 250 LYS B CA    1 
ATOM   3708 C C     . LYS B 1 228 ? 12.420  -28.181 -45.643 1.00 126.98 ? 250 LYS B C     1 
ATOM   3709 O O     . LYS B 1 228 ? 13.232  -28.225 -44.721 1.00 127.17 ? 250 LYS B O     1 
ATOM   3710 C CB    . LYS B 1 228 ? 12.561  -29.554 -47.745 1.00 127.56 ? 250 LYS B CB    1 
ATOM   3711 C CG    . LYS B 1 228 ? 12.820  -30.973 -48.235 1.00 129.33 ? 250 LYS B CG    1 
ATOM   3712 C CD    . LYS B 1 228 ? 13.324  -30.976 -49.694 1.00 132.27 ? 250 LYS B CD    1 
ATOM   3713 C CE    . LYS B 1 228 ? 13.428  -32.395 -50.296 1.00 133.54 ? 250 LYS B CE    1 
ATOM   3714 N NZ    . LYS B 1 228 ? 14.516  -33.230 -49.549 1.00 134.94 ? 250 LYS B NZ    1 
ATOM   3715 N N     . LEU B 1 229 ? 11.843  -27.047 -46.065 1.00 126.69 ? 251 LEU B N     1 
ATOM   3716 C CA    . LEU B 1 229 ? 12.209  -25.721 -45.532 1.00 126.53 ? 251 LEU B CA    1 
ATOM   3717 C C     . LEU B 1 229 ? 11.858  -25.520 -44.069 1.00 126.28 ? 251 LEU B C     1 
ATOM   3718 O O     . LEU B 1 229 ? 12.467  -24.661 -43.382 1.00 126.38 ? 251 LEU B O     1 
ATOM   3719 C CB    . LEU B 1 229 ? 11.554  -24.599 -46.330 1.00 126.60 ? 251 LEU B CB    1 
ATOM   3720 C CG    . LEU B 1 229 ? 11.969  -24.399 -47.784 1.00 127.36 ? 251 LEU B CG    1 
ATOM   3721 C CD1   . LEU B 1 229 ? 11.047  -23.363 -48.404 1.00 128.37 ? 251 LEU B CD1   1 
ATOM   3722 C CD2   . LEU B 1 229 ? 13.432  -23.966 -47.902 1.00 128.23 ? 251 LEU B CD2   1 
ATOM   3723 N N     . ILE B 1 230 ? 10.862  -26.304 -43.608 1.00 125.97 ? 252 ILE B N     1 
ATOM   3724 C CA    . ILE B 1 230 ? 10.383  -26.228 -42.231 1.00 125.55 ? 252 ILE B CA    1 
ATOM   3725 C C     . ILE B 1 230 ? 11.248  -27.050 -41.251 1.00 125.65 ? 252 ILE B C     1 
ATOM   3726 O O     . ILE B 1 230 ? 11.743  -26.493 -40.264 1.00 125.64 ? 252 ILE B O     1 
ATOM   3727 C CB    . ILE B 1 230 ? 8.871   -26.571 -42.163 1.00 125.37 ? 252 ILE B CB    1 
ATOM   3728 C CG1   . ILE B 1 230 ? 8.055   -25.418 -42.784 1.00 124.86 ? 252 ILE B CG1   1 
ATOM   3729 C CG2   . ILE B 1 230 ? 8.431   -26.807 -40.734 1.00 125.32 ? 252 ILE B CG2   1 
ATOM   3730 C CD1   . ILE B 1 230 ? 6.713   -25.838 -43.371 1.00 124.06 ? 252 ILE B CD1   1 
ATOM   3731 N N     . LEU B 1 231 ? 11.445  -28.346 -41.528 1.00 125.82 ? 253 LEU B N     1 
ATOM   3732 C CA    . LEU B 1 231 ? 12.363  -29.207 -40.737 1.00 126.14 ? 253 LEU B CA    1 
ATOM   3733 C C     . LEU B 1 231 ? 13.743  -28.580 -40.597 1.00 126.41 ? 253 LEU B C     1 
ATOM   3734 O O     . LEU B 1 231 ? 14.372  -28.653 -39.543 1.00 126.21 ? 253 LEU B O     1 
ATOM   3735 C CB    . LEU B 1 231 ? 12.531  -30.590 -41.387 1.00 126.06 ? 253 LEU B CB    1 
ATOM   3736 C CG    . LEU B 1 231 ? 11.364  -31.603 -41.222 1.00 126.04 ? 253 LEU B CG    1 
ATOM   3737 C CD1   . LEU B 1 231 ? 11.535  -32.820 -42.079 1.00 125.93 ? 253 LEU B CD1   1 
ATOM   3738 C CD2   . LEU B 1 231 ? 11.020  -32.052 -39.760 1.00 125.90 ? 253 LEU B CD2   1 
ATOM   3739 N N     . ASP B 1 232 ? 14.191  -27.991 -41.702 1.00 126.93 ? 254 ASP B N     1 
ATOM   3740 C CA    . ASP B 1 232 ? 15.384  -27.160 -41.779 1.00 127.51 ? 254 ASP B CA    1 
ATOM   3741 C C     . ASP B 1 232 ? 15.347  -26.069 -40.703 1.00 127.15 ? 254 ASP B C     1 
ATOM   3742 O O     . ASP B 1 232 ? 16.113  -26.121 -39.752 1.00 127.22 ? 254 ASP B O     1 
ATOM   3743 C CB    . ASP B 1 232 ? 15.473  -26.540 -43.190 1.00 128.13 ? 254 ASP B CB    1 
ATOM   3744 C CG    . ASP B 1 232 ? 16.904  -26.213 -43.613 1.00 130.22 ? 254 ASP B CG    1 
ATOM   3745 O OD1   . ASP B 1 232 ? 17.465  -25.212 -43.113 1.00 132.54 ? 254 ASP B OD1   1 
ATOM   3746 O OD2   . ASP B 1 232 ? 17.466  -26.944 -44.463 1.00 132.60 ? 254 ASP B OD2   1 
ATOM   3747 N N     . PHE B 1 233 ? 14.441  -25.102 -40.845 1.00 126.83 ? 255 PHE B N     1 
ATOM   3748 C CA    . PHE B 1 233 ? 14.273  -24.019 -39.867 1.00 126.44 ? 255 PHE B CA    1 
ATOM   3749 C C     . PHE B 1 233 ? 14.129  -24.539 -38.439 1.00 126.48 ? 255 PHE B C     1 
ATOM   3750 O O     . PHE B 1 233 ? 14.576  -23.895 -37.492 1.00 126.36 ? 255 PHE B O     1 
ATOM   3751 C CB    . PHE B 1 233 ? 13.070  -23.145 -40.240 1.00 126.22 ? 255 PHE B CB    1 
ATOM   3752 C CG    . PHE B 1 233 ? 12.584  -22.265 -39.126 1.00 125.11 ? 255 PHE B CG    1 
ATOM   3753 C CD1   . PHE B 1 233 ? 11.558  -22.695 -38.286 1.00 124.42 ? 255 PHE B CD1   1 
ATOM   3754 C CD2   . PHE B 1 233 ? 13.148  -21.009 -38.919 1.00 124.24 ? 255 PHE B CD2   1 
ATOM   3755 C CE1   . PHE B 1 233 ? 11.103  -21.889 -37.255 1.00 124.09 ? 255 PHE B CE1   1 
ATOM   3756 C CE2   . PHE B 1 233 ? 12.698  -20.199 -37.895 1.00 123.76 ? 255 PHE B CE2   1 
ATOM   3757 C CZ    . PHE B 1 233 ? 11.676  -20.636 -37.060 1.00 123.90 ? 255 PHE B CZ    1 
ATOM   3758 N N     . LEU B 1 234 ? 13.504  -25.702 -38.296 1.00 126.56 ? 256 LEU B N     1 
ATOM   3759 C CA    . LEU B 1 234 ? 13.383  -26.339 -36.995 1.00 126.91 ? 256 LEU B CA    1 
ATOM   3760 C C     . LEU B 1 234 ? 14.653  -27.049 -36.599 1.00 127.22 ? 256 LEU B C     1 
ATOM   3761 O O     . LEU B 1 234 ? 14.887  -27.281 -35.418 1.00 127.28 ? 256 LEU B O     1 
ATOM   3762 C CB    . LEU B 1 234 ? 12.236  -27.345 -36.969 1.00 126.85 ? 256 LEU B CB    1 
ATOM   3763 C CG    . LEU B 1 234 ? 10.783  -26.796 -36.899 1.00 126.77 ? 256 LEU B CG    1 
ATOM   3764 C CD1   . LEU B 1 234 ? 9.780   -27.953 -36.775 1.00 126.57 ? 256 LEU B CD1   1 
ATOM   3765 C CD2   . LEU B 1 234 ? 10.608  -25.744 -35.778 1.00 126.30 ? 256 LEU B CD2   1 
ATOM   3766 N N     . GLY B 1 235 ? 15.464  -27.404 -37.587 1.00 127.66 ? 257 GLY B N     1 
ATOM   3767 C CA    . GLY B 1 235 ? 16.686  -28.160 -37.339 1.00 128.18 ? 257 GLY B CA    1 
ATOM   3768 C C     . GLY B 1 235 ? 16.351  -29.599 -37.015 1.00 128.55 ? 257 GLY B C     1 
ATOM   3769 O O     . GLY B 1 235 ? 17.057  -30.245 -36.245 1.00 128.61 ? 257 GLY B O     1 
ATOM   3770 N N     . ILE B 1 236 ? 15.259  -30.095 -37.599 1.00 128.93 ? 258 ILE B N     1 
ATOM   3771 C CA    . ILE B 1 236 ? 14.859  -31.480 -37.422 1.00 129.30 ? 258 ILE B CA    1 
ATOM   3772 C C     . ILE B 1 236 ? 15.206  -32.266 -38.670 1.00 129.58 ? 258 ILE B C     1 
ATOM   3773 O O     . ILE B 1 236 ? 14.976  -31.801 -39.797 1.00 129.64 ? 258 ILE B O     1 
ATOM   3774 C CB    . ILE B 1 236 ? 13.353  -31.599 -37.139 1.00 129.31 ? 258 ILE B CB    1 
ATOM   3775 C CG1   . ILE B 1 236 ? 12.960  -30.723 -35.912 1.00 129.34 ? 258 ILE B CG1   1 
ATOM   3776 C CG2   . ILE B 1 236 ? 12.991  -33.076 -36.889 1.00 129.39 ? 258 ILE B CG2   1 
ATOM   3777 C CD1   . ILE B 1 236 ? 11.494  -30.393 -35.859 1.00 129.44 ? 258 ILE B CD1   1 
ATOM   3778 N N     . ALA B 1 237 ? 15.766  -33.455 -38.450 1.00 129.86 ? 259 ALA B N     1 
ATOM   3779 C CA    . ALA B 1 237 ? 16.128  -34.375 -39.522 1.00 130.18 ? 259 ALA B CA    1 
ATOM   3780 C C     . ALA B 1 237 ? 14.909  -34.724 -40.360 1.00 130.38 ? 259 ALA B C     1 
ATOM   3781 O O     . ALA B 1 237 ? 13.821  -34.941 -39.821 1.00 130.50 ? 259 ALA B O     1 
ATOM   3782 C CB    . ALA B 1 237 ? 16.745  -35.637 -38.946 1.00 130.17 ? 259 ALA B CB    1 
ATOM   3783 N N     . TRP B 1 238 ? 15.088  -34.760 -41.678 1.00 130.51 ? 260 TRP B N     1 
ATOM   3784 C CA    . TRP B 1 238 ? 14.003  -35.148 -42.569 1.00 130.52 ? 260 TRP B CA    1 
ATOM   3785 C C     . TRP B 1 238 ? 13.672  -36.644 -42.402 1.00 130.31 ? 260 TRP B C     1 
ATOM   3786 O O     . TRP B 1 238 ? 14.577  -37.526 -42.321 1.00 130.33 ? 260 TRP B O     1 
ATOM   3787 C CB    . TRP B 1 238 ? 14.338  -34.827 -44.046 1.00 130.69 ? 260 TRP B CB    1 
ATOM   3788 C CG    . TRP B 1 238 ? 13.239  -35.234 -45.037 1.00 131.24 ? 260 TRP B CG    1 
ATOM   3789 C CD1   . TRP B 1 238 ? 13.047  -36.481 -45.584 1.00 131.69 ? 260 TRP B CD1   1 
ATOM   3790 C CD2   . TRP B 1 238 ? 12.192  -34.389 -45.583 1.00 131.41 ? 260 TRP B CD2   1 
ATOM   3791 N NE1   . TRP B 1 238 ? 11.953  -36.465 -46.428 1.00 131.59 ? 260 TRP B NE1   1 
ATOM   3792 C CE2   . TRP B 1 238 ? 11.411  -35.195 -46.448 1.00 131.51 ? 260 TRP B CE2   1 
ATOM   3793 C CE3   . TRP B 1 238 ? 11.839  -33.032 -45.424 1.00 131.34 ? 260 TRP B CE3   1 
ATOM   3794 C CZ2   . TRP B 1 238 ? 10.300  -34.690 -47.148 1.00 131.70 ? 260 TRP B CZ2   1 
ATOM   3795 C CZ3   . TRP B 1 238 ? 10.730  -32.534 -46.114 1.00 131.40 ? 260 TRP B CZ3   1 
ATOM   3796 C CH2   . TRP B 1 238 ? 9.977   -33.413 -46.970 1.00 131.68 ? 260 TRP B CH2   1 
ATOM   3797 N N     . SER B 1 239 ? 12.352  -36.900 -42.329 1.00 130.10 ? 261 SER B N     1 
ATOM   3798 C CA    . SER B 1 239 ? 11.834  -38.254 -42.427 1.00 129.88 ? 261 SER B CA    1 
ATOM   3799 C C     . SER B 1 239 ? 10.736  -38.263 -43.479 1.00 129.80 ? 261 SER B C     1 
ATOM   3800 O O     . SER B 1 239 ? 9.991   -37.280 -43.635 1.00 129.79 ? 261 SER B O     1 
ATOM   3801 C CB    . SER B 1 239 ? 11.273  -38.731 -41.088 1.00 129.80 ? 261 SER B CB    1 
ATOM   3802 O OG    . SER B 1 239 ? 10.459  -39.874 -41.283 1.00 129.77 ? 261 SER B OG    1 
ATOM   3803 N N     . ASP B 1 240 ? 10.630  -39.378 -44.192 1.00 129.62 ? 262 ASP B N     1 
ATOM   3804 C CA    . ASP B 1 240 ? 9.667   -39.476 -45.267 1.00 129.46 ? 262 ASP B CA    1 
ATOM   3805 C C     . ASP B 1 240 ? 8.221   -39.588 -44.781 1.00 128.94 ? 262 ASP B C     1 
ATOM   3806 O O     . ASP B 1 240 ? 7.292   -39.221 -45.510 1.00 128.97 ? 262 ASP B O     1 
ATOM   3807 C CB    . ASP B 1 240 ? 10.009  -40.616 -46.214 1.00 129.75 ? 262 ASP B CB    1 
ATOM   3808 C CG    . ASP B 1 240 ? 9.212   -40.507 -47.523 1.00 130.93 ? 262 ASP B CG    1 
ATOM   3809 O OD1   . ASP B 1 240 ? 9.548   -39.689 -48.424 1.00 132.18 ? 262 ASP B OD1   1 
ATOM   3810 O OD2   . ASP B 1 240 ? 8.152   -41.219 -47.635 1.00 132.68 ? 262 ASP B OD2   1 
ATOM   3811 N N     . ALA B 1 241 ? 8.034   -40.073 -43.553 1.00 128.32 ? 263 ALA B N     1 
ATOM   3812 C CA    . ALA B 1 241 ? 6.692   -40.212 -42.969 1.00 127.99 ? 263 ALA B CA    1 
ATOM   3813 C C     . ALA B 1 241 ? 5.844   -38.934 -43.049 1.00 127.78 ? 263 ALA B C     1 
ATOM   3814 O O     . ALA B 1 241 ? 4.617   -39.012 -43.107 1.00 127.67 ? 263 ALA B O     1 
ATOM   3815 C CB    . ALA B 1 241 ? 6.781   -40.696 -41.541 1.00 127.89 ? 263 ALA B CB    1 
ATOM   3816 N N     . VAL B 1 242 ? 6.516   -37.778 -43.058 1.00 127.63 ? 264 VAL B N     1 
ATOM   3817 C CA    . VAL B 1 242 ? 5.904   -36.439 -43.198 1.00 127.60 ? 264 VAL B CA    1 
ATOM   3818 C C     . VAL B 1 242 ? 4.844   -36.272 -44.314 1.00 127.79 ? 264 VAL B C     1 
ATOM   3819 O O     . VAL B 1 242 ? 3.770   -35.688 -44.089 1.00 127.83 ? 264 VAL B O     1 
ATOM   3820 C CB    . VAL B 1 242 ? 7.023   -35.338 -43.294 1.00 127.46 ? 264 VAL B CB    1 
ATOM   3821 C CG1   . VAL B 1 242 ? 6.887   -34.465 -44.551 1.00 127.31 ? 264 VAL B CG1   1 
ATOM   3822 C CG2   . VAL B 1 242 ? 7.013   -34.479 -42.036 1.00 127.54 ? 264 VAL B CG2   1 
ATOM   3823 N N     . LEU B 1 243 ? 5.144   -36.788 -45.505 1.00 127.89 ? 265 LEU B N     1 
ATOM   3824 C CA    . LEU B 1 243 ? 4.266   -36.615 -46.657 1.00 128.04 ? 265 LEU B CA    1 
ATOM   3825 C C     . LEU B 1 243 ? 3.158   -37.669 -46.681 1.00 128.26 ? 265 LEU B C     1 
ATOM   3826 O O     . LEU B 1 243 ? 2.170   -37.537 -47.438 1.00 128.49 ? 265 LEU B O     1 
ATOM   3827 C CB    . LEU B 1 243 ? 5.083   -36.614 -47.958 1.00 127.94 ? 265 LEU B CB    1 
ATOM   3828 C CG    . LEU B 1 243 ? 6.132   -35.484 -48.076 1.00 128.06 ? 265 LEU B CG    1 
ATOM   3829 C CD1   . LEU B 1 243 ? 7.219   -35.788 -49.104 1.00 128.24 ? 265 LEU B CD1   1 
ATOM   3830 C CD2   . LEU B 1 243 ? 5.477   -34.138 -48.383 1.00 128.25 ? 265 LEU B CD2   1 
ATOM   3831 N N     . HIS B 1 244 ? 3.320   -38.698 -45.830 1.00 128.37 ? 266 HIS B N     1 
ATOM   3832 C CA    . HIS B 1 244 ? 2.377   -39.821 -45.761 1.00 128.60 ? 266 HIS B CA    1 
ATOM   3833 C C     . HIS B 1 244 ? 1.573   -39.834 -44.452 1.00 128.78 ? 266 HIS B C     1 
ATOM   3834 O O     . HIS B 1 244 ? 1.369   -40.897 -43.841 1.00 128.94 ? 266 HIS B O     1 
ATOM   3835 C CB    . HIS B 1 244 ? 3.123   -41.147 -45.987 1.00 128.50 ? 266 HIS B CB    1 
ATOM   3836 C CG    . HIS B 1 244 ? 3.647   -41.303 -47.386 1.00 128.69 ? 266 HIS B CG    1 
ATOM   3837 N ND1   . HIS B 1 244 ? 2.922   -41.931 -48.392 1.00 128.86 ? 266 HIS B ND1   1 
ATOM   3838 C CD2   . HIS B 1 244 ? 4.808   -40.879 -47.959 1.00 128.72 ? 266 HIS B CD2   1 
ATOM   3839 C CE1   . HIS B 1 244 ? 3.621   -41.901 -49.518 1.00 128.74 ? 266 HIS B CE1   1 
ATOM   3840 N NE2   . HIS B 1 244 ? 4.769   -41.267 -49.282 1.00 128.73 ? 266 HIS B NE2   1 
ATOM   3841 N N     . HIS B 1 245 ? 1.101   -38.646 -44.050 1.00 128.87 ? 267 HIS B N     1 
ATOM   3842 C CA    . HIS B 1 245 ? 0.453   -38.442 -42.748 1.00 128.84 ? 267 HIS B CA    1 
ATOM   3843 C C     . HIS B 1 245 ? -0.866  -39.201 -42.609 1.00 129.03 ? 267 HIS B C     1 
ATOM   3844 O O     . HIS B 1 245 ? -1.207  -39.686 -41.521 1.00 128.94 ? 267 HIS B O     1 
ATOM   3845 C CB    . HIS B 1 245 ? 0.247   -36.949 -42.475 1.00 128.71 ? 267 HIS B CB    1 
ATOM   3846 C CG    . HIS B 1 245 ? -0.692  -36.288 -43.433 1.00 128.00 ? 267 HIS B CG    1 
ATOM   3847 N ND1   . HIS B 1 245 ? -2.032  -36.101 -43.148 1.00 127.51 ? 267 HIS B ND1   1 
ATOM   3848 C CD2   . HIS B 1 245 ? -0.495  -35.794 -44.680 1.00 127.33 ? 267 HIS B CD2   1 
ATOM   3849 C CE1   . HIS B 1 245 ? -2.618  -35.507 -44.173 1.00 127.37 ? 267 HIS B CE1   1 
ATOM   3850 N NE2   . HIS B 1 245 ? -1.707  -35.311 -45.116 1.00 127.48 ? 267 HIS B NE2   1 
ATOM   3851 N N     . GLU B 1 246 ? -1.593  -39.301 -43.722 1.00 129.35 ? 268 GLU B N     1 
ATOM   3852 C CA    . GLU B 1 246 ? -2.876  -40.002 -43.772 1.00 129.89 ? 268 GLU B CA    1 
ATOM   3853 C C     . GLU B 1 246 ? -2.783  -41.465 -43.306 1.00 130.32 ? 268 GLU B C     1 
ATOM   3854 O O     . GLU B 1 246 ? -3.748  -42.014 -42.763 1.00 130.39 ? 268 GLU B O     1 
ATOM   3855 C CB    . GLU B 1 246 ? -3.495  -39.902 -45.180 1.00 129.77 ? 268 GLU B CB    1 
ATOM   3856 C CG    . GLU B 1 246 ? -2.729  -40.618 -46.304 1.00 129.85 ? 268 GLU B CG    1 
ATOM   3857 C CD    . GLU B 1 246 ? -1.466  -39.881 -46.772 1.00 130.25 ? 268 GLU B CD    1 
ATOM   3858 O OE1   . GLU B 1 246 ? -0.930  -40.270 -47.837 1.00 130.76 ? 268 GLU B OE1   1 
ATOM   3859 O OE2   . GLU B 1 246 ? -1.009  -38.919 -46.102 1.00 129.79 ? 268 GLU B OE2   1 
ATOM   3860 N N     . ASP B 1 247 ? -1.616  -42.078 -43.496 1.00 130.90 ? 269 ASP B N     1 
ATOM   3861 C CA    . ASP B 1 247 ? -1.422  -43.489 -43.169 1.00 131.54 ? 269 ASP B CA    1 
ATOM   3862 C C     . ASP B 1 247 ? -1.105  -43.745 -41.696 1.00 132.01 ? 269 ASP B C     1 
ATOM   3863 O O     . ASP B 1 247 ? -1.038  -44.901 -41.272 1.00 132.17 ? 269 ASP B O     1 
ATOM   3864 C CB    . ASP B 1 247 ? -0.329  -44.087 -44.062 1.00 131.46 ? 269 ASP B CB    1 
ATOM   3865 C CG    . ASP B 1 247 ? -0.670  -43.967 -45.544 1.00 131.74 ? 269 ASP B CG    1 
ATOM   3866 O OD1   . ASP B 1 247 ? -1.853  -44.185 -45.903 1.00 131.51 ? 269 ASP B OD1   1 
ATOM   3867 O OD2   . ASP B 1 247 ? 0.247   -43.653 -46.352 1.00 132.37 ? 269 ASP B OD2   1 
ATOM   3868 N N     . LEU B 1 248 ? -0.937  -42.671 -40.920 1.00 132.64 ? 270 LEU B N     1 
ATOM   3869 C CA    . LEU B 1 248 ? -0.446  -42.769 -39.532 1.00 133.27 ? 270 LEU B CA    1 
ATOM   3870 C C     . LEU B 1 248 ? -1.398  -42.248 -38.422 1.00 133.71 ? 270 LEU B C     1 
ATOM   3871 O O     . LEU B 1 248 ? -0.972  -42.080 -37.265 1.00 133.63 ? 270 LEU B O     1 
ATOM   3872 C CB    . LEU B 1 248 ? 0.929   -42.087 -39.412 1.00 133.19 ? 270 LEU B CB    1 
ATOM   3873 C CG    . LEU B 1 248 ? 2.104   -42.730 -40.155 1.00 133.30 ? 270 LEU B CG    1 
ATOM   3874 C CD1   . LEU B 1 248 ? 3.321   -41.801 -40.154 1.00 133.71 ? 270 LEU B CD1   1 
ATOM   3875 C CD2   . LEU B 1 248 ? 2.456   -44.089 -39.551 1.00 133.35 ? 270 LEU B CD2   1 
ATOM   3876 N N     . ILE B 1 249 ? -2.675  -42.003 -38.771 1.00 134.32 ? 271 ILE B N     1 
ATOM   3877 C CA    . ILE B 1 249 ? -3.680  -41.540 -37.793 1.00 134.90 ? 271 ILE B CA    1 
ATOM   3878 C C     . ILE B 1 249 ? -4.050  -42.673 -36.830 1.00 135.30 ? 271 ILE B C     1 
ATOM   3879 O O     . ILE B 1 249 ? -4.343  -43.800 -37.254 1.00 135.34 ? 271 ILE B O     1 
ATOM   3880 C CB    . ILE B 1 249 ? -4.959  -40.946 -38.484 1.00 134.95 ? 271 ILE B CB    1 
ATOM   3881 C CG1   . ILE B 1 249 ? -4.680  -39.521 -39.035 1.00 135.04 ? 271 ILE B CG1   1 
ATOM   3882 C CG2   . ILE B 1 249 ? -6.143  -40.894 -37.490 1.00 134.83 ? 271 ILE B CG2   1 
ATOM   3883 C CD1   . ILE B 1 249 ? -5.529  -39.202 -40.257 1.00 135.32 ? 271 ILE B CD1   1 
ATOM   3884 N N     . GLY B 1 250 ? -4.013  -42.359 -35.534 1.00 135.78 ? 272 GLY B N     1 
ATOM   3885 C CA    . GLY B 1 250 ? -4.266  -43.337 -34.474 1.00 136.29 ? 272 GLY B CA    1 
ATOM   3886 C C     . GLY B 1 250 ? -3.129  -44.330 -34.270 1.00 136.64 ? 272 GLY B C     1 
ATOM   3887 O O     . GLY B 1 250 ? -3.194  -45.170 -33.366 1.00 136.73 ? 272 GLY B O     1 
ATOM   3888 N N     . LYS B 1 251 ? -2.093  -44.234 -35.109 1.00 136.92 ? 273 LYS B N     1 
ATOM   3889 C CA    . LYS B 1 251 ? -0.926  -45.125 -35.043 1.00 137.15 ? 273 LYS B CA    1 
ATOM   3890 C C     . LYS B 1 251 ? 0.162   -44.530 -34.138 1.00 136.94 ? 273 LYS B C     1 
ATOM   3891 O O     . LYS B 1 251 ? 0.401   -43.302 -34.190 1.00 136.97 ? 273 LYS B O     1 
ATOM   3892 C CB    . LYS B 1 251 ? -0.354  -45.400 -36.447 1.00 137.34 ? 273 LYS B CB    1 
ATOM   3893 C CG    . LYS B 1 251 ? -1.393  -45.837 -37.512 1.00 138.22 ? 273 LYS B CG    1 
ATOM   3894 C CD    . LYS B 1 251 ? -0.722  -46.516 -38.706 1.00 139.49 ? 273 LYS B CD    1 
ATOM   3895 C CE    . LYS B 1 251 ? -1.247  -47.921 -38.927 1.00 140.16 ? 273 LYS B CE    1 
ATOM   3896 N NZ    . LYS B 1 251 ? -2.639  -47.867 -39.455 1.00 140.64 ? 273 LYS B NZ    1 
ATOM   3897 N N     . PRO B 1 252 ? 0.805   -45.395 -33.296 1.00 136.74 ? 274 PRO B N     1 
ATOM   3898 C CA    . PRO B 1 252 ? 1.894   -45.024 -32.360 1.00 136.36 ? 274 PRO B CA    1 
ATOM   3899 C C     . PRO B 1 252 ? 3.087   -44.249 -32.969 1.00 135.79 ? 274 PRO B C     1 
ATOM   3900 O O     . PRO B 1 252 ? 3.604   -44.634 -34.025 1.00 135.76 ? 274 PRO B O     1 
ATOM   3901 C CB    . PRO B 1 252 ? 2.351   -46.383 -31.809 1.00 136.43 ? 274 PRO B CB    1 
ATOM   3902 C CG    . PRO B 1 252 ? 1.106   -47.212 -31.814 1.00 136.61 ? 274 PRO B CG    1 
ATOM   3903 C CD    . PRO B 1 252 ? 0.362   -46.807 -33.068 1.00 136.77 ? 274 PRO B CD    1 
ATOM   3904 N N     . GLY B 1 253 ? 3.505   -43.171 -32.292 1.00 135.05 ? 275 GLY B N     1 
ATOM   3905 C CA    . GLY B 1 253 ? 4.601   -42.290 -32.751 1.00 133.97 ? 275 GLY B CA    1 
ATOM   3906 C C     . GLY B 1 253 ? 4.164   -41.244 -33.771 1.00 133.23 ? 275 GLY B C     1 
ATOM   3907 O O     . GLY B 1 253 ? 4.963   -40.383 -34.178 1.00 132.96 ? 275 GLY B O     1 
ATOM   3908 N N     . GLY B 1 254 ? 2.879   -41.326 -34.164 1.00 132.63 ? 276 GLY B N     1 
ATOM   3909 C CA    . GLY B 1 254 ? 2.297   -40.505 -35.227 1.00 131.75 ? 276 GLY B CA    1 
ATOM   3910 C C     . GLY B 1 254 ? 1.113   -39.629 -34.776 1.00 131.11 ? 276 GLY B C     1 
ATOM   3911 O O     . GLY B 1 254 ? 1.154   -38.990 -33.692 1.00 130.95 ? 276 GLY B O     1 
ATOM   3912 N N     . VAL B 1 255 ? 0.056   -39.624 -35.609 1.00 130.48 ? 277 VAL B N     1 
ATOM   3913 C CA    . VAL B 1 255 ? -1.019  -38.598 -35.544 1.00 129.80 ? 277 VAL B CA    1 
ATOM   3914 C C     . VAL B 1 255 ? -2.233  -38.970 -34.682 1.00 129.45 ? 277 VAL B C     1 
ATOM   3915 O O     . VAL B 1 255 ? -3.054  -39.815 -35.057 1.00 129.30 ? 277 VAL B O     1 
ATOM   3916 C CB    . VAL B 1 255 ? -1.519  -38.159 -36.969 1.00 129.75 ? 277 VAL B CB    1 
ATOM   3917 C CG1   . VAL B 1 255 ? -2.283  -36.826 -36.889 1.00 129.57 ? 277 VAL B CG1   1 
ATOM   3918 C CG2   . VAL B 1 255 ? -0.350  -38.041 -37.947 1.00 129.32 ? 277 VAL B CG2   1 
ATOM   3919 N N     . SER B 1 256 ? -2.340  -38.301 -33.535 1.00 129.13 ? 278 SER B N     1 
ATOM   3920 C CA    . SER B 1 256 ? -3.471  -38.469 -32.633 1.00 128.93 ? 278 SER B CA    1 
ATOM   3921 C C     . SER B 1 256 ? -4.499  -37.359 -32.876 1.00 128.83 ? 278 SER B C     1 
ATOM   3922 O O     . SER B 1 256 ? -4.151  -36.168 -32.898 1.00 128.76 ? 278 SER B O     1 
ATOM   3923 C CB    . SER B 1 256 ? -2.992  -38.458 -31.175 1.00 128.90 ? 278 SER B CB    1 
ATOM   3924 O OG    . SER B 1 256 ? -4.043  -38.796 -30.281 1.00 128.74 ? 278 SER B OG    1 
ATOM   3925 N N     . LEU B 1 257 ? -5.761  -37.756 -33.060 1.00 128.77 ? 279 LEU B N     1 
ATOM   3926 C CA    . LEU B 1 257 ? -6.833  -36.805 -33.382 1.00 128.73 ? 279 LEU B CA    1 
ATOM   3927 C C     . LEU B 1 257 ? -8.007  -36.856 -32.385 1.00 128.73 ? 279 LEU B C     1 
ATOM   3928 O O     . LEU B 1 257 ? -8.269  -37.903 -31.759 1.00 128.78 ? 279 LEU B O     1 
ATOM   3929 C CB    . LEU B 1 257 ? -7.333  -37.002 -34.836 1.00 128.62 ? 279 LEU B CB    1 
ATOM   3930 C CG    . LEU B 1 257 ? -6.317  -37.213 -36.025 1.00 128.54 ? 279 LEU B CG    1 
ATOM   3931 C CD1   . LEU B 1 257 ? -7.115  -37.506 -37.304 1.00 128.44 ? 279 LEU B CD1   1 
ATOM   3932 C CD2   . LEU B 1 257 ? -5.315  -36.017 -36.264 1.00 127.87 ? 279 LEU B CD2   1 
ATOM   3933 N N     . SER B 1 258 ? -8.689  -35.710 -32.232 1.00 128.77 ? 280 SER B N     1 
ATOM   3934 C CA    . SER B 1 258 ? -9.980  -35.642 -31.532 1.00 128.79 ? 280 SER B CA    1 
ATOM   3935 C C     . SER B 1 258 ? -11.108 -35.857 -32.560 1.00 128.80 ? 280 SER B C     1 
ATOM   3936 O O     . SER B 1 258 ? -11.053 -35.308 -33.682 1.00 128.64 ? 280 SER B O     1 
ATOM   3937 C CB    . SER B 1 258 ? -10.129 -34.290 -30.801 1.00 128.79 ? 280 SER B CB    1 
ATOM   3938 O OG    . SER B 1 258 ? -11.384 -34.177 -30.087 1.00 128.57 ? 280 SER B OG    1 
ATOM   3939 N N     . LYS B 1 259 ? -12.112 -36.663 -32.189 1.00 128.82 ? 281 LYS B N     1 
ATOM   3940 C CA    . LYS B 1 259 ? -13.228 -36.961 -33.102 1.00 128.99 ? 281 LYS B CA    1 
ATOM   3941 C C     . LYS B 1 259 ? -14.300 -35.847 -33.142 1.00 128.57 ? 281 LYS B C     1 
ATOM   3942 O O     . LYS B 1 259 ? -15.271 -35.937 -33.918 1.00 128.65 ? 281 LYS B O     1 
ATOM   3943 C CB    . LYS B 1 259 ? -13.850 -38.346 -32.817 1.00 129.27 ? 281 LYS B CB    1 
ATOM   3944 C CG    . LYS B 1 259 ? -14.999 -38.357 -31.812 1.00 130.76 ? 281 LYS B CG    1 
ATOM   3945 C CD    . LYS B 1 259 ? -16.059 -39.378 -32.221 1.00 133.72 ? 281 LYS B CD    1 
ATOM   3946 C CE    . LYS B 1 259 ? -17.382 -39.232 -31.373 1.00 135.89 ? 281 LYS B CE    1 
ATOM   3947 N NZ    . LYS B 1 259 ? -17.131 -39.754 -29.920 1.00 137.53 ? 281 LYS B NZ    1 
ATOM   3948 N N     . ILE B 1 260 ? -14.108 -34.806 -32.318 1.00 127.97 ? 282 ILE B N     1 
ATOM   3949 C CA    . ILE B 1 260 ? -15.031 -33.651 -32.263 1.00 127.29 ? 282 ILE B CA    1 
ATOM   3950 C C     . ILE B 1 260 ? -14.415 -32.267 -32.632 1.00 126.96 ? 282 ILE B C     1 
ATOM   3951 O O     . ILE B 1 260 ? -15.124 -31.246 -32.615 1.00 126.91 ? 282 ILE B O     1 
ATOM   3952 C CB    . ILE B 1 260 ? -15.845 -33.610 -30.930 1.00 127.23 ? 282 ILE B CB    1 
ATOM   3953 C CG1   . ILE B 1 260 ? -14.915 -33.754 -29.697 1.00 127.09 ? 282 ILE B CG1   1 
ATOM   3954 C CG2   . ILE B 1 260 ? -16.964 -34.681 -30.969 1.00 127.03 ? 282 ILE B CG2   1 
ATOM   3955 C CD1   . ILE B 1 260 ? -15.614 -33.605 -28.337 1.00 126.79 ? 282 ILE B CD1   1 
ATOM   3956 N N     . GLU B 1 261 ? -13.117 -32.247 -32.982 1.00 126.51 ? 283 GLU B N     1 
ATOM   3957 C CA    . GLU B 1 261 ? -12.486 -31.090 -33.660 1.00 126.02 ? 283 GLU B CA    1 
ATOM   3958 C C     . GLU B 1 261 ? -13.064 -30.884 -35.080 1.00 125.88 ? 283 GLU B C     1 
ATOM   3959 O O     . GLU B 1 261 ? -13.436 -31.852 -35.762 1.00 125.69 ? 283 GLU B O     1 
ATOM   3960 C CB    . GLU B 1 261 ? -10.954 -31.230 -33.710 1.00 125.82 ? 283 GLU B CB    1 
ATOM   3961 C CG    . GLU B 1 261 ? -10.226 -30.707 -32.473 1.00 125.26 ? 283 GLU B CG    1 
ATOM   3962 C CD    . GLU B 1 261 ? -8.703  -30.813 -32.575 1.00 125.31 ? 283 GLU B CD    1 
ATOM   3963 O OE1   . GLU B 1 261 ? -8.134  -30.687 -33.695 1.00 125.22 ? 283 GLU B OE1   1 
ATOM   3964 O OE2   . GLU B 1 261 ? -8.067  -31.016 -31.514 1.00 125.45 ? 283 GLU B OE2   1 
ATOM   3965 N N     . ARG B 1 262 ? -13.129 -29.623 -35.513 1.00 125.79 ? 284 ARG B N     1 
ATOM   3966 C CA    . ARG B 1 262 ? -13.849 -29.242 -36.739 1.00 125.82 ? 284 ARG B CA    1 
ATOM   3967 C C     . ARG B 1 262 ? -13.070 -29.528 -38.022 1.00 125.64 ? 284 ARG B C     1 
ATOM   3968 O O     . ARG B 1 262 ? -13.664 -29.737 -39.083 1.00 125.49 ? 284 ARG B O     1 
ATOM   3969 C CB    . ARG B 1 262 ? -14.271 -27.765 -36.682 1.00 125.85 ? 284 ARG B CB    1 
ATOM   3970 C CG    . ARG B 1 262 ? -15.115 -27.401 -35.449 1.00 127.00 ? 284 ARG B CG    1 
ATOM   3971 C CD    . ARG B 1 262 ? -16.433 -28.189 -35.405 1.00 129.48 ? 284 ARG B CD    1 
ATOM   3972 N NE    . ARG B 1 262 ? -17.545 -27.503 -36.102 1.00 132.07 ? 284 ARG B NE    1 
ATOM   3973 C CZ    . ARG B 1 262 ? -17.911 -27.695 -37.391 1.00 133.39 ? 284 ARG B CZ    1 
ATOM   3974 N NH1   . ARG B 1 262 ? -17.260 -28.560 -38.191 1.00 134.08 ? 284 ARG B NH1   1 
ATOM   3975 N NH2   . ARG B 1 262 ? -18.946 -27.011 -37.884 1.00 133.97 ? 284 ARG B NH2   1 
ATOM   3976 N N     . VAL B 1 267 ? -8.366  -33.341 -43.011 1.00 124.69 ? 289 VAL B N     1 
ATOM   3977 C CA    . VAL B 1 267 ? -7.114  -33.828 -42.374 1.00 124.99 ? 289 VAL B CA    1 
ATOM   3978 C C     . VAL B 1 267 ? -6.909  -35.346 -42.541 1.00 125.13 ? 289 VAL B C     1 
ATOM   3979 O O     . VAL B 1 267 ? -5.774  -35.807 -42.772 1.00 124.95 ? 289 VAL B O     1 
ATOM   3980 C CB    . VAL B 1 267 ? -7.011  -33.384 -40.850 1.00 124.99 ? 289 VAL B CB    1 
ATOM   3981 C CG1   . VAL B 1 267 ? -5.862  -34.129 -40.120 1.00 124.93 ? 289 VAL B CG1   1 
ATOM   3982 C CG2   . VAL B 1 267 ? -6.797  -31.866 -40.740 1.00 125.06 ? 289 VAL B CG2   1 
ATOM   3983 N N     . ILE B 1 268 ? -8.009  -36.106 -42.435 1.00 125.41 ? 290 ILE B N     1 
ATOM   3984 C CA    . ILE B 1 268 ? -7.992  -37.575 -42.618 1.00 125.55 ? 290 ILE B CA    1 
ATOM   3985 C C     . ILE B 1 268 ? -7.438  -38.009 -43.988 1.00 125.62 ? 290 ILE B C     1 
ATOM   3986 O O     . ILE B 1 268 ? -6.820  -39.077 -44.104 1.00 125.73 ? 290 ILE B O     1 
ATOM   3987 C CB    . ILE B 1 268 ? -9.386  -38.250 -42.339 1.00 125.51 ? 290 ILE B CB    1 
ATOM   3988 C CG1   . ILE B 1 268 ? -10.520 -37.560 -43.128 1.00 125.40 ? 290 ILE B CG1   1 
ATOM   3989 C CG2   . ILE B 1 268 ? -9.658  -38.300 -40.831 1.00 125.28 ? 290 ILE B CG2   1 
ATOM   3990 C CD1   . ILE B 1 268 ? -11.805 -38.369 -43.224 1.00 125.68 ? 290 ILE B CD1   1 
ATOM   3991 N N     . LYS B 1 269 ? -7.652  -37.165 -45.003 1.00 125.57 ? 291 LYS B N     1 
ATOM   3992 C CA    . LYS B 1 269 ? -7.129  -37.379 -46.364 1.00 125.56 ? 291 LYS B CA    1 
ATOM   3993 C C     . LYS B 1 269 ? -5.703  -36.811 -46.524 1.00 125.10 ? 291 LYS B C     1 
ATOM   3994 O O     . LYS B 1 269 ? -5.320  -35.912 -45.762 1.00 125.05 ? 291 LYS B O     1 
ATOM   3995 C CB    . LYS B 1 269 ? -8.078  -36.727 -47.384 1.00 125.78 ? 291 LYS B CB    1 
ATOM   3996 C CG    . LYS B 1 269 ? -9.465  -37.382 -47.421 1.00 126.83 ? 291 LYS B CG    1 
ATOM   3997 C CD    . LYS B 1 269 ? -10.571 -36.392 -47.801 1.00 128.21 ? 291 LYS B CD    1 
ATOM   3998 C CE    . LYS B 1 269 ? -11.059 -35.601 -46.573 1.00 128.84 ? 291 LYS B CE    1 
ATOM   3999 N NZ    . LYS B 1 269 ? -11.974 -34.494 -47.004 1.00 129.78 ? 291 LYS B NZ    1 
ATOM   4000 N N     . PRO B 1 270 ? -4.911  -37.337 -47.504 1.00 124.72 ? 292 PRO B N     1 
ATOM   4001 C CA    . PRO B 1 270 ? -3.594  -36.744 -47.797 1.00 124.41 ? 292 PRO B CA    1 
ATOM   4002 C C     . PRO B 1 270 ? -3.712  -35.319 -48.346 1.00 124.18 ? 292 PRO B C     1 
ATOM   4003 O O     . PRO B 1 270 ? -4.830  -34.839 -48.604 1.00 124.15 ? 292 PRO B O     1 
ATOM   4004 C CB    . PRO B 1 270 ? -3.004  -37.682 -48.873 1.00 124.26 ? 292 PRO B CB    1 
ATOM   4005 C CG    . PRO B 1 270 ? -4.165  -38.364 -49.476 1.00 124.42 ? 292 PRO B CG    1 
ATOM   4006 C CD    . PRO B 1 270 ? -5.153  -38.531 -48.343 1.00 124.70 ? 292 PRO B CD    1 
ATOM   4007 N N     . VAL B 1 271 ? -2.562  -34.656 -48.505 1.00 123.90 ? 293 VAL B N     1 
ATOM   4008 C CA    . VAL B 1 271 ? -2.478  -33.306 -49.085 1.00 123.68 ? 293 VAL B CA    1 
ATOM   4009 C C     . VAL B 1 271 ? -3.306  -33.183 -50.400 1.00 123.62 ? 293 VAL B C     1 
ATOM   4010 O O     . VAL B 1 271 ? -2.835  -33.600 -51.468 1.00 123.52 ? 293 VAL B O     1 
ATOM   4011 C CB    . VAL B 1 271 ? -0.969  -32.899 -49.314 1.00 123.63 ? 293 VAL B CB    1 
ATOM   4012 C CG1   . VAL B 1 271 ? -0.838  -31.418 -49.666 1.00 123.37 ? 293 VAL B CG1   1 
ATOM   4013 C CG2   . VAL B 1 271 ? -0.100  -33.238 -48.084 1.00 123.34 ? 293 VAL B CG2   1 
ATOM   4014 N N     . ASN B 1 272 ? -4.536  -32.639 -50.310 1.00 123.58 ? 294 ASN B N     1 
ATOM   4015 C CA    . ASN B 1 272 ? -5.419  -32.415 -51.506 1.00 123.56 ? 294 ASN B CA    1 
ATOM   4016 C C     . ASN B 1 272 ? -5.698  -30.930 -51.894 1.00 123.72 ? 294 ASN B C     1 
ATOM   4017 O O     . ASN B 1 272 ? -5.706  -30.038 -51.028 1.00 123.89 ? 294 ASN B O     1 
ATOM   4018 C CB    . ASN B 1 272 ? -6.737  -33.252 -51.448 1.00 123.30 ? 294 ASN B CB    1 
ATOM   4019 C CG    . ASN B 1 272 ? -7.668  -32.853 -50.279 1.00 122.72 ? 294 ASN B CG    1 
ATOM   4020 O OD1   . ASN B 1 272 ? -7.464  -33.258 -49.126 1.00 121.69 ? 294 ASN B OD1   1 
ATOM   4021 N ND2   . ASN B 1 272 ? -8.711  -32.086 -50.590 1.00 121.51 ? 294 ASN B ND2   1 
ATOM   4022 N N     . LEU B 1 273 ? -5.927  -30.684 -53.194 1.00 123.76 ? 295 LEU B N     1 
ATOM   4023 C CA    . LEU B 1 273 ? -6.053  -29.316 -53.742 1.00 124.00 ? 295 LEU B CA    1 
ATOM   4024 C C     . LEU B 1 273 ? -7.422  -28.640 -53.536 1.00 124.24 ? 295 LEU B C     1 
ATOM   4025 O O     . LEU B 1 273 ? -7.606  -27.458 -53.909 1.00 124.26 ? 295 LEU B O     1 
ATOM   4026 C CB    . LEU B 1 273 ? -5.731  -29.318 -55.248 1.00 123.87 ? 295 LEU B CB    1 
ATOM   4027 C CG    . LEU B 1 273 ? -4.331  -29.716 -55.743 1.00 124.08 ? 295 LEU B CG    1 
ATOM   4028 C CD1   . LEU B 1 273 ? -4.367  -30.074 -57.225 1.00 124.02 ? 295 LEU B CD1   1 
ATOM   4029 C CD2   . LEU B 1 273 ? -3.303  -28.619 -55.487 1.00 124.35 ? 295 LEU B CD2   1 
ATOM   4030 N N     . GLU B 1 274 ? -8.368  -29.393 -52.937 1.00 124.50 ? 296 GLU B N     1 
ATOM   4031 C CA    . GLU B 1 274 ? -9.800  -29.064 -53.013 1.00 124.76 ? 296 GLU B CA    1 
ATOM   4032 C C     . GLU B 1 274 ? -10.239 -27.783 -52.286 1.00 124.39 ? 296 GLU B C     1 
ATOM   4033 O O     . GLU B 1 274 ? -11.170 -27.093 -52.735 1.00 124.22 ? 296 GLU B O     1 
ATOM   4034 C CB    . GLU B 1 274 ? -10.645 -30.272 -52.565 1.00 125.11 ? 296 GLU B CB    1 
ATOM   4035 C CG    . GLU B 1 274 ? -10.371 -31.569 -53.378 1.00 126.86 ? 296 GLU B CG    1 
ATOM   4036 C CD    . GLU B 1 274 ? -11.342 -32.719 -53.060 1.00 129.13 ? 296 GLU B CD    1 
ATOM   4037 O OE1   . GLU B 1 274 ? -12.584 -32.522 -53.174 1.00 130.16 ? 296 GLU B OE1   1 
ATOM   4038 O OE2   . GLU B 1 274 ? -10.858 -33.828 -52.716 1.00 129.92 ? 296 GLU B OE2   1 
ATOM   4039 N N     . ALA B 1 275 ? -9.562  -27.465 -51.184 1.00 124.09 ? 297 ALA B N     1 
ATOM   4040 C CA    . ALA B 1 275 ? -9.952  -26.330 -50.345 1.00 123.92 ? 297 ALA B CA    1 
ATOM   4041 C C     . ALA B 1 275 ? -9.390  -24.963 -50.786 1.00 123.89 ? 297 ALA B C     1 
ATOM   4042 O O     . ALA B 1 275 ? -9.784  -23.920 -50.220 1.00 123.91 ? 297 ALA B O     1 
ATOM   4043 C CB    . ALA B 1 275 ? -9.599  -26.610 -48.895 1.00 123.76 ? 297 ALA B CB    1 
ATOM   4044 N N     . LEU B 1 276 ? -8.506  -24.975 -51.805 1.00 123.81 ? 298 LEU B N     1 
ATOM   4045 C CA    . LEU B 1 276 ? -7.705  -23.791 -52.218 1.00 123.64 ? 298 LEU B CA    1 
ATOM   4046 C C     . LEU B 1 276 ? -8.476  -22.538 -52.672 1.00 123.50 ? 298 LEU B C     1 
ATOM   4047 O O     . LEU B 1 276 ? -8.328  -21.454 -52.085 1.00 123.31 ? 298 LEU B O     1 
ATOM   4048 C CB    . LEU B 1 276 ? -6.671  -24.169 -53.296 1.00 123.57 ? 298 LEU B CB    1 
ATOM   4049 C CG    . LEU B 1 276 ? -5.506  -25.110 -52.965 1.00 123.61 ? 298 LEU B CG    1 
ATOM   4050 C CD1   . LEU B 1 276 ? -4.564  -25.173 -54.167 1.00 123.59 ? 298 LEU B CD1   1 
ATOM   4051 C CD2   . LEU B 1 276 ? -4.747  -24.696 -51.701 1.00 123.83 ? 298 LEU B CD2   1 
ATOM   4052 N N     . SER B 1 277 ? -9.279  -22.691 -53.724 1.00 123.45 ? 299 SER B N     1 
ATOM   4053 C CA    . SER B 1 277 ? -9.976  -21.558 -54.340 1.00 123.46 ? 299 SER B CA    1 
ATOM   4054 C C     . SER B 1 277 ? -11.505 -21.656 -54.265 1.00 123.35 ? 299 SER B C     1 
ATOM   4055 O O     . SER B 1 277 ? -12.202 -20.903 -54.948 1.00 123.39 ? 299 SER B O     1 
ATOM   4056 C CB    . SER B 1 277 ? -9.541  -21.391 -55.811 1.00 123.39 ? 299 SER B CB    1 
ATOM   4057 O OG    . SER B 1 277 ? -8.151  -21.103 -55.914 1.00 123.50 ? 299 SER B OG    1 
ATOM   4058 N N     . LYS B 1 278 ? -12.029 -22.568 -53.443 1.00 123.13 ? 300 LYS B N     1 
ATOM   4059 C CA    . LYS B 1 278 ? -13.475 -22.841 -53.451 1.00 122.95 ? 300 LYS B CA    1 
ATOM   4060 C C     . LYS B 1 278 ? -14.281 -21.648 -52.927 1.00 122.86 ? 300 LYS B C     1 
ATOM   4061 O O     . LYS B 1 278 ? -15.483 -21.515 -53.210 1.00 122.80 ? 300 LYS B O     1 
ATOM   4062 C CB    . LYS B 1 278 ? -13.805 -24.128 -52.682 1.00 122.90 ? 300 LYS B CB    1 
ATOM   4063 C CG    . LYS B 1 278 ? -13.592 -24.051 -51.191 1.00 122.54 ? 300 LYS B CG    1 
ATOM   4064 C CD    . LYS B 1 278 ? -14.070 -25.327 -50.516 1.00 122.72 ? 300 LYS B CD    1 
ATOM   4065 C CE    . LYS B 1 278 ? -14.091 -25.168 -48.998 1.00 123.33 ? 300 LYS B CE    1 
ATOM   4066 N NZ    . LYS B 1 278 ? -14.069 -26.489 -48.313 1.00 123.47 ? 300 LYS B NZ    1 
ATOM   4067 N N     . TRP B 1 279 ? -13.582 -20.784 -52.186 1.00 122.64 ? 301 TRP B N     1 
ATOM   4068 C CA    . TRP B 1 279 ? -14.131 -19.562 -51.595 1.00 122.42 ? 301 TRP B CA    1 
ATOM   4069 C C     . TRP B 1 279 ? -14.639 -18.562 -52.641 1.00 122.57 ? 301 TRP B C     1 
ATOM   4070 O O     . TRP B 1 279 ? -15.617 -17.849 -52.388 1.00 122.49 ? 301 TRP B O     1 
ATOM   4071 C CB    . TRP B 1 279 ? -13.047 -18.878 -50.749 1.00 122.17 ? 301 TRP B CB    1 
ATOM   4072 C CG    . TRP B 1 279 ? -11.927 -18.360 -51.615 1.00 121.13 ? 301 TRP B CG    1 
ATOM   4073 C CD1   . TRP B 1 279 ? -10.803 -19.042 -52.008 1.00 120.45 ? 301 TRP B CD1   1 
ATOM   4074 C CD2   . TRP B 1 279 ? -11.850 -17.065 -52.244 1.00 120.17 ? 301 TRP B CD2   1 
ATOM   4075 N NE1   . TRP B 1 279 ? -10.019 -18.247 -52.826 1.00 120.12 ? 301 TRP B NE1   1 
ATOM   4076 C CE2   . TRP B 1 279 ? -10.640 -17.033 -52.993 1.00 119.95 ? 301 TRP B CE2   1 
ATOM   4077 C CE3   . TRP B 1 279 ? -12.684 -15.928 -52.244 1.00 119.27 ? 301 TRP B CE3   1 
ATOM   4078 C CZ2   . TRP B 1 279 ? -10.234 -15.901 -53.723 1.00 119.12 ? 301 TRP B CZ2   1 
ATOM   4079 C CZ3   . TRP B 1 279 ? -12.286 -14.808 -52.978 1.00 118.64 ? 301 TRP B CZ3   1 
ATOM   4080 C CH2   . TRP B 1 279 ? -11.069 -14.805 -53.707 1.00 118.64 ? 301 TRP B CH2   1 
ATOM   4081 N N     . THR B 1 280 ? -13.956 -18.499 -53.792 1.00 122.79 ? 302 THR B N     1 
ATOM   4082 C CA    . THR B 1 280 ? -14.235 -17.476 -54.812 1.00 123.13 ? 302 THR B CA    1 
ATOM   4083 C C     . THR B 1 280 ? -15.602 -17.668 -55.484 1.00 123.39 ? 302 THR B C     1 
ATOM   4084 O O     . THR B 1 280 ? -15.969 -18.781 -55.878 1.00 123.39 ? 302 THR B O     1 
ATOM   4085 C CB    . THR B 1 280 ? -13.054 -17.264 -55.852 1.00 123.14 ? 302 THR B CB    1 
ATOM   4086 O OG1   . THR B 1 280 ? -13.507 -16.489 -56.979 1.00 122.74 ? 302 THR B OG1   1 
ATOM   4087 C CG2   . THR B 1 280 ? -12.469 -18.585 -56.354 1.00 123.09 ? 302 THR B CG2   1 
ATOM   4088 N N     . GLY B 1 281 ? -16.352 -16.568 -55.569 1.00 123.65 ? 303 GLY B N     1 
ATOM   4089 C CA    . GLY B 1 281 ? -17.709 -16.567 -56.108 1.00 123.88 ? 303 GLY B CA    1 
ATOM   4090 C C     . GLY B 1 281 ? -18.774 -16.393 -55.037 1.00 124.04 ? 303 GLY B C     1 
ATOM   4091 O O     . GLY B 1 281 ? -19.868 -15.893 -55.304 1.00 124.28 ? 303 GLY B O     1 
ATOM   4092 N N     . HIS B 1 282 ? -18.452 -16.795 -53.817 1.00 124.11 ? 304 HIS B N     1 
ATOM   4093 C CA    . HIS B 1 282 ? -19.435 -16.807 -52.748 1.00 124.35 ? 304 HIS B CA    1 
ATOM   4094 C C     . HIS B 1 282 ? -19.359 -15.543 -51.891 1.00 123.94 ? 304 HIS B C     1 
ATOM   4095 O O     . HIS B 1 282 ? -20.096 -15.408 -50.903 1.00 124.09 ? 304 HIS B O     1 
ATOM   4096 C CB    . HIS B 1 282 ? -19.264 -18.078 -51.910 1.00 124.79 ? 304 HIS B CB    1 
ATOM   4097 C CG    . HIS B 1 282 ? -19.197 -19.328 -52.737 1.00 126.37 ? 304 HIS B CG    1 
ATOM   4098 N ND1   . HIS B 1 282 ? -20.197 -20.290 -52.712 1.00 127.89 ? 304 HIS B ND1   1 
ATOM   4099 C CD2   . HIS B 1 282 ? -18.261 -19.763 -53.628 1.00 127.75 ? 304 HIS B CD2   1 
ATOM   4100 C CE1   . HIS B 1 282 ? -19.874 -21.267 -53.544 1.00 128.84 ? 304 HIS B CE1   1 
ATOM   4101 N NE2   . HIS B 1 282 ? -18.705 -20.971 -54.114 1.00 128.59 ? 304 HIS B NE2   1 
ATOM   4102 N N     . ILE B 1 283 ? -18.481 -14.615 -52.285 1.00 123.30 ? 305 ILE B N     1 
ATOM   4103 C CA    . ILE B 1 283 ? -18.289 -13.368 -51.545 1.00 122.62 ? 305 ILE B CA    1 
ATOM   4104 C C     . ILE B 1 283 ? -19.306 -12.317 -52.010 1.00 122.12 ? 305 ILE B C     1 
ATOM   4105 O O     . ILE B 1 283 ? -19.404 -12.051 -53.218 1.00 121.83 ? 305 ILE B O     1 
ATOM   4106 C CB    . ILE B 1 283 ? -16.838 -12.804 -51.689 1.00 122.62 ? 305 ILE B CB    1 
ATOM   4107 C CG1   . ILE B 1 283 ? -15.774 -13.925 -51.676 1.00 122.56 ? 305 ILE B CG1   1 
ATOM   4108 C CG2   . ILE B 1 283 ? -16.567 -11.715 -50.630 1.00 122.48 ? 305 ILE B CG2   1 
ATOM   4109 C CD1   . ILE B 1 283 ? -15.547 -14.634 -50.304 1.00 122.21 ? 305 ILE B CD1   1 
ATOM   4110 N N     . PRO B 1 284 ? -20.070 -11.729 -51.053 1.00 121.64 ? 306 PRO B N     1 
ATOM   4111 C CA    . PRO B 1 284 ? -20.972 -10.633 -51.389 1.00 121.28 ? 306 PRO B CA    1 
ATOM   4112 C C     . PRO B 1 284 ? -20.196 -9.570  -52.160 1.00 121.17 ? 306 PRO B C     1 
ATOM   4113 O O     . PRO B 1 284 ? -19.201 -9.041  -51.636 1.00 121.18 ? 306 PRO B O     1 
ATOM   4114 C CB    . PRO B 1 284 ? -21.394 -10.093 -50.017 1.00 121.15 ? 306 PRO B CB    1 
ATOM   4115 C CG    . PRO B 1 284 ? -21.265 -11.237 -49.097 1.00 121.18 ? 306 PRO B CG    1 
ATOM   4116 C CD    . PRO B 1 284 ? -20.089 -12.026 -49.606 1.00 121.56 ? 306 PRO B CD    1 
ATOM   4117 N N     . GLY B 1 285 ? -20.630 -9.294  -53.404 1.00 121.09 ? 307 GLY B N     1 
ATOM   4118 C CA    . GLY B 1 285 ? -19.987 -8.303  -54.282 1.00 120.77 ? 307 GLY B CA    1 
ATOM   4119 C C     . GLY B 1 285 ? -19.475 -7.047  -53.584 1.00 120.73 ? 307 GLY B C     1 
ATOM   4120 O O     . GLY B 1 285 ? -18.381 -6.575  -53.893 1.00 120.55 ? 307 GLY B O     1 
ATOM   4121 N N     . ASP B 1 286 ? -20.256 -6.515  -52.636 1.00 120.76 ? 308 ASP B N     1 
ATOM   4122 C CA    . ASP B 1 286 ? -19.878 -5.309  -51.885 1.00 120.89 ? 308 ASP B CA    1 
ATOM   4123 C C     . ASP B 1 286 ? -18.608 -5.488  -51.041 1.00 120.78 ? 308 ASP B C     1 
ATOM   4124 O O     . ASP B 1 286 ? -17.782 -4.567  -50.947 1.00 120.75 ? 308 ASP B O     1 
ATOM   4125 C CB    . ASP B 1 286 ? -21.036 -4.828  -50.996 1.00 121.10 ? 308 ASP B CB    1 
ATOM   4126 C CG    . ASP B 1 286 ? -21.307 -5.777  -49.829 1.00 122.04 ? 308 ASP B CG    1 
ATOM   4127 O OD1   . ASP B 1 286 ? -21.943 -6.841  -50.075 1.00 123.26 ? 308 ASP B OD1   1 
ATOM   4128 O OD2   . ASP B 1 286 ? -20.885 -5.458  -48.673 1.00 122.71 ? 308 ASP B OD2   1 
ATOM   4129 N N     . VAL B 1 287 ? -18.470 -6.667  -50.421 1.00 120.73 ? 309 VAL B N     1 
ATOM   4130 C CA    . VAL B 1 287 ? -17.288 -7.010  -49.613 1.00 120.54 ? 309 VAL B CA    1 
ATOM   4131 C C     . VAL B 1 287 ? -16.076 -7.247  -50.535 1.00 120.45 ? 309 VAL B C     1 
ATOM   4132 O O     . VAL B 1 287 ? -14.937 -6.944  -50.155 1.00 120.17 ? 309 VAL B O     1 
ATOM   4133 C CB    . VAL B 1 287 ? -17.558 -8.219  -48.633 1.00 120.54 ? 309 VAL B CB    1 
ATOM   4134 C CG1   . VAL B 1 287 ? -16.291 -8.625  -47.894 1.00 120.33 ? 309 VAL B CG1   1 
ATOM   4135 C CG2   . VAL B 1 287 ? -18.659 -7.872  -47.602 1.00 120.08 ? 309 VAL B CG2   1 
ATOM   4136 N N     . VAL B 1 288 ? -16.348 -7.753  -51.749 1.00 120.63 ? 310 VAL B N     1 
ATOM   4137 C CA    . VAL B 1 288 ? -15.336 -7.900  -52.816 1.00 120.93 ? 310 VAL B CA    1 
ATOM   4138 C C     . VAL B 1 288 ? -14.895 -6.534  -53.393 1.00 121.29 ? 310 VAL B C     1 
ATOM   4139 O O     . VAL B 1 288 ? -13.809 -6.399  -53.991 1.00 121.07 ? 310 VAL B O     1 
ATOM   4140 C CB    . VAL B 1 288 ? -15.862 -8.766  -54.003 1.00 120.88 ? 310 VAL B CB    1 
ATOM   4141 C CG1   . VAL B 1 288 ? -14.715 -9.226  -54.899 1.00 120.36 ? 310 VAL B CG1   1 
ATOM   4142 C CG2   . VAL B 1 288 ? -16.672 -9.961  -53.516 1.00 120.75 ? 310 VAL B CG2   1 
ATOM   4143 N N     . ARG B 1 289 ? -15.760 -5.535  -53.217 1.00 121.79 ? 311 ARG B N     1 
ATOM   4144 C CA    . ARG B 1 289 ? -15.523 -4.166  -53.680 1.00 122.18 ? 311 ARG B CA    1 
ATOM   4145 C C     . ARG B 1 289 ? -14.655 -3.400  -52.678 1.00 122.18 ? 311 ARG B C     1 
ATOM   4146 O O     . ARG B 1 289 ? -13.693 -2.724  -53.055 1.00 122.09 ? 311 ARG B O     1 
ATOM   4147 C CB    . ARG B 1 289 ? -16.874 -3.461  -53.871 1.00 122.32 ? 311 ARG B CB    1 
ATOM   4148 C CG    . ARG B 1 289 ? -16.826 -2.026  -54.390 1.00 122.92 ? 311 ARG B CG    1 
ATOM   4149 C CD    . ARG B 1 289 ? -18.131 -1.306  -54.056 1.00 123.82 ? 311 ARG B CD    1 
ATOM   4150 N NE    . ARG B 1 289 ? -18.255 -1.072  -52.614 1.00 124.92 ? 311 ARG B NE    1 
ATOM   4151 C CZ    . ARG B 1 289 ? -19.404 -1.027  -51.936 1.00 125.56 ? 311 ARG B CZ    1 
ATOM   4152 N NH1   . ARG B 1 289 ? -19.382 -0.808  -50.622 1.00 125.61 ? 311 ARG B NH1   1 
ATOM   4153 N NH2   . ARG B 1 289 ? -20.571 -1.213  -52.555 1.00 125.66 ? 311 ARG B NH2   1 
ATOM   4154 N N     . ASP B 1 290 ? -15.003 -3.528  -51.400 1.00 122.21 ? 312 ASP B N     1 
ATOM   4155 C CA    . ASP B 1 290 ? -14.292 -2.860  -50.318 1.00 122.33 ? 312 ASP B CA    1 
ATOM   4156 C C     . ASP B 1 290 ? -13.068 -3.666  -49.820 1.00 122.31 ? 312 ASP B C     1 
ATOM   4157 O O     . ASP B 1 290 ? -12.493 -3.346  -48.776 1.00 122.36 ? 312 ASP B O     1 
ATOM   4158 C CB    . ASP B 1 290 ? -15.265 -2.572  -49.153 1.00 122.42 ? 312 ASP B CB    1 
ATOM   4159 C CG    . ASP B 1 290 ? -16.509 -1.773  -49.581 1.00 122.40 ? 312 ASP B CG    1 
ATOM   4160 O OD1   . ASP B 1 290 ? -16.520 -1.219  -50.708 1.00 122.30 ? 312 ASP B OD1   1 
ATOM   4161 O OD2   . ASP B 1 290 ? -17.475 -1.691  -48.774 1.00 122.07 ? 312 ASP B OD2   1 
ATOM   4162 N N     . MET B 1 291 ? -12.659 -4.689  -50.575 1.00 122.26 ? 313 MET B N     1 
ATOM   4163 C CA    . MET B 1 291 ? -11.698 -5.686  -50.081 1.00 122.24 ? 313 MET B CA    1 
ATOM   4164 C C     . MET B 1 291 ? -10.467 -5.098  -49.416 1.00 122.48 ? 313 MET B C     1 
ATOM   4165 O O     . MET B 1 291 ? -10.108 -5.512  -48.309 1.00 122.46 ? 313 MET B O     1 
ATOM   4166 C CB    . MET B 1 291 ? -11.273 -6.668  -51.182 1.00 122.13 ? 313 MET B CB    1 
ATOM   4167 C CG    . MET B 1 291 ? -10.493 -7.894  -50.670 1.00 121.61 ? 313 MET B CG    1 
ATOM   4168 S SD    . MET B 1 291 ? -11.309 -8.773  -49.308 1.00 121.53 ? 313 MET B SD    1 
ATOM   4169 C CE    . MET B 1 291 ? -12.708 -9.541  -50.147 1.00 121.00 ? 313 MET B CE    1 
ATOM   4170 N N     . ALA B 1 292 ? -9.842  -4.129  -50.087 1.00 122.81 ? 314 ALA B N     1 
ATOM   4171 C CA    . ALA B 1 292 ? -8.567  -3.561  -49.631 1.00 123.25 ? 314 ALA B CA    1 
ATOM   4172 C C     . ALA B 1 292 ? -8.642  -2.738  -48.330 1.00 123.50 ? 314 ALA B C     1 
ATOM   4173 O O     . ALA B 1 292 ? -7.634  -2.577  -47.638 1.00 123.67 ? 314 ALA B O     1 
ATOM   4174 C CB    . ALA B 1 292 ? -7.905  -2.756  -50.748 1.00 123.20 ? 314 ALA B CB    1 
ATOM   4175 N N     . GLN B 1 293 ? -9.822  -2.224  -47.996 1.00 123.72 ? 315 GLN B N     1 
ATOM   4176 C CA    . GLN B 1 293 ? -9.997  -1.488  -46.744 1.00 123.94 ? 315 GLN B CA    1 
ATOM   4177 C C     . GLN B 1 293 ? -10.268 -2.453  -45.592 1.00 123.84 ? 315 GLN B C     1 
ATOM   4178 O O     . GLN B 1 293 ? -9.721  -2.268  -44.501 1.00 123.91 ? 315 GLN B O     1 
ATOM   4179 C CB    . GLN B 1 293 ? -11.129 -0.455  -46.851 1.00 124.19 ? 315 GLN B CB    1 
ATOM   4180 C CG    . GLN B 1 293 ? -10.845 0.715   -47.786 1.00 125.16 ? 315 GLN B CG    1 
ATOM   4181 C CD    . GLN B 1 293 ? -10.549 0.263   -49.205 1.00 126.56 ? 315 GLN B CD    1 
ATOM   4182 O OE1   . GLN B 1 293 ? -9.436  0.437   -49.694 1.00 127.15 ? 315 GLN B OE1   1 
ATOM   4183 N NE2   . GLN B 1 293 ? -11.537 -0.346  -49.862 1.00 126.92 ? 315 GLN B NE2   1 
ATOM   4184 N N     . ILE B 1 294 ? -11.104 -3.472  -45.848 1.00 123.68 ? 316 ILE B N     1 
ATOM   4185 C CA    . ILE B 1 294 ? -11.505 -4.485  -44.842 1.00 123.45 ? 316 ILE B CA    1 
ATOM   4186 C C     . ILE B 1 294 ? -10.318 -5.320  -44.368 1.00 123.46 ? 316 ILE B C     1 
ATOM   4187 O O     . ILE B 1 294 ? -10.208 -5.638  -43.168 1.00 123.40 ? 316 ILE B O     1 
ATOM   4188 C CB    . ILE B 1 294 ? -12.613 -5.448  -45.366 1.00 123.38 ? 316 ILE B CB    1 
ATOM   4189 C CG1   . ILE B 1 294 ? -13.845 -4.656  -45.837 1.00 123.52 ? 316 ILE B CG1   1 
ATOM   4190 C CG2   . ILE B 1 294 ? -12.993 -6.475  -44.281 1.00 122.95 ? 316 ILE B CG2   1 
ATOM   4191 C CD1   . ILE B 1 294 ? -14.881 -5.462  -46.655 1.00 123.03 ? 316 ILE B CD1   1 
ATOM   4192 N N     . ALA B 1 295 ? -9.444  -5.670  -45.319 1.00 123.39 ? 317 ALA B N     1 
ATOM   4193 C CA    . ALA B 1 295 ? -8.195  -6.383  -45.029 1.00 123.28 ? 317 ALA B CA    1 
ATOM   4194 C C     . ALA B 1 295 ? -6.966  -5.820  -45.798 1.00 123.22 ? 317 ALA B C     1 
ATOM   4195 O O     . ALA B 1 295 ? -6.591  -6.368  -46.850 1.00 123.30 ? 317 ALA B O     1 
ATOM   4196 C CB    . ALA B 1 295 ? -8.370  -7.899  -45.289 1.00 123.22 ? 317 ALA B CB    1 
ATOM   4197 N N     . PRO B 1 296 ? -6.332  -4.727  -45.281 1.00 123.08 ? 318 PRO B N     1 
ATOM   4198 C CA    . PRO B 1 296 ? -5.073  -4.263  -45.899 1.00 122.99 ? 318 PRO B CA    1 
ATOM   4199 C C     . PRO B 1 296 ? -3.952  -5.288  -45.730 1.00 123.02 ? 318 PRO B C     1 
ATOM   4200 O O     . PRO B 1 296 ? -2.942  -5.226  -46.438 1.00 122.82 ? 318 PRO B O     1 
ATOM   4201 C CB    . PRO B 1 296 ? -4.745  -2.971  -45.129 1.00 122.81 ? 318 PRO B CB    1 
ATOM   4202 C CG    . PRO B 1 296 ? -5.516  -3.051  -43.873 1.00 122.70 ? 318 PRO B CG    1 
ATOM   4203 C CD    . PRO B 1 296 ? -6.763  -3.824  -44.194 1.00 122.94 ? 318 PRO B CD    1 
ATOM   4204 N N     . MET B 1 297 ? -4.167  -6.221  -44.796 1.00 123.22 ? 319 MET B N     1 
ATOM   4205 C CA    . MET B 1 297 ? -3.239  -7.313  -44.473 1.00 123.43 ? 319 MET B CA    1 
ATOM   4206 C C     . MET B 1 297 ? -3.005  -8.301  -45.614 1.00 123.51 ? 319 MET B C     1 
ATOM   4207 O O     . MET B 1 297 ? -1.865  -8.691  -45.873 1.00 123.61 ? 319 MET B O     1 
ATOM   4208 C CB    . MET B 1 297 ? -3.692  -8.078  -43.213 1.00 123.42 ? 319 MET B CB    1 
ATOM   4209 C CG    . MET B 1 297 ? -3.333  -7.396  -41.890 1.00 123.43 ? 319 MET B CG    1 
ATOM   4210 S SD    . MET B 1 297 ? -1.623  -6.803  -41.824 1.00 123.55 ? 319 MET B SD    1 
ATOM   4211 C CE    . MET B 1 297 ? -0.750  -8.351  -41.577 1.00 123.37 ? 319 MET B CE    1 
ATOM   4212 N N     . LEU B 1 298 ? -4.070  -8.721  -46.289 1.00 123.60 ? 320 LEU B N     1 
ATOM   4213 C CA    . LEU B 1 298 ? -3.890  -9.570  -47.462 1.00 123.81 ? 320 LEU B CA    1 
ATOM   4214 C C     . LEU B 1 298 ? -2.737  -9.005  -48.308 1.00 124.11 ? 320 LEU B C     1 
ATOM   4215 O O     . LEU B 1 298 ? -1.768  -9.719  -48.590 1.00 123.87 ? 320 LEU B O     1 
ATOM   4216 C CB    . LEU B 1 298 ? -5.194  -9.670  -48.282 1.00 123.68 ? 320 LEU B CB    1 
ATOM   4217 C CG    . LEU B 1 298 ? -6.354  -10.443 -47.616 1.00 123.10 ? 320 LEU B CG    1 
ATOM   4218 C CD1   . LEU B 1 298 ? -7.667  -10.175 -48.371 1.00 122.82 ? 320 LEU B CD1   1 
ATOM   4219 C CD2   . LEU B 1 298 ? -6.059  -11.955 -47.549 1.00 121.88 ? 320 LEU B CD2   1 
ATOM   4220 N N     . ALA B 1 299 ? -2.838  -7.712  -48.648 1.00 124.66 ? 321 ALA B N     1 
ATOM   4221 C CA    . ALA B 1 299 ? -1.871  -7.003  -49.510 1.00 125.18 ? 321 ALA B CA    1 
ATOM   4222 C C     . ALA B 1 299 ? -0.416  -7.121  -49.045 1.00 125.53 ? 321 ALA B C     1 
ATOM   4223 O O     . ALA B 1 299 ? 0.450   -7.499  -49.834 1.00 125.55 ? 321 ALA B O     1 
ATOM   4224 C CB    . ALA B 1 299 ? -2.269  -5.529  -49.668 1.00 125.16 ? 321 ALA B CB    1 
ATOM   4225 N N     . GLN B 1 300 ? -0.155  -6.802  -47.774 1.00 125.99 ? 322 GLN B N     1 
ATOM   4226 C CA    . GLN B 1 300 ? 1.204   -6.864  -47.216 1.00 126.57 ? 322 GLN B CA    1 
ATOM   4227 C C     . GLN B 1 300 ? 1.700   -8.313  -47.035 1.00 126.20 ? 322 GLN B C     1 
ATOM   4228 O O     . GLN B 1 300 ? 2.897   -8.565  -47.151 1.00 126.11 ? 322 GLN B O     1 
ATOM   4229 C CB    . GLN B 1 300 ? 1.292   -6.093  -45.875 1.00 127.08 ? 322 GLN B CB    1 
ATOM   4230 C CG    . GLN B 1 300 ? 0.797   -4.638  -45.917 1.00 129.83 ? 322 GLN B CG    1 
ATOM   4231 C CD    . GLN B 1 300 ? 1.067   -3.911  -44.561 1.00 133.22 ? 322 GLN B CD    1 
ATOM   4232 O OE1   . GLN B 1 300 ? 0.154   -3.790  -43.684 1.00 134.66 ? 322 GLN B OE1   1 
ATOM   4233 N NE2   . GLN B 1 300 ? 2.326   -3.428  -44.382 1.00 134.15 ? 322 GLN B NE2   1 
ATOM   4234 N N     . LEU B 1 301 ? 0.779   -9.249  -46.752 1.00 126.01 ? 323 LEU B N     1 
ATOM   4235 C CA    . LEU B 1 301 ? 1.093   -10.689 -46.644 1.00 125.78 ? 323 LEU B CA    1 
ATOM   4236 C C     . LEU B 1 301 ? 1.499   -11.294 -47.980 1.00 125.70 ? 323 LEU B C     1 
ATOM   4237 O O     . LEU B 1 301 ? 2.075   -12.396 -48.032 1.00 125.52 ? 323 LEU B O     1 
ATOM   4238 C CB    . LEU B 1 301 ? -0.124  -11.474 -46.120 1.00 125.81 ? 323 LEU B CB    1 
ATOM   4239 C CG    . LEU B 1 301 ? -0.358  -11.544 -44.600 1.00 125.73 ? 323 LEU B CG    1 
ATOM   4240 C CD1   . LEU B 1 301 ? -1.735  -12.199 -44.344 1.00 125.69 ? 323 LEU B CD1   1 
ATOM   4241 C CD2   . LEU B 1 301 ? 0.760   -12.375 -43.911 1.00 125.46 ? 323 LEU B CD2   1 
ATOM   4242 N N     . GLY B 1 302 ? 1.166   -10.577 -49.054 1.00 125.73 ? 324 GLY B N     1 
ATOM   4243 C CA    . GLY B 1 302 ? 1.421   -11.037 -50.415 1.00 125.65 ? 324 GLY B CA    1 
ATOM   4244 C C     . GLY B 1 302 ? 0.158   -11.511 -51.122 1.00 125.57 ? 324 GLY B C     1 
ATOM   4245 O O     . GLY B 1 302 ? 0.228   -12.111 -52.198 1.00 125.54 ? 324 GLY B O     1 
ATOM   4246 N N     . TYR B 1 303 ? -0.998  -11.255 -50.518 1.00 125.45 ? 325 TYR B N     1 
ATOM   4247 C CA    . TYR B 1 303 ? -2.261  -11.598 -51.154 1.00 125.41 ? 325 TYR B CA    1 
ATOM   4248 C C     . TYR B 1 303 ? -2.861  -10.386 -51.859 1.00 125.80 ? 325 TYR B C     1 
ATOM   4249 O O     . TYR B 1 303 ? -3.075  -9.338  -51.238 1.00 125.99 ? 325 TYR B O     1 
ATOM   4250 C CB    . TYR B 1 303 ? -3.246  -12.194 -50.143 1.00 125.09 ? 325 TYR B CB    1 
ATOM   4251 C CG    . TYR B 1 303 ? -2.783  -13.505 -49.571 1.00 123.85 ? 325 TYR B CG    1 
ATOM   4252 C CD1   . TYR B 1 303 ? -2.669  -14.643 -50.398 1.00 122.50 ? 325 TYR B CD1   1 
ATOM   4253 C CD2   . TYR B 1 303 ? -2.450  -13.607 -48.210 1.00 122.94 ? 325 TYR B CD2   1 
ATOM   4254 C CE1   . TYR B 1 303 ? -2.238  -15.850 -49.888 1.00 121.92 ? 325 TYR B CE1   1 
ATOM   4255 C CE2   . TYR B 1 303 ? -2.021  -14.812 -47.683 1.00 122.58 ? 325 TYR B CE2   1 
ATOM   4256 C CZ    . TYR B 1 303 ? -1.917  -15.930 -48.531 1.00 122.31 ? 325 TYR B CZ    1 
ATOM   4257 O OH    . TYR B 1 303 ? -1.492  -17.130 -48.014 1.00 122.15 ? 325 TYR B OH    1 
ATOM   4258 N N     . ASP B 1 304 ? -3.120  -10.544 -53.163 1.00 125.99 ? 326 ASP B N     1 
ATOM   4259 C CA    . ASP B 1 304 ? -3.796  -9.530  -53.967 1.00 126.14 ? 326 ASP B CA    1 
ATOM   4260 C C     . ASP B 1 304 ? -5.296  -9.446  -53.624 1.00 126.19 ? 326 ASP B C     1 
ATOM   4261 O O     . ASP B 1 304 ? -6.055  -10.377 -53.956 1.00 125.90 ? 326 ASP B O     1 
ATOM   4262 C CB    . ASP B 1 304 ? -3.607  -9.859  -55.446 1.00 126.24 ? 326 ASP B CB    1 
ATOM   4263 C CG    . ASP B 1 304 ? -4.241  -8.826  -56.371 1.00 126.76 ? 326 ASP B CG    1 
ATOM   4264 O OD1   . ASP B 1 304 ? -3.980  -8.925  -57.591 1.00 127.42 ? 326 ASP B OD1   1 
ATOM   4265 O OD2   . ASP B 1 304 ? -4.994  -7.933  -55.905 1.00 126.97 ? 326 ASP B OD2   1 
ATOM   4266 N N     . PRO B 1 305 ? -5.724  -8.317  -52.982 1.00 126.40 ? 327 PRO B N     1 
ATOM   4267 C CA    . PRO B 1 305 ? -7.115  -8.132  -52.517 1.00 126.59 ? 327 PRO B CA    1 
ATOM   4268 C C     . PRO B 1 305 ? -8.081  -8.006  -53.693 1.00 126.90 ? 327 PRO B C     1 
ATOM   4269 O O     . PRO B 1 305 ? -9.310  -8.172  -53.527 1.00 126.77 ? 327 PRO B O     1 
ATOM   4270 C CB    . PRO B 1 305 ? -7.057  -6.809  -51.741 1.00 126.44 ? 327 PRO B CB    1 
ATOM   4271 C CG    . PRO B 1 305 ? -5.939  -6.044  -52.383 1.00 126.32 ? 327 PRO B CG    1 
ATOM   4272 C CD    . PRO B 1 305 ? -4.920  -7.086  -52.790 1.00 126.34 ? 327 PRO B CD    1 
ATOM   4273 N N     . TYR B 1 306 ? -7.496  -7.734  -54.871 1.00 127.26 ? 328 TYR B N     1 
ATOM   4274 C CA    . TYR B 1 306 ? -8.236  -7.478  -56.102 1.00 127.60 ? 328 TYR B CA    1 
ATOM   4275 C C     . TYR B 1 306 ? -8.187  -8.646  -57.100 1.00 127.30 ? 328 TYR B C     1 
ATOM   4276 O O     . TYR B 1 306 ? -9.015  -8.713  -58.014 1.00 127.37 ? 328 TYR B O     1 
ATOM   4277 C CB    . TYR B 1 306 ? -7.787  -6.139  -56.732 1.00 127.90 ? 328 TYR B CB    1 
ATOM   4278 C CG    . TYR B 1 306 ? -8.160  -4.921  -55.884 1.00 129.51 ? 328 TYR B CG    1 
ATOM   4279 C CD1   . TYR B 1 306 ? -9.440  -4.842  -55.277 1.00 131.17 ? 328 TYR B CD1   1 
ATOM   4280 C CD2   . TYR B 1 306 ? -7.279  -3.851  -55.696 1.00 130.70 ? 328 TYR B CD2   1 
ATOM   4281 C CE1   . TYR B 1 306 ? -9.798  -3.743  -54.499 1.00 132.26 ? 328 TYR B CE1   1 
ATOM   4282 C CE2   . TYR B 1 306 ? -7.686  -2.738  -54.919 1.00 131.66 ? 328 TYR B CE2   1 
ATOM   4283 C CZ    . TYR B 1 306 ? -8.881  -2.696  -54.325 1.00 132.30 ? 328 TYR B CZ    1 
ATOM   4284 O OH    . TYR B 1 306 ? -9.278  -1.617  -53.555 1.00 132.82 ? 328 TYR B OH    1 
ATOM   4285 N N     . ALA B 1 307 ? -7.240  -9.571  -56.916 1.00 126.95 ? 329 ALA B N     1 
ATOM   4286 C CA    . ALA B 1 307 ? -7.281  -10.821 -57.662 1.00 126.77 ? 329 ALA B CA    1 
ATOM   4287 C C     . ALA B 1 307 ? -8.314  -11.744 -57.018 1.00 126.88 ? 329 ALA B C     1 
ATOM   4288 O O     . ALA B 1 307 ? -8.263  -11.990 -55.804 1.00 126.81 ? 329 ALA B O     1 
ATOM   4289 C CB    . ALA B 1 307 ? -5.928  -11.466 -57.697 1.00 126.53 ? 329 ALA B CB    1 
ATOM   4290 N N     . ASN B 1 308 ? -9.263  -12.226 -57.829 1.00 127.07 ? 330 ASN B N     1 
ATOM   4291 C CA    . ASN B 1 308 ? -10.351 -13.098 -57.339 1.00 127.38 ? 330 ASN B CA    1 
ATOM   4292 C C     . ASN B 1 308 ? -10.494 -14.455 -58.069 1.00 127.26 ? 330 ASN B C     1 
ATOM   4293 O O     . ASN B 1 308 ? -11.397 -14.616 -58.897 1.00 127.22 ? 330 ASN B O     1 
ATOM   4294 C CB    . ASN B 1 308 ? -11.702 -12.350 -57.330 1.00 127.50 ? 330 ASN B CB    1 
ATOM   4295 C CG    . ASN B 1 308 ? -11.979 -11.617 -56.003 1.00 128.31 ? 330 ASN B CG    1 
ATOM   4296 O OD1   . ASN B 1 308 ? -13.001 -11.904 -55.336 1.00 129.19 ? 330 ASN B OD1   1 
ATOM   4297 N ND2   . ASN B 1 308 ? -11.073 -10.663 -55.618 1.00 128.91 ? 330 ASN B ND2   1 
ATOM   4298 N N     . PRO B 1 309 ? -9.627  -15.448 -57.738 1.00 127.18 ? 331 PRO B N     1 
ATOM   4299 C CA    . PRO B 1 309 ? -8.553  -15.402 -56.725 1.00 126.85 ? 331 PRO B CA    1 
ATOM   4300 C C     . PRO B 1 309 ? -7.238  -14.800 -57.263 1.00 126.40 ? 331 PRO B C     1 
ATOM   4301 O O     . PRO B 1 309 ? -7.164  -14.479 -58.458 1.00 126.20 ? 331 PRO B O     1 
ATOM   4302 C CB    . PRO B 1 309 ? -8.369  -16.886 -56.348 1.00 126.88 ? 331 PRO B CB    1 
ATOM   4303 C CG    . PRO B 1 309 ? -8.766  -17.658 -57.572 1.00 127.01 ? 331 PRO B CG    1 
ATOM   4304 C CD    . PRO B 1 309 ? -9.722  -16.784 -58.374 1.00 127.22 ? 331 PRO B CD    1 
ATOM   4305 N N     . PRO B 1 310 ? -6.222  -14.598 -56.379 1.00 126.07 ? 332 PRO B N     1 
ATOM   4306 C CA    . PRO B 1 310 ? -4.873  -14.493 -56.938 1.00 125.77 ? 332 PRO B CA    1 
ATOM   4307 C C     . PRO B 1 310 ? -4.516  -15.836 -57.592 1.00 125.67 ? 332 PRO B C     1 
ATOM   4308 O O     . PRO B 1 310 ? -5.210  -16.847 -57.348 1.00 125.81 ? 332 PRO B O     1 
ATOM   4309 C CB    . PRO B 1 310 ? -3.997  -14.243 -55.702 1.00 125.51 ? 332 PRO B CB    1 
ATOM   4310 C CG    . PRO B 1 310 ? -4.911  -13.634 -54.701 1.00 125.46 ? 332 PRO B CG    1 
ATOM   4311 C CD    . PRO B 1 310 ? -6.243  -14.287 -54.929 1.00 126.00 ? 332 PRO B CD    1 
ATOM   4312 N N     . ASN B 1 311 ? -3.478  -15.854 -58.435 1.00 125.35 ? 333 ASN B N     1 
ATOM   4313 C CA    . ASN B 1 311 ? -2.949  -17.129 -58.926 1.00 124.91 ? 333 ASN B CA    1 
ATOM   4314 C C     . ASN B 1 311 ? -1.880  -17.664 -57.982 1.00 124.82 ? 333 ASN B C     1 
ATOM   4315 O O     . ASN B 1 311 ? -0.726  -17.205 -57.979 1.00 124.70 ? 333 ASN B O     1 
ATOM   4316 C CB    . ASN B 1 311 ? -2.414  -17.048 -60.356 1.00 124.78 ? 333 ASN B CB    1 
ATOM   4317 C CG    . ASN B 1 311 ? -1.905  -18.395 -60.859 1.00 124.58 ? 333 ASN B CG    1 
ATOM   4318 O OD1   . ASN B 1 311 ? -0.925  -18.460 -61.610 1.00 124.43 ? 333 ASN B OD1   1 
ATOM   4319 N ND2   . ASN B 1 311 ? -2.562  -19.482 -60.428 1.00 123.94 ? 333 ASN B ND2   1 
ATOM   4320 N N     . TYR B 1 312 ? -2.292  -18.647 -57.188 1.00 124.82 ? 334 TYR B N     1 
ATOM   4321 C CA    . TYR B 1 312 ? -1.497  -19.168 -56.085 1.00 124.82 ? 334 TYR B CA    1 
ATOM   4322 C C     . TYR B 1 312 ? -0.228  -19.906 -56.564 1.00 124.91 ? 334 TYR B C     1 
ATOM   4323 O O     . TYR B 1 312 ? 0.831   -19.814 -55.937 1.00 124.88 ? 334 TYR B O     1 
ATOM   4324 C CB    . TYR B 1 312 ? -2.364  -20.090 -55.200 1.00 124.80 ? 334 TYR B CB    1 
ATOM   4325 C CG    . TYR B 1 312 ? -3.626  -19.488 -54.530 1.00 124.68 ? 334 TYR B CG    1 
ATOM   4326 C CD1   . TYR B 1 312 ? -3.590  -18.244 -53.857 1.00 124.44 ? 334 TYR B CD1   1 
ATOM   4327 C CD2   . TYR B 1 312 ? -4.840  -20.210 -54.511 1.00 124.53 ? 334 TYR B CD2   1 
ATOM   4328 C CE1   . TYR B 1 312 ? -4.745  -17.720 -53.218 1.00 124.29 ? 334 TYR B CE1   1 
ATOM   4329 C CE2   . TYR B 1 312 ? -5.994  -19.698 -53.872 1.00 124.41 ? 334 TYR B CE2   1 
ATOM   4330 C CZ    . TYR B 1 312 ? -5.942  -18.458 -53.230 1.00 124.31 ? 334 TYR B CZ    1 
ATOM   4331 O OH    . TYR B 1 312 ? -7.084  -17.971 -52.613 1.00 123.70 ? 334 TYR B OH    1 
ATOM   4332 N N     . GLY B 1 313 ? -0.341  -20.627 -57.676 1.00 125.08 ? 335 GLY B N     1 
ATOM   4333 C CA    . GLY B 1 313 ? 0.774   -21.403 -58.219 1.00 125.38 ? 335 GLY B CA    1 
ATOM   4334 C C     . GLY B 1 313 ? 0.311   -22.725 -58.815 1.00 125.69 ? 335 GLY B C     1 
ATOM   4335 O O     . GLY B 1 313 ? -0.900  -22.952 -58.993 1.00 125.71 ? 335 GLY B O     1 
ATOM   4336 N N     . ASN B 1 314 ? 1.277   -23.600 -59.114 1.00 126.00 ? 336 ASN B N     1 
ATOM   4337 C CA    . ASN B 1 314 ? 1.021   -24.875 -59.817 1.00 126.26 ? 336 ASN B CA    1 
ATOM   4338 C C     . ASN B 1 314 ? 1.357   -26.138 -59.008 1.00 126.32 ? 336 ASN B C     1 
ATOM   4339 O O     . ASN B 1 314 ? 2.472   -26.257 -58.482 1.00 126.30 ? 336 ASN B O     1 
ATOM   4340 C CB    . ASN B 1 314 ? 1.761   -24.903 -61.158 1.00 126.22 ? 336 ASN B CB    1 
ATOM   4341 C CG    . ASN B 1 314 ? 1.307   -23.799 -62.090 1.00 126.62 ? 336 ASN B CG    1 
ATOM   4342 O OD1   . ASN B 1 314 ? 0.118   -23.700 -62.434 1.00 127.17 ? 336 ASN B OD1   1 
ATOM   4343 N ND2   . ASN B 1 314 ? 2.250   -22.952 -62.503 1.00 126.90 ? 336 ASN B ND2   1 
ATOM   4344 N N     . PRO B 1 315 ? 0.399   -27.094 -58.924 1.00 126.41 ? 337 PRO B N     1 
ATOM   4345 C CA    . PRO B 1 315 ? 0.590   -28.256 -58.044 1.00 126.46 ? 337 PRO B CA    1 
ATOM   4346 C C     . PRO B 1 315 ? 1.709   -29.214 -58.458 1.00 126.50 ? 337 PRO B C     1 
ATOM   4347 O O     . PRO B 1 315 ? 2.019   -29.359 -59.649 1.00 126.28 ? 337 PRO B O     1 
ATOM   4348 C CB    . PRO B 1 315 ? -0.777  -28.962 -58.066 1.00 126.43 ? 337 PRO B CB    1 
ATOM   4349 C CG    . PRO B 1 315 ? -1.449  -28.486 -59.302 1.00 126.35 ? 337 PRO B CG    1 
ATOM   4350 C CD    . PRO B 1 315 ? -0.924  -27.107 -59.584 1.00 126.36 ? 337 PRO B CD    1 
ATOM   4351 N N     . ASP B 1 316 ? 2.319   -29.829 -57.445 1.00 126.73 ? 338 ASP B N     1 
ATOM   4352 C CA    . ASP B 1 316 ? 3.224   -30.956 -57.620 1.00 126.86 ? 338 ASP B CA    1 
ATOM   4353 C C     . ASP B 1 316 ? 2.412   -32.106 -58.212 1.00 126.76 ? 338 ASP B C     1 
ATOM   4354 O O     . ASP B 1 316 ? 1.225   -32.268 -57.863 1.00 126.64 ? 338 ASP B O     1 
ATOM   4355 C CB    . ASP B 1 316 ? 3.801   -31.403 -56.257 1.00 126.97 ? 338 ASP B CB    1 
ATOM   4356 C CG    . ASP B 1 316 ? 4.804   -30.409 -55.665 1.00 127.28 ? 338 ASP B CG    1 
ATOM   4357 O OD1   . ASP B 1 316 ? 5.243   -29.477 -56.388 1.00 128.02 ? 338 ASP B OD1   1 
ATOM   4358 O OD2   . ASP B 1 316 ? 5.162   -30.575 -54.472 1.00 127.42 ? 338 ASP B OD2   1 
ATOM   4359 N N     . PRO B 1 317 ? 3.036   -32.909 -59.106 1.00 126.67 ? 339 PRO B N     1 
ATOM   4360 C CA    . PRO B 1 317 ? 2.395   -34.155 -59.549 1.00 126.67 ? 339 PRO B CA    1 
ATOM   4361 C C     . PRO B 1 317 ? 1.967   -35.022 -58.356 1.00 126.68 ? 339 PRO B C     1 
ATOM   4362 O O     . PRO B 1 317 ? 0.982   -35.772 -58.466 1.00 126.64 ? 339 PRO B O     1 
ATOM   4363 C CB    . PRO B 1 317 ? 3.495   -34.851 -60.361 1.00 126.64 ? 339 PRO B CB    1 
ATOM   4364 C CG    . PRO B 1 317 ? 4.337   -33.736 -60.879 1.00 126.57 ? 339 PRO B CG    1 
ATOM   4365 C CD    . PRO B 1 317 ? 4.312   -32.663 -59.811 1.00 126.53 ? 339 PRO B CD    1 
ATOM   4366 N N     . PHE B 1 318 ? 2.695   -34.891 -57.233 1.00 126.75 ? 340 PHE B N     1 
ATOM   4367 C CA    . PHE B 1 318 ? 2.367   -35.591 -55.983 1.00 127.01 ? 340 PHE B CA    1 
ATOM   4368 C C     . PHE B 1 318 ? 1.022   -35.170 -55.340 1.00 126.98 ? 340 PHE B C     1 
ATOM   4369 O O     . PHE B 1 318 ? 0.291   -36.027 -54.803 1.00 127.04 ? 340 PHE B O     1 
ATOM   4370 C CB    . PHE B 1 318 ? 3.525   -35.466 -54.962 1.00 127.13 ? 340 PHE B CB    1 
ATOM   4371 C CG    . PHE B 1 318 ? 3.191   -36.019 -53.595 1.00 128.00 ? 340 PHE B CG    1 
ATOM   4372 C CD1   . PHE B 1 318 ? 2.936   -35.156 -52.522 1.00 128.89 ? 340 PHE B CD1   1 
ATOM   4373 C CD2   . PHE B 1 318 ? 3.113   -37.401 -53.383 1.00 128.66 ? 340 PHE B CD2   1 
ATOM   4374 C CE1   . PHE B 1 318 ? 2.615   -35.658 -51.248 1.00 129.46 ? 340 PHE B CE1   1 
ATOM   4375 C CE2   . PHE B 1 318 ? 2.791   -37.919 -52.119 1.00 129.38 ? 340 PHE B CE2   1 
ATOM   4376 C CZ    . PHE B 1 318 ? 2.543   -37.044 -51.046 1.00 129.60 ? 340 PHE B CZ    1 
ATOM   4377 N N     . VAL B 1 319 ? 0.706   -33.869 -55.388 1.00 126.86 ? 341 VAL B N     1 
ATOM   4378 C CA    . VAL B 1 319 ? -0.540  -33.329 -54.792 1.00 126.63 ? 341 VAL B CA    1 
ATOM   4379 C C     . VAL B 1 319 ? -1.787  -33.578 -55.672 1.00 126.53 ? 341 VAL B C     1 
ATOM   4380 O O     . VAL B 1 319 ? -2.906  -33.771 -55.150 1.00 126.28 ? 341 VAL B O     1 
ATOM   4381 C CB    . VAL B 1 319 ? -0.417  -31.819 -54.465 1.00 126.58 ? 341 VAL B CB    1 
ATOM   4382 C CG1   . VAL B 1 319 ? -1.497  -31.403 -53.473 1.00 126.43 ? 341 VAL B CG1   1 
ATOM   4383 C CG2   . VAL B 1 319 ? 0.951   -31.519 -53.897 1.00 126.38 ? 341 VAL B CG2   1 
ATOM   4384 N N     . ILE B 1 320 ? -1.575  -33.568 -56.999 1.00 126.43 ? 342 ILE B N     1 
ATOM   4385 C CA    . ILE B 1 320 ? -2.607  -33.928 -57.992 1.00 126.31 ? 342 ILE B CA    1 
ATOM   4386 C C     . ILE B 1 320 ? -3.072  -35.400 -57.871 1.00 126.39 ? 342 ILE B C     1 
ATOM   4387 O O     . ILE B 1 320 ? -4.282  -35.661 -57.793 1.00 126.33 ? 342 ILE B O     1 
ATOM   4388 C CB    . ILE B 1 320 ? -2.130  -33.636 -59.447 1.00 126.19 ? 342 ILE B CB    1 
ATOM   4389 C CG1   . ILE B 1 320 ? -1.536  -32.222 -59.543 1.00 125.88 ? 342 ILE B CG1   1 
ATOM   4390 C CG2   . ILE B 1 320 ? -3.271  -33.868 -60.461 1.00 126.07 ? 342 ILE B CG2   1 
ATOM   4391 C CD1   . ILE B 1 320 ? -0.514  -32.038 -60.654 1.00 125.60 ? 342 ILE B CD1   1 
ATOM   4392 N N     . ASN B 1 321 ? -2.108  -36.337 -57.862 1.00 126.37 ? 343 ASN B N     1 
ATOM   4393 C CA    . ASN B 1 321 ? -2.360  -37.779 -57.638 1.00 126.29 ? 343 ASN B CA    1 
ATOM   4394 C C     . ASN B 1 321 ? -2.976  -38.072 -56.279 1.00 125.99 ? 343 ASN B C     1 
ATOM   4395 O O     . ASN B 1 321 ? -3.693  -39.077 -56.123 1.00 125.93 ? 343 ASN B O     1 
ATOM   4396 C CB    . ASN B 1 321 ? -1.080  -38.605 -57.801 1.00 126.38 ? 343 ASN B CB    1 
ATOM   4397 C CG    . ASN B 1 321 ? -0.582  -38.637 -59.240 1.00 127.39 ? 343 ASN B CG    1 
ATOM   4398 O OD1   . ASN B 1 321 ? -1.286  -38.228 -60.166 1.00 128.36 ? 343 ASN B OD1   1 
ATOM   4399 N ND2   . ASN B 1 321 ? 0.643   -39.123 -59.430 1.00 128.68 ? 343 ASN B ND2   1 
ATOM   4400 N N     . ASN B 1 322 ? -2.681  -37.195 -55.305 1.00 125.69 ? 344 ASN B N     1 
ATOM   4401 C CA    . ASN B 1 322 ? -3.370  -37.198 -54.017 1.00 125.61 ? 344 ASN B CA    1 
ATOM   4402 C C     . ASN B 1 322 ? -4.818  -36.682 -54.105 1.00 125.61 ? 344 ASN B C     1 
ATOM   4403 O O     . ASN B 1 322 ? -5.728  -37.256 -53.446 1.00 125.68 ? 344 ASN B O     1 
ATOM   4404 C CB    . ASN B 1 322 ? -2.588  -36.395 -52.969 1.00 125.49 ? 344 ASN B CB    1 
ATOM   4405 C CG    . ASN B 1 322 ? -1.234  -37.005 -52.646 1.00 125.46 ? 344 ASN B CG    1 
ATOM   4406 O OD1   . ASN B 1 322 ? -0.880  -38.090 -53.127 1.00 125.07 ? 344 ASN B OD1   1 
ATOM   4407 N ND2   . ASN B 1 322 ? -0.459  -36.295 -51.830 1.00 125.69 ? 344 ASN B ND2   1 
ATOM   4408 N N     . THR B 1 323 ? -5.030  -35.613 -54.903 1.00 125.52 ? 345 THR B N     1 
ATOM   4409 C CA    . THR B 1 323 ? -6.385  -35.059 -55.133 1.00 125.43 ? 345 THR B CA    1 
ATOM   4410 C C     . THR B 1 323 ? -7.270  -36.096 -55.833 1.00 125.56 ? 345 THR B C     1 
ATOM   4411 O O     . THR B 1 323 ? -8.477  -36.187 -55.541 1.00 125.38 ? 345 THR B O     1 
ATOM   4412 C CB    . THR B 1 323 ? -6.358  -33.750 -55.985 1.00 125.36 ? 345 THR B CB    1 
ATOM   4413 O OG1   . THR B 1 323 ? -5.343  -32.867 -55.490 1.00 125.07 ? 345 THR B OG1   1 
ATOM   4414 C CG2   . THR B 1 323 ? -7.722  -33.036 -55.959 1.00 124.92 ? 345 THR B CG2   1 
ATOM   4415 N N     . GLN B 1 324 ? -6.629  -36.872 -56.736 1.00 125.74 ? 346 GLN B N     1 
ATOM   4416 C CA    . GLN B 1 324 ? -7.250  -37.945 -57.544 1.00 125.92 ? 346 GLN B CA    1 
ATOM   4417 C C     . GLN B 1 324 ? -7.668  -39.221 -56.768 1.00 126.20 ? 346 GLN B C     1 
ATOM   4418 O O     . GLN B 1 324 ? -8.762  -39.755 -57.022 1.00 126.16 ? 346 GLN B O     1 
ATOM   4419 C CB    . GLN B 1 324 ? -6.350  -38.308 -58.751 1.00 125.76 ? 346 GLN B CB    1 
ATOM   4420 C CG    . GLN B 1 324 ? -6.180  -37.191 -59.808 1.00 125.37 ? 346 GLN B CG    1 
ATOM   4421 C CD    . GLN B 1 324 ? -7.504  -36.723 -60.426 1.00 125.33 ? 346 GLN B CD    1 
ATOM   4422 O OE1   . GLN B 1 324 ? -8.366  -37.536 -60.783 1.00 125.28 ? 346 GLN B OE1   1 
ATOM   4423 N NE2   . GLN B 1 324 ? -7.664  -35.406 -60.558 1.00 125.08 ? 346 GLN B NE2   1 
ATOM   4424 N N     . ARG B 1 325 ? -6.810  -39.710 -55.853 1.00 126.58 ? 347 ARG B N     1 
ATOM   4425 C CA    . ARG B 1 325 ? -7.154  -40.846 -54.954 1.00 127.05 ? 347 ARG B CA    1 
ATOM   4426 C C     . ARG B 1 325 ? -8.309  -40.526 -53.987 1.00 127.30 ? 347 ARG B C     1 
ATOM   4427 O O     . ARG B 1 325 ? -9.089  -41.419 -53.632 1.00 127.16 ? 347 ARG B O     1 
ATOM   4428 C CB    . ARG B 1 325 ? -5.941  -41.310 -54.126 1.00 127.05 ? 347 ARG B CB    1 
ATOM   4429 C CG    . ARG B 1 325 ? -4.761  -41.879 -54.920 1.00 127.75 ? 347 ARG B CG    1 
ATOM   4430 C CD    . ARG B 1 325 ? -3.778  -42.656 -54.026 1.00 129.05 ? 347 ARG B CD    1 
ATOM   4431 N NE    . ARG B 1 325 ? -3.424  -41.960 -52.782 1.00 130.21 ? 347 ARG B NE    1 
ATOM   4432 C CZ    . ARG B 1 325 ? -2.322  -41.224 -52.597 1.00 130.91 ? 347 ARG B CZ    1 
ATOM   4433 N NH1   . ARG B 1 325 ? -1.430  -41.057 -53.580 1.00 131.16 ? 347 ARG B NH1   1 
ATOM   4434 N NH2   . ARG B 1 325 ? -2.113  -40.644 -51.417 1.00 131.10 ? 347 ARG B NH2   1 
ATOM   4435 N N     . VAL B 1 326 ? -8.383  -39.259 -53.557 1.00 127.84 ? 348 VAL B N     1 
ATOM   4436 C CA    . VAL B 1 326 ? -9.443  -38.733 -52.669 1.00 128.33 ? 348 VAL B CA    1 
ATOM   4437 C C     . VAL B 1 326 ? -10.821 -38.602 -53.366 1.00 128.83 ? 348 VAL B C     1 
ATOM   4438 O O     . VAL B 1 326 ? -11.848 -38.947 -52.773 1.00 128.75 ? 348 VAL B O     1 
ATOM   4439 C CB    . VAL B 1 326 ? -9.007  -37.376 -51.966 1.00 128.32 ? 348 VAL B CB    1 
ATOM   4440 C CG1   . VAL B 1 326 ? -10.218 -36.633 -51.375 1.00 128.10 ? 348 VAL B CG1   1 
ATOM   4441 C CG2   . VAL B 1 326 ? -7.962  -37.643 -50.845 1.00 127.85 ? 348 VAL B CG2   1 
ATOM   4442 N N     . LEU B 1 327 ? -10.840 -38.106 -54.609 1.00 129.61 ? 349 LEU B N     1 
ATOM   4443 C CA    . LEU B 1 327 ? -12.057 -38.108 -55.450 1.00 130.50 ? 349 LEU B CA    1 
ATOM   4444 C C     . LEU B 1 327 ? -12.533 -39.536 -55.809 1.00 131.67 ? 349 LEU B C     1 
ATOM   4445 O O     . LEU B 1 327 ? -13.717 -39.749 -56.093 1.00 131.57 ? 349 LEU B O     1 
ATOM   4446 C CB    . LEU B 1 327 ? -11.855 -37.286 -56.740 1.00 130.05 ? 349 LEU B CB    1 
ATOM   4447 C CG    . LEU B 1 327 ? -11.474 -35.788 -56.719 1.00 128.98 ? 349 LEU B CG    1 
ATOM   4448 C CD1   . LEU B 1 327 ? -11.160 -35.302 -58.158 1.00 127.65 ? 349 LEU B CD1   1 
ATOM   4449 C CD2   . LEU B 1 327 ? -12.565 -34.936 -56.083 1.00 127.45 ? 349 LEU B CD2   1 
ATOM   4450 N N     . LYS B 1 328 ? -11.601 -40.496 -55.800 1.00 133.33 ? 350 LYS B N     1 
ATOM   4451 C CA    . LYS B 1 328 ? -11.889 -41.917 -56.076 1.00 135.00 ? 350 LYS B CA    1 
ATOM   4452 C C     . LYS B 1 328 ? -12.412 -42.677 -54.848 1.00 136.07 ? 350 LYS B C     1 
ATOM   4453 O O     . LYS B 1 328 ? -13.086 -43.704 -54.996 1.00 136.34 ? 350 LYS B O     1 
ATOM   4454 C CB    . LYS B 1 328 ? -10.646 -42.627 -56.636 1.00 135.02 ? 350 LYS B CB    1 
ATOM   4455 C CG    . LYS B 1 328 ? -10.374 -42.357 -58.122 1.00 135.80 ? 350 LYS B CG    1 
ATOM   4456 C CD    . LYS B 1 328 ? -8.941  -42.734 -58.495 1.00 137.00 ? 350 LYS B CD    1 
ATOM   4457 C CE    . LYS B 1 328 ? -8.562  -42.243 -59.897 1.00 137.50 ? 350 LYS B CE    1 
ATOM   4458 N NZ    . LYS B 1 328 ? -7.054  -42.195 -60.025 1.00 138.06 ? 350 LYS B NZ    1 
ATOM   4459 N N     . GLY B 1 329 ? -12.094 -42.178 -53.644 1.00 137.29 ? 351 GLY B N     1 
ATOM   4460 C CA    . GLY B 1 329 ? -12.607 -42.755 -52.400 1.00 138.82 ? 351 GLY B CA    1 
ATOM   4461 C C     . GLY B 1 329 ? -11.616 -43.631 -51.642 1.00 139.91 ? 351 GLY B C     1 
ATOM   4462 O O     . GLY B 1 329 ? -12.001 -44.675 -51.087 1.00 140.13 ? 351 GLY B O     1 
ATOM   4463 N N     . ASP B 1 330 ? -10.342 -43.204 -51.610 1.00 140.85 ? 352 ASP B N     1 
ATOM   4464 C CA    . ASP B 1 330 ? -9.297  -43.924 -50.869 1.00 141.67 ? 352 ASP B CA    1 
ATOM   4465 C C     . ASP B 1 330 ? -9.254  -43.444 -49.407 1.00 141.76 ? 352 ASP B C     1 
ATOM   4466 O O     . ASP B 1 330 ? -9.449  -44.312 -48.477 1.00 141.95 ? 352 ASP B O     1 
ATOM   4467 C CB    . ASP B 1 330 ? -7.919  -43.726 -51.540 1.00 141.98 ? 352 ASP B CB    1 
ATOM   4468 C CG    . ASP B 1 330 ? -7.884  -44.196 -53.013 1.00 142.88 ? 352 ASP B CG    1 
ATOM   4469 O OD1   . ASP B 1 330 ? -8.944  -44.562 -53.578 1.00 143.99 ? 352 ASP B OD1   1 
ATOM   4470 O OD2   . ASP B 1 330 ? -6.784  -44.192 -53.614 1.00 143.62 ? 352 ASP B OD2   1 
ATOM   4471 N N     . VAL C 1 39  ? -51.272 -44.906 -37.109 1.00 145.35 ? 61  VAL C N     1 
ATOM   4472 C CA    . VAL C 1 39  ? -51.386 -44.206 -38.444 1.00 145.28 ? 61  VAL C CA    1 
ATOM   4473 C C     . VAL C 1 39  ? -51.429 -42.687 -38.232 1.00 144.97 ? 61  VAL C C     1 
ATOM   4474 O O     . VAL C 1 39  ? -52.484 -42.105 -38.000 1.00 144.88 ? 61  VAL C O     1 
ATOM   4475 C CB    . VAL C 1 39  ? -52.552 -44.647 -39.379 1.00 145.38 ? 61  VAL C CB    1 
ATOM   4476 C CG1   . VAL C 1 39  ? -52.392 -44.018 -40.788 1.00 145.65 ? 61  VAL C CG1   1 
ATOM   4477 C CG2   . VAL C 1 39  ? -52.543 -46.182 -39.491 1.00 145.60 ? 61  VAL C CG2   1 
ATOM   4478 N N     . TYR C 1 40  ? -50.264 -42.053 -38.314 1.00 144.68 ? 62  TYR C N     1 
ATOM   4479 C CA    . TYR C 1 40  ? -50.148 -40.636 -38.003 1.00 144.41 ? 62  TYR C CA    1 
ATOM   4480 C C     . TYR C 1 40  ? -50.061 -39.795 -39.271 1.00 143.84 ? 62  TYR C C     1 
ATOM   4481 O O     . TYR C 1 40  ? -49.202 -40.030 -40.126 1.00 143.99 ? 62  TYR C O     1 
ATOM   4482 C CB    . TYR C 1 40  ? -48.923 -40.384 -37.105 1.00 144.80 ? 62  TYR C CB    1 
ATOM   4483 C CG    . TYR C 1 40  ? -48.942 -41.123 -35.769 1.00 145.66 ? 62  TYR C CG    1 
ATOM   4484 C CD1   . TYR C 1 40  ? -49.616 -40.588 -34.659 1.00 146.30 ? 62  TYR C CD1   1 
ATOM   4485 C CD2   . TYR C 1 40  ? -48.274 -42.348 -35.610 1.00 146.39 ? 62  TYR C CD2   1 
ATOM   4486 C CE1   . TYR C 1 40  ? -49.636 -41.256 -33.427 1.00 146.59 ? 62  TYR C CE1   1 
ATOM   4487 C CE2   . TYR C 1 40  ? -48.289 -43.026 -34.381 1.00 146.80 ? 62  TYR C CE2   1 
ATOM   4488 C CZ    . TYR C 1 40  ? -48.973 -42.472 -33.297 1.00 146.84 ? 62  TYR C CZ    1 
ATOM   4489 O OH    . TYR C 1 40  ? -48.993 -43.130 -32.086 1.00 146.88 ? 62  TYR C OH    1 
ATOM   4490 N N     . ARG C 1 41  ? -50.953 -38.815 -39.383 1.00 143.00 ? 63  ARG C N     1 
ATOM   4491 C CA    . ARG C 1 41  ? -50.954 -37.890 -40.515 1.00 142.34 ? 63  ARG C CA    1 
ATOM   4492 C C     . ARG C 1 41  ? -50.150 -36.627 -40.227 1.00 141.35 ? 63  ARG C C     1 
ATOM   4493 O O     . ARG C 1 41  ? -50.014 -36.219 -39.070 1.00 141.39 ? 63  ARG C O     1 
ATOM   4494 C CB    . ARG C 1 41  ? -52.383 -37.520 -40.898 1.00 142.71 ? 63  ARG C CB    1 
ATOM   4495 C CG    . ARG C 1 41  ? -53.046 -38.557 -41.767 1.00 144.22 ? 63  ARG C CG    1 
ATOM   4496 C CD    . ARG C 1 41  ? -54.164 -38.020 -42.380 1.00 146.38 ? 63  ARG C CD    1 
ATOM   4497 N NE    . ARG C 1 41  ? -54.247 -38.587 -43.719 1.00 147.99 ? 63  ARG C NE    1 
ATOM   4498 C CZ    . ARG C 1 41  ? -54.816 -39.764 -43.953 1.00 148.91 ? 63  ARG C CZ    1 
ATOM   4499 N NH1   . ARG C 1 41  ? -55.374 -40.519 -42.934 1.00 149.17 ? 63  ARG C NH1   1 
ATOM   4500 N NH2   . ARG C 1 41  ? -54.826 -40.188 -45.214 1.00 149.57 ? 63  ARG C NH2   1 
ATOM   4501 N N     . TYR C 1 42  ? -49.635 -35.998 -41.284 1.00 140.11 ? 64  TYR C N     1 
ATOM   4502 C CA    . TYR C 1 42  ? -48.708 -34.861 -41.098 1.00 138.89 ? 64  TYR C CA    1 
ATOM   4503 C C     . TYR C 1 42  ? -48.689 -33.849 -42.253 1.00 137.85 ? 64  TYR C C     1 
ATOM   4504 O O     . TYR C 1 42  ? -48.737 -34.228 -43.426 1.00 137.73 ? 64  TYR C O     1 
ATOM   4505 C CB    . TYR C 1 42  ? -47.265 -35.393 -40.851 1.00 139.04 ? 64  TYR C CB    1 
ATOM   4506 C CG    . TYR C 1 42  ? -46.534 -35.847 -42.128 1.00 139.32 ? 64  TYR C CG    1 
ATOM   4507 C CD1   . TYR C 1 42  ? -45.477 -35.057 -42.640 1.00 139.33 ? 64  TYR C CD1   1 
ATOM   4508 C CD2   . TYR C 1 42  ? -46.829 -37.071 -42.817 1.00 139.28 ? 64  TYR C CD2   1 
ATOM   4509 C CE1   . TYR C 1 42  ? -44.786 -35.470 -43.800 1.00 138.91 ? 64  TYR C CE1   1 
ATOM   4510 C CE2   . TYR C 1 42  ? -46.047 -37.488 -43.905 1.00 139.11 ? 64  TYR C CE2   1 
ATOM   4511 C CZ    . TYR C 1 42  ? -45.098 -36.681 -44.463 1.00 138.92 ? 64  TYR C CZ    1 
ATOM   4512 O OH    . TYR C 1 42  ? -44.320 -37.084 -45.541 1.00 138.89 ? 64  TYR C OH    1 
ATOM   4513 N N     . GLY C 1 43  ? -48.587 -32.556 -41.910 1.00 136.65 ? 65  GLY C N     1 
ATOM   4514 C CA    . GLY C 1 43  ? -48.510 -31.489 -42.913 1.00 135.28 ? 65  GLY C CA    1 
ATOM   4515 C C     . GLY C 1 43  ? -48.393 -30.096 -42.316 1.00 134.39 ? 65  GLY C C     1 
ATOM   4516 O O     . GLY C 1 43  ? -48.561 -29.879 -41.098 1.00 134.30 ? 65  GLY C O     1 
ATOM   4517 N N     . LYS C 1 44  ? -48.096 -29.163 -43.221 1.00 133.67 ? 66  LYS C N     1 
ATOM   4518 C CA    . LYS C 1 44  ? -48.061 -27.715 -42.987 1.00 133.14 ? 66  LYS C CA    1 
ATOM   4519 C C     . LYS C 1 44  ? -48.714 -27.248 -41.692 1.00 132.39 ? 66  LYS C C     1 
ATOM   4520 O O     . LYS C 1 44  ? -48.091 -26.585 -40.841 1.00 132.15 ? 66  LYS C O     1 
ATOM   4521 C CB    . LYS C 1 44  ? -48.854 -27.074 -44.134 1.00 133.53 ? 66  LYS C CB    1 
ATOM   4522 C CG    . LYS C 1 44  ? -48.161 -25.972 -44.913 1.00 134.92 ? 66  LYS C CG    1 
ATOM   4523 C CD    . LYS C 1 44  ? -48.669 -25.960 -46.375 1.00 137.53 ? 66  LYS C CD    1 
ATOM   4524 C CE    . LYS C 1 44  ? -50.137 -25.485 -46.512 1.00 138.75 ? 66  LYS C CE    1 
ATOM   4525 N NZ    . LYS C 1 44  ? -50.714 -25.783 -47.862 1.00 139.61 ? 66  LYS C NZ    1 
ATOM   4526 N N     . ALA C 1 45  ? -49.997 -27.599 -41.573 1.00 131.71 ? 67  ALA C N     1 
ATOM   4527 C CA    . ALA C 1 45  ? -50.881 -26.953 -40.629 1.00 130.95 ? 67  ALA C CA    1 
ATOM   4528 C C     . ALA C 1 45  ? -50.838 -27.625 -39.275 1.00 130.35 ? 67  ALA C C     1 
ATOM   4529 O O     . ALA C 1 45  ? -51.436 -27.130 -38.307 1.00 130.34 ? 67  ALA C O     1 
ATOM   4530 C CB    . ALA C 1 45  ? -52.296 -26.980 -41.176 1.00 130.92 ? 67  ALA C CB    1 
ATOM   4531 N N     . MET C 1 46  ? -50.147 -28.762 -39.205 1.00 129.51 ? 68  MET C N     1 
ATOM   4532 C CA    . MET C 1 46  ? -50.200 -29.563 -38.003 1.00 128.77 ? 68  MET C CA    1 
ATOM   4533 C C     . MET C 1 46  ? -49.596 -28.807 -36.820 1.00 128.20 ? 68  MET C C     1 
ATOM   4534 O O     . MET C 1 46  ? -48.860 -27.822 -37.013 1.00 128.08 ? 68  MET C O     1 
ATOM   4535 C CB    . MET C 1 46  ? -49.596 -30.956 -38.217 1.00 128.79 ? 68  MET C CB    1 
ATOM   4536 C CG    . MET C 1 46  ? -48.079 -31.005 -38.230 1.00 128.92 ? 68  MET C CG    1 
ATOM   4537 S SD    . MET C 1 46  ? -47.477 -32.658 -38.632 1.00 128.42 ? 68  MET C SD    1 
ATOM   4538 C CE    . MET C 1 46  ? -47.986 -33.611 -37.196 1.00 129.20 ? 68  MET C CE    1 
ATOM   4539 N N     . PRO C 1 47  ? -49.944 -29.236 -35.593 1.00 127.60 ? 69  PRO C N     1 
ATOM   4540 C CA    . PRO C 1 47  ? -49.490 -28.502 -34.436 1.00 126.99 ? 69  PRO C CA    1 
ATOM   4541 C C     . PRO C 1 47  ? -48.053 -28.880 -34.130 1.00 126.26 ? 69  PRO C C     1 
ATOM   4542 O O     . PRO C 1 47  ? -47.759 -30.026 -33.697 1.00 126.16 ? 69  PRO C O     1 
ATOM   4543 C CB    . PRO C 1 47  ? -50.459 -28.942 -33.333 1.00 127.15 ? 69  PRO C CB    1 
ATOM   4544 C CG    . PRO C 1 47  ? -50.975 -30.285 -33.762 1.00 127.41 ? 69  PRO C CG    1 
ATOM   4545 C CD    . PRO C 1 47  ? -50.669 -30.470 -35.220 1.00 127.63 ? 69  PRO C CD    1 
ATOM   4546 N N     . LEU C 1 48  ? -47.164 -27.906 -34.391 1.00 125.42 ? 70  LEU C N     1 
ATOM   4547 C CA    . LEU C 1 48  ? -45.753 -28.139 -34.198 1.00 124.61 ? 70  LEU C CA    1 
ATOM   4548 C C     . LEU C 1 48  ? -45.232 -27.331 -33.039 1.00 123.82 ? 70  LEU C C     1 
ATOM   4549 O O     . LEU C 1 48  ? -45.772 -26.269 -32.708 1.00 123.72 ? 70  LEU C O     1 
ATOM   4550 C CB    . LEU C 1 48  ? -44.990 -27.789 -35.468 1.00 124.80 ? 70  LEU C CB    1 
ATOM   4551 C CG    . LEU C 1 48  ? -45.369 -28.692 -36.649 1.00 125.16 ? 70  LEU C CG    1 
ATOM   4552 C CD1   . LEU C 1 48  ? -44.840 -28.111 -37.947 1.00 125.82 ? 70  LEU C CD1   1 
ATOM   4553 C CD2   . LEU C 1 48  ? -44.854 -30.112 -36.434 1.00 125.58 ? 70  LEU C CD2   1 
ATOM   4554 N N     . ILE C 1 49  ? -44.185 -27.853 -32.410 1.00 122.84 ? 71  ILE C N     1 
ATOM   4555 C CA    . ILE C 1 49  ? -43.562 -27.147 -31.313 1.00 121.92 ? 71  ILE C CA    1 
ATOM   4556 C C     . ILE C 1 49  ? -42.113 -26.884 -31.633 1.00 121.35 ? 71  ILE C C     1 
ATOM   4557 O O     . ILE C 1 49  ? -41.336 -27.797 -31.923 1.00 121.07 ? 71  ILE C O     1 
ATOM   4558 C CB    . ILE C 1 49  ? -43.651 -27.909 -29.982 1.00 121.87 ? 71  ILE C CB    1 
ATOM   4559 C CG1   . ILE C 1 49  ? -45.029 -28.582 -29.838 1.00 122.05 ? 71  ILE C CG1   1 
ATOM   4560 C CG2   . ILE C 1 49  ? -43.416 -26.939 -28.814 1.00 121.57 ? 71  ILE C CG2   1 
ATOM   4561 C CD1   . ILE C 1 49  ? -45.066 -29.694 -28.805 1.00 122.31 ? 71  ILE C CD1   1 
ATOM   4562 N N     . PHE C 1 50  ? -41.761 -25.611 -31.583 1.00 120.80 ? 72  PHE C N     1 
ATOM   4563 C CA    . PHE C 1 50  ? -40.393 -25.213 -31.776 1.00 120.44 ? 72  PHE C CA    1 
ATOM   4564 C C     . PHE C 1 50  ? -39.813 -24.751 -30.476 1.00 120.33 ? 72  PHE C C     1 
ATOM   4565 O O     . PHE C 1 50  ? -40.270 -23.770 -29.893 1.00 120.46 ? 72  PHE C O     1 
ATOM   4566 C CB    . PHE C 1 50  ? -40.306 -24.092 -32.794 1.00 120.44 ? 72  PHE C CB    1 
ATOM   4567 C CG    . PHE C 1 50  ? -40.625 -24.527 -34.175 1.00 120.32 ? 72  PHE C CG    1 
ATOM   4568 C CD1   . PHE C 1 50  ? -39.744 -25.340 -34.874 1.00 120.37 ? 72  PHE C CD1   1 
ATOM   4569 C CD2   . PHE C 1 50  ? -41.812 -24.147 -34.772 1.00 120.13 ? 72  PHE C CD2   1 
ATOM   4570 C CE1   . PHE C 1 50  ? -40.037 -25.760 -36.145 1.00 120.21 ? 72  PHE C CE1   1 
ATOM   4571 C CE2   . PHE C 1 50  ? -42.114 -24.559 -36.041 1.00 120.10 ? 72  PHE C CE2   1 
ATOM   4572 C CZ    . PHE C 1 50  ? -41.226 -25.370 -36.733 1.00 120.35 ? 72  PHE C CZ    1 
ATOM   4573 N N     . VAL C 1 51  ? -38.805 -25.468 -30.012 1.00 120.16 ? 73  VAL C N     1 
ATOM   4574 C CA    . VAL C 1 51  ? -38.071 -25.029 -28.845 1.00 119.99 ? 73  VAL C CA    1 
ATOM   4575 C C     . VAL C 1 51  ? -36.742 -24.440 -29.297 1.00 119.77 ? 73  VAL C C     1 
ATOM   4576 O O     . VAL C 1 51  ? -36.061 -24.988 -30.184 1.00 119.61 ? 73  VAL C O     1 
ATOM   4577 C CB    . VAL C 1 51  ? -37.864 -26.169 -27.834 1.00 120.10 ? 73  VAL C CB    1 
ATOM   4578 C CG1   . VAL C 1 51  ? -37.347 -25.623 -26.500 1.00 119.92 ? 73  VAL C CG1   1 
ATOM   4579 C CG2   . VAL C 1 51  ? -39.177 -26.926 -27.626 1.00 120.11 ? 73  VAL C CG2   1 
ATOM   4580 N N     . GLY C 1 52  ? -36.395 -23.305 -28.697 1.00 119.57 ? 74  GLY C N     1 
ATOM   4581 C CA    . GLY C 1 52  ? -35.149 -22.641 -29.006 1.00 119.44 ? 74  GLY C CA    1 
ATOM   4582 C C     . GLY C 1 52  ? -34.818 -21.595 -27.968 1.00 119.39 ? 74  GLY C C     1 
ATOM   4583 O O     . GLY C 1 52  ? -35.493 -21.487 -26.933 1.00 119.59 ? 74  GLY C O     1 
ATOM   4584 N N     . GLY C 1 53  ? -33.784 -20.808 -28.271 1.00 119.33 ? 75  GLY C N     1 
ATOM   4585 C CA    . GLY C 1 53  ? -33.186 -19.885 -27.311 1.00 119.12 ? 75  GLY C CA    1 
ATOM   4586 C C     . GLY C 1 53  ? -31.676 -19.954 -27.456 1.00 119.00 ? 75  GLY C C     1 
ATOM   4587 O O     . GLY C 1 53  ? -31.158 -20.837 -28.148 1.00 119.01 ? 75  GLY C O     1 
ATOM   4588 N N     . VAL C 1 54  ? -30.968 -19.022 -26.818 1.00 118.77 ? 76  VAL C N     1 
ATOM   4589 C CA    . VAL C 1 54  ? -29.504 -19.056 -26.787 1.00 118.43 ? 76  VAL C CA    1 
ATOM   4590 C C     . VAL C 1 54  ? -29.057 -20.396 -26.166 1.00 118.29 ? 76  VAL C C     1 
ATOM   4591 O O     . VAL C 1 54  ? -29.554 -20.779 -25.107 1.00 118.20 ? 76  VAL C O     1 
ATOM   4592 C CB    . VAL C 1 54  ? -28.917 -17.824 -26.031 1.00 118.41 ? 76  VAL C CB    1 
ATOM   4593 C CG1   . VAL C 1 54  ? -27.378 -17.911 -25.922 1.00 118.19 ? 76  VAL C CG1   1 
ATOM   4594 C CG2   . VAL C 1 54  ? -29.350 -16.511 -26.724 1.00 117.94 ? 76  VAL C CG2   1 
ATOM   4595 N N     . PRO C 1 55  ? -28.155 -21.134 -26.848 1.00 118.12 ? 77  PRO C N     1 
ATOM   4596 C CA    . PRO C 1 55  ? -27.713 -22.416 -26.324 1.00 118.00 ? 77  PRO C CA    1 
ATOM   4597 C C     . PRO C 1 55  ? -27.257 -22.276 -24.897 1.00 117.93 ? 77  PRO C C     1 
ATOM   4598 O O     . PRO C 1 55  ? -26.979 -21.167 -24.436 1.00 117.93 ? 77  PRO C O     1 
ATOM   4599 C CB    . PRO C 1 55  ? -26.521 -22.761 -27.210 1.00 117.95 ? 77  PRO C CB    1 
ATOM   4600 C CG    . PRO C 1 55  ? -26.855 -22.158 -28.497 1.00 118.02 ? 77  PRO C CG    1 
ATOM   4601 C CD    . PRO C 1 55  ? -27.538 -20.852 -28.158 1.00 118.19 ? 77  PRO C CD    1 
ATOM   4602 N N     . ARG C 1 56  ? -27.176 -23.403 -24.209 1.00 117.92 ? 78  ARG C N     1 
ATOM   4603 C CA    . ARG C 1 56  ? -26.867 -23.421 -22.788 1.00 118.03 ? 78  ARG C CA    1 
ATOM   4604 C C     . ARG C 1 56  ? -27.966 -22.692 -22.001 1.00 117.94 ? 78  ARG C C     1 
ATOM   4605 O O     . ARG C 1 56  ? -27.715 -22.162 -20.917 1.00 117.87 ? 78  ARG C O     1 
ATOM   4606 C CB    . ARG C 1 56  ? -25.463 -22.849 -22.495 1.00 118.18 ? 78  ARG C CB    1 
ATOM   4607 C CG    . ARG C 1 56  ? -24.337 -23.207 -23.513 1.00 118.56 ? 78  ARG C CG    1 
ATOM   4608 C CD    . ARG C 1 56  ? -24.270 -24.689 -23.927 1.00 119.18 ? 78  ARG C CD    1 
ATOM   4609 N NE    . ARG C 1 56  ? -24.201 -25.602 -22.786 1.00 120.05 ? 78  ARG C NE    1 
ATOM   4610 C CZ    . ARG C 1 56  ? -24.574 -26.881 -22.819 1.00 120.40 ? 78  ARG C CZ    1 
ATOM   4611 N NH1   . ARG C 1 56  ? -25.047 -27.410 -23.938 1.00 120.73 ? 78  ARG C NH1   1 
ATOM   4612 N NH2   . ARG C 1 56  ? -24.486 -27.634 -21.727 1.00 120.46 ? 78  ARG C NH2   1 
ATOM   4613 N N     . SER C 1 57  ? -29.180 -22.674 -22.562 1.00 117.87 ? 79  SER C N     1 
ATOM   4614 C CA    . SER C 1 57  ? -30.356 -22.137 -21.871 1.00 117.77 ? 79  SER C CA    1 
ATOM   4615 C C     . SER C 1 57  ? -31.340 -23.235 -21.498 1.00 117.68 ? 79  SER C C     1 
ATOM   4616 O O     . SER C 1 57  ? -32.532 -22.983 -21.351 1.00 117.61 ? 79  SER C O     1 
ATOM   4617 C CB    . SER C 1 57  ? -31.054 -21.072 -22.713 1.00 117.76 ? 79  SER C CB    1 
ATOM   4618 O OG    . SER C 1 57  ? -30.231 -19.932 -22.863 1.00 117.87 ? 79  SER C OG    1 
ATOM   4619 N N     . GLY C 1 58  ? -30.823 -24.450 -21.345 1.00 117.69 ? 80  GLY C N     1 
ATOM   4620 C CA    . GLY C 1 58  ? -31.611 -25.599 -20.908 1.00 117.80 ? 80  GLY C CA    1 
ATOM   4621 C C     . GLY C 1 58  ? -32.587 -26.073 -21.956 1.00 117.89 ? 80  GLY C C     1 
ATOM   4622 O O     . GLY C 1 58  ? -33.618 -26.687 -21.645 1.00 117.85 ? 80  GLY C O     1 
ATOM   4623 N N     . THR C 1 59  ? -32.260 -25.783 -23.207 1.00 117.99 ? 81  THR C N     1 
ATOM   4624 C CA    . THR C 1 59  ? -33.139 -26.117 -24.300 1.00 118.26 ? 81  THR C CA    1 
ATOM   4625 C C     . THR C 1 59  ? -33.226 -27.624 -24.485 1.00 118.41 ? 81  THR C C     1 
ATOM   4626 O O     . THR C 1 59  ? -34.276 -28.142 -24.844 1.00 118.70 ? 81  THR C O     1 
ATOM   4627 C CB    . THR C 1 59  ? -32.694 -25.460 -25.602 1.00 118.22 ? 81  THR C CB    1 
ATOM   4628 O OG1   . THR C 1 59  ? -31.356 -25.863 -25.888 1.00 118.66 ? 81  THR C OG1   1 
ATOM   4629 C CG2   . THR C 1 59  ? -32.732 -23.945 -25.481 1.00 118.21 ? 81  THR C CG2   1 
ATOM   4630 N N     . THR C 1 60  ? -32.140 -28.335 -24.223 1.00 118.54 ? 82  THR C N     1 
ATOM   4631 C CA    . THR C 1 60  ? -32.180 -29.781 -24.331 1.00 118.86 ? 82  THR C CA    1 
ATOM   4632 C C     . THR C 1 60  ? -33.052 -30.331 -23.231 1.00 118.94 ? 82  THR C C     1 
ATOM   4633 O O     . THR C 1 60  ? -33.750 -31.322 -23.431 1.00 118.91 ? 82  THR C O     1 
ATOM   4634 C CB    . THR C 1 60  ? -30.804 -30.411 -24.195 1.00 119.00 ? 82  THR C CB    1 
ATOM   4635 O OG1   . THR C 1 60  ? -29.845 -29.615 -24.898 1.00 119.51 ? 82  THR C OG1   1 
ATOM   4636 C CG2   . THR C 1 60  ? -30.808 -31.817 -24.781 1.00 119.23 ? 82  THR C CG2   1 
ATOM   4637 N N     . LEU C 1 61  ? -33.005 -29.675 -22.070 1.00 119.14 ? 83  LEU C N     1 
ATOM   4638 C CA    . LEU C 1 61  ? -33.816 -30.076 -20.925 1.00 119.32 ? 83  LEU C CA    1 
ATOM   4639 C C     . LEU C 1 61  ? -35.305 -29.945 -21.213 1.00 119.61 ? 83  LEU C C     1 
ATOM   4640 O O     . LEU C 1 61  ? -36.085 -30.894 -21.025 1.00 119.82 ? 83  LEU C O     1 
ATOM   4641 C CB    . LEU C 1 61  ? -33.467 -29.219 -19.715 1.00 119.22 ? 83  LEU C CB    1 
ATOM   4642 C CG    . LEU C 1 61  ? -34.280 -29.459 -18.442 1.00 118.93 ? 83  LEU C CG    1 
ATOM   4643 C CD1   . LEU C 1 61  ? -34.186 -30.919 -18.006 1.00 118.78 ? 83  LEU C CD1   1 
ATOM   4644 C CD2   . LEU C 1 61  ? -33.799 -28.519 -17.333 1.00 118.31 ? 83  LEU C CD2   1 
ATOM   4645 N N     . MET C 1 62  ? -35.690 -28.753 -21.655 1.00 119.82 ? 84  MET C N     1 
ATOM   4646 C CA    . MET C 1 62  ? -37.061 -28.467 -22.019 1.00 119.95 ? 84  MET C CA    1 
ATOM   4647 C C     . MET C 1 62  ? -37.635 -29.602 -22.851 1.00 120.02 ? 84  MET C C     1 
ATOM   4648 O O     . MET C 1 62  ? -38.571 -30.290 -22.437 1.00 119.76 ? 84  MET C O     1 
ATOM   4649 C CB    . MET C 1 62  ? -37.105 -27.162 -22.805 1.00 119.93 ? 84  MET C CB    1 
ATOM   4650 C CG    . MET C 1 62  ? -38.490 -26.654 -23.067 1.00 120.36 ? 84  MET C CG    1 
ATOM   4651 S SD    . MET C 1 62  ? -39.407 -26.371 -21.541 1.00 120.99 ? 84  MET C SD    1 
ATOM   4652 C CE    . MET C 1 62  ? -40.437 -27.850 -21.450 1.00 121.61 ? 84  MET C CE    1 
ATOM   4653 N N     . ARG C 1 63  ? -37.022 -29.810 -24.011 1.00 120.51 ? 85  ARG C N     1 
ATOM   4654 C CA    . ARG C 1 63  ? -37.481 -30.797 -24.975 1.00 121.12 ? 85  ARG C CA    1 
ATOM   4655 C C     . ARG C 1 63  ? -37.500 -32.211 -24.411 1.00 121.41 ? 85  ARG C C     1 
ATOM   4656 O O     . ARG C 1 63  ? -38.435 -32.970 -24.662 1.00 121.46 ? 85  ARG C O     1 
ATOM   4657 C CB    . ARG C 1 63  ? -36.658 -30.711 -26.282 1.00 121.22 ? 85  ARG C CB    1 
ATOM   4658 C CG    . ARG C 1 63  ? -35.211 -31.262 -26.254 1.00 121.25 ? 85  ARG C CG    1 
ATOM   4659 C CD    . ARG C 1 63  ? -35.170 -32.734 -26.661 1.00 120.93 ? 85  ARG C CD    1 
ATOM   4660 N NE    . ARG C 1 63  ? -33.840 -33.175 -27.073 1.00 120.89 ? 85  ARG C NE    1 
ATOM   4661 C CZ    . ARG C 1 63  ? -33.502 -34.451 -27.245 1.00 121.04 ? 85  ARG C CZ    1 
ATOM   4662 N NH1   . ARG C 1 63  ? -34.396 -35.426 -27.039 1.00 120.60 ? 85  ARG C NH1   1 
ATOM   4663 N NH2   . ARG C 1 63  ? -32.264 -34.750 -27.628 1.00 121.74 ? 85  ARG C NH2   1 
ATOM   4664 N N     . ALA C 1 64  ? -36.468 -32.554 -23.645 1.00 121.90 ? 86  ALA C N     1 
ATOM   4665 C CA    . ALA C 1 64  ? -36.330 -33.900 -23.116 1.00 122.34 ? 86  ALA C CA    1 
ATOM   4666 C C     . ALA C 1 64  ? -37.576 -34.251 -22.350 1.00 122.62 ? 86  ALA C C     1 
ATOM   4667 O O     . ALA C 1 64  ? -38.074 -35.367 -22.445 1.00 122.62 ? 86  ALA C O     1 
ATOM   4668 C CB    . ALA C 1 64  ? -35.121 -33.994 -22.216 1.00 122.43 ? 86  ALA C CB    1 
ATOM   4669 N N     . MET C 1 65  ? -38.081 -33.272 -21.608 1.00 123.08 ? 87  MET C N     1 
ATOM   4670 C CA    . MET C 1 65  ? -39.286 -33.450 -20.824 1.00 123.63 ? 87  MET C CA    1 
ATOM   4671 C C     . MET C 1 65  ? -40.517 -33.593 -21.708 1.00 123.79 ? 87  MET C C     1 
ATOM   4672 O O     . MET C 1 65  ? -41.431 -34.364 -21.399 1.00 123.82 ? 87  MET C O     1 
ATOM   4673 C CB    . MET C 1 65  ? -39.454 -32.291 -19.852 1.00 123.70 ? 87  MET C CB    1 
ATOM   4674 C CG    . MET C 1 65  ? -38.568 -32.415 -18.624 1.00 124.50 ? 87  MET C CG    1 
ATOM   4675 S SD    . MET C 1 65  ? -38.973 -31.201 -17.358 1.00 125.65 ? 87  MET C SD    1 
ATOM   4676 C CE    . MET C 1 65  ? -38.526 -29.703 -18.247 1.00 126.33 ? 87  MET C CE    1 
ATOM   4677 N N     . LEU C 1 66  ? -40.530 -32.861 -22.818 1.00 123.97 ? 88  LEU C N     1 
ATOM   4678 C CA    . LEU C 1 66  ? -41.637 -32.962 -23.731 1.00 124.14 ? 88  LEU C CA    1 
ATOM   4679 C C     . LEU C 1 66  ? -41.599 -34.303 -24.452 1.00 124.60 ? 88  LEU C C     1 
ATOM   4680 O O     . LEU C 1 66  ? -42.641 -34.875 -24.733 1.00 124.71 ? 88  LEU C O     1 
ATOM   4681 C CB    . LEU C 1 66  ? -41.617 -31.790 -24.703 1.00 124.06 ? 88  LEU C CB    1 
ATOM   4682 C CG    . LEU C 1 66  ? -41.569 -30.411 -24.020 1.00 123.83 ? 88  LEU C CG    1 
ATOM   4683 C CD1   . LEU C 1 66  ? -41.268 -29.309 -25.010 1.00 123.78 ? 88  LEU C CD1   1 
ATOM   4684 C CD2   . LEU C 1 66  ? -42.861 -30.113 -23.287 1.00 124.13 ? 88  LEU C CD2   1 
ATOM   4685 N N     . ASP C 1 67  ? -40.398 -34.811 -24.728 1.00 125.28 ? 89  ASP C N     1 
ATOM   4686 C CA    . ASP C 1 67  ? -40.225 -36.102 -25.421 1.00 125.90 ? 89  ASP C CA    1 
ATOM   4687 C C     . ASP C 1 67  ? -40.830 -37.249 -24.621 1.00 126.19 ? 89  ASP C C     1 
ATOM   4688 O O     . ASP C 1 67  ? -41.436 -38.176 -25.180 1.00 126.16 ? 89  ASP C O     1 
ATOM   4689 C CB    . ASP C 1 67  ? -38.735 -36.388 -25.685 1.00 125.99 ? 89  ASP C CB    1 
ATOM   4690 C CG    . ASP C 1 67  ? -38.403 -36.508 -27.182 1.00 126.25 ? 89  ASP C CG    1 
ATOM   4691 O OD1   . ASP C 1 67  ? -39.048 -37.324 -27.884 1.00 126.69 ? 89  ASP C OD1   1 
ATOM   4692 O OD2   . ASP C 1 67  ? -37.474 -35.809 -27.652 1.00 126.44 ? 89  ASP C OD2   1 
ATOM   4693 N N     . ALA C 1 68  ? -40.654 -37.159 -23.306 1.00 126.65 ? 90  ALA C N     1 
ATOM   4694 C CA    . ALA C 1 68  ? -41.122 -38.165 -22.372 1.00 127.24 ? 90  ALA C CA    1 
ATOM   4695 C C     . ALA C 1 68  ? -42.613 -38.430 -22.552 1.00 127.76 ? 90  ALA C C     1 
ATOM   4696 O O     . ALA C 1 68  ? -43.059 -39.590 -22.542 1.00 127.79 ? 90  ALA C O     1 
ATOM   4697 C CB    . ALA C 1 68  ? -40.831 -37.715 -20.962 1.00 127.20 ? 90  ALA C CB    1 
ATOM   4698 N N     . HIS C 1 69  ? -43.373 -37.344 -22.729 1.00 128.44 ? 91  HIS C N     1 
ATOM   4699 C CA    . HIS C 1 69  ? -44.807 -37.425 -23.003 1.00 129.01 ? 91  HIS C CA    1 
ATOM   4700 C C     . HIS C 1 69  ? -45.069 -38.442 -24.121 1.00 129.42 ? 91  HIS C C     1 
ATOM   4701 O O     . HIS C 1 69  ? -44.379 -38.436 -25.158 1.00 129.37 ? 91  HIS C O     1 
ATOM   4702 C CB    . HIS C 1 69  ? -45.360 -36.044 -23.383 1.00 129.03 ? 91  HIS C CB    1 
ATOM   4703 C CG    . HIS C 1 69  ? -46.820 -35.867 -23.099 1.00 129.12 ? 91  HIS C CG    1 
ATOM   4704 N ND1   . HIS C 1 69  ? -47.805 -36.473 -23.847 1.00 129.37 ? 91  HIS C ND1   1 
ATOM   4705 C CD2   . HIS C 1 69  ? -47.461 -35.130 -22.163 1.00 129.41 ? 91  HIS C CD2   1 
ATOM   4706 C CE1   . HIS C 1 69  ? -48.990 -36.129 -23.377 1.00 129.52 ? 91  HIS C CE1   1 
ATOM   4707 N NE2   . HIS C 1 69  ? -48.809 -35.314 -22.354 1.00 129.85 ? 91  HIS C NE2   1 
ATOM   4708 N N     . PRO C 1 70  ? -46.050 -39.338 -23.896 1.00 129.78 ? 92  PRO C N     1 
ATOM   4709 C CA    . PRO C 1 70  ? -46.418 -40.367 -24.868 1.00 130.04 ? 92  PRO C CA    1 
ATOM   4710 C C     . PRO C 1 70  ? -46.928 -39.787 -26.190 1.00 130.25 ? 92  PRO C C     1 
ATOM   4711 O O     . PRO C 1 70  ? -46.669 -40.369 -27.240 1.00 130.38 ? 92  PRO C O     1 
ATOM   4712 C CB    . PRO C 1 70  ? -47.537 -41.138 -24.157 1.00 130.03 ? 92  PRO C CB    1 
ATOM   4713 C CG    . PRO C 1 70  ? -48.055 -40.196 -23.120 1.00 129.90 ? 92  PRO C CG    1 
ATOM   4714 C CD    . PRO C 1 70  ? -46.858 -39.436 -22.663 1.00 129.77 ? 92  PRO C CD    1 
ATOM   4715 N N     . GLU C 1 71  ? -47.630 -38.653 -26.135 1.00 130.42 ? 93  GLU C N     1 
ATOM   4716 C CA    . GLU C 1 71  ? -48.184 -38.005 -27.336 1.00 130.54 ? 93  GLU C CA    1 
ATOM   4717 C C     . GLU C 1 71  ? -47.147 -37.167 -28.110 1.00 129.79 ? 93  GLU C C     1 
ATOM   4718 O O     . GLU C 1 71  ? -47.407 -36.771 -29.252 1.00 129.98 ? 93  GLU C O     1 
ATOM   4719 C CB    . GLU C 1 71  ? -49.401 -37.119 -26.983 1.00 131.04 ? 93  GLU C CB    1 
ATOM   4720 C CG    . GLU C 1 71  ? -50.672 -37.854 -26.494 1.00 133.36 ? 93  GLU C CG    1 
ATOM   4721 C CD    . GLU C 1 71  ? -51.755 -36.891 -25.993 1.00 136.36 ? 93  GLU C CD    1 
ATOM   4722 O OE1   . GLU C 1 71  ? -52.365 -36.175 -26.825 1.00 137.59 ? 93  GLU C OE1   1 
ATOM   4723 O OE2   . GLU C 1 71  ? -52.001 -36.848 -24.766 1.00 137.65 ? 93  GLU C OE2   1 
ATOM   4724 N N     . VAL C 1 72  ? -45.987 -36.895 -27.504 1.00 128.71 ? 94  VAL C N     1 
ATOM   4725 C CA    . VAL C 1 72  ? -45.036 -35.933 -28.081 1.00 127.60 ? 94  VAL C CA    1 
ATOM   4726 C C     . VAL C 1 72  ? -43.645 -36.502 -28.407 1.00 126.84 ? 94  VAL C C     1 
ATOM   4727 O O     . VAL C 1 72  ? -43.181 -37.467 -27.774 1.00 126.77 ? 94  VAL C O     1 
ATOM   4728 C CB    . VAL C 1 72  ? -44.901 -34.664 -27.191 1.00 127.56 ? 94  VAL C CB    1 
ATOM   4729 C CG1   . VAL C 1 72  ? -44.131 -33.569 -27.910 1.00 127.61 ? 94  VAL C CG1   1 
ATOM   4730 C CG2   . VAL C 1 72  ? -46.260 -34.137 -26.808 1.00 127.59 ? 94  VAL C CG2   1 
ATOM   4731 N N     . ARG C 1 73  ? -43.009 -35.883 -29.412 1.00 125.74 ? 95  ARG C N     1 
ATOM   4732 C CA    . ARG C 1 73  ? -41.618 -36.125 -29.769 1.00 124.69 ? 95  ARG C CA    1 
ATOM   4733 C C     . ARG C 1 73  ? -40.991 -34.860 -30.350 1.00 124.09 ? 95  ARG C C     1 
ATOM   4734 O O     . ARG C 1 73  ? -41.603 -34.162 -31.162 1.00 123.75 ? 95  ARG C O     1 
ATOM   4735 C CB    . ARG C 1 73  ? -41.508 -37.286 -30.762 1.00 124.74 ? 95  ARG C CB    1 
ATOM   4736 C CG    . ARG C 1 73  ? -40.108 -37.895 -30.901 1.00 124.38 ? 95  ARG C CG    1 
ATOM   4737 C CD    . ARG C 1 73  ? -39.304 -37.235 -32.006 1.00 123.85 ? 95  ARG C CD    1 
ATOM   4738 N NE    . ARG C 1 73  ? -39.687 -37.752 -33.334 1.00 123.65 ? 95  ARG C NE    1 
ATOM   4739 C CZ    . ARG C 1 73  ? -39.691 -37.004 -34.441 1.00 123.68 ? 95  ARG C CZ    1 
ATOM   4740 N NH1   . ARG C 1 73  ? -40.049 -37.570 -35.602 1.00 123.97 ? 95  ARG C NH1   1 
ATOM   4741 N NH2   . ARG C 1 73  ? -39.350 -35.685 -34.389 1.00 123.44 ? 95  ARG C NH2   1 
ATOM   4742 N N     . CYS C 1 74  ? -39.765 -34.575 -29.904 1.00 123.61 ? 96  CYS C N     1 
ATOM   4743 C CA    . CYS C 1 74  ? -38.951 -33.490 -30.441 1.00 123.13 ? 96  CYS C CA    1 
ATOM   4744 C C     . CYS C 1 74  ? -37.717 -34.067 -31.088 1.00 122.76 ? 96  CYS C C     1 
ATOM   4745 O O     . CYS C 1 74  ? -37.379 -33.723 -32.222 1.00 122.75 ? 96  CYS C O     1 
ATOM   4746 C CB    . CYS C 1 74  ? -38.467 -32.565 -29.330 1.00 123.17 ? 96  CYS C CB    1 
ATOM   4747 S SG    . CYS C 1 74  ? -39.693 -31.563 -28.534 1.00 123.27 ? 96  CYS C SG    1 
ATOM   4748 N N     . GLY C 1 75  ? -37.032 -34.924 -30.330 1.00 122.43 ? 97  GLY C N     1 
ATOM   4749 C CA    . GLY C 1 75  ? -35.759 -35.512 -30.740 1.00 122.16 ? 97  GLY C CA    1 
ATOM   4750 C C     . GLY C 1 75  ? -34.514 -34.628 -30.611 1.00 121.81 ? 97  GLY C C     1 
ATOM   4751 O O     . GLY C 1 75  ? -34.493 -33.617 -29.874 1.00 121.80 ? 97  GLY C O     1 
ATOM   4752 N N     . GLU C 1 76  ? -33.478 -35.022 -31.354 1.00 121.35 ? 98  GLU C N     1 
ATOM   4753 C CA    . GLU C 1 76  ? -32.188 -34.353 -31.348 1.00 121.09 ? 98  GLU C CA    1 
ATOM   4754 C C     . GLU C 1 76  ? -32.227 -33.073 -32.142 1.00 120.67 ? 98  GLU C C     1 
ATOM   4755 O O     . GLU C 1 76  ? -33.230 -32.755 -32.779 1.00 120.56 ? 98  GLU C O     1 
ATOM   4756 C CB    . GLU C 1 76  ? -31.133 -35.271 -31.969 1.00 121.24 ? 98  GLU C CB    1 
ATOM   4757 C CG    . GLU C 1 76  ? -30.897 -36.560 -31.194 1.00 122.39 ? 98  GLU C CG    1 
ATOM   4758 C CD    . GLU C 1 76  ? -31.917 -37.655 -31.534 1.00 123.35 ? 98  GLU C CD    1 
ATOM   4759 O OE1   . GLU C 1 76  ? -31.706 -38.833 -31.125 1.00 124.17 ? 98  GLU C OE1   1 
ATOM   4760 O OE2   . GLU C 1 76  ? -32.928 -37.348 -32.210 1.00 123.26 ? 98  GLU C OE2   1 
ATOM   4761 N N     . GLU C 1 77  ? -31.124 -32.336 -32.091 1.00 120.39 ? 99  GLU C N     1 
ATOM   4762 C CA    . GLU C 1 77  ? -30.919 -31.209 -32.983 1.00 120.23 ? 99  GLU C CA    1 
ATOM   4763 C C     . GLU C 1 77  ? -30.742 -31.770 -34.386 1.00 120.18 ? 99  GLU C C     1 
ATOM   4764 O O     . GLU C 1 77  ? -30.127 -32.826 -34.575 1.00 120.16 ? 99  GLU C O     1 
ATOM   4765 C CB    . GLU C 1 77  ? -29.693 -30.391 -32.563 1.00 120.15 ? 99  GLU C CB    1 
ATOM   4766 C CG    . GLU C 1 77  ? -29.909 -29.577 -31.290 1.00 120.12 ? 99  GLU C CG    1 
ATOM   4767 C CD    . GLU C 1 77  ? -28.689 -28.775 -30.863 1.00 120.03 ? 99  GLU C CD    1 
ATOM   4768 O OE1   . GLU C 1 77  ? -27.596 -28.968 -31.442 1.00 119.95 ? 99  GLU C OE1   1 
ATOM   4769 O OE2   . GLU C 1 77  ? -28.827 -27.953 -29.929 1.00 119.85 ? 99  GLU C OE2   1 
ATOM   4770 N N     . THR C 1 78  ? -31.312 -31.083 -35.364 1.00 120.23 ? 100 THR C N     1 
ATOM   4771 C CA    . THR C 1 78  ? -31.236 -31.540 -36.741 1.00 120.46 ? 100 THR C CA    1 
ATOM   4772 C C     . THR C 1 78  ? -30.059 -30.876 -37.404 1.00 120.57 ? 100 THR C C     1 
ATOM   4773 O O     . THR C 1 78  ? -29.482 -31.426 -38.344 1.00 120.47 ? 100 THR C O     1 
ATOM   4774 C CB    . THR C 1 78  ? -32.479 -31.123 -37.545 1.00 120.64 ? 100 THR C CB    1 
ATOM   4775 O OG1   . THR C 1 78  ? -32.407 -29.718 -37.861 1.00 120.95 ? 100 THR C OG1   1 
ATOM   4776 C CG2   . THR C 1 78  ? -33.775 -31.454 -36.782 1.00 120.53 ? 100 THR C CG2   1 
ATOM   4777 N N     . ARG C 1 79  ? -29.740 -29.671 -36.916 1.00 120.86 ? 101 ARG C N     1 
ATOM   4778 C CA    . ARG C 1 79  ? -28.689 -28.803 -37.465 1.00 121.22 ? 101 ARG C CA    1 
ATOM   4779 C C     . ARG C 1 79  ? -29.068 -28.278 -38.853 1.00 120.99 ? 101 ARG C C     1 
ATOM   4780 O O     . ARG C 1 79  ? -28.783 -27.125 -39.200 1.00 121.05 ? 101 ARG C O     1 
ATOM   4781 C CB    . ARG C 1 79  ? -27.339 -29.543 -37.536 1.00 121.55 ? 101 ARG C CB    1 
ATOM   4782 C CG    . ARG C 1 79  ? -26.839 -30.116 -36.217 1.00 122.91 ? 101 ARG C CG    1 
ATOM   4783 C CD    . ARG C 1 79  ? -25.541 -30.922 -36.457 1.00 125.72 ? 101 ARG C CD    1 
ATOM   4784 N NE    . ARG C 1 79  ? -24.534 -30.540 -35.448 1.00 128.59 ? 101 ARG C NE    1 
ATOM   4785 C CZ    . ARG C 1 79  ? -23.782 -29.439 -35.521 1.00 130.27 ? 101 ARG C CZ    1 
ATOM   4786 N NH1   . ARG C 1 79  ? -23.912 -28.601 -36.568 1.00 130.61 ? 101 ARG C NH1   1 
ATOM   4787 N NH2   . ARG C 1 79  ? -22.896 -29.172 -34.541 1.00 131.67 ? 101 ARG C NH2   1 
ATOM   4788 N N     . ILE C 1 80  ? -29.716 -29.136 -39.636 1.00 120.69 ? 102 ILE C N     1 
ATOM   4789 C CA    . ILE C 1 80  ? -29.968 -28.866 -41.033 1.00 120.44 ? 102 ILE C CA    1 
ATOM   4790 C C     . ILE C 1 80  ? -30.911 -27.694 -41.215 1.00 120.14 ? 102 ILE C C     1 
ATOM   4791 O O     . ILE C 1 80  ? -30.766 -26.870 -42.120 1.00 119.93 ? 102 ILE C O     1 
ATOM   4792 C CB    . ILE C 1 80  ? -30.510 -30.137 -41.739 1.00 120.55 ? 102 ILE C CB    1 
ATOM   4793 C CG1   . ILE C 1 80  ? -30.451 -29.960 -43.253 1.00 120.88 ? 102 ILE C CG1   1 
ATOM   4794 C CG2   . ILE C 1 80  ? -31.908 -30.521 -41.236 1.00 120.32 ? 102 ILE C CG2   1 
ATOM   4795 C CD1   . ILE C 1 80  ? -29.056 -29.618 -43.715 1.00 122.37 ? 102 ILE C CD1   1 
ATOM   4796 N N     . ILE C 1 81  ? -31.879 -27.624 -40.324 1.00 119.92 ? 103 ILE C N     1 
ATOM   4797 C CA    . ILE C 1 81  ? -32.923 -26.657 -40.470 1.00 119.92 ? 103 ILE C CA    1 
ATOM   4798 C C     . ILE C 1 81  ? -32.376 -25.235 -40.336 1.00 120.01 ? 103 ILE C C     1 
ATOM   4799 O O     . ILE C 1 81  ? -32.507 -24.449 -41.276 1.00 120.02 ? 103 ILE C O     1 
ATOM   4800 C CB    . ILE C 1 81  ? -34.085 -26.965 -39.529 1.00 119.88 ? 103 ILE C CB    1 
ATOM   4801 C CG1   . ILE C 1 81  ? -34.700 -28.312 -39.929 1.00 119.89 ? 103 ILE C CG1   1 
ATOM   4802 C CG2   . ILE C 1 81  ? -35.113 -25.845 -39.580 1.00 119.93 ? 103 ILE C CG2   1 
ATOM   4803 C CD1   . ILE C 1 81  ? -35.536 -28.978 -38.852 1.00 120.61 ? 103 ILE C CD1   1 
ATOM   4804 N N     . PRO C 1 82  ? -31.717 -24.909 -39.202 1.00 120.09 ? 104 PRO C N     1 
ATOM   4805 C CA    . PRO C 1 82  ? -31.295 -23.516 -39.059 1.00 120.11 ? 104 PRO C CA    1 
ATOM   4806 C C     . PRO C 1 82  ? -30.441 -23.125 -40.239 1.00 120.17 ? 104 PRO C C     1 
ATOM   4807 O O     . PRO C 1 82  ? -30.388 -21.944 -40.626 1.00 120.09 ? 104 PRO C O     1 
ATOM   4808 C CB    . PRO C 1 82  ? -30.457 -23.523 -37.778 1.00 120.11 ? 104 PRO C CB    1 
ATOM   4809 C CG    . PRO C 1 82  ? -30.115 -24.948 -37.539 1.00 120.13 ? 104 PRO C CG    1 
ATOM   4810 C CD    . PRO C 1 82  ? -31.256 -25.732 -38.073 1.00 120.09 ? 104 PRO C CD    1 
ATOM   4811 N N     . ARG C 1 83  ? -29.815 -24.144 -40.827 1.00 120.41 ? 105 ARG C N     1 
ATOM   4812 C CA    . ARG C 1 83  ? -28.947 -23.946 -41.954 1.00 120.99 ? 105 ARG C CA    1 
ATOM   4813 C C     . ARG C 1 83  ? -29.729 -23.437 -43.147 1.00 120.54 ? 105 ARG C C     1 
ATOM   4814 O O     . ARG C 1 83  ? -29.439 -22.361 -43.687 1.00 120.32 ? 105 ARG C O     1 
ATOM   4815 C CB    . ARG C 1 83  ? -28.240 -25.254 -42.291 1.00 121.50 ? 105 ARG C CB    1 
ATOM   4816 C CG    . ARG C 1 83  ? -26.886 -25.057 -42.979 1.00 124.17 ? 105 ARG C CG    1 
ATOM   4817 C CD    . ARG C 1 83  ? -26.091 -26.357 -43.050 1.00 128.28 ? 105 ARG C CD    1 
ATOM   4818 N NE    . ARG C 1 83  ? -25.466 -26.736 -41.783 1.00 131.18 ? 105 ARG C NE    1 
ATOM   4819 C CZ    . ARG C 1 83  ? -24.183 -26.533 -41.487 1.00 132.93 ? 105 ARG C CZ    1 
ATOM   4820 N NH1   . ARG C 1 83  ? -23.717 -26.917 -40.306 1.00 133.93 ? 105 ARG C NH1   1 
ATOM   4821 N NH2   . ARG C 1 83  ? -23.366 -25.950 -42.367 1.00 133.92 ? 105 ARG C NH2   1 
ATOM   4822 N N     . VAL C 1 84  ? -30.743 -24.205 -43.535 1.00 120.31 ? 106 VAL C N     1 
ATOM   4823 C CA    . VAL C 1 84  ? -31.544 -23.864 -44.703 1.00 120.08 ? 106 VAL C CA    1 
ATOM   4824 C C     . VAL C 1 84  ? -32.269 -22.542 -44.505 1.00 119.89 ? 106 VAL C C     1 
ATOM   4825 O O     . VAL C 1 84  ? -32.586 -21.847 -45.469 1.00 119.80 ? 106 VAL C O     1 
ATOM   4826 C CB    . VAL C 1 84  ? -32.517 -24.998 -45.103 1.00 120.05 ? 106 VAL C CB    1 
ATOM   4827 C CG1   . VAL C 1 84  ? -31.738 -26.213 -45.558 1.00 120.16 ? 106 VAL C CG1   1 
ATOM   4828 C CG2   . VAL C 1 84  ? -33.421 -25.374 -43.958 1.00 120.06 ? 106 VAL C CG2   1 
ATOM   4829 N N     . LEU C 1 85  ? -32.497 -22.199 -43.239 1.00 119.75 ? 107 LEU C N     1 
ATOM   4830 C CA    . LEU C 1 85  ? -33.137 -20.946 -42.869 1.00 119.74 ? 107 LEU C CA    1 
ATOM   4831 C C     . LEU C 1 85  ? -32.226 -19.778 -43.144 1.00 119.95 ? 107 LEU C C     1 
ATOM   4832 O O     . LEU C 1 85  ? -32.609 -18.828 -43.822 1.00 119.94 ? 107 LEU C O     1 
ATOM   4833 C CB    . LEU C 1 85  ? -33.502 -20.948 -41.386 1.00 119.61 ? 107 LEU C CB    1 
ATOM   4834 C CG    . LEU C 1 85  ? -34.764 -21.706 -40.971 1.00 119.02 ? 107 LEU C CG    1 
ATOM   4835 C CD1   . LEU C 1 85  ? -34.772 -21.932 -39.464 1.00 118.15 ? 107 LEU C CD1   1 
ATOM   4836 C CD2   . LEU C 1 85  ? -36.004 -20.938 -41.419 1.00 118.46 ? 107 LEU C CD2   1 
ATOM   4837 N N     . ALA C 1 86  ? -31.018 -19.856 -42.604 1.00 120.34 ? 108 ALA C N     1 
ATOM   4838 C CA    . ALA C 1 86  ? -30.023 -18.823 -42.812 1.00 120.86 ? 108 ALA C CA    1 
ATOM   4839 C C     . ALA C 1 86  ? -29.933 -18.485 -44.302 1.00 121.27 ? 108 ALA C C     1 
ATOM   4840 O O     . ALA C 1 86  ? -29.890 -17.317 -44.686 1.00 121.16 ? 108 ALA C O     1 
ATOM   4841 C CB    . ALA C 1 86  ? -28.678 -19.279 -42.266 1.00 120.71 ? 108 ALA C CB    1 
ATOM   4842 N N     . MET C 1 87  ? -29.946 -19.520 -45.135 1.00 121.92 ? 109 MET C N     1 
ATOM   4843 C CA    . MET C 1 87  ? -29.843 -19.354 -46.572 1.00 122.84 ? 109 MET C CA    1 
ATOM   4844 C C     . MET C 1 87  ? -31.074 -18.703 -47.116 1.00 123.20 ? 109 MET C C     1 
ATOM   4845 O O     . MET C 1 87  ? -31.002 -17.705 -47.836 1.00 123.00 ? 109 MET C O     1 
ATOM   4846 C CB    . MET C 1 87  ? -29.743 -20.708 -47.235 1.00 123.04 ? 109 MET C CB    1 
ATOM   4847 C CG    . MET C 1 87  ? -28.571 -21.543 -46.805 1.00 124.59 ? 109 MET C CG    1 
ATOM   4848 S SD    . MET C 1 87  ? -29.047 -23.289 -46.798 1.00 127.03 ? 109 MET C SD    1 
ATOM   4849 C CE    . MET C 1 87  ? -30.657 -23.268 -47.757 1.00 125.15 ? 109 MET C CE    1 
ATOM   4850 N N     . ARG C 1 88  ? -32.212 -19.306 -46.787 1.00 124.12 ? 110 ARG C N     1 
ATOM   4851 C CA    . ARG C 1 88  ? -33.492 -18.795 -47.228 1.00 125.20 ? 110 ARG C CA    1 
ATOM   4852 C C     . ARG C 1 88  ? -33.485 -17.295 -47.003 1.00 125.71 ? 110 ARG C C     1 
ATOM   4853 O O     . ARG C 1 88  ? -33.678 -16.503 -47.936 1.00 125.60 ? 110 ARG C O     1 
ATOM   4854 C CB    . ARG C 1 88  ? -34.631 -19.467 -46.451 1.00 125.26 ? 110 ARG C CB    1 
ATOM   4855 C CG    . ARG C 1 88  ? -36.015 -19.234 -47.039 1.00 126.49 ? 110 ARG C CG    1 
ATOM   4856 C CD    . ARG C 1 88  ? -36.624 -17.932 -46.527 1.00 128.42 ? 110 ARG C CD    1 
ATOM   4857 N NE    . ARG C 1 88  ? -37.900 -17.642 -47.188 1.00 130.23 ? 110 ARG C NE    1 
ATOM   4858 C CZ    . ARG C 1 88  ? -38.031 -16.938 -48.322 1.00 131.09 ? 110 ARG C CZ    1 
ATOM   4859 N NH1   . ARG C 1 88  ? -39.242 -16.728 -48.835 1.00 131.21 ? 110 ARG C NH1   1 
ATOM   4860 N NH2   . ARG C 1 88  ? -36.957 -16.439 -48.942 1.00 131.75 ? 110 ARG C NH2   1 
ATOM   4861 N N     . GLN C 1 89  ? -33.237 -16.930 -45.748 1.00 126.62 ? 111 GLN C N     1 
ATOM   4862 C CA    . GLN C 1 89  ? -33.039 -15.551 -45.354 1.00 127.55 ? 111 GLN C CA    1 
ATOM   4863 C C     . GLN C 1 89  ? -32.221 -14.835 -46.419 1.00 127.60 ? 111 GLN C C     1 
ATOM   4864 O O     . GLN C 1 89  ? -32.723 -13.944 -47.116 1.00 127.55 ? 111 GLN C O     1 
ATOM   4865 C CB    . GLN C 1 89  ? -32.328 -15.498 -43.991 1.00 127.84 ? 111 GLN C CB    1 
ATOM   4866 C CG    . GLN C 1 89  ? -31.932 -14.099 -43.503 1.00 130.00 ? 111 GLN C CG    1 
ATOM   4867 C CD    . GLN C 1 89  ? -33.129 -13.234 -43.101 1.00 132.91 ? 111 GLN C CD    1 
ATOM   4868 O OE1   . GLN C 1 89  ? -33.282 -12.872 -41.931 1.00 134.57 ? 111 GLN C OE1   1 
ATOM   4869 N NE2   . GLN C 1 89  ? -33.977 -12.890 -44.072 1.00 134.13 ? 111 GLN C NE2   1 
ATOM   4870 N N     . ALA C 1 90  ? -30.973 -15.272 -46.562 1.00 127.80 ? 112 ALA C N     1 
ATOM   4871 C CA    . ALA C 1 90  ? -30.027 -14.623 -47.448 1.00 127.98 ? 112 ALA C CA    1 
ATOM   4872 C C     . ALA C 1 90  ? -30.659 -14.225 -48.779 1.00 128.04 ? 112 ALA C C     1 
ATOM   4873 O O     . ALA C 1 90  ? -30.526 -13.081 -49.216 1.00 127.84 ? 112 ALA C O     1 
ATOM   4874 C CB    . ALA C 1 90  ? -28.802 -15.512 -47.656 1.00 128.05 ? 112 ALA C CB    1 
ATOM   4875 N N     . TRP C 1 91  ? -31.380 -15.154 -49.398 1.00 128.36 ? 113 TRP C N     1 
ATOM   4876 C CA    . TRP C 1 91  ? -31.936 -14.911 -50.730 1.00 128.92 ? 113 TRP C CA    1 
ATOM   4877 C C     . TRP C 1 91  ? -32.999 -13.830 -50.739 1.00 129.48 ? 113 TRP C C     1 
ATOM   4878 O O     . TRP C 1 91  ? -33.154 -13.114 -51.743 1.00 129.43 ? 113 TRP C O     1 
ATOM   4879 C CB    . TRP C 1 91  ? -32.519 -16.186 -51.324 1.00 128.73 ? 113 TRP C CB    1 
ATOM   4880 C CG    . TRP C 1 91  ? -31.624 -17.347 -51.153 1.00 128.15 ? 113 TRP C CG    1 
ATOM   4881 C CD1   . TRP C 1 91  ? -30.257 -17.362 -51.274 1.00 127.44 ? 113 TRP C CD1   1 
ATOM   4882 C CD2   . TRP C 1 91  ? -32.017 -18.680 -50.830 1.00 127.44 ? 113 TRP C CD2   1 
ATOM   4883 N NE1   . TRP C 1 91  ? -29.776 -18.624 -51.035 1.00 127.20 ? 113 TRP C NE1   1 
ATOM   4884 C CE2   . TRP C 1 91  ? -30.834 -19.456 -50.764 1.00 127.26 ? 113 TRP C CE2   1 
ATOM   4885 C CE3   . TRP C 1 91  ? -33.255 -19.299 -50.589 1.00 126.91 ? 113 TRP C CE3   1 
ATOM   4886 C CZ2   . TRP C 1 91  ? -30.851 -20.825 -50.469 1.00 126.96 ? 113 TRP C CZ2   1 
ATOM   4887 C CZ3   . TRP C 1 91  ? -33.272 -20.660 -50.289 1.00 126.66 ? 113 TRP C CZ3   1 
ATOM   4888 C CH2   . TRP C 1 91  ? -32.075 -21.407 -50.233 1.00 126.65 ? 113 TRP C CH2   1 
ATOM   4889 N N     . SER C 1 92  ? -33.737 -13.730 -49.627 1.00 130.20 ? 114 SER C N     1 
ATOM   4890 C CA    . SER C 1 92  ? -34.752 -12.687 -49.492 1.00 130.89 ? 114 SER C CA    1 
ATOM   4891 C C     . SER C 1 92  ? -34.163 -11.411 -48.927 1.00 131.09 ? 114 SER C C     1 
ATOM   4892 O O     . SER C 1 92  ? -34.625 -10.310 -49.259 1.00 131.23 ? 114 SER C O     1 
ATOM   4893 C CB    . SER C 1 92  ? -35.937 -13.156 -48.643 1.00 130.97 ? 114 SER C CB    1 
ATOM   4894 O OG    . SER C 1 92  ? -36.992 -13.606 -49.482 1.00 131.51 ? 114 SER C OG    1 
ATOM   4895 N N     . LYS C 1 93  ? -33.135 -11.562 -48.083 1.00 131.24 ? 115 LYS C N     1 
ATOM   4896 C CA    . LYS C 1 93  ? -32.386 -10.420 -47.576 1.00 131.45 ? 115 LYS C CA    1 
ATOM   4897 C C     . LYS C 1 93  ? -31.940 -9.529  -48.743 1.00 131.47 ? 115 LYS C C     1 
ATOM   4898 O O     . LYS C 1 93  ? -31.623 -8.351  -48.567 1.00 131.49 ? 115 LYS C O     1 
ATOM   4899 C CB    . LYS C 1 93  ? -31.195 -10.898 -46.744 1.00 131.49 ? 115 LYS C CB    1 
ATOM   4900 C CG    . LYS C 1 93  ? -30.605 -9.823  -45.829 1.00 132.11 ? 115 LYS C CG    1 
ATOM   4901 C CD    . LYS C 1 93  ? -30.175 -10.365 -44.445 1.00 132.47 ? 115 LYS C CD    1 
ATOM   4902 C CE    . LYS C 1 93  ? -31.342 -10.397 -43.432 1.00 132.44 ? 115 LYS C CE    1 
ATOM   4903 N NZ    . LYS C 1 93  ? -31.969 -9.068  -43.151 1.00 132.26 ? 115 LYS C NZ    1 
ATOM   4904 N N     . SER C 1 94  ? -31.962 -10.112 -49.941 1.00 131.54 ? 116 SER C N     1 
ATOM   4905 C CA    . SER C 1 94  ? -31.655 -9.418  -51.188 1.00 131.54 ? 116 SER C CA    1 
ATOM   4906 C C     . SER C 1 94  ? -32.766 -8.498  -51.726 1.00 131.53 ? 116 SER C C     1 
ATOM   4907 O O     . SER C 1 94  ? -33.930 -8.585  -51.317 1.00 131.47 ? 116 SER C O     1 
ATOM   4908 C CB    . SER C 1 94  ? -31.267 -10.457 -52.251 1.00 131.57 ? 116 SER C CB    1 
ATOM   4909 O OG    . SER C 1 94  ? -31.465 -9.971  -53.567 1.00 131.40 ? 116 SER C OG    1 
ATOM   4910 N N     . GLY C 1 95  ? -32.371 -7.610  -52.641 1.00 131.51 ? 117 GLY C N     1 
ATOM   4911 C CA    . GLY C 1 95  ? -33.291 -6.844  -53.488 1.00 131.44 ? 117 GLY C CA    1 
ATOM   4912 C C     . GLY C 1 95  ? -33.050 -7.177  -54.958 1.00 131.37 ? 117 GLY C C     1 
ATOM   4913 O O     . GLY C 1 95  ? -33.926 -6.976  -55.809 1.00 131.39 ? 117 GLY C O     1 
ATOM   4914 N N     . ARG C 1 96  ? -31.852 -7.699  -55.235 1.00 131.32 ? 118 ARG C N     1 
ATOM   4915 C CA    . ARG C 1 96  ? -31.387 -8.087  -56.574 1.00 131.23 ? 118 ARG C CA    1 
ATOM   4916 C C     . ARG C 1 96  ? -31.831 -9.525  -56.879 1.00 131.13 ? 118 ARG C C     1 
ATOM   4917 O O     . ARG C 1 96  ? -32.760 -9.739  -57.663 1.00 131.05 ? 118 ARG C O     1 
ATOM   4918 C CB    . ARG C 1 96  ? -29.849 -7.978  -56.630 1.00 131.29 ? 118 ARG C CB    1 
ATOM   4919 C CG    . ARG C 1 96  ? -29.213 -7.744  -58.009 1.00 131.13 ? 118 ARG C CG    1 
ATOM   4920 C CD    . ARG C 1 96  ? -27.678 -7.889  -57.932 1.00 130.43 ? 118 ARG C CD    1 
ATOM   4921 N NE    . ARG C 1 96  ? -26.955 -6.889  -58.734 1.00 129.71 ? 118 ARG C NE    1 
ATOM   4922 C CZ    . ARG C 1 96  ? -26.593 -7.041  -60.009 1.00 129.17 ? 118 ARG C CZ    1 
ATOM   4923 N NH1   . ARG C 1 96  ? -26.881 -8.157  -60.676 1.00 128.84 ? 118 ARG C NH1   1 
ATOM   4924 N NH2   . ARG C 1 96  ? -25.939 -6.063  -60.627 1.00 128.88 ? 118 ARG C NH2   1 
ATOM   4925 N N     . GLU C 1 97  ? -31.159 -10.492 -56.240 1.00 131.04 ? 119 GLU C N     1 
ATOM   4926 C CA    . GLU C 1 97  ? -31.487 -11.928 -56.307 1.00 130.89 ? 119 GLU C CA    1 
ATOM   4927 C C     . GLU C 1 97  ? -32.942 -12.161 -55.915 1.00 130.68 ? 119 GLU C C     1 
ATOM   4928 O O     . GLU C 1 97  ? -33.502 -13.230 -56.159 1.00 130.67 ? 119 GLU C O     1 
ATOM   4929 C CB    . GLU C 1 97  ? -30.549 -12.730 -55.389 1.00 131.02 ? 119 GLU C CB    1 
ATOM   4930 C CG    . GLU C 1 97  ? -30.621 -14.265 -55.524 1.00 131.35 ? 119 GLU C CG    1 
ATOM   4931 C CD    . GLU C 1 97  ? -29.469 -14.879 -56.327 1.00 131.74 ? 119 GLU C CD    1 
ATOM   4932 O OE1   . GLU C 1 97  ? -28.344 -14.311 -56.334 1.00 131.60 ? 119 GLU C OE1   1 
ATOM   4933 O OE2   . GLU C 1 97  ? -29.690 -15.954 -56.937 1.00 132.05 ? 119 GLU C OE2   1 
ATOM   4934 N N     . LYS C 1 98  ? -33.533 -11.143 -55.296 1.00 130.49 ? 120 LYS C N     1 
ATOM   4935 C CA    . LYS C 1 98  ? -34.962 -11.086 -55.012 1.00 130.21 ? 120 LYS C CA    1 
ATOM   4936 C C     . LYS C 1 98  ? -35.730 -11.030 -56.334 1.00 129.91 ? 120 LYS C C     1 
ATOM   4937 O O     . LYS C 1 98  ? -36.383 -12.006 -56.718 1.00 129.85 ? 120 LYS C O     1 
ATOM   4938 C CB    . LYS C 1 98  ? -35.259 -9.856  -54.142 1.00 130.26 ? 120 LYS C CB    1 
ATOM   4939 C CG    . LYS C 1 98  ? -36.688 -9.702  -53.659 1.00 130.16 ? 120 LYS C CG    1 
ATOM   4940 C CD    . LYS C 1 98  ? -36.933 -8.264  -53.207 1.00 130.20 ? 120 LYS C CD    1 
ATOM   4941 C CE    . LYS C 1 98  ? -38.312 -8.083  -52.573 1.00 130.19 ? 120 LYS C CE    1 
ATOM   4942 N NZ    . LYS C 1 98  ? -39.444 -8.477  -53.480 1.00 129.53 ? 120 LYS C NZ    1 
ATOM   4943 N N     . LEU C 1 99  ? -35.620 -9.899  -57.033 1.00 129.54 ? 121 LEU C N     1 
ATOM   4944 C CA    . LEU C 1 99  ? -36.286 -9.700  -58.321 1.00 129.18 ? 121 LEU C CA    1 
ATOM   4945 C C     . LEU C 1 99  ? -35.859 -10.744 -59.343 1.00 128.85 ? 121 LEU C C     1 
ATOM   4946 O O     . LEU C 1 99  ? -36.688 -11.234 -60.106 1.00 128.72 ? 121 LEU C O     1 
ATOM   4947 C CB    . LEU C 1 99  ? -36.036 -8.285  -58.850 1.00 129.21 ? 121 LEU C CB    1 
ATOM   4948 C CG    . LEU C 1 99  ? -36.811 -7.175  -58.132 1.00 129.40 ? 121 LEU C CG    1 
ATOM   4949 C CD1   . LEU C 1 99  ? -36.136 -5.813  -58.307 1.00 129.35 ? 121 LEU C CD1   1 
ATOM   4950 C CD2   . LEU C 1 99  ? -38.277 -7.136  -58.584 1.00 129.27 ? 121 LEU C CD2   1 
ATOM   4951 N N     . ARG C 1 100 ? -34.568 -11.088 -59.326 1.00 128.59 ? 122 ARG C N     1 
ATOM   4952 C CA    . ARG C 1 100 ? -33.994 -12.163 -60.154 1.00 128.30 ? 122 ARG C CA    1 
ATOM   4953 C C     . ARG C 1 100 ? -34.702 -13.520 -59.977 1.00 128.01 ? 122 ARG C C     1 
ATOM   4954 O O     . ARG C 1 100 ? -34.507 -14.432 -60.789 1.00 128.00 ? 122 ARG C O     1 
ATOM   4955 C CB    . ARG C 1 100 ? -32.481 -12.320 -59.881 1.00 128.31 ? 122 ARG C CB    1 
ATOM   4956 C CG    . ARG C 1 100 ? -31.589 -11.182 -60.411 1.00 128.76 ? 122 ARG C CG    1 
ATOM   4957 C CD    . ARG C 1 100 ? -30.292 -11.010 -59.595 1.00 129.48 ? 122 ARG C CD    1 
ATOM   4958 N NE    . ARG C 1 100 ? -29.138 -11.741 -60.128 1.00 130.44 ? 122 ARG C NE    1 
ATOM   4959 C CZ    . ARG C 1 100 ? -27.986 -11.926 -59.477 1.00 131.23 ? 122 ARG C CZ    1 
ATOM   4960 N NH1   . ARG C 1 100 ? -27.818 -11.447 -58.247 1.00 131.31 ? 122 ARG C NH1   1 
ATOM   4961 N NH2   . ARG C 1 100 ? -26.993 -12.601 -60.053 1.00 131.81 ? 122 ARG C NH2   1 
ATOM   4962 N N     . LEU C 1 101 ? -35.517 -13.648 -58.923 1.00 127.62 ? 123 LEU C N     1 
ATOM   4963 C CA    . LEU C 1 101 ? -36.208 -14.908 -58.628 1.00 127.12 ? 123 LEU C CA    1 
ATOM   4964 C C     . LEU C 1 101 ? -37.702 -14.891 -58.976 1.00 127.07 ? 123 LEU C C     1 
ATOM   4965 O O     . LEU C 1 101 ? -38.233 -15.898 -59.437 1.00 126.99 ? 123 LEU C O     1 
ATOM   4966 C CB    . LEU C 1 101 ? -35.973 -15.356 -57.173 1.00 126.84 ? 123 LEU C CB    1 
ATOM   4967 C CG    . LEU C 1 101 ? -34.630 -16.006 -56.800 1.00 126.11 ? 123 LEU C CG    1 
ATOM   4968 C CD1   . LEU C 1 101 ? -34.574 -16.285 -55.319 1.00 125.58 ? 123 LEU C CD1   1 
ATOM   4969 C CD2   . LEU C 1 101 ? -34.354 -17.284 -57.565 1.00 125.46 ? 123 LEU C CD2   1 
ATOM   4970 N N     . ASP C 1 102 ? -38.370 -13.756 -58.763 1.00 127.08 ? 124 ASP C N     1 
ATOM   4971 C CA    . ASP C 1 102 ? -39.800 -13.615 -59.099 1.00 127.03 ? 124 ASP C CA    1 
ATOM   4972 C C     . ASP C 1 102 ? -39.980 -13.579 -60.608 1.00 127.22 ? 124 ASP C C     1 
ATOM   4973 O O     . ASP C 1 102 ? -41.034 -13.929 -61.139 1.00 127.02 ? 124 ASP C O     1 
ATOM   4974 C CB    . ASP C 1 102 ? -40.377 -12.338 -58.498 1.00 126.88 ? 124 ASP C CB    1 
ATOM   4975 C CG    . ASP C 1 102 ? -39.969 -12.139 -57.053 1.00 126.76 ? 124 ASP C CG    1 
ATOM   4976 O OD1   . ASP C 1 102 ? -40.286 -13.007 -56.206 1.00 126.33 ? 124 ASP C OD1   1 
ATOM   4977 O OD2   . ASP C 1 102 ? -39.330 -11.104 -56.766 1.00 126.81 ? 124 ASP C OD2   1 
ATOM   4978 N N     . GLU C 1 103 ? -38.928 -13.126 -61.286 1.00 127.65 ? 125 GLU C N     1 
ATOM   4979 C CA    . GLU C 1 103 ? -38.821 -13.225 -62.731 1.00 128.01 ? 125 GLU C CA    1 
ATOM   4980 C C     . GLU C 1 103 ? -38.729 -14.688 -63.179 1.00 127.66 ? 125 GLU C C     1 
ATOM   4981 O O     . GLU C 1 103 ? -39.258 -15.056 -64.227 1.00 127.65 ? 125 GLU C O     1 
ATOM   4982 C CB    . GLU C 1 103 ? -37.594 -12.440 -63.207 1.00 128.42 ? 125 GLU C CB    1 
ATOM   4983 C CG    . GLU C 1 103 ? -37.848 -10.941 -63.277 1.00 130.39 ? 125 GLU C CG    1 
ATOM   4984 C CD    . GLU C 1 103 ? -38.900 -10.593 -64.300 1.00 133.01 ? 125 GLU C CD    1 
ATOM   4985 O OE1   . GLU C 1 103 ? -39.969 -10.070 -63.875 1.00 133.50 ? 125 GLU C OE1   1 
ATOM   4986 O OE2   . GLU C 1 103 ? -38.594 -10.867 -65.518 1.00 134.88 ? 125 GLU C OE2   1 
ATOM   4987 N N     . ALA C 1 104 ? -38.058 -15.514 -62.374 1.00 127.24 ? 126 ALA C N     1 
ATOM   4988 C CA    . ALA C 1 104 ? -37.895 -16.943 -62.658 1.00 126.62 ? 126 ALA C CA    1 
ATOM   4989 C C     . ALA C 1 104 ? -39.134 -17.760 -62.238 1.00 126.10 ? 126 ALA C C     1 
ATOM   4990 O O     . ALA C 1 104 ? -39.187 -18.986 -62.395 1.00 125.69 ? 126 ALA C O     1 
ATOM   4991 C CB    . ALA C 1 104 ? -36.634 -17.464 -61.959 1.00 126.69 ? 126 ALA C CB    1 
ATOM   4992 N N     . GLY C 1 105 ? -40.133 -17.066 -61.709 1.00 125.75 ? 127 GLY C N     1 
ATOM   4993 C CA    . GLY C 1 105 ? -41.305 -17.726 -61.155 1.00 125.57 ? 127 GLY C CA    1 
ATOM   4994 C C     . GLY C 1 105 ? -41.063 -18.263 -59.751 1.00 125.45 ? 127 GLY C C     1 
ATOM   4995 O O     . GLY C 1 105 ? -41.951 -18.875 -59.154 1.00 125.40 ? 127 GLY C O     1 
ATOM   4996 N N     . VAL C 1 106 ? -39.859 -18.040 -59.223 1.00 125.28 ? 128 VAL C N     1 
ATOM   4997 C CA    . VAL C 1 106 ? -39.516 -18.469 -57.872 1.00 124.97 ? 128 VAL C CA    1 
ATOM   4998 C C     . VAL C 1 106 ? -39.849 -17.322 -56.933 1.00 125.02 ? 128 VAL C C     1 
ATOM   4999 O O     . VAL C 1 106 ? -38.990 -16.499 -56.605 1.00 124.98 ? 128 VAL C O     1 
ATOM   5000 C CB    . VAL C 1 106 ? -38.022 -18.838 -57.749 1.00 124.84 ? 128 VAL C CB    1 
ATOM   5001 C CG1   . VAL C 1 106 ? -37.757 -19.536 -56.439 1.00 124.82 ? 128 VAL C CG1   1 
ATOM   5002 C CG2   . VAL C 1 106 ? -37.600 -19.736 -58.889 1.00 124.82 ? 128 VAL C CG2   1 
ATOM   5003 N N     . THR C 1 107 ? -41.113 -17.264 -56.520 1.00 125.22 ? 129 THR C N     1 
ATOM   5004 C CA    . THR C 1 107 ? -41.581 -16.219 -55.607 1.00 125.52 ? 129 THR C CA    1 
ATOM   5005 C C     . THR C 1 107 ? -41.561 -16.700 -54.165 1.00 125.84 ? 129 THR C C     1 
ATOM   5006 O O     . THR C 1 107 ? -41.300 -17.877 -53.887 1.00 125.91 ? 129 THR C O     1 
ATOM   5007 C CB    . THR C 1 107 ? -43.028 -15.775 -55.922 1.00 125.45 ? 129 THR C CB    1 
ATOM   5008 O OG1   . THR C 1 107 ? -43.924 -16.878 -55.715 1.00 125.03 ? 129 THR C OG1   1 
ATOM   5009 C CG2   . THR C 1 107 ? -43.150 -15.268 -57.359 1.00 125.60 ? 129 THR C CG2   1 
ATOM   5010 N N     . ASP C 1 108 ? -41.860 -15.782 -53.251 1.00 126.20 ? 130 ASP C N     1 
ATOM   5011 C CA    . ASP C 1 108 ? -41.987 -16.106 -51.839 1.00 126.52 ? 130 ASP C CA    1 
ATOM   5012 C C     . ASP C 1 108 ? -42.807 -17.370 -51.664 1.00 126.39 ? 130 ASP C C     1 
ATOM   5013 O O     . ASP C 1 108 ? -42.381 -18.309 -50.995 1.00 126.22 ? 130 ASP C O     1 
ATOM   5014 C CB    . ASP C 1 108 ? -42.645 -14.945 -51.098 1.00 126.81 ? 130 ASP C CB    1 
ATOM   5015 C CG    . ASP C 1 108 ? -41.811 -13.659 -51.183 1.00 127.82 ? 130 ASP C CG    1 
ATOM   5016 O OD1   . ASP C 1 108 ? -40.599 -13.711 -50.824 1.00 129.17 ? 130 ASP C OD1   1 
ATOM   5017 O OD2   . ASP C 1 108 ? -42.368 -12.600 -51.609 1.00 128.95 ? 130 ASP C OD2   1 
ATOM   5018 N N     . GLU C 1 109 ? -43.968 -17.384 -52.313 1.00 126.41 ? 131 GLU C N     1 
ATOM   5019 C CA    . GLU C 1 109 ? -44.931 -18.477 -52.218 1.00 126.58 ? 131 GLU C CA    1 
ATOM   5020 C C     . GLU C 1 109 ? -44.309 -19.820 -52.559 1.00 125.89 ? 131 GLU C C     1 
ATOM   5021 O O     . GLU C 1 109 ? -44.446 -20.773 -51.797 1.00 125.99 ? 131 GLU C O     1 
ATOM   5022 C CB    . GLU C 1 109 ? -46.151 -18.224 -53.114 1.00 127.02 ? 131 GLU C CB    1 
ATOM   5023 C CG    . GLU C 1 109 ? -46.883 -16.906 -52.844 1.00 129.46 ? 131 GLU C CG    1 
ATOM   5024 C CD    . GLU C 1 109 ? -46.287 -15.720 -53.607 1.00 132.84 ? 131 GLU C CD    1 
ATOM   5025 O OE1   . GLU C 1 109 ? -45.099 -15.343 -53.351 1.00 133.52 ? 131 GLU C OE1   1 
ATOM   5026 O OE2   . GLU C 1 109 ? -47.028 -15.158 -54.462 1.00 134.47 ? 131 GLU C OE2   1 
ATOM   5027 N N     . VAL C 1 110 ? -43.625 -19.901 -53.695 1.00 125.04 ? 132 VAL C N     1 
ATOM   5028 C CA    . VAL C 1 110 ? -42.954 -21.134 -54.043 1.00 124.30 ? 132 VAL C CA    1 
ATOM   5029 C C     . VAL C 1 110 ? -41.913 -21.400 -52.967 1.00 123.97 ? 132 VAL C C     1 
ATOM   5030 O O     . VAL C 1 110 ? -41.855 -22.499 -52.422 1.00 123.95 ? 132 VAL C O     1 
ATOM   5031 C CB    . VAL C 1 110 ? -42.299 -21.078 -55.431 1.00 124.30 ? 132 VAL C CB    1 
ATOM   5032 C CG1   . VAL C 1 110 ? -41.866 -22.465 -55.868 1.00 124.11 ? 132 VAL C CG1   1 
ATOM   5033 C CG2   . VAL C 1 110 ? -43.247 -20.509 -56.443 1.00 124.18 ? 132 VAL C CG2   1 
ATOM   5034 N N     . LEU C 1 111 ? -41.122 -20.376 -52.640 1.00 123.56 ? 133 LEU C N     1 
ATOM   5035 C CA    . LEU C 1 111 ? -40.056 -20.512 -51.651 1.00 123.41 ? 133 LEU C CA    1 
ATOM   5036 C C     . LEU C 1 111 ? -40.564 -21.160 -50.371 1.00 123.13 ? 133 LEU C C     1 
ATOM   5037 O O     . LEU C 1 111 ? -40.111 -22.236 -49.962 1.00 122.97 ? 133 LEU C O     1 
ATOM   5038 C CB    . LEU C 1 111 ? -39.465 -19.140 -51.322 1.00 123.59 ? 133 LEU C CB    1 
ATOM   5039 C CG    . LEU C 1 111 ? -38.467 -18.531 -52.308 1.00 123.88 ? 133 LEU C CG    1 
ATOM   5040 C CD1   . LEU C 1 111 ? -38.295 -17.042 -52.013 1.00 124.22 ? 133 LEU C CD1   1 
ATOM   5041 C CD2   . LEU C 1 111 ? -37.114 -19.262 -52.224 1.00 124.57 ? 133 LEU C CD2   1 
ATOM   5042 N N     . ASP C 1 112 ? -41.528 -20.489 -49.756 1.00 122.82 ? 134 ASP C N     1 
ATOM   5043 C CA    . ASP C 1 112 ? -42.105 -20.944 -48.519 1.00 122.62 ? 134 ASP C CA    1 
ATOM   5044 C C     . ASP C 1 112 ? -42.630 -22.352 -48.673 1.00 122.35 ? 134 ASP C C     1 
ATOM   5045 O O     . ASP C 1 112 ? -42.320 -23.217 -47.863 1.00 122.27 ? 134 ASP C O     1 
ATOM   5046 C CB    . ASP C 1 112 ? -43.200 -19.977 -48.101 1.00 122.77 ? 134 ASP C CB    1 
ATOM   5047 C CG    . ASP C 1 112 ? -42.662 -18.569 -47.910 1.00 123.45 ? 134 ASP C CG    1 
ATOM   5048 O OD1   . ASP C 1 112 ? -41.468 -18.316 -48.249 1.00 123.95 ? 134 ASP C OD1   1 
ATOM   5049 O OD2   . ASP C 1 112 ? -43.431 -17.714 -47.422 1.00 124.31 ? 134 ASP C OD2   1 
ATOM   5050 N N     . ALA C 1 113 ? -43.389 -22.586 -49.740 1.00 122.20 ? 135 ALA C N     1 
ATOM   5051 C CA    . ALA C 1 113 ? -43.886 -23.921 -50.051 1.00 122.09 ? 135 ALA C CA    1 
ATOM   5052 C C     . ALA C 1 113 ? -42.778 -24.959 -49.942 1.00 122.04 ? 135 ALA C C     1 
ATOM   5053 O O     . ALA C 1 113 ? -42.922 -25.963 -49.242 1.00 121.97 ? 135 ALA C O     1 
ATOM   5054 C CB    . ALA C 1 113 ? -44.498 -23.948 -51.438 1.00 122.18 ? 135 ALA C CB    1 
ATOM   5055 N N     . ALA C 1 114 ? -41.668 -24.702 -50.633 1.00 121.96 ? 136 ALA C N     1 
ATOM   5056 C CA    . ALA C 1 114 ? -40.539 -25.611 -50.618 1.00 121.89 ? 136 ALA C CA    1 
ATOM   5057 C C     . ALA C 1 114 ? -40.044 -25.761 -49.194 1.00 121.99 ? 136 ALA C C     1 
ATOM   5058 O O     . ALA C 1 114 ? -39.903 -26.885 -48.693 1.00 122.06 ? 136 ALA C O     1 
ATOM   5059 C CB    . ALA C 1 114 ? -39.441 -25.103 -51.510 1.00 121.81 ? 136 ALA C CB    1 
ATOM   5060 N N     . MET C 1 115 ? -39.809 -24.624 -48.538 1.00 122.01 ? 137 MET C N     1 
ATOM   5061 C CA    . MET C 1 115 ? -39.336 -24.620 -47.163 1.00 121.97 ? 137 MET C CA    1 
ATOM   5062 C C     . MET C 1 115 ? -40.191 -25.558 -46.334 1.00 122.02 ? 137 MET C C     1 
ATOM   5063 O O     . MET C 1 115 ? -39.665 -26.484 -45.721 1.00 121.91 ? 137 MET C O     1 
ATOM   5064 C CB    . MET C 1 115 ? -39.349 -23.207 -46.583 1.00 121.96 ? 137 MET C CB    1 
ATOM   5065 C CG    . MET C 1 115 ? -38.343 -22.263 -47.225 1.00 121.94 ? 137 MET C CG    1 
ATOM   5066 S SD    . MET C 1 115 ? -36.655 -22.918 -47.219 1.00 121.95 ? 137 MET C SD    1 
ATOM   5067 C CE    . MET C 1 115 ? -36.179 -22.702 -45.507 1.00 122.72 ? 137 MET C CE    1 
ATOM   5068 N N     . GLN C 1 116 ? -41.509 -25.331 -46.364 1.00 122.22 ? 138 GLN C N     1 
ATOM   5069 C CA    . GLN C 1 116 ? -42.491 -26.181 -45.682 1.00 122.41 ? 138 GLN C CA    1 
ATOM   5070 C C     . GLN C 1 116 ? -42.193 -27.644 -45.928 1.00 122.12 ? 138 GLN C C     1 
ATOM   5071 O O     . GLN C 1 116 ? -41.897 -28.391 -44.996 1.00 122.10 ? 138 GLN C O     1 
ATOM   5072 C CB    . GLN C 1 116 ? -43.909 -25.891 -46.175 1.00 122.57 ? 138 GLN C CB    1 
ATOM   5073 C CG    . GLN C 1 116 ? -44.511 -24.589 -45.687 1.00 124.10 ? 138 GLN C CG    1 
ATOM   5074 C CD    . GLN C 1 116 ? -45.773 -24.201 -46.456 1.00 126.04 ? 138 GLN C CD    1 
ATOM   5075 O OE1   . GLN C 1 116 ? -46.012 -24.676 -47.578 1.00 126.96 ? 138 GLN C OE1   1 
ATOM   5076 N NE2   . GLN C 1 116 ? -46.588 -23.330 -45.852 1.00 126.53 ? 138 GLN C NE2   1 
ATOM   5077 N N     . ALA C 1 117 ? -42.259 -28.033 -47.199 1.00 121.84 ? 139 ALA C N     1 
ATOM   5078 C CA    . ALA C 1 117 ? -41.994 -29.398 -47.617 1.00 121.58 ? 139 ALA C CA    1 
ATOM   5079 C C     . ALA C 1 117 ? -40.729 -29.930 -46.964 1.00 121.45 ? 139 ALA C C     1 
ATOM   5080 O O     . ALA C 1 117 ? -40.746 -31.003 -46.362 1.00 121.32 ? 139 ALA C O     1 
ATOM   5081 C CB    . ALA C 1 117 ? -41.873 -29.463 -49.120 1.00 121.52 ? 139 ALA C CB    1 
ATOM   5082 N N     . PHE C 1 118 ? -39.652 -29.145 -47.065 1.00 121.40 ? 140 PHE C N     1 
ATOM   5083 C CA    . PHE C 1 118 ? -38.322 -29.540 -46.596 1.00 121.45 ? 140 PHE C CA    1 
ATOM   5084 C C     . PHE C 1 118 ? -38.262 -29.812 -45.097 1.00 121.48 ? 140 PHE C C     1 
ATOM   5085 O O     . PHE C 1 118 ? -38.123 -30.961 -44.666 1.00 121.52 ? 140 PHE C O     1 
ATOM   5086 C CB    . PHE C 1 118 ? -37.290 -28.467 -46.959 1.00 121.47 ? 140 PHE C CB    1 
ATOM   5087 C CG    . PHE C 1 118 ? -35.871 -28.855 -46.635 1.00 121.45 ? 140 PHE C CG    1 
ATOM   5088 C CD1   . PHE C 1 118 ? -35.133 -29.652 -47.534 1.00 121.09 ? 140 PHE C CD1   1 
ATOM   5089 C CD2   . PHE C 1 118 ? -35.274 -28.422 -45.431 1.00 121.38 ? 140 PHE C CD2   1 
ATOM   5090 C CE1   . PHE C 1 118 ? -33.834 -30.012 -47.239 1.00 120.89 ? 140 PHE C CE1   1 
ATOM   5091 C CE2   . PHE C 1 118 ? -33.971 -28.781 -45.131 1.00 121.33 ? 140 PHE C CE2   1 
ATOM   5092 C CZ    . PHE C 1 118 ? -33.251 -29.575 -46.037 1.00 121.19 ? 140 PHE C CZ    1 
ATOM   5093 N N     . ILE C 1 119 ? -38.348 -28.738 -44.308 1.00 121.52 ? 141 ILE C N     1 
ATOM   5094 C CA    . ILE C 1 119 ? -38.330 -28.849 -42.859 1.00 121.45 ? 141 ILE C CA    1 
ATOM   5095 C C     . ILE C 1 119 ? -39.237 -30.000 -42.435 1.00 121.62 ? 141 ILE C C     1 
ATOM   5096 O O     . ILE C 1 119 ? -38.804 -30.893 -41.703 1.00 121.52 ? 141 ILE C O     1 
ATOM   5097 C CB    . ILE C 1 119 ? -38.768 -27.519 -42.218 1.00 121.39 ? 141 ILE C CB    1 
ATOM   5098 C CG1   . ILE C 1 119 ? -37.719 -26.437 -42.524 1.00 121.15 ? 141 ILE C CG1   1 
ATOM   5099 C CG2   . ILE C 1 119 ? -38.969 -27.665 -40.717 1.00 121.01 ? 141 ILE C CG2   1 
ATOM   5100 C CD1   . ILE C 1 119 ? -38.341 -25.037 -42.639 1.00 121.06 ? 141 ILE C CD1   1 
ATOM   5101 N N     . LEU C 1 120 ? -40.475 -29.990 -42.940 1.00 121.86 ? 142 LEU C N     1 
ATOM   5102 C CA    . LEU C 1 120 ? -41.471 -31.012 -42.613 1.00 122.23 ? 142 LEU C CA    1 
ATOM   5103 C C     . LEU C 1 120 ? -40.904 -32.416 -42.689 1.00 122.16 ? 142 LEU C C     1 
ATOM   5104 O O     . LEU C 1 120 ? -40.914 -33.150 -41.706 1.00 122.34 ? 142 LEU C O     1 
ATOM   5105 C CB    . LEU C 1 120 ? -42.701 -30.905 -43.524 1.00 122.45 ? 142 LEU C CB    1 
ATOM   5106 C CG    . LEU C 1 120 ? -43.828 -29.957 -43.106 1.00 122.98 ? 142 LEU C CG    1 
ATOM   5107 C CD1   . LEU C 1 120 ? -44.898 -29.938 -44.190 1.00 123.91 ? 142 LEU C CD1   1 
ATOM   5108 C CD2   . LEU C 1 120 ? -44.417 -30.361 -41.751 1.00 123.60 ? 142 LEU C CD2   1 
ATOM   5109 N N     . GLU C 1 121 ? -40.397 -32.781 -43.858 1.00 122.04 ? 143 GLU C N     1 
ATOM   5110 C CA    . GLU C 1 121 ? -39.847 -34.104 -44.040 1.00 122.10 ? 143 GLU C CA    1 
ATOM   5111 C C     . GLU C 1 121 ? -38.880 -34.408 -42.927 1.00 121.80 ? 143 GLU C C     1 
ATOM   5112 O O     . GLU C 1 121 ? -39.001 -35.424 -42.246 1.00 121.76 ? 143 GLU C O     1 
ATOM   5113 C CB    . GLU C 1 121 ? -39.135 -34.191 -45.382 1.00 122.43 ? 143 GLU C CB    1 
ATOM   5114 C CG    . GLU C 1 121 ? -40.074 -34.154 -46.574 1.00 123.55 ? 143 GLU C CG    1 
ATOM   5115 C CD    . GLU C 1 121 ? -41.034 -35.324 -46.590 1.00 124.96 ? 143 GLU C CD    1 
ATOM   5116 O OE1   . GLU C 1 121 ? -40.633 -36.443 -46.174 1.00 125.62 ? 143 GLU C OE1   1 
ATOM   5117 O OE2   . GLU C 1 121 ? -42.190 -35.116 -47.019 1.00 125.29 ? 143 GLU C OE2   1 
ATOM   5118 N N     . VAL C 1 122 ? -37.935 -33.496 -42.736 1.00 121.55 ? 144 VAL C N     1 
ATOM   5119 C CA    . VAL C 1 122 ? -36.904 -33.662 -41.741 1.00 121.43 ? 144 VAL C CA    1 
ATOM   5120 C C     . VAL C 1 122 ? -37.595 -33.959 -40.423 1.00 121.26 ? 144 VAL C C     1 
ATOM   5121 O O     . VAL C 1 122 ? -37.502 -35.073 -39.889 1.00 121.12 ? 144 VAL C O     1 
ATOM   5122 C CB    . VAL C 1 122 ? -36.034 -32.392 -41.628 1.00 121.48 ? 144 VAL C CB    1 
ATOM   5123 C CG1   . VAL C 1 122 ? -34.811 -32.651 -40.719 1.00 121.73 ? 144 VAL C CG1   1 
ATOM   5124 C CG2   . VAL C 1 122 ? -35.572 -31.939 -43.020 1.00 121.43 ? 144 VAL C CG2   1 
ATOM   5125 N N     . ILE C 1 123 ? -38.330 -32.965 -39.933 1.00 121.13 ? 145 ILE C N     1 
ATOM   5126 C CA    . ILE C 1 123 ? -39.005 -33.096 -38.668 1.00 121.31 ? 145 ILE C CA    1 
ATOM   5127 C C     . ILE C 1 123 ? -39.681 -34.461 -38.588 1.00 121.69 ? 145 ILE C C     1 
ATOM   5128 O O     . ILE C 1 123 ? -39.536 -35.179 -37.599 1.00 121.95 ? 145 ILE C O     1 
ATOM   5129 C CB    . ILE C 1 123 ? -40.015 -31.954 -38.459 1.00 121.09 ? 145 ILE C CB    1 
ATOM   5130 C CG1   . ILE C 1 123 ? -39.318 -30.596 -38.631 1.00 120.44 ? 145 ILE C CG1   1 
ATOM   5131 C CG2   . ILE C 1 123 ? -40.661 -32.070 -37.083 1.00 121.49 ? 145 ILE C CG2   1 
ATOM   5132 C CD1   . ILE C 1 123 ? -40.115 -29.413 -38.133 1.00 119.32 ? 145 ILE C CD1   1 
ATOM   5133 N N     . ALA C 1 124 ? -40.373 -34.831 -39.658 1.00 122.11 ? 146 ALA C N     1 
ATOM   5134 C CA    . ALA C 1 124 ? -41.139 -36.066 -39.700 1.00 122.58 ? 146 ALA C CA    1 
ATOM   5135 C C     . ALA C 1 124 ? -40.273 -37.303 -39.584 1.00 122.91 ? 146 ALA C C     1 
ATOM   5136 O O     . ALA C 1 124 ? -40.553 -38.192 -38.783 1.00 122.98 ? 146 ALA C O     1 
ATOM   5137 C CB    . ALA C 1 124 ? -41.940 -36.131 -40.984 1.00 122.70 ? 146 ALA C CB    1 
ATOM   5138 N N     . LYS C 1 125 ? -39.221 -37.352 -40.388 1.00 123.37 ? 147 LYS C N     1 
ATOM   5139 C CA    . LYS C 1 125 ? -38.508 -38.595 -40.605 1.00 123.93 ? 147 LYS C CA    1 
ATOM   5140 C C     . LYS C 1 125 ? -37.420 -38.855 -39.589 1.00 124.10 ? 147 LYS C C     1 
ATOM   5141 O O     . LYS C 1 125 ? -37.064 -40.006 -39.347 1.00 124.01 ? 147 LYS C O     1 
ATOM   5142 C CB    . LYS C 1 125 ? -37.899 -38.606 -42.008 1.00 124.03 ? 147 LYS C CB    1 
ATOM   5143 C CG    . LYS C 1 125 ? -38.916 -38.561 -43.126 1.00 125.08 ? 147 LYS C CG    1 
ATOM   5144 C CD    . LYS C 1 125 ? -39.779 -39.808 -43.129 1.00 127.24 ? 147 LYS C CD    1 
ATOM   5145 C CE    . LYS C 1 125 ? -40.966 -39.648 -44.069 1.00 128.44 ? 147 LYS C CE    1 
ATOM   5146 N NZ    . LYS C 1 125 ? -40.557 -39.612 -45.508 1.00 128.31 ? 147 LYS C NZ    1 
ATOM   5147 N N     . HIS C 1 126 ? -36.897 -37.794 -38.988 1.00 124.53 ? 148 HIS C N     1 
ATOM   5148 C CA    . HIS C 1 126 ? -35.658 -37.920 -38.227 1.00 125.06 ? 148 HIS C CA    1 
ATOM   5149 C C     . HIS C 1 126 ? -35.795 -38.721 -36.933 1.00 125.78 ? 148 HIS C C     1 
ATOM   5150 O O     . HIS C 1 126 ? -34.794 -39.155 -36.359 1.00 125.81 ? 148 HIS C O     1 
ATOM   5151 C CB    . HIS C 1 126 ? -34.959 -36.552 -38.043 1.00 124.85 ? 148 HIS C CB    1 
ATOM   5152 C CG    . HIS C 1 126 ? -35.422 -35.753 -36.854 1.00 123.86 ? 148 HIS C CG    1 
ATOM   5153 N ND1   . HIS C 1 126 ? -34.706 -35.707 -35.666 1.00 123.20 ? 148 HIS C ND1   1 
ATOM   5154 C CD2   . HIS C 1 126 ? -36.492 -34.924 -36.688 1.00 122.75 ? 148 HIS C CD2   1 
ATOM   5155 C CE1   . HIS C 1 126 ? -35.329 -34.909 -34.810 1.00 122.36 ? 148 HIS C CE1   1 
ATOM   5156 N NE2   . HIS C 1 126 ? -36.415 -34.419 -35.406 1.00 122.16 ? 148 HIS C NE2   1 
ATOM   5157 N N     . GLY C 1 127 ? -37.035 -38.962 -36.510 1.00 126.63 ? 149 GLY C N     1 
ATOM   5158 C CA    . GLY C 1 127 ? -37.278 -39.686 -35.271 1.00 127.81 ? 149 GLY C CA    1 
ATOM   5159 C C     . GLY C 1 127 ? -38.527 -40.542 -35.261 1.00 128.58 ? 149 GLY C C     1 
ATOM   5160 O O     . GLY C 1 127 ? -39.152 -40.763 -36.293 1.00 128.46 ? 149 GLY C O     1 
ATOM   5161 N N     . GLU C 1 128 ? -38.874 -41.022 -34.071 1.00 129.62 ? 150 GLU C N     1 
ATOM   5162 C CA    . GLU C 1 128 ? -40.060 -41.842 -33.854 1.00 130.84 ? 150 GLU C CA    1 
ATOM   5163 C C     . GLU C 1 128 ? -41.333 -41.091 -34.197 1.00 131.04 ? 150 GLU C C     1 
ATOM   5164 O O     . GLU C 1 128 ? -41.382 -39.866 -34.037 1.00 131.12 ? 150 GLU C O     1 
ATOM   5165 C CB    . GLU C 1 128 ? -40.143 -42.258 -32.391 1.00 131.13 ? 150 GLU C CB    1 
ATOM   5166 C CG    . GLU C 1 128 ? -39.191 -43.350 -31.990 1.00 133.54 ? 150 GLU C CG    1 
ATOM   5167 C CD    . GLU C 1 128 ? -39.638 -44.030 -30.717 1.00 136.86 ? 150 GLU C CD    1 
ATOM   5168 O OE1   . GLU C 1 128 ? -40.697 -44.689 -30.744 1.00 138.61 ? 150 GLU C OE1   1 
ATOM   5169 O OE2   . GLU C 1 128 ? -38.939 -43.908 -29.689 1.00 138.05 ? 150 GLU C OE2   1 
ATOM   5170 N N     . PRO C 1 129 ? -42.375 -41.827 -34.655 1.00 131.33 ? 151 PRO C N     1 
ATOM   5171 C CA    . PRO C 1 129 ? -43.666 -41.205 -34.971 1.00 131.42 ? 151 PRO C CA    1 
ATOM   5172 C C     . PRO C 1 129 ? -44.412 -40.833 -33.705 1.00 131.40 ? 151 PRO C C     1 
ATOM   5173 O O     . PRO C 1 129 ? -44.286 -41.529 -32.700 1.00 131.40 ? 151 PRO C O     1 
ATOM   5174 C CB    . PRO C 1 129 ? -44.427 -42.328 -35.708 1.00 131.47 ? 151 PRO C CB    1 
ATOM   5175 C CG    . PRO C 1 129 ? -43.856 -43.611 -35.144 1.00 131.50 ? 151 PRO C CG    1 
ATOM   5176 C CD    . PRO C 1 129 ? -42.396 -43.307 -34.927 1.00 131.42 ? 151 PRO C CD    1 
ATOM   5177 N N     . ALA C 1 130 ? -45.176 -39.745 -33.764 1.00 131.41 ? 152 ALA C N     1 
ATOM   5178 C CA    . ALA C 1 130 ? -46.016 -39.306 -32.646 1.00 131.44 ? 152 ALA C CA    1 
ATOM   5179 C C     . ALA C 1 130 ? -47.224 -38.500 -33.134 1.00 131.36 ? 152 ALA C C     1 
ATOM   5180 O O     . ALA C 1 130 ? -47.331 -38.200 -34.339 1.00 131.44 ? 152 ALA C O     1 
ATOM   5181 C CB    . ALA C 1 130 ? -45.192 -38.495 -31.638 1.00 131.49 ? 152 ALA C CB    1 
ATOM   5182 N N     . ARG C 1 131 ? -48.127 -38.155 -32.198 1.00 131.13 ? 153 ARG C N     1 
ATOM   5183 C CA    . ARG C 1 131 ? -49.308 -37.361 -32.528 1.00 131.05 ? 153 ARG C CA    1 
ATOM   5184 C C     . ARG C 1 131 ? -49.002 -35.862 -32.693 1.00 130.31 ? 153 ARG C C     1 
ATOM   5185 O O     . ARG C 1 131 ? -49.429 -35.235 -33.668 1.00 130.28 ? 153 ARG C O     1 
ATOM   5186 C CB    . ARG C 1 131 ? -50.412 -37.576 -31.490 1.00 131.48 ? 153 ARG C CB    1 
ATOM   5187 C CG    . ARG C 1 131 ? -51.747 -37.012 -31.937 1.00 133.72 ? 153 ARG C CG    1 
ATOM   5188 C CD    . ARG C 1 131 ? -52.828 -37.097 -30.872 1.00 137.73 ? 153 ARG C CD    1 
ATOM   5189 N NE    . ARG C 1 131 ? -52.667 -36.163 -29.745 1.00 140.89 ? 153 ARG C NE    1 
ATOM   5190 C CZ    . ARG C 1 131 ? -52.792 -34.835 -29.813 1.00 142.47 ? 153 ARG C CZ    1 
ATOM   5191 N NH1   . ARG C 1 131 ? -53.041 -34.230 -30.970 1.00 143.62 ? 153 ARG C NH1   1 
ATOM   5192 N NH2   . ARG C 1 131 ? -52.645 -34.099 -28.717 1.00 143.03 ? 153 ARG C NH2   1 
ATOM   5193 N N     . VAL C 1 132 ? -48.281 -35.291 -31.728 1.00 129.50 ? 154 VAL C N     1 
ATOM   5194 C CA    . VAL C 1 132 ? -47.820 -33.901 -31.816 1.00 128.59 ? 154 VAL C CA    1 
ATOM   5195 C C     . VAL C 1 132 ? -46.311 -33.909 -31.998 1.00 127.79 ? 154 VAL C C     1 
ATOM   5196 O O     . VAL C 1 132 ? -45.583 -34.492 -31.188 1.00 127.81 ? 154 VAL C O     1 
ATOM   5197 C CB    . VAL C 1 132 ? -48.164 -33.077 -30.546 1.00 128.69 ? 154 VAL C CB    1 
ATOM   5198 C CG1   . VAL C 1 132 ? -47.653 -31.642 -30.677 1.00 128.58 ? 154 VAL C CG1   1 
ATOM   5199 C CG2   . VAL C 1 132 ? -49.655 -33.092 -30.276 1.00 128.76 ? 154 VAL C CG2   1 
ATOM   5200 N N     . LEU C 1 133 ? -45.838 -33.271 -33.061 1.00 126.72 ? 155 LEU C N     1 
ATOM   5201 C CA    . LEU C 1 133 ? -44.404 -33.229 -33.301 1.00 125.60 ? 155 LEU C CA    1 
ATOM   5202 C C     . LEU C 1 133 ? -43.787 -31.920 -32.817 1.00 124.94 ? 155 LEU C C     1 
ATOM   5203 O O     . LEU C 1 133 ? -44.450 -30.877 -32.748 1.00 124.78 ? 155 LEU C O     1 
ATOM   5204 C CB    . LEU C 1 133 ? -44.067 -33.521 -34.774 1.00 125.48 ? 155 LEU C CB    1 
ATOM   5205 C CG    . LEU C 1 133 ? -44.196 -34.974 -35.261 1.00 124.95 ? 155 LEU C CG    1 
ATOM   5206 C CD1   . LEU C 1 133 ? -43.899 -35.034 -36.744 1.00 125.10 ? 155 LEU C CD1   1 
ATOM   5207 C CD2   . LEU C 1 133 ? -43.283 -35.953 -34.517 1.00 124.45 ? 155 LEU C CD2   1 
ATOM   5208 N N     . CYS C 1 134 ? -42.512 -32.004 -32.456 1.00 124.09 ? 156 CYS C N     1 
ATOM   5209 C CA    . CYS C 1 134 ? -41.755 -30.845 -32.045 1.00 123.34 ? 156 CYS C CA    1 
ATOM   5210 C C     . CYS C 1 134 ? -40.339 -30.885 -32.573 1.00 122.90 ? 156 CYS C C     1 
ATOM   5211 O O     . CYS C 1 134 ? -39.830 -31.934 -32.972 1.00 122.89 ? 156 CYS C O     1 
ATOM   5212 C CB    . CYS C 1 134 ? -41.709 -30.762 -30.535 1.00 123.39 ? 156 CYS C CB    1 
ATOM   5213 S SG    . CYS C 1 134 ? -40.133 -30.162 -29.927 1.00 123.18 ? 156 CYS C SG    1 
ATOM   5214 N N     . ASN C 1 135 ? -39.700 -29.727 -32.557 1.00 122.27 ? 157 ASN C N     1 
ATOM   5215 C CA    . ASN C 1 135 ? -38.323 -29.635 -32.954 1.00 121.79 ? 157 ASN C CA    1 
ATOM   5216 C C     . ASN C 1 135 ? -37.559 -28.740 -32.003 1.00 121.47 ? 157 ASN C C     1 
ATOM   5217 O O     . ASN C 1 135 ? -38.156 -27.856 -31.354 1.00 121.48 ? 157 ASN C O     1 
ATOM   5218 C CB    . ASN C 1 135 ? -38.222 -29.100 -34.371 1.00 121.78 ? 157 ASN C CB    1 
ATOM   5219 C CG    . ASN C 1 135 ? -36.799 -28.898 -34.804 1.00 121.83 ? 157 ASN C CG    1 
ATOM   5220 O OD1   . ASN C 1 135 ? -36.341 -27.750 -34.927 1.00 122.18 ? 157 ASN C OD1   1 
ATOM   5221 N ND2   . ASN C 1 135 ? -36.073 -30.013 -34.997 1.00 121.64 ? 157 ASN C ND2   1 
ATOM   5222 N N     . LYS C 1 136 ? -36.241 -28.983 -31.925 1.00 120.95 ? 158 LYS C N     1 
ATOM   5223 C CA    . LYS C 1 136 ? -35.353 -28.156 -31.123 1.00 120.41 ? 158 LYS C CA    1 
ATOM   5224 C C     . LYS C 1 136 ? -34.010 -27.933 -31.823 1.00 120.17 ? 158 LYS C C     1 
ATOM   5225 O O     . LYS C 1 136 ? -33.213 -28.859 -31.968 1.00 120.10 ? 158 LYS C O     1 
ATOM   5226 C CB    . LYS C 1 136 ? -35.151 -28.783 -29.739 1.00 120.33 ? 158 LYS C CB    1 
ATOM   5227 C CG    . LYS C 1 136 ? -34.565 -27.841 -28.684 1.00 119.93 ? 158 LYS C CG    1 
ATOM   5228 C CD    . LYS C 1 136 ? -33.035 -27.759 -28.745 1.00 119.18 ? 158 LYS C CD    1 
ATOM   5229 C CE    . LYS C 1 136 ? -32.374 -29.109 -28.416 1.00 118.57 ? 158 LYS C CE    1 
ATOM   5230 N NZ    . LYS C 1 136 ? -30.907 -28.956 -28.263 1.00 118.36 ? 158 LYS C NZ    1 
ATOM   5231 N N     . ASP C 1 137 ? -33.789 -26.696 -32.268 1.00 119.96 ? 159 ASP C N     1 
ATOM   5232 C CA    . ASP C 1 137 ? -32.485 -26.237 -32.741 1.00 119.88 ? 159 ASP C CA    1 
ATOM   5233 C C     . ASP C 1 137 ? -32.348 -24.782 -32.378 1.00 119.88 ? 159 ASP C C     1 
ATOM   5234 O O     . ASP C 1 137 ? -32.963 -23.925 -33.009 1.00 119.92 ? 159 ASP C O     1 
ATOM   5235 C CB    . ASP C 1 137 ? -32.335 -26.393 -34.244 1.00 119.83 ? 159 ASP C CB    1 
ATOM   5236 C CG    . ASP C 1 137 ? -31.534 -27.608 -34.609 1.00 120.11 ? 159 ASP C CG    1 
ATOM   5237 O OD1   . ASP C 1 137 ? -30.303 -27.607 -34.355 1.00 120.11 ? 159 ASP C OD1   1 
ATOM   5238 O OD2   . ASP C 1 137 ? -32.137 -28.565 -35.149 1.00 120.81 ? 159 ASP C OD2   1 
ATOM   5239 N N     . PRO C 1 138 ? -31.520 -24.493 -31.367 1.00 119.97 ? 160 PRO C N     1 
ATOM   5240 C CA    . PRO C 1 138 ? -31.517 -23.199 -30.696 1.00 119.90 ? 160 PRO C CA    1 
ATOM   5241 C C     . PRO C 1 138 ? -31.874 -22.020 -31.606 1.00 119.79 ? 160 PRO C C     1 
ATOM   5242 O O     . PRO C 1 138 ? -32.819 -21.281 -31.291 1.00 119.73 ? 160 PRO C O     1 
ATOM   5243 C CB    . PRO C 1 138 ? -30.085 -23.096 -30.159 1.00 119.94 ? 160 PRO C CB    1 
ATOM   5244 C CG    . PRO C 1 138 ? -29.736 -24.508 -29.831 1.00 119.86 ? 160 PRO C CG    1 
ATOM   5245 C CD    . PRO C 1 138 ? -30.388 -25.333 -30.927 1.00 120.08 ? 160 PRO C CD    1 
ATOM   5246 N N     . PHE C 1 139 ? -31.170 -21.874 -32.741 1.00 119.73 ? 161 PHE C N     1 
ATOM   5247 C CA    . PHE C 1 139 ? -31.268 -20.638 -33.517 1.00 119.80 ? 161 PHE C CA    1 
ATOM   5248 C C     . PHE C 1 139 ? -32.493 -20.473 -34.414 1.00 119.94 ? 161 PHE C C     1 
ATOM   5249 O O     . PHE C 1 139 ? -32.662 -19.421 -35.044 1.00 119.97 ? 161 PHE C O     1 
ATOM   5250 C CB    . PHE C 1 139 ? -29.970 -20.364 -34.272 1.00 119.71 ? 161 PHE C CB    1 
ATOM   5251 C CG    . PHE C 1 139 ? -28.873 -19.859 -33.386 1.00 119.77 ? 161 PHE C CG    1 
ATOM   5252 C CD1   . PHE C 1 139 ? -28.860 -18.524 -32.960 1.00 119.90 ? 161 PHE C CD1   1 
ATOM   5253 C CD2   . PHE C 1 139 ? -27.867 -20.721 -32.949 1.00 119.62 ? 161 PHE C CD2   1 
ATOM   5254 C CE1   . PHE C 1 139 ? -27.849 -18.047 -32.123 1.00 119.87 ? 161 PHE C CE1   1 
ATOM   5255 C CE2   . PHE C 1 139 ? -26.849 -20.256 -32.119 1.00 119.84 ? 161 PHE C CE2   1 
ATOM   5256 C CZ    . PHE C 1 139 ? -26.840 -18.916 -31.703 1.00 119.97 ? 161 PHE C CZ    1 
ATOM   5257 N N     . THR C 1 140 ? -33.355 -21.496 -34.448 1.00 120.10 ? 162 THR C N     1 
ATOM   5258 C CA    . THR C 1 140 ? -34.630 -21.407 -35.158 1.00 120.04 ? 162 THR C CA    1 
ATOM   5259 C C     . THR C 1 140 ? -35.421 -20.223 -34.638 1.00 120.32 ? 162 THR C C     1 
ATOM   5260 O O     . THR C 1 140 ? -35.878 -19.393 -35.414 1.00 120.24 ? 162 THR C O     1 
ATOM   5261 C CB    . THR C 1 140 ? -35.483 -22.680 -35.011 1.00 119.83 ? 162 THR C CB    1 
ATOM   5262 O OG1   . THR C 1 140 ? -35.809 -22.895 -33.631 1.00 119.35 ? 162 THR C OG1   1 
ATOM   5263 C CG2   . THR C 1 140 ? -34.737 -23.888 -35.547 1.00 119.93 ? 162 THR C CG2   1 
ATOM   5264 N N     . LEU C 1 141 ? -35.536 -20.137 -33.314 1.00 120.93 ? 163 LEU C N     1 
ATOM   5265 C CA    . LEU C 1 141 ? -36.297 -19.076 -32.639 1.00 121.61 ? 163 LEU C CA    1 
ATOM   5266 C C     . LEU C 1 141 ? -35.920 -17.656 -33.064 1.00 121.96 ? 163 LEU C C     1 
ATOM   5267 O O     . LEU C 1 141 ? -36.542 -16.681 -32.630 1.00 122.03 ? 163 LEU C O     1 
ATOM   5268 C CB    . LEU C 1 141 ? -36.192 -19.228 -31.113 1.00 121.58 ? 163 LEU C CB    1 
ATOM   5269 C CG    . LEU C 1 141 ? -37.245 -20.083 -30.367 1.00 121.84 ? 163 LEU C CG    1 
ATOM   5270 C CD1   . LEU C 1 141 ? -38.525 -19.278 -30.106 1.00 122.14 ? 163 LEU C CD1   1 
ATOM   5271 C CD2   . LEU C 1 141 ? -37.571 -21.393 -31.089 1.00 122.16 ? 163 LEU C CD2   1 
ATOM   5272 N N     . LYS C 1 142 ? -34.905 -17.550 -33.914 1.00 122.37 ? 164 LYS C N     1 
ATOM   5273 C CA    . LYS C 1 142 ? -34.539 -16.277 -34.491 1.00 122.87 ? 164 LYS C CA    1 
ATOM   5274 C C     . LYS C 1 142 ? -35.477 -15.948 -35.633 1.00 122.83 ? 164 LYS C C     1 
ATOM   5275 O O     . LYS C 1 142 ? -35.704 -14.771 -35.937 1.00 122.85 ? 164 LYS C O     1 
ATOM   5276 C CB    . LYS C 1 142 ? -33.105 -16.317 -34.994 1.00 123.12 ? 164 LYS C CB    1 
ATOM   5277 C CG    . LYS C 1 142 ? -32.069 -16.327 -33.890 1.00 124.51 ? 164 LYS C CG    1 
ATOM   5278 C CD    . LYS C 1 142 ? -30.738 -15.833 -34.407 1.00 127.50 ? 164 LYS C CD    1 
ATOM   5279 C CE    . LYS C 1 142 ? -30.757 -14.326 -34.622 1.00 129.37 ? 164 LYS C CE    1 
ATOM   5280 N NZ    . LYS C 1 142 ? -29.488 -13.845 -35.275 1.00 131.10 ? 164 LYS C NZ    1 
ATOM   5281 N N     . SER C 1 143 ? -36.026 -16.997 -36.256 1.00 122.93 ? 165 SER C N     1 
ATOM   5282 C CA    . SER C 1 143 ? -36.858 -16.851 -37.455 1.00 123.00 ? 165 SER C CA    1 
ATOM   5283 C C     . SER C 1 143 ? -38.320 -17.219 -37.201 1.00 122.87 ? 165 SER C C     1 
ATOM   5284 O O     . SER C 1 143 ? -39.056 -17.574 -38.125 1.00 122.69 ? 165 SER C O     1 
ATOM   5285 C CB    . SER C 1 143 ? -36.303 -17.719 -38.592 1.00 123.02 ? 165 SER C CB    1 
ATOM   5286 O OG    . SER C 1 143 ? -34.889 -17.665 -38.645 1.00 123.10 ? 165 SER C OG    1 
ATOM   5287 N N     . SER C 1 144 ? -38.738 -17.133 -35.943 1.00 122.95 ? 166 SER C N     1 
ATOM   5288 C CA    . SER C 1 144 ? -40.090 -17.541 -35.577 1.00 123.07 ? 166 SER C CA    1 
ATOM   5289 C C     . SER C 1 144 ? -41.152 -16.801 -36.405 1.00 123.01 ? 166 SER C C     1 
ATOM   5290 O O     . SER C 1 144 ? -42.062 -17.446 -36.982 1.00 123.07 ? 166 SER C O     1 
ATOM   5291 C CB    . SER C 1 144 ? -40.338 -17.444 -34.053 1.00 123.10 ? 166 SER C CB    1 
ATOM   5292 O OG    . SER C 1 144 ? -39.734 -16.277 -33.468 1.00 123.37 ? 166 SER C OG    1 
ATOM   5293 N N     . VAL C 1 145 ? -41.009 -15.467 -36.500 1.00 122.81 ? 167 VAL C N     1 
ATOM   5294 C CA    . VAL C 1 145 ? -41.954 -14.664 -37.276 1.00 122.60 ? 167 VAL C CA    1 
ATOM   5295 C C     . VAL C 1 145 ? -42.262 -15.413 -38.553 1.00 122.70 ? 167 VAL C C     1 
ATOM   5296 O O     . VAL C 1 145 ? -43.416 -15.727 -38.825 1.00 122.75 ? 167 VAL C O     1 
ATOM   5297 C CB    . VAL C 1 145 ? -41.439 -13.225 -37.549 1.00 122.48 ? 167 VAL C CB    1 
ATOM   5298 C CG1   . VAL C 1 145 ? -42.111 -12.611 -38.762 1.00 122.05 ? 167 VAL C CG1   1 
ATOM   5299 C CG2   . VAL C 1 145 ? -41.720 -12.352 -36.345 1.00 122.63 ? 167 VAL C CG2   1 
ATOM   5300 N N     . TYR C 1 146 ? -41.210 -15.748 -39.293 1.00 122.93 ? 168 TYR C N     1 
ATOM   5301 C CA    . TYR C 1 146 ? -41.320 -16.507 -40.533 1.00 123.22 ? 168 TYR C CA    1 
ATOM   5302 C C     . TYR C 1 146 ? -41.866 -17.921 -40.296 1.00 123.45 ? 168 TYR C C     1 
ATOM   5303 O O     . TYR C 1 146 ? -42.791 -18.353 -40.983 1.00 123.63 ? 168 TYR C O     1 
ATOM   5304 C CB    . TYR C 1 146 ? -39.954 -16.536 -41.233 1.00 123.20 ? 168 TYR C CB    1 
ATOM   5305 C CG    . TYR C 1 146 ? -39.886 -17.267 -42.565 1.00 123.37 ? 168 TYR C CG    1 
ATOM   5306 C CD1   . TYR C 1 146 ? -40.418 -16.698 -43.735 1.00 123.87 ? 168 TYR C CD1   1 
ATOM   5307 C CD2   . TYR C 1 146 ? -39.247 -18.512 -42.662 1.00 123.47 ? 168 TYR C CD2   1 
ATOM   5308 C CE1   . TYR C 1 146 ? -40.340 -17.368 -44.962 1.00 123.97 ? 168 TYR C CE1   1 
ATOM   5309 C CE2   . TYR C 1 146 ? -39.160 -19.185 -43.878 1.00 123.72 ? 168 TYR C CE2   1 
ATOM   5310 C CZ    . TYR C 1 146 ? -39.712 -18.611 -45.020 1.00 124.02 ? 168 TYR C CZ    1 
ATOM   5311 O OH    . TYR C 1 146 ? -39.628 -19.276 -46.224 1.00 124.21 ? 168 TYR C OH    1 
ATOM   5312 N N     . LEU C 1 147 ? -41.313 -18.628 -39.315 1.00 123.66 ? 169 LEU C N     1 
ATOM   5313 C CA    . LEU C 1 147 ? -41.725 -19.997 -39.031 1.00 123.92 ? 169 LEU C CA    1 
ATOM   5314 C C     . LEU C 1 147 ? -43.226 -20.130 -38.850 1.00 124.37 ? 169 LEU C C     1 
ATOM   5315 O O     . LEU C 1 147 ? -43.857 -21.031 -39.412 1.00 124.29 ? 169 LEU C O     1 
ATOM   5316 C CB    . LEU C 1 147 ? -41.011 -20.484 -37.780 1.00 123.88 ? 169 LEU C CB    1 
ATOM   5317 C CG    . LEU C 1 147 ? -39.905 -21.524 -37.907 1.00 123.48 ? 169 LEU C CG    1 
ATOM   5318 C CD1   . LEU C 1 147 ? -39.396 -21.616 -39.310 1.00 123.36 ? 169 LEU C CD1   1 
ATOM   5319 C CD2   . LEU C 1 147 ? -38.788 -21.189 -36.949 1.00 123.12 ? 169 LEU C CD2   1 
ATOM   5320 N N     . SER C 1 148 ? -43.785 -19.210 -38.068 1.00 125.11 ? 170 SER C N     1 
ATOM   5321 C CA    . SER C 1 148 ? -45.208 -19.199 -37.744 1.00 125.92 ? 170 SER C CA    1 
ATOM   5322 C C     . SER C 1 148 ? -46.044 -18.998 -38.998 1.00 126.32 ? 170 SER C C     1 
ATOM   5323 O O     . SER C 1 148 ? -47.180 -19.477 -39.077 1.00 126.45 ? 170 SER C O     1 
ATOM   5324 C CB    . SER C 1 148 ? -45.509 -18.096 -36.726 1.00 125.95 ? 170 SER C CB    1 
ATOM   5325 O OG    . SER C 1 148 ? -46.874 -18.128 -36.330 1.00 126.30 ? 170 SER C OG    1 
ATOM   5326 N N     . ARG C 1 149 ? -45.467 -18.284 -39.966 1.00 126.76 ? 171 ARG C N     1 
ATOM   5327 C CA    . ARG C 1 149 ? -46.093 -18.062 -41.269 1.00 127.13 ? 171 ARG C CA    1 
ATOM   5328 C C     . ARG C 1 149 ? -46.070 -19.335 -42.082 1.00 126.63 ? 171 ARG C C     1 
ATOM   5329 O O     . ARG C 1 149 ? -46.977 -19.577 -42.886 1.00 126.73 ? 171 ARG C O     1 
ATOM   5330 C CB    . ARG C 1 149 ? -45.397 -16.945 -42.047 1.00 127.48 ? 171 ARG C CB    1 
ATOM   5331 C CG    . ARG C 1 149 ? -45.482 -15.611 -41.361 1.00 129.80 ? 171 ARG C CG    1 
ATOM   5332 C CD    . ARG C 1 149 ? -45.644 -14.489 -42.346 1.00 134.12 ? 171 ARG C CD    1 
ATOM   5333 N NE    . ARG C 1 149 ? -45.846 -13.232 -41.629 1.00 137.23 ? 171 ARG C NE    1 
ATOM   5334 C CZ    . ARG C 1 149 ? -44.870 -12.383 -41.324 1.00 138.94 ? 171 ARG C CZ    1 
ATOM   5335 N NH1   . ARG C 1 149 ? -43.617 -12.646 -41.690 1.00 139.73 ? 171 ARG C NH1   1 
ATOM   5336 N NH2   . ARG C 1 149 ? -45.149 -11.265 -40.662 1.00 139.80 ? 171 ARG C NH2   1 
ATOM   5337 N N     . LEU C 1 150 ? -45.033 -20.146 -41.866 1.00 126.09 ? 172 LEU C N     1 
ATOM   5338 C CA    . LEU C 1 150 ? -44.927 -21.412 -42.565 1.00 125.57 ? 172 LEU C CA    1 
ATOM   5339 C C     . LEU C 1 150 ? -45.844 -22.452 -41.961 1.00 125.27 ? 172 LEU C C     1 
ATOM   5340 O O     . LEU C 1 150 ? -46.288 -23.373 -42.667 1.00 125.32 ? 172 LEU C O     1 
ATOM   5341 C CB    . LEU C 1 150 ? -43.491 -21.925 -42.562 1.00 125.62 ? 172 LEU C CB    1 
ATOM   5342 C CG    . LEU C 1 150 ? -42.425 -21.253 -43.434 1.00 125.29 ? 172 LEU C CG    1 
ATOM   5343 C CD1   . LEU C 1 150 ? -41.190 -22.112 -43.450 1.00 125.05 ? 172 LEU C CD1   1 
ATOM   5344 C CD2   . LEU C 1 150 ? -42.903 -21.049 -44.840 1.00 125.31 ? 172 LEU C CD2   1 
ATOM   5345 N N     . PHE C 1 151 ? -46.133 -22.316 -40.656 1.00 124.86 ? 173 PHE C N     1 
ATOM   5346 C CA    . PHE C 1 151 ? -46.978 -23.296 -39.993 1.00 124.60 ? 173 PHE C CA    1 
ATOM   5347 C C     . PHE C 1 151 ? -47.905 -22.610 -39.004 1.00 124.62 ? 173 PHE C C     1 
ATOM   5348 O O     . PHE C 1 151 ? -47.556 -22.431 -37.842 1.00 124.77 ? 173 PHE C O     1 
ATOM   5349 C CB    . PHE C 1 151 ? -46.112 -24.352 -39.320 1.00 124.52 ? 173 PHE C CB    1 
ATOM   5350 C CG    . PHE C 1 151 ? -44.991 -24.846 -40.189 1.00 123.93 ? 173 PHE C CG    1 
ATOM   5351 C CD1   . PHE C 1 151 ? -45.205 -25.867 -41.101 1.00 123.35 ? 173 PHE C CD1   1 
ATOM   5352 C CD2   . PHE C 1 151 ? -43.724 -24.285 -40.099 1.00 123.58 ? 173 PHE C CD2   1 
ATOM   5353 C CE1   . PHE C 1 151 ? -44.178 -26.332 -41.904 1.00 122.86 ? 173 PHE C CE1   1 
ATOM   5354 C CE2   . PHE C 1 151 ? -42.689 -24.745 -40.900 1.00 123.40 ? 173 PHE C CE2   1 
ATOM   5355 C CZ    . PHE C 1 151 ? -42.922 -25.771 -41.808 1.00 123.17 ? 173 PHE C CZ    1 
ATOM   5356 N N     . PRO C 1 152 ? -49.110 -22.239 -39.466 1.00 124.55 ? 174 PRO C N     1 
ATOM   5357 C CA    . PRO C 1 152 ? -49.982 -21.302 -38.758 1.00 124.43 ? 174 PRO C CA    1 
ATOM   5358 C C     . PRO C 1 152 ? -50.514 -21.897 -37.469 1.00 124.26 ? 174 PRO C C     1 
ATOM   5359 O O     . PRO C 1 152 ? -51.163 -21.201 -36.689 1.00 124.28 ? 174 PRO C O     1 
ATOM   5360 C CB    . PRO C 1 152 ? -51.140 -21.065 -39.745 1.00 124.51 ? 174 PRO C CB    1 
ATOM   5361 C CG    . PRO C 1 152 ? -50.720 -21.759 -41.038 1.00 124.54 ? 174 PRO C CG    1 
ATOM   5362 C CD    . PRO C 1 152 ? -49.817 -22.859 -40.618 1.00 124.61 ? 174 PRO C CD    1 
ATOM   5363 N N     . ASN C 1 153 ? -50.237 -23.177 -37.255 1.00 123.99 ? 175 ASN C N     1 
ATOM   5364 C CA    . ASN C 1 153 ? -50.651 -23.830 -36.037 1.00 123.83 ? 175 ASN C CA    1 
ATOM   5365 C C     . ASN C 1 153 ? -49.491 -24.383 -35.241 1.00 123.54 ? 175 ASN C C     1 
ATOM   5366 O O     . ASN C 1 153 ? -49.673 -25.204 -34.345 1.00 123.56 ? 175 ASN C O     1 
ATOM   5367 C CB    . ASN C 1 153 ? -51.663 -24.919 -36.343 1.00 124.01 ? 175 ASN C CB    1 
ATOM   5368 C CG    . ASN C 1 153 ? -52.952 -24.366 -36.917 1.00 124.54 ? 175 ASN C CG    1 
ATOM   5369 O OD1   . ASN C 1 153 ? -53.674 -25.091 -37.624 1.00 125.44 ? 175 ASN C OD1   1 
ATOM   5370 N ND2   . ASN C 1 153 ? -53.250 -23.076 -36.615 1.00 124.91 ? 175 ASN C ND2   1 
ATOM   5371 N N     . SER C 1 154 ? -48.293 -23.918 -35.568 1.00 123.21 ? 176 SER C N     1 
ATOM   5372 C CA    . SER C 1 154 ? -47.121 -24.213 -34.770 1.00 122.77 ? 176 SER C CA    1 
ATOM   5373 C C     . SER C 1 154 ? -47.092 -23.280 -33.574 1.00 122.57 ? 176 SER C C     1 
ATOM   5374 O O     . SER C 1 154 ? -47.619 -22.165 -33.633 1.00 122.59 ? 176 SER C O     1 
ATOM   5375 C CB    . SER C 1 154 ? -45.869 -23.979 -35.589 1.00 122.73 ? 176 SER C CB    1 
ATOM   5376 O OG    . SER C 1 154 ? -45.787 -22.605 -35.937 1.00 122.55 ? 176 SER C OG    1 
ATOM   5377 N N     . LYS C 1 155 ? -46.459 -23.739 -32.500 1.00 122.20 ? 177 LYS C N     1 
ATOM   5378 C CA    . LYS C 1 155 ? -46.286 -22.939 -31.300 1.00 121.86 ? 177 LYS C CA    1 
ATOM   5379 C C     . LYS C 1 155 ? -44.801 -22.843 -30.939 1.00 121.23 ? 177 LYS C C     1 
ATOM   5380 O O     . LYS C 1 155 ? -44.008 -23.713 -31.312 1.00 120.87 ? 177 LYS C O     1 
ATOM   5381 C CB    . LYS C 1 155 ? -47.082 -23.543 -30.140 1.00 122.21 ? 177 LYS C CB    1 
ATOM   5382 C CG    . LYS C 1 155 ? -48.610 -23.408 -30.222 1.00 123.34 ? 177 LYS C CG    1 
ATOM   5383 C CD    . LYS C 1 155 ? -49.109 -22.076 -29.632 1.00 125.55 ? 177 LYS C CD    1 
ATOM   5384 C CE    . LYS C 1 155 ? -50.185 -22.277 -28.561 1.00 126.46 ? 177 LYS C CE    1 
ATOM   5385 N NZ    . LYS C 1 155 ? -51.279 -23.205 -28.952 1.00 127.76 ? 177 LYS C NZ    1 
ATOM   5386 N N     . PHE C 1 156 ? -44.450 -21.795 -30.186 1.00 120.82 ? 178 PHE C N     1 
ATOM   5387 C CA    . PHE C 1 156 ? -43.046 -21.448 -29.878 1.00 120.36 ? 178 PHE C CA    1 
ATOM   5388 C C     . PHE C 1 156 ? -42.637 -21.303 -28.382 1.00 119.96 ? 178 PHE C C     1 
ATOM   5389 O O     . PHE C 1 156 ? -43.209 -20.510 -27.619 1.00 119.75 ? 178 PHE C O     1 
ATOM   5390 C CB    . PHE C 1 156 ? -42.643 -20.182 -30.651 1.00 120.42 ? 178 PHE C CB    1 
ATOM   5391 C CG    . PHE C 1 156 ? -42.650 -20.354 -32.159 1.00 120.13 ? 178 PHE C CG    1 
ATOM   5392 C CD1   . PHE C 1 156 ? -41.478 -20.703 -32.846 1.00 119.51 ? 178 PHE C CD1   1 
ATOM   5393 C CD2   . PHE C 1 156 ? -43.819 -20.153 -32.892 1.00 119.72 ? 178 PHE C CD2   1 
ATOM   5394 C CE1   . PHE C 1 156 ? -41.476 -20.858 -34.231 1.00 118.60 ? 178 PHE C CE1   1 
ATOM   5395 C CE2   . PHE C 1 156 ? -43.825 -20.306 -34.278 1.00 119.36 ? 178 PHE C CE2   1 
ATOM   5396 C CZ    . PHE C 1 156 ? -42.650 -20.662 -34.944 1.00 118.73 ? 178 PHE C CZ    1 
ATOM   5397 N N     . LEU C 1 157 ? -41.617 -22.073 -28.002 1.00 119.56 ? 179 LEU C N     1 
ATOM   5398 C CA    . LEU C 1 157 ? -41.033 -22.029 -26.671 1.00 119.26 ? 179 LEU C CA    1 
ATOM   5399 C C     . LEU C 1 157 ? -39.576 -21.535 -26.699 1.00 119.16 ? 179 LEU C C     1 
ATOM   5400 O O     . LEU C 1 157 ? -38.651 -22.262 -27.108 1.00 118.92 ? 179 LEU C O     1 
ATOM   5401 C CB    . LEU C 1 157 ? -41.129 -23.410 -26.008 1.00 119.27 ? 179 LEU C CB    1 
ATOM   5402 C CG    . LEU C 1 157 ? -42.518 -24.055 -25.816 1.00 118.77 ? 179 LEU C CG    1 
ATOM   5403 C CD1   . LEU C 1 157 ? -42.359 -25.497 -25.306 1.00 118.39 ? 179 LEU C CD1   1 
ATOM   5404 C CD2   . LEU C 1 157 ? -43.367 -23.204 -24.852 1.00 118.76 ? 179 LEU C CD2   1 
ATOM   5405 N N     . LEU C 1 158 ? -39.390 -20.293 -26.252 1.00 119.04 ? 180 LEU C N     1 
ATOM   5406 C CA    . LEU C 1 158 ? -38.081 -19.644 -26.201 1.00 118.89 ? 180 LEU C CA    1 
ATOM   5407 C C     . LEU C 1 158 ? -37.500 -19.714 -24.777 1.00 118.97 ? 180 LEU C C     1 
ATOM   5408 O O     . LEU C 1 158 ? -37.972 -19.010 -23.876 1.00 119.39 ? 180 LEU C O     1 
ATOM   5409 C CB    . LEU C 1 158 ? -38.246 -18.183 -26.648 1.00 118.81 ? 180 LEU C CB    1 
ATOM   5410 C CG    . LEU C 1 158 ? -37.153 -17.133 -26.349 1.00 118.54 ? 180 LEU C CG    1 
ATOM   5411 C CD1   . LEU C 1 158 ? -35.887 -17.466 -27.124 1.00 119.13 ? 180 LEU C CD1   1 
ATOM   5412 C CD2   . LEU C 1 158 ? -37.658 -15.756 -26.727 1.00 118.46 ? 180 LEU C CD2   1 
ATOM   5413 N N     . MET C 1 159 ? -36.489 -20.564 -24.566 1.00 118.80 ? 181 MET C N     1 
ATOM   5414 C CA    . MET C 1 159 ? -35.889 -20.741 -23.225 1.00 118.44 ? 181 MET C CA    1 
ATOM   5415 C C     . MET C 1 159 ? -35.121 -19.504 -22.803 1.00 118.39 ? 181 MET C C     1 
ATOM   5416 O O     . MET C 1 159 ? -34.280 -19.008 -23.548 1.00 118.52 ? 181 MET C O     1 
ATOM   5417 C CB    . MET C 1 159 ? -34.943 -21.944 -23.194 1.00 118.32 ? 181 MET C CB    1 
ATOM   5418 C CG    . MET C 1 159 ? -35.621 -23.267 -23.451 1.00 118.18 ? 181 MET C CG    1 
ATOM   5419 S SD    . MET C 1 159 ? -36.905 -23.613 -22.261 1.00 117.15 ? 181 MET C SD    1 
ATOM   5420 C CE    . MET C 1 159 ? -35.897 -23.933 -20.816 1.00 118.69 ? 181 MET C CE    1 
ATOM   5421 N N     . VAL C 1 160 ? -35.418 -19.004 -21.611 1.00 118.36 ? 182 VAL C N     1 
ATOM   5422 C CA    . VAL C 1 160 ? -34.724 -17.830 -21.082 1.00 118.47 ? 182 VAL C CA    1 
ATOM   5423 C C     . VAL C 1 160 ? -33.983 -18.148 -19.780 1.00 118.57 ? 182 VAL C C     1 
ATOM   5424 O O     . VAL C 1 160 ? -34.587 -18.397 -18.730 1.00 118.72 ? 182 VAL C O     1 
ATOM   5425 C CB    . VAL C 1 160 ? -35.665 -16.597 -20.926 1.00 118.44 ? 182 VAL C CB    1 
ATOM   5426 C CG1   . VAL C 1 160 ? -34.923 -15.423 -20.290 1.00 118.34 ? 182 VAL C CG1   1 
ATOM   5427 C CG2   . VAL C 1 160 ? -36.217 -16.171 -22.285 1.00 118.66 ? 182 VAL C CG2   1 
ATOM   5428 N N     . ARG C 1 161 ? -32.659 -18.147 -19.880 1.00 118.56 ? 183 ARG C N     1 
ATOM   5429 C CA    . ARG C 1 161 ? -31.790 -18.348 -18.744 1.00 118.48 ? 183 ARG C CA    1 
ATOM   5430 C C     . ARG C 1 161 ? -30.925 -17.116 -18.592 1.00 118.30 ? 183 ARG C C     1 
ATOM   5431 O O     . ARG C 1 161 ? -30.559 -16.469 -19.574 1.00 118.08 ? 183 ARG C O     1 
ATOM   5432 C CB    . ARG C 1 161 ? -30.915 -19.571 -18.979 1.00 118.64 ? 183 ARG C CB    1 
ATOM   5433 C CG    . ARG C 1 161 ? -30.124 -20.044 -17.765 1.00 119.03 ? 183 ARG C CG    1 
ATOM   5434 C CD    . ARG C 1 161 ? -29.262 -21.230 -18.172 1.00 119.70 ? 183 ARG C CD    1 
ATOM   5435 N NE    . ARG C 1 161 ? -28.429 -21.748 -17.092 1.00 120.08 ? 183 ARG C NE    1 
ATOM   5436 C CZ    . ARG C 1 161 ? -27.376 -22.541 -17.278 1.00 120.50 ? 183 ARG C CZ    1 
ATOM   5437 N NH1   . ARG C 1 161 ? -27.019 -22.904 -18.507 1.00 120.73 ? 183 ARG C NH1   1 
ATOM   5438 N NH2   . ARG C 1 161 ? -26.670 -22.962 -16.234 1.00 120.36 ? 183 ARG C NH2   1 
ATOM   5439 N N     . ASP C 1 162 ? -30.608 -16.793 -17.347 1.00 118.37 ? 184 ASP C N     1 
ATOM   5440 C CA    . ASP C 1 162 ? -29.703 -15.702 -17.054 1.00 118.44 ? 184 ASP C CA    1 
ATOM   5441 C C     . ASP C 1 162 ? -28.491 -15.865 -17.954 1.00 118.32 ? 184 ASP C C     1 
ATOM   5442 O O     . ASP C 1 162 ? -27.813 -16.898 -17.917 1.00 118.32 ? 184 ASP C O     1 
ATOM   5443 C CB    . ASP C 1 162 ? -29.294 -15.738 -15.577 1.00 118.61 ? 184 ASP C CB    1 
ATOM   5444 C CG    . ASP C 1 162 ? -28.708 -14.418 -15.092 1.00 118.94 ? 184 ASP C CG    1 
ATOM   5445 O OD1   . ASP C 1 162 ? -28.043 -13.715 -15.886 1.00 119.34 ? 184 ASP C OD1   1 
ATOM   5446 O OD2   . ASP C 1 162 ? -28.907 -14.091 -13.900 1.00 119.22 ? 184 ASP C OD2   1 
ATOM   5447 N N     . GLY C 1 163 ? -28.243 -14.855 -18.781 1.00 118.27 ? 185 GLY C N     1 
ATOM   5448 C CA    . GLY C 1 163 ? -27.126 -14.883 -19.731 1.00 118.18 ? 185 GLY C CA    1 
ATOM   5449 C C     . GLY C 1 163 ? -25.781 -15.145 -19.095 1.00 118.08 ? 185 GLY C C     1 
ATOM   5450 O O     . GLY C 1 163 ? -24.888 -15.728 -19.716 1.00 118.12 ? 185 GLY C O     1 
ATOM   5451 N N     . ARG C 1 164 ? -25.653 -14.712 -17.845 1.00 117.96 ? 186 ARG C N     1 
ATOM   5452 C CA    . ARG C 1 164 ? -24.455 -14.930 -17.067 1.00 117.98 ? 186 ARG C CA    1 
ATOM   5453 C C     . ARG C 1 164 ? -24.162 -16.427 -16.876 1.00 118.01 ? 186 ARG C C     1 
ATOM   5454 O O     . ARG C 1 164 ? -22.999 -16.834 -16.952 1.00 118.39 ? 186 ARG C O     1 
ATOM   5455 C CB    . ARG C 1 164 ? -24.537 -14.164 -15.739 1.00 117.94 ? 186 ARG C CB    1 
ATOM   5456 C CG    . ARG C 1 164 ? -24.322 -12.650 -15.914 1.00 117.97 ? 186 ARG C CG    1 
ATOM   5457 C CD    . ARG C 1 164 ? -24.482 -11.855 -14.623 1.00 118.08 ? 186 ARG C CD    1 
ATOM   5458 N NE    . ARG C 1 164 ? -25.848 -11.943 -14.100 1.00 118.84 ? 186 ARG C NE    1 
ATOM   5459 C CZ    . ARG C 1 164 ? -26.326 -11.230 -13.077 1.00 119.30 ? 186 ARG C CZ    1 
ATOM   5460 N NH1   . ARG C 1 164 ? -25.555 -10.355 -12.446 1.00 119.65 ? 186 ARG C NH1   1 
ATOM   5461 N NH2   . ARG C 1 164 ? -27.590 -11.390 -12.687 1.00 119.58 ? 186 ARG C NH2   1 
ATOM   5462 N N     . ALA C 1 165 ? -25.204 -17.241 -16.679 1.00 117.73 ? 187 ALA C N     1 
ATOM   5463 C CA    . ALA C 1 165 ? -25.032 -18.694 -16.498 1.00 117.50 ? 187 ALA C CA    1 
ATOM   5464 C C     . ALA C 1 165 ? -24.880 -19.451 -17.821 1.00 117.38 ? 187 ALA C C     1 
ATOM   5465 O O     . ALA C 1 165 ? -24.290 -20.549 -17.855 1.00 117.15 ? 187 ALA C O     1 
ATOM   5466 C CB    . ALA C 1 165 ? -26.176 -19.272 -15.685 1.00 117.61 ? 187 ALA C CB    1 
ATOM   5467 N N     . SER C 1 166 ? -25.431 -18.864 -18.892 1.00 117.40 ? 188 SER C N     1 
ATOM   5468 C CA    . SER C 1 166 ? -25.261 -19.383 -20.252 1.00 117.48 ? 188 SER C CA    1 
ATOM   5469 C C     . SER C 1 166 ? -23.849 -19.113 -20.747 1.00 117.40 ? 188 SER C C     1 
ATOM   5470 O O     . SER C 1 166 ? -23.186 -20.017 -21.247 1.00 117.48 ? 188 SER C O     1 
ATOM   5471 C CB    . SER C 1 166 ? -26.260 -18.743 -21.229 1.00 117.50 ? 188 SER C CB    1 
ATOM   5472 O OG    . SER C 1 166 ? -27.593 -19.284 -21.064 1.00 117.68 ? 188 SER C OG    1 
ATOM   5473 N N     . VAL C 1 167 ? -23.403 -17.864 -20.606 1.00 117.29 ? 189 VAL C N     1 
ATOM   5474 C CA    . VAL C 1 167 ? -22.084 -17.441 -21.070 1.00 117.18 ? 189 VAL C CA    1 
ATOM   5475 C C     . VAL C 1 167 ? -20.987 -18.174 -20.317 1.00 117.22 ? 189 VAL C C     1 
ATOM   5476 O O     . VAL C 1 167 ? -20.035 -18.667 -20.920 1.00 117.00 ? 189 VAL C O     1 
ATOM   5477 C CB    . VAL C 1 167 ? -21.920 -15.914 -20.981 1.00 117.08 ? 189 VAL C CB    1 
ATOM   5478 C CG1   . VAL C 1 167 ? -20.470 -15.525 -20.829 1.00 117.29 ? 189 VAL C CG1   1 
ATOM   5479 C CG2   . VAL C 1 167 ? -22.493 -15.277 -22.220 1.00 116.79 ? 189 VAL C CG2   1 
ATOM   5480 N N     . HIS C 1 168 ? -21.143 -18.248 -19.001 1.00 117.43 ? 190 HIS C N     1 
ATOM   5481 C CA    . HIS C 1 168 ? -20.282 -19.060 -18.155 1.00 117.97 ? 190 HIS C CA    1 
ATOM   5482 C C     . HIS C 1 168 ? -20.291 -20.513 -18.621 1.00 117.78 ? 190 HIS C C     1 
ATOM   5483 O O     . HIS C 1 168 ? -19.238 -21.107 -18.819 1.00 117.83 ? 190 HIS C O     1 
ATOM   5484 C CB    . HIS C 1 168 ? -20.742 -18.950 -16.696 1.00 118.42 ? 190 HIS C CB    1 
ATOM   5485 C CG    . HIS C 1 168 ? -20.094 -19.937 -15.763 1.00 120.11 ? 190 HIS C CG    1 
ATOM   5486 N ND1   . HIS C 1 168 ? -18.792 -19.799 -15.317 1.00 121.56 ? 190 HIS C ND1   1 
ATOM   5487 C CD2   . HIS C 1 168 ? -20.583 -21.057 -15.164 1.00 121.47 ? 190 HIS C CD2   1 
ATOM   5488 C CE1   . HIS C 1 168 ? -18.502 -20.802 -14.497 1.00 122.28 ? 190 HIS C CE1   1 
ATOM   5489 N NE2   . HIS C 1 168 ? -19.571 -21.579 -14.388 1.00 122.16 ? 190 HIS C NE2   1 
ATOM   5490 N N     . SER C 1 169 ? -21.482 -21.074 -18.805 1.00 117.80 ? 191 SER C N     1 
ATOM   5491 C CA    . SER C 1 169 ? -21.608 -22.450 -19.260 1.00 117.79 ? 191 SER C CA    1 
ATOM   5492 C C     . SER C 1 169 ? -20.869 -22.710 -20.576 1.00 117.97 ? 191 SER C C     1 
ATOM   5493 O O     . SER C 1 169 ? -20.202 -23.744 -20.708 1.00 117.90 ? 191 SER C O     1 
ATOM   5494 C CB    . SER C 1 169 ? -23.078 -22.837 -19.397 1.00 117.70 ? 191 SER C CB    1 
ATOM   5495 O OG    . SER C 1 169 ? -23.198 -24.052 -20.104 1.00 117.50 ? 191 SER C OG    1 
ATOM   5496 N N     . MET C 1 170 ? -20.977 -21.773 -21.532 1.00 118.41 ? 192 MET C N     1 
ATOM   5497 C CA    . MET C 1 170 ? -20.415 -21.966 -22.892 1.00 118.94 ? 192 MET C CA    1 
ATOM   5498 C C     . MET C 1 170 ? -18.907 -21.726 -22.992 1.00 119.15 ? 192 MET C C     1 
ATOM   5499 O O     . MET C 1 170 ? -18.235 -22.274 -23.877 1.00 118.99 ? 192 MET C O     1 
ATOM   5500 C CB    . MET C 1 170 ? -21.165 -21.131 -23.951 1.00 119.08 ? 192 MET C CB    1 
ATOM   5501 C CG    . MET C 1 170 ? -21.010 -19.604 -23.836 1.00 119.34 ? 192 MET C CG    1 
ATOM   5502 S SD    . MET C 1 170 ? -21.926 -18.682 -25.109 1.00 120.20 ? 192 MET C SD    1 
ATOM   5503 C CE    . MET C 1 170 ? -23.645 -18.919 -24.626 1.00 118.95 ? 192 MET C CE    1 
ATOM   5504 N N     . ILE C 1 171 ? -18.402 -20.886 -22.089 1.00 119.63 ? 193 ILE C N     1 
ATOM   5505 C CA    . ILE C 1 171 ? -16.965 -20.620 -21.932 1.00 119.96 ? 193 ILE C CA    1 
ATOM   5506 C C     . ILE C 1 171 ? -16.260 -21.806 -21.247 1.00 120.23 ? 193 ILE C C     1 
ATOM   5507 O O     . ILE C 1 171 ? -15.241 -22.287 -21.738 1.00 120.31 ? 193 ILE C O     1 
ATOM   5508 C CB    . ILE C 1 171 ? -16.721 -19.253 -21.191 1.00 119.88 ? 193 ILE C CB    1 
ATOM   5509 C CG1   . ILE C 1 171 ? -16.778 -18.090 -22.203 1.00 120.00 ? 193 ILE C CG1   1 
ATOM   5510 C CG2   . ILE C 1 171 ? -15.404 -19.238 -20.418 1.00 119.39 ? 193 ILE C CG2   1 
ATOM   5511 C CD1   . ILE C 1 171 ? -16.946 -16.712 -21.583 1.00 119.55 ? 193 ILE C CD1   1 
ATOM   5512 N N     . THR C 1 172 ? -16.830 -22.289 -20.143 1.00 120.68 ? 194 THR C N     1 
ATOM   5513 C CA    . THR C 1 172 ? -16.250 -23.394 -19.369 1.00 121.21 ? 194 THR C CA    1 
ATOM   5514 C C     . THR C 1 172 ? -16.409 -24.783 -20.004 1.00 121.36 ? 194 THR C C     1 
ATOM   5515 O O     . THR C 1 172 ? -15.545 -25.656 -19.817 1.00 121.45 ? 194 THR C O     1 
ATOM   5516 C CB    . THR C 1 172 ? -16.821 -23.436 -17.933 1.00 121.24 ? 194 THR C CB    1 
ATOM   5517 O OG1   . THR C 1 172 ? -18.237 -23.682 -17.984 1.00 121.82 ? 194 THR C OG1   1 
ATOM   5518 C CG2   . THR C 1 172 ? -16.562 -22.107 -17.224 1.00 121.53 ? 194 THR C CG2   1 
ATOM   5519 N N     . ARG C 1 173 ? -17.511 -24.979 -20.738 1.00 121.58 ? 195 ARG C N     1 
ATOM   5520 C CA    . ARG C 1 173 ? -17.820 -26.260 -21.399 1.00 121.71 ? 195 ARG C CA    1 
ATOM   5521 C C     . ARG C 1 173 ? -17.275 -26.374 -22.815 1.00 121.81 ? 195 ARG C C     1 
ATOM   5522 O O     . ARG C 1 173 ? -17.550 -27.377 -23.514 1.00 121.80 ? 195 ARG C O     1 
ATOM   5523 C CB    . ARG C 1 173 ? -19.320 -26.511 -21.435 1.00 121.67 ? 195 ARG C CB    1 
ATOM   5524 C CG    . ARG C 1 173 ? -19.897 -26.920 -20.117 1.00 121.65 ? 195 ARG C CG    1 
ATOM   5525 C CD    . ARG C 1 173 ? -21.358 -27.267 -20.300 1.00 121.78 ? 195 ARG C CD    1 
ATOM   5526 N NE    . ARG C 1 173 ? -22.027 -27.488 -19.017 1.00 122.12 ? 195 ARG C NE    1 
ATOM   5527 C CZ    . ARG C 1 173 ? -22.130 -28.689 -18.412 1.00 122.28 ? 195 ARG C CZ    1 
ATOM   5528 N NH1   . ARG C 1 173 ? -21.593 -29.799 -18.968 1.00 122.81 ? 195 ARG C NH1   1 
ATOM   5529 N NH2   . ARG C 1 173 ? -22.766 -28.784 -17.245 1.00 121.48 ? 195 ARG C NH2   1 
ATOM   5530 N N     . LYS C 1 174 ? -16.525 -25.332 -23.228 1.00 122.02 ? 196 LYS C N     1 
ATOM   5531 C CA    . LYS C 1 174 ? -15.759 -25.337 -24.482 1.00 122.04 ? 196 LYS C CA    1 
ATOM   5532 C C     . LYS C 1 174 ? -16.622 -25.525 -25.745 1.00 122.16 ? 196 LYS C C     1 
ATOM   5533 O O     . LYS C 1 174 ? -16.338 -26.380 -26.590 1.00 122.23 ? 196 LYS C O     1 
ATOM   5534 C CB    . LYS C 1 174 ? -14.548 -26.299 -24.402 1.00 121.85 ? 196 LYS C CB    1 
ATOM   5535 C CG    . LYS C 1 174 ? -13.295 -25.680 -23.738 1.00 121.18 ? 196 LYS C CG    1 
ATOM   5536 C CD    . LYS C 1 174 ? -13.114 -26.025 -22.246 1.00 120.53 ? 196 LYS C CD    1 
ATOM   5537 C CE    . LYS C 1 174 ? -11.881 -26.912 -22.019 1.00 120.04 ? 196 LYS C CE    1 
ATOM   5538 N NZ    . LYS C 1 174 ? -11.226 -26.666 -20.694 1.00 119.15 ? 196 LYS C NZ    1 
ATOM   5539 N N     . VAL C 1 175 ? -17.681 -24.714 -25.853 1.00 122.22 ? 197 VAL C N     1 
ATOM   5540 C CA    . VAL C 1 175 ? -18.550 -24.707 -27.032 1.00 122.38 ? 197 VAL C CA    1 
ATOM   5541 C C     . VAL C 1 175 ? -18.220 -23.469 -27.886 1.00 122.31 ? 197 VAL C C     1 
ATOM   5542 O O     . VAL C 1 175 ? -18.150 -22.358 -27.351 1.00 122.46 ? 197 VAL C O     1 
ATOM   5543 C CB    . VAL C 1 175 ? -20.072 -24.664 -26.642 1.00 122.50 ? 197 VAL C CB    1 
ATOM   5544 C CG1   . VAL C 1 175 ? -20.931 -25.350 -27.710 1.00 122.50 ? 197 VAL C CG1   1 
ATOM   5545 C CG2   . VAL C 1 175 ? -20.331 -25.287 -25.258 1.00 122.51 ? 197 VAL C CG2   1 
ATOM   5546 N N     . THR C 1 176 ? -17.983 -23.660 -29.192 1.00 122.14 ? 198 THR C N     1 
ATOM   5547 C CA    . THR C 1 176 ? -17.928 -22.527 -30.146 1.00 121.89 ? 198 THR C CA    1 
ATOM   5548 C C     . THR C 1 176 ? -19.228 -22.488 -30.976 1.00 121.78 ? 198 THR C C     1 
ATOM   5549 O O     . THR C 1 176 ? -19.594 -23.481 -31.620 1.00 121.95 ? 198 THR C O     1 
ATOM   5550 C CB    . THR C 1 176 ? -16.639 -22.501 -31.100 1.00 121.87 ? 198 THR C CB    1 
ATOM   5551 O OG1   . THR C 1 176 ? -16.043 -23.801 -31.209 1.00 121.61 ? 198 THR C OG1   1 
ATOM   5552 C CG2   . THR C 1 176 ? -15.577 -21.526 -30.594 1.00 121.56 ? 198 THR C CG2   1 
ATOM   5553 N N     . ILE C 1 177 ? -19.942 -21.353 -30.931 1.00 121.38 ? 199 ILE C N     1 
ATOM   5554 C CA    . ILE C 1 177 ? -21.148 -21.161 -31.762 1.00 120.92 ? 199 ILE C CA    1 
ATOM   5555 C C     . ILE C 1 177 ? -20.838 -20.224 -32.932 1.00 120.90 ? 199 ILE C C     1 
ATOM   5556 O O     . ILE C 1 177 ? -19.897 -19.422 -32.867 1.00 120.81 ? 199 ILE C O     1 
ATOM   5557 C CB    . ILE C 1 177 ? -22.360 -20.626 -30.938 1.00 120.76 ? 199 ILE C CB    1 
ATOM   5558 C CG1   . ILE C 1 177 ? -22.917 -21.726 -30.015 1.00 120.47 ? 199 ILE C CG1   1 
ATOM   5559 C CG2   . ILE C 1 177 ? -23.456 -20.103 -31.855 1.00 119.97 ? 199 ILE C CG2   1 
ATOM   5560 C CD1   . ILE C 1 177 ? -23.194 -21.244 -28.586 1.00 120.79 ? 199 ILE C CD1   1 
ATOM   5561 N N     . SER C 1 184 ? -13.729 -14.467 -24.224 1.00 119.49 ? 206 SER C N     1 
ATOM   5562 C CA    . SER C 1 184 ? -14.036 -13.252 -23.460 1.00 119.39 ? 206 SER C CA    1 
ATOM   5563 C C     . SER C 1 184 ? -15.457 -13.306 -22.939 1.00 119.24 ? 206 SER C C     1 
ATOM   5564 O O     . SER C 1 184 ? -16.377 -13.620 -23.692 1.00 119.30 ? 206 SER C O     1 
ATOM   5565 C CB    . SER C 1 184 ? -13.849 -11.992 -24.321 1.00 119.55 ? 206 SER C CB    1 
ATOM   5566 O OG    . SER C 1 184 ? -14.528 -10.863 -23.776 1.00 119.66 ? 206 SER C OG    1 
ATOM   5567 N N     . TYR C 1 185 ? -15.632 -12.996 -21.652 1.00 119.10 ? 207 TYR C N     1 
ATOM   5568 C CA    . TYR C 1 185 ? -16.964 -12.876 -21.062 1.00 118.97 ? 207 TYR C CA    1 
ATOM   5569 C C     . TYR C 1 185 ? -17.638 -11.628 -21.600 1.00 118.85 ? 207 TYR C C     1 
ATOM   5570 O O     . TYR C 1 185 ? -18.763 -11.689 -22.093 1.00 118.89 ? 207 TYR C O     1 
ATOM   5571 C CB    . TYR C 1 185 ? -16.891 -12.815 -19.538 1.00 118.93 ? 207 TYR C CB    1 
ATOM   5572 C CG    . TYR C 1 185 ? -16.840 -14.170 -18.860 1.00 119.29 ? 207 TYR C CG    1 
ATOM   5573 C CD1   . TYR C 1 185 ? -17.937 -14.647 -18.132 1.00 119.54 ? 207 TYR C CD1   1 
ATOM   5574 C CD2   . TYR C 1 185 ? -15.691 -14.973 -18.933 1.00 120.03 ? 207 TYR C CD2   1 
ATOM   5575 C CE1   . TYR C 1 185 ? -17.899 -15.894 -17.491 1.00 119.88 ? 207 TYR C CE1   1 
ATOM   5576 C CE2   . TYR C 1 185 ? -15.644 -16.226 -18.301 1.00 120.26 ? 207 TYR C CE2   1 
ATOM   5577 C CZ    . TYR C 1 185 ? -16.753 -16.677 -17.581 1.00 119.95 ? 207 TYR C CZ    1 
ATOM   5578 O OH    . TYR C 1 185 ? -16.717 -17.905 -16.956 1.00 119.52 ? 207 TYR C OH    1 
ATOM   5579 N N     . ARG C 1 186 ? -16.932 -10.504 -21.514 1.00 118.71 ? 208 ARG C N     1 
ATOM   5580 C CA    . ARG C 1 186 ? -17.373 -9.253  -22.115 1.00 118.73 ? 208 ARG C CA    1 
ATOM   5581 C C     . ARG C 1 186 ? -17.927 -9.435  -23.539 1.00 118.70 ? 208 ARG C C     1 
ATOM   5582 O O     . ARG C 1 186 ? -18.994 -8.913  -23.875 1.00 118.57 ? 208 ARG C O     1 
ATOM   5583 C CB    . ARG C 1 186 ? -16.204 -8.278  -22.136 1.00 118.74 ? 208 ARG C CB    1 
ATOM   5584 C CG    . ARG C 1 186 ? -16.413 -7.075  -23.075 1.00 119.13 ? 208 ARG C CG    1 
ATOM   5585 C CD    . ARG C 1 186 ? -15.382 -6.028  -22.762 1.00 119.53 ? 208 ARG C CD    1 
ATOM   5586 N NE    . ARG C 1 186 ? -15.285 -5.814  -21.316 1.00 119.90 ? 208 ARG C NE    1 
ATOM   5587 C CZ    . ARG C 1 186 ? -16.064 -4.985  -20.616 1.00 120.05 ? 208 ARG C CZ    1 
ATOM   5588 N NH1   . ARG C 1 186 ? -17.006 -4.273  -21.229 1.00 120.03 ? 208 ARG C NH1   1 
ATOM   5589 N NH2   . ARG C 1 186 ? -15.896 -4.862  -19.300 1.00 119.70 ? 208 ARG C NH2   1 
ATOM   5590 N N     . ASP C 1 187 ? -17.185 -10.172 -24.367 1.00 118.76 ? 209 ASP C N     1 
ATOM   5591 C CA    . ASP C 1 187 ? -17.599 -10.494 -25.734 1.00 118.77 ? 209 ASP C CA    1 
ATOM   5592 C C     . ASP C 1 187 ? -18.811 -11.434 -25.726 1.00 118.48 ? 209 ASP C C     1 
ATOM   5593 O O     . ASP C 1 187 ? -19.827 -11.137 -26.361 1.00 118.46 ? 209 ASP C O     1 
ATOM   5594 C CB    . ASP C 1 187 ? -16.401 -11.079 -26.528 1.00 119.02 ? 209 ASP C CB    1 
ATOM   5595 C CG    . ASP C 1 187 ? -16.781 -11.586 -27.938 1.00 119.68 ? 209 ASP C CG    1 
ATOM   5596 O OD1   . ASP C 1 187 ? -16.472 -10.885 -28.952 1.00 119.87 ? 209 ASP C OD1   1 
ATOM   5597 O OD2   . ASP C 1 187 ? -17.365 -12.703 -28.034 1.00 120.45 ? 209 ASP C OD2   1 
ATOM   5598 N N     . CYS C 1 188 ? -18.703 -12.544 -24.990 1.00 118.21 ? 210 CYS C N     1 
ATOM   5599 C CA    . CYS C 1 188 ? -19.748 -13.581 -24.955 1.00 118.00 ? 210 CYS C CA    1 
ATOM   5600 C C     . CYS C 1 188 ? -21.112 -13.085 -24.469 1.00 118.01 ? 210 CYS C C     1 
ATOM   5601 O O     . CYS C 1 188 ? -22.158 -13.574 -24.915 1.00 117.93 ? 210 CYS C O     1 
ATOM   5602 C CB    . CYS C 1 188 ? -19.294 -14.786 -24.130 1.00 117.91 ? 210 CYS C CB    1 
ATOM   5603 S SG    . CYS C 1 188 ? -18.292 -15.969 -25.074 1.00 116.97 ? 210 CYS C SG    1 
ATOM   5604 N N     . LEU C 1 189 ? -21.088 -12.104 -23.572 1.00 117.99 ? 211 LEU C N     1 
ATOM   5605 C CA    . LEU C 1 189 ? -22.305 -11.499 -23.058 1.00 118.14 ? 211 LEU C CA    1 
ATOM   5606 C C     . LEU C 1 189 ? -22.959 -10.480 -23.995 1.00 118.30 ? 211 LEU C C     1 
ATOM   5607 O O     . LEU C 1 189 ? -24.168 -10.560 -24.238 1.00 118.46 ? 211 LEU C O     1 
ATOM   5608 C CB    . LEU C 1 189 ? -22.042 -10.892 -21.696 1.00 118.07 ? 211 LEU C CB    1 
ATOM   5609 C CG    . LEU C 1 189 ? -21.972 -11.994 -20.649 1.00 118.65 ? 211 LEU C CG    1 
ATOM   5610 C CD1   . LEU C 1 189 ? -21.028 -11.593 -19.539 1.00 119.42 ? 211 LEU C CD1   1 
ATOM   5611 C CD2   . LEU C 1 189 ? -23.363 -12.284 -20.091 1.00 119.58 ? 211 LEU C CD2   1 
ATOM   5612 N N     . THR C 1 190 ? -22.181 -9.533  -24.524 1.00 118.43 ? 212 THR C N     1 
ATOM   5613 C CA    . THR C 1 190 ? -22.693 -8.613  -25.554 1.00 118.43 ? 212 THR C CA    1 
ATOM   5614 C C     . THR C 1 190 ? -23.441 -9.436  -26.599 1.00 118.45 ? 212 THR C C     1 
ATOM   5615 O O     . THR C 1 190 ? -24.522 -9.053  -27.054 1.00 118.50 ? 212 THR C O     1 
ATOM   5616 C CB    . THR C 1 190 ? -21.560 -7.831  -26.273 1.00 118.46 ? 212 THR C CB    1 
ATOM   5617 O OG1   . THR C 1 190 ? -20.626 -7.318  -25.303 1.00 118.64 ? 212 THR C OG1   1 
ATOM   5618 C CG2   . THR C 1 190 ? -22.145 -6.671  -27.108 1.00 118.21 ? 212 THR C CG2   1 
ATOM   5619 N N     . LYS C 1 191 ? -22.851 -10.586 -26.935 1.00 118.49 ? 213 LYS C N     1 
ATOM   5620 C CA    . LYS C 1 191 ? -23.355 -11.493 -27.961 1.00 118.55 ? 213 LYS C CA    1 
ATOM   5621 C C     . LYS C 1 191 ? -24.666 -12.147 -27.540 1.00 118.44 ? 213 LYS C C     1 
ATOM   5622 O O     . LYS C 1 191 ? -25.660 -12.084 -28.270 1.00 118.32 ? 213 LYS C O     1 
ATOM   5623 C CB    . LYS C 1 191 ? -22.301 -12.561 -28.289 1.00 118.56 ? 213 LYS C CB    1 
ATOM   5624 C CG    . LYS C 1 191 ? -22.175 -12.868 -29.778 1.00 118.70 ? 213 LYS C CG    1 
ATOM   5625 C CD    . LYS C 1 191 ? -21.398 -11.720 -30.525 1.00 118.79 ? 213 LYS C CD    1 
ATOM   5626 C CE    . LYS C 1 191 ? -22.114 -11.443 -31.932 1.00 119.03 ? 213 LYS C CE    1 
ATOM   5627 N NZ    . LYS C 1 191 ? -20.940 -10.985 -32.902 1.00 118.87 ? 213 LYS C NZ    1 
ATOM   5628 N N     . TRP C 1 192 ? -24.654 -12.769 -26.361 1.00 118.41 ? 214 TRP C N     1 
ATOM   5629 C CA    . TRP C 1 192 ? -25.864 -13.309 -25.750 1.00 118.50 ? 214 TRP C CA    1 
ATOM   5630 C C     . TRP C 1 192 ? -26.947 -12.242 -25.740 1.00 118.56 ? 214 TRP C C     1 
ATOM   5631 O O     . TRP C 1 192 ? -28.102 -12.506 -26.099 1.00 118.62 ? 214 TRP C O     1 
ATOM   5632 C CB    . TRP C 1 192 ? -25.582 -13.763 -24.318 1.00 118.48 ? 214 TRP C CB    1 
ATOM   5633 C CG    . TRP C 1 192 ? -26.814 -14.083 -23.540 1.00 118.59 ? 214 TRP C CG    1 
ATOM   5634 C CD1   . TRP C 1 192 ? -27.402 -15.306 -23.418 1.00 118.88 ? 214 TRP C CD1   1 
ATOM   5635 C CD2   . TRP C 1 192 ? -27.621 -13.167 -22.777 1.00 119.05 ? 214 TRP C CD2   1 
ATOM   5636 N NE1   . TRP C 1 192 ? -28.526 -15.214 -22.629 1.00 119.33 ? 214 TRP C NE1   1 
ATOM   5637 C CE2   . TRP C 1 192 ? -28.687 -13.913 -22.224 1.00 119.34 ? 214 TRP C CE2   1 
ATOM   5638 C CE3   . TRP C 1 192 ? -27.549 -11.789 -22.507 1.00 119.12 ? 214 TRP C CE3   1 
ATOM   5639 C CZ2   . TRP C 1 192 ? -29.676 -13.327 -21.407 1.00 119.14 ? 214 TRP C CZ2   1 
ATOM   5640 C CZ3   . TRP C 1 192 ? -28.539 -11.204 -21.699 1.00 119.08 ? 214 TRP C CZ3   1 
ATOM   5641 C CH2   . TRP C 1 192 ? -29.582 -11.977 -21.157 1.00 118.92 ? 214 TRP C CH2   1 
ATOM   5642 N N     . ASN C 1 193 ? -26.550 -11.040 -25.329 1.00 118.56 ? 215 ASN C N     1 
ATOM   5643 C CA    . ASN C 1 193 ? -27.439 -9.903  -25.263 1.00 118.76 ? 215 ASN C CA    1 
ATOM   5644 C C     . ASN C 1 193 ? -28.171 -9.665  -26.570 1.00 119.16 ? 215 ASN C C     1 
ATOM   5645 O O     . ASN C 1 193 ? -29.396 -9.743  -26.618 1.00 119.19 ? 215 ASN C O     1 
ATOM   5646 C CB    . ASN C 1 193 ? -26.668 -8.653  -24.884 1.00 118.54 ? 215 ASN C CB    1 
ATOM   5647 C CG    . ASN C 1 193 ? -27.529 -7.426  -24.911 1.00 118.43 ? 215 ASN C CG    1 
ATOM   5648 O OD1   . ASN C 1 193 ? -27.578 -6.705  -25.909 1.00 118.65 ? 215 ASN C OD1   1 
ATOM   5649 N ND2   . ASN C 1 193 ? -28.245 -7.193  -23.823 1.00 117.89 ? 215 ASN C ND2   1 
ATOM   5650 N N     . LYS C 1 194 ? -27.420 -9.378  -27.626 1.00 119.62 ? 216 LYS C N     1 
ATOM   5651 C CA    . LYS C 1 194 ? -28.025 -9.083  -28.916 1.00 120.31 ? 216 LYS C CA    1 
ATOM   5652 C C     . LYS C 1 194 ? -28.873 -10.262 -29.423 1.00 120.17 ? 216 LYS C C     1 
ATOM   5653 O O     . LYS C 1 194 ? -29.989 -10.062 -29.919 1.00 119.97 ? 216 LYS C O     1 
ATOM   5654 C CB    . LYS C 1 194 ? -26.945 -8.675  -29.938 1.00 120.66 ? 216 LYS C CB    1 
ATOM   5655 C CG    . LYS C 1 194 ? -27.481 -8.023  -31.231 1.00 122.97 ? 216 LYS C CG    1 
ATOM   5656 C CD    . LYS C 1 194 ? -28.386 -6.790  -30.963 1.00 126.64 ? 216 LYS C CD    1 
ATOM   5657 C CE    . LYS C 1 194 ? -28.885 -6.142  -32.263 1.00 128.64 ? 216 LYS C CE    1 
ATOM   5658 N NZ    . LYS C 1 194 ? -29.913 -6.970  -32.986 1.00 130.24 ? 216 LYS C NZ    1 
ATOM   5659 N N     . ALA C 1 195 ? -28.342 -11.478 -29.271 1.00 120.30 ? 217 ALA C N     1 
ATOM   5660 C CA    . ALA C 1 195 ? -29.004 -12.704 -29.741 1.00 120.46 ? 217 ALA C CA    1 
ATOM   5661 C C     . ALA C 1 195 ? -30.377 -12.853 -29.109 1.00 120.61 ? 217 ALA C C     1 
ATOM   5662 O O     . ALA C 1 195 ? -31.389 -12.991 -29.811 1.00 120.69 ? 217 ALA C O     1 
ATOM   5663 C CB    . ALA C 1 195 ? -28.148 -13.932 -29.431 1.00 120.45 ? 217 ALA C CB    1 
ATOM   5664 N N     . ILE C 1 196 ? -30.401 -12.810 -27.780 1.00 120.77 ? 218 ILE C N     1 
ATOM   5665 C CA    . ILE C 1 196 ? -31.642 -12.927 -27.019 1.00 121.06 ? 218 ILE C CA    1 
ATOM   5666 C C     . ILE C 1 196 ? -32.582 -11.706 -27.219 1.00 121.13 ? 218 ILE C C     1 
ATOM   5667 O O     . ILE C 1 196 ? -33.804 -11.849 -27.161 1.00 121.05 ? 218 ILE C O     1 
ATOM   5668 C CB    . ILE C 1 196 ? -31.337 -13.250 -25.510 1.00 121.11 ? 218 ILE C CB    1 
ATOM   5669 C CG1   . ILE C 1 196 ? -32.226 -14.397 -24.971 1.00 121.22 ? 218 ILE C CG1   1 
ATOM   5670 C CG2   . ILE C 1 196 ? -31.291 -11.969 -24.630 1.00 121.10 ? 218 ILE C CG2   1 
ATOM   5671 C CD1   . ILE C 1 196 ? -33.675 -14.036 -24.715 1.00 122.23 ? 218 ILE C CD1   1 
ATOM   5672 N N     . GLU C 1 197 ? -32.004 -10.529 -27.482 1.00 121.33 ? 219 GLU C N     1 
ATOM   5673 C CA    . GLU C 1 197 ? -32.760 -9.301  -27.768 1.00 121.57 ? 219 GLU C CA    1 
ATOM   5674 C C     . GLU C 1 197 ? -33.577 -9.454  -29.055 1.00 121.53 ? 219 GLU C C     1 
ATOM   5675 O O     . GLU C 1 197 ? -34.723 -8.998  -29.146 1.00 121.66 ? 219 GLU C O     1 
ATOM   5676 C CB    . GLU C 1 197 ? -31.796 -8.115  -27.883 1.00 121.66 ? 219 GLU C CB    1 
ATOM   5677 C CG    . GLU C 1 197 ? -32.395 -6.835  -28.419 1.00 123.14 ? 219 GLU C CG    1 
ATOM   5678 C CD    . GLU C 1 197 ? -31.374 -6.018  -29.177 1.00 125.49 ? 219 GLU C CD    1 
ATOM   5679 O OE1   . GLU C 1 197 ? -30.471 -5.449  -28.523 1.00 126.45 ? 219 GLU C OE1   1 
ATOM   5680 O OE2   . GLU C 1 197 ? -31.472 -5.952  -30.430 1.00 126.91 ? 219 GLU C OE2   1 
ATOM   5681 N N     . VAL C 1 198 ? -32.975 -10.100 -30.048 1.00 121.50 ? 220 VAL C N     1 
ATOM   5682 C CA    . VAL C 1 198 ? -33.670 -10.422 -31.278 1.00 121.60 ? 220 VAL C CA    1 
ATOM   5683 C C     . VAL C 1 198 ? -34.760 -11.454 -30.976 1.00 121.77 ? 220 VAL C C     1 
ATOM   5684 O O     . VAL C 1 198 ? -35.943 -11.193 -31.208 1.00 121.78 ? 220 VAL C O     1 
ATOM   5685 C CB    . VAL C 1 198 ? -32.680 -10.917 -32.374 1.00 121.61 ? 220 VAL C CB    1 
ATOM   5686 C CG1   . VAL C 1 198 ? -33.421 -11.520 -33.561 1.00 121.62 ? 220 VAL C CG1   1 
ATOM   5687 C CG2   . VAL C 1 198 ? -31.794 -9.768  -32.847 1.00 121.42 ? 220 VAL C CG2   1 
ATOM   5688 N N     . MET C 1 199 ? -34.357 -12.595 -30.415 1.00 122.07 ? 221 MET C N     1 
ATOM   5689 C CA    . MET C 1 199 ? -35.265 -13.714 -30.140 1.00 122.63 ? 221 MET C CA    1 
ATOM   5690 C C     . MET C 1 199 ? -36.530 -13.323 -29.381 1.00 122.81 ? 221 MET C C     1 
ATOM   5691 O O     . MET C 1 199 ? -37.583 -13.971 -29.526 1.00 122.79 ? 221 MET C O     1 
ATOM   5692 C CB    . MET C 1 199 ? -34.533 -14.804 -29.373 1.00 122.59 ? 221 MET C CB    1 
ATOM   5693 C CG    . MET C 1 199 ? -33.510 -15.530 -30.191 1.00 123.49 ? 221 MET C CG    1 
ATOM   5694 S SD    . MET C 1 199 ? -32.780 -16.824 -29.188 1.00 125.37 ? 221 MET C SD    1 
ATOM   5695 C CE    . MET C 1 199 ? -31.687 -17.605 -30.373 1.00 126.46 ? 221 MET C CE    1 
ATOM   5696 N N     . TYR C 1 200 ? -36.409 -12.260 -28.577 1.00 123.22 ? 222 TYR C N     1 
ATOM   5697 C CA    . TYR C 1 200 ? -37.527 -11.748 -27.810 1.00 123.79 ? 222 TYR C CA    1 
ATOM   5698 C C     . TYR C 1 200 ? -38.438 -10.867 -28.648 1.00 123.88 ? 222 TYR C C     1 
ATOM   5699 O O     . TYR C 1 200 ? -39.665 -10.988 -28.564 1.00 124.19 ? 222 TYR C O     1 
ATOM   5700 C CB    . TYR C 1 200 ? -37.048 -10.969 -26.585 1.00 124.03 ? 222 TYR C CB    1 
ATOM   5701 C CG    . TYR C 1 200 ? -38.145 -10.792 -25.561 1.00 125.40 ? 222 TYR C CG    1 
ATOM   5702 C CD1   . TYR C 1 200 ? -38.623 -11.892 -24.825 1.00 126.85 ? 222 TYR C CD1   1 
ATOM   5703 C CD2   . TYR C 1 200 ? -38.725 -9.542  -25.341 1.00 126.46 ? 222 TYR C CD2   1 
ATOM   5704 C CE1   . TYR C 1 200 ? -39.643 -11.756 -23.890 1.00 128.16 ? 222 TYR C CE1   1 
ATOM   5705 C CE2   . TYR C 1 200 ? -39.744 -9.390  -24.401 1.00 127.79 ? 222 TYR C CE2   1 
ATOM   5706 C CZ    . TYR C 1 200 ? -40.201 -10.508 -23.679 1.00 128.61 ? 222 TYR C CZ    1 
ATOM   5707 O OH    . TYR C 1 200 ? -41.208 -10.397 -22.736 1.00 129.71 ? 222 TYR C OH    1 
ATOM   5708 N N     . ALA C 1 201 ? -37.842 -9.978  -29.442 1.00 123.83 ? 223 ALA C N     1 
ATOM   5709 C CA    . ALA C 1 201 ? -38.609 -9.102  -30.318 1.00 123.95 ? 223 ALA C CA    1 
ATOM   5710 C C     . ALA C 1 201 ? -39.537 -9.915  -31.228 1.00 124.12 ? 223 ALA C C     1 
ATOM   5711 O O     . ALA C 1 201 ? -40.707 -9.562  -31.392 1.00 124.08 ? 223 ALA C O     1 
ATOM   5712 C CB    . ALA C 1 201 ? -37.683 -8.228  -31.126 1.00 123.91 ? 223 ALA C CB    1 
ATOM   5713 N N     . GLN C 1 202 ? -39.010 -11.012 -31.781 1.00 124.39 ? 224 GLN C N     1 
ATOM   5714 C CA    . GLN C 1 202 ? -39.786 -11.971 -32.578 1.00 124.82 ? 224 GLN C CA    1 
ATOM   5715 C C     . GLN C 1 202 ? -40.914 -12.598 -31.750 1.00 125.21 ? 224 GLN C C     1 
ATOM   5716 O O     . GLN C 1 202 ? -42.083 -12.527 -32.138 1.00 125.38 ? 224 GLN C O     1 
ATOM   5717 C CB    . GLN C 1 202 ? -38.881 -13.085 -33.145 1.00 124.81 ? 224 GLN C CB    1 
ATOM   5718 C CG    . GLN C 1 202 ? -37.903 -12.666 -34.279 1.00 125.25 ? 224 GLN C CG    1 
ATOM   5719 C CD    . GLN C 1 202 ? -38.400 -12.986 -35.713 1.00 125.28 ? 224 GLN C CD    1 
ATOM   5720 O OE1   . GLN C 1 202 ? -38.668 -14.153 -36.059 1.00 124.74 ? 224 GLN C OE1   1 
ATOM   5721 N NE2   . GLN C 1 202 ? -38.487 -11.944 -36.555 1.00 125.16 ? 224 GLN C NE2   1 
ATOM   5722 N N     . CYS C 1 203 ? -40.561 -13.201 -30.612 1.00 125.66 ? 225 CYS C N     1 
ATOM   5723 C CA    . CYS C 1 203 ? -41.534 -13.821 -29.703 1.00 126.01 ? 225 CYS C CA    1 
ATOM   5724 C C     . CYS C 1 203 ? -42.610 -12.841 -29.274 1.00 126.38 ? 225 CYS C C     1 
ATOM   5725 O O     . CYS C 1 203 ? -43.740 -13.238 -28.984 1.00 126.45 ? 225 CYS C O     1 
ATOM   5726 C CB    . CYS C 1 203 ? -40.840 -14.365 -28.457 1.00 125.93 ? 225 CYS C CB    1 
ATOM   5727 S SG    . CYS C 1 203 ? -41.935 -15.289 -27.371 1.00 126.10 ? 225 CYS C SG    1 
ATOM   5728 N N     . MET C 1 204 ? -42.246 -11.562 -29.228 1.00 126.97 ? 226 MET C N     1 
ATOM   5729 C CA    . MET C 1 204 ? -43.191 -10.513 -28.897 1.00 127.79 ? 226 MET C CA    1 
ATOM   5730 C C     . MET C 1 204 ? -44.071 -10.124 -30.078 1.00 128.27 ? 226 MET C C     1 
ATOM   5731 O O     . MET C 1 204 ? -45.274 -9.911  -29.915 1.00 128.48 ? 226 MET C O     1 
ATOM   5732 C CB    . MET C 1 204 ? -42.476 -9.299  -28.312 1.00 127.76 ? 226 MET C CB    1 
ATOM   5733 C CG    . MET C 1 204 ? -42.000 -9.517  -26.879 1.00 128.28 ? 226 MET C CG    1 
ATOM   5734 S SD    . MET C 1 204 ? -43.248 -10.161 -25.721 1.00 129.43 ? 226 MET C SD    1 
ATOM   5735 C CE    . MET C 1 204 ? -42.938 -11.937 -25.749 1.00 129.37 ? 226 MET C CE    1 
ATOM   5736 N N     . GLU C 1 205 ? -43.477 -10.044 -31.263 1.00 128.80 ? 227 GLU C N     1 
ATOM   5737 C CA    . GLU C 1 205 ? -44.233 -9.788  -32.487 1.00 129.41 ? 227 GLU C CA    1 
ATOM   5738 C C     . GLU C 1 205 ? -45.260 -10.901 -32.750 1.00 129.45 ? 227 GLU C C     1 
ATOM   5739 O O     . GLU C 1 205 ? -46.424 -10.630 -33.060 1.00 129.45 ? 227 GLU C O     1 
ATOM   5740 C CB    . GLU C 1 205 ? -43.270 -9.652  -33.666 1.00 129.62 ? 227 GLU C CB    1 
ATOM   5741 C CG    . GLU C 1 205 ? -43.811 -8.871  -34.862 1.00 130.93 ? 227 GLU C CG    1 
ATOM   5742 C CD    . GLU C 1 205 ? -42.739 -8.623  -35.916 1.00 132.69 ? 227 GLU C CD    1 
ATOM   5743 O OE1   . GLU C 1 205 ? -43.006 -8.856  -37.117 1.00 133.42 ? 227 GLU C OE1   1 
ATOM   5744 O OE2   . GLU C 1 205 ? -41.620 -8.205  -35.542 1.00 133.52 ? 227 GLU C OE2   1 
ATOM   5745 N N     . VAL C 1 206 ? -44.813 -12.147 -32.598 1.00 129.59 ? 228 VAL C N     1 
ATOM   5746 C CA    . VAL C 1 206 ? -45.635 -13.341 -32.814 1.00 129.77 ? 228 VAL C CA    1 
ATOM   5747 C C     . VAL C 1 206 ? -46.979 -13.324 -32.070 1.00 129.83 ? 228 VAL C C     1 
ATOM   5748 O O     . VAL C 1 206 ? -47.998 -13.757 -32.614 1.00 129.78 ? 228 VAL C O     1 
ATOM   5749 C CB    . VAL C 1 206 ? -44.828 -14.618 -32.455 1.00 129.79 ? 228 VAL C CB    1 
ATOM   5750 C CG1   . VAL C 1 206 ? -45.756 -15.788 -32.148 1.00 130.03 ? 228 VAL C CG1   1 
ATOM   5751 C CG2   . VAL C 1 206 ? -43.866 -14.965 -33.590 1.00 129.72 ? 228 VAL C CG2   1 
ATOM   5752 N N     . GLY C 1 207 ? -46.977 -12.821 -30.833 1.00 130.09 ? 229 GLY C N     1 
ATOM   5753 C CA    . GLY C 1 207 ? -48.205 -12.766 -30.048 1.00 130.47 ? 229 GLY C CA    1 
ATOM   5754 C C     . GLY C 1 207 ? -48.168 -13.792 -28.936 1.00 130.71 ? 229 GLY C C     1 
ATOM   5755 O O     . GLY C 1 207 ? -47.674 -14.912 -29.127 1.00 130.80 ? 229 GLY C O     1 
ATOM   5756 N N     . LYS C 1 208 ? -48.707 -13.402 -27.781 1.00 130.83 ? 230 LYS C N     1 
ATOM   5757 C CA    . LYS C 1 208 ? -48.624 -14.186 -26.538 1.00 131.02 ? 230 LYS C CA    1 
ATOM   5758 C C     . LYS C 1 208 ? -49.223 -15.573 -26.743 1.00 130.65 ? 230 LYS C C     1 
ATOM   5759 O O     . LYS C 1 208 ? -48.922 -16.524 -26.016 1.00 130.47 ? 230 LYS C O     1 
ATOM   5760 C CB    . LYS C 1 208 ? -49.350 -13.447 -25.403 1.00 131.34 ? 230 LYS C CB    1 
ATOM   5761 C CG    . LYS C 1 208 ? -49.044 -11.931 -25.354 1.00 132.83 ? 230 LYS C CG    1 
ATOM   5762 C CD    . LYS C 1 208 ? -49.988 -11.170 -24.436 1.00 135.49 ? 230 LYS C CD    1 
ATOM   5763 C CE    . LYS C 1 208 ? -49.330 -10.828 -23.105 1.00 137.21 ? 230 LYS C CE    1 
ATOM   5764 N NZ    . LYS C 1 208 ? -49.204 -12.022 -22.190 1.00 138.61 ? 230 LYS C NZ    1 
ATOM   5765 N N     . GLU C 1 209 ? -50.049 -15.671 -27.774 1.00 130.37 ? 231 GLU C N     1 
ATOM   5766 C CA    . GLU C 1 209 ? -50.800 -16.867 -28.070 1.00 130.31 ? 231 GLU C CA    1 
ATOM   5767 C C     . GLU C 1 209 ? -49.957 -17.917 -28.763 1.00 129.43 ? 231 GLU C C     1 
ATOM   5768 O O     . GLU C 1 209 ? -50.216 -19.114 -28.631 1.00 129.31 ? 231 GLU C O     1 
ATOM   5769 C CB    . GLU C 1 209 ? -51.936 -16.479 -28.983 1.00 130.81 ? 231 GLU C CB    1 
ATOM   5770 C CG    . GLU C 1 209 ? -53.168 -17.308 -28.831 1.00 133.39 ? 231 GLU C CG    1 
ATOM   5771 C CD    . GLU C 1 209 ? -54.334 -16.604 -29.460 1.00 136.88 ? 231 GLU C CD    1 
ATOM   5772 O OE1   . GLU C 1 209 ? -54.739 -16.999 -30.577 1.00 138.43 ? 231 GLU C OE1   1 
ATOM   5773 O OE2   . GLU C 1 209 ? -54.823 -15.626 -28.852 1.00 138.32 ? 231 GLU C OE2   1 
ATOM   5774 N N     . LYS C 1 210 ? -48.962 -17.452 -29.516 1.00 128.51 ? 232 LYS C N     1 
ATOM   5775 C CA    . LYS C 1 210 ? -48.101 -18.321 -30.307 1.00 127.55 ? 232 LYS C CA    1 
ATOM   5776 C C     . LYS C 1 210 ? -46.733 -18.541 -29.686 1.00 126.72 ? 232 LYS C C     1 
ATOM   5777 O O     . LYS C 1 210 ? -46.141 -19.597 -29.886 1.00 126.59 ? 232 LYS C O     1 
ATOM   5778 C CB    . LYS C 1 210 ? -47.911 -17.757 -31.710 1.00 127.73 ? 232 LYS C CB    1 
ATOM   5779 C CG    . LYS C 1 210 ? -49.012 -18.085 -32.701 1.00 128.09 ? 232 LYS C CG    1 
ATOM   5780 C CD    . LYS C 1 210 ? -48.660 -17.494 -34.050 1.00 128.60 ? 232 LYS C CD    1 
ATOM   5781 C CE    . LYS C 1 210 ? -49.481 -18.124 -35.181 1.00 129.07 ? 232 LYS C CE    1 
ATOM   5782 N NZ    . LYS C 1 210 ? -49.161 -19.575 -35.434 1.00 129.47 ? 232 LYS C NZ    1 
ATOM   5783 N N     . CYS C 1 211 ? -46.223 -17.548 -28.955 1.00 125.80 ? 233 CYS C N     1 
ATOM   5784 C CA    . CYS C 1 211 ? -44.893 -17.664 -28.344 1.00 124.96 ? 233 CYS C CA    1 
ATOM   5785 C C     . CYS C 1 211 ? -44.805 -17.388 -26.839 1.00 124.30 ? 233 CYS C C     1 
ATOM   5786 O O     . CYS C 1 211 ? -45.164 -16.305 -26.354 1.00 124.04 ? 233 CYS C O     1 
ATOM   5787 C CB    . CYS C 1 211 ? -43.870 -16.807 -29.082 1.00 125.06 ? 233 CYS C CB    1 
ATOM   5788 S SG    . CYS C 1 211 ? -42.224 -17.010 -28.402 1.00 125.21 ? 233 CYS C SG    1 
ATOM   5789 N N     . LEU C 1 212 ? -44.269 -18.378 -26.127 1.00 123.64 ? 234 LEU C N     1 
ATOM   5790 C CA    . LEU C 1 212 ? -44.181 -18.362 -24.673 1.00 123.03 ? 234 LEU C CA    1 
ATOM   5791 C C     . LEU C 1 212 ? -42.715 -18.272 -24.232 1.00 122.54 ? 234 LEU C C     1 
ATOM   5792 O O     . LEU C 1 212 ? -41.922 -19.153 -24.589 1.00 122.44 ? 234 LEU C O     1 
ATOM   5793 C CB    . LEU C 1 212 ? -44.792 -19.662 -24.124 1.00 123.05 ? 234 LEU C CB    1 
ATOM   5794 C CG    . LEU C 1 212 ? -45.584 -19.724 -22.812 1.00 123.05 ? 234 LEU C CG    1 
ATOM   5795 C CD1   . LEU C 1 212 ? -45.585 -21.148 -22.214 1.00 123.32 ? 234 LEU C CD1   1 
ATOM   5796 C CD2   . LEU C 1 212 ? -45.109 -18.695 -21.786 1.00 123.70 ? 234 LEU C CD2   1 
ATOM   5797 N N     . PRO C 1 213 ? -42.346 -17.207 -23.471 1.00 122.02 ? 235 PRO C N     1 
ATOM   5798 C CA    . PRO C 1 213 ? -41.046 -17.174 -22.782 1.00 121.61 ? 235 PRO C CA    1 
ATOM   5799 C C     . PRO C 1 213 ? -41.008 -18.171 -21.615 1.00 121.38 ? 235 PRO C C     1 
ATOM   5800 O O     . PRO C 1 213 ? -41.884 -18.121 -20.752 1.00 121.45 ? 235 PRO C O     1 
ATOM   5801 C CB    . PRO C 1 213 ? -40.959 -15.733 -22.253 1.00 121.41 ? 235 PRO C CB    1 
ATOM   5802 C CG    . PRO C 1 213 ? -41.919 -14.957 -23.063 1.00 121.55 ? 235 PRO C CG    1 
ATOM   5803 C CD    . PRO C 1 213 ? -43.035 -15.906 -23.377 1.00 122.02 ? 235 PRO C CD    1 
ATOM   5804 N N     . VAL C 1 214 ? -40.016 -19.072 -21.598 1.00 121.17 ? 236 VAL C N     1 
ATOM   5805 C CA    . VAL C 1 214 ? -39.894 -20.102 -20.545 1.00 121.08 ? 236 VAL C CA    1 
ATOM   5806 C C     . VAL C 1 214 ? -38.603 -19.918 -19.727 1.00 121.24 ? 236 VAL C C     1 
ATOM   5807 O O     . VAL C 1 214 ? -37.502 -20.149 -20.233 1.00 121.34 ? 236 VAL C O     1 
ATOM   5808 C CB    . VAL C 1 214 ? -39.960 -21.555 -21.127 1.00 120.93 ? 236 VAL C CB    1 
ATOM   5809 C CG1   . VAL C 1 214 ? -39.835 -22.601 -20.026 1.00 120.71 ? 236 VAL C CG1   1 
ATOM   5810 C CG2   . VAL C 1 214 ? -41.248 -21.776 -21.890 1.00 120.85 ? 236 VAL C CG2   1 
ATOM   5811 N N     . TYR C 1 215 ? -38.745 -19.514 -18.465 1.00 121.29 ? 237 TYR C N     1 
ATOM   5812 C CA    . TYR C 1 215 ? -37.592 -19.236 -17.616 1.00 121.47 ? 237 TYR C CA    1 
ATOM   5813 C C     . TYR C 1 215 ? -36.989 -20.496 -17.025 1.00 121.07 ? 237 TYR C C     1 
ATOM   5814 O O     . TYR C 1 215 ? -37.636 -21.206 -16.246 1.00 120.99 ? 237 TYR C O     1 
ATOM   5815 C CB    . TYR C 1 215 ? -37.957 -18.244 -16.520 1.00 121.97 ? 237 TYR C CB    1 
ATOM   5816 C CG    . TYR C 1 215 ? -38.208 -16.859 -17.049 1.00 123.91 ? 237 TYR C CG    1 
ATOM   5817 C CD1   . TYR C 1 215 ? -37.142 -15.984 -17.277 1.00 125.66 ? 237 TYR C CD1   1 
ATOM   5818 C CD2   . TYR C 1 215 ? -39.512 -16.422 -17.329 1.00 125.78 ? 237 TYR C CD2   1 
ATOM   5819 C CE1   . TYR C 1 215 ? -37.362 -14.713 -17.764 1.00 127.21 ? 237 TYR C CE1   1 
ATOM   5820 C CE2   . TYR C 1 215 ? -39.744 -15.150 -17.819 1.00 127.30 ? 237 TYR C CE2   1 
ATOM   5821 C CZ    . TYR C 1 215 ? -38.662 -14.304 -18.034 1.00 127.95 ? 237 TYR C CZ    1 
ATOM   5822 O OH    . TYR C 1 215 ? -38.872 -13.040 -18.516 1.00 129.38 ? 237 TYR C OH    1 
ATOM   5823 N N     . TYR C 1 216 ? -35.739 -20.753 -17.409 1.00 120.74 ? 238 TYR C N     1 
ATOM   5824 C CA    . TYR C 1 216 ? -35.008 -21.948 -17.001 1.00 120.47 ? 238 TYR C CA    1 
ATOM   5825 C C     . TYR C 1 216 ? -35.045 -22.105 -15.495 1.00 120.63 ? 238 TYR C C     1 
ATOM   5826 O O     . TYR C 1 216 ? -35.362 -23.177 -14.970 1.00 120.71 ? 238 TYR C O     1 
ATOM   5827 C CB    . TYR C 1 216 ? -33.551 -21.871 -17.463 1.00 120.24 ? 238 TYR C CB    1 
ATOM   5828 C CG    . TYR C 1 216 ? -32.656 -22.930 -16.837 1.00 119.71 ? 238 TYR C CG    1 
ATOM   5829 C CD1   . TYR C 1 216 ? -32.671 -24.248 -17.303 1.00 119.24 ? 238 TYR C CD1   1 
ATOM   5830 C CD2   . TYR C 1 216 ? -31.792 -22.617 -15.777 1.00 118.62 ? 238 TYR C CD2   1 
ATOM   5831 C CE1   . TYR C 1 216 ? -31.853 -25.225 -16.737 1.00 118.52 ? 238 TYR C CE1   1 
ATOM   5832 C CE2   . TYR C 1 216 ? -30.977 -23.595 -15.202 1.00 117.88 ? 238 TYR C CE2   1 
ATOM   5833 C CZ    . TYR C 1 216 ? -31.017 -24.891 -15.696 1.00 117.90 ? 238 TYR C CZ    1 
ATOM   5834 O OH    . TYR C 1 216 ? -30.233 -25.868 -15.157 1.00 118.05 ? 238 TYR C OH    1 
ATOM   5835 N N     . GLU C 1 217 ? -34.713 -21.020 -14.808 1.00 120.70 ? 239 GLU C N     1 
ATOM   5836 C CA    . GLU C 1 217 ? -34.666 -21.016 -13.354 1.00 120.88 ? 239 GLU C CA    1 
ATOM   5837 C C     . GLU C 1 217 ? -36.039 -21.326 -12.765 1.00 121.13 ? 239 GLU C C     1 
ATOM   5838 O O     . GLU C 1 217 ? -36.144 -22.045 -11.774 1.00 121.11 ? 239 GLU C O     1 
ATOM   5839 C CB    . GLU C 1 217 ? -34.103 -19.660 -12.811 1.00 120.88 ? 239 GLU C CB    1 
ATOM   5840 C CG    . GLU C 1 217 ? -34.376 -18.422 -13.718 1.00 120.69 ? 239 GLU C CG    1 
ATOM   5841 C CD    . GLU C 1 217 ? -33.759 -18.548 -15.115 1.00 120.26 ? 239 GLU C CD    1 
ATOM   5842 O OE1   . GLU C 1 217 ? -34.544 -18.576 -16.103 1.00 119.72 ? 239 GLU C OE1   1 
ATOM   5843 O OE2   . GLU C 1 217 ? -32.513 -18.636 -15.240 1.00 120.59 ? 239 GLU C OE2   1 
ATOM   5844 N N     . GLN C 1 218 ? -37.088 -20.810 -13.399 1.00 121.40 ? 240 GLN C N     1 
ATOM   5845 C CA    . GLN C 1 218 ? -38.448 -21.092 -12.969 1.00 121.65 ? 240 GLN C CA    1 
ATOM   5846 C C     . GLN C 1 218 ? -38.837 -22.523 -13.247 1.00 121.60 ? 240 GLN C C     1 
ATOM   5847 O O     . GLN C 1 218 ? -39.648 -23.103 -12.527 1.00 121.54 ? 240 GLN C O     1 
ATOM   5848 C CB    . GLN C 1 218 ? -39.426 -20.145 -13.641 1.00 121.77 ? 240 GLN C CB    1 
ATOM   5849 C CG    . GLN C 1 218 ? -39.288 -18.724 -13.165 1.00 123.07 ? 240 GLN C CG    1 
ATOM   5850 C CD    . GLN C 1 218 ? -38.901 -18.656 -11.705 1.00 125.35 ? 240 GLN C CD    1 
ATOM   5851 O OE1   . GLN C 1 218 ? -37.807 -18.201 -11.373 1.00 126.94 ? 240 GLN C OE1   1 
ATOM   5852 N NE2   . GLN C 1 218 ? -39.782 -19.136 -10.823 1.00 125.76 ? 240 GLN C NE2   1 
ATOM   5853 N N     . LEU C 1 219 ? -38.235 -23.084 -14.290 1.00 121.71 ? 241 LEU C N     1 
ATOM   5854 C CA    . LEU C 1 219 ? -38.501 -24.449 -14.695 1.00 121.95 ? 241 LEU C CA    1 
ATOM   5855 C C     . LEU C 1 219 ? -37.841 -25.449 -13.763 1.00 122.01 ? 241 LEU C C     1 
ATOM   5856 O O     . LEU C 1 219 ? -38.482 -26.385 -13.297 1.00 121.95 ? 241 LEU C O     1 
ATOM   5857 C CB    . LEU C 1 219 ? -38.002 -24.673 -16.117 1.00 122.07 ? 241 LEU C CB    1 
ATOM   5858 C CG    . LEU C 1 219 ? -38.543 -25.819 -16.983 1.00 122.49 ? 241 LEU C CG    1 
ATOM   5859 C CD1   . LEU C 1 219 ? -37.498 -26.122 -18.050 1.00 123.54 ? 241 LEU C CD1   1 
ATOM   5860 C CD2   . LEU C 1 219 ? -38.844 -27.086 -16.190 1.00 123.02 ? 241 LEU C CD2   1 
ATOM   5861 N N     . VAL C 1 220 ? -36.556 -25.268 -13.496 1.00 122.18 ? 242 VAL C N     1 
ATOM   5862 C CA    . VAL C 1 220 ? -35.860 -26.228 -12.654 1.00 122.48 ? 242 VAL C CA    1 
ATOM   5863 C C     . VAL C 1 220 ? -36.334 -26.123 -11.199 1.00 122.76 ? 242 VAL C C     1 
ATOM   5864 O O     . VAL C 1 220 ? -36.521 -27.149 -10.541 1.00 122.79 ? 242 VAL C O     1 
ATOM   5865 C CB    . VAL C 1 220 ? -34.337 -26.087 -12.751 1.00 122.49 ? 242 VAL C CB    1 
ATOM   5866 C CG1   . VAL C 1 220 ? -33.623 -27.100 -11.839 1.00 122.76 ? 242 VAL C CG1   1 
ATOM   5867 C CG2   . VAL C 1 220 ? -33.907 -26.305 -14.204 1.00 122.73 ? 242 VAL C CG2   1 
ATOM   5868 N N     . LEU C 1 221 ? -36.534 -24.886 -10.718 1.00 123.07 ? 243 LEU C N     1 
ATOM   5869 C CA    . LEU C 1 221 ? -37.090 -24.634 -9.381  1.00 123.37 ? 243 LEU C CA    1 
ATOM   5870 C C     . LEU C 1 221 ? -38.464 -25.257 -9.238  1.00 123.66 ? 243 LEU C C     1 
ATOM   5871 O O     . LEU C 1 221 ? -38.701 -26.043 -8.324  1.00 123.83 ? 243 LEU C O     1 
ATOM   5872 C CB    . LEU C 1 221 ? -37.249 -23.126 -9.118  1.00 123.30 ? 243 LEU C CB    1 
ATOM   5873 C CG    . LEU C 1 221 ? -36.094 -22.264 -8.589  1.00 123.49 ? 243 LEU C CG    1 
ATOM   5874 C CD1   . LEU C 1 221 ? -36.553 -20.807 -8.569  1.00 123.43 ? 243 LEU C CD1   1 
ATOM   5875 C CD2   . LEU C 1 221 ? -35.604 -22.697 -7.191  1.00 123.54 ? 243 LEU C CD2   1 
ATOM   5876 N N     . HIS C 1 222 ? -39.367 -24.883 -10.139 1.00 123.96 ? 244 HIS C N     1 
ATOM   5877 C CA    . HIS C 1 222 ? -40.746 -25.333 -10.078 1.00 124.32 ? 244 HIS C CA    1 
ATOM   5878 C C     . HIS C 1 222 ? -41.065 -26.179 -11.315 1.00 124.57 ? 244 HIS C C     1 
ATOM   5879 O O     . HIS C 1 222 ? -41.653 -25.663 -12.286 1.00 124.61 ? 244 HIS C O     1 
ATOM   5880 C CB    . HIS C 1 222 ? -41.695 -24.128 -9.982  1.00 124.34 ? 244 HIS C CB    1 
ATOM   5881 C CG    . HIS C 1 222 ? -41.237 -23.067 -9.028  1.00 124.42 ? 244 HIS C CG    1 
ATOM   5882 N ND1   . HIS C 1 222 ? -41.591 -23.063 -7.684  1.00 124.65 ? 244 HIS C ND1   1 
ATOM   5883 C CD2   . HIS C 1 222 ? -40.456 -21.973 -9.226  1.00 124.55 ? 244 HIS C CD2   1 
ATOM   5884 C CE1   . HIS C 1 222 ? -41.043 -22.014 -7.092  1.00 124.90 ? 244 HIS C CE1   1 
ATOM   5885 N NE2   . HIS C 1 222 ? -40.348 -21.337 -8.006  1.00 124.66 ? 244 HIS C NE2   1 
ATOM   5886 N N     . PRO C 1 223 ? -40.682 -27.485 -11.286 1.00 124.79 ? 245 PRO C N     1 
ATOM   5887 C CA    . PRO C 1 223 ? -40.887 -28.336 -12.460 1.00 125.10 ? 245 PRO C CA    1 
ATOM   5888 C C     . PRO C 1 223 ? -42.352 -28.664 -12.741 1.00 125.46 ? 245 PRO C C     1 
ATOM   5889 O O     . PRO C 1 223 ? -42.727 -28.798 -13.907 1.00 125.55 ? 245 PRO C O     1 
ATOM   5890 C CB    . PRO C 1 223 ? -40.094 -29.607 -12.118 1.00 125.10 ? 245 PRO C CB    1 
ATOM   5891 C CG    . PRO C 1 223 ? -40.072 -29.654 -10.643 1.00 124.75 ? 245 PRO C CG    1 
ATOM   5892 C CD    . PRO C 1 223 ? -40.064 -28.239 -10.168 1.00 124.64 ? 245 PRO C CD    1 
ATOM   5893 N N     . ARG C 1 224 ? -43.167 -28.788 -11.685 1.00 126.05 ? 246 ARG C N     1 
ATOM   5894 C CA    . ARG C 1 224 ? -44.577 -29.148 -11.850 1.00 126.65 ? 246 ARG C CA    1 
ATOM   5895 C C     . ARG C 1 224 ? -45.451 -27.963 -12.268 1.00 126.54 ? 246 ARG C C     1 
ATOM   5896 O O     . ARG C 1 224 ? -46.328 -28.121 -13.115 1.00 126.48 ? 246 ARG C O     1 
ATOM   5897 C CB    . ARG C 1 224 ? -45.124 -29.807 -10.576 1.00 127.05 ? 246 ARG C CB    1 
ATOM   5898 C CG    . ARG C 1 224 ? -46.450 -30.533 -10.780 1.00 128.88 ? 246 ARG C CG    1 
ATOM   5899 C CD    . ARG C 1 224 ? -46.899 -31.287 -9.528  1.00 132.12 ? 246 ARG C CD    1 
ATOM   5900 N NE    . ARG C 1 224 ? -48.199 -31.926 -9.751  1.00 134.74 ? 246 ARG C NE    1 
ATOM   5901 C CZ    . ARG C 1 224 ? -48.376 -33.223 -10.026 1.00 136.15 ? 246 ARG C CZ    1 
ATOM   5902 N NH1   . ARG C 1 224 ? -47.336 -34.054 -10.095 1.00 136.84 ? 246 ARG C NH1   1 
ATOM   5903 N NH2   . ARG C 1 224 ? -49.603 -33.693 -10.224 1.00 136.87 ? 246 ARG C NH2   1 
ATOM   5904 N N     . ARG C 1 225 ? -45.203 -26.791 -11.677 1.00 126.63 ? 247 ARG C N     1 
ATOM   5905 C CA    A ARG C 1 225 ? -45.979 -25.587 -11.984 0.50 126.70 ? 247 ARG C CA    1 
ATOM   5906 C CA    B ARG C 1 225 ? -45.967 -25.576 -11.979 0.50 126.73 ? 247 ARG C CA    1 
ATOM   5907 C C     . ARG C 1 225 ? -45.745 -25.110 -13.416 1.00 126.65 ? 247 ARG C C     1 
ATOM   5908 O O     . ARG C 1 225 ? -46.698 -24.770 -14.121 1.00 126.71 ? 247 ARG C O     1 
ATOM   5909 C CB    A ARG C 1 225 ? -45.668 -24.462 -10.989 0.50 126.81 ? 247 ARG C CB    1 
ATOM   5910 C CB    B ARG C 1 225 ? -45.591 -24.455 -11.000 0.50 126.86 ? 247 ARG C CB    1 
ATOM   5911 C CG    A ARG C 1 225 ? -46.562 -23.227 -11.143 0.50 127.26 ? 247 ARG C CG    1 
ATOM   5912 C CG    B ARG C 1 225 ? -46.327 -23.123 -11.211 0.50 127.43 ? 247 ARG C CG    1 
ATOM   5913 C CD    A ARG C 1 225 ? -48.038 -23.635 -11.245 0.50 128.27 ? 247 ARG C CD    1 
ATOM   5914 C CD    B ARG C 1 225 ? -45.683 -22.024 -10.380 0.50 128.63 ? 247 ARG C CD    1 
ATOM   5915 N NE    A ARG C 1 225 ? -48.908 -22.522 -11.645 0.50 128.81 ? 247 ARG C NE    1 
ATOM   5916 N NE    B ARG C 1 225 ? -45.547 -22.417 -8.979  0.50 129.41 ? 247 ARG C NE    1 
ATOM   5917 C CZ    A ARG C 1 225 ? -49.871 -22.011 -10.877 0.50 128.93 ? 247 ARG C CZ    1 
ATOM   5918 C CZ    B ARG C 1 225 ? -44.787 -21.778 -8.092  0.50 129.85 ? 247 ARG C CZ    1 
ATOM   5919 N NH1   A ARG C 1 225 ? -50.098 -22.515 -9.662  0.50 128.92 ? 247 ARG C NH1   1 
ATOM   5920 N NH1   B ARG C 1 225 ? -44.084 -20.710 -8.457  0.50 130.14 ? 247 ARG C NH1   1 
ATOM   5921 N NH2   A ARG C 1 225 ? -50.614 -20.998 -11.327 0.50 129.04 ? 247 ARG C NH2   1 
ATOM   5922 N NH2   B ARG C 1 225 ? -44.726 -22.210 -6.840  0.50 130.12 ? 247 ARG C NH2   1 
ATOM   5923 N N     . SER C 1 226 ? -44.479 -25.095 -13.839 1.00 126.53 ? 248 SER C N     1 
ATOM   5924 C CA    . SER C 1 226 ? -44.090 -24.605 -15.173 1.00 126.27 ? 248 SER C CA    1 
ATOM   5925 C C     . SER C 1 226 ? -44.634 -25.443 -16.346 1.00 126.21 ? 248 SER C C     1 
ATOM   5926 O O     . SER C 1 226 ? -45.200 -24.887 -17.294 1.00 126.13 ? 248 SER C O     1 
ATOM   5927 C CB    . SER C 1 226 ? -42.564 -24.459 -15.267 1.00 126.19 ? 248 SER C CB    1 
ATOM   5928 O OG    . SER C 1 226 ? -42.071 -23.721 -14.149 1.00 126.01 ? 248 SER C OG    1 
ATOM   5929 N N     . LEU C 1 227 ? -44.468 -26.768 -16.263 1.00 126.18 ? 249 LEU C N     1 
ATOM   5930 C CA    . LEU C 1 227 ? -44.983 -27.727 -17.259 1.00 126.20 ? 249 LEU C CA    1 
ATOM   5931 C C     . LEU C 1 227 ? -46.514 -27.711 -17.408 1.00 126.46 ? 249 LEU C C     1 
ATOM   5932 O O     . LEU C 1 227 ? -47.041 -27.829 -18.523 1.00 126.38 ? 249 LEU C O     1 
ATOM   5933 C CB    . LEU C 1 227 ? -44.499 -29.151 -16.938 1.00 125.98 ? 249 LEU C CB    1 
ATOM   5934 C CG    . LEU C 1 227 ? -43.180 -29.676 -17.538 1.00 125.74 ? 249 LEU C CG    1 
ATOM   5935 C CD1   . LEU C 1 227 ? -43.219 -29.758 -19.072 1.00 125.98 ? 249 LEU C CD1   1 
ATOM   5936 C CD2   . LEU C 1 227 ? -41.969 -28.890 -17.082 1.00 125.43 ? 249 LEU C CD2   1 
ATOM   5937 N N     . LYS C 1 228 ? -47.218 -27.583 -16.283 1.00 126.71 ? 250 LYS C N     1 
ATOM   5938 C CA    . LYS C 1 228 ? -48.658 -27.363 -16.314 1.00 127.01 ? 250 LYS C CA    1 
ATOM   5939 C C     . LYS C 1 228 ? -48.962 -26.162 -17.203 1.00 126.73 ? 250 LYS C C     1 
ATOM   5940 O O     . LYS C 1 228 ? -49.657 -26.310 -18.204 1.00 126.81 ? 250 LYS C O     1 
ATOM   5941 C CB    . LYS C 1 228 ? -49.229 -27.149 -14.905 1.00 127.34 ? 250 LYS C CB    1 
ATOM   5942 C CG    . LYS C 1 228 ? -49.672 -28.424 -14.170 1.00 128.96 ? 250 LYS C CG    1 
ATOM   5943 C CD    . LYS C 1 228 ? -50.259 -28.083 -12.773 1.00 131.51 ? 250 LYS C CD    1 
ATOM   5944 C CE    . LYS C 1 228 ? -50.425 -29.335 -11.870 1.00 132.73 ? 250 LYS C CE    1 
ATOM   5945 N NZ    . LYS C 1 228 ? -51.447 -30.308 -12.408 1.00 134.02 ? 250 LYS C NZ    1 
ATOM   5946 N N     . LEU C 1 229 ? -48.405 -24.994 -16.853 1.00 126.43 ? 251 LEU C N     1 
ATOM   5947 C CA    . LEU C 1 229 ? -48.612 -23.748 -17.609 1.00 126.22 ? 251 LEU C CA    1 
ATOM   5948 C C     . LEU C 1 229 ? -48.239 -23.886 -19.069 1.00 125.92 ? 251 LEU C C     1 
ATOM   5949 O O     . LEU C 1 229 ? -48.796 -23.186 -19.929 1.00 125.88 ? 251 LEU C O     1 
ATOM   5950 C CB    . LEU C 1 229 ? -47.786 -22.601 -17.024 1.00 126.31 ? 251 LEU C CB    1 
ATOM   5951 C CG    . LEU C 1 229 ? -48.138 -22.066 -15.634 1.00 127.06 ? 251 LEU C CG    1 
ATOM   5952 C CD1   . LEU C 1 229 ? -47.095 -21.042 -15.206 1.00 127.83 ? 251 LEU C CD1   1 
ATOM   5953 C CD2   . LEU C 1 229 ? -49.545 -21.460 -15.597 1.00 127.93 ? 251 LEU C CD2   1 
ATOM   5954 N N     . ILE C 1 230 ? -47.279 -24.779 -19.333 1.00 125.63 ? 252 ILE C N     1 
ATOM   5955 C CA    . ILE C 1 230 ? -46.749 -24.962 -20.675 1.00 125.28 ? 252 ILE C CA    1 
ATOM   5956 C C     . ILE C 1 230 ? -47.658 -25.870 -21.500 1.00 125.36 ? 252 ILE C C     1 
ATOM   5957 O O     . ILE C 1 230 ? -48.122 -25.458 -22.562 1.00 125.32 ? 252 ILE C O     1 
ATOM   5958 C CB    . ILE C 1 230 ? -45.270 -25.439 -20.629 1.00 125.17 ? 252 ILE C CB    1 
ATOM   5959 C CG1   . ILE C 1 230 ? -44.359 -24.248 -20.249 1.00 124.47 ? 252 ILE C CG1   1 
ATOM   5960 C CG2   . ILE C 1 230 ? -44.843 -26.038 -21.969 1.00 125.11 ? 252 ILE C CG2   1 
ATOM   5961 C CD1   . ILE C 1 230 ? -43.006 -24.648 -19.680 1.00 123.76 ? 252 ILE C CD1   1 
ATOM   5962 N N     . LEU C 1 231 ? -47.926 -27.084 -21.006 1.00 125.53 ? 253 LEU C N     1 
ATOM   5963 C CA    . LEU C 1 231 ? -48.853 -28.031 -21.660 1.00 125.88 ? 253 LEU C CA    1 
ATOM   5964 C C     . LEU C 1 231 ? -50.247 -27.425 -21.851 1.00 126.28 ? 253 LEU C C     1 
ATOM   5965 O O     . LEU C 1 231 ? -50.983 -27.764 -22.788 1.00 126.03 ? 253 LEU C O     1 
ATOM   5966 C CB    . LEU C 1 231 ? -48.969 -29.310 -20.832 1.00 125.81 ? 253 LEU C CB    1 
ATOM   5967 C CG    . LEU C 1 231 ? -47.705 -30.143 -20.640 1.00 125.38 ? 253 LEU C CG    1 
ATOM   5968 C CD1   . LEU C 1 231 ? -47.925 -31.166 -19.564 1.00 125.12 ? 253 LEU C CD1   1 
ATOM   5969 C CD2   . LEU C 1 231 ? -47.327 -30.822 -21.932 1.00 125.50 ? 253 LEU C CD2   1 
ATOM   5970 N N     . ASP C 1 232 ? -50.582 -26.541 -20.914 1.00 126.94 ? 254 ASP C N     1 
ATOM   5971 C CA    . ASP C 1 232 ? -51.721 -25.636 -20.967 1.00 127.50 ? 254 ASP C CA    1 
ATOM   5972 C C     . ASP C 1 232 ? -51.623 -24.781 -22.237 1.00 127.20 ? 254 ASP C C     1 
ATOM   5973 O O     . ASP C 1 232 ? -52.371 -24.993 -23.191 1.00 127.31 ? 254 ASP C O     1 
ATOM   5974 C CB    . ASP C 1 232 ? -51.693 -24.746 -19.699 1.00 128.05 ? 254 ASP C CB    1 
ATOM   5975 C CG    . ASP C 1 232 ? -53.057 -24.174 -19.326 1.00 129.89 ? 254 ASP C CG    1 
ATOM   5976 O OD1   . ASP C 1 232 ? -53.448 -23.119 -19.893 1.00 132.21 ? 254 ASP C OD1   1 
ATOM   5977 O OD2   . ASP C 1 232 ? -53.726 -24.758 -18.443 1.00 131.98 ? 254 ASP C OD2   1 
ATOM   5978 N N     . PHE C 1 233 ? -50.676 -23.843 -22.248 1.00 126.92 ? 255 PHE C N     1 
ATOM   5979 C CA    . PHE C 1 233 ? -50.434 -22.934 -23.375 1.00 126.53 ? 255 PHE C CA    1 
ATOM   5980 C C     . PHE C 1 233 ? -50.378 -23.610 -24.754 1.00 126.55 ? 255 PHE C C     1 
ATOM   5981 O O     . PHE C 1 233 ? -50.757 -23.011 -25.763 1.00 126.46 ? 255 PHE C O     1 
ATOM   5982 C CB    . PHE C 1 233 ? -49.155 -22.135 -23.113 1.00 126.37 ? 255 PHE C CB    1 
ATOM   5983 C CG    . PHE C 1 233 ? -48.554 -21.530 -24.337 1.00 125.49 ? 255 PHE C CG    1 
ATOM   5984 C CD1   . PHE C 1 233 ? -47.487 -22.152 -24.975 1.00 124.88 ? 255 PHE C CD1   1 
ATOM   5985 C CD2   . PHE C 1 233 ? -49.052 -20.343 -24.853 1.00 124.67 ? 255 PHE C CD2   1 
ATOM   5986 C CE1   . PHE C 1 233 ? -46.923 -21.603 -26.110 1.00 124.41 ? 255 PHE C CE1   1 
ATOM   5987 C CE2   . PHE C 1 233 ? -48.496 -19.782 -25.985 1.00 124.52 ? 255 PHE C CE2   1 
ATOM   5988 C CZ    . PHE C 1 233 ? -47.425 -20.412 -26.617 1.00 124.57 ? 255 PHE C CZ    1 
ATOM   5989 N N     . LEU C 1 234 ? -49.899 -24.851 -24.790 1.00 126.66 ? 256 LEU C N     1 
ATOM   5990 C CA    . LEU C 1 234 ? -49.843 -25.615 -26.034 1.00 126.77 ? 256 LEU C CA    1 
ATOM   5991 C C     . LEU C 1 234 ? -51.177 -26.250 -26.372 1.00 127.09 ? 256 LEU C C     1 
ATOM   5992 O O     . LEU C 1 234 ? -51.463 -26.516 -27.539 1.00 127.03 ? 256 LEU C O     1 
ATOM   5993 C CB    . LEU C 1 234 ? -48.788 -26.716 -25.939 1.00 126.62 ? 256 LEU C CB    1 
ATOM   5994 C CG    . LEU C 1 234 ? -47.357 -26.251 -25.696 1.00 126.10 ? 256 LEU C CG    1 
ATOM   5995 C CD1   . LEU C 1 234 ? -46.476 -27.465 -25.474 1.00 125.85 ? 256 LEU C CD1   1 
ATOM   5996 C CD2   . LEU C 1 234 ? -46.861 -25.417 -26.865 1.00 125.61 ? 256 LEU C CD2   1 
ATOM   5997 N N     . GLY C 1 235 ? -51.981 -26.511 -25.342 1.00 127.52 ? 257 GLY C N     1 
ATOM   5998 C CA    . GLY C 1 235 ? -53.259 -27.183 -25.528 1.00 128.05 ? 257 GLY C CA    1 
ATOM   5999 C C     . GLY C 1 235 ? -53.056 -28.680 -25.557 1.00 128.41 ? 257 GLY C C     1 
ATOM   6000 O O     . GLY C 1 235 ? -53.621 -29.381 -26.421 1.00 128.43 ? 257 GLY C O     1 
ATOM   6001 N N     . ILE C 1 236 ? -52.227 -29.163 -24.615 1.00 128.77 ? 258 ILE C N     1 
ATOM   6002 C CA    . ILE C 1 236 ? -51.984 -30.590 -24.484 1.00 129.17 ? 258 ILE C CA    1 
ATOM   6003 C C     . ILE C 1 236 ? -52.320 -31.040 -23.077 1.00 129.36 ? 258 ILE C C     1 
ATOM   6004 O O     . ILE C 1 236 ? -51.987 -30.368 -22.092 1.00 129.33 ? 258 ILE C O     1 
ATOM   6005 C CB    . ILE C 1 236 ? -50.527 -30.971 -24.815 1.00 129.25 ? 258 ILE C CB    1 
ATOM   6006 C CG1   . ILE C 1 236 ? -50.143 -30.458 -26.214 1.00 129.59 ? 258 ILE C CG1   1 
ATOM   6007 C CG2   . ILE C 1 236 ? -50.343 -32.497 -24.754 1.00 129.30 ? 258 ILE C CG2   1 
ATOM   6008 C CD1   . ILE C 1 236 ? -48.652 -30.391 -26.471 1.00 129.86 ? 258 ILE C CD1   1 
ATOM   6009 N N     . ALA C 1 237 ? -52.992 -32.186 -23.013 1.00 129.62 ? 259 ALA C N     1 
ATOM   6010 C CA    . ALA C 1 237 ? -53.350 -32.838 -21.765 1.00 129.81 ? 259 ALA C CA    1 
ATOM   6011 C C     . ALA C 1 237 ? -52.098 -33.164 -20.969 1.00 129.94 ? 259 ALA C C     1 
ATOM   6012 O O     . ALA C 1 237 ? -51.111 -33.647 -21.522 1.00 130.05 ? 259 ALA C O     1 
ATOM   6013 C CB    . ALA C 1 237 ? -54.131 -34.111 -22.050 1.00 129.81 ? 259 ALA C CB    1 
ATOM   6014 N N     . TRP C 1 238 ? -52.141 -32.896 -19.667 1.00 130.02 ? 260 TRP C N     1 
ATOM   6015 C CA    . TRP C 1 238 ? -51.045 -33.267 -18.785 1.00 130.03 ? 260 TRP C CA    1 
ATOM   6016 C C     . TRP C 1 238 ? -50.765 -34.773 -18.817 1.00 129.84 ? 260 TRP C C     1 
ATOM   6017 O O     . TRP C 1 238 ? -51.671 -35.593 -19.004 1.00 129.82 ? 260 TRP C O     1 
ATOM   6018 C CB    . TRP C 1 238 ? -51.345 -32.853 -17.342 1.00 130.19 ? 260 TRP C CB    1 
ATOM   6019 C CG    . TRP C 1 238 ? -50.279 -33.323 -16.378 1.00 130.73 ? 260 TRP C CG    1 
ATOM   6020 C CD1   . TRP C 1 238 ? -50.256 -34.500 -15.667 1.00 131.20 ? 260 TRP C CD1   1 
ATOM   6021 C CD2   . TRP C 1 238 ? -49.072 -32.637 -16.050 1.00 130.81 ? 260 TRP C CD2   1 
ATOM   6022 N NE1   . TRP C 1 238 ? -49.109 -34.578 -14.912 1.00 130.90 ? 260 TRP C NE1   1 
ATOM   6023 C CE2   . TRP C 1 238 ? -48.369 -33.445 -15.124 1.00 130.75 ? 260 TRP C CE2   1 
ATOM   6024 C CE3   . TRP C 1 238 ? -48.525 -31.406 -16.431 1.00 130.73 ? 260 TRP C CE3   1 
ATOM   6025 C CZ2   . TRP C 1 238 ? -47.148 -33.065 -14.588 1.00 130.84 ? 260 TRP C CZ2   1 
ATOM   6026 C CZ3   . TRP C 1 238 ? -47.312 -31.031 -15.902 1.00 130.87 ? 260 TRP C CZ3   1 
ATOM   6027 C CH2   . TRP C 1 238 ? -46.634 -31.857 -14.987 1.00 131.02 ? 260 TRP C CH2   1 
ATOM   6028 N N     . SER C 1 239 ? -49.494 -35.117 -18.632 1.00 129.60 ? 261 SER C N     1 
ATOM   6029 C CA    . SER C 1 239 ? -49.101 -36.470 -18.261 1.00 129.36 ? 261 SER C CA    1 
ATOM   6030 C C     . SER C 1 239 ? -48.125 -36.355 -17.091 1.00 129.28 ? 261 SER C C     1 
ATOM   6031 O O     . SER C 1 239 ? -47.370 -35.383 -17.000 1.00 129.30 ? 261 SER C O     1 
ATOM   6032 C CB    . SER C 1 239 ? -48.453 -37.183 -19.447 1.00 129.30 ? 261 SER C CB    1 
ATOM   6033 O OG    . SER C 1 239 ? -47.993 -38.508 -19.051 1.00 129.18 ? 261 SER C OG    1 
ATOM   6034 N N     . ASP C 1 240 ? -48.162 -37.321 -16.176 1.00 129.11 ? 262 ASP C N     1 
ATOM   6035 C CA    . ASP C 1 240 ? -47.225 -37.334 -15.053 1.00 129.03 ? 262 ASP C CA    1 
ATOM   6036 C C     . ASP C 1 240 ? -45.802 -37.700 -15.501 1.00 128.62 ? 262 ASP C C     1 
ATOM   6037 O O     . ASP C 1 240 ? -44.828 -37.417 -14.787 1.00 128.61 ? 262 ASP C O     1 
ATOM   6038 C CB    . ASP C 1 240 ? -47.708 -38.290 -13.956 1.00 129.35 ? 262 ASP C CB    1 
ATOM   6039 C CG    . ASP C 1 240 ? -46.800 -38.278 -12.727 1.00 130.31 ? 262 ASP C CG    1 
ATOM   6040 O OD1   . ASP C 1 240 ? -46.935 -37.365 -11.873 1.00 131.38 ? 262 ASP C OD1   1 
ATOM   6041 O OD2   . ASP C 1 240 ? -45.948 -39.188 -12.618 1.00 131.79 ? 262 ASP C OD2   1 
ATOM   6042 N N     . ALA C 1 241 ? -45.689 -38.313 -16.687 1.00 128.17 ? 263 ALA C N     1 
ATOM   6043 C CA    . ALA C 1 241 ? -44.395 -38.709 -17.256 1.00 127.88 ? 263 ALA C CA    1 
ATOM   6044 C C     . ALA C 1 241 ? -43.380 -37.558 -17.425 1.00 127.72 ? 263 ALA C C     1 
ATOM   6045 O O     . ALA C 1 241 ? -42.169 -37.791 -17.372 1.00 127.70 ? 263 ALA C O     1 
ATOM   6046 C CB    . ALA C 1 241 ? -44.604 -39.434 -18.571 1.00 127.81 ? 263 ALA C CB    1 
ATOM   6047 N N     . VAL C 1 242 ? -43.886 -36.334 -17.619 1.00 127.52 ? 264 VAL C N     1 
ATOM   6048 C CA    . VAL C 1 242 ? -43.088 -35.088 -17.745 1.00 127.42 ? 264 VAL C CA    1 
ATOM   6049 C C     . VAL C 1 242 ? -41.972 -34.840 -16.690 1.00 127.55 ? 264 VAL C C     1 
ATOM   6050 O O     . VAL C 1 242 ? -40.892 -34.307 -17.003 1.00 127.51 ? 264 VAL C O     1 
ATOM   6051 C CB    . VAL C 1 242 ? -44.051 -33.851 -17.847 1.00 127.26 ? 264 VAL C CB    1 
ATOM   6052 C CG1   . VAL C 1 242 ? -43.661 -32.724 -16.909 1.00 127.09 ? 264 VAL C CG1   1 
ATOM   6053 C CG2   . VAL C 1 242 ? -44.136 -33.358 -19.274 1.00 127.33 ? 264 VAL C CG2   1 
ATOM   6054 N N     . LEU C 1 243 ? -42.234 -35.227 -15.446 1.00 127.62 ? 265 LEU C N     1 
ATOM   6055 C CA    . LEU C 1 243 ? -41.304 -34.957 -14.361 1.00 127.72 ? 265 LEU C CA    1 
ATOM   6056 C C     . LEU C 1 243 ? -40.396 -36.160 -14.093 1.00 127.90 ? 265 LEU C C     1 
ATOM   6057 O O     . LEU C 1 243 ? -39.640 -36.188 -13.091 1.00 128.02 ? 265 LEU C O     1 
ATOM   6058 C CB    . LEU C 1 243 ? -42.085 -34.557 -13.104 1.00 127.63 ? 265 LEU C CB    1 
ATOM   6059 C CG    . LEU C 1 243 ? -43.083 -33.413 -13.319 1.00 127.51 ? 265 LEU C CG    1 
ATOM   6060 C CD1   . LEU C 1 243 ? -44.167 -33.419 -12.251 1.00 127.80 ? 265 LEU C CD1   1 
ATOM   6061 C CD2   . LEU C 1 243 ? -42.383 -32.058 -13.388 1.00 127.42 ? 265 LEU C CD2   1 
ATOM   6062 N N     . HIS C 1 244 ? -40.464 -37.142 -15.006 1.00 127.97 ? 266 HIS C N     1 
ATOM   6063 C CA    . HIS C 1 244 ? -39.702 -38.384 -14.865 1.00 128.15 ? 266 HIS C CA    1 
ATOM   6064 C C     . HIS C 1 244 ? -38.896 -38.735 -16.122 1.00 128.23 ? 266 HIS C C     1 
ATOM   6065 O O     . HIS C 1 244 ? -38.626 -39.924 -16.391 1.00 128.38 ? 266 HIS C O     1 
ATOM   6066 C CB    . HIS C 1 244 ? -40.644 -39.532 -14.493 1.00 128.10 ? 266 HIS C CB    1 
ATOM   6067 C CG    . HIS C 1 244 ? -41.382 -39.309 -13.207 1.00 128.65 ? 266 HIS C CG    1 
ATOM   6068 N ND1   . HIS C 1 244 ? -40.763 -39.445 -11.961 1.00 129.53 ? 266 HIS C ND1   1 
ATOM   6069 C CD2   . HIS C 1 244 ? -42.682 -38.936 -12.970 1.00 128.87 ? 266 HIS C CD2   1 
ATOM   6070 C CE1   . HIS C 1 244 ? -41.652 -39.178 -11.011 1.00 129.47 ? 266 HIS C CE1   1 
ATOM   6071 N NE2   . HIS C 1 244 ? -42.824 -38.867 -11.596 1.00 129.16 ? 266 HIS C NE2   1 
ATOM   6072 N N     . HIS C 1 245 ? -38.492 -37.697 -16.867 1.00 128.22 ? 267 HIS C N     1 
ATOM   6073 C CA    . HIS C 1 245 ? -37.823 -37.856 -18.169 1.00 128.07 ? 267 HIS C CA    1 
ATOM   6074 C C     . HIS C 1 245 ? -36.558 -38.701 -18.066 1.00 128.23 ? 267 HIS C C     1 
ATOM   6075 O O     . HIS C 1 245 ? -36.232 -39.447 -18.984 1.00 128.18 ? 267 HIS C O     1 
ATOM   6076 C CB    . HIS C 1 245 ? -37.452 -36.492 -18.730 1.00 127.88 ? 267 HIS C CB    1 
ATOM   6077 C CG    . HIS C 1 245 ? -36.425 -35.791 -17.912 1.00 127.23 ? 267 HIS C CG    1 
ATOM   6078 N ND1   . HIS C 1 245 ? -35.073 -35.954 -18.127 1.00 126.57 ? 267 HIS C ND1   1 
ATOM   6079 C CD2   . HIS C 1 245 ? -36.547 -34.978 -16.837 1.00 126.86 ? 267 HIS C CD2   1 
ATOM   6080 C CE1   . HIS C 1 245 ? -34.405 -35.242 -17.239 1.00 126.61 ? 267 HIS C CE1   1 
ATOM   6081 N NE2   . HIS C 1 245 ? -35.277 -34.640 -16.444 1.00 126.76 ? 267 HIS C NE2   1 
ATOM   6082 N N     . GLU C 1 246 ? -35.849 -38.573 -16.949 1.00 128.52 ? 268 GLU C N     1 
ATOM   6083 C CA    . GLU C 1 246 ? -34.670 -39.377 -16.692 1.00 129.10 ? 268 GLU C CA    1 
ATOM   6084 C C     . GLU C 1 246 ? -34.981 -40.867 -16.794 1.00 129.62 ? 268 GLU C C     1 
ATOM   6085 O O     . GLU C 1 246 ? -34.084 -41.667 -17.048 1.00 129.76 ? 268 GLU C O     1 
ATOM   6086 C CB    . GLU C 1 246 ? -34.090 -39.057 -15.312 1.00 129.04 ? 268 GLU C CB    1 
ATOM   6087 C CG    . GLU C 1 246 ? -34.915 -39.566 -14.125 1.00 129.19 ? 268 GLU C CG    1 
ATOM   6088 C CD    . GLU C 1 246 ? -36.146 -38.716 -13.821 1.00 129.52 ? 268 GLU C CD    1 
ATOM   6089 O OE1   . GLU C 1 246 ? -36.858 -39.036 -12.835 1.00 129.80 ? 268 GLU C OE1   1 
ATOM   6090 O OE2   . GLU C 1 246 ? -36.408 -37.731 -14.555 1.00 129.41 ? 268 GLU C OE2   1 
ATOM   6091 N N     . ASP C 1 247 ? -36.254 -41.227 -16.607 1.00 130.28 ? 269 ASP C N     1 
ATOM   6092 C CA    . ASP C 1 247 ? -36.688 -42.629 -16.622 1.00 131.02 ? 269 ASP C CA    1 
ATOM   6093 C C     . ASP C 1 247 ? -37.129 -43.155 -17.993 1.00 131.57 ? 269 ASP C C     1 
ATOM   6094 O O     . ASP C 1 247 ? -37.588 -44.310 -18.100 1.00 131.60 ? 269 ASP C O     1 
ATOM   6095 C CB    . ASP C 1 247 ? -37.816 -42.845 -15.609 1.00 130.94 ? 269 ASP C CB    1 
ATOM   6096 C CG    . ASP C 1 247 ? -37.361 -42.656 -14.181 1.00 131.03 ? 269 ASP C CG    1 
ATOM   6097 O OD1   . ASP C 1 247 ? -36.160 -42.856 -13.899 1.00 130.68 ? 269 ASP C OD1   1 
ATOM   6098 O OD2   . ASP C 1 247 ? -38.212 -42.313 -13.337 1.00 131.22 ? 269 ASP C OD2   1 
ATOM   6099 N N     . LEU C 1 248 ? -36.988 -42.319 -19.035 1.00 132.34 ? 270 LEU C N     1 
ATOM   6100 C CA    . LEU C 1 248 ? -37.469 -42.681 -20.380 1.00 133.05 ? 270 LEU C CA    1 
ATOM   6101 C C     . LEU C 1 248 ? -36.435 -42.509 -21.514 1.00 133.55 ? 270 LEU C C     1 
ATOM   6102 O O     . LEU C 1 248 ? -36.800 -42.386 -22.694 1.00 133.62 ? 270 LEU C O     1 
ATOM   6103 C CB    . LEU C 1 248 ? -38.789 -41.951 -20.702 1.00 133.01 ? 270 LEU C CB    1 
ATOM   6104 C CG    . LEU C 1 248 ? -40.004 -42.309 -19.827 1.00 132.97 ? 270 LEU C CG    1 
ATOM   6105 C CD1   . LEU C 1 248 ? -41.166 -41.353 -20.146 1.00 133.01 ? 270 LEU C CD1   1 
ATOM   6106 C CD2   . LEU C 1 248 ? -40.429 -43.777 -20.036 1.00 133.03 ? 270 LEU C CD2   1 
ATOM   6107 N N     . ILE C 1 249 ? -35.152 -42.516 -21.154 1.00 134.15 ? 271 ILE C N     1 
ATOM   6108 C CA    . ILE C 1 249 ? -34.080 -42.312 -22.132 1.00 134.75 ? 271 ILE C CA    1 
ATOM   6109 C C     . ILE C 1 249 ? -33.813 -43.573 -22.957 1.00 135.15 ? 271 ILE C C     1 
ATOM   6110 O O     . ILE C 1 249 ? -33.511 -44.643 -22.413 1.00 135.22 ? 271 ILE C O     1 
ATOM   6111 C CB    . ILE C 1 249 ? -32.778 -41.792 -21.472 1.00 134.72 ? 271 ILE C CB    1 
ATOM   6112 C CG1   . ILE C 1 249 ? -33.028 -40.404 -20.858 1.00 134.80 ? 271 ILE C CG1   1 
ATOM   6113 C CG2   . ILE C 1 249 ? -31.647 -41.710 -22.517 1.00 134.73 ? 271 ILE C CG2   1 
ATOM   6114 C CD1   . ILE C 1 249 ? -32.104 -40.060 -19.705 1.00 135.07 ? 271 ILE C CD1   1 
ATOM   6115 N N     . GLY C 1 250 ? -33.939 -43.430 -24.275 1.00 135.58 ? 272 GLY C N     1 
ATOM   6116 C CA    . GLY C 1 250 ? -33.758 -44.541 -25.196 1.00 136.06 ? 272 GLY C CA    1 
ATOM   6117 C C     . GLY C 1 250 ? -35.017 -45.376 -25.348 1.00 136.33 ? 272 GLY C C     1 
ATOM   6118 O O     . GLY C 1 250 ? -35.098 -46.227 -26.252 1.00 136.36 ? 272 GLY C O     1 
ATOM   6119 N N     . LYS C 1 251 ? -35.998 -45.128 -24.470 1.00 136.62 ? 273 LYS C N     1 
ATOM   6120 C CA    . LYS C 1 251 ? -37.253 -45.891 -24.457 1.00 136.97 ? 273 LYS C CA    1 
ATOM   6121 C C     . LYS C 1 251 ? -38.256 -45.332 -25.472 1.00 136.85 ? 273 LYS C C     1 
ATOM   6122 O O     . LYS C 1 251 ? -38.267 -44.117 -25.718 1.00 136.91 ? 273 LYS C O     1 
ATOM   6123 C CB    . LYS C 1 251 ? -37.891 -45.883 -23.064 1.00 137.15 ? 273 LYS C CB    1 
ATOM   6124 C CG    . LYS C 1 251 ? -36.926 -46.052 -21.909 1.00 138.14 ? 273 LYS C CG    1 
ATOM   6125 C CD    . LYS C 1 251 ? -37.694 -46.140 -20.579 1.00 139.84 ? 273 LYS C CD    1 
ATOM   6126 C CE    . LYS C 1 251 ? -37.355 -47.408 -19.795 1.00 141.09 ? 273 LYS C CE    1 
ATOM   6127 N NZ    . LYS C 1 251 ? -35.909 -47.467 -19.400 1.00 142.11 ? 273 LYS C NZ    1 
ATOM   6128 N N     . PRO C 1 252 ? -39.109 -46.213 -26.057 1.00 136.69 ? 274 PRO C N     1 
ATOM   6129 C CA    . PRO C 1 252 ? -40.094 -45.804 -27.079 1.00 136.29 ? 274 PRO C CA    1 
ATOM   6130 C C     . PRO C 1 252 ? -41.113 -44.798 -26.538 1.00 135.66 ? 274 PRO C C     1 
ATOM   6131 O O     . PRO C 1 252 ? -41.477 -44.864 -25.350 1.00 135.64 ? 274 PRO C O     1 
ATOM   6132 C CB    . PRO C 1 252 ? -40.790 -47.128 -27.460 1.00 136.37 ? 274 PRO C CB    1 
ATOM   6133 C CG    . PRO C 1 252 ? -39.818 -48.192 -27.073 1.00 136.77 ? 274 PRO C CG    1 
ATOM   6134 C CD    . PRO C 1 252 ? -39.166 -47.681 -25.812 1.00 136.81 ? 274 PRO C CD    1 
ATOM   6135 N N     . GLY C 1 253 ? -41.544 -43.870 -27.408 1.00 134.82 ? 275 GLY C N     1 
ATOM   6136 C CA    . GLY C 1 253 ? -42.507 -42.819 -27.042 1.00 133.54 ? 275 GLY C CA    1 
ATOM   6137 C C     . GLY C 1 253 ? -41.927 -41.757 -26.128 1.00 132.64 ? 275 GLY C C     1 
ATOM   6138 O O     . GLY C 1 253 ? -42.589 -40.757 -25.818 1.00 132.37 ? 275 GLY C O     1 
ATOM   6139 N N     . GLY C 1 254 ? -40.680 -41.987 -25.711 1.00 131.85 ? 276 GLY C N     1 
ATOM   6140 C CA    . GLY C 1 254 ? -39.979 -41.116 -24.789 1.00 130.83 ? 276 GLY C CA    1 
ATOM   6141 C C     . GLY C 1 254 ? -38.811 -40.383 -25.431 1.00 130.15 ? 276 GLY C C     1 
ATOM   6142 O O     . GLY C 1 254 ? -38.908 -39.914 -26.572 1.00 129.97 ? 276 GLY C O     1 
ATOM   6143 N N     . VAL C 1 255 ? -37.700 -40.313 -24.695 1.00 129.60 ? 277 VAL C N     1 
ATOM   6144 C CA    . VAL C 1 255 ? -36.589 -39.395 -25.002 1.00 128.92 ? 277 VAL C CA    1 
ATOM   6145 C C     . VAL C 1 255 ? -35.440 -40.065 -25.758 1.00 128.67 ? 277 VAL C C     1 
ATOM   6146 O O     . VAL C 1 255 ? -34.918 -41.115 -25.326 1.00 128.51 ? 277 VAL C O     1 
ATOM   6147 C CB    . VAL C 1 255 ? -36.025 -38.711 -23.718 1.00 128.77 ? 277 VAL C CB    1 
ATOM   6148 C CG1   . VAL C 1 255 ? -35.238 -37.466 -24.082 1.00 128.49 ? 277 VAL C CG1   1 
ATOM   6149 C CG2   . VAL C 1 255 ? -37.144 -38.353 -22.751 1.00 128.36 ? 277 VAL C CG2   1 
ATOM   6150 N N     . SER C 1 256 ? -35.056 -39.427 -26.881 1.00 128.47 ? 278 SER C N     1 
ATOM   6151 C CA    . SER C 1 256 ? -33.943 -39.881 -27.723 1.00 128.33 ? 278 SER C CA    1 
ATOM   6152 C C     . SER C 1 256 ? -32.834 -38.819 -27.744 1.00 128.16 ? 278 SER C C     1 
ATOM   6153 O O     . SER C 1 256 ? -33.110 -37.637 -27.982 1.00 128.23 ? 278 SER C O     1 
ATOM   6154 C CB    . SER C 1 256 ? -34.445 -40.172 -29.148 1.00 128.38 ? 278 SER C CB    1 
ATOM   6155 O OG    . SER C 1 256 ? -33.398 -40.675 -29.980 1.00 128.48 ? 278 SER C OG    1 
ATOM   6156 N N     . LEU C 1 257 ? -31.587 -39.243 -27.501 1.00 127.92 ? 279 LEU C N     1 
ATOM   6157 C CA    . LEU C 1 257 ? -30.457 -38.311 -27.328 1.00 127.70 ? 279 LEU C CA    1 
ATOM   6158 C C     . LEU C 1 257 ? -29.254 -38.603 -28.214 1.00 127.66 ? 279 LEU C C     1 
ATOM   6159 O O     . LEU C 1 257 ? -28.808 -39.770 -28.323 1.00 127.63 ? 279 LEU C O     1 
ATOM   6160 C CB    . LEU C 1 257 ? -29.971 -38.316 -25.876 1.00 127.60 ? 279 LEU C CB    1 
ATOM   6161 C CG    . LEU C 1 257 ? -30.894 -37.903 -24.735 1.00 127.32 ? 279 LEU C CG    1 
ATOM   6162 C CD1   . LEU C 1 257 ? -30.220 -38.242 -23.413 1.00 126.93 ? 279 LEU C CD1   1 
ATOM   6163 C CD2   . LEU C 1 257 ? -31.220 -36.411 -24.823 1.00 127.13 ? 279 LEU C CD2   1 
ATOM   6164 N N     . SER C 1 258 ? -28.717 -37.532 -28.825 1.00 127.65 ? 280 SER C N     1 
ATOM   6165 C CA    . SER C 1 258 ? -27.444 -37.640 -29.523 1.00 127.77 ? 280 SER C CA    1 
ATOM   6166 C C     . SER C 1 258 ? -26.354 -37.790 -28.470 1.00 127.88 ? 280 SER C C     1 
ATOM   6167 O O     . SER C 1 258 ? -26.293 -37.013 -27.514 1.00 127.79 ? 280 SER C O     1 
ATOM   6168 C CB    . SER C 1 258 ? -27.191 -36.414 -30.404 1.00 127.75 ? 280 SER C CB    1 
ATOM   6169 O OG    . SER C 1 258 ? -25.909 -36.488 -31.031 1.00 127.68 ? 280 SER C OG    1 
ATOM   6170 N N     . LYS C 1 259 ? -25.504 -38.798 -28.634 1.00 128.02 ? 281 LYS C N     1 
ATOM   6171 C CA    . LYS C 1 259 ? -24.472 -39.060 -27.643 1.00 128.19 ? 281 LYS C CA    1 
ATOM   6172 C C     . LYS C 1 259 ? -23.317 -38.056 -27.736 1.00 127.76 ? 281 LYS C C     1 
ATOM   6173 O O     . LYS C 1 259 ? -22.451 -38.020 -26.856 1.00 127.76 ? 281 LYS C O     1 
ATOM   6174 C CB    . LYS C 1 259 ? -23.990 -40.516 -27.715 1.00 128.54 ? 281 LYS C CB    1 
ATOM   6175 C CG    . LYS C 1 259 ? -22.996 -40.828 -28.841 1.00 130.25 ? 281 LYS C CG    1 
ATOM   6176 C CD    . LYS C 1 259 ? -21.995 -41.866 -28.340 1.00 133.59 ? 281 LYS C CD    1 
ATOM   6177 C CE    . LYS C 1 259 ? -20.854 -42.080 -29.330 1.00 135.74 ? 281 LYS C CE    1 
ATOM   6178 N NZ    . LYS C 1 259 ? -21.303 -42.839 -30.540 1.00 137.19 ? 281 LYS C NZ    1 
ATOM   6179 N N     . ILE C 1 260 ? -23.331 -37.230 -28.787 1.00 127.27 ? 282 ILE C N     1 
ATOM   6180 C CA    . ILE C 1 260 ? -22.281 -36.218 -29.023 1.00 126.74 ? 282 ILE C CA    1 
ATOM   6181 C C     . ILE C 1 260 ? -22.741 -34.748 -28.934 1.00 126.40 ? 282 ILE C C     1 
ATOM   6182 O O     . ILE C 1 260 ? -21.921 -33.827 -29.067 1.00 126.22 ? 282 ILE C O     1 
ATOM   6183 C CB    . ILE C 1 260 ? -21.536 -36.457 -30.363 1.00 126.71 ? 282 ILE C CB    1 
ATOM   6184 C CG1   . ILE C 1 260 ? -22.533 -36.590 -31.520 1.00 126.56 ? 282 ILE C CG1   1 
ATOM   6185 C CG2   . ILE C 1 260 ? -20.607 -37.678 -30.254 1.00 126.69 ? 282 ILE C CG2   1 
ATOM   6186 C CD1   . ILE C 1 260 ? -21.878 -36.815 -32.850 1.00 126.70 ? 282 ILE C CD1   1 
ATOM   6187 N N     . GLU C 1 261 ? -24.045 -34.538 -28.721 1.00 126.04 ? 283 GLU C N     1 
ATOM   6188 C CA    . GLU C 1 261 ? -24.581 -33.215 -28.376 1.00 125.60 ? 283 GLU C CA    1 
ATOM   6189 C C     . GLU C 1 261 ? -23.985 -32.803 -27.038 1.00 125.54 ? 283 GLU C C     1 
ATOM   6190 O O     . GLU C 1 261 ? -23.582 -33.658 -26.242 1.00 125.37 ? 283 GLU C O     1 
ATOM   6191 C CB    . GLU C 1 261 ? -26.113 -33.235 -28.306 1.00 125.46 ? 283 GLU C CB    1 
ATOM   6192 C CG    . GLU C 1 261 ? -26.811 -32.894 -29.628 1.00 125.23 ? 283 GLU C CG    1 
ATOM   6193 C CD    . GLU C 1 261 ? -28.349 -33.152 -29.612 1.00 125.34 ? 283 GLU C CD    1 
ATOM   6194 O OE1   . GLU C 1 261 ? -29.009 -33.158 -28.522 1.00 125.69 ? 283 GLU C OE1   1 
ATOM   6195 O OE2   . GLU C 1 261 ? -28.907 -33.334 -30.715 1.00 125.12 ? 283 GLU C OE2   1 
ATOM   6196 N N     . ARG C 1 262 ? -23.910 -31.500 -26.791 1.00 125.58 ? 284 ARG C N     1 
ATOM   6197 C CA    . ARG C 1 262 ? -23.176 -31.010 -25.621 1.00 125.88 ? 284 ARG C CA    1 
ATOM   6198 C C     . ARG C 1 262 ? -23.987 -31.024 -24.302 1.00 125.96 ? 284 ARG C C     1 
ATOM   6199 O O     . ARG C 1 262 ? -23.413 -30.899 -23.203 1.00 125.86 ? 284 ARG C O     1 
ATOM   6200 C CB    . ARG C 1 262 ? -22.530 -29.643 -25.913 1.00 125.96 ? 284 ARG C CB    1 
ATOM   6201 C CG    . ARG C 1 262 ? -21.706 -29.582 -27.236 1.00 127.15 ? 284 ARG C CG    1 
ATOM   6202 C CD    . ARG C 1 262 ? -20.461 -30.510 -27.262 1.00 129.31 ? 284 ARG C CD    1 
ATOM   6203 N NE    . ARG C 1 262 ? -19.188 -29.807 -27.028 1.00 131.77 ? 284 ARG C NE    1 
ATOM   6204 C CZ    . ARG C 1 262 ? -18.507 -29.815 -25.875 1.00 133.61 ? 284 ARG C CZ    1 
ATOM   6205 N NH1   . ARG C 1 262 ? -18.960 -30.488 -24.818 1.00 134.61 ? 284 ARG C NH1   1 
ATOM   6206 N NH2   . ARG C 1 262 ? -17.363 -29.144 -25.696 1.00 134.52 ? 284 ARG C NH2   1 
ATOM   6207 N N     . SER C 1 263 ? -25.308 -31.202 -24.411 1.00 126.38 ? 285 SER C N     1 
ATOM   6208 C CA    . SER C 1 263 ? -26.176 -31.389 -23.235 1.00 126.55 ? 285 SER C CA    1 
ATOM   6209 C C     . SER C 1 263 ? -26.514 -32.866 -22.984 1.00 126.79 ? 285 SER C C     1 
ATOM   6210 O O     . SER C 1 263 ? -27.326 -33.183 -22.107 1.00 126.94 ? 285 SER C O     1 
ATOM   6211 C CB    . SER C 1 263 ? -27.461 -30.570 -23.369 1.00 126.44 ? 285 SER C CB    1 
ATOM   6212 O OG    . SER C 1 263 ? -27.268 -29.228 -22.963 1.00 126.11 ? 285 SER C OG    1 
ATOM   6213 N N     . THR C 1 264 ? -25.866 -33.749 -23.748 1.00 126.98 ? 286 THR C N     1 
ATOM   6214 C CA    . THR C 1 264 ? -26.069 -35.206 -23.707 1.00 127.03 ? 286 THR C CA    1 
ATOM   6215 C C     . THR C 1 264 ? -26.153 -35.842 -22.308 1.00 127.04 ? 286 THR C C     1 
ATOM   6216 O O     . THR C 1 264 ? -26.826 -36.865 -22.155 1.00 127.06 ? 286 THR C O     1 
ATOM   6217 C CB    . THR C 1 264 ? -24.996 -35.943 -24.578 1.00 127.16 ? 286 THR C CB    1 
ATOM   6218 O OG1   . THR C 1 264 ? -25.271 -35.718 -25.968 1.00 127.04 ? 286 THR C OG1   1 
ATOM   6219 C CG2   . THR C 1 264 ? -24.968 -37.450 -24.315 1.00 127.16 ? 286 THR C CG2   1 
ATOM   6220 N N     . ASP C 1 265 ? -25.502 -35.251 -21.297 1.00 126.99 ? 287 ASP C N     1 
ATOM   6221 C CA    . ASP C 1 265 ? -25.454 -35.896 -19.964 1.00 126.88 ? 287 ASP C CA    1 
ATOM   6222 C C     . ASP C 1 265 ? -25.469 -35.062 -18.659 1.00 126.66 ? 287 ASP C C     1 
ATOM   6223 O O     . ASP C 1 265 ? -24.898 -35.487 -17.643 1.00 126.70 ? 287 ASP C O     1 
ATOM   6224 C CB    . ASP C 1 265 ? -24.339 -36.962 -19.917 1.00 126.89 ? 287 ASP C CB    1 
ATOM   6225 C CG    . ASP C 1 265 ? -23.026 -36.448 -20.441 1.00 127.35 ? 287 ASP C CG    1 
ATOM   6226 O OD1   . ASP C 1 265 ? -22.448 -35.559 -19.772 1.00 127.97 ? 287 ASP C OD1   1 
ATOM   6227 O OD2   . ASP C 1 265 ? -22.578 -36.927 -21.516 1.00 127.44 ? 287 ASP C OD2   1 
ATOM   6228 N N     . GLN C 1 266 ? -26.103 -33.882 -18.690 1.00 126.33 ? 288 GLN C N     1 
ATOM   6229 C CA    . GLN C 1 266 ? -26.641 -33.245 -17.466 1.00 125.78 ? 288 GLN C CA    1 
ATOM   6230 C C     . GLN C 1 266 ? -28.148 -33.450 -17.541 1.00 125.53 ? 288 GLN C C     1 
ATOM   6231 O O     . GLN C 1 266 ? -28.868 -33.446 -16.532 1.00 125.36 ? 288 GLN C O     1 
ATOM   6232 C CB    . GLN C 1 266 ? -26.325 -31.746 -17.353 1.00 125.71 ? 288 GLN C CB    1 
ATOM   6233 C CG    . GLN C 1 266 ? -24.931 -31.319 -17.759 1.00 124.90 ? 288 GLN C CG    1 
ATOM   6234 C CD    . GLN C 1 266 ? -24.906 -30.758 -19.166 1.00 124.51 ? 288 GLN C CD    1 
ATOM   6235 O OE1   . GLN C 1 266 ? -24.178 -31.250 -20.037 1.00 124.39 ? 288 GLN C OE1   1 
ATOM   6236 N NE2   . GLN C 1 266 ? -25.715 -29.732 -19.402 1.00 123.61 ? 288 GLN C NE2   1 
ATOM   6237 N N     . VAL C 1 267 ? -28.597 -33.625 -18.778 1.00 125.08 ? 289 VAL C N     1 
ATOM   6238 C CA    . VAL C 1 267 ? -29.972 -33.940 -19.097 1.00 124.99 ? 289 VAL C CA    1 
ATOM   6239 C C     . VAL C 1 267 ? -30.365 -35.342 -18.582 1.00 124.93 ? 289 VAL C C     1 
ATOM   6240 O O     . VAL C 1 267 ? -31.474 -35.520 -18.054 1.00 124.78 ? 289 VAL C O     1 
ATOM   6241 C CB    . VAL C 1 267 ? -30.210 -33.757 -20.638 1.00 125.02 ? 289 VAL C CB    1 
ATOM   6242 C CG1   . VAL C 1 267 ? -31.524 -34.445 -21.097 1.00 124.96 ? 289 VAL C CG1   1 
ATOM   6243 C CG2   . VAL C 1 267 ? -30.183 -32.230 -21.028 1.00 124.83 ? 289 VAL C CG2   1 
ATOM   6244 N N     . ILE C 1 268 ? -29.454 -36.320 -18.712 1.00 124.92 ? 290 ILE C N     1 
ATOM   6245 C CA    . ILE C 1 268 ? -29.722 -37.699 -18.248 1.00 125.00 ? 290 ILE C CA    1 
ATOM   6246 C C     . ILE C 1 268 ? -30.172 -37.771 -16.782 1.00 125.02 ? 290 ILE C C     1 
ATOM   6247 O O     . ILE C 1 268 ? -30.921 -38.680 -16.400 1.00 125.14 ? 290 ILE C O     1 
ATOM   6248 C CB    . ILE C 1 268 ? -28.520 -38.672 -18.463 1.00 125.00 ? 290 ILE C CB    1 
ATOM   6249 C CG1   . ILE C 1 268 ? -27.238 -38.132 -17.800 1.00 125.27 ? 290 ILE C CG1   1 
ATOM   6250 C CG2   . ILE C 1 268 ? -28.337 -38.973 -19.947 1.00 125.02 ? 290 ILE C CG2   1 
ATOM   6251 C CD1   . ILE C 1 268 ? -26.163 -39.182 -17.534 1.00 125.96 ? 290 ILE C CD1   1 
ATOM   6252 N N     . LYS C 1 269 ? -29.704 -36.809 -15.977 1.00 124.92 ? 291 LYS C N     1 
ATOM   6253 C CA    . LYS C 1 269 ? -30.075 -36.696 -14.568 1.00 124.85 ? 291 LYS C CA    1 
ATOM   6254 C C     . LYS C 1 269 ? -31.416 -36.004 -14.455 1.00 124.36 ? 291 LYS C C     1 
ATOM   6255 O O     . LYS C 1 269 ? -31.765 -35.221 -15.338 1.00 124.49 ? 291 LYS C O     1 
ATOM   6256 C CB    . LYS C 1 269 ? -29.032 -35.871 -13.815 1.00 125.12 ? 291 LYS C CB    1 
ATOM   6257 C CG    . LYS C 1 269 ? -27.751 -36.626 -13.502 1.00 126.17 ? 291 LYS C CG    1 
ATOM   6258 C CD    . LYS C 1 269 ? -26.609 -35.663 -13.200 1.00 127.82 ? 291 LYS C CD    1 
ATOM   6259 C CE    . LYS C 1 269 ? -26.033 -35.070 -14.491 1.00 128.80 ? 291 LYS C CE    1 
ATOM   6260 N NZ    . LYS C 1 269 ? -25.016 -33.997 -14.242 1.00 129.86 ? 291 LYS C NZ    1 
ATOM   6261 N N     . PRO C 1 270 ? -32.169 -36.277 -13.370 1.00 123.90 ? 292 PRO C N     1 
ATOM   6262 C CA    . PRO C 1 270 ? -33.434 -35.573 -13.157 1.00 123.63 ? 292 PRO C CA    1 
ATOM   6263 C C     . PRO C 1 270 ? -33.230 -34.073 -12.926 1.00 123.26 ? 292 PRO C C     1 
ATOM   6264 O O     . PRO C 1 270 ? -32.108 -33.638 -12.634 1.00 122.92 ? 292 PRO C O     1 
ATOM   6265 C CB    . PRO C 1 270 ? -34.010 -36.247 -11.902 1.00 123.68 ? 292 PRO C CB    1 
ATOM   6266 C CG    . PRO C 1 270 ? -32.837 -36.853 -11.222 1.00 123.74 ? 292 PRO C CG    1 
ATOM   6267 C CD    . PRO C 1 270 ? -31.938 -37.297 -12.332 1.00 123.83 ? 292 PRO C CD    1 
ATOM   6268 N N     . VAL C 1 271 ? -34.312 -33.305 -13.087 1.00 122.97 ? 293 VAL C N     1 
ATOM   6269 C CA    . VAL C 1 271 ? -34.310 -31.858 -12.869 1.00 122.75 ? 293 VAL C CA    1 
ATOM   6270 C C     . VAL C 1 271 ? -33.523 -31.544 -11.613 1.00 122.71 ? 293 VAL C C     1 
ATOM   6271 O O     . VAL C 1 271 ? -34.006 -31.787 -10.505 1.00 122.86 ? 293 VAL C O     1 
ATOM   6272 C CB    . VAL C 1 271 ? -35.751 -31.316 -12.683 1.00 122.73 ? 293 VAL C CB    1 
ATOM   6273 C CG1   . VAL C 1 271 ? -35.744 -29.796 -12.486 1.00 122.57 ? 293 VAL C CG1   1 
ATOM   6274 C CG2   . VAL C 1 271 ? -36.641 -31.714 -13.858 1.00 122.68 ? 293 VAL C CG2   1 
ATOM   6275 N N     . ASN C 1 272 ? -32.309 -31.028 -11.777 1.00 122.60 ? 294 ASN C N     1 
ATOM   6276 C CA    . ASN C 1 272 ? -31.473 -30.721 -10.613 1.00 122.73 ? 294 ASN C CA    1 
ATOM   6277 C C     . ASN C 1 272 ? -31.012 -29.270 -10.500 1.00 122.84 ? 294 ASN C C     1 
ATOM   6278 O O     . ASN C 1 272 ? -30.839 -28.577 -11.519 1.00 122.74 ? 294 ASN C O     1 
ATOM   6279 C CB    . ASN C 1 272 ? -30.298 -31.706 -10.473 1.00 122.63 ? 294 ASN C CB    1 
ATOM   6280 C CG    . ASN C 1 272 ? -29.260 -31.550 -11.569 1.00 122.45 ? 294 ASN C CG    1 
ATOM   6281 O OD1   . ASN C 1 272 ? -29.402 -32.103 -12.665 1.00 122.43 ? 294 ASN C OD1   1 
ATOM   6282 N ND2   . ASN C 1 272 ? -28.196 -30.815 -11.270 1.00 121.51 ? 294 ASN C ND2   1 
ATOM   6283 N N     . LEU C 1 273 ? -30.818 -28.830 -9.240  1.00 123.03 ? 295 LEU C N     1 
ATOM   6284 C CA    . LEU C 1 273 ? -30.588 -27.422 -8.921  1.00 123.21 ? 295 LEU C CA    1 
ATOM   6285 C C     . LEU C 1 273 ? -29.143 -26.989 -9.158  1.00 123.40 ? 295 LEU C C     1 
ATOM   6286 O O     . LEU C 1 273 ? -28.818 -25.798 -9.099  1.00 123.41 ? 295 LEU C O     1 
ATOM   6287 C CB    . LEU C 1 273 ? -30.949 -27.173 -7.452  1.00 123.18 ? 295 LEU C CB    1 
ATOM   6288 C CG    . LEU C 1 273 ? -32.363 -27.515 -6.973  1.00 123.28 ? 295 LEU C CG    1 
ATOM   6289 C CD1   . LEU C 1 273 ? -32.420 -27.787 -5.470  1.00 123.65 ? 295 LEU C CD1   1 
ATOM   6290 C CD2   . LEU C 1 273 ? -33.303 -26.390 -7.335  1.00 123.93 ? 295 LEU C CD2   1 
ATOM   6291 N N     . GLU C 1 274 ? -28.278 -27.959 -9.434  1.00 123.57 ? 296 GLU C N     1 
ATOM   6292 C CA    . GLU C 1 274 ? -26.841 -27.729 -9.359  1.00 123.95 ? 296 GLU C CA    1 
ATOM   6293 C C     . GLU C 1 274 ? -26.334 -26.631 -10.285 1.00 123.57 ? 296 GLU C C     1 
ATOM   6294 O O     . GLU C 1 274 ? -25.409 -25.896 -9.938  1.00 123.57 ? 296 GLU C O     1 
ATOM   6295 C CB    . GLU C 1 274 ? -26.070 -29.046 -9.545  1.00 124.33 ? 296 GLU C CB    1 
ATOM   6296 C CG    . GLU C 1 274 ? -26.333 -30.050 -8.394  1.00 126.40 ? 296 GLU C CG    1 
ATOM   6297 C CD    . GLU C 1 274 ? -25.365 -31.237 -8.350  1.00 128.92 ? 296 GLU C CD    1 
ATOM   6298 O OE1   . GLU C 1 274 ? -24.111 -31.001 -8.470  1.00 129.58 ? 296 GLU C OE1   1 
ATOM   6299 O OE2   . GLU C 1 274 ? -25.871 -32.414 -8.254  1.00 130.31 ? 296 GLU C OE2   1 
ATOM   6300 N N     . ALA C 1 275 ? -26.965 -26.497 -11.443 1.00 123.27 ? 297 ALA C N     1 
ATOM   6301 C CA    . ALA C 1 275 ? -26.477 -25.570 -12.450 1.00 123.16 ? 297 ALA C CA    1 
ATOM   6302 C C     . ALA C 1 275 ? -26.854 -24.114 -12.174 1.00 123.06 ? 297 ALA C C     1 
ATOM   6303 O O     . ALA C 1 275 ? -26.255 -23.195 -12.738 1.00 123.15 ? 297 ALA C O     1 
ATOM   6304 C CB    . ALA C 1 275 ? -26.947 -25.997 -13.828 1.00 123.06 ? 297 ALA C CB    1 
ATOM   6305 N N     . LEU C 1 276 ? -27.821 -23.914 -11.285 1.00 122.96 ? 298 LEU C N     1 
ATOM   6306 C CA    . LEU C 1 276 ? -28.480 -22.613 -11.114 1.00 122.99 ? 298 LEU C CA    1 
ATOM   6307 C C     . LEU C 1 276 ? -27.553 -21.401 -11.065 1.00 122.96 ? 298 LEU C C     1 
ATOM   6308 O O     . LEU C 1 276 ? -27.626 -20.508 -11.920 1.00 122.90 ? 298 LEU C O     1 
ATOM   6309 C CB    . LEU C 1 276 ? -29.382 -22.624 -9.859  1.00 123.02 ? 298 LEU C CB    1 
ATOM   6310 C CG    . LEU C 1 276 ? -30.602 -23.545 -9.917  1.00 123.04 ? 298 LEU C CG    1 
ATOM   6311 C CD1   . LEU C 1 276 ? -31.401 -23.439 -8.639  1.00 122.33 ? 298 LEU C CD1   1 
ATOM   6312 C CD2   . LEU C 1 276 ? -31.453 -23.226 -11.146 1.00 124.04 ? 298 LEU C CD2   1 
ATOM   6313 N N     . SER C 1 277 ? -26.682 -21.382 -10.063 1.00 123.02 ? 299 SER C N     1 
ATOM   6314 C CA    . SER C 1 277 ? -25.913 -20.183 -9.747  1.00 123.07 ? 299 SER C CA    1 
ATOM   6315 C C     . SER C 1 277 ? -24.395 -20.411 -9.718  1.00 122.95 ? 299 SER C C     1 
ATOM   6316 O O     . SER C 1 277 ? -23.654 -19.549 -9.243  1.00 123.11 ? 299 SER C O     1 
ATOM   6317 C CB    . SER C 1 277 ? -26.392 -19.582 -8.407  1.00 123.19 ? 299 SER C CB    1 
ATOM   6318 O OG    . SER C 1 277 ? -27.786 -19.287 -8.417  1.00 123.28 ? 299 SER C OG    1 
ATOM   6319 N N     . LYS C 1 278 ? -23.931 -21.550 -10.237 1.00 122.68 ? 300 LYS C N     1 
ATOM   6320 C CA    . LYS C 1 278 ? -22.504 -21.907 -10.155 1.00 122.29 ? 300 LYS C CA    1 
ATOM   6321 C C     . LYS C 1 278 ? -21.614 -20.884 -10.855 1.00 122.03 ? 300 LYS C C     1 
ATOM   6322 O O     . LYS C 1 278 ? -20.419 -20.786 -10.571 1.00 121.94 ? 300 LYS C O     1 
ATOM   6323 C CB    . LYS C 1 278 ? -22.256 -23.312 -10.707 1.00 122.27 ? 300 LYS C CB    1 
ATOM   6324 C CG    . LYS C 1 278 ? -22.556 -23.476 -12.176 1.00 122.04 ? 300 LYS C CG    1 
ATOM   6325 C CD    . LYS C 1 278 ? -22.417 -24.924 -12.570 1.00 122.22 ? 300 LYS C CD    1 
ATOM   6326 C CE    . LYS C 1 278 ? -22.400 -25.080 -14.085 1.00 122.52 ? 300 LYS C CE    1 
ATOM   6327 N NZ    . LYS C 1 278 ? -22.340 -26.529 -14.493 1.00 122.35 ? 300 LYS C NZ    1 
ATOM   6328 N N     . TRP C 1 279 ? -22.235 -20.122 -11.752 1.00 121.78 ? 301 TRP C N     1 
ATOM   6329 C CA    . TRP C 1 279 ? -21.588 -19.052 -12.492 1.00 121.61 ? 301 TRP C CA    1 
ATOM   6330 C C     . TRP C 1 279 ? -20.969 -17.971 -11.605 1.00 121.88 ? 301 TRP C C     1 
ATOM   6331 O O     . TRP C 1 279 ? -19.890 -17.468 -11.913 1.00 122.07 ? 301 TRP C O     1 
ATOM   6332 C CB    . TRP C 1 279 ? -22.594 -18.398 -13.450 1.00 121.39 ? 301 TRP C CB    1 
ATOM   6333 C CG    . TRP C 1 279 ? -23.702 -17.638 -12.749 1.00 120.21 ? 301 TRP C CG    1 
ATOM   6334 C CD1   . TRP C 1 279 ? -24.856 -18.163 -12.227 1.00 119.43 ? 301 TRP C CD1   1 
ATOM   6335 C CD2   . TRP C 1 279 ? -23.747 -16.221 -12.494 1.00 118.79 ? 301 TRP C CD2   1 
ATOM   6336 N NE1   . TRP C 1 279 ? -25.614 -17.169 -11.662 1.00 118.62 ? 301 TRP C NE1   1 
ATOM   6337 C CE2   . TRP C 1 279 ? -24.956 -15.968 -11.811 1.00 118.19 ? 301 TRP C CE2   1 
ATOM   6338 C CE3   . TRP C 1 279 ? -22.880 -15.146 -12.775 1.00 118.13 ? 301 TRP C CE3   1 
ATOM   6339 C CZ2   . TRP C 1 279 ? -25.327 -14.686 -11.411 1.00 117.54 ? 301 TRP C CZ2   1 
ATOM   6340 C CZ3   . TRP C 1 279 ? -23.248 -13.872 -12.373 1.00 117.44 ? 301 TRP C CZ3   1 
ATOM   6341 C CH2   . TRP C 1 279 ? -24.463 -13.654 -11.699 1.00 117.23 ? 301 TRP C CH2   1 
ATOM   6342 N N     . THR C 1 280 ? -21.647 -17.606 -10.519 1.00 122.13 ? 302 THR C N     1 
ATOM   6343 C CA    . THR C 1 280 ? -21.250 -16.427 -9.742  1.00 122.42 ? 302 THR C CA    1 
ATOM   6344 C C     . THR C 1 280 ? -19.881 -16.561 -9.073  1.00 122.52 ? 302 THR C C     1 
ATOM   6345 O O     . THR C 1 280 ? -19.528 -17.627 -8.554  1.00 122.50 ? 302 THR C O     1 
ATOM   6346 C CB    . THR C 1 280 ? -22.358 -15.931 -8.742  1.00 122.55 ? 302 THR C CB    1 
ATOM   6347 O OG1   . THR C 1 280 ? -21.837 -14.817 -7.931  1.00 122.47 ? 302 THR C OG1   1 
ATOM   6348 C CG2   . THR C 1 280 ? -22.854 -17.081 -7.803  1.00 122.59 ? 302 THR C CG2   1 
ATOM   6349 N N     . GLY C 1 281 ? -19.115 -15.472 -9.124  1.00 122.70 ? 303 GLY C N     1 
ATOM   6350 C CA    . GLY C 1 281 ? -17.767 -15.441 -8.579  1.00 122.92 ? 303 GLY C CA    1 
ATOM   6351 C C     . GLY C 1 281 ? -16.693 -15.555 -9.642  1.00 123.12 ? 303 GLY C C     1 
ATOM   6352 O O     . GLY C 1 281 ? -15.642 -14.871 -9.550  1.00 123.32 ? 303 GLY C O     1 
ATOM   6353 N N     . HIS C 1 282 ? -16.949 -16.412 -10.663 1.00 123.20 ? 304 HIS C N     1 
ATOM   6354 C CA    . HIS C 1 282 ? -15.929 -16.655 -11.667 1.00 123.30 ? 304 HIS C CA    1 
ATOM   6355 C C     . HIS C 1 282 ? -15.880 -15.521 -12.677 1.00 122.99 ? 304 HIS C C     1 
ATOM   6356 O O     . HIS C 1 282 ? -15.089 -15.554 -13.625 1.00 123.14 ? 304 HIS C O     1 
ATOM   6357 C CB    . HIS C 1 282 ? -16.185 -17.988 -12.362 1.00 123.70 ? 304 HIS C CB    1 
ATOM   6358 C CG    . HIS C 1 282 ? -16.322 -19.138 -11.416 1.00 125.28 ? 304 HIS C CG    1 
ATOM   6359 N ND1   . HIS C 1 282 ? -15.395 -20.169 -11.350 1.00 126.83 ? 304 HIS C ND1   1 
ATOM   6360 C CD2   . HIS C 1 282 ? -17.276 -19.418 -10.493 1.00 127.26 ? 304 HIS C CD2   1 
ATOM   6361 C CE1   . HIS C 1 282 ? -15.775 -21.039 -10.431 1.00 127.96 ? 304 HIS C CE1   1 
ATOM   6362 N NE2   . HIS C 1 282 ? -16.911 -20.605 -9.894  1.00 127.97 ? 304 HIS C NE2   1 
ATOM   6363 N N     . ILE C 1 283 ? -16.721 -14.513 -12.473 1.00 122.48 ? 305 ILE C N     1 
ATOM   6364 C CA    . ILE C 1 283 ? -16.793 -13.405 -13.409 1.00 122.01 ? 305 ILE C CA    1 
ATOM   6365 C C     . ILE C 1 283 ? -15.693 -12.395 -13.119 1.00 121.54 ? 305 ILE C C     1 
ATOM   6366 O O     . ILE C 1 283 ? -15.570 -11.923 -11.987 1.00 121.33 ? 305 ILE C O     1 
ATOM   6367 C CB    . ILE C 1 283 ? -18.170 -12.691 -13.389 1.00 122.08 ? 305 ILE C CB    1 
ATOM   6368 C CG1   . ILE C 1 283 ? -19.334 -13.701 -13.288 1.00 122.30 ? 305 ILE C CG1   1 
ATOM   6369 C CG2   . ILE C 1 283 ? -18.298 -11.736 -14.601 1.00 121.98 ? 305 ILE C CG2   1 
ATOM   6370 C CD1   . ILE C 1 283 ? -19.575 -14.602 -14.554 1.00 122.30 ? 305 ILE C CD1   1 
ATOM   6371 N N     . PRO C 1 284 ? -14.885 -12.071 -14.147 1.00 121.14 ? 306 PRO C N     1 
ATOM   6372 C CA    . PRO C 1 284 ? -13.953 -10.958 -14.057 1.00 120.83 ? 306 PRO C CA    1 
ATOM   6373 C C     . PRO C 1 284 ? -14.675 -9.715  -13.536 1.00 120.64 ? 306 PRO C C     1 
ATOM   6374 O O     . PRO C 1 284 ? -15.684 -9.294  -14.113 1.00 120.63 ? 306 PRO C O     1 
ATOM   6375 C CB    . PRO C 1 284 ? -13.535 -10.741 -15.513 1.00 120.80 ? 306 PRO C CB    1 
ATOM   6376 C CG    . PRO C 1 284 ? -13.677 -12.066 -16.152 1.00 120.93 ? 306 PRO C CG    1 
ATOM   6377 C CD    . PRO C 1 284 ? -14.824 -12.747 -15.466 1.00 121.22 ? 306 PRO C CD    1 
ATOM   6378 N N     . GLY C 1 285 ? -14.158 -9.155  -12.441 1.00 120.54 ? 307 GLY C N     1 
ATOM   6379 C CA    . GLY C 1 285 ? -14.732 -7.971  -11.789 1.00 120.37 ? 307 GLY C CA    1 
ATOM   6380 C C     . GLY C 1 285 ? -15.172 -6.832  -12.699 1.00 120.31 ? 307 GLY C C     1 
ATOM   6381 O O     . GLY C 1 285 ? -16.235 -6.253  -12.488 1.00 120.28 ? 307 GLY C O     1 
ATOM   6382 N N     . ASP C 1 286 ? -14.356 -6.511  -13.705 1.00 120.27 ? 308 ASP C N     1 
ATOM   6383 C CA    . ASP C 1 286 ? -14.636 -5.412  -14.633 1.00 120.32 ? 308 ASP C CA    1 
ATOM   6384 C C     . ASP C 1 286 ? -15.874 -5.691  -15.470 1.00 120.16 ? 308 ASP C C     1 
ATOM   6385 O O     . ASP C 1 286 ? -16.544 -4.759  -15.930 1.00 120.12 ? 308 ASP C O     1 
ATOM   6386 C CB    . ASP C 1 286 ? -13.453 -5.204  -15.578 1.00 120.66 ? 308 ASP C CB    1 
ATOM   6387 C CG    . ASP C 1 286 ? -13.308 -6.354  -16.576 1.00 121.67 ? 308 ASP C CG    1 
ATOM   6388 O OD1   . ASP C 1 286 ? -12.983 -7.485  -16.125 1.00 122.87 ? 308 ASP C OD1   1 
ATOM   6389 O OD2   . ASP C 1 286 ? -13.533 -6.133  -17.800 1.00 122.48 ? 308 ASP C OD2   1 
ATOM   6390 N N     . VAL C 1 287 ? -16.147 -6.978  -15.688 1.00 120.09 ? 309 VAL C N     1 
ATOM   6391 C CA    . VAL C 1 287 ? -17.349 -7.415  -16.397 1.00 120.11 ? 309 VAL C CA    1 
ATOM   6392 C C     . VAL C 1 287 ? -18.560 -7.349  -15.444 1.00 120.07 ? 309 VAL C C     1 
ATOM   6393 O O     . VAL C 1 287 ? -19.627 -6.869  -15.821 1.00 119.91 ? 309 VAL C O     1 
ATOM   6394 C CB    . VAL C 1 287 ? -17.157 -8.825  -17.056 1.00 120.08 ? 309 VAL C CB    1 
ATOM   6395 C CG1   . VAL C 1 287 ? -18.468 -9.354  -17.605 1.00 120.28 ? 309 VAL C CG1   1 
ATOM   6396 C CG2   . VAL C 1 287 ? -16.123 -8.755  -18.192 1.00 119.88 ? 309 VAL C CG2   1 
ATOM   6397 N N     . VAL C 1 288 ? -18.369 -7.800  -14.206 1.00 120.27 ? 310 VAL C N     1 
ATOM   6398 C CA    . VAL C 1 288 ? -19.361 -7.642  -13.135 1.00 120.61 ? 310 VAL C CA    1 
ATOM   6399 C C     . VAL C 1 288 ? -19.767 -6.165  -12.960 1.00 120.95 ? 310 VAL C C     1 
ATOM   6400 O O     . VAL C 1 288 ? -20.903 -5.842  -12.608 1.00 120.86 ? 310 VAL C O     1 
ATOM   6401 C CB    . VAL C 1 288 ? -18.803 -8.163  -11.778 1.00 120.55 ? 310 VAL C CB    1 
ATOM   6402 C CG1   . VAL C 1 288 ? -19.906 -8.286  -10.760 1.00 120.63 ? 310 VAL C CG1   1 
ATOM   6403 C CG2   . VAL C 1 288 ? -18.106 -9.503  -11.932 1.00 120.43 ? 310 VAL C CG2   1 
ATOM   6404 N N     . ARG C 1 289 ? -18.810 -5.287  -13.227 1.00 121.57 ? 311 ARG C N     1 
ATOM   6405 C CA    . ARG C 1 289 ? -18.914 -3.847  -13.015 1.00 122.12 ? 311 ARG C CA    1 
ATOM   6406 C C     . ARG C 1 289 ? -19.631 -3.115  -14.162 1.00 122.14 ? 311 ARG C C     1 
ATOM   6407 O O     . ARG C 1 289 ? -20.359 -2.130  -13.931 1.00 122.25 ? 311 ARG C O     1 
ATOM   6408 C CB    . ARG C 1 289 ? -17.488 -3.303  -12.848 1.00 122.43 ? 311 ARG C CB    1 
ATOM   6409 C CG    . ARG C 1 289 ? -17.337 -1.786  -12.812 1.00 123.19 ? 311 ARG C CG    1 
ATOM   6410 C CD    . ARG C 1 289 ? -15.944 -1.405  -13.326 1.00 123.98 ? 311 ARG C CD    1 
ATOM   6411 N NE    . ARG C 1 289 ? -15.890 -1.429  -14.796 1.00 124.67 ? 311 ARG C NE    1 
ATOM   6412 C CZ    . ARG C 1 289 ? -14.791 -1.665  -15.528 1.00 124.96 ? 311 ARG C CZ    1 
ATOM   6413 N NH1   . ARG C 1 289 ? -14.871 -1.652  -16.858 1.00 125.04 ? 311 ARG C NH1   1 
ATOM   6414 N NH2   . ARG C 1 289 ? -13.616 -1.918  -14.944 1.00 125.24 ? 311 ARG C NH2   1 
ATOM   6415 N N     . ASP C 1 290 ? -19.408 -3.591  -15.391 1.00 122.15 ? 312 ASP C N     1 
ATOM   6416 C CA    . ASP C 1 290 ? -20.015 -2.991  -16.588 1.00 122.30 ? 312 ASP C CA    1 
ATOM   6417 C C     . ASP C 1 290 ? -21.293 -3.744  -17.045 1.00 122.29 ? 312 ASP C C     1 
ATOM   6418 O O     . ASP C 1 290 ? -21.802 -3.539  -18.162 1.00 122.19 ? 312 ASP C O     1 
ATOM   6419 C CB    . ASP C 1 290 ? -18.974 -2.917  -17.727 1.00 122.45 ? 312 ASP C CB    1 
ATOM   6420 C CG    . ASP C 1 290 ? -17.670 -2.208  -17.308 1.00 122.53 ? 312 ASP C CG    1 
ATOM   6421 O OD1   . ASP C 1 290 ? -17.721 -1.354  -16.394 1.00 122.73 ? 312 ASP C OD1   1 
ATOM   6422 O OD2   . ASP C 1 290 ? -16.598 -2.504  -17.901 1.00 122.08 ? 312 ASP C OD2   1 
ATOM   6423 N N     . MET C 1 291 ? -21.814 -4.592  -16.154 1.00 122.25 ? 313 MET C N     1 
ATOM   6424 C CA    . MET C 1 291 ? -22.903 -5.520  -16.464 1.00 122.06 ? 313 MET C CA    1 
ATOM   6425 C C     . MET C 1 291 ? -24.036 -4.857  -17.230 1.00 122.20 ? 313 MET C C     1 
ATOM   6426 O O     . MET C 1 291 ? -24.449 -5.354  -18.285 1.00 122.20 ? 313 MET C O     1 
ATOM   6427 C CB    . MET C 1 291 ? -23.438 -6.181  -15.179 1.00 121.88 ? 313 MET C CB    1 
ATOM   6428 C CG    . MET C 1 291 ? -24.273 -7.439  -15.405 1.00 121.35 ? 313 MET C CG    1 
ATOM   6429 S SD    . MET C 1 291 ? -23.490 -8.632  -16.525 1.00 121.45 ? 313 MET C SD    1 
ATOM   6430 C CE    . MET C 1 291 ? -22.165 -9.272  -15.494 1.00 121.05 ? 313 MET C CE    1 
ATOM   6431 N N     . ALA C 1 292 ? -24.501 -3.721  -16.711 1.00 122.43 ? 314 ALA C N     1 
ATOM   6432 C CA    . ALA C 1 292 ? -25.704 -3.057  -17.217 1.00 122.77 ? 314 ALA C CA    1 
ATOM   6433 C C     . ALA C 1 292 ? -25.592 -2.547  -18.647 1.00 122.94 ? 314 ALA C C     1 
ATOM   6434 O O     . ALA C 1 292 ? -26.602 -2.397  -19.331 1.00 123.02 ? 314 ALA C O     1 
ATOM   6435 C CB    . ALA C 1 292 ? -26.125 -1.927  -16.286 1.00 122.78 ? 314 ALA C CB    1 
ATOM   6436 N N     . GLN C 1 293 ? -24.369 -2.272  -19.086 1.00 123.22 ? 315 GLN C N     1 
ATOM   6437 C CA    . GLN C 1 293 ? -24.120 -1.758  -20.433 1.00 123.61 ? 315 GLN C CA    1 
ATOM   6438 C C     . GLN C 1 293 ? -23.925 -2.928  -21.375 1.00 123.55 ? 315 GLN C C     1 
ATOM   6439 O O     . GLN C 1 293 ? -24.365 -2.887  -22.536 1.00 123.42 ? 315 GLN C O     1 
ATOM   6440 C CB    . GLN C 1 293 ? -22.874 -0.866  -20.460 1.00 123.79 ? 315 GLN C CB    1 
ATOM   6441 C CG    . GLN C 1 293 ? -22.962 0.349   -19.561 1.00 125.06 ? 315 GLN C CG    1 
ATOM   6442 C CD    . GLN C 1 293 ? -23.565 -0.009  -18.190 1.00 127.47 ? 315 GLN C CD    1 
ATOM   6443 O OE1   . GLN C 1 293 ? -24.773 0.197   -17.941 1.00 128.42 ? 315 GLN C OE1   1 
ATOM   6444 N NE2   . GLN C 1 293 ? -22.743 -0.596  -17.314 1.00 128.14 ? 315 GLN C NE2   1 
ATOM   6445 N N     . ILE C 1 294 ? -23.259 -3.966  -20.852 1.00 123.51 ? 316 ILE C N     1 
ATOM   6446 C CA    . ILE C 1 294 ? -22.983 -5.195  -21.597 1.00 123.35 ? 316 ILE C CA    1 
ATOM   6447 C C     . ILE C 1 294 ? -24.268 -5.954  -21.891 1.00 123.38 ? 316 ILE C C     1 
ATOM   6448 O O     . ILE C 1 294 ? -24.469 -6.420  -23.019 1.00 123.49 ? 316 ILE C O     1 
ATOM   6449 C CB    . ILE C 1 294 ? -22.004 -6.133  -20.850 1.00 123.26 ? 316 ILE C CB    1 
ATOM   6450 C CG1   . ILE C 1 294 ? -20.694 -5.396  -20.534 1.00 123.24 ? 316 ILE C CG1   1 
ATOM   6451 C CG2   . ILE C 1 294 ? -21.744 -7.396  -21.687 1.00 122.97 ? 316 ILE C CG2   1 
ATOM   6452 C CD1   . ILE C 1 294 ? -19.700 -6.181  -19.671 1.00 122.97 ? 316 ILE C CD1   1 
ATOM   6453 N N     . ALA C 1 295 ? -25.129 -6.068  -20.876 1.00 123.29 ? 317 ALA C N     1 
ATOM   6454 C CA    . ALA C 1 295 ? -26.397 -6.786  -21.007 1.00 123.17 ? 317 ALA C CA    1 
ATOM   6455 C C     . ALA C 1 295 ? -27.599 -6.020  -20.431 1.00 123.09 ? 317 ALA C C     1 
ATOM   6456 O O     . ALA C 1 295 ? -28.142 -6.416  -19.393 1.00 123.09 ? 317 ALA C O     1 
ATOM   6457 C CB    . ALA C 1 295 ? -26.282 -8.175  -20.373 1.00 123.17 ? 317 ALA C CB    1 
ATOM   6458 N N     . PRO C 1 296 ? -28.036 -4.930  -21.110 1.00 123.00 ? 318 PRO C N     1 
ATOM   6459 C CA    . PRO C 1 296 ? -29.224 -4.245  -20.604 1.00 122.95 ? 318 PRO C CA    1 
ATOM   6460 C C     . PRO C 1 296 ? -30.396 -5.210  -20.600 1.00 123.04 ? 318 PRO C C     1 
ATOM   6461 O O     . PRO C 1 296 ? -31.346 -5.023  -19.829 1.00 122.96 ? 318 PRO C O     1 
ATOM   6462 C CB    . PRO C 1 296 ? -29.458 -3.127  -21.631 1.00 122.87 ? 318 PRO C CB    1 
ATOM   6463 C CG    . PRO C 1 296 ? -28.754 -3.576  -22.874 1.00 122.84 ? 318 PRO C CG    1 
ATOM   6464 C CD    . PRO C 1 296 ? -27.556 -4.329  -22.375 1.00 122.98 ? 318 PRO C CD    1 
ATOM   6465 N N     . MET C 1 297 ? -30.295 -6.237  -21.455 1.00 123.25 ? 319 MET C N     1 
ATOM   6466 C CA    . MET C 1 297 ? -31.325 -7.271  -21.604 1.00 123.52 ? 319 MET C CA    1 
ATOM   6467 C C     . MET C 1 297 ? -31.598 -8.045  -20.314 1.00 123.55 ? 319 MET C C     1 
ATOM   6468 O O     . MET C 1 297 ? -32.757 -8.370  -20.013 1.00 123.73 ? 319 MET C O     1 
ATOM   6469 C CB    . MET C 1 297 ? -30.999 -8.247  -22.750 1.00 123.49 ? 319 MET C CB    1 
ATOM   6470 C CG    . MET C 1 297 ? -31.396 -7.756  -24.154 1.00 123.78 ? 319 MET C CG    1 
ATOM   6471 S SD    . MET C 1 297 ? -33.062 -7.032  -24.337 1.00 125.39 ? 319 MET C SD    1 
ATOM   6472 C CE    . MET C 1 297 ? -34.159 -8.457  -24.274 1.00 124.50 ? 319 MET C CE    1 
ATOM   6473 N N     . LEU C 1 298 ? -30.551 -8.338  -19.551 1.00 123.42 ? 320 LEU C N     1 
ATOM   6474 C CA    . LEU C 1 298 ? -30.760 -8.979  -18.262 1.00 123.48 ? 320 LEU C CA    1 
ATOM   6475 C C     . LEU C 1 298 ? -31.836 -8.211  -17.494 1.00 123.75 ? 320 LEU C C     1 
ATOM   6476 O O     . LEU C 1 298 ? -32.792 -8.813  -17.000 1.00 123.67 ? 320 LEU C O     1 
ATOM   6477 C CB    . LEU C 1 298 ? -29.451 -9.044  -17.461 1.00 123.36 ? 320 LEU C CB    1 
ATOM   6478 C CG    . LEU C 1 298 ? -28.397 -10.071 -17.909 1.00 122.65 ? 320 LEU C CG    1 
ATOM   6479 C CD1   . LEU C 1 298 ? -27.053 -9.793  -17.218 1.00 121.88 ? 320 LEU C CD1   1 
ATOM   6480 C CD2   . LEU C 1 298 ? -28.867 -11.505 -17.635 1.00 121.47 ? 320 LEU C CD2   1 
ATOM   6481 N N     . ALA C 1 299 ? -31.694 -6.881  -17.451 1.00 124.21 ? 321 ALA C N     1 
ATOM   6482 C CA    . ALA C 1 299 ? -32.625 -5.990  -16.748 1.00 124.79 ? 321 ALA C CA    1 
ATOM   6483 C C     . ALA C 1 299 ? -34.075 -6.147  -17.214 1.00 125.28 ? 321 ALA C C     1 
ATOM   6484 O O     . ALA C 1 299 ? -34.977 -6.358  -16.399 1.00 125.30 ? 321 ALA C O     1 
ATOM   6485 C CB    . ALA C 1 299 ? -32.174 -4.533  -16.880 1.00 124.65 ? 321 ALA C CB    1 
ATOM   6486 N N     . GLN C 1 300 ? -34.289 -6.057  -18.526 1.00 125.85 ? 322 GLN C N     1 
ATOM   6487 C CA    . GLN C 1 300 ? -35.632 -6.129  -19.102 1.00 126.44 ? 322 GLN C CA    1 
ATOM   6488 C C     . GLN C 1 300 ? -36.261 -7.516  -18.970 1.00 126.10 ? 322 GLN C C     1 
ATOM   6489 O O     . GLN C 1 300 ? -37.472 -7.625  -18.774 1.00 126.18 ? 322 GLN C O     1 
ATOM   6490 C CB    . GLN C 1 300 ? -35.613 -5.685  -20.568 1.00 126.85 ? 322 GLN C CB    1 
ATOM   6491 C CG    . GLN C 1 300 ? -35.033 -4.291  -20.778 1.00 129.64 ? 322 GLN C CG    1 
ATOM   6492 C CD    . GLN C 1 300 ? -35.476 -3.681  -22.092 1.00 133.51 ? 322 GLN C CD    1 
ATOM   6493 O OE1   . GLN C 1 300 ? -34.735 -3.713  -23.091 1.00 135.52 ? 322 GLN C OE1   1 
ATOM   6494 N NE2   . GLN C 1 300 ? -36.696 -3.129  -22.104 1.00 134.63 ? 322 GLN C NE2   1 
ATOM   6495 N N     . LEU C 1 301 ? -35.437 -8.565  -19.069 1.00 125.80 ? 323 LEU C N     1 
ATOM   6496 C CA    . LEU C 1 301 ? -35.908 -9.942  -18.912 1.00 125.52 ? 323 LEU C CA    1 
ATOM   6497 C C     . LEU C 1 301 ? -36.279 -10.258 -17.472 1.00 125.42 ? 323 LEU C C     1 
ATOM   6498 O O     . LEU C 1 301 ? -36.834 -11.321 -17.187 1.00 125.37 ? 323 LEU C O     1 
ATOM   6499 C CB    . LEU C 1 301 ? -34.854 -10.941 -19.396 1.00 125.53 ? 323 LEU C CB    1 
ATOM   6500 C CG    . LEU C 1 301 ? -34.652 -11.099 -20.904 1.00 125.35 ? 323 LEU C CG    1 
ATOM   6501 C CD1   . LEU C 1 301 ? -33.455 -11.985 -21.172 1.00 125.29 ? 323 LEU C CD1   1 
ATOM   6502 C CD2   . LEU C 1 301 ? -35.885 -11.687 -21.553 1.00 125.23 ? 323 LEU C CD2   1 
ATOM   6503 N N     . GLY C 1 302 ? -35.965 -9.334  -16.569 1.00 125.34 ? 324 GLY C N     1 
ATOM   6504 C CA    . GLY C 1 302 ? -36.249 -9.512  -15.149 1.00 125.29 ? 324 GLY C CA    1 
ATOM   6505 C C     . GLY C 1 302 ? -35.061 -10.049 -14.373 1.00 125.19 ? 324 GLY C C     1 
ATOM   6506 O O     . GLY C 1 302 ? -35.213 -10.539 -13.250 1.00 125.32 ? 324 GLY C O     1 
ATOM   6507 N N     . TYR C 1 303 ? -33.875 -9.964  -14.971 1.00 124.98 ? 325 TYR C N     1 
ATOM   6508 C CA    . TYR C 1 303 ? -32.658 -10.358 -14.287 1.00 124.81 ? 325 TYR C CA    1 
ATOM   6509 C C     . TYR C 1 303 ? -31.922 -9.126  -13.766 1.00 125.16 ? 325 TYR C C     1 
ATOM   6510 O O     . TYR C 1 303 ? -31.591 -8.228  -14.550 1.00 125.16 ? 325 TYR C O     1 
ATOM   6511 C CB    . TYR C 1 303 ? -31.770 -11.173 -15.222 1.00 124.45 ? 325 TYR C CB    1 
ATOM   6512 C CG    . TYR C 1 303 ? -32.371 -12.498 -15.599 1.00 123.18 ? 325 TYR C CG    1 
ATOM   6513 C CD1   . TYR C 1 303 ? -32.613 -13.482 -14.609 1.00 121.90 ? 325 TYR C CD1   1 
ATOM   6514 C CD2   . TYR C 1 303 ? -32.695 -12.773 -16.940 1.00 122.13 ? 325 TYR C CD2   1 
ATOM   6515 C CE1   . TYR C 1 303 ? -33.164 -14.708 -14.945 1.00 121.35 ? 325 TYR C CE1   1 
ATOM   6516 C CE2   . TYR C 1 303 ? -33.246 -13.997 -17.293 1.00 121.72 ? 325 TYR C CE2   1 
ATOM   6517 C CZ    . TYR C 1 303 ? -33.480 -14.961 -16.289 1.00 121.69 ? 325 TYR C CZ    1 
ATOM   6518 O OH    . TYR C 1 303 ? -34.028 -16.175 -16.634 1.00 121.54 ? 325 TYR C OH    1 
ATOM   6519 N N     . ASP C 1 304 ? -31.688 -9.088  -12.444 1.00 125.39 ? 326 ASP C N     1 
ATOM   6520 C CA    . ASP C 1 304 ? -30.953 -7.987  -11.789 1.00 125.53 ? 326 ASP C CA    1 
ATOM   6521 C C     . ASP C 1 304 ? -29.469 -8.056  -12.146 1.00 125.63 ? 326 ASP C C     1 
ATOM   6522 O O     . ASP C 1 304 ? -28.775 -8.997  -11.734 1.00 125.55 ? 326 ASP C O     1 
ATOM   6523 C CB    . ASP C 1 304 ? -31.148 -8.019  -10.261 1.00 125.48 ? 326 ASP C CB    1 
ATOM   6524 C CG    . ASP C 1 304 ? -30.622 -6.757  -9.551  1.00 125.38 ? 326 ASP C CG    1 
ATOM   6525 O OD1   . ASP C 1 304 ? -30.945 -6.594  -8.363  1.00 125.27 ? 326 ASP C OD1   1 
ATOM   6526 O OD2   . ASP C 1 304 ? -29.894 -5.933  -10.147 1.00 125.59 ? 326 ASP C OD2   1 
ATOM   6527 N N     . PRO C 1 305 ? -28.977 -7.056  -12.915 1.00 125.80 ? 327 PRO C N     1 
ATOM   6528 C CA    . PRO C 1 305 ? -27.584 -7.100  -13.367 1.00 126.02 ? 327 PRO C CA    1 
ATOM   6529 C C     . PRO C 1 305 ? -26.630 -6.912  -12.198 1.00 126.28 ? 327 PRO C C     1 
ATOM   6530 O O     . PRO C 1 305 ? -25.486 -7.369  -12.253 1.00 126.41 ? 327 PRO C O     1 
ATOM   6531 C CB    . PRO C 1 305 ? -27.485 -5.915  -14.334 1.00 125.95 ? 327 PRO C CB    1 
ATOM   6532 C CG    . PRO C 1 305 ? -28.545 -4.962  -13.878 1.00 125.90 ? 327 PRO C CG    1 
ATOM   6533 C CD    . PRO C 1 305 ? -29.657 -5.808  -13.326 1.00 125.74 ? 327 PRO C CD    1 
ATOM   6534 N N     . TYR C 1 306 ? -27.127 -6.265  -11.144 1.00 126.56 ? 328 TYR C N     1 
ATOM   6535 C CA    . TYR C 1 306 ? -26.317 -5.867  -10.003 1.00 126.96 ? 328 TYR C CA    1 
ATOM   6536 C C     . TYR C 1 306 ? -26.393 -6.828  -8.816  1.00 126.83 ? 328 TYR C C     1 
ATOM   6537 O O     . TYR C 1 306 ? -25.612 -6.721  -7.871  1.00 126.89 ? 328 TYR C O     1 
ATOM   6538 C CB    . TYR C 1 306 ? -26.656 -4.419  -9.605  1.00 127.22 ? 328 TYR C CB    1 
ATOM   6539 C CG    . TYR C 1 306 ? -26.204 -3.415  -10.648 1.00 128.99 ? 328 TYR C CG    1 
ATOM   6540 C CD1   . TYR C 1 306 ? -24.983 -3.601  -11.324 1.00 131.16 ? 328 TYR C CD1   1 
ATOM   6541 C CD2   . TYR C 1 306 ? -26.978 -2.283  -10.962 1.00 130.35 ? 328 TYR C CD2   1 
ATOM   6542 C CE1   . TYR C 1 306 ? -24.543 -2.698  -12.293 1.00 132.31 ? 328 TYR C CE1   1 
ATOM   6543 C CE2   . TYR C 1 306 ? -26.542 -1.360  -11.934 1.00 131.69 ? 328 TYR C CE2   1 
ATOM   6544 C CZ    . TYR C 1 306 ? -25.321 -1.580  -12.594 1.00 132.56 ? 328 TYR C CZ    1 
ATOM   6545 O OH    . TYR C 1 306 ? -24.858 -0.701  -13.556 1.00 133.40 ? 328 TYR C OH    1 
ATOM   6546 N N     . ALA C 1 307 ? -27.316 -7.782  -8.879  1.00 126.73 ? 329 ALA C N     1 
ATOM   6547 C CA    . ALA C 1 307 ? -27.355 -8.869  -7.908  1.00 126.58 ? 329 ALA C CA    1 
ATOM   6548 C C     . ALA C 1 307 ? -26.471 -10.018 -8.403  1.00 126.60 ? 329 ALA C C     1 
ATOM   6549 O O     . ALA C 1 307 ? -26.583 -10.444 -9.560  1.00 126.58 ? 329 ALA C O     1 
ATOM   6550 C CB    . ALA C 1 307 ? -28.781 -9.332  -7.696  1.00 126.49 ? 329 ALA C CB    1 
ATOM   6551 N N     . ASN C 1 308 ? -25.591 -10.507 -7.529  1.00 126.64 ? 330 ASN C N     1 
ATOM   6552 C CA    . ASN C 1 308 ? -24.597 -11.523 -7.902  1.00 126.80 ? 330 ASN C CA    1 
ATOM   6553 C C     . ASN C 1 308 ? -24.562 -12.759 -6.991  1.00 126.68 ? 330 ASN C C     1 
ATOM   6554 O O     . ASN C 1 308 ? -23.661 -12.867 -6.161  1.00 126.88 ? 330 ASN C O     1 
ATOM   6555 C CB    . ASN C 1 308 ? -23.194 -10.899 -7.941  1.00 126.80 ? 330 ASN C CB    1 
ATOM   6556 C CG    . ASN C 1 308 ? -22.888 -10.222 -9.260  1.00 127.69 ? 330 ASN C CG    1 
ATOM   6557 O OD1   . ASN C 1 308 ? -22.066 -10.708 -10.042 1.00 128.97 ? 330 ASN C OD1   1 
ATOM   6558 N ND2   . ASN C 1 308 ? -23.545 -9.094  -9.520  1.00 128.49 ? 330 ASN C ND2   1 
ATOM   6559 N N     . PRO C 1 309 ? -25.513 -13.711 -7.154  1.00 126.45 ? 331 PRO C N     1 
ATOM   6560 C CA    . PRO C 1 309 ? -26.582 -13.762 -8.141  1.00 126.19 ? 331 PRO C CA    1 
ATOM   6561 C C     . PRO C 1 309 ? -27.785 -12.957 -7.671  1.00 125.91 ? 331 PRO C C     1 
ATOM   6562 O O     . PRO C 1 309 ? -27.744 -12.397 -6.575  1.00 125.94 ? 331 PRO C O     1 
ATOM   6563 C CB    . PRO C 1 309 ? -26.940 -15.250 -8.160  1.00 126.22 ? 331 PRO C CB    1 
ATOM   6564 C CG    . PRO C 1 309 ? -26.759 -15.682 -6.750  1.00 126.23 ? 331 PRO C CG    1 
ATOM   6565 C CD    . PRO C 1 309 ? -25.596 -14.859 -6.224  1.00 126.41 ? 331 PRO C CD    1 
ATOM   6566 N N     . PRO C 1 310 ? -28.838 -12.866 -8.505  1.00 125.63 ? 332 PRO C N     1 
ATOM   6567 C CA    . PRO C 1 310 ? -30.137 -12.480 -7.956  1.00 125.37 ? 332 PRO C CA    1 
ATOM   6568 C C     . PRO C 1 310 ? -30.691 -13.607 -7.078  1.00 125.05 ? 332 PRO C C     1 
ATOM   6569 O O     . PRO C 1 310 ? -30.057 -14.669 -6.967  1.00 125.02 ? 332 PRO C O     1 
ATOM   6570 C CB    . PRO C 1 310 ? -31.006 -12.297 -9.211  1.00 125.46 ? 332 PRO C CB    1 
ATOM   6571 C CG    . PRO C 1 310 ? -30.038 -12.033 -10.324 1.00 125.40 ? 332 PRO C CG    1 
ATOM   6572 C CD    . PRO C 1 310 ? -28.846 -12.874 -9.982  1.00 125.64 ? 332 PRO C CD    1 
ATOM   6573 N N     . ASN C 1 311 ? -31.845 -13.374 -6.444  1.00 124.63 ? 333 ASN C N     1 
ATOM   6574 C CA    . ASN C 1 311 ? -32.538 -14.447 -5.735  1.00 124.27 ? 333 ASN C CA    1 
ATOM   6575 C C     . ASN C 1 311 ? -33.627 -15.030 -6.617  1.00 124.18 ? 333 ASN C C     1 
ATOM   6576 O O     . ASN C 1 311 ? -34.727 -14.477 -6.719  1.00 124.09 ? 333 ASN C O     1 
ATOM   6577 C CB    . ASN C 1 311 ? -33.120 -13.976 -4.399  1.00 124.14 ? 333 ASN C CB    1 
ATOM   6578 C CG    . ASN C 1 311 ? -33.806 -15.100 -3.630  1.00 123.72 ? 333 ASN C CG    1 
ATOM   6579 O OD1   . ASN C 1 311 ? -34.657 -14.847 -2.784  1.00 123.56 ? 333 ASN C OD1   1 
ATOM   6580 N ND2   . ASN C 1 311 ? -33.435 -16.345 -3.924  1.00 123.07 ? 333 ASN C ND2   1 
ATOM   6581 N N     . TYR C 1 312 ? -33.303 -16.156 -7.249  1.00 124.14 ? 334 TYR C N     1 
ATOM   6582 C CA    . TYR C 1 312 ? -34.187 -16.780 -8.231  1.00 124.06 ? 334 TYR C CA    1 
ATOM   6583 C C     . TYR C 1 312 ? -35.512 -17.278 -7.625  1.00 124.01 ? 334 TYR C C     1 
ATOM   6584 O O     . TYR C 1 312 ? -36.534 -17.264 -8.299  1.00 123.89 ? 334 TYR C O     1 
ATOM   6585 C CB    . TYR C 1 312 ? -33.476 -17.916 -9.007  1.00 124.07 ? 334 TYR C CB    1 
ATOM   6586 C CG    . TYR C 1 312 ? -32.230 -17.549 -9.837  1.00 123.77 ? 334 TYR C CG    1 
ATOM   6587 C CD1   . TYR C 1 312 ? -32.212 -16.423 -10.675 1.00 123.46 ? 334 TYR C CD1   1 
ATOM   6588 C CD2   . TYR C 1 312 ? -31.084 -18.374 -9.814  1.00 123.80 ? 334 TYR C CD2   1 
ATOM   6589 C CE1   . TYR C 1 312 ? -31.071 -16.110 -11.438 1.00 123.66 ? 334 TYR C CE1   1 
ATOM   6590 C CE2   . TYR C 1 312 ? -29.943 -18.070 -10.569 1.00 123.43 ? 334 TYR C CE2   1 
ATOM   6591 C CZ    . TYR C 1 312 ? -29.943 -16.941 -11.377 1.00 123.58 ? 334 TYR C CZ    1 
ATOM   6592 O OH    . TYR C 1 312 ? -28.819 -16.648 -12.123 1.00 123.49 ? 334 TYR C OH    1 
ATOM   6593 N N     . GLY C 1 313 ? -35.493 -17.709 -6.361  1.00 124.12 ? 335 GLY C N     1 
ATOM   6594 C CA    . GLY C 1 313 ? -36.693 -18.253 -5.723  1.00 124.37 ? 335 GLY C CA    1 
ATOM   6595 C C     . GLY C 1 313 ? -36.395 -19.476 -4.880  1.00 124.65 ? 335 GLY C C     1 
ATOM   6596 O O     . GLY C 1 313 ? -35.255 -19.648 -4.424  1.00 124.82 ? 335 GLY C O     1 
ATOM   6597 N N     . ASN C 1 314 ? -37.411 -20.337 -4.684  1.00 124.84 ? 336 ASN C N     1 
ATOM   6598 C CA    . ASN C 1 314 ? -37.274 -21.457 -3.748  1.00 125.20 ? 336 ASN C CA    1 
ATOM   6599 C C     . ASN C 1 314 ? -37.671 -22.807 -4.338  1.00 125.12 ? 336 ASN C C     1 
ATOM   6600 O O     . ASN C 1 314 ? -38.729 -22.916 -4.952  1.00 125.03 ? 336 ASN C O     1 
ATOM   6601 C CB    . ASN C 1 314 ? -38.062 -21.171 -2.459  1.00 125.41 ? 336 ASN C CB    1 
ATOM   6602 C CG    . ASN C 1 314 ? -37.457 -20.030 -1.643  1.00 126.17 ? 336 ASN C CG    1 
ATOM   6603 O OD1   . ASN C 1 314 ? -36.233 -19.967 -1.442  1.00 127.26 ? 336 ASN C OD1   1 
ATOM   6604 N ND2   . ASN C 1 314 ? -38.314 -19.126 -1.166  1.00 126.52 ? 336 ASN C ND2   1 
ATOM   6605 N N     . PRO C 1 315 ? -36.825 -23.844 -4.134  1.00 125.25 ? 337 PRO C N     1 
ATOM   6606 C CA    . PRO C 1 315 ? -37.034 -25.120 -4.807  1.00 125.39 ? 337 PRO C CA    1 
ATOM   6607 C C     . PRO C 1 315 ? -38.175 -25.910 -4.220  1.00 125.54 ? 337 PRO C C     1 
ATOM   6608 O O     . PRO C 1 315 ? -38.402 -25.860 -3.015  1.00 125.39 ? 337 PRO C O     1 
ATOM   6609 C CB    . PRO C 1 315 ? -35.719 -25.868 -4.562  1.00 125.47 ? 337 PRO C CB    1 
ATOM   6610 C CG    . PRO C 1 315 ? -35.201 -25.315 -3.293  1.00 125.43 ? 337 PRO C CG    1 
ATOM   6611 C CD    . PRO C 1 315 ? -35.620 -23.878 -3.253  1.00 125.35 ? 337 PRO C CD    1 
ATOM   6612 N N     . ASP C 1 316 ? -38.886 -26.622 -5.091  1.00 125.91 ? 338 ASP C N     1 
ATOM   6613 C CA    . ASP C 1 316 ? -39.880 -27.609 -4.682  1.00 126.25 ? 338 ASP C CA    1 
ATOM   6614 C C     . ASP C 1 316 ? -39.116 -28.746 -4.025  1.00 126.39 ? 338 ASP C C     1 
ATOM   6615 O O     . ASP C 1 316 ? -38.002 -29.063 -4.468  1.00 126.36 ? 338 ASP C O     1 
ATOM   6616 C CB    . ASP C 1 316 ? -40.651 -28.177 -5.889  1.00 126.33 ? 338 ASP C CB    1 
ATOM   6617 C CG    . ASP C 1 316 ? -41.703 -27.219 -6.449  1.00 126.61 ? 338 ASP C CG    1 
ATOM   6618 O OD1   . ASP C 1 316 ? -42.059 -26.225 -5.782  1.00 127.10 ? 338 ASP C OD1   1 
ATOM   6619 O OD2   . ASP C 1 316 ? -42.184 -27.473 -7.576  1.00 126.94 ? 338 ASP C OD2   1 
ATOM   6620 N N     . PRO C 1 317 ? -39.703 -29.362 -2.971  1.00 126.55 ? 339 PRO C N     1 
ATOM   6621 C CA    . PRO C 1 317 ? -39.122 -30.565 -2.348  1.00 126.53 ? 339 PRO C CA    1 
ATOM   6622 C C     . PRO C 1 317 ? -38.848 -31.683 -3.370  1.00 126.53 ? 339 PRO C C     1 
ATOM   6623 O O     . PRO C 1 317 ? -37.971 -32.536 -3.130  1.00 126.52 ? 339 PRO C O     1 
ATOM   6624 C CB    . PRO C 1 317 ? -40.202 -31.001 -1.345  1.00 126.58 ? 339 PRO C CB    1 
ATOM   6625 C CG    . PRO C 1 317 ? -40.930 -29.740 -1.000  1.00 126.57 ? 339 PRO C CG    1 
ATOM   6626 C CD    . PRO C 1 317 ? -40.919 -28.907 -2.260  1.00 126.56 ? 339 PRO C CD    1 
ATOM   6627 N N     . PHE C 1 318 ? -39.588 -31.661 -4.493  1.00 126.49 ? 340 PHE C N     1 
ATOM   6628 C CA    . PHE C 1 318 ? -39.364 -32.582 -5.616  1.00 126.51 ? 340 PHE C CA    1 
ATOM   6629 C C     . PHE C 1 318 ? -37.988 -32.384 -6.273  1.00 126.38 ? 340 PHE C C     1 
ATOM   6630 O O     . PHE C 1 318 ? -37.320 -33.364 -6.640  1.00 126.42 ? 340 PHE C O     1 
ATOM   6631 C CB    . PHE C 1 318 ? -40.493 -32.435 -6.655  1.00 126.62 ? 340 PHE C CB    1 
ATOM   6632 C CG    . PHE C 1 318 ? -40.291 -33.245 -7.917  1.00 127.12 ? 340 PHE C CG    1 
ATOM   6633 C CD1   . PHE C 1 318 ? -40.290 -32.606 -9.173  1.00 127.53 ? 340 PHE C CD1   1 
ATOM   6634 C CD2   . PHE C 1 318 ? -40.117 -34.642 -7.854  1.00 127.73 ? 340 PHE C CD2   1 
ATOM   6635 C CE1   . PHE C 1 318 ? -40.115 -33.340 -10.354 1.00 127.87 ? 340 PHE C CE1   1 
ATOM   6636 C CE2   . PHE C 1 318 ? -39.935 -35.389 -9.026  1.00 128.18 ? 340 PHE C CE2   1 
ATOM   6637 C CZ    . PHE C 1 318 ? -39.934 -34.735 -10.280 1.00 128.09 ? 340 PHE C CZ    1 
ATOM   6638 N N     . VAL C 1 319 ? -37.568 -31.125 -6.405  1.00 126.14 ? 341 VAL C N     1 
ATOM   6639 C CA    . VAL C 1 319 ? -36.290 -30.805 -7.042  1.00 125.96 ? 341 VAL C CA    1 
ATOM   6640 C C     . VAL C 1 319 ? -35.105 -31.003 -6.090  1.00 125.89 ? 341 VAL C C     1 
ATOM   6641 O O     . VAL C 1 319 ? -34.030 -31.449 -6.510  1.00 125.95 ? 341 VAL C O     1 
ATOM   6642 C CB    . VAL C 1 319 ? -36.267 -29.370 -7.578  1.00 125.90 ? 341 VAL C CB    1 
ATOM   6643 C CG1   . VAL C 1 319 ? -35.340 -29.288 -8.772  1.00 126.11 ? 341 VAL C CG1   1 
ATOM   6644 C CG2   . VAL C 1 319 ? -37.644 -28.950 -7.985  1.00 125.96 ? 341 VAL C CG2   1 
ATOM   6645 N N     . ILE C 1 320 ? -35.306 -30.651 -4.820  1.00 125.65 ? 342 ILE C N     1 
ATOM   6646 C CA    . ILE C 1 320 ? -34.314 -30.871 -3.774  1.00 125.42 ? 342 ILE C CA    1 
ATOM   6647 C C     . ILE C 1 320 ? -33.984 -32.366 -3.655  1.00 125.55 ? 342 ILE C C     1 
ATOM   6648 O O     . ILE C 1 320 ? -32.815 -32.747 -3.708  1.00 125.63 ? 342 ILE C O     1 
ATOM   6649 C CB    . ILE C 1 320 ? -34.801 -30.322 -2.415  1.00 125.31 ? 342 ILE C CB    1 
ATOM   6650 C CG1   . ILE C 1 320 ? -35.100 -28.824 -2.509  1.00 124.97 ? 342 ILE C CG1   1 
ATOM   6651 C CG2   . ILE C 1 320 ? -33.769 -30.582 -1.332  1.00 125.49 ? 342 ILE C CG2   1 
ATOM   6652 C CD1   . ILE C 1 320 ? -36.029 -28.308 -1.419  1.00 124.38 ? 342 ILE C CD1   1 
ATOM   6653 N N     . ASN C 1 321 ? -35.016 -33.201 -3.518  1.00 125.70 ? 343 ASN C N     1 
ATOM   6654 C CA    . ASN C 1 321 ? -34.863 -34.665 -3.412  1.00 125.92 ? 343 ASN C CA    1 
ATOM   6655 C C     . ASN C 1 321 ? -34.220 -35.320 -4.635  1.00 125.66 ? 343 ASN C C     1 
ATOM   6656 O O     . ASN C 1 321 ? -33.520 -36.335 -4.514  1.00 125.63 ? 343 ASN C O     1 
ATOM   6657 C CB    . ASN C 1 321 ? -36.212 -35.336 -3.122  1.00 126.25 ? 343 ASN C CB    1 
ATOM   6658 C CG    . ASN C 1 321 ? -36.677 -35.137 -1.681  1.00 127.32 ? 343 ASN C CG    1 
ATOM   6659 O OD1   . ASN C 1 321 ? -35.922 -34.659 -0.826  1.00 128.69 ? 343 ASN C OD1   1 
ATOM   6660 N ND2   . ASN C 1 321 ? -37.927 -35.512 -1.407  1.00 128.29 ? 343 ASN C ND2   1 
ATOM   6661 N N     . ASN C 1 322 ? -34.481 -34.747 -5.810  1.00 125.37 ? 344 ASN C N     1 
ATOM   6662 C CA    . ASN C 1 322 ? -33.759 -35.117 -7.020  1.00 125.09 ? 344 ASN C CA    1 
ATOM   6663 C C     . ASN C 1 322 ? -32.275 -34.789 -6.876  1.00 124.99 ? 344 ASN C C     1 
ATOM   6664 O O     . ASN C 1 322 ? -31.427 -35.676 -7.043  1.00 125.07 ? 344 ASN C O     1 
ATOM   6665 C CB    . ASN C 1 322 ? -34.342 -34.414 -8.247  1.00 124.92 ? 344 ASN C CB    1 
ATOM   6666 C CG    . ASN C 1 322 ? -35.729 -34.887 -8.579  1.00 124.60 ? 344 ASN C CG    1 
ATOM   6667 O OD1   . ASN C 1 322 ? -36.214 -35.887 -8.044  1.00 124.29 ? 344 ASN C OD1   1 
ATOM   6668 N ND2   . ASN C 1 322 ? -36.388 -34.161 -9.465  1.00 125.12 ? 344 ASN C ND2   1 
ATOM   6669 N N     . THR C 1 323 ? -31.980 -33.524 -6.540  1.00 124.78 ? 345 THR C N     1 
ATOM   6670 C CA    . THR C 1 323 ? -30.603 -33.035 -6.383  1.00 124.63 ? 345 THR C CA    1 
ATOM   6671 C C     . THR C 1 323 ? -29.790 -33.975 -5.496  1.00 124.79 ? 345 THR C C     1 
ATOM   6672 O O     . THR C 1 323 ? -28.605 -34.230 -5.760  1.00 124.66 ? 345 THR C O     1 
ATOM   6673 C CB    . THR C 1 323 ? -30.570 -31.596 -5.810  1.00 124.51 ? 345 THR C CB    1 
ATOM   6674 O OG1   . THR C 1 323 ? -31.484 -30.767 -6.545  1.00 123.85 ? 345 THR C OG1   1 
ATOM   6675 C CG2   . THR C 1 323 ? -29.158 -31.005 -5.897  1.00 124.30 ? 345 THR C CG2   1 
ATOM   6676 N N     . GLN C 1 324 ? -30.466 -34.502 -4.468  1.00 125.06 ? 346 GLN C N     1 
ATOM   6677 C CA    . GLN C 1 324 ? -29.901 -35.480 -3.541  1.00 125.49 ? 346 GLN C CA    1 
ATOM   6678 C C     . GLN C 1 324 ? -29.575 -36.825 -4.207  1.00 125.74 ? 346 GLN C C     1 
ATOM   6679 O O     . GLN C 1 324 ? -28.439 -37.305 -4.107  1.00 125.78 ? 346 GLN C O     1 
ATOM   6680 C CB    . GLN C 1 324 ? -30.844 -35.698 -2.338  1.00 125.48 ? 346 GLN C CB    1 
ATOM   6681 C CG    . GLN C 1 324 ? -30.977 -34.500 -1.378  1.00 125.68 ? 346 GLN C CG    1 
ATOM   6682 C CD    . GLN C 1 324 ? -29.655 -34.105 -0.717  1.00 126.34 ? 346 GLN C CD    1 
ATOM   6683 O OE1   . GLN C 1 324 ? -28.904 -34.959 -0.226  1.00 126.52 ? 346 GLN C OE1   1 
ATOM   6684 N NE2   . GLN C 1 324 ? -29.367 -32.801 -0.703  1.00 126.69 ? 346 GLN C NE2   1 
ATOM   6685 N N     . ARG C 1 325 ? -30.564 -37.427 -4.877  1.00 126.09 ? 347 ARG C N     1 
ATOM   6686 C CA    . ARG C 1 325 ? -30.375 -38.718 -5.548  1.00 126.55 ? 347 ARG C CA    1 
ATOM   6687 C C     . ARG C 1 325 ? -29.175 -38.663 -6.474  1.00 126.78 ? 347 ARG C C     1 
ATOM   6688 O O     . ARG C 1 325 ? -28.440 -39.643 -6.619  1.00 126.64 ? 347 ARG C O     1 
ATOM   6689 C CB    . ARG C 1 325 ? -31.608 -39.097 -6.366  1.00 126.57 ? 347 ARG C CB    1 
ATOM   6690 C CG    . ARG C 1 325 ? -32.800 -39.557 -5.555  1.00 127.41 ? 347 ARG C CG    1 
ATOM   6691 C CD    . ARG C 1 325 ? -33.742 -40.391 -6.419  1.00 129.10 ? 347 ARG C CD    1 
ATOM   6692 N NE    . ARG C 1 325 ? -34.001 -39.770 -7.727  1.00 130.25 ? 347 ARG C NE    1 
ATOM   6693 C CZ    . ARG C 1 325 ? -35.020 -38.946 -7.984  1.00 131.04 ? 347 ARG C CZ    1 
ATOM   6694 N NH1   . ARG C 1 325 ? -35.902 -38.625 -7.025  1.00 131.42 ? 347 ARG C NH1   1 
ATOM   6695 N NH2   . ARG C 1 325 ? -35.159 -38.438 -9.210  1.00 131.21 ? 347 ARG C NH2   1 
ATOM   6696 N N     . VAL C 1 326 ? -29.000 -37.496 -7.092  1.00 127.33 ? 348 VAL C N     1 
ATOM   6697 C CA    . VAL C 1 326 ? -27.924 -37.226 -8.046  1.00 127.96 ? 348 VAL C CA    1 
ATOM   6698 C C     . VAL C 1 326 ? -26.555 -37.145 -7.352  1.00 128.42 ? 348 VAL C C     1 
ATOM   6699 O O     . VAL C 1 326 ? -25.562 -37.679 -7.861  1.00 128.25 ? 348 VAL C O     1 
ATOM   6700 C CB    . VAL C 1 326 ? -28.227 -35.931 -8.874  1.00 127.95 ? 348 VAL C CB    1 
ATOM   6701 C CG1   . VAL C 1 326 ? -26.948 -35.345 -9.482  1.00 127.95 ? 348 VAL C CG1   1 
ATOM   6702 C CG2   . VAL C 1 326 ? -29.277 -36.227 -9.977  1.00 127.71 ? 348 VAL C CG2   1 
ATOM   6703 N N     . LEU C 1 327 ? -26.515 -36.487 -6.193  1.00 129.19 ? 349 LEU C N     1 
ATOM   6704 C CA    . LEU C 1 327 ? -25.290 -36.397 -5.391  1.00 130.03 ? 349 LEU C CA    1 
ATOM   6705 C C     . LEU C 1 327 ? -24.928 -37.732 -4.726  1.00 131.22 ? 349 LEU C C     1 
ATOM   6706 O O     . LEU C 1 327 ? -23.800 -37.894 -4.207  1.00 131.16 ? 349 LEU C O     1 
ATOM   6707 C CB    . LEU C 1 327 ? -25.395 -35.275 -4.350  1.00 129.49 ? 349 LEU C CB    1 
ATOM   6708 C CG    . LEU C 1 327 ? -25.655 -33.870 -4.910  1.00 128.47 ? 349 LEU C CG    1 
ATOM   6709 C CD1   . LEU C 1 327 ? -26.284 -32.976 -3.844  1.00 127.31 ? 349 LEU C CD1   1 
ATOM   6710 C CD2   . LEU C 1 327 ? -24.384 -33.252 -5.481  1.00 126.93 ? 349 LEU C CD2   1 
ATOM   6711 N N     . LYS C 1 328 ? -25.882 -38.682 -4.752  1.00 132.97 ? 350 LYS C N     1 
ATOM   6712 C CA    . LYS C 1 328 ? -25.630 -40.054 -4.285  1.00 134.69 ? 350 LYS C CA    1 
ATOM   6713 C C     . LYS C 1 328 ? -25.183 -40.984 -5.421  1.00 135.75 ? 350 LYS C C     1 
ATOM   6714 O O     . LYS C 1 328 ? -24.588 -42.043 -5.162  1.00 135.93 ? 350 LYS C O     1 
ATOM   6715 C CB    . LYS C 1 328 ? -26.863 -40.627 -3.573  1.00 134.74 ? 350 LYS C CB    1 
ATOM   6716 C CG    . LYS C 1 328 ? -27.029 -40.120 -2.162  1.00 135.15 ? 350 LYS C CG    1 
ATOM   6717 C CD    . LYS C 1 328 ? -28.487 -40.044 -1.806  1.00 136.20 ? 350 LYS C CD    1 
ATOM   6718 C CE    . LYS C 1 328 ? -28.706 -38.989 -0.747  1.00 136.96 ? 350 LYS C CE    1 
ATOM   6719 N NZ    . LYS C 1 328 ? -30.097 -39.066 -0.228  1.00 137.91 ? 350 LYS C NZ    1 
ATOM   6720 N N     . GLY C 1 329 ? -25.481 -40.589 -6.669  1.00 136.93 ? 351 GLY C N     1 
ATOM   6721 C CA    . GLY C 1 329 ? -25.015 -41.314 -7.857  1.00 138.37 ? 351 GLY C CA    1 
ATOM   6722 C C     . GLY C 1 329 ? -26.040 -42.236 -8.498  1.00 139.39 ? 351 GLY C C     1 
ATOM   6723 O O     . GLY C 1 329 ? -25.698 -43.337 -8.945  1.00 139.47 ? 351 GLY C O     1 
ATOM   6724 N N     . ASP C 1 330 ? -27.293 -41.781 -8.549  1.00 140.29 ? 352 ASP C N     1 
ATOM   6725 C CA    . ASP C 1 330 ? -28.378 -42.557 -9.141  1.00 141.16 ? 352 ASP C CA    1 
ATOM   6726 C C     . ASP C 1 330 ? -28.391 -42.426 -10.664 1.00 141.27 ? 352 ASP C C     1 
ATOM   6727 O O     . ASP C 1 330 ? -28.381 -43.468 -11.374 1.00 141.44 ? 352 ASP C O     1 
ATOM   6728 C CB    . ASP C 1 330 ? -29.724 -42.116 -8.555  1.00 141.54 ? 352 ASP C CB    1 
ATOM   6729 C CG    . ASP C 1 330 ? -29.795 -42.288 -7.031  1.00 142.66 ? 352 ASP C CG    1 
ATOM   6730 O OD1   . ASP C 1 330 ? -28.714 -42.454 -6.358  1.00 143.42 ? 352 ASP C OD1   1 
ATOM   6731 O OD2   . ASP C 1 330 ? -30.944 -42.316 -6.507  1.00 143.87 ? 352 ASP C OD2   1 
ATOM   6732 N N     . VAL D 1 39  ? -56.334 -31.609 -63.320 1.00 145.44 ? 61  VAL D N     1 
ATOM   6733 C CA    . VAL D 1 39  ? -55.746 -32.196 -62.074 1.00 145.39 ? 61  VAL D CA    1 
ATOM   6734 C C     . VAL D 1 39  ? -54.502 -33.018 -62.423 1.00 145.21 ? 61  VAL D C     1 
ATOM   6735 O O     . VAL D 1 39  ? -54.602 -34.150 -62.921 1.00 145.24 ? 61  VAL D O     1 
ATOM   6736 C CB    . VAL D 1 39  ? -56.783 -33.061 -61.285 1.00 145.49 ? 61  VAL D CB    1 
ATOM   6737 C CG1   . VAL D 1 39  ? -56.201 -33.536 -59.947 1.00 145.48 ? 61  VAL D CG1   1 
ATOM   6738 C CG2   . VAL D 1 39  ? -58.074 -32.279 -61.051 1.00 145.72 ? 61  VAL D CG2   1 
ATOM   6739 N N     . TYR D 1 40  ? -53.333 -32.427 -62.162 1.00 144.97 ? 62  TYR D N     1 
ATOM   6740 C CA    . TYR D 1 40  ? -52.044 -33.081 -62.417 1.00 144.62 ? 62  TYR D CA    1 
ATOM   6741 C C     . TYR D 1 40  ? -51.331 -33.512 -61.137 1.00 144.11 ? 62  TYR D C     1 
ATOM   6742 O O     . TYR D 1 40  ? -50.930 -32.656 -60.287 1.00 144.09 ? 62  TYR D O     1 
ATOM   6743 C CB    . TYR D 1 40  ? -51.118 -32.180 -63.241 1.00 144.80 ? 62  TYR D CB    1 
ATOM   6744 C CG    . TYR D 1 40  ? -51.635 -31.899 -64.632 1.00 145.42 ? 62  TYR D CG    1 
ATOM   6745 C CD1   . TYR D 1 40  ? -51.561 -32.878 -65.650 1.00 145.99 ? 62  TYR D CD1   1 
ATOM   6746 C CD2   . TYR D 1 40  ? -52.203 -30.657 -64.934 1.00 146.08 ? 62  TYR D CD2   1 
ATOM   6747 C CE1   . TYR D 1 40  ? -52.041 -32.624 -66.939 1.00 146.42 ? 62  TYR D CE1   1 
ATOM   6748 C CE2   . TYR D 1 40  ? -52.686 -30.390 -66.219 1.00 146.44 ? 62  TYR D CE2   1 
ATOM   6749 C CZ    . TYR D 1 40  ? -52.601 -31.378 -67.217 1.00 146.56 ? 62  TYR D CZ    1 
ATOM   6750 O OH    . TYR D 1 40  ? -53.074 -31.121 -68.491 1.00 146.79 ? 62  TYR D OH    1 
ATOM   6751 N N     . ARG D 1 41  ? -51.185 -34.851 -61.022 1.00 143.35 ? 63  ARG D N     1 
ATOM   6752 C CA    . ARG D 1 41  ? -50.476 -35.470 -59.905 1.00 142.55 ? 63  ARG D CA    1 
ATOM   6753 C C     . ARG D 1 41  ? -48.971 -35.394 -60.114 1.00 141.62 ? 63  ARG D C     1 
ATOM   6754 O O     . ARG D 1 41  ? -48.480 -35.538 -61.242 1.00 141.66 ? 63  ARG D O     1 
ATOM   6755 C CB    . ARG D 1 41  ? -50.898 -36.932 -59.739 1.00 142.74 ? 63  ARG D CB    1 
ATOM   6756 C CG    . ARG D 1 41  ? -52.265 -37.088 -59.118 1.00 143.99 ? 63  ARG D CG    1 
ATOM   6757 C CD    . ARG D 1 41  ? -52.469 -38.470 -58.516 1.00 146.37 ? 63  ARG D CD    1 
ATOM   6758 N NE    . ARG D 1 41  ? -53.189 -38.371 -57.243 1.00 148.20 ? 63  ARG D NE    1 
ATOM   6759 C CZ    . ARG D 1 41  ? -54.506 -38.172 -57.134 1.00 149.09 ? 63  ARG D CZ    1 
ATOM   6760 N NH1   . ARG D 1 41  ? -55.272 -38.050 -58.225 1.00 149.48 ? 63  ARG D NH1   1 
ATOM   6761 N NH2   . ARG D 1 41  ? -55.059 -38.090 -55.928 1.00 149.69 ? 63  ARG D NH2   1 
ATOM   6762 N N     . TYR D 1 42  ? -48.242 -35.152 -59.020 1.00 140.34 ? 64  TYR D N     1 
ATOM   6763 C CA    . TYR D 1 42  ? -46.790 -35.144 -59.070 1.00 138.90 ? 64  TYR D CA    1 
ATOM   6764 C C     . TYR D 1 42  ? -46.219 -35.924 -57.915 1.00 137.99 ? 64  TYR D C     1 
ATOM   6765 O O     . TYR D 1 42  ? -46.712 -35.841 -56.789 1.00 137.87 ? 64  TYR D O     1 
ATOM   6766 C CB    . TYR D 1 42  ? -46.216 -33.719 -59.156 1.00 138.87 ? 64  TYR D CB    1 
ATOM   6767 C CG    . TYR D 1 42  ? -46.490 -32.782 -57.994 1.00 138.56 ? 64  TYR D CG    1 
ATOM   6768 C CD1   . TYR D 1 42  ? -45.446 -32.308 -57.203 1.00 138.45 ? 64  TYR D CD1   1 
ATOM   6769 C CD2   . TYR D 1 42  ? -47.783 -32.328 -57.718 1.00 138.78 ? 64  TYR D CD2   1 
ATOM   6770 C CE1   . TYR D 1 42  ? -45.681 -31.428 -56.149 1.00 138.35 ? 64  TYR D CE1   1 
ATOM   6771 C CE2   . TYR D 1 42  ? -48.031 -31.452 -56.663 1.00 138.53 ? 64  TYR D CE2   1 
ATOM   6772 C CZ    . TYR D 1 42  ? -46.974 -31.005 -55.889 1.00 138.41 ? 64  TYR D CZ    1 
ATOM   6773 O OH    . TYR D 1 42  ? -47.209 -30.139 -54.848 1.00 138.56 ? 64  TYR D OH    1 
ATOM   6774 N N     . GLY D 1 43  ? -45.197 -36.716 -58.223 1.00 136.99 ? 65  GLY D N     1 
ATOM   6775 C CA    . GLY D 1 43  ? -44.566 -37.547 -57.230 1.00 135.88 ? 65  GLY D CA    1 
ATOM   6776 C C     . GLY D 1 43  ? -43.113 -37.815 -57.544 1.00 135.10 ? 65  GLY D C     1 
ATOM   6777 O O     . GLY D 1 43  ? -42.645 -37.600 -58.666 1.00 135.05 ? 65  GLY D O     1 
ATOM   6778 N N     . LYS D 1 44  ? -42.409 -38.279 -56.520 1.00 134.27 ? 66  LYS D N     1 
ATOM   6779 C CA    . LYS D 1 44  ? -41.067 -38.813 -56.626 1.00 133.52 ? 66  LYS D CA    1 
ATOM   6780 C C     . LYS D 1 44  ? -40.785 -39.518 -57.963 1.00 132.68 ? 66  LYS D C     1 
ATOM   6781 O O     . LYS D 1 44  ? -39.760 -39.265 -58.598 1.00 132.61 ? 66  LYS D O     1 
ATOM   6782 C CB    . LYS D 1 44  ? -40.871 -39.798 -55.476 1.00 133.72 ? 66  LYS D CB    1 
ATOM   6783 C CG    . LYS D 1 44  ? -39.729 -39.449 -54.531 1.00 135.03 ? 66  LYS D CG    1 
ATOM   6784 C CD    . LYS D 1 44  ? -40.045 -39.876 -53.102 1.00 137.32 ? 66  LYS D CD    1 
ATOM   6785 C CE    . LYS D 1 44  ? -39.903 -41.403 -52.925 1.00 138.83 ? 66  LYS D CE    1 
ATOM   6786 N NZ    . LYS D 1 44  ? -40.433 -41.831 -51.596 1.00 139.90 ? 66  LYS D NZ    1 
ATOM   6787 N N     . ALA D 1 45  ? -41.708 -40.378 -58.395 1.00 131.69 ? 67  ALA D N     1 
ATOM   6788 C CA    . ALA D 1 45  ? -41.445 -41.320 -59.492 1.00 130.66 ? 67  ALA D CA    1 
ATOM   6789 C C     . ALA D 1 45  ? -41.866 -40.862 -60.892 1.00 130.03 ? 67  ALA D C     1 
ATOM   6790 O O     . ALA D 1 45  ? -41.769 -41.635 -61.849 1.00 129.94 ? 67  ALA D O     1 
ATOM   6791 C CB    . ALA D 1 45  ? -42.064 -42.683 -59.171 1.00 130.62 ? 67  ALA D CB    1 
ATOM   6792 N N     . MET D 1 46  ? -42.321 -39.617 -61.020 1.00 129.27 ? 68  MET D N     1 
ATOM   6793 C CA    . MET D 1 46  ? -42.811 -39.115 -62.310 1.00 128.52 ? 68  MET D CA    1 
ATOM   6794 C C     . MET D 1 46  ? -41.680 -38.891 -63.331 1.00 127.95 ? 68  MET D C     1 
ATOM   6795 O O     . MET D 1 46  ? -40.515 -38.743 -62.952 1.00 127.87 ? 68  MET D O     1 
ATOM   6796 C CB    . MET D 1 46  ? -43.656 -37.847 -62.115 1.00 128.51 ? 68  MET D CB    1 
ATOM   6797 C CG    . MET D 1 46  ? -42.868 -36.577 -61.835 1.00 128.60 ? 68  MET D CG    1 
ATOM   6798 S SD    . MET D 1 46  ? -43.909 -35.155 -61.452 1.00 128.45 ? 68  MET D SD    1 
ATOM   6799 C CE    . MET D 1 46  ? -44.783 -34.939 -63.002 1.00 128.85 ? 68  MET D CE    1 
ATOM   6800 N N     . PRO D 1 47  ? -42.022 -38.864 -64.632 1.00 127.40 ? 69  PRO D N     1 
ATOM   6801 C CA    . PRO D 1 47  ? -40.976 -38.643 -65.617 1.00 126.94 ? 69  PRO D CA    1 
ATOM   6802 C C     . PRO D 1 47  ? -40.600 -37.165 -65.665 1.00 126.36 ? 69  PRO D C     1 
ATOM   6803 O O     . PRO D 1 47  ? -41.377 -36.310 -66.155 1.00 126.35 ? 69  PRO D O     1 
ATOM   6804 C CB    . PRO D 1 47  ? -41.621 -39.096 -66.933 1.00 127.03 ? 69  PRO D CB    1 
ATOM   6805 C CG    . PRO D 1 47  ? -43.067 -38.837 -66.747 1.00 127.29 ? 69  PRO D CG    1 
ATOM   6806 C CD    . PRO D 1 47  ? -43.363 -38.908 -65.248 1.00 127.48 ? 69  PRO D CD    1 
ATOM   6807 N N     . LEU D 1 48  ? -39.413 -36.878 -65.131 1.00 125.59 ? 70  LEU D N     1 
ATOM   6808 C CA    . LEU D 1 48  ? -38.901 -35.523 -65.135 1.00 124.80 ? 70  LEU D CA    1 
ATOM   6809 C C     . LEU D 1 48  ? -37.854 -35.343 -66.213 1.00 124.05 ? 70  LEU D C     1 
ATOM   6810 O O     . LEU D 1 48  ? -37.251 -36.314 -66.673 1.00 123.96 ? 70  LEU D O     1 
ATOM   6811 C CB    . LEU D 1 48  ? -38.314 -35.179 -63.772 1.00 124.97 ? 70  LEU D CB    1 
ATOM   6812 C CG    . LEU D 1 48  ? -39.346 -35.005 -62.663 1.00 125.23 ? 70  LEU D CG    1 
ATOM   6813 C CD1   . LEU D 1 48  ? -38.640 -34.947 -61.327 1.00 125.86 ? 70  LEU D CD1   1 
ATOM   6814 C CD2   . LEU D 1 48  ? -40.172 -33.741 -62.902 1.00 125.91 ? 70  LEU D CD2   1 
ATOM   6815 N N     . ILE D 1 49  ? -37.654 -34.095 -66.621 1.00 123.12 ? 71  ILE D N     1 
ATOM   6816 C CA    . ILE D 1 49  ? -36.605 -33.760 -67.571 1.00 122.24 ? 71  ILE D CA    1 
ATOM   6817 C C     . ILE D 1 49  ? -35.667 -32.736 -66.959 1.00 121.65 ? 71  ILE D C     1 
ATOM   6818 O O     . ILE D 1 49  ? -36.096 -31.689 -66.472 1.00 121.44 ? 71  ILE D O     1 
ATOM   6819 C CB    . ILE D 1 49  ? -37.165 -33.203 -68.897 1.00 122.26 ? 71  ILE D CB    1 
ATOM   6820 C CG1   . ILE D 1 49  ? -38.233 -34.133 -69.479 1.00 122.52 ? 71  ILE D CG1   1 
ATOM   6821 C CG2   . ILE D 1 49  ? -36.050 -32.999 -69.908 1.00 121.90 ? 71  ILE D CG2   1 
ATOM   6822 C CD1   . ILE D 1 49  ? -39.084 -33.490 -70.568 1.00 122.75 ? 71  ILE D CD1   1 
ATOM   6823 N N     . PHE D 1 50  ? -34.379 -33.051 -66.984 1.00 121.01 ? 72  PHE D N     1 
ATOM   6824 C CA    . PHE D 1 50  ? -33.375 -32.095 -66.577 1.00 120.52 ? 72  PHE D CA    1 
ATOM   6825 C C     . PHE D 1 50  ? -32.496 -31.699 -67.743 1.00 120.23 ? 72  PHE D C     1 
ATOM   6826 O O     . PHE D 1 50  ? -31.764 -32.514 -68.322 1.00 119.91 ? 72  PHE D O     1 
ATOM   6827 C CB    . PHE D 1 50  ? -32.542 -32.635 -65.424 1.00 120.57 ? 72  PHE D CB    1 
ATOM   6828 C CG    . PHE D 1 50  ? -33.312 -32.786 -64.154 1.00 120.33 ? 72  PHE D CG    1 
ATOM   6829 C CD1   . PHE D 1 50  ? -33.621 -31.673 -63.382 1.00 120.02 ? 72  PHE D CD1   1 
ATOM   6830 C CD2   . PHE D 1 50  ? -33.738 -34.039 -63.733 1.00 120.36 ? 72  PHE D CD2   1 
ATOM   6831 C CE1   . PHE D 1 50  ? -34.338 -31.809 -62.206 1.00 119.89 ? 72  PHE D CE1   1 
ATOM   6832 C CE2   . PHE D 1 50  ? -34.453 -34.189 -62.555 1.00 120.20 ? 72  PHE D CE2   1 
ATOM   6833 C CZ    . PHE D 1 50  ? -34.756 -33.072 -61.790 1.00 120.04 ? 72  PHE D CZ    1 
ATOM   6834 N N     . VAL D 1 51  ? -32.612 -30.426 -68.091 1.00 120.03 ? 73  VAL D N     1 
ATOM   6835 C CA    . VAL D 1 51  ? -31.782 -29.830 -69.104 1.00 120.03 ? 73  VAL D CA    1 
ATOM   6836 C C     . VAL D 1 51  ? -30.749 -29.025 -68.342 1.00 120.06 ? 73  VAL D C     1 
ATOM   6837 O O     . VAL D 1 51  ? -31.064 -28.419 -67.306 1.00 120.09 ? 73  VAL D O     1 
ATOM   6838 C CB    . VAL D 1 51  ? -32.592 -28.879 -70.011 1.00 120.06 ? 73  VAL D CB    1 
ATOM   6839 C CG1   . VAL D 1 51  ? -31.728 -28.344 -71.143 1.00 120.22 ? 73  VAL D CG1   1 
ATOM   6840 C CG2   . VAL D 1 51  ? -33.812 -29.584 -70.582 1.00 120.20 ? 73  VAL D CG2   1 
ATOM   6841 N N     . GLY D 1 52  ? -29.516 -29.043 -68.852 1.00 120.03 ? 74  GLY D N     1 
ATOM   6842 C CA    . GLY D 1 52  ? -28.403 -28.297 -68.264 1.00 119.84 ? 74  GLY D CA    1 
ATOM   6843 C C     . GLY D 1 52  ? -27.141 -28.376 -69.104 1.00 119.62 ? 74  GLY D C     1 
ATOM   6844 O O     . GLY D 1 52  ? -27.201 -28.652 -70.306 1.00 119.78 ? 74  GLY D O     1 
ATOM   6845 N N     . GLY D 1 53  ? -25.998 -28.145 -68.461 1.00 119.29 ? 75  GLY D N     1 
ATOM   6846 C CA    . GLY D 1 53  ? -24.718 -28.027 -69.156 1.00 119.02 ? 75  GLY D CA    1 
ATOM   6847 C C     . GLY D 1 53  ? -24.192 -26.612 -68.953 1.00 118.76 ? 75  GLY D C     1 
ATOM   6848 O O     . GLY D 1 53  ? -24.924 -25.732 -68.451 1.00 118.79 ? 75  GLY D O     1 
ATOM   6849 N N     . VAL D 1 54  ? -22.932 -26.385 -69.336 1.00 118.47 ? 76  VAL D N     1 
ATOM   6850 C CA    . VAL D 1 54  ? -22.328 -25.054 -69.193 1.00 118.13 ? 76  VAL D CA    1 
ATOM   6851 C C     . VAL D 1 54  ? -23.237 -24.005 -69.833 1.00 117.97 ? 76  VAL D C     1 
ATOM   6852 O O     . VAL D 1 54  ? -23.713 -24.198 -70.951 1.00 117.86 ? 76  VAL D O     1 
ATOM   6853 C CB    . VAL D 1 54  ? -20.905 -24.974 -69.811 1.00 118.13 ? 76  VAL D CB    1 
ATOM   6854 C CG1   . VAL D 1 54  ? -20.246 -23.619 -69.526 1.00 117.71 ? 76  VAL D CG1   1 
ATOM   6855 C CG2   . VAL D 1 54  ? -20.028 -26.093 -69.279 1.00 118.29 ? 76  VAL D CG2   1 
ATOM   6856 N N     . PRO D 1 55  ? -23.506 -22.905 -69.108 1.00 117.82 ? 77  PRO D N     1 
ATOM   6857 C CA    . PRO D 1 55  ? -24.299 -21.816 -69.645 1.00 117.68 ? 77  PRO D CA    1 
ATOM   6858 C C     . PRO D 1 55  ? -23.810 -21.398 -71.007 1.00 117.49 ? 77  PRO D C     1 
ATOM   6859 O O     . PRO D 1 55  ? -22.679 -21.678 -71.374 1.00 117.55 ? 77  PRO D O     1 
ATOM   6860 C CB    . PRO D 1 55  ? -24.055 -20.695 -68.642 1.00 117.62 ? 77  PRO D CB    1 
ATOM   6861 C CG    . PRO D 1 55  ? -23.926 -21.399 -67.370 1.00 117.74 ? 77  PRO D CG    1 
ATOM   6862 C CD    . PRO D 1 55  ? -23.186 -22.676 -67.688 1.00 117.94 ? 77  PRO D CD    1 
ATOM   6863 N N     . ARG D 1 56  ? -24.676 -20.728 -71.748 1.00 117.38 ? 78  ARG D N     1 
ATOM   6864 C CA    . ARG D 1 56  ? -24.378 -20.314 -73.098 1.00 117.50 ? 78  ARG D CA    1 
ATOM   6865 C C     . ARG D 1 56  ? -24.234 -21.513 -74.045 1.00 117.54 ? 78  ARG D C     1 
ATOM   6866 O O     . ARG D 1 56  ? -23.840 -21.336 -75.215 1.00 117.75 ? 78  ARG D O     1 
ATOM   6867 C CB    . ARG D 1 56  ? -23.154 -19.387 -73.140 1.00 117.69 ? 78  ARG D CB    1 
ATOM   6868 C CG    . ARG D 1 56  ? -23.069 -18.349 -72.006 1.00 117.85 ? 78  ARG D CG    1 
ATOM   6869 C CD    . ARG D 1 56  ? -24.374 -17.611 -71.765 1.00 118.31 ? 78  ARG D CD    1 
ATOM   6870 N NE    . ARG D 1 56  ? -24.864 -16.926 -72.958 1.00 119.17 ? 78  ARG D NE    1 
ATOM   6871 C CZ    . ARG D 1 56  ? -26.083 -16.378 -73.067 1.00 119.67 ? 78  ARG D CZ    1 
ATOM   6872 N NH1   . ARG D 1 56  ? -26.954 -16.434 -72.057 1.00 119.96 ? 78  ARG D NH1   1 
ATOM   6873 N NH2   . ARG D 1 56  ? -26.442 -15.779 -74.191 1.00 119.48 ? 78  ARG D NH2   1 
ATOM   6874 N N     . SER D 1 57  ? -24.574 -22.725 -73.544 1.00 117.47 ? 79  SER D N     1 
ATOM   6875 C CA    . SER D 1 57  ? -24.577 -23.921 -74.394 1.00 117.49 ? 79  SER D CA    1 
ATOM   6876 C C     . SER D 1 57  ? -25.946 -24.217 -74.970 1.00 117.49 ? 79  SER D C     1 
ATOM   6877 O O     . SER D 1 57  ? -26.321 -25.379 -75.131 1.00 117.36 ? 79  SER D O     1 
ATOM   6878 C CB    . SER D 1 57  ? -24.093 -25.138 -73.624 1.00 117.50 ? 79  SER D CB    1 
ATOM   6879 O OG    . SER D 1 57  ? -22.779 -24.920 -73.161 1.00 117.69 ? 79  SER D OG    1 
ATOM   6880 N N     . GLY D 1 58  ? -26.690 -23.158 -75.276 1.00 117.55 ? 80  GLY D N     1 
ATOM   6881 C CA    . GLY D 1 58  ? -28.018 -23.292 -75.840 1.00 117.72 ? 80  GLY D CA    1 
ATOM   6882 C C     . GLY D 1 58  ? -28.941 -24.104 -74.963 1.00 117.91 ? 80  GLY D C     1 
ATOM   6883 O O     . GLY D 1 58  ? -29.783 -24.841 -75.464 1.00 118.10 ? 80  GLY D O     1 
ATOM   6884 N N     . THR D 1 59  ? -28.781 -23.975 -73.650 1.00 118.10 ? 81  THR D N     1 
ATOM   6885 C CA    . THR D 1 59  ? -29.655 -24.659 -72.702 1.00 118.32 ? 81  THR D CA    1 
ATOM   6886 C C     . THR D 1 59  ? -31.078 -24.048 -72.647 1.00 118.59 ? 81  THR D C     1 
ATOM   6887 O O     . THR D 1 59  ? -32.072 -24.778 -72.551 1.00 118.57 ? 81  THR D O     1 
ATOM   6888 C CB    . THR D 1 59  ? -29.016 -24.718 -71.299 1.00 118.23 ? 81  THR D CB    1 
ATOM   6889 O OG1   . THR D 1 59  ? -28.772 -23.384 -70.835 1.00 117.98 ? 81  THR D OG1   1 
ATOM   6890 C CG2   . THR D 1 59  ? -27.683 -25.462 -71.353 1.00 117.94 ? 81  THR D CG2   1 
ATOM   6891 N N     . THR D 1 60  ? -31.166 -22.719 -72.725 1.00 118.84 ? 82  THR D N     1 
ATOM   6892 C CA    . THR D 1 60  ? -32.451 -22.011 -72.766 1.00 119.05 ? 82  THR D CA    1 
ATOM   6893 C C     . THR D 1 60  ? -33.253 -22.391 -74.011 1.00 119.14 ? 82  THR D C     1 
ATOM   6894 O O     . THR D 1 60  ? -34.434 -22.698 -73.921 1.00 119.25 ? 82  THR D O     1 
ATOM   6895 C CB    . THR D 1 60  ? -32.275 -20.473 -72.745 1.00 119.07 ? 82  THR D CB    1 
ATOM   6896 O OG1   . THR D 1 60  ? -31.219 -20.110 -71.848 1.00 119.17 ? 82  THR D OG1   1 
ATOM   6897 C CG2   . THR D 1 60  ? -33.560 -19.790 -72.306 1.00 119.27 ? 82  THR D CG2   1 
ATOM   6898 N N     . LEU D 1 61  ? -32.603 -22.361 -75.173 1.00 119.21 ? 83  LEU D N     1 
ATOM   6899 C CA    . LEU D 1 61  ? -33.233 -22.782 -76.415 1.00 119.20 ? 83  LEU D CA    1 
ATOM   6900 C C     . LEU D 1 61  ? -33.809 -24.180 -76.248 1.00 119.27 ? 83  LEU D C     1 
ATOM   6901 O O     . LEU D 1 61  ? -34.974 -24.400 -76.533 1.00 119.27 ? 83  LEU D O     1 
ATOM   6902 C CB    . LEU D 1 61  ? -32.217 -22.746 -77.566 1.00 119.18 ? 83  LEU D CB    1 
ATOM   6903 C CG    . LEU D 1 61  ? -32.616 -23.195 -78.975 1.00 118.89 ? 83  LEU D CG    1 
ATOM   6904 C CD1   . LEU D 1 61  ? -33.775 -22.364 -79.534 1.00 118.39 ? 83  LEU D CD1   1 
ATOM   6905 C CD2   . LEU D 1 61  ? -31.399 -23.165 -79.895 1.00 117.86 ? 83  LEU D CD2   1 
ATOM   6906 N N     . MET D 1 62  ? -32.992 -25.108 -75.758 1.00 119.50 ? 84  MET D N     1 
ATOM   6907 C CA    . MET D 1 62  ? -33.406 -26.492 -75.592 1.00 119.80 ? 84  MET D CA    1 
ATOM   6908 C C     . MET D 1 62  ? -34.668 -26.593 -74.776 1.00 120.11 ? 84  MET D C     1 
ATOM   6909 O O     . MET D 1 62  ? -35.656 -27.172 -75.216 1.00 120.11 ? 84  MET D O     1 
ATOM   6910 C CB    . MET D 1 62  ? -32.327 -27.307 -74.893 1.00 119.78 ? 84  MET D CB    1 
ATOM   6911 C CG    . MET D 1 62  ? -32.734 -28.752 -74.675 1.00 119.86 ? 84  MET D CG    1 
ATOM   6912 S SD    . MET D 1 62  ? -32.911 -29.610 -76.243 1.00 119.58 ? 84  MET D SD    1 
ATOM   6913 C CE    . MET D 1 62  ? -34.675 -29.758 -76.443 1.00 120.16 ? 84  MET D CE    1 
ATOM   6914 N N     . ARG D 1 63  ? -34.623 -26.040 -73.570 1.00 120.55 ? 85  ARG D N     1 
ATOM   6915 C CA    . ARG D 1 63  ? -35.782 -26.074 -72.712 1.00 120.98 ? 85  ARG D CA    1 
ATOM   6916 C C     . ARG D 1 63  ? -36.918 -25.323 -73.376 1.00 121.43 ? 85  ARG D C     1 
ATOM   6917 O O     . ARG D 1 63  ? -38.046 -25.790 -73.342 1.00 121.69 ? 85  ARG D O     1 
ATOM   6918 C CB    . ARG D 1 63  ? -35.474 -25.535 -71.308 1.00 120.91 ? 85  ARG D CB    1 
ATOM   6919 C CG    . ARG D 1 63  ? -35.251 -24.028 -71.187 1.00 120.73 ? 85  ARG D CG    1 
ATOM   6920 C CD    . ARG D 1 63  ? -36.547 -23.295 -70.905 1.00 120.15 ? 85  ARG D CD    1 
ATOM   6921 N NE    . ARG D 1 63  ? -36.326 -21.880 -70.586 1.00 120.20 ? 85  ARG D NE    1 
ATOM   6922 C CZ    . ARG D 1 63  ? -37.303 -20.999 -70.396 1.00 120.52 ? 85  ARG D CZ    1 
ATOM   6923 N NH1   . ARG D 1 63  ? -38.578 -21.384 -70.493 1.00 120.75 ? 85  ARG D NH1   1 
ATOM   6924 N NH2   . ARG D 1 63  ? -37.007 -19.734 -70.101 1.00 120.85 ? 85  ARG D NH2   1 
ATOM   6925 N N     . ALA D 1 64  ? -36.618 -24.187 -74.011 1.00 121.99 ? 86  ALA D N     1 
ATOM   6926 C CA    . ALA D 1 64  ? -37.654 -23.353 -74.637 1.00 122.52 ? 86  ALA D CA    1 
ATOM   6927 C C     . ALA D 1 64  ? -38.462 -24.158 -75.642 1.00 122.91 ? 86  ALA D C     1 
ATOM   6928 O O     . ALA D 1 64  ? -39.680 -23.996 -75.745 1.00 122.91 ? 86  ALA D O     1 
ATOM   6929 C CB    . ALA D 1 64  ? -37.048 -22.118 -75.299 1.00 122.47 ? 86  ALA D CB    1 
ATOM   6930 N N     . MET D 1 65  ? -37.770 -25.040 -76.362 1.00 123.47 ? 87  MET D N     1 
ATOM   6931 C CA    . MET D 1 65  ? -38.404 -25.943 -77.311 1.00 123.99 ? 87  MET D CA    1 
ATOM   6932 C C     . MET D 1 65  ? -39.200 -27.037 -76.604 1.00 124.20 ? 87  MET D C     1 
ATOM   6933 O O     . MET D 1 65  ? -40.141 -27.584 -77.170 1.00 124.42 ? 87  MET D O     1 
ATOM   6934 C CB    . MET D 1 65  ? -37.378 -26.538 -78.286 1.00 124.05 ? 87  MET D CB    1 
ATOM   6935 C CG    . MET D 1 65  ? -37.039 -25.615 -79.471 1.00 124.60 ? 87  MET D CG    1 
ATOM   6936 S SD    . MET D 1 65  ? -35.996 -26.380 -80.726 1.00 125.10 ? 87  MET D SD    1 
ATOM   6937 C CE    . MET D 1 65  ? -34.614 -26.865 -79.691 1.00 126.10 ? 87  MET D CE    1 
ATOM   6938 N N     . LEU D 1 66  ? -38.845 -27.348 -75.365 1.00 124.49 ? 88  LEU D N     1 
ATOM   6939 C CA    . LEU D 1 66  ? -39.603 -28.351 -74.631 1.00 124.89 ? 88  LEU D CA    1 
ATOM   6940 C C     . LEU D 1 66  ? -40.875 -27.782 -73.955 1.00 125.33 ? 88  LEU D C     1 
ATOM   6941 O O     . LEU D 1 66  ? -41.834 -28.531 -73.711 1.00 125.49 ? 88  LEU D O     1 
ATOM   6942 C CB    . LEU D 1 66  ? -38.690 -29.103 -73.655 1.00 124.82 ? 88  LEU D CB    1 
ATOM   6943 C CG    . LEU D 1 66  ? -37.438 -29.741 -74.282 1.00 124.58 ? 88  LEU D CG    1 
ATOM   6944 C CD1   . LEU D 1 66  ? -36.370 -29.966 -73.230 1.00 124.62 ? 88  LEU D CD1   1 
ATOM   6945 C CD2   . LEU D 1 66  ? -37.753 -31.050 -75.004 1.00 124.57 ? 88  LEU D CD2   1 
ATOM   6946 N N     . ASP D 1 67  ? -40.886 -26.464 -73.686 1.00 125.80 ? 89  ASP D N     1 
ATOM   6947 C CA    . ASP D 1 67  ? -42.051 -25.748 -73.102 1.00 126.25 ? 89  ASP D CA    1 
ATOM   6948 C C     . ASP D 1 67  ? -43.243 -25.660 -74.058 1.00 126.57 ? 89  ASP D C     1 
ATOM   6949 O O     . ASP D 1 67  ? -44.407 -25.782 -73.639 1.00 126.48 ? 89  ASP D O     1 
ATOM   6950 C CB    . ASP D 1 67  ? -41.656 -24.320 -72.683 1.00 126.26 ? 89  ASP D CB    1 
ATOM   6951 C CG    . ASP D 1 67  ? -41.769 -24.079 -71.172 1.00 126.47 ? 89  ASP D CG    1 
ATOM   6952 O OD1   . ASP D 1 67  ? -42.873 -24.251 -70.604 1.00 126.72 ? 89  ASP D OD1   1 
ATOM   6953 O OD2   . ASP D 1 67  ? -40.755 -23.684 -70.555 1.00 126.68 ? 89  ASP D OD2   1 
ATOM   6954 N N     . ALA D 1 68  ? -42.922 -25.428 -75.335 1.00 126.98 ? 90  ALA D N     1 
ATOM   6955 C CA    . ALA D 1 68  ? -43.893 -25.314 -76.429 1.00 127.36 ? 90  ALA D CA    1 
ATOM   6956 C C     . ALA D 1 68  ? -44.697 -26.592 -76.634 1.00 127.61 ? 90  ALA D C     1 
ATOM   6957 O O     . ALA D 1 68  ? -45.857 -26.536 -77.053 1.00 127.71 ? 90  ALA D O     1 
ATOM   6958 C CB    . ALA D 1 68  ? -43.185 -24.919 -77.726 1.00 127.36 ? 90  ALA D CB    1 
ATOM   6959 N N     . HIS D 1 69  ? -44.078 -27.737 -76.352 1.00 127.97 ? 91  HIS D N     1 
ATOM   6960 C CA    . HIS D 1 69  ? -44.804 -28.987 -76.295 1.00 128.47 ? 91  HIS D CA    1 
ATOM   6961 C C     . HIS D 1 69  ? -45.933 -28.827 -75.285 1.00 128.95 ? 91  HIS D C     1 
ATOM   6962 O O     . HIS D 1 69  ? -45.713 -28.356 -74.160 1.00 128.98 ? 91  HIS D O     1 
ATOM   6963 C CB    . HIS D 1 69  ? -43.892 -30.138 -75.890 1.00 128.43 ? 91  HIS D CB    1 
ATOM   6964 C CG    . HIS D 1 69  ? -44.421 -31.481 -76.279 1.00 128.69 ? 91  HIS D CG    1 
ATOM   6965 N ND1   . HIS D 1 69  ? -45.589 -31.999 -75.755 1.00 128.89 ? 91  HIS D ND1   1 
ATOM   6966 C CD2   . HIS D 1 69  ? -43.943 -32.413 -77.146 1.00 129.07 ? 91  HIS D CD2   1 
ATOM   6967 C CE1   . HIS D 1 69  ? -45.810 -33.191 -76.283 1.00 129.22 ? 91  HIS D CE1   1 
ATOM   6968 N NE2   . HIS D 1 69  ? -44.824 -33.467 -77.129 1.00 129.44 ? 91  HIS D NE2   1 
ATOM   6969 N N     . PRO D 1 70  ? -47.156 -29.194 -75.693 1.00 129.36 ? 92  PRO D N     1 
ATOM   6970 C CA    . PRO D 1 70  ? -48.328 -29.016 -74.853 1.00 129.67 ? 92  PRO D CA    1 
ATOM   6971 C C     . PRO D 1 70  ? -48.206 -29.808 -73.564 1.00 129.97 ? 92  PRO D C     1 
ATOM   6972 O O     . PRO D 1 70  ? -48.600 -29.326 -72.503 1.00 130.06 ? 92  PRO D O     1 
ATOM   6973 C CB    . PRO D 1 70  ? -49.460 -29.588 -75.713 1.00 129.71 ? 92  PRO D CB    1 
ATOM   6974 C CG    . PRO D 1 70  ? -48.784 -30.528 -76.651 1.00 129.57 ? 92  PRO D CG    1 
ATOM   6975 C CD    . PRO D 1 70  ? -47.496 -29.854 -76.964 1.00 129.39 ? 92  PRO D CD    1 
ATOM   6976 N N     . GLU D 1 71  ? -47.641 -31.008 -73.671 1.00 130.24 ? 93  GLU D N     1 
ATOM   6977 C CA    . GLU D 1 71  ? -47.517 -31.930 -72.546 1.00 130.53 ? 93  GLU D CA    1 
ATOM   6978 C C     . GLU D 1 71  ? -46.418 -31.545 -71.560 1.00 129.80 ? 93  GLU D C     1 
ATOM   6979 O O     . GLU D 1 71  ? -46.305 -32.145 -70.482 1.00 129.83 ? 93  GLU D O     1 
ATOM   6980 C CB    . GLU D 1 71  ? -47.212 -33.337 -73.054 1.00 131.05 ? 93  GLU D CB    1 
ATOM   6981 C CG    . GLU D 1 71  ? -48.203 -33.895 -74.072 1.00 133.66 ? 93  GLU D CG    1 
ATOM   6982 C CD    . GLU D 1 71  ? -47.761 -35.251 -74.577 1.00 137.00 ? 93  GLU D CD    1 
ATOM   6983 O OE1   . GLU D 1 71  ? -47.425 -36.117 -73.733 1.00 138.54 ? 93  GLU D OE1   1 
ATOM   6984 O OE2   . GLU D 1 71  ? -47.746 -35.449 -75.814 1.00 138.13 ? 93  GLU D OE2   1 
ATOM   6985 N N     . VAL D 1 72  ? -45.592 -30.568 -71.934 1.00 128.88 ? 94  VAL D N     1 
ATOM   6986 C CA    . VAL D 1 72  ? -44.361 -30.330 -71.190 1.00 127.76 ? 94  VAL D CA    1 
ATOM   6987 C C     . VAL D 1 72  ? -44.124 -28.872 -70.807 1.00 126.94 ? 94  VAL D C     1 
ATOM   6988 O O     . VAL D 1 72  ? -44.417 -27.937 -71.583 1.00 126.70 ? 94  VAL D O     1 
ATOM   6989 C CB    . VAL D 1 72  ? -43.130 -30.869 -71.949 1.00 127.84 ? 94  VAL D CB    1 
ATOM   6990 C CG1   . VAL D 1 72  ? -41.932 -30.959 -71.018 1.00 128.06 ? 94  VAL D CG1   1 
ATOM   6991 C CG2   . VAL D 1 72  ? -43.418 -32.244 -72.558 1.00 127.81 ? 94  VAL D CG2   1 
ATOM   6992 N N     . ARG D 1 73  ? -43.594 -28.710 -69.593 1.00 125.93 ? 95  ARG D N     1 
ATOM   6993 C CA    . ARG D 1 73  ? -43.159 -27.417 -69.074 1.00 125.14 ? 95  ARG D CA    1 
ATOM   6994 C C     . ARG D 1 73  ? -41.764 -27.527 -68.415 1.00 124.68 ? 95  ARG D C     1 
ATOM   6995 O O     . ARG D 1 73  ? -41.537 -28.410 -67.582 1.00 124.59 ? 95  ARG D O     1 
ATOM   6996 C CB    . ARG D 1 73  ? -44.204 -26.883 -68.082 1.00 125.07 ? 95  ARG D CB    1 
ATOM   6997 C CG    . ARG D 1 73  ? -44.103 -25.394 -67.722 1.00 124.81 ? 95  ARG D CG    1 
ATOM   6998 C CD    . ARG D 1 73  ? -43.358 -25.164 -66.396 1.00 124.62 ? 95  ARG D CD    1 
ATOM   6999 N NE    . ARG D 1 73  ? -44.162 -25.510 -65.211 1.00 124.16 ? 95  ARG D NE    1 
ATOM   7000 C CZ    . ARG D 1 73  ? -43.670 -25.805 -63.999 1.00 124.02 ? 95  ARG D CZ    1 
ATOM   7001 N NH1   . ARG D 1 73  ? -44.500 -26.098 -63.003 1.00 123.90 ? 95  ARG D NH1   1 
ATOM   7002 N NH2   . ARG D 1 73  ? -42.357 -25.820 -63.773 1.00 124.02 ? 95  ARG D NH2   1 
ATOM   7003 N N     . CYS D 1 74  ? -40.838 -26.647 -68.821 1.00 124.04 ? 96  CYS D N     1 
ATOM   7004 C CA    . CYS D 1 74  ? -39.531 -26.476 -68.163 1.00 123.52 ? 96  CYS D CA    1 
ATOM   7005 C C     . CYS D 1 74  ? -39.481 -25.146 -67.452 1.00 123.11 ? 96  CYS D C     1 
ATOM   7006 O O     . CYS D 1 74  ? -38.994 -25.057 -66.320 1.00 123.30 ? 96  CYS D O     1 
ATOM   7007 C CB    . CYS D 1 74  ? -38.374 -26.444 -69.157 1.00 123.54 ? 96  CYS D CB    1 
ATOM   7008 S SG    . CYS D 1 74  ? -38.000 -27.957 -70.003 1.00 124.07 ? 96  CYS D SG    1 
ATOM   7009 N N     . GLY D 1 75  ? -39.946 -24.107 -68.149 1.00 122.54 ? 97  GLY D N     1 
ATOM   7010 C CA    . GLY D 1 75  ? -39.881 -22.739 -67.654 1.00 121.97 ? 97  GLY D CA    1 
ATOM   7011 C C     . GLY D 1 75  ? -38.453 -22.275 -67.433 1.00 121.62 ? 97  GLY D C     1 
ATOM   7012 O O     . GLY D 1 75  ? -37.494 -22.914 -67.883 1.00 121.52 ? 97  GLY D O     1 
ATOM   7013 N N     . GLU D 1 76  ? -38.327 -21.172 -66.704 1.00 121.33 ? 98  GLU D N     1 
ATOM   7014 C CA    . GLU D 1 76  ? -37.052 -20.491 -66.480 1.00 121.14 ? 98  GLU D CA    1 
ATOM   7015 C C     . GLU D 1 76  ? -36.099 -21.231 -65.524 1.00 120.80 ? 98  GLU D C     1 
ATOM   7016 O O     . GLU D 1 76  ? -36.383 -22.353 -65.076 1.00 120.68 ? 98  GLU D O     1 
ATOM   7017 C CB    . GLU D 1 76  ? -37.310 -19.060 -65.969 1.00 121.25 ? 98  GLU D CB    1 
ATOM   7018 C CG    . GLU D 1 76  ? -38.183 -18.205 -66.884 1.00 122.11 ? 98  GLU D CG    1 
ATOM   7019 C CD    . GLU D 1 76  ? -39.683 -18.320 -66.571 1.00 123.99 ? 98  GLU D CD    1 
ATOM   7020 O OE1   . GLU D 1 76  ? -40.413 -17.328 -66.800 1.00 125.05 ? 98  GLU D OE1   1 
ATOM   7021 O OE2   . GLU D 1 76  ? -40.143 -19.385 -66.095 1.00 124.62 ? 98  GLU D OE2   1 
ATOM   7022 N N     . GLU D 1 77  ? -34.961 -20.587 -65.231 1.00 120.48 ? 99  GLU D N     1 
ATOM   7023 C CA    . GLU D 1 77  ? -33.996 -21.102 -64.270 1.00 120.24 ? 99  GLU D CA    1 
ATOM   7024 C C     . GLU D 1 77  ? -34.435 -20.766 -62.857 1.00 120.18 ? 99  GLU D C     1 
ATOM   7025 O O     . GLU D 1 77  ? -34.823 -19.631 -62.585 1.00 120.02 ? 99  GLU D O     1 
ATOM   7026 C CB    . GLU D 1 77  ? -32.624 -20.479 -64.507 1.00 120.20 ? 99  GLU D CB    1 
ATOM   7027 C CG    . GLU D 1 77  ? -31.950 -20.867 -65.807 1.00 120.15 ? 99  GLU D CG    1 
ATOM   7028 C CD    . GLU D 1 77  ? -30.597 -20.200 -65.971 1.00 120.28 ? 99  GLU D CD    1 
ATOM   7029 O OE1   . GLU D 1 77  ? -30.252 -19.324 -65.142 1.00 120.53 ? 99  GLU D OE1   1 
ATOM   7030 O OE2   . GLU D 1 77  ? -29.877 -20.550 -66.929 1.00 119.99 ? 99  GLU D OE2   1 
ATOM   7031 N N     . THR D 1 78  ? -34.342 -21.749 -61.961 1.00 120.24 ? 100 THR D N     1 
ATOM   7032 C CA    . THR D 1 78  ? -34.720 -21.572 -60.553 1.00 120.30 ? 100 THR D CA    1 
ATOM   7033 C C     . THR D 1 78  ? -33.642 -20.860 -59.735 1.00 120.42 ? 100 THR D C     1 
ATOM   7034 O O     . THR D 1 78  ? -33.964 -20.104 -58.817 1.00 120.53 ? 100 THR D O     1 
ATOM   7035 C CB    . THR D 1 78  ? -35.090 -22.920 -59.848 1.00 120.26 ? 100 THR D CB    1 
ATOM   7036 O OG1   . THR D 1 78  ? -33.904 -23.703 -59.628 1.00 120.20 ? 100 THR D OG1   1 
ATOM   7037 C CG2   . THR D 1 78  ? -36.102 -23.712 -60.681 1.00 120.22 ? 100 THR D CG2   1 
ATOM   7038 N N     . ARG D 1 79  ? -32.373 -21.104 -60.064 1.00 120.54 ? 101 ARG D N     1 
ATOM   7039 C CA    . ARG D 1 79  ? -31.240 -20.577 -59.296 1.00 120.85 ? 101 ARG D CA    1 
ATOM   7040 C C     . ARG D 1 79  ? -31.130 -21.302 -57.967 1.00 120.70 ? 101 ARG D C     1 
ATOM   7041 O O     . ARG D 1 79  ? -30.047 -21.427 -57.389 1.00 120.75 ? 101 ARG D O     1 
ATOM   7042 C CB    . ARG D 1 79  ? -31.408 -19.084 -59.011 1.00 121.06 ? 101 ARG D CB    1 
ATOM   7043 C CG    . ARG D 1 79  ? -31.620 -18.231 -60.221 1.00 122.36 ? 101 ARG D CG    1 
ATOM   7044 C CD    . ARG D 1 79  ? -31.537 -16.771 -59.854 1.00 125.22 ? 101 ARG D CD    1 
ATOM   7045 N NE    . ARG D 1 79  ? -30.667 -16.072 -60.796 1.00 128.09 ? 101 ARG D NE    1 
ATOM   7046 C CZ    . ARG D 1 79  ? -29.335 -16.062 -60.702 1.00 129.61 ? 101 ARG D CZ    1 
ATOM   7047 N NH1   . ARG D 1 79  ? -28.713 -16.709 -59.695 1.00 130.21 ? 101 ARG D NH1   1 
ATOM   7048 N NH2   . ARG D 1 79  ? -28.622 -15.402 -61.612 1.00 130.71 ? 101 ARG D NH2   1 
ATOM   7049 N N     . ILE D 1 80  ? -32.278 -21.772 -57.492 1.00 120.56 ? 102 ILE D N     1 
ATOM   7050 C CA    . ILE D 1 80  ? -32.399 -22.276 -56.147 1.00 120.59 ? 102 ILE D CA    1 
ATOM   7051 C C     . ILE D 1 80  ? -32.026 -23.751 -56.027 1.00 120.32 ? 102 ILE D C     1 
ATOM   7052 O O     . ILE D 1 80  ? -31.359 -24.156 -55.070 1.00 120.32 ? 102 ILE D O     1 
ATOM   7053 C CB    . ILE D 1 80  ? -33.824 -21.980 -55.585 1.00 120.77 ? 102 ILE D CB    1 
ATOM   7054 C CG1   . ILE D 1 80  ? -33.813 -21.977 -54.054 1.00 121.77 ? 102 ILE D CG1   1 
ATOM   7055 C CG2   . ILE D 1 80  ? -34.873 -22.935 -56.153 1.00 120.84 ? 102 ILE D CG2   1 
ATOM   7056 C CD1   . ILE D 1 80  ? -32.774 -21.038 -53.477 1.00 123.53 ? 102 ILE D CD1   1 
ATOM   7057 N N     . ILE D 1 81  ? -32.448 -24.549 -57.004 1.00 120.08 ? 103 ILE D N     1 
ATOM   7058 C CA    . ILE D 1 81  ? -32.209 -25.983 -56.967 1.00 119.93 ? 103 ILE D CA    1 
ATOM   7059 C C     . ILE D 1 81  ? -30.709 -26.274 -56.910 1.00 119.98 ? 103 ILE D C     1 
ATOM   7060 O O     . ILE D 1 81  ? -30.252 -27.018 -56.038 1.00 119.87 ? 103 ILE D O     1 
ATOM   7061 C CB    . ILE D 1 81  ? -32.878 -26.691 -58.155 1.00 119.80 ? 103 ILE D CB    1 
ATOM   7062 C CG1   . ILE D 1 81  ? -34.399 -26.523 -58.048 1.00 119.70 ? 103 ILE D CG1   1 
ATOM   7063 C CG2   . ILE D 1 81  ? -32.513 -28.170 -58.155 1.00 119.76 ? 103 ILE D CG2   1 
ATOM   7064 C CD1   . ILE D 1 81  ? -35.147 -26.782 -59.325 1.00 119.92 ? 103 ILE D CD1   1 
ATOM   7065 N N     . PRO D 1 82  ? -29.931 -25.654 -57.812 1.00 120.02 ? 104 PRO D N     1 
ATOM   7066 C CA    . PRO D 1 82  ? -28.506 -25.889 -57.755 1.00 120.13 ? 104 PRO D CA    1 
ATOM   7067 C C     . PRO D 1 82  ? -27.997 -25.549 -56.373 1.00 120.31 ? 104 PRO D C     1 
ATOM   7068 O O     . PRO D 1 82  ? -27.317 -26.358 -55.735 1.00 120.40 ? 104 PRO D O     1 
ATOM   7069 C CB    . PRO D 1 82  ? -27.948 -24.885 -58.771 1.00 120.20 ? 104 PRO D CB    1 
ATOM   7070 C CG    . PRO D 1 82  ? -29.003 -23.844 -58.930 1.00 120.09 ? 104 PRO D CG    1 
ATOM   7071 C CD    . PRO D 1 82  ? -30.269 -24.611 -58.804 1.00 120.08 ? 104 PRO D CD    1 
ATOM   7072 N N     . ARG D 1 83  ? -28.369 -24.353 -55.918 1.00 120.49 ? 105 ARG D N     1 
ATOM   7073 C CA    . ARG D 1 83  ? -27.906 -23.808 -54.670 1.00 120.71 ? 105 ARG D CA    1 
ATOM   7074 C C     . ARG D 1 83  ? -28.076 -24.797 -53.533 1.00 120.38 ? 105 ARG D C     1 
ATOM   7075 O O     . ARG D 1 83  ? -27.160 -24.975 -52.735 1.00 120.40 ? 105 ARG D O     1 
ATOM   7076 C CB    . ARG D 1 83  ? -28.679 -22.544 -54.387 1.00 121.02 ? 105 ARG D CB    1 
ATOM   7077 C CG    . ARG D 1 83  ? -27.975 -21.573 -53.513 1.00 123.10 ? 105 ARG D CG    1 
ATOM   7078 C CD    . ARG D 1 83  ? -28.856 -20.373 -53.396 1.00 127.47 ? 105 ARG D CD    1 
ATOM   7079 N NE    . ARG D 1 83  ? -28.937 -19.613 -54.651 1.00 130.42 ? 105 ARG D NE    1 
ATOM   7080 C CZ    . ARG D 1 83  ? -28.157 -18.565 -54.935 1.00 132.56 ? 105 ARG D CZ    1 
ATOM   7081 N NH1   . ARG D 1 83  ? -28.301 -17.929 -56.098 1.00 133.44 ? 105 ARG D NH1   1 
ATOM   7082 N NH2   . ARG D 1 83  ? -27.233 -18.150 -54.055 1.00 133.69 ? 105 ARG D NH2   1 
ATOM   7083 N N     . VAL D 1 84  ? -29.232 -25.458 -53.480 1.00 120.17 ? 106 VAL D N     1 
ATOM   7084 C CA    . VAL D 1 84  ? -29.511 -26.417 -52.409 1.00 120.06 ? 106 VAL D CA    1 
ATOM   7085 C C     . VAL D 1 84  ? -28.822 -27.752 -52.616 1.00 119.90 ? 106 VAL D C     1 
ATOM   7086 O O     . VAL D 1 84  ? -28.561 -28.480 -51.657 1.00 119.82 ? 106 VAL D O     1 
ATOM   7087 C CB    . VAL D 1 84  ? -31.017 -26.653 -52.201 1.00 120.13 ? 106 VAL D CB    1 
ATOM   7088 C CG1   . VAL D 1 84  ? -31.681 -25.375 -51.725 1.00 120.42 ? 106 VAL D CG1   1 
ATOM   7089 C CG2   . VAL D 1 84  ? -31.682 -27.190 -53.469 1.00 120.27 ? 106 VAL D CG2   1 
ATOM   7090 N N     . LEU D 1 85  ? -28.542 -28.078 -53.869 1.00 119.78 ? 107 LEU D N     1 
ATOM   7091 C CA    . LEU D 1 85  ? -27.764 -29.261 -54.178 1.00 119.76 ? 107 LEU D CA    1 
ATOM   7092 C C     . LEU D 1 85  ? -26.333 -29.062 -53.712 1.00 120.07 ? 107 LEU D C     1 
ATOM   7093 O O     . LEU D 1 85  ? -25.729 -29.969 -53.132 1.00 120.01 ? 107 LEU D O     1 
ATOM   7094 C CB    . LEU D 1 85  ? -27.784 -29.518 -55.674 1.00 119.52 ? 107 LEU D CB    1 
ATOM   7095 C CG    . LEU D 1 85  ? -29.116 -30.019 -56.214 1.00 118.96 ? 107 LEU D CG    1 
ATOM   7096 C CD1   . LEU D 1 85  ? -29.230 -29.672 -57.671 1.00 118.23 ? 107 LEU D CD1   1 
ATOM   7097 C CD2   . LEU D 1 85  ? -29.232 -31.518 -56.001 1.00 118.53 ? 107 LEU D CD2   1 
ATOM   7098 N N     . ALA D 1 86  ? -25.813 -27.855 -53.967 1.00 120.54 ? 108 ALA D N     1 
ATOM   7099 C CA    . ALA D 1 86  ? -24.451 -27.470 -53.600 1.00 121.06 ? 108 ALA D CA    1 
ATOM   7100 C C     . ALA D 1 86  ? -24.192 -27.612 -52.106 1.00 121.40 ? 108 ALA D C     1 
ATOM   7101 O O     . ALA D 1 86  ? -23.145 -28.118 -51.690 1.00 121.41 ? 108 ALA D O     1 
ATOM   7102 C CB    . ALA D 1 86  ? -24.169 -26.043 -54.054 1.00 121.04 ? 108 ALA D CB    1 
ATOM   7103 N N     . MET D 1 87  ? -25.147 -27.158 -51.308 1.00 121.95 ? 109 MET D N     1 
ATOM   7104 C CA    . MET D 1 87  ? -25.084 -27.352 -49.875 1.00 122.80 ? 109 MET D CA    1 
ATOM   7105 C C     . MET D 1 87  ? -25.281 -28.815 -49.534 1.00 123.18 ? 109 MET D C     1 
ATOM   7106 O O     . MET D 1 87  ? -24.578 -29.343 -48.682 1.00 123.14 ? 109 MET D O     1 
ATOM   7107 C CB    . MET D 1 87  ? -26.181 -26.572 -49.188 1.00 122.94 ? 109 MET D CB    1 
ATOM   7108 C CG    . MET D 1 87  ? -26.175 -25.086 -49.418 1.00 124.02 ? 109 MET D CG    1 
ATOM   7109 S SD    . MET D 1 87  ? -27.904 -24.563 -49.492 1.00 126.04 ? 109 MET D SD    1 
ATOM   7110 C CE    . MET D 1 87  ? -28.750 -25.954 -48.682 1.00 124.80 ? 109 MET D CE    1 
ATOM   7111 N N     . ARG D 1 88  ? -26.250 -29.460 -50.183 1.00 123.96 ? 110 ARG D N     1 
ATOM   7112 C CA    . ARG D 1 88  ? -26.495 -30.882 -49.954 1.00 124.98 ? 110 ARG D CA    1 
ATOM   7113 C C     . ARG D 1 88  ? -25.194 -31.648 -50.120 1.00 125.58 ? 110 ARG D C     1 
ATOM   7114 O O     . ARG D 1 88  ? -24.795 -32.419 -49.246 1.00 125.68 ? 110 ARG D O     1 
ATOM   7115 C CB    . ARG D 1 88  ? -27.562 -31.433 -50.906 1.00 124.99 ? 110 ARG D CB    1 
ATOM   7116 C CG    . ARG D 1 88  ? -28.047 -32.840 -50.555 1.00 125.95 ? 110 ARG D CG    1 
ATOM   7117 C CD    . ARG D 1 88  ? -27.028 -33.914 -50.992 1.00 127.95 ? 110 ARG D CD    1 
ATOM   7118 N NE    . ARG D 1 88  ? -27.294 -35.235 -50.408 1.00 129.68 ? 110 ARG D NE    1 
ATOM   7119 C CZ    . ARG D 1 88  ? -26.812 -35.664 -49.226 1.00 130.31 ? 110 ARG D CZ    1 
ATOM   7120 N NH1   . ARG D 1 88  ? -27.117 -36.887 -48.804 1.00 130.12 ? 110 ARG D NH1   1 
ATOM   7121 N NH2   . ARG D 1 88  ? -26.030 -34.881 -48.461 1.00 131.30 ? 110 ARG D NH2   1 
ATOM   7122 N N     . GLN D 1 89  ? -24.546 -31.426 -51.258 1.00 126.44 ? 111 GLN D N     1 
ATOM   7123 C CA    . GLN D 1 89  ? -23.210 -31.930 -51.516 1.00 127.35 ? 111 GLN D CA    1 
ATOM   7124 C C     . GLN D 1 89  ? -22.316 -31.738 -50.288 1.00 127.47 ? 111 GLN D C     1 
ATOM   7125 O O     . GLN D 1 89  ? -21.850 -32.715 -49.692 1.00 127.42 ? 111 GLN D O     1 
ATOM   7126 C CB    . GLN D 1 89  ? -22.621 -31.202 -52.732 1.00 127.63 ? 111 GLN D CB    1 
ATOM   7127 C CG    . GLN D 1 89  ? -21.209 -31.612 -53.119 1.00 129.58 ? 111 GLN D CG    1 
ATOM   7128 C CD    . GLN D 1 89  ? -21.141 -33.013 -53.710 1.00 132.29 ? 111 GLN D CD    1 
ATOM   7129 O OE1   . GLN D 1 89  ? -20.848 -33.183 -54.896 1.00 133.50 ? 111 GLN D OE1   1 
ATOM   7130 N NE2   . GLN D 1 89  ? -21.417 -34.025 -52.886 1.00 133.75 ? 111 GLN D NE2   1 
ATOM   7131 N N     . ALA D 1 90  ? -22.129 -30.470 -49.910 1.00 127.78 ? 112 ALA D N     1 
ATOM   7132 C CA    . ALA D 1 90  ? -21.242 -30.037 -48.820 1.00 128.03 ? 112 ALA D CA    1 
ATOM   7133 C C     . ALA D 1 90  ? -21.345 -30.791 -47.493 1.00 128.22 ? 112 ALA D C     1 
ATOM   7134 O O     . ALA D 1 90  ? -20.326 -31.043 -46.843 1.00 128.11 ? 112 ALA D O     1 
ATOM   7135 C CB    . ALA D 1 90  ? -21.397 -28.538 -48.585 1.00 128.02 ? 112 ALA D CB    1 
ATOM   7136 N N     . TRP D 1 91  ? -22.566 -31.138 -47.090 1.00 128.70 ? 113 TRP D N     1 
ATOM   7137 C CA    . TRP D 1 91  ? -22.782 -31.868 -45.834 1.00 129.24 ? 113 TRP D CA    1 
ATOM   7138 C C     . TRP D 1 91  ? -22.379 -33.334 -45.932 1.00 129.80 ? 113 TRP D C     1 
ATOM   7139 O O     . TRP D 1 91  ? -21.857 -33.894 -44.966 1.00 129.84 ? 113 TRP D O     1 
ATOM   7140 C CB    . TRP D 1 91  ? -24.238 -31.769 -45.368 1.00 129.11 ? 113 TRP D CB    1 
ATOM   7141 C CG    . TRP D 1 91  ? -24.769 -30.371 -45.351 1.00 128.59 ? 113 TRP D CG    1 
ATOM   7142 C CD1   . TRP D 1 91  ? -24.164 -29.259 -44.806 1.00 128.00 ? 113 TRP D CD1   1 
ATOM   7143 C CD2   . TRP D 1 91  ? -26.019 -29.929 -45.900 1.00 127.97 ? 113 TRP D CD2   1 
ATOM   7144 N NE1   . TRP D 1 91  ? -24.961 -28.154 -44.995 1.00 127.80 ? 113 TRP D NE1   1 
ATOM   7145 C CE2   . TRP D 1 91  ? -26.106 -28.535 -45.662 1.00 127.82 ? 113 TRP D CE2   1 
ATOM   7146 C CE3   . TRP D 1 91  ? -27.073 -30.574 -46.579 1.00 127.70 ? 113 TRP D CE3   1 
ATOM   7147 C CZ2   . TRP D 1 91  ? -27.213 -27.772 -46.078 1.00 127.38 ? 113 TRP D CZ2   1 
ATOM   7148 C CZ3   . TRP D 1 91  ? -28.173 -29.814 -46.995 1.00 127.35 ? 113 TRP D CZ3   1 
ATOM   7149 C CH2   . TRP D 1 91  ? -28.232 -28.428 -46.739 1.00 127.11 ? 113 TRP D CH2   1 
ATOM   7150 N N     . SER D 1 92  ? -22.646 -33.957 -47.083 1.00 130.48 ? 114 SER D N     1 
ATOM   7151 C CA    . SER D 1 92  ? -22.121 -35.295 -47.366 1.00 131.06 ? 114 SER D CA    1 
ATOM   7152 C C     . SER D 1 92  ? -20.654 -35.226 -47.753 1.00 131.29 ? 114 SER D C     1 
ATOM   7153 O O     . SER D 1 92  ? -19.917 -36.222 -47.594 1.00 131.47 ? 114 SER D O     1 
ATOM   7154 C CB    . SER D 1 92  ? -22.930 -36.005 -48.442 1.00 131.05 ? 114 SER D CB    1 
ATOM   7155 O OG    . SER D 1 92  ? -23.996 -36.698 -47.823 1.00 131.54 ? 114 SER D OG    1 
ATOM   7156 N N     . LYS D 1 93  ? -20.235 -34.038 -48.233 1.00 131.49 ? 115 LYS D N     1 
ATOM   7157 C CA    . LYS D 1 93  ? -18.816 -33.724 -48.408 1.00 131.79 ? 115 LYS D CA    1 
ATOM   7158 C C     . LYS D 1 93  ? -18.118 -33.521 -47.050 1.00 131.97 ? 115 LYS D C     1 
ATOM   7159 O O     . LYS D 1 93  ? -16.936 -33.166 -46.997 1.00 132.06 ? 115 LYS D O     1 
ATOM   7160 C CB    . LYS D 1 93  ? -18.645 -32.479 -49.286 1.00 131.84 ? 115 LYS D CB    1 
ATOM   7161 C CG    . LYS D 1 93  ? -17.308 -32.386 -50.040 1.00 131.87 ? 115 LYS D CG    1 
ATOM   7162 C CD    . LYS D 1 93  ? -16.984 -30.950 -50.503 1.00 131.74 ? 115 LYS D CD    1 
ATOM   7163 C CE    . LYS D 1 93  ? -17.926 -30.434 -51.604 1.00 131.69 ? 115 LYS D CE    1 
ATOM   7164 N NZ    . LYS D 1 93  ? -17.756 -31.131 -52.911 1.00 131.48 ? 115 LYS D NZ    1 
ATOM   7165 N N     . SER D 1 94  ? -18.859 -33.740 -45.960 1.00 132.14 ? 116 SER D N     1 
ATOM   7166 C CA    . SER D 1 94  ? -18.304 -33.755 -44.600 1.00 132.14 ? 116 SER D CA    1 
ATOM   7167 C C     . SER D 1 94  ? -18.398 -35.174 -44.017 1.00 132.14 ? 116 SER D C     1 
ATOM   7168 O O     . SER D 1 94  ? -19.190 -36.013 -44.501 1.00 132.08 ? 116 SER D O     1 
ATOM   7169 C CB    . SER D 1 94  ? -19.036 -32.741 -43.704 1.00 132.14 ? 116 SER D CB    1 
ATOM   7170 O OG    . SER D 1 94  ? -18.262 -32.392 -42.568 1.00 131.95 ? 116 SER D OG    1 
ATOM   7171 N N     . GLY D 1 95  ? -17.573 -35.438 -42.992 1.00 132.17 ? 117 GLY D N     1 
ATOM   7172 C CA    . GLY D 1 95  ? -17.536 -36.748 -42.343 1.00 132.14 ? 117 GLY D CA    1 
ATOM   7173 C C     . GLY D 1 95  ? -17.225 -36.612 -40.867 1.00 132.10 ? 117 GLY D C     1 
ATOM   7174 O O     . GLY D 1 95  ? -17.184 -37.601 -40.134 1.00 132.06 ? 117 GLY D O     1 
ATOM   7175 N N     . ARG D 1 96  ? -16.980 -35.373 -40.449 1.00 132.20 ? 118 ARG D N     1 
ATOM   7176 C CA    . ARG D 1 96  ? -16.847 -35.026 -39.038 1.00 132.38 ? 118 ARG D CA    1 
ATOM   7177 C C     . ARG D 1 96  ? -18.001 -34.097 -38.636 1.00 132.42 ? 118 ARG D C     1 
ATOM   7178 O O     . ARG D 1 96  ? -18.050 -33.600 -37.506 1.00 132.34 ? 118 ARG D O     1 
ATOM   7179 C CB    . ARG D 1 96  ? -15.477 -34.381 -38.748 1.00 132.43 ? 118 ARG D CB    1 
ATOM   7180 C CG    . ARG D 1 96  ? -14.251 -35.206 -39.174 1.00 132.55 ? 118 ARG D CG    1 
ATOM   7181 C CD    . ARG D 1 96  ? -14.309 -36.647 -38.672 1.00 133.03 ? 118 ARG D CD    1 
ATOM   7182 N NE    . ARG D 1 96  ? -13.000 -37.297 -38.706 1.00 132.90 ? 118 ARG D NE    1 
ATOM   7183 C CZ    . ARG D 1 96  ? -12.170 -37.361 -37.667 1.00 132.95 ? 118 ARG D CZ    1 
ATOM   7184 N NH1   . ARG D 1 96  ? -12.505 -36.814 -36.501 1.00 132.76 ? 118 ARG D NH1   1 
ATOM   7185 N NH2   . ARG D 1 96  ? -10.999 -37.973 -37.790 1.00 133.15 ? 118 ARG D NH2   1 
ATOM   7186 N N     . GLU D 1 97  ? -18.917 -33.877 -39.584 1.00 132.46 ? 119 GLU D N     1 
ATOM   7187 C CA    . GLU D 1 97  ? -20.156 -33.110 -39.375 1.00 132.46 ? 119 GLU D CA    1 
ATOM   7188 C C     . GLU D 1 97  ? -21.394 -33.977 -39.676 1.00 132.35 ? 119 GLU D C     1 
ATOM   7189 O O     . GLU D 1 97  ? -22.448 -33.832 -39.038 1.00 132.26 ? 119 GLU D O     1 
ATOM   7190 C CB    . GLU D 1 97  ? -20.127 -31.809 -40.208 1.00 132.50 ? 119 GLU D CB    1 
ATOM   7191 C CG    . GLU D 1 97  ? -21.418 -31.447 -40.984 1.00 132.73 ? 119 GLU D CG    1 
ATOM   7192 C CD    . GLU D 1 97  ? -22.501 -30.778 -40.134 1.00 132.48 ? 119 GLU D CD    1 
ATOM   7193 O OE1   . GLU D 1 97  ? -22.240 -30.451 -38.947 1.00 132.92 ? 119 GLU D OE1   1 
ATOM   7194 O OE2   . GLU D 1 97  ? -23.616 -30.567 -40.670 1.00 131.39 ? 119 GLU D OE2   1 
ATOM   7195 N N     . LYS D 1 98  ? -21.245 -34.875 -40.650 1.00 132.18 ? 120 LYS D N     1 
ATOM   7196 C CA    . LYS D 1 98  ? -22.269 -35.862 -40.983 1.00 131.95 ? 120 LYS D CA    1 
ATOM   7197 C C     . LYS D 1 98  ? -22.264 -36.960 -39.921 1.00 131.97 ? 120 LYS D C     1 
ATOM   7198 O O     . LYS D 1 98  ? -23.308 -37.525 -39.595 1.00 131.97 ? 120 LYS D O     1 
ATOM   7199 C CB    . LYS D 1 98  ? -22.010 -36.439 -42.375 1.00 131.87 ? 120 LYS D CB    1 
ATOM   7200 C CG    . LYS D 1 98  ? -23.156 -37.234 -42.963 1.00 131.28 ? 120 LYS D CG    1 
ATOM   7201 C CD    . LYS D 1 98  ? -22.837 -37.668 -44.384 1.00 130.50 ? 120 LYS D CD    1 
ATOM   7202 C CE    . LYS D 1 98  ? -23.330 -39.081 -44.638 1.00 130.21 ? 120 LYS D CE    1 
ATOM   7203 N NZ    . LYS D 1 98  ? -22.777 -40.042 -43.631 1.00 129.46 ? 120 LYS D NZ    1 
ATOM   7204 N N     . LEU D 1 99  ? -21.071 -37.253 -39.399 1.00 131.89 ? 121 LEU D N     1 
ATOM   7205 C CA    . LEU D 1 99  ? -20.897 -38.034 -38.175 1.00 131.84 ? 121 LEU D CA    1 
ATOM   7206 C C     . LEU D 1 99  ? -21.974 -37.606 -37.174 1.00 131.85 ? 121 LEU D C     1 
ATOM   7207 O O     . LEU D 1 99  ? -22.820 -38.413 -36.767 1.00 131.76 ? 121 LEU D O     1 
ATOM   7208 C CB    . LEU D 1 99  ? -19.489 -37.762 -37.617 1.00 131.86 ? 121 LEU D CB    1 
ATOM   7209 C CG    . LEU D 1 99  ? -18.845 -38.499 -36.436 1.00 131.73 ? 121 LEU D CG    1 
ATOM   7210 C CD1   . LEU D 1 99  ? -17.327 -38.615 -36.655 1.00 131.46 ? 121 LEU D CD1   1 
ATOM   7211 C CD2   . LEU D 1 99  ? -19.148 -37.799 -35.114 1.00 131.37 ? 121 LEU D CD2   1 
ATOM   7212 N N     . ARG D 1 100 ? -21.950 -36.315 -36.838 1.00 131.86 ? 122 ARG D N     1 
ATOM   7213 C CA    . ARG D 1 100 ? -22.875 -35.681 -35.897 1.00 131.85 ? 122 ARG D CA    1 
ATOM   7214 C C     . ARG D 1 100 ? -24.325 -35.716 -36.352 1.00 131.58 ? 122 ARG D C     1 
ATOM   7215 O O     . ARG D 1 100 ? -25.235 -35.623 -35.529 1.00 131.61 ? 122 ARG D O     1 
ATOM   7216 C CB    . ARG D 1 100 ? -22.452 -34.229 -35.649 1.00 131.97 ? 122 ARG D CB    1 
ATOM   7217 C CG    . ARG D 1 100 ? -21.185 -34.093 -34.811 1.00 132.81 ? 122 ARG D CG    1 
ATOM   7218 C CD    . ARG D 1 100 ? -20.146 -33.207 -35.488 1.00 134.32 ? 122 ARG D CD    1 
ATOM   7219 N NE    . ARG D 1 100 ? -20.458 -31.769 -35.359 1.00 135.34 ? 122 ARG D NE    1 
ATOM   7220 C CZ    . ARG D 1 100 ? -19.892 -30.810 -36.097 1.00 135.62 ? 122 ARG D CZ    1 
ATOM   7221 N NH1   . ARG D 1 100 ? -18.973 -31.113 -37.046 1.00 135.53 ? 122 ARG D NH1   1 
ATOM   7222 N NH2   . ARG D 1 100 ? -20.256 -29.534 -35.892 1.00 135.79 ? 122 ARG D NH2   1 
ATOM   7223 N N     . LEU D 1 101 ? -24.534 -35.841 -37.659 1.00 131.24 ? 123 LEU D N     1 
ATOM   7224 C CA    . LEU D 1 101 ? -25.879 -35.909 -38.213 1.00 131.03 ? 123 LEU D CA    1 
ATOM   7225 C C     . LEU D 1 101 ? -26.369 -37.344 -38.334 1.00 130.86 ? 123 LEU D C     1 
ATOM   7226 O O     . LEU D 1 101 ? -27.568 -37.601 -38.201 1.00 130.68 ? 123 LEU D O     1 
ATOM   7227 C CB    . LEU D 1 101 ? -25.945 -35.204 -39.562 1.00 131.11 ? 123 LEU D CB    1 
ATOM   7228 C CG    . LEU D 1 101 ? -25.901 -33.679 -39.492 1.00 131.14 ? 123 LEU D CG    1 
ATOM   7229 C CD1   . LEU D 1 101 ? -25.473 -33.107 -40.831 1.00 131.21 ? 123 LEU D CD1   1 
ATOM   7230 C CD2   . LEU D 1 101 ? -27.247 -33.122 -39.056 1.00 130.72 ? 123 LEU D CD2   1 
ATOM   7231 N N     . ASP D 1 102 ? -25.439 -38.269 -38.595 1.00 130.65 ? 124 ASP D N     1 
ATOM   7232 C CA    . ASP D 1 102 ? -25.711 -39.707 -38.515 1.00 130.43 ? 124 ASP D CA    1 
ATOM   7233 C C     . ASP D 1 102 ? -26.132 -40.031 -37.093 1.00 130.15 ? 124 ASP D C     1 
ATOM   7234 O O     . ASP D 1 102 ? -26.938 -40.939 -36.852 1.00 130.07 ? 124 ASP D O     1 
ATOM   7235 C CB    . ASP D 1 102 ? -24.463 -40.513 -38.883 1.00 130.50 ? 124 ASP D CB    1 
ATOM   7236 C CG    . ASP D 1 102 ? -24.256 -40.612 -40.380 1.00 130.77 ? 124 ASP D CG    1 
ATOM   7237 O OD1   . ASP D 1 102 ? -25.266 -40.624 -41.125 1.00 131.27 ? 124 ASP D OD1   1 
ATOM   7238 O OD2   . ASP D 1 102 ? -23.084 -40.686 -40.812 1.00 130.77 ? 124 ASP D OD2   1 
ATOM   7239 N N     . GLU D 1 103 ? -25.565 -39.255 -36.170 1.00 129.63 ? 125 GLU D N     1 
ATOM   7240 C CA    . GLU D 1 103 ? -25.893 -39.271 -34.750 1.00 129.40 ? 125 GLU D CA    1 
ATOM   7241 C C     . GLU D 1 103 ? -27.207 -38.565 -34.404 1.00 128.79 ? 125 GLU D C     1 
ATOM   7242 O O     . GLU D 1 103 ? -27.882 -38.931 -33.433 1.00 128.60 ? 125 GLU D O     1 
ATOM   7243 C CB    . GLU D 1 103 ? -24.752 -38.619 -33.973 1.00 129.59 ? 125 GLU D CB    1 
ATOM   7244 C CG    . GLU D 1 103 ? -23.640 -39.581 -33.655 1.00 131.64 ? 125 GLU D CG    1 
ATOM   7245 C CD    . GLU D 1 103 ? -24.151 -40.766 -32.838 1.00 134.62 ? 125 GLU D CD    1 
ATOM   7246 O OE1   . GLU D 1 103 ? -24.294 -41.879 -33.428 1.00 135.73 ? 125 GLU D OE1   1 
ATOM   7247 O OE2   . GLU D 1 103 ? -24.437 -40.572 -31.619 1.00 135.98 ? 125 GLU D OE2   1 
ATOM   7248 N N     . ALA D 1 104 ? -27.551 -37.546 -35.196 1.00 128.22 ? 126 ALA D N     1 
ATOM   7249 C CA    . ALA D 1 104 ? -28.765 -36.757 -34.983 1.00 127.62 ? 126 ALA D CA    1 
ATOM   7250 C C     . ALA D 1 104 ? -30.032 -37.465 -35.481 1.00 127.24 ? 126 ALA D C     1 
ATOM   7251 O O     . ALA D 1 104 ? -31.158 -37.047 -35.148 1.00 127.05 ? 126 ALA D O     1 
ATOM   7252 C CB    . ALA D 1 104 ? -28.625 -35.384 -35.653 1.00 127.59 ? 126 ALA D CB    1 
ATOM   7253 N N     . GLY D 1 105 ? -29.841 -38.533 -36.273 1.00 126.87 ? 127 GLY D N     1 
ATOM   7254 C CA    . GLY D 1 105 ? -30.955 -39.200 -36.961 1.00 126.51 ? 127 GLY D CA    1 
ATOM   7255 C C     . GLY D 1 105 ? -31.105 -38.720 -38.403 1.00 126.34 ? 127 GLY D C     1 
ATOM   7256 O O     . GLY D 1 105 ? -31.889 -39.286 -39.184 1.00 126.25 ? 127 GLY D O     1 
ATOM   7257 N N     . VAL D 1 106 ? -30.347 -37.674 -38.749 1.00 126.15 ? 128 VAL D N     1 
ATOM   7258 C CA    . VAL D 1 106 ? -30.350 -37.087 -40.094 1.00 125.76 ? 128 VAL D CA    1 
ATOM   7259 C C     . VAL D 1 106 ? -29.438 -37.936 -40.991 1.00 125.81 ? 128 VAL D C     1 
ATOM   7260 O O     . VAL D 1 106 ? -28.234 -37.634 -41.158 1.00 125.82 ? 128 VAL D O     1 
ATOM   7261 C CB    . VAL D 1 106 ? -29.920 -35.570 -40.088 1.00 125.66 ? 128 VAL D CB    1 
ATOM   7262 C CG1   . VAL D 1 106 ? -30.355 -34.876 -41.367 1.00 125.15 ? 128 VAL D CG1   1 
ATOM   7263 C CG2   . VAL D 1 106 ? -30.501 -34.823 -38.880 1.00 125.45 ? 128 VAL D CG2   1 
ATOM   7264 N N     . THR D 1 107 ? -30.017 -39.016 -41.534 1.00 125.75 ? 129 THR D N     1 
ATOM   7265 C CA    . THR D 1 107 ? -29.290 -39.953 -42.403 1.00 125.74 ? 129 THR D CA    1 
ATOM   7266 C C     . THR D 1 107 ? -29.443 -39.578 -43.878 1.00 126.00 ? 129 THR D C     1 
ATOM   7267 O O     . THR D 1 107 ? -30.269 -38.724 -44.228 1.00 125.77 ? 129 THR D O     1 
ATOM   7268 C CB    . THR D 1 107 ? -29.746 -41.425 -42.194 1.00 125.54 ? 129 THR D CB    1 
ATOM   7269 O OG1   . THR D 1 107 ? -31.190 -41.509 -42.276 1.00 124.68 ? 129 THR D OG1   1 
ATOM   7270 C CG2   . THR D 1 107 ? -29.278 -41.946 -40.831 1.00 125.43 ? 129 THR D CG2   1 
ATOM   7271 N N     . ASP D 1 108 ? -28.634 -40.210 -44.731 1.00 126.39 ? 130 ASP D N     1 
ATOM   7272 C CA    . ASP D 1 108 ? -28.775 -40.079 -46.188 1.00 126.90 ? 130 ASP D CA    1 
ATOM   7273 C C     . ASP D 1 108 ? -30.261 -40.145 -46.640 1.00 126.71 ? 130 ASP D C     1 
ATOM   7274 O O     . ASP D 1 108 ? -30.757 -39.225 -47.292 1.00 126.73 ? 130 ASP D O     1 
ATOM   7275 C CB    . ASP D 1 108 ? -27.912 -41.130 -46.930 1.00 127.23 ? 130 ASP D CB    1 
ATOM   7276 C CG    . ASP D 1 108 ? -26.404 -40.760 -46.977 1.00 128.42 ? 130 ASP D CG    1 
ATOM   7277 O OD1   . ASP D 1 108 ? -26.057 -39.585 -47.264 1.00 129.78 ? 130 ASP D OD1   1 
ATOM   7278 O OD2   . ASP D 1 108 ? -25.557 -41.664 -46.756 1.00 129.84 ? 130 ASP D OD2   1 
ATOM   7279 N N     . GLU D 1 109 ? -30.959 -41.216 -46.259 1.00 126.51 ? 131 GLU D N     1 
ATOM   7280 C CA    . GLU D 1 109 ? -32.359 -41.448 -46.629 1.00 126.40 ? 131 GLU D CA    1 
ATOM   7281 C C     . GLU D 1 109 ? -33.228 -40.210 -46.445 1.00 125.78 ? 131 GLU D C     1 
ATOM   7282 O O     . GLU D 1 109 ? -33.845 -39.720 -47.412 1.00 125.69 ? 131 GLU D O     1 
ATOM   7283 C CB    . GLU D 1 109 ? -32.938 -42.599 -45.801 1.00 126.71 ? 131 GLU D CB    1 
ATOM   7284 C CG    . GLU D 1 109 ? -32.244 -43.933 -46.009 1.00 129.07 ? 131 GLU D CG    1 
ATOM   7285 C CD    . GLU D 1 109 ? -30.993 -44.106 -45.153 1.00 132.28 ? 131 GLU D CD    1 
ATOM   7286 O OE1   . GLU D 1 109 ? -29.912 -43.544 -45.526 1.00 133.49 ? 131 GLU D OE1   1 
ATOM   7287 O OE2   . GLU D 1 109 ? -31.085 -44.826 -44.115 1.00 133.86 ? 131 GLU D OE2   1 
ATOM   7288 N N     . VAL D 1 110 ? -33.257 -39.711 -45.198 1.00 125.28 ? 132 VAL D N     1 
ATOM   7289 C CA    . VAL D 1 110 ? -34.035 -38.521 -44.834 1.00 124.66 ? 132 VAL D CA    1 
ATOM   7290 C C     . VAL D 1 110 ? -33.613 -37.322 -45.681 1.00 124.39 ? 132 VAL D C     1 
ATOM   7291 O O     . VAL D 1 110 ? -34.449 -36.724 -46.360 1.00 124.23 ? 132 VAL D O     1 
ATOM   7292 C CB    . VAL D 1 110 ? -33.901 -38.161 -43.320 1.00 124.73 ? 132 VAL D CB    1 
ATOM   7293 C CG1   . VAL D 1 110 ? -34.851 -37.012 -42.943 1.00 124.28 ? 132 VAL D CG1   1 
ATOM   7294 C CG2   . VAL D 1 110 ? -34.149 -39.387 -42.433 1.00 124.64 ? 132 VAL D CG2   1 
ATOM   7295 N N     . LEU D 1 111 ? -32.320 -36.978 -45.641 1.00 124.04 ? 133 LEU D N     1 
ATOM   7296 C CA    . LEU D 1 111 ? -31.794 -35.910 -46.484 1.00 123.73 ? 133 LEU D CA    1 
ATOM   7297 C C     . LEU D 1 111 ? -32.431 -36.025 -47.869 1.00 123.56 ? 133 LEU D C     1 
ATOM   7298 O O     . LEU D 1 111 ? -33.035 -35.073 -48.370 1.00 123.51 ? 133 LEU D O     1 
ATOM   7299 C CB    . LEU D 1 111 ? -30.265 -35.995 -46.589 1.00 123.69 ? 133 LEU D CB    1 
ATOM   7300 C CG    . LEU D 1 111 ? -29.378 -35.473 -45.460 1.00 123.72 ? 133 LEU D CG    1 
ATOM   7301 C CD1   . LEU D 1 111 ? -27.927 -35.870 -45.709 1.00 124.43 ? 133 LEU D CD1   1 
ATOM   7302 C CD2   . LEU D 1 111 ? -29.489 -33.962 -45.324 1.00 123.91 ? 133 LEU D CD2   1 
ATOM   7303 N N     . ASP D 1 112 ? -32.323 -37.218 -48.451 1.00 123.35 ? 134 ASP D N     1 
ATOM   7304 C CA    . ASP D 1 112 ? -32.800 -37.485 -49.797 1.00 123.15 ? 134 ASP D CA    1 
ATOM   7305 C C     . ASP D 1 112 ? -34.298 -37.272 -49.909 1.00 122.76 ? 134 ASP D C     1 
ATOM   7306 O O     . ASP D 1 112 ? -34.763 -36.575 -50.807 1.00 122.75 ? 134 ASP D O     1 
ATOM   7307 C CB    . ASP D 1 112 ? -32.374 -38.888 -50.239 1.00 123.35 ? 134 ASP D CB    1 
ATOM   7308 C CG    . ASP D 1 112 ? -30.886 -38.919 -50.728 1.00 123.79 ? 134 ASP D CG    1 
ATOM   7309 O OD1   . ASP D 1 112 ? -30.159 -37.898 -50.577 1.00 124.33 ? 134 ASP D OD1   1 
ATOM   7310 O OD2   . ASP D 1 112 ? -30.436 -39.959 -51.269 1.00 124.19 ? 134 ASP D OD2   1 
ATOM   7311 N N     . ALA D 1 113 ? -35.049 -37.841 -48.977 1.00 122.36 ? 135 ALA D N     1 
ATOM   7312 C CA    . ALA D 1 113 ? -36.479 -37.601 -48.944 1.00 122.08 ? 135 ALA D CA    1 
ATOM   7313 C C     . ALA D 1 113 ? -36.780 -36.101 -48.926 1.00 121.89 ? 135 ALA D C     1 
ATOM   7314 O O     . ALA D 1 113 ? -37.606 -35.636 -49.700 1.00 121.81 ? 135 ALA D O     1 
ATOM   7315 C CB    . ALA D 1 113 ? -37.110 -38.302 -47.767 1.00 122.14 ? 135 ALA D CB    1 
ATOM   7316 N N     . ALA D 1 114 ? -36.086 -35.351 -48.071 1.00 121.74 ? 136 ALA D N     1 
ATOM   7317 C CA    . ALA D 1 114 ? -36.305 -33.908 -47.938 1.00 121.66 ? 136 ALA D CA    1 
ATOM   7318 C C     . ALA D 1 114 ? -35.966 -33.174 -49.218 1.00 121.75 ? 136 ALA D C     1 
ATOM   7319 O O     . ALA D 1 114 ? -36.690 -32.271 -49.634 1.00 121.66 ? 136 ALA D O     1 
ATOM   7320 C CB    . ALA D 1 114 ? -35.490 -33.348 -46.795 1.00 121.67 ? 136 ALA D CB    1 
ATOM   7321 N N     . MET D 1 115 ? -34.852 -33.561 -49.832 1.00 121.95 ? 137 MET D N     1 
ATOM   7322 C CA    . MET D 1 115 ? -34.438 -32.988 -51.104 1.00 122.03 ? 137 MET D CA    1 
ATOM   7323 C C     . MET D 1 115 ? -35.561 -33.186 -52.102 1.00 122.07 ? 137 MET D C     1 
ATOM   7324 O O     . MET D 1 115 ? -36.128 -32.209 -52.602 1.00 122.00 ? 137 MET D O     1 
ATOM   7325 C CB    . MET D 1 115 ? -33.149 -33.646 -51.612 1.00 122.05 ? 137 MET D CB    1 
ATOM   7326 C CG    . MET D 1 115 ? -31.883 -33.227 -50.880 1.00 122.07 ? 137 MET D CG    1 
ATOM   7327 S SD    . MET D 1 115 ? -31.579 -31.447 -50.918 1.00 122.61 ? 137 MET D SD    1 
ATOM   7328 C CE    . MET D 1 115 ? -30.820 -31.214 -52.529 1.00 122.39 ? 137 MET D CE    1 
ATOM   7329 N N     . GLN D 1 116 ? -35.886 -34.460 -52.357 1.00 122.16 ? 138 GLN D N     1 
ATOM   7330 C CA    . GLN D 1 116 ? -36.979 -34.841 -53.245 1.00 122.24 ? 138 GLN D CA    1 
ATOM   7331 C C     . GLN D 1 116 ? -38.062 -33.826 -53.073 1.00 121.87 ? 138 GLN D C     1 
ATOM   7332 O O     . GLN D 1 116 ? -38.362 -33.057 -53.979 1.00 121.75 ? 138 GLN D O     1 
ATOM   7333 C CB    . GLN D 1 116 ? -37.543 -36.213 -52.870 1.00 122.46 ? 138 GLN D CB    1 
ATOM   7334 C CG    . GLN D 1 116 ? -36.689 -37.393 -53.283 1.00 123.92 ? 138 GLN D CG    1 
ATOM   7335 C CD    . GLN D 1 116 ? -37.017 -38.671 -52.513 1.00 125.58 ? 138 GLN D CD    1 
ATOM   7336 O OE1   . GLN D 1 116 ? -37.560 -38.629 -51.406 1.00 126.12 ? 138 GLN D OE1   1 
ATOM   7337 N NE2   . GLN D 1 116 ? -36.685 -39.818 -53.103 1.00 126.22 ? 138 GLN D NE2   1 
ATOM   7338 N N     . ALA D 1 117 ? -38.614 -33.814 -51.867 1.00 121.76 ? 139 ALA D N     1 
ATOM   7339 C CA    . ALA D 1 117 ? -39.671 -32.896 -51.491 1.00 121.67 ? 139 ALA D CA    1 
ATOM   7340 C C     . ALA D 1 117 ? -39.319 -31.465 -51.864 1.00 121.51 ? 139 ALA D C     1 
ATOM   7341 O O     . ALA D 1 117 ? -40.118 -30.782 -52.505 1.00 121.54 ? 139 ALA D O     1 
ATOM   7342 C CB    . ALA D 1 117 ? -39.960 -33.000 -49.997 1.00 121.76 ? 139 ALA D CB    1 
ATOM   7343 N N     . PHE D 1 118 ? -38.125 -31.018 -51.481 1.00 121.22 ? 140 PHE D N     1 
ATOM   7344 C CA    . PHE D 1 118 ? -37.780 -29.630 -51.686 1.00 120.97 ? 140 PHE D CA    1 
ATOM   7345 C C     . PHE D 1 118 ? -37.829 -29.302 -53.149 1.00 120.89 ? 140 PHE D C     1 
ATOM   7346 O O     . PHE D 1 118 ? -38.514 -28.361 -53.578 1.00 120.87 ? 140 PHE D O     1 
ATOM   7347 C CB    . PHE D 1 118 ? -36.388 -29.316 -51.185 1.00 120.89 ? 140 PHE D CB    1 
ATOM   7348 C CG    . PHE D 1 118 ? -35.997 -27.903 -51.438 1.00 120.97 ? 140 PHE D CG    1 
ATOM   7349 C CD1   . PHE D 1 118 ? -36.214 -26.935 -50.465 1.00 121.19 ? 140 PHE D CD1   1 
ATOM   7350 C CD2   . PHE D 1 118 ? -35.468 -27.519 -52.666 1.00 120.88 ? 140 PHE D CD2   1 
ATOM   7351 C CE1   . PHE D 1 118 ? -35.878 -25.608 -50.690 1.00 121.24 ? 140 PHE D CE1   1 
ATOM   7352 C CE2   . PHE D 1 118 ? -35.135 -26.197 -52.905 1.00 121.05 ? 140 PHE D CE2   1 
ATOM   7353 C CZ    . PHE D 1 118 ? -35.340 -25.236 -51.913 1.00 121.21 ? 140 PHE D CZ    1 
ATOM   7354 N N     . ILE D 1 119 ? -37.077 -30.092 -53.907 1.00 120.87 ? 141 ILE D N     1 
ATOM   7355 C CA    . ILE D 1 119 ? -36.952 -29.868 -55.318 1.00 120.96 ? 141 ILE D CA    1 
ATOM   7356 C C     . ILE D 1 119 ? -38.313 -29.943 -56.005 1.00 121.04 ? 141 ILE D C     1 
ATOM   7357 O O     . ILE D 1 119 ? -38.815 -28.912 -56.492 1.00 120.98 ? 141 ILE D O     1 
ATOM   7358 C CB    . ILE D 1 119 ? -35.932 -30.831 -55.929 1.00 120.94 ? 141 ILE D CB    1 
ATOM   7359 C CG1   . ILE D 1 119 ? -34.584 -30.673 -55.211 1.00 120.81 ? 141 ILE D CG1   1 
ATOM   7360 C CG2   . ILE D 1 119 ? -35.768 -30.546 -57.407 1.00 121.11 ? 141 ILE D CG2   1 
ATOM   7361 C CD1   . ILE D 1 119 ? -33.642 -31.835 -55.398 1.00 120.56 ? 141 ILE D CD1   1 
ATOM   7362 N N     . LEU D 1 120 ? -38.923 -31.149 -56.009 1.00 121.27 ? 142 LEU D N     1 
ATOM   7363 C CA    . LEU D 1 120 ? -40.232 -31.336 -56.639 1.00 121.52 ? 142 LEU D CA    1 
ATOM   7364 C C     . LEU D 1 120 ? -41.074 -30.074 -56.556 1.00 121.59 ? 142 LEU D C     1 
ATOM   7365 O O     . LEU D 1 120 ? -41.516 -29.560 -57.579 1.00 121.60 ? 142 LEU D O     1 
ATOM   7366 C CB    . LEU D 1 120 ? -40.994 -32.510 -56.014 1.00 121.70 ? 142 LEU D CB    1 
ATOM   7367 C CG    . LEU D 1 120 ? -40.931 -33.899 -56.683 1.00 122.20 ? 142 LEU D CG    1 
ATOM   7368 C CD1   . LEU D 1 120 ? -41.284 -34.985 -55.671 1.00 123.20 ? 142 LEU D CD1   1 
ATOM   7369 C CD2   . LEU D 1 120 ? -41.888 -33.979 -57.886 1.00 122.73 ? 142 LEU D CD2   1 
ATOM   7370 N N     . GLU D 1 121 ? -41.260 -29.564 -55.338 1.00 121.86 ? 143 GLU D N     1 
ATOM   7371 C CA    . GLU D 1 121 ? -42.106 -28.393 -55.090 1.00 122.09 ? 143 GLU D CA    1 
ATOM   7372 C C     . GLU D 1 121 ? -41.738 -27.207 -55.973 1.00 121.78 ? 143 GLU D C     1 
ATOM   7373 O O     . GLU D 1 121 ? -42.615 -26.555 -56.553 1.00 121.81 ? 143 GLU D O     1 
ATOM   7374 C CB    . GLU D 1 121 ? -42.063 -27.972 -53.611 1.00 122.31 ? 143 GLU D CB    1 
ATOM   7375 C CG    . GLU D 1 121 ? -42.752 -28.935 -52.630 1.00 123.77 ? 143 GLU D CG    1 
ATOM   7376 C CD    . GLU D 1 121 ? -44.275 -29.057 -52.818 1.00 125.52 ? 143 GLU D CD    1 
ATOM   7377 O OE1   . GLU D 1 121 ? -44.912 -28.108 -53.339 1.00 126.16 ? 143 GLU D OE1   1 
ATOM   7378 O OE2   . GLU D 1 121 ? -44.839 -30.113 -52.420 1.00 126.04 ? 143 GLU D OE2   1 
ATOM   7379 N N     . VAL D 1 122 ? -40.441 -26.936 -56.080 1.00 121.54 ? 144 VAL D N     1 
ATOM   7380 C CA    . VAL D 1 122 ? -39.986 -25.805 -56.866 1.00 121.31 ? 144 VAL D CA    1 
ATOM   7381 C C     . VAL D 1 122 ? -40.419 -25.989 -58.312 1.00 121.33 ? 144 VAL D C     1 
ATOM   7382 O O     . VAL D 1 122 ? -41.039 -25.099 -58.903 1.00 121.36 ? 144 VAL D O     1 
ATOM   7383 C CB    . VAL D 1 122 ? -38.467 -25.644 -56.796 1.00 121.24 ? 144 VAL D CB    1 
ATOM   7384 C CG1   . VAL D 1 122 ? -38.046 -24.343 -57.512 1.00 121.24 ? 144 VAL D CG1   1 
ATOM   7385 C CG2   . VAL D 1 122 ? -38.000 -25.644 -55.328 1.00 120.99 ? 144 VAL D CG2   1 
ATOM   7386 N N     . ILE D 1 123 ? -40.110 -27.160 -58.867 1.00 121.37 ? 145 ILE D N     1 
ATOM   7387 C CA    . ILE D 1 123 ? -40.442 -27.476 -60.252 1.00 121.47 ? 145 ILE D CA    1 
ATOM   7388 C C     . ILE D 1 123 ? -41.940 -27.372 -60.493 1.00 121.76 ? 145 ILE D C     1 
ATOM   7389 O O     . ILE D 1 123 ? -42.388 -26.609 -61.362 1.00 121.83 ? 145 ILE D O     1 
ATOM   7390 C CB    . ILE D 1 123 ? -39.936 -28.879 -60.661 1.00 121.33 ? 145 ILE D CB    1 
ATOM   7391 C CG1   . ILE D 1 123 ? -38.391 -28.919 -60.630 1.00 121.03 ? 145 ILE D CG1   1 
ATOM   7392 C CG2   . ILE D 1 123 ? -40.462 -29.266 -62.055 1.00 121.39 ? 145 ILE D CG2   1 
ATOM   7393 C CD1   . ILE D 1 123 ? -37.841 -30.362 -60.792 1.00 120.08 ? 145 ILE D CD1   1 
ATOM   7394 N N     . ALA D 1 124 ? -42.706 -28.129 -59.703 1.00 122.08 ? 146 ALA D N     1 
ATOM   7395 C CA    . ALA D 1 124 ? -44.153 -28.125 -59.818 1.00 122.34 ? 146 ALA D CA    1 
ATOM   7396 C C     . ALA D 1 124 ? -44.693 -26.705 -59.806 1.00 122.67 ? 146 ALA D C     1 
ATOM   7397 O O     . ALA D 1 124 ? -45.356 -26.288 -60.761 1.00 122.80 ? 146 ALA D O     1 
ATOM   7398 C CB    . ALA D 1 124 ? -44.787 -28.950 -58.706 1.00 122.24 ? 146 ALA D CB    1 
ATOM   7399 N N     . LYS D 1 125 ? -44.359 -25.949 -58.756 1.00 123.20 ? 147 LYS D N     1 
ATOM   7400 C CA    . LYS D 1 125 ? -45.072 -24.709 -58.470 1.00 123.89 ? 147 LYS D CA    1 
ATOM   7401 C C     . LYS D 1 125 ? -44.590 -23.463 -59.199 1.00 124.04 ? 147 LYS D C     1 
ATOM   7402 O O     . LYS D 1 125 ? -45.373 -22.546 -59.438 1.00 124.03 ? 147 LYS D O     1 
ATOM   7403 C CB    . LYS D 1 125 ? -45.085 -24.438 -56.962 1.00 124.15 ? 147 LYS D CB    1 
ATOM   7404 C CG    . LYS D 1 125 ? -45.609 -25.593 -56.099 1.00 125.38 ? 147 LYS D CG    1 
ATOM   7405 C CD    . LYS D 1 125 ? -47.090 -25.876 -56.309 1.00 126.84 ? 147 LYS D CD    1 
ATOM   7406 C CE    . LYS D 1 125 ? -47.525 -27.105 -55.521 1.00 127.68 ? 147 LYS D CE    1 
ATOM   7407 N NZ    . LYS D 1 125 ? -47.577 -26.836 -54.053 1.00 127.78 ? 147 LYS D NZ    1 
ATOM   7408 N N     . HIS D 1 126 ? -43.313 -23.411 -59.548 1.00 124.47 ? 148 HIS D N     1 
ATOM   7409 C CA    . HIS D 1 126 ? -42.752 -22.150 -60.011 1.00 124.89 ? 148 HIS D CA    1 
ATOM   7410 C C     . HIS D 1 126 ? -43.241 -21.778 -61.408 1.00 125.69 ? 148 HIS D C     1 
ATOM   7411 O O     . HIS D 1 126 ? -43.109 -20.628 -61.821 1.00 125.78 ? 148 HIS D O     1 
ATOM   7412 C CB    . HIS D 1 126 ? -41.228 -22.170 -59.941 1.00 124.51 ? 148 HIS D CB    1 
ATOM   7413 C CG    . HIS D 1 126 ? -40.589 -22.801 -61.129 1.00 123.24 ? 148 HIS D CG    1 
ATOM   7414 N ND1   . HIS D 1 126 ? -39.853 -22.074 -62.046 1.00 122.14 ? 148 HIS D ND1   1 
ATOM   7415 C CD2   . HIS D 1 126 ? -40.604 -24.086 -61.571 1.00 122.28 ? 148 HIS D CD2   1 
ATOM   7416 C CE1   . HIS D 1 126 ? -39.424 -22.887 -62.996 1.00 121.84 ? 148 HIS D CE1   1 
ATOM   7417 N NE2   . HIS D 1 126 ? -39.866 -24.114 -62.733 1.00 121.81 ? 148 HIS D NE2   1 
ATOM   7418 N N     . GLY D 1 127 ? -43.812 -22.752 -62.125 1.00 126.63 ? 149 GLY D N     1 
ATOM   7419 C CA    . GLY D 1 127 ? -44.391 -22.496 -63.443 1.00 127.97 ? 149 GLY D CA    1 
ATOM   7420 C C     . GLY D 1 127 ? -45.795 -23.057 -63.560 1.00 128.92 ? 149 GLY D C     1 
ATOM   7421 O O     . GLY D 1 127 ? -46.343 -23.563 -62.580 1.00 128.92 ? 149 GLY D O     1 
ATOM   7422 N N     . GLU D 1 128 ? -46.378 -22.954 -64.757 1.00 129.93 ? 150 GLU D N     1 
ATOM   7423 C CA    . GLU D 1 128 ? -47.686 -23.555 -65.060 1.00 130.97 ? 150 GLU D CA    1 
ATOM   7424 C C     . GLU D 1 128 ? -47.587 -25.085 -65.013 1.00 131.07 ? 150 GLU D C     1 
ATOM   7425 O O     . GLU D 1 128 ? -46.525 -25.647 -65.286 1.00 131.21 ? 150 GLU D O     1 
ATOM   7426 C CB    . GLU D 1 128 ? -48.173 -23.130 -66.454 1.00 131.27 ? 150 GLU D CB    1 
ATOM   7427 C CG    . GLU D 1 128 ? -48.694 -21.705 -66.566 1.00 133.33 ? 150 GLU D CG    1 
ATOM   7428 C CD    . GLU D 1 128 ? -49.310 -21.451 -67.935 1.00 136.34 ? 150 GLU D CD    1 
ATOM   7429 O OE1   . GLU D 1 128 ? -50.311 -22.138 -68.260 1.00 138.02 ? 150 GLU D OE1   1 
ATOM   7430 O OE2   . GLU D 1 128 ? -48.790 -20.650 -68.697 1.00 137.63 ? 150 GLU D OE2   1 
ATOM   7431 N N     . PRO D 1 129 ? -48.691 -25.773 -64.670 1.00 131.17 ? 151 PRO D N     1 
ATOM   7432 C CA    . PRO D 1 129 ? -48.572 -27.236 -64.606 1.00 131.14 ? 151 PRO D CA    1 
ATOM   7433 C C     . PRO D 1 129 ? -48.380 -27.859 -65.988 1.00 131.00 ? 151 PRO D C     1 
ATOM   7434 O O     . PRO D 1 129 ? -48.683 -27.226 -67.000 1.00 131.01 ? 151 PRO D O     1 
ATOM   7435 C CB    . PRO D 1 129 ? -49.901 -27.681 -63.971 1.00 131.26 ? 151 PRO D CB    1 
ATOM   7436 C CG    . PRO D 1 129 ? -50.836 -26.527 -64.149 1.00 131.43 ? 151 PRO D CG    1 
ATOM   7437 C CD    . PRO D 1 129 ? -50.006 -25.285 -64.206 1.00 131.24 ? 151 PRO D CD    1 
ATOM   7438 N N     . ALA D 1 130 ? -47.847 -29.075 -66.015 1.00 130.85 ? 152 ALA D N     1 
ATOM   7439 C CA    . ALA D 1 130 ? -47.713 -29.854 -67.243 1.00 130.85 ? 152 ALA D CA    1 
ATOM   7440 C C     . ALA D 1 130 ? -47.745 -31.339 -66.901 1.00 130.92 ? 152 ALA D C     1 
ATOM   7441 O O     . ALA D 1 130 ? -47.486 -31.706 -65.759 1.00 130.99 ? 152 ALA D O     1 
ATOM   7442 C CB    . ALA D 1 130 ? -46.435 -29.504 -67.959 1.00 130.82 ? 152 ALA D CB    1 
ATOM   7443 N N     . ARG D 1 131 ? -48.077 -32.186 -67.884 1.00 131.00 ? 153 ARG D N     1 
ATOM   7444 C CA    . ARG D 1 131 ? -48.112 -33.642 -67.687 1.00 131.07 ? 153 ARG D CA    1 
ATOM   7445 C C     . ARG D 1 131 ? -46.683 -34.178 -67.522 1.00 130.35 ? 153 ARG D C     1 
ATOM   7446 O O     . ARG D 1 131 ? -46.430 -35.112 -66.741 1.00 130.27 ? 153 ARG D O     1 
ATOM   7447 C CB    . ARG D 1 131 ? -48.840 -34.341 -68.853 1.00 131.54 ? 153 ARG D CB    1 
ATOM   7448 C CG    . ARG D 1 131 ? -49.163 -35.823 -68.616 1.00 133.72 ? 153 ARG D CG    1 
ATOM   7449 C CD    . ARG D 1 131 ? -49.526 -36.564 -69.912 1.00 137.88 ? 153 ARG D CD    1 
ATOM   7450 N NE    . ARG D 1 131 ? -48.411 -36.646 -70.867 1.00 141.02 ? 153 ARG D NE    1 
ATOM   7451 C CZ    . ARG D 1 131 ? -47.376 -37.484 -70.770 1.00 142.48 ? 153 ARG D CZ    1 
ATOM   7452 N NH1   . ARG D 1 131 ? -47.274 -38.335 -69.746 1.00 143.26 ? 153 ARG D NH1   1 
ATOM   7453 N NH2   . ARG D 1 131 ? -46.427 -37.463 -71.702 1.00 142.87 ? 153 ARG D NH2   1 
ATOM   7454 N N     . VAL D 1 132 ? -45.757 -33.568 -68.264 1.00 129.52 ? 154 VAL D N     1 
ATOM   7455 C CA    . VAL D 1 132 ? -44.337 -33.859 -68.127 1.00 128.55 ? 154 VAL D CA    1 
ATOM   7456 C C     . VAL D 1 132 ? -43.634 -32.611 -67.601 1.00 127.73 ? 154 VAL D C     1 
ATOM   7457 O O     . VAL D 1 132 ? -43.639 -31.558 -68.257 1.00 127.54 ? 154 VAL D O     1 
ATOM   7458 C CB    . VAL D 1 132 ? -43.698 -34.287 -69.460 1.00 128.66 ? 154 VAL D CB    1 
ATOM   7459 C CG1   . VAL D 1 132 ? -42.294 -34.805 -69.225 1.00 128.61 ? 154 VAL D CG1   1 
ATOM   7460 C CG2   . VAL D 1 132 ? -44.537 -35.350 -70.166 1.00 128.83 ? 154 VAL D CG2   1 
ATOM   7461 N N     . LEU D 1 133 ? -43.043 -32.738 -66.410 1.00 126.67 ? 155 LEU D N     1 
ATOM   7462 C CA    . LEU D 1 133 ? -42.313 -31.634 -65.784 1.00 125.64 ? 155 LEU D CA    1 
ATOM   7463 C C     . LEU D 1 133 ? -40.826 -31.695 -66.038 1.00 124.98 ? 155 LEU D C     1 
ATOM   7464 O O     . LEU D 1 133 ? -40.206 -32.758 -65.967 1.00 124.78 ? 155 LEU D O     1 
ATOM   7465 C CB    . LEU D 1 133 ? -42.552 -31.573 -64.274 1.00 125.61 ? 155 LEU D CB    1 
ATOM   7466 C CG    . LEU D 1 133 ? -43.739 -30.702 -63.753 1.00 125.40 ? 155 LEU D CG    1 
ATOM   7467 C CD1   . LEU D 1 133 ? -43.796 -30.829 -62.242 1.00 125.41 ? 155 LEU D CD1   1 
ATOM   7468 C CD2   . LEU D 1 133 ? -43.663 -29.200 -64.139 1.00 124.88 ? 155 LEU D CD2   1 
ATOM   7469 N N     . CYS D 1 134 ? -40.268 -30.525 -66.316 1.00 124.17 ? 156 CYS D N     1 
ATOM   7470 C CA    . CYS D 1 134 ? -38.871 -30.389 -66.647 1.00 123.45 ? 156 CYS D CA    1 
ATOM   7471 C C     . CYS D 1 134 ? -38.287 -29.190 -65.937 1.00 123.02 ? 156 CYS D C     1 
ATOM   7472 O O     . CYS D 1 134 ? -39.013 -28.272 -65.561 1.00 122.99 ? 156 CYS D O     1 
ATOM   7473 C CB    . CYS D 1 134 ? -38.710 -30.195 -68.146 1.00 123.47 ? 156 CYS D CB    1 
ATOM   7474 S SG    . CYS D 1 134 ? -37.280 -29.193 -68.572 1.00 123.23 ? 156 CYS D SG    1 
ATOM   7475 N N     . ASN D 1 135 ? -36.968 -29.201 -65.773 1.00 122.45 ? 157 ASN D N     1 
ATOM   7476 C CA    . ASN D 1 135 ? -36.256 -28.083 -65.178 1.00 121.90 ? 157 ASN D CA    1 
ATOM   7477 C C     . ASN D 1 135 ? -34.947 -27.796 -65.872 1.00 121.52 ? 157 ASN D C     1 
ATOM   7478 O O     . ASN D 1 135 ? -34.180 -28.720 -66.205 1.00 121.51 ? 157 ASN D O     1 
ATOM   7479 C CB    . ASN D 1 135 ? -35.965 -28.342 -63.704 1.00 121.97 ? 157 ASN D CB    1 
ATOM   7480 C CG    . ASN D 1 135 ? -35.080 -27.271 -63.106 1.00 121.90 ? 157 ASN D CG    1 
ATOM   7481 O OD1   . ASN D 1 135 ? -33.874 -27.486 -62.922 1.00 121.96 ? 157 ASN D OD1   1 
ATOM   7482 N ND2   . ASN D 1 135 ? -35.666 -26.095 -62.834 1.00 121.59 ? 157 ASN D ND2   1 
ATOM   7483 N N     . LYS D 1 136 ? -34.681 -26.502 -66.053 1.00 121.03 ? 158 LYS D N     1 
ATOM   7484 C CA    . LYS D 1 136 ? -33.425 -26.088 -66.629 1.00 120.53 ? 158 LYS D CA    1 
ATOM   7485 C C     . LYS D 1 136 ? -32.682 -25.143 -65.704 1.00 120.37 ? 158 LYS D C     1 
ATOM   7486 O O     . LYS D 1 136 ? -33.069 -23.986 -65.535 1.00 120.24 ? 158 LYS D O     1 
ATOM   7487 C CB    . LYS D 1 136 ? -33.653 -25.445 -67.994 1.00 120.47 ? 158 LYS D CB    1 
ATOM   7488 C CG    . LYS D 1 136 ? -32.416 -25.419 -68.885 1.00 120.06 ? 158 LYS D CG    1 
ATOM   7489 C CD    . LYS D 1 136 ? -31.523 -24.215 -68.612 1.00 119.79 ? 158 LYS D CD    1 
ATOM   7490 C CE    . LYS D 1 136 ? -32.163 -22.916 -69.095 1.00 119.61 ? 158 LYS D CE    1 
ATOM   7491 N NZ    . LYS D 1 136 ? -31.213 -21.767 -69.021 1.00 119.57 ? 158 LYS D NZ    1 
ATOM   7492 N N     . ASP D 1 137 ? -31.623 -25.672 -65.097 1.00 120.23 ? 159 ASP D N     1 
ATOM   7493 C CA    . ASP D 1 137 ? -30.609 -24.884 -64.396 1.00 120.14 ? 159 ASP D CA    1 
ATOM   7494 C C     . ASP D 1 137 ? -29.245 -25.447 -64.774 1.00 119.90 ? 159 ASP D C     1 
ATOM   7495 O O     . ASP D 1 137 ? -28.847 -26.495 -64.261 1.00 119.96 ? 159 ASP D O     1 
ATOM   7496 C CB    . ASP D 1 137 ? -30.793 -24.942 -62.878 1.00 120.17 ? 159 ASP D CB    1 
ATOM   7497 C CG    . ASP D 1 137 ? -31.597 -23.779 -62.339 1.00 120.52 ? 159 ASP D CG    1 
ATOM   7498 O OD1   . ASP D 1 137 ? -31.083 -22.635 -62.347 1.00 120.68 ? 159 ASP D OD1   1 
ATOM   7499 O OD2   . ASP D 1 137 ? -32.737 -24.019 -61.886 1.00 121.30 ? 159 ASP D OD2   1 
ATOM   7500 N N     . PRO D 1 138 ? -28.519 -24.747 -65.665 1.00 119.57 ? 160 PRO D N     1 
ATOM   7501 C CA    . PRO D 1 138 ? -27.300 -25.279 -66.244 1.00 119.38 ? 160 PRO D CA    1 
ATOM   7502 C C     . PRO D 1 138 ? -26.569 -26.304 -65.355 1.00 119.38 ? 160 PRO D C     1 
ATOM   7503 O O     . PRO D 1 138 ? -26.506 -27.486 -65.706 1.00 119.26 ? 160 PRO D O     1 
ATOM   7504 C CB    . PRO D 1 138 ? -26.458 -24.019 -66.447 1.00 119.34 ? 160 PRO D CB    1 
ATOM   7505 C CG    . PRO D 1 138 ? -27.446 -22.983 -66.775 1.00 119.15 ? 160 PRO D CG    1 
ATOM   7506 C CD    . PRO D 1 138 ? -28.704 -23.320 -66.006 1.00 119.43 ? 160 PRO D CD    1 
ATOM   7507 N N     . PHE D 1 139 ? -26.069 -25.870 -64.199 1.00 119.37 ? 161 PHE D N     1 
ATOM   7508 C CA    . PHE D 1 139 ? -25.106 -26.672 -63.445 1.00 119.53 ? 161 PHE D CA    1 
ATOM   7509 C C     . PHE D 1 139 ? -25.666 -27.873 -62.711 1.00 119.74 ? 161 PHE D C     1 
ATOM   7510 O O     . PHE D 1 139 ? -24.924 -28.613 -62.068 1.00 119.62 ? 161 PHE D O     1 
ATOM   7511 C CB    . PHE D 1 139 ? -24.301 -25.788 -62.502 1.00 119.54 ? 161 PHE D CB    1 
ATOM   7512 C CG    . PHE D 1 139 ? -23.265 -24.972 -63.204 1.00 119.61 ? 161 PHE D CG    1 
ATOM   7513 C CD1   . PHE D 1 139 ? -22.060 -25.552 -63.597 1.00 119.40 ? 161 PHE D CD1   1 
ATOM   7514 C CD2   . PHE D 1 139 ? -23.496 -23.628 -63.496 1.00 119.70 ? 161 PHE D CD2   1 
ATOM   7515 C CE1   . PHE D 1 139 ? -21.094 -24.804 -64.263 1.00 119.39 ? 161 PHE D CE1   1 
ATOM   7516 C CE2   . PHE D 1 139 ? -22.531 -22.868 -64.162 1.00 119.55 ? 161 PHE D CE2   1 
ATOM   7517 C CZ    . PHE D 1 139 ? -21.328 -23.459 -64.545 1.00 119.41 ? 161 PHE D CZ    1 
ATOM   7518 N N     . THR D 1 140 ? -26.974 -28.071 -62.818 1.00 120.20 ? 162 THR D N     1 
ATOM   7519 C CA    . THR D 1 140 ? -27.628 -29.233 -62.216 1.00 120.64 ? 162 THR D CA    1 
ATOM   7520 C C     . THR D 1 140 ? -26.966 -30.513 -62.700 1.00 120.91 ? 162 THR D C     1 
ATOM   7521 O O     . THR D 1 140 ? -26.725 -31.451 -61.932 1.00 120.82 ? 162 THR D O     1 
ATOM   7522 C CB    . THR D 1 140 ? -29.135 -29.295 -62.570 1.00 120.58 ? 162 THR D CB    1 
ATOM   7523 O OG1   . THR D 1 140 ? -29.308 -29.063 -63.980 1.00 120.50 ? 162 THR D OG1   1 
ATOM   7524 C CG2   . THR D 1 140 ? -29.922 -28.252 -61.775 1.00 120.53 ? 162 THR D CG2   1 
ATOM   7525 N N     . LEU D 1 141 ? -26.649 -30.520 -63.985 1.00 121.31 ? 163 LEU D N     1 
ATOM   7526 C CA    . LEU D 1 141 ? -26.122 -31.692 -64.635 1.00 121.86 ? 163 LEU D CA    1 
ATOM   7527 C C     . LEU D 1 141 ? -24.838 -32.155 -63.955 1.00 122.14 ? 163 LEU D C     1 
ATOM   7528 O O     . LEU D 1 141 ? -24.332 -33.245 -64.237 1.00 122.23 ? 163 LEU D O     1 
ATOM   7529 C CB    . LEU D 1 141 ? -25.927 -31.401 -66.132 1.00 122.01 ? 163 LEU D CB    1 
ATOM   7530 C CG    . LEU D 1 141 ? -27.149 -31.464 -67.095 1.00 122.31 ? 163 LEU D CG    1 
ATOM   7531 C CD1   . LEU D 1 141 ? -27.169 -32.753 -67.935 1.00 122.56 ? 163 LEU D CD1   1 
ATOM   7532 C CD2   . LEU D 1 141 ? -28.524 -31.269 -66.418 1.00 122.30 ? 163 LEU D CD2   1 
ATOM   7533 N N     . LYS D 1 142 ? -24.335 -31.328 -63.038 1.00 122.54 ? 164 LYS D N     1 
ATOM   7534 C CA    . LYS D 1 142 ? -23.180 -31.687 -62.217 1.00 123.01 ? 164 LYS D CA    1 
ATOM   7535 C C     . LYS D 1 142 ? -23.537 -32.768 -61.212 1.00 122.91 ? 164 LYS D C     1 
ATOM   7536 O O     . LYS D 1 142 ? -22.668 -33.483 -60.724 1.00 122.91 ? 164 LYS D O     1 
ATOM   7537 C CB    . LYS D 1 142 ? -22.637 -30.471 -61.461 1.00 123.22 ? 164 LYS D CB    1 
ATOM   7538 C CG    . LYS D 1 142 ? -22.024 -29.387 -62.340 1.00 124.74 ? 164 LYS D CG    1 
ATOM   7539 C CD    . LYS D 1 142 ? -20.971 -28.591 -61.579 1.00 127.76 ? 164 LYS D CD    1 
ATOM   7540 C CE    . LYS D 1 142 ? -19.612 -29.339 -61.548 1.00 129.78 ? 164 LYS D CE    1 
ATOM   7541 N NZ    . LYS D 1 142 ? -18.450 -28.497 -61.083 1.00 131.34 ? 164 LYS D NZ    1 
ATOM   7542 N N     . SER D 1 143 ? -24.822 -32.878 -60.908 1.00 122.93 ? 165 SER D N     1 
ATOM   7543 C CA    . SER D 1 143 ? -25.280 -33.729 -59.823 1.00 122.91 ? 165 SER D CA    1 
ATOM   7544 C C     . SER D 1 143 ? -26.242 -34.785 -60.337 1.00 122.87 ? 165 SER D C     1 
ATOM   7545 O O     . SER D 1 143 ? -26.972 -35.408 -59.565 1.00 122.72 ? 165 SER D O     1 
ATOM   7546 C CB    . SER D 1 143 ? -25.961 -32.871 -58.763 1.00 122.90 ? 165 SER D CB    1 
ATOM   7547 O OG    . SER D 1 143 ? -25.309 -31.616 -58.646 1.00 123.01 ? 165 SER D OG    1 
ATOM   7548 N N     . SER D 1 144 ? -26.217 -34.991 -61.649 1.00 122.90 ? 166 SER D N     1 
ATOM   7549 C CA    . SER D 1 144 ? -27.141 -35.905 -62.316 1.00 122.95 ? 166 SER D CA    1 
ATOM   7550 C C     . SER D 1 144 ? -27.158 -37.343 -61.766 1.00 122.91 ? 166 SER D C     1 
ATOM   7551 O O     . SER D 1 144 ? -28.217 -37.960 -61.678 1.00 122.97 ? 166 SER D O     1 
ATOM   7552 C CB    . SER D 1 144 ? -26.900 -35.897 -63.829 1.00 122.90 ? 166 SER D CB    1 
ATOM   7553 O OG    . SER D 1 144 ? -25.512 -35.958 -64.131 1.00 123.09 ? 166 SER D OG    1 
ATOM   7554 N N     . VAL D 1 145 ? -25.999 -37.873 -61.392 1.00 122.91 ? 167 VAL D N     1 
ATOM   7555 C CA    . VAL D 1 145 ? -25.933 -39.220 -60.825 1.00 122.89 ? 167 VAL D CA    1 
ATOM   7556 C C     . VAL D 1 145 ? -26.799 -39.307 -59.572 1.00 122.96 ? 167 VAL D C     1 
ATOM   7557 O O     . VAL D 1 145 ? -27.557 -40.264 -59.394 1.00 122.99 ? 167 VAL D O     1 
ATOM   7558 C CB    . VAL D 1 145 ? -24.478 -39.635 -60.513 1.00 122.88 ? 167 VAL D CB    1 
ATOM   7559 C CG1   . VAL D 1 145 ? -24.436 -40.780 -59.518 1.00 123.06 ? 167 VAL D CG1   1 
ATOM   7560 C CG2   . VAL D 1 145 ? -23.758 -40.031 -61.790 1.00 122.94 ? 167 VAL D CG2   1 
ATOM   7561 N N     . TYR D 1 146 ? -26.685 -38.291 -58.720 1.00 123.10 ? 168 TYR D N     1 
ATOM   7562 C CA    . TYR D 1 146 ? -27.487 -38.185 -57.511 1.00 123.30 ? 168 TYR D CA    1 
ATOM   7563 C C     . TYR D 1 146 ? -28.949 -37.929 -57.861 1.00 123.53 ? 168 TYR D C     1 
ATOM   7564 O O     . TYR D 1 146 ? -29.838 -38.606 -57.344 1.00 123.60 ? 168 TYR D O     1 
ATOM   7565 C CB    . TYR D 1 146 ? -26.938 -37.075 -56.609 1.00 123.35 ? 168 TYR D CB    1 
ATOM   7566 C CG    . TYR D 1 146 ? -27.777 -36.765 -55.378 1.00 123.52 ? 168 TYR D CG    1 
ATOM   7567 C CD1   . TYR D 1 146 ? -27.828 -37.652 -54.298 1.00 123.67 ? 168 TYR D CD1   1 
ATOM   7568 C CD2   . TYR D 1 146 ? -28.502 -35.571 -55.285 1.00 123.60 ? 168 TYR D CD2   1 
ATOM   7569 C CE1   . TYR D 1 146 ? -28.592 -37.365 -53.164 1.00 123.74 ? 168 TYR D CE1   1 
ATOM   7570 C CE2   . TYR D 1 146 ? -29.267 -35.271 -54.155 1.00 123.75 ? 168 TYR D CE2   1 
ATOM   7571 C CZ    . TYR D 1 146 ? -29.308 -36.171 -53.098 1.00 123.85 ? 168 TYR D CZ    1 
ATOM   7572 O OH    . TYR D 1 146 ? -30.068 -35.875 -51.981 1.00 123.68 ? 168 TYR D OH    1 
ATOM   7573 N N     . LEU D 1 147 ? -29.192 -36.962 -58.747 1.00 123.75 ? 169 LEU D N     1 
ATOM   7574 C CA    . LEU D 1 147 ? -30.545 -36.634 -59.189 1.00 123.84 ? 169 LEU D CA    1 
ATOM   7575 C C     . LEU D 1 147 ? -31.276 -37.864 -59.675 1.00 124.31 ? 169 LEU D C     1 
ATOM   7576 O O     . LEU D 1 147 ? -32.421 -38.075 -59.314 1.00 124.39 ? 169 LEU D O     1 
ATOM   7577 C CB    . LEU D 1 147 ? -30.511 -35.583 -60.292 1.00 123.59 ? 169 LEU D CB    1 
ATOM   7578 C CG    . LEU D 1 147 ? -30.826 -34.127 -59.952 1.00 123.13 ? 169 LEU D CG    1 
ATOM   7579 C CD1   . LEU D 1 147 ? -30.386 -33.743 -58.523 1.00 123.08 ? 169 LEU D CD1   1 
ATOM   7580 C CD2   . LEU D 1 147 ? -30.161 -33.215 -60.993 1.00 122.92 ? 169 LEU D CD2   1 
ATOM   7581 N N     . SER D 1 148 ? -30.593 -38.681 -60.474 1.00 125.07 ? 170 SER D N     1 
ATOM   7582 C CA    . SER D 1 148 ? -31.162 -39.903 -61.037 1.00 125.92 ? 170 SER D CA    1 
ATOM   7583 C C     . SER D 1 148 ? -31.550 -40.907 -59.970 1.00 126.32 ? 170 SER D C     1 
ATOM   7584 O O     . SER D 1 148 ? -32.498 -41.677 -60.148 1.00 126.47 ? 170 SER D O     1 
ATOM   7585 C CB    . SER D 1 148 ? -30.176 -40.566 -61.993 1.00 126.00 ? 170 SER D CB    1 
ATOM   7586 O OG    . SER D 1 148 ? -30.615 -41.883 -62.309 1.00 126.71 ? 170 SER D OG    1 
ATOM   7587 N N     . ARG D 1 149 ? -30.797 -40.916 -58.877 1.00 126.82 ? 171 ARG D N     1 
ATOM   7588 C CA    . ARG D 1 149 ? -31.139 -41.747 -57.732 1.00 127.46 ? 171 ARG D CA    1 
ATOM   7589 C C     . ARG D 1 149 ? -32.361 -41.193 -57.007 1.00 127.00 ? 171 ARG D C     1 
ATOM   7590 O O     . ARG D 1 149 ? -33.217 -41.956 -56.546 1.00 126.94 ? 171 ARG D O     1 
ATOM   7591 C CB    . ARG D 1 149 ? -29.961 -41.851 -56.771 1.00 127.93 ? 171 ARG D CB    1 
ATOM   7592 C CG    . ARG D 1 149 ? -28.811 -42.639 -57.328 1.00 130.36 ? 171 ARG D CG    1 
ATOM   7593 C CD    . ARG D 1 149 ? -28.118 -43.380 -56.212 1.00 134.73 ? 171 ARG D CD    1 
ATOM   7594 N NE    . ARG D 1 149 ? -26.959 -44.125 -56.699 1.00 137.58 ? 171 ARG D NE    1 
ATOM   7595 C CZ    . ARG D 1 149 ? -25.737 -43.612 -56.827 1.00 138.97 ? 171 ARG D CZ    1 
ATOM   7596 N NH1   . ARG D 1 149 ? -25.491 -42.337 -56.510 1.00 139.70 ? 171 ARG D NH1   1 
ATOM   7597 N NH2   . ARG D 1 149 ? -24.756 -44.382 -57.274 1.00 139.84 ? 171 ARG D NH2   1 
ATOM   7598 N N     . LEU D 1 150 ? -32.426 -39.865 -56.912 1.00 126.52 ? 172 LEU D N     1 
ATOM   7599 C CA    . LEU D 1 150 ? -33.569 -39.189 -56.321 1.00 126.06 ? 172 LEU D CA    1 
ATOM   7600 C C     . LEU D 1 150 ? -34.837 -39.455 -57.122 1.00 125.84 ? 172 LEU D C     1 
ATOM   7601 O O     . LEU D 1 150 ? -35.880 -39.776 -56.552 1.00 125.92 ? 172 LEU D O     1 
ATOM   7602 C CB    . LEU D 1 150 ? -33.330 -37.677 -56.228 1.00 126.00 ? 172 LEU D CB    1 
ATOM   7603 C CG    . LEU D 1 150 ? -32.607 -37.084 -55.011 1.00 125.83 ? 172 LEU D CG    1 
ATOM   7604 C CD1   . LEU D 1 150 ? -32.780 -35.576 -54.995 1.00 125.59 ? 172 LEU D CD1   1 
ATOM   7605 C CD2   . LEU D 1 150 ? -33.104 -37.684 -53.697 1.00 125.77 ? 172 LEU D CD2   1 
ATOM   7606 N N     . PHE D 1 151 ? -34.740 -39.328 -58.441 1.00 125.49 ? 173 PHE D N     1 
ATOM   7607 C CA    . PHE D 1 151 ? -35.904 -39.451 -59.304 1.00 125.14 ? 173 PHE D CA    1 
ATOM   7608 C C     . PHE D 1 151 ? -35.682 -40.568 -60.324 1.00 125.18 ? 173 PHE D C     1 
ATOM   7609 O O     . PHE D 1 151 ? -35.300 -40.298 -61.464 1.00 125.23 ? 173 PHE D O     1 
ATOM   7610 C CB    . PHE D 1 151 ? -36.197 -38.110 -59.990 1.00 124.97 ? 173 PHE D CB    1 
ATOM   7611 C CG    . PHE D 1 151 ? -36.205 -36.925 -59.048 1.00 124.31 ? 173 PHE D CG    1 
ATOM   7612 C CD1   . PHE D 1 151 ? -37.308 -36.665 -58.238 1.00 124.16 ? 173 PHE D CD1   1 
ATOM   7613 C CD2   . PHE D 1 151 ? -35.119 -36.062 -58.980 1.00 123.71 ? 173 PHE D CD2   1 
ATOM   7614 C CE1   . PHE D 1 151 ? -37.325 -35.567 -57.366 1.00 123.78 ? 173 PHE D CE1   1 
ATOM   7615 C CE2   . PHE D 1 151 ? -35.129 -34.965 -58.112 1.00 123.49 ? 173 PHE D CE2   1 
ATOM   7616 C CZ    . PHE D 1 151 ? -36.236 -34.719 -57.306 1.00 123.55 ? 173 PHE D CZ    1 
ATOM   7617 N N     . PRO D 1 152 ? -35.928 -41.832 -59.912 1.00 125.15 ? 174 PRO D N     1 
ATOM   7618 C CA    . PRO D 1 152 ? -35.567 -43.040 -60.668 1.00 125.15 ? 174 PRO D CA    1 
ATOM   7619 C C     . PRO D 1 152 ? -36.150 -43.104 -62.077 1.00 125.05 ? 174 PRO D C     1 
ATOM   7620 O O     . PRO D 1 152 ? -35.746 -43.960 -62.868 1.00 125.17 ? 174 PRO D O     1 
ATOM   7621 C CB    . PRO D 1 152 ? -36.150 -44.172 -59.816 1.00 125.15 ? 174 PRO D CB    1 
ATOM   7622 C CG    . PRO D 1 152 ? -36.234 -43.602 -58.454 1.00 125.16 ? 174 PRO D CG    1 
ATOM   7623 C CD    . PRO D 1 152 ? -36.639 -42.181 -58.665 1.00 125.09 ? 174 PRO D CD    1 
ATOM   7624 N N     . ASN D 1 153 ? -37.084 -42.211 -62.384 1.00 124.82 ? 175 ASN D N     1 
ATOM   7625 C CA    . ASN D 1 153 ? -37.660 -42.137 -63.723 1.00 124.70 ? 175 ASN D CA    1 
ATOM   7626 C C     . ASN D 1 153 ? -37.391 -40.794 -64.419 1.00 124.29 ? 175 ASN D C     1 
ATOM   7627 O O     . ASN D 1 153 ? -37.991 -40.485 -65.451 1.00 124.42 ? 175 ASN D O     1 
ATOM   7628 C CB    . ASN D 1 153 ? -39.170 -42.467 -63.696 1.00 124.96 ? 175 ASN D CB    1 
ATOM   7629 C CG    . ASN D 1 153 ? -39.468 -43.913 -63.248 1.00 125.39 ? 175 ASN D CG    1 
ATOM   7630 O OD1   . ASN D 1 153 ? -40.426 -44.160 -62.509 1.00 125.84 ? 175 ASN D OD1   1 
ATOM   7631 N ND2   . ASN D 1 153 ? -38.655 -44.865 -63.703 1.00 125.62 ? 175 ASN D ND2   1 
ATOM   7632 N N     . SER D 1 154 ? -36.488 -39.998 -63.857 1.00 123.73 ? 176 SER D N     1 
ATOM   7633 C CA    . SER D 1 154 ? -36.092 -38.757 -64.501 1.00 123.24 ? 176 SER D CA    1 
ATOM   7634 C C     . SER D 1 154 ? -35.117 -39.053 -65.632 1.00 122.98 ? 176 SER D C     1 
ATOM   7635 O O     . SER D 1 154 ? -34.453 -40.094 -65.643 1.00 122.82 ? 176 SER D O     1 
ATOM   7636 C CB    . SER D 1 154 ? -35.478 -37.779 -63.497 1.00 123.26 ? 176 SER D CB    1 
ATOM   7637 O OG    . SER D 1 154 ? -34.341 -38.339 -62.859 1.00 123.20 ? 176 SER D OG    1 
ATOM   7638 N N     . LYS D 1 155 ? -35.061 -38.132 -66.590 1.00 122.72 ? 177 LYS D N     1 
ATOM   7639 C CA    . LYS D 1 155 ? -34.158 -38.229 -67.732 1.00 122.41 ? 177 LYS D CA    1 
ATOM   7640 C C     . LYS D 1 155 ? -33.312 -36.952 -67.828 1.00 121.82 ? 177 LYS D C     1 
ATOM   7641 O O     . LYS D 1 155 ? -33.671 -35.909 -67.253 1.00 121.72 ? 177 LYS D O     1 
ATOM   7642 C CB    . LYS D 1 155 ? -34.948 -38.461 -69.031 1.00 122.62 ? 177 LYS D CB    1 
ATOM   7643 C CG    . LYS D 1 155 ? -35.676 -39.814 -69.155 1.00 123.71 ? 177 LYS D CG    1 
ATOM   7644 C CD    . LYS D 1 155 ? -34.736 -40.946 -69.580 1.00 125.78 ? 177 LYS D CD    1 
ATOM   7645 C CE    . LYS D 1 155 ? -35.373 -41.873 -70.634 1.00 126.91 ? 177 LYS D CE    1 
ATOM   7646 N NZ    . LYS D 1 155 ? -36.579 -42.689 -70.143 1.00 128.05 ? 177 LYS D NZ    1 
ATOM   7647 N N     . PHE D 1 156 ? -32.195 -37.036 -68.553 1.00 121.16 ? 178 PHE D N     1 
ATOM   7648 C CA    . PHE D 1 156 ? -31.214 -35.951 -68.583 1.00 120.43 ? 178 PHE D CA    1 
ATOM   7649 C C     . PHE D 1 156 ? -30.722 -35.621 -69.977 1.00 120.05 ? 178 PHE D C     1 
ATOM   7650 O O     . PHE D 1 156 ? -30.285 -36.501 -70.723 1.00 119.80 ? 178 PHE D O     1 
ATOM   7651 C CB    . PHE D 1 156 ? -30.032 -36.284 -67.672 1.00 120.35 ? 178 PHE D CB    1 
ATOM   7652 C CG    . PHE D 1 156 ? -30.421 -36.482 -66.238 1.00 119.80 ? 178 PHE D CG    1 
ATOM   7653 C CD1   . PHE D 1 156 ? -30.388 -35.419 -65.349 1.00 119.23 ? 178 PHE D CD1   1 
ATOM   7654 C CD2   . PHE D 1 156 ? -30.844 -37.729 -65.782 1.00 119.39 ? 178 PHE D CD2   1 
ATOM   7655 C CE1   . PHE D 1 156 ? -30.760 -35.594 -64.025 1.00 119.12 ? 178 PHE D CE1   1 
ATOM   7656 C CE2   . PHE D 1 156 ? -31.222 -37.913 -64.462 1.00 119.06 ? 178 PHE D CE2   1 
ATOM   7657 C CZ    . PHE D 1 156 ? -31.181 -36.845 -63.581 1.00 119.01 ? 178 PHE D CZ    1 
ATOM   7658 N N     . LEU D 1 157 ? -30.800 -34.339 -70.314 1.00 119.74 ? 179 LEU D N     1 
ATOM   7659 C CA    . LEU D 1 157 ? -30.293 -33.846 -71.586 1.00 119.55 ? 179 LEU D CA    1 
ATOM   7660 C C     . LEU D 1 157 ? -29.092 -32.943 -71.337 1.00 119.38 ? 179 LEU D C     1 
ATOM   7661 O O     . LEU D 1 157 ? -29.204 -31.917 -70.653 1.00 119.39 ? 179 LEU D O     1 
ATOM   7662 C CB    . LEU D 1 157 ? -31.383 -33.096 -72.368 1.00 119.67 ? 179 LEU D CB    1 
ATOM   7663 C CG    . LEU D 1 157 ? -32.744 -33.738 -72.702 1.00 119.33 ? 179 LEU D CG    1 
ATOM   7664 C CD1   . LEU D 1 157 ? -33.627 -32.753 -73.477 1.00 118.94 ? 179 LEU D CD1   1 
ATOM   7665 C CD2   . LEU D 1 157 ? -32.623 -35.068 -73.459 1.00 119.04 ? 179 LEU D CD2   1 
ATOM   7666 N N     . LEU D 1 158 ? -27.947 -33.340 -71.893 1.00 119.08 ? 180 LEU D N     1 
ATOM   7667 C CA    . LEU D 1 158 ? -26.697 -32.648 -71.644 1.00 118.84 ? 180 LEU D CA    1 
ATOM   7668 C C     . LEU D 1 158 ? -26.294 -31.799 -72.852 1.00 118.84 ? 180 LEU D C     1 
ATOM   7669 O O     . LEU D 1 158 ? -25.889 -32.334 -73.884 1.00 118.83 ? 180 LEU D O     1 
ATOM   7670 C CB    . LEU D 1 158 ? -25.621 -33.672 -71.299 1.00 118.66 ? 180 LEU D CB    1 
ATOM   7671 C CG    . LEU D 1 158 ? -24.235 -33.122 -70.982 1.00 118.78 ? 180 LEU D CG    1 
ATOM   7672 C CD1   . LEU D 1 158 ? -24.290 -32.100 -69.852 1.00 119.36 ? 180 LEU D CD1   1 
ATOM   7673 C CD2   . LEU D 1 158 ? -23.342 -34.271 -70.606 1.00 118.79 ? 180 LEU D CD2   1 
ATOM   7674 N N     . MET D 1 159 ? -26.416 -30.474 -72.709 1.00 118.88 ? 181 MET D N     1 
ATOM   7675 C CA    . MET D 1 159 ? -26.182 -29.530 -73.817 1.00 118.92 ? 181 MET D CA    1 
ATOM   7676 C C     . MET D 1 159 ? -24.700 -29.353 -74.057 1.00 118.77 ? 181 MET D C     1 
ATOM   7677 O O     . MET D 1 159 ? -23.981 -28.889 -73.177 1.00 118.85 ? 181 MET D O     1 
ATOM   7678 C CB    . MET D 1 159 ? -26.822 -28.154 -73.543 1.00 119.01 ? 181 MET D CB    1 
ATOM   7679 C CG    . MET D 1 159 ? -28.362 -28.100 -73.654 1.00 119.21 ? 181 MET D CG    1 
ATOM   7680 S SD    . MET D 1 159 ? -29.100 -28.746 -75.186 1.00 118.72 ? 181 MET D SD    1 
ATOM   7681 C CE    . MET D 1 159 ? -28.299 -27.718 -76.418 1.00 119.08 ? 181 MET D CE    1 
ATOM   7682 N N     . VAL D 1 160 ? -24.256 -29.711 -75.258 1.00 118.61 ? 182 VAL D N     1 
ATOM   7683 C CA    . VAL D 1 160 ? -22.840 -29.708 -75.603 1.00 118.33 ? 182 VAL D CA    1 
ATOM   7684 C C     . VAL D 1 160 ? -22.574 -28.739 -76.746 1.00 118.26 ? 182 VAL D C     1 
ATOM   7685 O O     . VAL D 1 160 ? -22.926 -29.013 -77.894 1.00 118.44 ? 182 VAL D O     1 
ATOM   7686 C CB    . VAL D 1 160 ? -22.365 -31.120 -76.015 1.00 118.29 ? 182 VAL D CB    1 
ATOM   7687 C CG1   . VAL D 1 160 ? -20.889 -31.102 -76.333 1.00 118.45 ? 182 VAL D CG1   1 
ATOM   7688 C CG2   . VAL D 1 160 ? -22.662 -32.141 -74.920 1.00 118.07 ? 182 VAL D CG2   1 
ATOM   7689 N N     . ARG D 1 161 ? -21.950 -27.611 -76.432 1.00 118.08 ? 183 ARG D N     1 
ATOM   7690 C CA    . ARG D 1 161 ? -21.628 -26.607 -77.443 1.00 118.14 ? 183 ARG D CA    1 
ATOM   7691 C C     . ARG D 1 161 ? -20.121 -26.390 -77.511 1.00 118.22 ? 183 ARG D C     1 
ATOM   7692 O O     . ARG D 1 161 ? -19.449 -26.509 -76.492 1.00 118.43 ? 183 ARG D O     1 
ATOM   7693 C CB    . ARG D 1 161 ? -22.317 -25.297 -77.091 1.00 118.09 ? 183 ARG D CB    1 
ATOM   7694 C CG    . ARG D 1 161 ? -22.200 -24.235 -78.145 1.00 118.12 ? 183 ARG D CG    1 
ATOM   7695 C CD    . ARG D 1 161 ? -22.947 -23.013 -77.713 1.00 118.20 ? 183 ARG D CD    1 
ATOM   7696 N NE    . ARG D 1 161 ? -22.761 -21.937 -78.669 1.00 118.70 ? 183 ARG D NE    1 
ATOM   7697 C CZ    . ARG D 1 161 ? -23.104 -20.674 -78.440 1.00 119.06 ? 183 ARG D CZ    1 
ATOM   7698 N NH1   . ARG D 1 161 ? -23.655 -20.311 -77.276 1.00 118.83 ? 183 ARG D NH1   1 
ATOM   7699 N NH2   . ARG D 1 161 ? -22.888 -19.770 -79.385 1.00 119.59 ? 183 ARG D NH2   1 
ATOM   7700 N N     . ASP D 1 162 ? -19.586 -26.078 -78.697 1.00 118.17 ? 184 ASP D N     1 
ATOM   7701 C CA    . ASP D 1 162 ? -18.160 -25.767 -78.818 1.00 118.10 ? 184 ASP D CA    1 
ATOM   7702 C C     . ASP D 1 162 ? -17.857 -24.702 -77.768 1.00 117.89 ? 184 ASP D C     1 
ATOM   7703 O O     . ASP D 1 162 ? -18.453 -23.622 -77.780 1.00 117.80 ? 184 ASP D O     1 
ATOM   7704 C CB    . ASP D 1 162 ? -17.798 -25.280 -80.234 1.00 118.22 ? 184 ASP D CB    1 
ATOM   7705 C CG    . ASP D 1 162 ? -16.295 -25.447 -80.571 1.00 118.63 ? 184 ASP D CG    1 
ATOM   7706 O OD1   . ASP D 1 162 ? -15.429 -25.277 -79.681 1.00 119.12 ? 184 ASP D OD1   1 
ATOM   7707 O OD2   . ASP D 1 162 ? -15.972 -25.734 -81.748 1.00 118.73 ? 184 ASP D OD2   1 
ATOM   7708 N N     . GLY D 1 163 ? -16.964 -25.039 -76.837 1.00 117.64 ? 185 GLY D N     1 
ATOM   7709 C CA    . GLY D 1 163 ? -16.641 -24.174 -75.698 1.00 117.38 ? 185 GLY D CA    1 
ATOM   7710 C C     . GLY D 1 163 ? -16.104 -22.821 -76.098 1.00 117.21 ? 185 GLY D C     1 
ATOM   7711 O O     . GLY D 1 163 ? -16.281 -21.835 -75.393 1.00 116.96 ? 185 GLY D O     1 
ATOM   7712 N N     . ARG D 1 164 ? -15.443 -22.793 -77.249 1.00 117.28 ? 186 ARG D N     1 
ATOM   7713 C CA    . ARG D 1 164 ? -14.934 -21.568 -77.826 1.00 117.36 ? 186 ARG D CA    1 
ATOM   7714 C C     . ARG D 1 164 ? -16.100 -20.616 -78.029 1.00 117.30 ? 186 ARG D C     1 
ATOM   7715 O O     . ARG D 1 164 ? -16.010 -19.425 -77.702 1.00 117.20 ? 186 ARG D O     1 
ATOM   7716 C CB    . ARG D 1 164 ? -14.209 -21.875 -79.146 1.00 117.47 ? 186 ARG D CB    1 
ATOM   7717 C CG    . ARG D 1 164 ? -12.965 -22.763 -78.956 1.00 117.78 ? 186 ARG D CG    1 
ATOM   7718 C CD    . ARG D 1 164 ? -12.338 -23.218 -80.261 1.00 118.28 ? 186 ARG D CD    1 
ATOM   7719 N NE    . ARG D 1 164 ? -13.052 -24.337 -80.870 1.00 118.68 ? 186 ARG D NE    1 
ATOM   7720 C CZ    . ARG D 1 164 ? -12.528 -25.145 -81.789 1.00 118.99 ? 186 ARG D CZ    1 
ATOM   7721 N NH1   . ARG D 1 164 ? -11.274 -24.977 -82.209 1.00 119.41 ? 186 ARG D NH1   1 
ATOM   7722 N NH2   . ARG D 1 164 ? -13.257 -26.135 -82.281 1.00 119.09 ? 186 ARG D NH2   1 
ATOM   7723 N N     . ALA D 1 165 ? -17.205 -21.171 -78.541 1.00 117.33 ? 187 ALA D N     1 
ATOM   7724 C CA    . ALA D 1 165 ? -18.427 -20.415 -78.742 1.00 117.33 ? 187 ALA D CA    1 
ATOM   7725 C C     . ALA D 1 165 ? -19.017 -19.990 -77.407 1.00 117.34 ? 187 ALA D C     1 
ATOM   7726 O O     . ALA D 1 165 ? -19.377 -18.824 -77.231 1.00 117.42 ? 187 ALA D O     1 
ATOM   7727 C CB    . ALA D 1 165 ? -19.433 -21.236 -79.532 1.00 117.41 ? 187 ALA D CB    1 
ATOM   7728 N N     . SER D 1 166 ? -19.109 -20.937 -76.471 1.00 117.27 ? 188 SER D N     1 
ATOM   7729 C CA    . SER D 1 166 ? -19.628 -20.653 -75.133 1.00 117.12 ? 188 SER D CA    1 
ATOM   7730 C C     . SER D 1 166 ? -18.788 -19.575 -74.489 1.00 117.13 ? 188 SER D C     1 
ATOM   7731 O O     . SER D 1 166 ? -19.306 -18.582 -73.983 1.00 117.12 ? 188 SER D O     1 
ATOM   7732 C CB    . SER D 1 166 ? -19.581 -21.899 -74.251 1.00 116.96 ? 188 SER D CB    1 
ATOM   7733 O OG    . SER D 1 166 ? -20.302 -22.970 -74.822 1.00 117.03 ? 188 SER D OG    1 
ATOM   7734 N N     . VAL D 1 167 ? -17.477 -19.786 -74.530 1.00 117.14 ? 189 VAL D N     1 
ATOM   7735 C CA    . VAL D 1 167 ? -16.536 -18.947 -73.825 1.00 117.07 ? 189 VAL D CA    1 
ATOM   7736 C C     . VAL D 1 167 ? -16.528 -17.550 -74.418 1.00 117.19 ? 189 VAL D C     1 
ATOM   7737 O O     . VAL D 1 167 ? -16.549 -16.559 -73.689 1.00 117.19 ? 189 VAL D O     1 
ATOM   7738 C CB    . VAL D 1 167 ? -15.145 -19.587 -73.816 1.00 116.95 ? 189 VAL D CB    1 
ATOM   7739 C CG1   . VAL D 1 167 ? -14.085 -18.561 -73.484 1.00 117.09 ? 189 VAL D CG1   1 
ATOM   7740 C CG2   . VAL D 1 167 ? -15.112 -20.748 -72.814 1.00 116.76 ? 189 VAL D CG2   1 
ATOM   7741 N N     . HIS D 1 168 ? -16.524 -17.477 -75.742 1.00 117.41 ? 190 HIS D N     1 
ATOM   7742 C CA    . HIS D 1 168 ? -16.659 -16.200 -76.420 1.00 117.79 ? 190 HIS D CA    1 
ATOM   7743 C C     . HIS D 1 168 ? -17.904 -15.539 -75.874 1.00 117.50 ? 190 HIS D C     1 
ATOM   7744 O O     . HIS D 1 168 ? -17.860 -14.429 -75.331 1.00 117.22 ? 190 HIS D O     1 
ATOM   7745 C CB    . HIS D 1 168 ? -16.787 -16.416 -77.937 1.00 118.24 ? 190 HIS D CB    1 
ATOM   7746 C CG    . HIS D 1 168 ? -17.091 -15.167 -78.716 1.00 119.68 ? 190 HIS D CG    1 
ATOM   7747 N ND1   . HIS D 1 168 ? -16.177 -14.143 -78.875 1.00 121.16 ? 190 HIS D ND1   1 
ATOM   7748 C CD2   . HIS D 1 168 ? -18.199 -14.792 -79.403 1.00 120.86 ? 190 HIS D CD2   1 
ATOM   7749 C CE1   . HIS D 1 168 ? -16.713 -13.189 -79.616 1.00 121.52 ? 190 HIS D CE1   1 
ATOM   7750 N NE2   . HIS D 1 168 ? -17.940 -13.557 -79.948 1.00 121.68 ? 190 HIS D NE2   1 
ATOM   7751 N N     . SER D 1 169 ? -19.008 -16.266 -75.998 1.00 117.51 ? 191 SER D N     1 
ATOM   7752 C CA    . SER D 1 169 ? -20.306 -15.776 -75.609 1.00 117.62 ? 191 SER D CA    1 
ATOM   7753 C C     . SER D 1 169 ? -20.218 -15.098 -74.253 1.00 117.81 ? 191 SER D C     1 
ATOM   7754 O O     . SER D 1 169 ? -20.509 -13.908 -74.135 1.00 117.83 ? 191 SER D O     1 
ATOM   7755 C CB    . SER D 1 169 ? -21.313 -16.926 -75.588 1.00 117.50 ? 191 SER D CB    1 
ATOM   7756 O OG    . SER D 1 169 ? -22.549 -16.516 -75.040 1.00 117.64 ? 191 SER D OG    1 
ATOM   7757 N N     . MET D 1 170 ? -19.770 -15.843 -73.246 1.00 118.06 ? 192 MET D N     1 
ATOM   7758 C CA    . MET D 1 170 ? -19.816 -15.370 -71.864 1.00 118.30 ? 192 MET D CA    1 
ATOM   7759 C C     . MET D 1 170 ? -18.865 -14.223 -71.578 1.00 118.46 ? 192 MET D C     1 
ATOM   7760 O O     . MET D 1 170 ? -19.073 -13.452 -70.649 1.00 118.45 ? 192 MET D O     1 
ATOM   7761 C CB    . MET D 1 170 ? -19.582 -16.517 -70.881 1.00 118.28 ? 192 MET D CB    1 
ATOM   7762 C CG    . MET D 1 170 ? -18.241 -17.207 -71.003 1.00 118.37 ? 192 MET D CG    1 
ATOM   7763 S SD    . MET D 1 170 ? -17.983 -18.447 -69.718 1.00 119.14 ? 192 MET D SD    1 
ATOM   7764 C CE    . MET D 1 170 ? -19.125 -19.747 -70.217 1.00 118.76 ? 192 MET D CE    1 
ATOM   7765 N N     . ILE D 1 171 ? -17.825 -14.107 -72.384 1.00 118.83 ? 193 ILE D N     1 
ATOM   7766 C CA    . ILE D 1 171 ? -16.867 -13.038 -72.207 1.00 119.23 ? 193 ILE D CA    1 
ATOM   7767 C C     . ILE D 1 171 ? -17.430 -11.762 -72.807 1.00 119.60 ? 193 ILE D C     1 
ATOM   7768 O O     . ILE D 1 171 ? -17.532 -10.735 -72.135 1.00 119.38 ? 193 ILE D O     1 
ATOM   7769 C CB    . ILE D 1 171 ? -15.508 -13.425 -72.824 1.00 119.18 ? 193 ILE D CB    1 
ATOM   7770 C CG1   . ILE D 1 171 ? -14.791 -14.396 -71.880 1.00 118.97 ? 193 ILE D CG1   1 
ATOM   7771 C CG2   . ILE D 1 171 ? -14.645 -12.191 -73.093 1.00 119.26 ? 193 ILE D CG2   1 
ATOM   7772 C CD1   . ILE D 1 171 ? -13.646 -15.128 -72.492 1.00 118.99 ? 193 ILE D CD1   1 
ATOM   7773 N N     . THR D 1 172 ? -17.820 -11.852 -74.074 1.00 120.29 ? 194 THR D N     1 
ATOM   7774 C CA    . THR D 1 172 ? -18.289 -10.694 -74.811 1.00 121.06 ? 194 THR D CA    1 
ATOM   7775 C C     . THR D 1 172 ? -19.609 -10.193 -74.245 1.00 121.24 ? 194 THR D C     1 
ATOM   7776 O O     . THR D 1 172 ? -19.806 -8.982  -74.102 1.00 121.42 ? 194 THR D O     1 
ATOM   7777 C CB    . THR D 1 172 ? -18.456 -11.018 -76.302 1.00 121.17 ? 194 THR D CB    1 
ATOM   7778 O OG1   . THR D 1 172 ? -19.144 -12.279 -76.431 1.00 122.00 ? 194 THR D OG1   1 
ATOM   7779 C CG2   . THR D 1 172 ? -17.083 -11.113 -76.985 1.00 121.22 ? 194 THR D CG2   1 
ATOM   7780 N N     . ARG D 1 173 ? -20.501 -11.129 -73.906 1.00 121.41 ? 195 ARG D N     1 
ATOM   7781 C CA    . ARG D 1 173 ? -21.801 -10.774 -73.344 1.00 121.46 ? 195 ARG D CA    1 
ATOM   7782 C C     . ARG D 1 173 ? -21.713 -10.312 -71.888 1.00 121.48 ? 195 ARG D C     1 
ATOM   7783 O O     . ARG D 1 173 ? -22.721 -9.913  -71.304 1.00 121.57 ? 195 ARG D O     1 
ATOM   7784 C CB    . ARG D 1 173 ? -22.802 -11.927 -73.485 1.00 121.47 ? 195 ARG D CB    1 
ATOM   7785 C CG    . ARG D 1 173 ? -23.272 -12.158 -74.909 1.00 121.52 ? 195 ARG D CG    1 
ATOM   7786 C CD    . ARG D 1 173 ? -24.530 -13.021 -74.961 1.00 121.20 ? 195 ARG D CD    1 
ATOM   7787 N NE    . ARG D 1 173 ? -24.821 -13.419 -76.333 1.00 120.59 ? 195 ARG D NE    1 
ATOM   7788 C CZ    . ARG D 1 173 ? -25.435 -12.628 -77.229 1.00 120.16 ? 195 ARG D CZ    1 
ATOM   7789 N NH1   . ARG D 1 173 ? -25.836 -11.389 -76.902 1.00 120.70 ? 195 ARG D NH1   1 
ATOM   7790 N NH2   . ARG D 1 173 ? -25.649 -13.077 -78.449 1.00 119.58 ? 195 ARG D NH2   1 
ATOM   7791 N N     . LYS D 1 174 ? -20.512 -10.360 -71.312 1.00 121.40 ? 196 LYS D N     1 
ATOM   7792 C CA    . LYS D 1 174 ? -20.295 -9.931  -69.929 1.00 121.36 ? 196 LYS D CA    1 
ATOM   7793 C C     . LYS D 1 174 ? -21.145 -10.703 -68.908 1.00 121.17 ? 196 LYS D C     1 
ATOM   7794 O O     . LYS D 1 174 ? -21.713 -10.111 -67.988 1.00 121.22 ? 196 LYS D O     1 
ATOM   7795 C CB    . LYS D 1 174 ? -20.524 -8.414  -69.791 1.00 121.47 ? 196 LYS D CB    1 
ATOM   7796 C CG    . LYS D 1 174 ? -19.300 -7.610  -69.357 1.00 121.80 ? 196 LYS D CG    1 
ATOM   7797 C CD    . LYS D 1 174 ? -18.561 -6.936  -70.515 1.00 121.91 ? 196 LYS D CD    1 
ATOM   7798 C CE    . LYS D 1 174 ? -17.415 -6.066  -69.979 1.00 121.67 ? 196 LYS D CE    1 
ATOM   7799 N NZ    . LYS D 1 174 ? -16.841 -5.135  -70.989 1.00 121.38 ? 196 LYS D NZ    1 
ATOM   7800 N N     . VAL D 1 175 ? -21.220 -12.021 -69.070 1.00 120.95 ? 197 VAL D N     1 
ATOM   7801 C CA    . VAL D 1 175 ? -22.026 -12.861 -68.184 1.00 120.94 ? 197 VAL D CA    1 
ATOM   7802 C C     . VAL D 1 175 ? -21.157 -13.541 -67.136 1.00 120.84 ? 197 VAL D C     1 
ATOM   7803 O O     . VAL D 1 175 ? -20.346 -14.411 -67.463 1.00 120.98 ? 197 VAL D O     1 
ATOM   7804 C CB    . VAL D 1 175 ? -22.802 -13.940 -68.963 1.00 120.96 ? 197 VAL D CB    1 
ATOM   7805 C CG1   . VAL D 1 175 ? -23.793 -14.641 -68.046 1.00 121.24 ? 197 VAL D CG1   1 
ATOM   7806 C CG2   . VAL D 1 175 ? -23.531 -13.331 -70.152 1.00 121.32 ? 197 VAL D CG2   1 
ATOM   7807 N N     . THR D 1 176 ? -21.336 -13.153 -65.875 1.00 120.71 ? 198 THR D N     1 
ATOM   7808 C CA    . THR D 1 176 ? -20.484 -13.664 -64.810 1.00 120.73 ? 198 THR D CA    1 
ATOM   7809 C C     . THR D 1 176 ? -21.008 -14.996 -64.258 1.00 120.86 ? 198 THR D C     1 
ATOM   7810 O O     . THR D 1 176 ? -22.177 -15.097 -63.856 1.00 120.92 ? 198 THR D O     1 
ATOM   7811 C CB    . THR D 1 176 ? -20.307 -12.621 -63.689 1.00 120.69 ? 198 THR D CB    1 
ATOM   7812 O OG1   . THR D 1 176 ? -21.494 -11.807 -63.602 1.00 120.41 ? 198 THR D OG1   1 
ATOM   7813 C CG2   . THR D 1 176 ? -19.103 -11.712 -63.965 1.00 120.52 ? 198 THR D CG2   1 
ATOM   7814 N N     . ILE D 1 177 ? -20.145 -16.018 -64.262 1.00 120.89 ? 199 ILE D N     1 
ATOM   7815 C CA    . ILE D 1 177 ? -20.487 -17.337 -63.701 1.00 120.86 ? 199 ILE D CA    1 
ATOM   7816 C C     . ILE D 1 177 ? -19.602 -17.652 -62.503 1.00 121.09 ? 199 ILE D C     1 
ATOM   7817 O O     . ILE D 1 177 ? -18.507 -17.099 -62.384 1.00 121.08 ? 199 ILE D O     1 
ATOM   7818 C CB    . ILE D 1 177 ? -20.364 -18.466 -64.753 1.00 120.75 ? 199 ILE D CB    1 
ATOM   7819 C CG1   . ILE D 1 177 ? -21.371 -18.241 -65.886 1.00 120.54 ? 199 ILE D CG1   1 
ATOM   7820 C CG2   . ILE D 1 177 ? -20.588 -19.845 -64.108 1.00 120.33 ? 199 ILE D CG2   1 
ATOM   7821 C CD1   . ILE D 1 177 ? -21.001 -18.918 -67.198 1.00 120.13 ? 199 ILE D CD1   1 
ATOM   7822 N N     . ALA D 1 178 ? -20.091 -18.540 -61.630 1.00 121.43 ? 200 ALA D N     1 
ATOM   7823 C CA    . ALA D 1 178 ? -19.402 -18.949 -60.399 1.00 121.83 ? 200 ALA D CA    1 
ATOM   7824 C C     . ALA D 1 178 ? -17.877 -19.179 -60.545 1.00 122.14 ? 200 ALA D C     1 
ATOM   7825 O O     . ALA D 1 178 ? -17.417 -20.320 -60.685 1.00 122.37 ? 200 ALA D O     1 
ATOM   7826 C CB    . ALA D 1 178 ? -20.095 -20.187 -59.807 1.00 121.70 ? 200 ALA D CB    1 
ATOM   7827 N N     . GLY D 1 179 ? -17.109 -18.086 -60.519 1.00 122.31 ? 201 GLY D N     1 
ATOM   7828 C CA    . GLY D 1 179 ? -15.644 -18.134 -60.607 1.00 122.53 ? 201 GLY D CA    1 
ATOM   7829 C C     . GLY D 1 179 ? -15.029 -18.340 -61.988 1.00 122.68 ? 201 GLY D C     1 
ATOM   7830 O O     . GLY D 1 179 ? -14.212 -19.253 -62.180 1.00 122.75 ? 201 GLY D O     1 
ATOM   7831 N N     . PHE D 1 180 ? -15.409 -17.488 -62.944 1.00 122.84 ? 202 PHE D N     1 
ATOM   7832 C CA    . PHE D 1 180 ? -14.847 -17.509 -64.301 1.00 122.99 ? 202 PHE D CA    1 
ATOM   7833 C C     . PHE D 1 180 ? -14.280 -16.136 -64.644 1.00 122.89 ? 202 PHE D C     1 
ATOM   7834 O O     . PHE D 1 180 ? -15.023 -15.144 -64.663 1.00 122.80 ? 202 PHE D O     1 
ATOM   7835 C CB    . PHE D 1 180 ? -15.926 -17.855 -65.328 1.00 123.18 ? 202 PHE D CB    1 
ATOM   7836 C CG    . PHE D 1 180 ? -16.176 -19.333 -65.499 1.00 124.06 ? 202 PHE D CG    1 
ATOM   7837 C CD1   . PHE D 1 180 ? -16.730 -20.095 -64.467 1.00 124.74 ? 202 PHE D CD1   1 
ATOM   7838 C CD2   . PHE D 1 180 ? -15.900 -19.956 -66.719 1.00 124.69 ? 202 PHE D CD2   1 
ATOM   7839 C CE1   . PHE D 1 180 ? -16.982 -21.467 -64.637 1.00 125.03 ? 202 PHE D CE1   1 
ATOM   7840 C CE2   . PHE D 1 180 ? -16.154 -21.325 -66.904 1.00 124.93 ? 202 PHE D CE2   1 
ATOM   7841 C CZ    . PHE D 1 180 ? -16.695 -22.083 -65.860 1.00 124.91 ? 202 PHE D CZ    1 
ATOM   7842 N N     . ASP D 1 181 ? -12.973 -16.084 -64.923 1.00 122.89 ? 203 ASP D N     1 
ATOM   7843 C CA    . ASP D 1 181 ? -12.283 -14.817 -65.242 1.00 122.78 ? 203 ASP D CA    1 
ATOM   7844 C C     . ASP D 1 181 ? -12.496 -14.381 -66.696 1.00 122.71 ? 203 ASP D C     1 
ATOM   7845 O O     . ASP D 1 181 ? -11.888 -14.930 -67.621 1.00 122.73 ? 203 ASP D O     1 
ATOM   7846 C CB    . ASP D 1 181 ? -10.779 -14.875 -64.899 1.00 122.64 ? 203 ASP D CB    1 
ATOM   7847 C CG    . ASP D 1 181 ? -10.058 -13.541 -65.136 1.00 122.33 ? 203 ASP D CG    1 
ATOM   7848 O OD1   . ASP D 1 181 ? -10.627 -12.466 -64.836 1.00 121.96 ? 203 ASP D OD1   1 
ATOM   7849 O OD2   . ASP D 1 181 ? -8.909  -13.569 -65.617 1.00 122.29 ? 203 ASP D OD2   1 
ATOM   7850 N N     . LEU D 1 182 ? -13.356 -13.378 -66.873 1.00 122.49 ? 204 LEU D N     1 
ATOM   7851 C CA    . LEU D 1 182 ? -13.708 -12.857 -68.193 1.00 122.25 ? 204 LEU D CA    1 
ATOM   7852 C C     . LEU D 1 182 ? -12.535 -12.200 -68.940 1.00 122.01 ? 204 LEU D C     1 
ATOM   7853 O O     . LEU D 1 182 ? -12.510 -12.203 -70.172 1.00 122.12 ? 204 LEU D O     1 
ATOM   7854 C CB    . LEU D 1 182 ? -14.918 -11.907 -68.104 1.00 122.37 ? 204 LEU D CB    1 
ATOM   7855 C CG    . LEU D 1 182 ? -16.247 -12.401 -67.489 1.00 122.84 ? 204 LEU D CG    1 
ATOM   7856 C CD1   . LEU D 1 182 ? -17.310 -11.299 -67.479 1.00 122.90 ? 204 LEU D CD1   1 
ATOM   7857 C CD2   . LEU D 1 182 ? -16.806 -13.654 -68.169 1.00 123.30 ? 204 LEU D CD2   1 
ATOM   7858 N N     . SER D 1 183 ? -11.567 -11.650 -68.205 1.00 121.63 ? 205 SER D N     1 
ATOM   7859 C CA    . SER D 1 183 ? -10.389 -11.016 -68.823 1.00 121.14 ? 205 SER D CA    1 
ATOM   7860 C C     . SER D 1 183 ? -9.443  -12.010 -69.507 1.00 120.75 ? 205 SER D C     1 
ATOM   7861 O O     . SER D 1 183 ? -8.624  -11.615 -70.339 1.00 120.70 ? 205 SER D O     1 
ATOM   7862 C CB    . SER D 1 183 ? -9.620  -10.164 -67.807 1.00 121.22 ? 205 SER D CB    1 
ATOM   7863 O OG    . SER D 1 183 ? -10.071 -8.818  -67.825 1.00 121.23 ? 205 SER D OG    1 
ATOM   7864 N N     . SER D 1 184 ? -9.559  -13.292 -69.153 1.00 120.24 ? 206 SER D N     1 
ATOM   7865 C CA    . SER D 1 184 ? -8.739  -14.323 -69.766 1.00 119.68 ? 206 SER D CA    1 
ATOM   7866 C C     . SER D 1 184 ? -9.580  -15.411 -70.396 1.00 119.42 ? 206 SER D C     1 
ATOM   7867 O O     . SER D 1 184 ? -10.293 -16.144 -69.709 1.00 119.35 ? 206 SER D O     1 
ATOM   7868 C CB    . SER D 1 184 ? -7.782  -14.939 -68.750 1.00 119.66 ? 206 SER D CB    1 
ATOM   7869 O OG    . SER D 1 184 ? -7.211  -16.135 -69.263 1.00 119.29 ? 206 SER D OG    1 
ATOM   7870 N N     . TYR D 1 185 ? -9.485  -15.509 -71.717 1.00 119.15 ? 207 TYR D N     1 
ATOM   7871 C CA    . TYR D 1 185 ? -10.056 -16.630 -72.441 1.00 118.98 ? 207 TYR D CA    1 
ATOM   7872 C C     . TYR D 1 185 ? -9.451  -17.925 -71.888 1.00 118.80 ? 207 TYR D C     1 
ATOM   7873 O O     . TYR D 1 185 ? -10.169 -18.884 -71.585 1.00 118.65 ? 207 TYR D O     1 
ATOM   7874 C CB    . TYR D 1 185 ? -9.800  -16.478 -73.952 1.00 119.02 ? 207 TYR D CB    1 
ATOM   7875 C CG    . TYR D 1 185 ? -10.809 -15.591 -74.678 1.00 119.22 ? 207 TYR D CG    1 
ATOM   7876 C CD1   . TYR D 1 185 ? -11.849 -16.157 -75.432 1.00 119.59 ? 207 TYR D CD1   1 
ATOM   7877 C CD2   . TYR D 1 185 ? -10.733 -14.190 -74.613 1.00 119.58 ? 207 TYR D CD2   1 
ATOM   7878 C CE1   . TYR D 1 185 ? -12.798 -15.348 -76.107 1.00 119.85 ? 207 TYR D CE1   1 
ATOM   7879 C CE2   . TYR D 1 185 ? -11.680 -13.371 -75.282 1.00 120.07 ? 207 TYR D CE2   1 
ATOM   7880 C CZ    . TYR D 1 185 ? -12.707 -13.959 -76.028 1.00 119.84 ? 207 TYR D CZ    1 
ATOM   7881 O OH    . TYR D 1 185 ? -13.633 -13.167 -76.687 1.00 119.16 ? 207 TYR D OH    1 
ATOM   7882 N N     . ARG D 1 186 ? -8.129  -17.916 -71.723 1.00 118.69 ? 208 ARG D N     1 
ATOM   7883 C CA    . ARG D 1 186 ? -7.383  -19.057 -71.204 1.00 118.61 ? 208 ARG D CA    1 
ATOM   7884 C C     . ARG D 1 186 ? -8.097  -19.663 -70.003 1.00 118.43 ? 208 ARG D C     1 
ATOM   7885 O O     . ARG D 1 186 ? -8.430  -20.856 -69.995 1.00 118.22 ? 208 ARG D O     1 
ATOM   7886 C CB    . ARG D 1 186 ? -5.952  -18.625 -70.838 1.00 118.76 ? 208 ARG D CB    1 
ATOM   7887 C CG    . ARG D 1 186 ? -5.088  -19.709 -70.182 1.00 118.95 ? 208 ARG D CG    1 
ATOM   7888 C CD    . ARG D 1 186 ? -3.604  -19.377 -70.245 1.00 118.93 ? 208 ARG D CD    1 
ATOM   7889 N NE    . ARG D 1 186 ? -3.139  -19.298 -71.630 1.00 119.58 ? 208 ARG D NE    1 
ATOM   7890 C CZ    . ARG D 1 186 ? -2.676  -20.328 -72.342 1.00 120.02 ? 208 ARG D CZ    1 
ATOM   7891 N NH1   . ARG D 1 186 ? -2.595  -21.546 -71.806 1.00 119.88 ? 208 ARG D NH1   1 
ATOM   7892 N NH2   . ARG D 1 186 ? -2.290  -20.135 -73.602 1.00 120.16 ? 208 ARG D NH2   1 
ATOM   7893 N N     . ASP D 1 187 ? -8.337  -18.810 -69.009 1.00 118.41 ? 209 ASP D N     1 
ATOM   7894 C CA    . ASP D 1 187 ? -9.003  -19.190 -67.772 1.00 118.53 ? 209 ASP D CA    1 
ATOM   7895 C C     . ASP D 1 187 ? -10.371 -19.812 -68.055 1.00 118.33 ? 209 ASP D C     1 
ATOM   7896 O O     . ASP D 1 187 ? -10.620 -20.988 -67.722 1.00 118.33 ? 209 ASP D O     1 
ATOM   7897 C CB    . ASP D 1 187 ? -9.140  -17.948 -66.866 1.00 118.79 ? 209 ASP D CB    1 
ATOM   7898 C CG    . ASP D 1 187 ? -10.021 -18.195 -65.631 1.00 119.38 ? 209 ASP D CG    1 
ATOM   7899 O OD1   . ASP D 1 187 ? -9.437  -18.356 -64.515 1.00 119.87 ? 209 ASP D OD1   1 
ATOM   7900 O OD2   . ASP D 1 187 ? -11.284 -18.208 -65.769 1.00 119.21 ? 209 ASP D OD2   1 
ATOM   7901 N N     . CYS D 1 188 ? -11.249 -19.018 -68.678 1.00 118.06 ? 210 CYS D N     1 
ATOM   7902 C CA    . CYS D 1 188 ? -12.602 -19.471 -68.945 1.00 117.79 ? 210 CYS D CA    1 
ATOM   7903 C C     . CYS D 1 188 ? -12.596 -20.822 -69.640 1.00 117.78 ? 210 CYS D C     1 
ATOM   7904 O O     . CYS D 1 188 ? -13.469 -21.655 -69.390 1.00 117.79 ? 210 CYS D O     1 
ATOM   7905 C CB    . CYS D 1 188 ? -13.336 -18.453 -69.807 1.00 117.77 ? 210 CYS D CB    1 
ATOM   7906 S SG    . CYS D 1 188 ? -13.668 -16.906 -68.969 1.00 117.12 ? 210 CYS D SG    1 
ATOM   7907 N N     . LEU D 1 189 ? -11.605 -21.029 -70.508 1.00 117.67 ? 211 LEU D N     1 
ATOM   7908 C CA    . LEU D 1 189 ? -11.516 -22.246 -71.302 1.00 117.70 ? 211 LEU D CA    1 
ATOM   7909 C C     . LEU D 1 189 ? -11.064 -23.411 -70.457 1.00 117.68 ? 211 LEU D C     1 
ATOM   7910 O O     . LEU D 1 189 ? -11.666 -24.484 -70.481 1.00 117.62 ? 211 LEU D O     1 
ATOM   7911 C CB    . LEU D 1 189 ? -10.588 -22.035 -72.495 1.00 117.67 ? 211 LEU D CB    1 
ATOM   7912 C CG    . LEU D 1 189 ? -11.338 -21.386 -73.658 1.00 118.00 ? 211 LEU D CG    1 
ATOM   7913 C CD1   . LEU D 1 189 ? -10.430 -20.539 -74.520 1.00 118.13 ? 211 LEU D CD1   1 
ATOM   7914 C CD2   . LEU D 1 189 ? -12.015 -22.461 -74.502 1.00 118.88 ? 211 LEU D CD2   1 
ATOM   7915 N N     . THR D 1 190 ? -10.003 -23.179 -69.700 1.00 117.84 ? 212 THR D N     1 
ATOM   7916 C CA    . THR D 1 190 ? -9.562  -24.106 -68.678 1.00 118.03 ? 212 THR D CA    1 
ATOM   7917 C C     . THR D 1 190 ? -10.755 -24.499 -67.829 1.00 118.11 ? 212 THR D C     1 
ATOM   7918 O O     . THR D 1 190 ? -10.929 -25.669 -67.470 1.00 118.19 ? 212 THR D O     1 
ATOM   7919 C CB    . THR D 1 190 ? -8.538  -23.419 -67.783 1.00 118.00 ? 212 THR D CB    1 
ATOM   7920 O OG1   . THR D 1 190 ? -7.491  -22.896 -68.604 1.00 118.07 ? 212 THR D OG1   1 
ATOM   7921 C CG2   . THR D 1 190 ? -7.963  -24.386 -66.762 1.00 118.26 ? 212 THR D CG2   1 
ATOM   7922 N N     . LYS D 1 191 ? -11.584 -23.498 -67.547 1.00 118.16 ? 213 LYS D N     1 
ATOM   7923 C CA    . LYS D 1 191 ? -12.702 -23.615 -66.633 1.00 118.15 ? 213 LYS D CA    1 
ATOM   7924 C C     . LYS D 1 191 ? -13.854 -24.390 -67.272 1.00 118.03 ? 213 LYS D C     1 
ATOM   7925 O O     . LYS D 1 191 ? -14.376 -25.347 -66.685 1.00 117.85 ? 213 LYS D O     1 
ATOM   7926 C CB    . LYS D 1 191 ? -13.136 -22.209 -66.219 1.00 118.14 ? 213 LYS D CB    1 
ATOM   7927 C CG    . LYS D 1 191 ? -13.367 -22.043 -64.727 1.00 118.70 ? 213 LYS D CG    1 
ATOM   7928 C CD    . LYS D 1 191 ? -12.075 -21.737 -63.955 1.00 118.66 ? 213 LYS D CD    1 
ATOM   7929 C CE    . LYS D 1 191 ? -12.127 -22.487 -62.585 1.00 118.41 ? 213 LYS D CE    1 
ATOM   7930 N NZ    . LYS D 1 191 ? -11.782 -21.572 -61.441 1.00 117.60 ? 213 LYS D NZ    1 
ATOM   7931 N N     . TRP D 1 192 ? -14.225 -23.972 -68.482 1.00 118.09 ? 214 TRP D N     1 
ATOM   7932 C CA    . TRP D 1 192 ? -15.200 -24.677 -69.305 1.00 118.23 ? 214 TRP D CA    1 
ATOM   7933 C C     . TRP D 1 192 ? -14.885 -26.169 -69.326 1.00 118.25 ? 214 TRP D C     1 
ATOM   7934 O O     . TRP D 1 192 ? -15.738 -27.018 -69.038 1.00 118.23 ? 214 TRP D O     1 
ATOM   7935 C CB    . TRP D 1 192 ? -15.182 -24.115 -70.736 1.00 118.14 ? 214 TRP D CB    1 
ATOM   7936 C CG    . TRP D 1 192 ? -15.988 -24.929 -71.706 1.00 118.52 ? 214 TRP D CG    1 
ATOM   7937 C CD1   . TRP D 1 192 ? -17.329 -24.837 -71.927 1.00 118.97 ? 214 TRP D CD1   1 
ATOM   7938 C CD2   . TRP D 1 192 ? -15.511 -25.971 -72.574 1.00 118.83 ? 214 TRP D CD2   1 
ATOM   7939 N NE1   . TRP D 1 192 ? -17.721 -25.751 -72.877 1.00 119.16 ? 214 TRP D NE1   1 
ATOM   7940 C CE2   . TRP D 1 192 ? -16.625 -26.463 -73.288 1.00 119.08 ? 214 TRP D CE2   1 
ATOM   7941 C CE3   . TRP D 1 192 ? -14.252 -26.539 -72.815 1.00 119.09 ? 214 TRP D CE3   1 
ATOM   7942 C CZ2   . TRP D 1 192 ? -16.517 -27.490 -74.234 1.00 119.22 ? 214 TRP D CZ2   1 
ATOM   7943 C CZ3   . TRP D 1 192 ? -14.144 -27.565 -73.752 1.00 118.88 ? 214 TRP D CZ3   1 
ATOM   7944 C CH2   . TRP D 1 192 ? -15.271 -28.026 -74.450 1.00 119.27 ? 214 TRP D CH2   1 
ATOM   7945 N N     . ASN D 1 193 ? -13.635 -26.464 -69.662 1.00 118.39 ? 215 ASN D N     1 
ATOM   7946 C CA    . ASN D 1 193 ? -13.159 -27.822 -69.807 1.00 118.63 ? 215 ASN D CA    1 
ATOM   7947 C C     . ASN D 1 193 ? -13.485 -28.669 -68.594 1.00 118.90 ? 215 ASN D C     1 
ATOM   7948 O O     . ASN D 1 193 ? -14.186 -29.675 -68.701 1.00 118.67 ? 215 ASN D O     1 
ATOM   7949 C CB    . ASN D 1 193 ? -11.653 -27.802 -70.051 1.00 118.55 ? 215 ASN D CB    1 
ATOM   7950 C CG    . ASN D 1 193 ? -11.060 -29.183 -70.105 1.00 118.47 ? 215 ASN D CG    1 
ATOM   7951 O OD1   . ASN D 1 193 ? -10.663 -29.743 -69.074 1.00 119.29 ? 215 ASN D OD1   1 
ATOM   7952 N ND2   . ASN D 1 193 ? -11.004 -29.749 -71.308 1.00 117.66 ? 215 ASN D ND2   1 
ATOM   7953 N N     . LYS D 1 194 ? -12.974 -28.237 -67.444 1.00 119.47 ? 216 LYS D N     1 
ATOM   7954 C CA    . LYS D 1 194 ? -13.159 -28.950 -66.194 1.00 120.13 ? 216 LYS D CA    1 
ATOM   7955 C C     . LYS D 1 194 ? -14.641 -29.140 -65.918 1.00 120.01 ? 216 LYS D C     1 
ATOM   7956 O O     . LYS D 1 194 ? -15.095 -30.246 -65.613 1.00 119.98 ? 216 LYS D O     1 
ATOM   7957 C CB    . LYS D 1 194 ? -12.492 -28.195 -65.044 1.00 120.42 ? 216 LYS D CB    1 
ATOM   7958 C CG    . LYS D 1 194 ? -12.348 -29.014 -63.767 1.00 122.56 ? 216 LYS D CG    1 
ATOM   7959 C CD    . LYS D 1 194 ? -11.567 -30.312 -64.012 1.00 126.48 ? 216 LYS D CD    1 
ATOM   7960 C CE    . LYS D 1 194 ? -11.475 -31.176 -62.754 1.00 128.99 ? 216 LYS D CE    1 
ATOM   7961 N NZ    . LYS D 1 194 ? -12.791 -31.776 -62.351 1.00 131.15 ? 216 LYS D NZ    1 
ATOM   7962 N N     . ALA D 1 195 ? -15.390 -28.053 -66.048 1.00 119.98 ? 217 ALA D N     1 
ATOM   7963 C CA    . ALA D 1 195 ? -16.824 -28.105 -65.890 1.00 120.01 ? 217 ALA D CA    1 
ATOM   7964 C C     . ALA D 1 195 ? -17.402 -29.234 -66.750 1.00 120.10 ? 217 ALA D C     1 
ATOM   7965 O O     . ALA D 1 195 ? -17.966 -30.202 -66.223 1.00 120.15 ? 217 ALA D O     1 
ATOM   7966 C CB    . ALA D 1 195 ? -17.437 -26.760 -66.255 1.00 119.91 ? 217 ALA D CB    1 
ATOM   7967 N N     . ILE D 1 196 ? -17.210 -29.130 -68.063 1.00 120.17 ? 218 ILE D N     1 
ATOM   7968 C CA    . ILE D 1 196 ? -17.828 -30.056 -69.006 1.00 120.42 ? 218 ILE D CA    1 
ATOM   7969 C C     . ILE D 1 196 ? -17.368 -31.499 -68.771 1.00 120.48 ? 218 ILE D C     1 
ATOM   7970 O O     . ILE D 1 196 ? -18.185 -32.451 -68.798 1.00 120.27 ? 218 ILE D O     1 
ATOM   7971 C CB    . ILE D 1 196 ? -17.605 -29.580 -70.480 1.00 120.53 ? 218 ILE D CB    1 
ATOM   7972 C CG1   . ILE D 1 196 ? -18.779 -29.982 -71.417 1.00 121.06 ? 218 ILE D CG1   1 
ATOM   7973 C CG2   . ILE D 1 196 ? -16.203 -29.936 -71.013 1.00 120.59 ? 218 ILE D CG2   1 
ATOM   7974 C CD1   . ILE D 1 196 ? -18.855 -31.475 -71.867 1.00 122.34 ? 218 ILE D CD1   1 
ATOM   7975 N N     . GLU D 1 197 ? -16.058 -31.634 -68.506 1.00 120.76 ? 219 GLU D N     1 
ATOM   7976 C CA    . GLU D 1 197 ? -15.442 -32.928 -68.252 1.00 121.14 ? 219 GLU D CA    1 
ATOM   7977 C C     . GLU D 1 197 ? -16.221 -33.685 -67.186 1.00 120.95 ? 219 GLU D C     1 
ATOM   7978 O O     . GLU D 1 197 ? -16.475 -34.887 -67.308 1.00 120.81 ? 219 GLU D O     1 
ATOM   7979 C CB    . GLU D 1 197 ? -13.998 -32.712 -67.810 1.00 121.36 ? 219 GLU D CB    1 
ATOM   7980 C CG    . GLU D 1 197 ? -13.309 -33.924 -67.209 1.00 123.15 ? 219 GLU D CG    1 
ATOM   7981 C CD    . GLU D 1 197 ? -12.193 -33.527 -66.258 1.00 125.70 ? 219 GLU D CD    1 
ATOM   7982 O OE1   . GLU D 1 197 ? -11.236 -32.852 -66.700 1.00 126.63 ? 219 GLU D OE1   1 
ATOM   7983 O OE2   . GLU D 1 197 ? -12.279 -33.887 -65.063 1.00 126.82 ? 219 GLU D OE2   1 
ATOM   7984 N N     . VAL D 1 198 ? -16.608 -32.951 -66.151 1.00 120.99 ? 220 VAL D N     1 
ATOM   7985 C CA    . VAL D 1 198 ? -17.369 -33.505 -65.053 1.00 121.14 ? 220 VAL D CA    1 
ATOM   7986 C C     . VAL D 1 198 ? -18.739 -33.954 -65.551 1.00 121.33 ? 220 VAL D C     1 
ATOM   7987 O O     . VAL D 1 198 ? -19.063 -35.142 -65.501 1.00 121.29 ? 220 VAL D O     1 
ATOM   7988 C CB    . VAL D 1 198 ? -17.510 -32.470 -63.906 1.00 121.08 ? 220 VAL D CB    1 
ATOM   7989 C CG1   . VAL D 1 198 ? -18.416 -33.014 -62.814 1.00 121.15 ? 220 VAL D CG1   1 
ATOM   7990 C CG2   . VAL D 1 198 ? -16.132 -32.116 -63.319 1.00 121.11 ? 220 VAL D CG2   1 
ATOM   7991 N N     . MET D 1 199 ? -19.522 -33.001 -66.058 1.00 121.69 ? 221 MET D N     1 
ATOM   7992 C CA    . MET D 1 199 ? -20.904 -33.257 -66.460 1.00 122.13 ? 221 MET D CA    1 
ATOM   7993 C C     . MET D 1 199 ? -20.984 -34.481 -67.353 1.00 122.33 ? 221 MET D C     1 
ATOM   7994 O O     . MET D 1 199 ? -21.949 -35.239 -67.301 1.00 122.18 ? 221 MET D O     1 
ATOM   7995 C CB    . MET D 1 199 ? -21.491 -32.043 -67.181 1.00 122.19 ? 221 MET D CB    1 
ATOM   7996 C CG    . MET D 1 199 ? -21.657 -30.797 -66.315 1.00 122.95 ? 221 MET D CG    1 
ATOM   7997 S SD    . MET D 1 199 ? -22.177 -29.358 -67.274 1.00 124.16 ? 221 MET D SD    1 
ATOM   7998 C CE    . MET D 1 199 ? -22.225 -28.063 -66.029 1.00 125.76 ? 221 MET D CE    1 
ATOM   7999 N N     . TYR D 1 200 ? -19.948 -34.671 -68.161 1.00 122.82 ? 222 TYR D N     1 
ATOM   8000 C CA    . TYR D 1 200 ? -19.897 -35.788 -69.078 1.00 123.41 ? 222 TYR D CA    1 
ATOM   8001 C C     . TYR D 1 200 ? -19.738 -37.085 -68.305 1.00 123.43 ? 222 TYR D C     1 
ATOM   8002 O O     . TYR D 1 200 ? -20.484 -38.043 -68.518 1.00 123.37 ? 222 TYR D O     1 
ATOM   8003 C CB    . TYR D 1 200 ? -18.751 -35.615 -70.084 1.00 123.64 ? 222 TYR D CB    1 
ATOM   8004 C CG    . TYR D 1 200 ? -18.935 -36.452 -71.330 1.00 124.88 ? 222 TYR D CG    1 
ATOM   8005 C CD1   . TYR D 1 200 ? -19.732 -35.986 -72.396 1.00 126.17 ? 222 TYR D CD1   1 
ATOM   8006 C CD2   . TYR D 1 200 ? -18.320 -37.713 -71.437 1.00 126.11 ? 222 TYR D CD2   1 
ATOM   8007 C CE1   . TYR D 1 200 ? -19.911 -36.751 -73.537 1.00 127.47 ? 222 TYR D CE1   1 
ATOM   8008 C CE2   . TYR D 1 200 ? -18.491 -38.487 -72.577 1.00 127.34 ? 222 TYR D CE2   1 
ATOM   8009 C CZ    . TYR D 1 200 ? -19.289 -38.000 -73.623 1.00 127.92 ? 222 TYR D CZ    1 
ATOM   8010 O OH    . TYR D 1 200 ? -19.463 -38.759 -74.760 1.00 129.19 ? 222 TYR D OH    1 
ATOM   8011 N N     . ALA D 1 201 ? -18.764 -37.100 -67.400 1.00 123.67 ? 223 ALA D N     1 
ATOM   8012 C CA    . ALA D 1 201 ? -18.498 -38.268 -66.572 1.00 123.93 ? 223 ALA D CA    1 
ATOM   8013 C C     . ALA D 1 201 ? -19.792 -38.745 -65.932 1.00 124.09 ? 223 ALA D C     1 
ATOM   8014 O O     . ALA D 1 201 ? -20.102 -39.936 -65.957 1.00 124.10 ? 223 ALA D O     1 
ATOM   8015 C CB    . ALA D 1 201 ? -17.455 -37.943 -65.509 1.00 123.86 ? 223 ALA D CB    1 
ATOM   8016 N N     . GLN D 1 202 ? -20.544 -37.792 -65.382 1.00 124.38 ? 224 GLN D N     1 
ATOM   8017 C CA    . GLN D 1 202 ? -21.845 -38.048 -64.773 1.00 124.71 ? 224 GLN D CA    1 
ATOM   8018 C C     . GLN D 1 202 ? -22.748 -38.748 -65.771 1.00 125.03 ? 224 GLN D C     1 
ATOM   8019 O O     . GLN D 1 202 ? -23.237 -39.849 -65.522 1.00 124.80 ? 224 GLN D O     1 
ATOM   8020 C CB    . GLN D 1 202 ? -22.503 -36.719 -64.374 1.00 124.66 ? 224 GLN D CB    1 
ATOM   8021 C CG    . GLN D 1 202 ? -21.944 -36.069 -63.129 1.00 124.76 ? 224 GLN D CG    1 
ATOM   8022 C CD    . GLN D 1 202 ? -22.666 -36.499 -61.864 1.00 125.14 ? 224 GLN D CD    1 
ATOM   8023 O OE1   . GLN D 1 202 ? -23.810 -36.104 -61.616 1.00 124.53 ? 224 GLN D OE1   1 
ATOM   8024 N NE2   . GLN D 1 202 ? -21.989 -37.301 -61.041 1.00 125.85 ? 224 GLN D NE2   1 
ATOM   8025 N N     . CYS D 1 203 ? -22.940 -38.086 -66.910 1.00 125.67 ? 225 CYS D N     1 
ATOM   8026 C CA    . CYS D 1 203 ? -23.838 -38.529 -67.971 1.00 126.30 ? 225 CYS D CA    1 
ATOM   8027 C C     . CYS D 1 203 ? -23.502 -39.942 -68.432 1.00 126.73 ? 225 CYS D C     1 
ATOM   8028 O O     . CYS D 1 203 ? -24.405 -40.750 -68.699 1.00 126.65 ? 225 CYS D O     1 
ATOM   8029 C CB    . CYS D 1 203 ? -23.760 -37.544 -69.143 1.00 126.25 ? 225 CYS D CB    1 
ATOM   8030 S SG    . CYS D 1 203 ? -24.900 -37.836 -70.522 1.00 126.60 ? 225 CYS D SG    1 
ATOM   8031 N N     . MET D 1 204 ? -22.198 -40.225 -68.507 1.00 127.41 ? 226 MET D N     1 
ATOM   8032 C CA    . MET D 1 204 ? -21.693 -41.536 -68.907 1.00 128.08 ? 226 MET D CA    1 
ATOM   8033 C C     . MET D 1 204 ? -21.928 -42.576 -67.827 1.00 128.49 ? 226 MET D C     1 
ATOM   8034 O O     . MET D 1 204 ? -22.319 -43.707 -68.116 1.00 128.53 ? 226 MET D O     1 
ATOM   8035 C CB    . MET D 1 204 ? -20.203 -41.465 -69.246 1.00 128.09 ? 226 MET D CB    1 
ATOM   8036 C CG    . MET D 1 204 ? -19.890 -40.846 -70.593 1.00 128.39 ? 226 MET D CG    1 
ATOM   8037 S SD    . MET D 1 204 ? -20.698 -41.667 -71.988 1.00 129.46 ? 226 MET D SD    1 
ATOM   8038 C CE    . MET D 1 204 ? -22.057 -40.543 -72.354 1.00 129.61 ? 226 MET D CE    1 
ATOM   8039 N N     . GLU D 1 205 ? -21.679 -42.186 -66.581 1.00 129.05 ? 227 GLU D N     1 
ATOM   8040 C CA    . GLU D 1 205 ? -21.947 -43.047 -65.447 1.00 129.69 ? 227 GLU D CA    1 
ATOM   8041 C C     . GLU D 1 205 ? -23.442 -43.322 -65.396 1.00 129.81 ? 227 GLU D C     1 
ATOM   8042 O O     . GLU D 1 205 ? -23.871 -44.468 -65.229 1.00 129.86 ? 227 GLU D O     1 
ATOM   8043 C CB    . GLU D 1 205 ? -21.483 -42.369 -64.165 1.00 129.89 ? 227 GLU D CB    1 
ATOM   8044 C CG    . GLU D 1 205 ? -21.330 -43.300 -62.979 1.00 131.24 ? 227 GLU D CG    1 
ATOM   8045 C CD    . GLU D 1 205 ? -20.575 -42.650 -61.819 1.00 132.97 ? 227 GLU D CD    1 
ATOM   8046 O OE1   . GLU D 1 205 ? -21.065 -42.765 -60.658 1.00 133.41 ? 227 GLU D OE1   1 
ATOM   8047 O OE2   . GLU D 1 205 ? -19.494 -42.022 -62.068 1.00 133.71 ? 227 GLU D OE2   1 
ATOM   8048 N N     . VAL D 1 206 ? -24.224 -42.258 -65.574 1.00 130.03 ? 228 VAL D N     1 
ATOM   8049 C CA    . VAL D 1 206 ? -25.679 -42.341 -65.606 1.00 130.26 ? 228 VAL D CA    1 
ATOM   8050 C C     . VAL D 1 206 ? -26.151 -43.387 -66.608 1.00 130.44 ? 228 VAL D C     1 
ATOM   8051 O O     . VAL D 1 206 ? -26.932 -44.274 -66.256 1.00 130.52 ? 228 VAL D O     1 
ATOM   8052 C CB    . VAL D 1 206 ? -26.316 -40.956 -65.893 1.00 130.23 ? 228 VAL D CB    1 
ATOM   8053 C CG1   . VAL D 1 206 ? -27.682 -41.094 -66.534 1.00 130.23 ? 228 VAL D CG1   1 
ATOM   8054 C CG2   . VAL D 1 206 ? -26.422 -40.157 -64.600 1.00 130.56 ? 228 VAL D CG2   1 
ATOM   8055 N N     . GLY D 1 207 ? -25.661 -43.291 -67.842 1.00 130.67 ? 229 GLY D N     1 
ATOM   8056 C CA    . GLY D 1 207 ? -26.026 -44.244 -68.880 1.00 131.04 ? 229 GLY D CA    1 
ATOM   8057 C C     . GLY D 1 207 ? -26.866 -43.645 -69.993 1.00 131.31 ? 229 GLY D C     1 
ATOM   8058 O O     . GLY D 1 207 ? -27.704 -42.767 -69.758 1.00 131.19 ? 229 GLY D O     1 
ATOM   8059 N N     . LYS D 1 208 ? -26.635 -44.151 -71.207 1.00 131.69 ? 230 LYS D N     1 
ATOM   8060 C CA    . LYS D 1 208 ? -27.296 -43.683 -72.436 1.00 131.97 ? 230 LYS D CA    1 
ATOM   8061 C C     . LYS D 1 208 ? -28.816 -43.683 -72.269 1.00 131.59 ? 230 LYS D C     1 
ATOM   8062 O O     . LYS D 1 208 ? -29.514 -42.878 -72.891 1.00 131.55 ? 230 LYS D O     1 
ATOM   8063 C CB    . LYS D 1 208 ? -26.906 -44.577 -73.636 1.00 132.23 ? 230 LYS D CB    1 
ATOM   8064 C CG    . LYS D 1 208 ? -25.419 -44.989 -73.680 1.00 134.02 ? 230 LYS D CG    1 
ATOM   8065 C CD    . LYS D 1 208 ? -25.134 -46.163 -74.653 1.00 136.93 ? 230 LYS D CD    1 
ATOM   8066 C CE    . LYS D 1 208 ? -24.188 -45.778 -75.821 1.00 138.26 ? 230 LYS D CE    1 
ATOM   8067 N NZ    . LYS D 1 208 ? -24.900 -45.266 -77.041 1.00 139.19 ? 230 LYS D NZ    1 
ATOM   8068 N N     . GLU D 1 209 ? -29.304 -44.587 -71.414 1.00 131.24 ? 231 GLU D N     1 
ATOM   8069 C CA    . GLU D 1 209 ? -30.728 -44.791 -71.187 1.00 131.04 ? 231 GLU D CA    1 
ATOM   8070 C C     . GLU D 1 209 ? -31.388 -43.589 -70.520 1.00 130.24 ? 231 GLU D C     1 
ATOM   8071 O O     . GLU D 1 209 ? -32.528 -43.239 -70.851 1.00 130.18 ? 231 GLU D O     1 
ATOM   8072 C CB    . GLU D 1 209 ? -30.931 -46.034 -70.324 1.00 131.40 ? 231 GLU D CB    1 
ATOM   8073 C CG    . GLU D 1 209 ? -32.387 -46.526 -70.277 1.00 133.58 ? 231 GLU D CG    1 
ATOM   8074 C CD    . GLU D 1 209 ? -32.466 -47.973 -69.870 1.00 136.61 ? 231 GLU D CD    1 
ATOM   8075 O OE1   . GLU D 1 209 ? -33.237 -48.285 -68.942 1.00 137.79 ? 231 GLU D OE1   1 
ATOM   8076 O OE2   . GLU D 1 209 ? -31.747 -48.799 -70.473 1.00 138.02 ? 231 GLU D OE2   1 
ATOM   8077 N N     . LYS D 1 210 ? -30.669 -42.973 -69.579 1.00 129.27 ? 232 LYS D N     1 
ATOM   8078 C CA    . LYS D 1 210 ? -31.189 -41.837 -68.809 1.00 128.23 ? 232 LYS D CA    1 
ATOM   8079 C C     . LYS D 1 210 ? -30.577 -40.508 -69.250 1.00 127.37 ? 232 LYS D C     1 
ATOM   8080 O O     . LYS D 1 210 ? -31.202 -39.456 -69.108 1.00 127.11 ? 232 LYS D O     1 
ATOM   8081 C CB    . LYS D 1 210 ? -30.960 -42.046 -67.304 1.00 128.34 ? 232 LYS D CB    1 
ATOM   8082 C CG    . LYS D 1 210 ? -31.943 -42.998 -66.599 1.00 128.75 ? 232 LYS D CG    1 
ATOM   8083 C CD    . LYS D 1 210 ? -31.347 -43.433 -65.226 1.00 129.71 ? 232 LYS D CD    1 
ATOM   8084 C CE    . LYS D 1 210 ? -32.331 -44.232 -64.359 1.00 129.98 ? 232 LYS D CE    1 
ATOM   8085 N NZ    . LYS D 1 210 ? -33.332 -43.318 -63.635 1.00 130.10 ? 232 LYS D NZ    1 
ATOM   8086 N N     . CYS D 1 211 ? -29.356 -40.555 -69.778 1.00 126.42 ? 233 CYS D N     1 
ATOM   8087 C CA    . CYS D 1 211 ? -28.698 -39.338 -70.224 1.00 125.59 ? 233 CYS D CA    1 
ATOM   8088 C C     . CYS D 1 211 ? -28.366 -39.343 -71.703 1.00 124.92 ? 233 CYS D C     1 
ATOM   8089 O O     . CYS D 1 211 ? -27.852 -40.334 -72.259 1.00 124.69 ? 233 CYS D O     1 
ATOM   8090 C CB    . CYS D 1 211 ? -27.436 -39.045 -69.412 1.00 125.71 ? 233 CYS D CB    1 
ATOM   8091 S SG    . CYS D 1 211 ? -26.738 -37.411 -69.768 1.00 126.26 ? 233 CYS D SG    1 
ATOM   8092 N N     . LEU D 1 212 ? -28.655 -38.196 -72.317 1.00 124.23 ? 234 LEU D N     1 
ATOM   8093 C CA    . LEU D 1 212 ? -28.411 -37.981 -73.725 1.00 123.56 ? 234 LEU D CA    1 
ATOM   8094 C C     . LEU D 1 212 ? -27.649 -36.673 -73.903 1.00 122.94 ? 234 LEU D C     1 
ATOM   8095 O O     . LEU D 1 212 ? -28.116 -35.605 -73.487 1.00 122.90 ? 234 LEU D O     1 
ATOM   8096 C CB    . LEU D 1 212 ? -29.738 -37.899 -74.467 1.00 123.63 ? 234 LEU D CB    1 
ATOM   8097 C CG    . LEU D 1 212 ? -29.872 -38.317 -75.930 1.00 123.92 ? 234 LEU D CG    1 
ATOM   8098 C CD1   . LEU D 1 212 ? -30.844 -37.348 -76.601 1.00 124.20 ? 234 LEU D CD1   1 
ATOM   8099 C CD2   . LEU D 1 212 ? -28.531 -38.336 -76.674 1.00 124.39 ? 234 LEU D CD2   1 
ATOM   8100 N N     . PRO D 1 213 ? -26.457 -36.753 -74.500 1.00 122.31 ? 235 PRO D N     1 
ATOM   8101 C CA    . PRO D 1 213 ? -25.748 -35.530 -74.839 1.00 121.84 ? 235 PRO D CA    1 
ATOM   8102 C C     . PRO D 1 213 ? -26.457 -34.841 -75.990 1.00 121.38 ? 235 PRO D C     1 
ATOM   8103 O O     . PRO D 1 213 ? -26.945 -35.514 -76.903 1.00 121.17 ? 235 PRO D O     1 
ATOM   8104 C CB    . PRO D 1 213 ? -24.369 -36.034 -75.272 1.00 121.87 ? 235 PRO D CB    1 
ATOM   8105 C CG    . PRO D 1 213 ? -24.251 -37.405 -74.661 1.00 122.02 ? 235 PRO D CG    1 
ATOM   8106 C CD    . PRO D 1 213 ? -25.627 -37.955 -74.698 1.00 122.21 ? 235 PRO D CD    1 
ATOM   8107 N N     . VAL D 1 214 ? -26.534 -33.514 -75.933 1.00 121.04 ? 236 VAL D N     1 
ATOM   8108 C CA    . VAL D 1 214 ? -27.214 -32.755 -76.974 1.00 120.99 ? 236 VAL D CA    1 
ATOM   8109 C C     . VAL D 1 214 ? -26.314 -31.679 -77.568 1.00 120.96 ? 236 VAL D C     1 
ATOM   8110 O O     . VAL D 1 214 ? -25.985 -30.697 -76.904 1.00 120.69 ? 236 VAL D O     1 
ATOM   8111 C CB    . VAL D 1 214 ? -28.541 -32.138 -76.471 1.00 121.04 ? 236 VAL D CB    1 
ATOM   8112 C CG1   . VAL D 1 214 ? -29.253 -31.398 -77.602 1.00 120.98 ? 236 VAL D CG1   1 
ATOM   8113 C CG2   . VAL D 1 214 ? -29.457 -33.218 -75.906 1.00 121.10 ? 236 VAL D CG2   1 
ATOM   8114 N N     . TYR D 1 215 ? -25.942 -31.869 -78.833 1.00 121.09 ? 237 TYR D N     1 
ATOM   8115 C CA    . TYR D 1 215 ? -25.011 -30.971 -79.511 1.00 121.35 ? 237 TYR D CA    1 
ATOM   8116 C C     . TYR D 1 215 ? -25.693 -29.762 -80.135 1.00 120.87 ? 237 TYR D C     1 
ATOM   8117 O O     . TYR D 1 215 ? -26.491 -29.896 -81.068 1.00 120.76 ? 237 TYR D O     1 
ATOM   8118 C CB    . TYR D 1 215 ? -24.188 -31.732 -80.550 1.00 121.87 ? 237 TYR D CB    1 
ATOM   8119 C CG    . TYR D 1 215 ? -23.224 -32.699 -79.918 1.00 123.58 ? 237 TYR D CG    1 
ATOM   8120 C CD1   . TYR D 1 215 ? -21.926 -32.311 -79.617 1.00 125.25 ? 237 TYR D CD1   1 
ATOM   8121 C CD2   . TYR D 1 215 ? -23.621 -33.996 -79.599 1.00 125.36 ? 237 TYR D CD2   1 
ATOM   8122 C CE1   . TYR D 1 215 ? -21.044 -33.192 -79.032 1.00 126.84 ? 237 TYR D CE1   1 
ATOM   8123 C CE2   . TYR D 1 215 ? -22.748 -34.882 -79.012 1.00 126.77 ? 237 TYR D CE2   1 
ATOM   8124 C CZ    . TYR D 1 215 ? -21.464 -34.473 -78.731 1.00 127.44 ? 237 TYR D CZ    1 
ATOM   8125 O OH    . TYR D 1 215 ? -20.597 -35.358 -78.148 1.00 128.89 ? 237 TYR D OH    1 
ATOM   8126 N N     . TYR D 1 216 ? -25.343 -28.585 -79.612 1.00 120.45 ? 238 TYR D N     1 
ATOM   8127 C CA    . TYR D 1 216 ? -25.944 -27.312 -79.996 1.00 120.21 ? 238 TYR D CA    1 
ATOM   8128 C C     . TYR D 1 216 ? -25.974 -27.087 -81.488 1.00 120.58 ? 238 TYR D C     1 
ATOM   8129 O O     . TYR D 1 216 ? -27.012 -26.765 -82.058 1.00 120.77 ? 238 TYR D O     1 
ATOM   8130 C CB    . TYR D 1 216 ? -25.181 -26.161 -79.352 1.00 119.92 ? 238 TYR D CB    1 
ATOM   8131 C CG    . TYR D 1 216 ? -25.616 -24.785 -79.816 1.00 118.94 ? 238 TYR D CG    1 
ATOM   8132 C CD1   . TYR D 1 216 ? -26.795 -24.206 -79.348 1.00 118.40 ? 238 TYR D CD1   1 
ATOM   8133 C CD2   . TYR D 1 216 ? -24.837 -24.050 -80.699 1.00 118.25 ? 238 TYR D CD2   1 
ATOM   8134 C CE1   . TYR D 1 216 ? -27.194 -22.937 -79.757 1.00 117.68 ? 238 TYR D CE1   1 
ATOM   8135 C CE2   . TYR D 1 216 ? -25.232 -22.778 -81.113 1.00 117.96 ? 238 TYR D CE2   1 
ATOM   8136 C CZ    . TYR D 1 216 ? -26.413 -22.232 -80.635 1.00 117.28 ? 238 TYR D CZ    1 
ATOM   8137 O OH    . TYR D 1 216 ? -26.815 -20.979 -81.031 1.00 116.84 ? 238 TYR D OH    1 
ATOM   8138 N N     . GLU D 1 217 ? -24.819 -27.238 -82.116 1.00 121.01 ? 239 GLU D N     1 
ATOM   8139 C CA    . GLU D 1 217 ? -24.686 -26.979 -83.543 1.00 121.31 ? 239 GLU D CA    1 
ATOM   8140 C C     . GLU D 1 217 ? -25.444 -27.991 -84.391 1.00 121.51 ? 239 GLU D C     1 
ATOM   8141 O O     . GLU D 1 217 ? -25.969 -27.632 -85.435 1.00 121.45 ? 239 GLU D O     1 
ATOM   8142 C CB    . GLU D 1 217 ? -23.207 -26.875 -83.955 1.00 121.33 ? 239 GLU D CB    1 
ATOM   8143 C CG    . GLU D 1 217 ? -22.237 -27.783 -83.165 1.00 121.50 ? 239 GLU D CG    1 
ATOM   8144 C CD    . GLU D 1 217 ? -22.097 -27.399 -81.688 1.00 121.26 ? 239 GLU D CD    1 
ATOM   8145 O OE1   . GLU D 1 217 ? -22.450 -28.239 -80.827 1.00 120.90 ? 239 GLU D OE1   1 
ATOM   8146 O OE2   . GLU D 1 217 ? -21.652 -26.264 -81.392 1.00 121.32 ? 239 GLU D OE2   1 
ATOM   8147 N N     . GLN D 1 218 ? -25.512 -29.240 -83.922 1.00 121.95 ? 240 GLN D N     1 
ATOM   8148 C CA    . GLN D 1 218 ? -26.326 -30.289 -84.558 1.00 122.49 ? 240 GLN D CA    1 
ATOM   8149 C C     . GLN D 1 218 ? -27.812 -29.977 -84.460 1.00 122.50 ? 240 GLN D C     1 
ATOM   8150 O O     . GLN D 1 218 ? -28.601 -30.312 -85.350 1.00 122.53 ? 240 GLN D O     1 
ATOM   8151 C CB    . GLN D 1 218 ? -26.063 -31.657 -83.913 1.00 122.67 ? 240 GLN D CB    1 
ATOM   8152 C CG    . GLN D 1 218 ? -24.759 -32.310 -84.324 1.00 123.68 ? 240 GLN D CG    1 
ATOM   8153 C CD    . GLN D 1 218 ? -24.446 -32.090 -85.815 1.00 125.33 ? 240 GLN D CD    1 
ATOM   8154 O OE1   . GLN D 1 218 ? -23.371 -31.548 -86.172 1.00 126.68 ? 240 GLN D OE1   1 
ATOM   8155 N NE2   . GLN D 1 218 ? -25.393 -32.484 -86.693 1.00 125.39 ? 240 GLN D NE2   1 
ATOM   8156 N N     . LEU D 1 219 ? -28.178 -29.342 -83.356 1.00 122.55 ? 241 LEU D N     1 
ATOM   8157 C CA    . LEU D 1 219 ? -29.546 -28.961 -83.104 1.00 122.71 ? 241 LEU D CA    1 
ATOM   8158 C C     . LEU D 1 219 ? -29.925 -27.768 -83.974 1.00 122.61 ? 241 LEU D C     1 
ATOM   8159 O O     . LEU D 1 219 ? -30.950 -27.806 -84.656 1.00 122.67 ? 241 LEU D O     1 
ATOM   8160 C CB    . LEU D 1 219 ? -29.716 -28.621 -81.620 1.00 122.94 ? 241 LEU D CB    1 
ATOM   8161 C CG    . LEU D 1 219 ? -31.048 -28.690 -80.858 1.00 123.24 ? 241 LEU D CG    1 
ATOM   8162 C CD1   . LEU D 1 219 ? -31.027 -27.616 -79.775 1.00 123.79 ? 241 LEU D CD1   1 
ATOM   8163 C CD2   . LEU D 1 219 ? -32.270 -28.506 -81.742 1.00 123.86 ? 241 LEU D CD2   1 
ATOM   8164 N N     . VAL D 1 220 ? -29.104 -26.714 -83.950 1.00 122.52 ? 242 VAL D N     1 
ATOM   8165 C CA    . VAL D 1 220 ? -29.402 -25.501 -84.708 1.00 122.60 ? 242 VAL D CA    1 
ATOM   8166 C C     . VAL D 1 220 ? -29.475 -25.802 -86.207 1.00 122.90 ? 242 VAL D C     1 
ATOM   8167 O O     . VAL D 1 220 ? -30.276 -25.191 -86.924 1.00 122.96 ? 242 VAL D O     1 
ATOM   8168 C CB    . VAL D 1 220 ? -28.404 -24.362 -84.400 1.00 122.51 ? 242 VAL D CB    1 
ATOM   8169 C CG1   . VAL D 1 220 ? -28.443 -23.296 -85.473 1.00 122.38 ? 242 VAL D CG1   1 
ATOM   8170 C CG2   . VAL D 1 220 ? -28.720 -23.744 -83.052 1.00 122.38 ? 242 VAL D CG2   1 
ATOM   8171 N N     . LEU D 1 221 ? -28.663 -26.772 -86.659 1.00 123.26 ? 243 LEU D N     1 
ATOM   8172 C CA    . LEU D 1 221 ? -28.634 -27.188 -88.068 1.00 123.43 ? 243 LEU D CA    1 
ATOM   8173 C C     . LEU D 1 221 ? -29.781 -28.114 -88.462 1.00 123.57 ? 243 LEU D C     1 
ATOM   8174 O O     . LEU D 1 221 ? -30.478 -27.842 -89.440 1.00 123.60 ? 243 LEU D O     1 
ATOM   8175 C CB    . LEU D 1 221 ? -27.309 -27.882 -88.405 1.00 123.44 ? 243 LEU D CB    1 
ATOM   8176 C CG    . LEU D 1 221 ? -25.998 -27.091 -88.409 1.00 123.31 ? 243 LEU D CG    1 
ATOM   8177 C CD1   . LEU D 1 221 ? -24.853 -28.075 -88.582 1.00 123.41 ? 243 LEU D CD1   1 
ATOM   8178 C CD2   . LEU D 1 221 ? -25.967 -26.018 -89.498 1.00 123.42 ? 243 LEU D CD2   1 
ATOM   8179 N N     . HIS D 1 222 ? -29.945 -29.218 -87.723 1.00 123.89 ? 244 HIS D N     1 
ATOM   8180 C CA    . HIS D 1 222 ? -30.983 -30.217 -88.015 1.00 124.28 ? 244 HIS D CA    1 
ATOM   8181 C C     . HIS D 1 222 ? -32.051 -30.268 -86.914 1.00 124.45 ? 244 HIS D C     1 
ATOM   8182 O O     . HIS D 1 222 ? -32.176 -31.281 -86.214 1.00 124.34 ? 244 HIS D O     1 
ATOM   8183 C CB    . HIS D 1 222 ? -30.375 -31.614 -88.208 1.00 124.31 ? 244 HIS D CB    1 
ATOM   8184 C CG    . HIS D 1 222 ? -29.170 -31.645 -89.100 1.00 124.80 ? 244 HIS D CG    1 
ATOM   8185 N ND1   . HIS D 1 222 ? -29.259 -31.733 -90.479 1.00 125.25 ? 244 HIS D ND1   1 
ATOM   8186 C CD2   . HIS D 1 222 ? -27.847 -31.617 -88.808 1.00 125.04 ? 244 HIS D CD2   1 
ATOM   8187 C CE1   . HIS D 1 222 ? -28.042 -31.749 -90.998 1.00 125.25 ? 244 HIS D CE1   1 
ATOM   8188 N NE2   . HIS D 1 222 ? -27.168 -31.682 -90.005 1.00 125.38 ? 244 HIS D NE2   1 
ATOM   8189 N N     . PRO D 1 223 ? -32.847 -29.187 -86.774 1.00 124.69 ? 245 PRO D N     1 
ATOM   8190 C CA    . PRO D 1 223 ? -33.718 -29.131 -85.620 1.00 125.02 ? 245 PRO D CA    1 
ATOM   8191 C C     . PRO D 1 223 ? -34.755 -30.231 -85.682 1.00 125.55 ? 245 PRO D C     1 
ATOM   8192 O O     . PRO D 1 223 ? -35.193 -30.729 -84.639 1.00 125.64 ? 245 PRO D O     1 
ATOM   8193 C CB    . PRO D 1 223 ? -34.362 -27.748 -85.729 1.00 124.93 ? 245 PRO D CB    1 
ATOM   8194 C CG    . PRO D 1 223 ? -34.324 -27.415 -87.154 1.00 124.62 ? 245 PRO D CG    1 
ATOM   8195 C CD    . PRO D 1 223 ? -33.154 -28.121 -87.753 1.00 124.69 ? 245 PRO D CD    1 
ATOM   8196 N N     . ARG D 1 224 ? -35.118 -30.628 -86.899 1.00 126.18 ? 246 ARG D N     1 
ATOM   8197 C CA    . ARG D 1 224 ? -36.101 -31.678 -87.069 1.00 126.96 ? 246 ARG D CA    1 
ATOM   8198 C C     . ARG D 1 224 ? -35.508 -33.033 -86.692 1.00 126.86 ? 246 ARG D C     1 
ATOM   8199 O O     . ARG D 1 224 ? -36.090 -33.755 -85.878 1.00 126.98 ? 246 ARG D O     1 
ATOM   8200 C CB    . ARG D 1 224 ? -36.688 -31.689 -88.487 1.00 127.32 ? 246 ARG D CB    1 
ATOM   8201 C CG    . ARG D 1 224 ? -38.076 -32.380 -88.544 1.00 129.13 ? 246 ARG D CG    1 
ATOM   8202 C CD    . ARG D 1 224 ? -38.825 -32.134 -89.850 1.00 131.99 ? 246 ARG D CD    1 
ATOM   8203 N NE    . ARG D 1 224 ? -40.078 -32.893 -89.877 1.00 134.49 ? 246 ARG D NE    1 
ATOM   8204 C CZ    . ARG D 1 224 ? -41.302 -32.363 -89.737 1.00 136.04 ? 246 ARG D CZ    1 
ATOM   8205 N NH1   . ARG D 1 224 ? -41.472 -31.050 -89.577 1.00 136.79 ? 246 ARG D NH1   1 
ATOM   8206 N NH2   . ARG D 1 224 ? -42.368 -33.154 -89.767 1.00 136.89 ? 246 ARG D NH2   1 
ATOM   8207 N N     . ARG D 1 225 ? -34.351 -33.362 -87.263 1.00 126.79 ? 247 ARG D N     1 
ATOM   8208 C CA    A ARG D 1 225 ? -33.693 -34.630 -86.968 0.50 126.76 ? 247 ARG D CA    1 
ATOM   8209 C CA    B ARG D 1 225 ? -33.679 -34.624 -86.967 0.50 126.79 ? 247 ARG D CA    1 
ATOM   8210 C C     . ARG D 1 225 ? -33.420 -34.746 -85.472 1.00 126.58 ? 247 ARG D C     1 
ATOM   8211 O O     . ARG D 1 225 ? -33.689 -35.785 -84.866 1.00 126.43 ? 247 ARG D O     1 
ATOM   8212 C CB    A ARG D 1 225 ? -32.395 -34.771 -87.776 0.50 126.91 ? 247 ARG D CB    1 
ATOM   8213 C CB    B ARG D 1 225 ? -32.360 -34.721 -87.738 0.50 126.97 ? 247 ARG D CB    1 
ATOM   8214 C CG    A ARG D 1 225 ? -31.675 -36.108 -87.595 0.50 127.46 ? 247 ARG D CG    1 
ATOM   8215 C CG    B ARG D 1 225 ? -31.623 -36.061 -87.560 0.50 127.68 ? 247 ARG D CG    1 
ATOM   8216 C CD    A ARG D 1 225 ? -32.648 -37.285 -87.697 0.50 128.26 ? 247 ARG D CD    1 
ATOM   8217 C CD    B ARG D 1 225 ? -30.270 -36.022 -88.245 0.50 128.74 ? 247 ARG D CD    1 
ATOM   8218 N NE    A ARG D 1 225 ? -32.003 -38.570 -87.414 0.50 128.59 ? 247 ARG D NE    1 
ATOM   8219 N NE    B ARG D 1 225 ? -30.392 -35.398 -89.571 0.50 129.46 ? 247 ARG D NE    1 
ATOM   8220 C CZ    A ARG D 1 225 ? -31.689 -39.485 -88.357 0.50 128.61 ? 247 ARG D CZ    1 
ATOM   8221 C CZ    B ARG D 1 225 ? -29.360 -34.928 -90.265 0.50 129.91 ? 247 ARG D CZ    1 
ATOM   8222 N NH1   A ARG D 1 225 ? -32.126 -39.264 -89.604 0.50 128.68 ? 247 ARG D NH1   1 
ATOM   8223 N NH1   B ARG D 1 225 ? -28.117 -35.009 -89.761 0.50 129.97 ? 247 ARG D NH1   1 
ATOM   8224 N NH2   A ARG D 1 225 ? -31.116 -40.627 -87.905 0.50 128.55 ? 247 ARG D NH2   1 
ATOM   8225 N NH2   B ARG D 1 225 ? -29.573 -34.373 -91.464 0.50 130.26 ? 247 ARG D NH2   1 
ATOM   8226 N N     . SER D 1 226 ? -32.901 -33.668 -84.889 1.00 126.35 ? 248 SER D N     1 
ATOM   8227 C CA    . SER D 1 226 ? -32.532 -33.657 -83.484 1.00 126.14 ? 248 SER D CA    1 
ATOM   8228 C C     . SER D 1 226 ? -33.727 -33.985 -82.581 1.00 126.05 ? 248 SER D C     1 
ATOM   8229 O O     . SER D 1 226 ? -33.819 -35.130 -82.044 1.00 126.03 ? 248 SER D O     1 
ATOM   8230 C CB    . SER D 1 226 ? -31.893 -32.311 -83.103 1.00 126.10 ? 248 SER D CB    1 
ATOM   8231 O OG    . SER D 1 226 ? -30.714 -32.068 -83.860 1.00 125.90 ? 248 SER D OG    1 
ATOM   8232 N N     . LEU D 1 227 ? -34.654 -33.002 -82.444 1.00 125.93 ? 249 LEU D N     1 
ATOM   8233 C CA    . LEU D 1 227 ? -35.763 -33.144 -81.506 1.00 125.85 ? 249 LEU D CA    1 
ATOM   8234 C C     . LEU D 1 227 ? -36.440 -34.506 -81.582 1.00 126.11 ? 249 LEU D C     1 
ATOM   8235 O O     . LEU D 1 227 ? -36.830 -35.057 -80.547 1.00 126.09 ? 249 LEU D O     1 
ATOM   8236 C CB    . LEU D 1 227 ? -36.786 -32.022 -81.701 1.00 125.66 ? 249 LEU D CB    1 
ATOM   8237 C CG    . LEU D 1 227 ? -36.680 -30.753 -80.849 1.00 125.18 ? 249 LEU D CG    1 
ATOM   8238 C CD1   . LEU D 1 227 ? -36.720 -31.060 -79.362 1.00 125.07 ? 249 LEU D CD1   1 
ATOM   8239 C CD2   . LEU D 1 227 ? -35.451 -29.971 -81.194 1.00 124.91 ? 249 LEU D CD2   1 
ATOM   8240 N N     . LYS D 1 228 ? -36.557 -35.048 -82.802 1.00 126.49 ? 250 LYS D N     1 
ATOM   8241 C CA    . LYS D 1 228 ? -37.183 -36.359 -83.032 1.00 126.87 ? 250 LYS D CA    1 
ATOM   8242 C C     . LYS D 1 228 ? -36.493 -37.430 -82.214 1.00 126.63 ? 250 LYS D C     1 
ATOM   8243 O O     . LYS D 1 228 ? -37.136 -38.183 -81.488 1.00 126.65 ? 250 LYS D O     1 
ATOM   8244 C CB    . LYS D 1 228 ? -37.169 -36.744 -84.518 1.00 127.15 ? 250 LYS D CB    1 
ATOM   8245 C CG    . LYS D 1 228 ? -38.410 -36.308 -85.280 1.00 128.70 ? 250 LYS D CG    1 
ATOM   8246 C CD    . LYS D 1 228 ? -38.399 -36.768 -86.731 1.00 131.46 ? 250 LYS D CD    1 
ATOM   8247 C CE    . LYS D 1 228 ? -39.647 -36.284 -87.464 1.00 132.77 ? 250 LYS D CE    1 
ATOM   8248 N NZ    . LYS D 1 228 ? -40.918 -36.795 -86.847 1.00 133.79 ? 250 LYS D NZ    1 
ATOM   8249 N N     . LEU D 1 229 ? -35.173 -37.474 -82.324 1.00 126.39 ? 251 LEU D N     1 
ATOM   8250 C CA    . LEU D 1 229 ? -34.389 -38.400 -81.547 1.00 126.17 ? 251 LEU D CA    1 
ATOM   8251 C C     . LEU D 1 229 ? -34.583 -38.095 -80.069 1.00 125.84 ? 251 LEU D C     1 
ATOM   8252 O O     . LEU D 1 229 ? -34.703 -39.018 -79.257 1.00 125.78 ? 251 LEU D O     1 
ATOM   8253 C CB    . LEU D 1 229 ? -32.919 -38.281 -81.937 1.00 126.43 ? 251 LEU D CB    1 
ATOM   8254 C CG    . LEU D 1 229 ? -32.605 -38.516 -83.424 1.00 127.30 ? 251 LEU D CG    1 
ATOM   8255 C CD1   . LEU D 1 229 ? -31.237 -37.947 -83.803 1.00 128.33 ? 251 LEU D CD1   1 
ATOM   8256 C CD2   . LEU D 1 229 ? -32.684 -40.000 -83.775 1.00 128.28 ? 251 LEU D CD2   1 
ATOM   8257 N N     . ILE D 1 230 ? -34.643 -36.795 -79.743 1.00 125.51 ? 252 ILE D N     1 
ATOM   8258 C CA    . ILE D 1 230 ? -34.773 -36.312 -78.361 1.00 125.15 ? 252 ILE D CA    1 
ATOM   8259 C C     . ILE D 1 230 ? -36.023 -36.891 -77.753 1.00 125.26 ? 252 ILE D C     1 
ATOM   8260 O O     . ILE D 1 230 ? -35.969 -37.676 -76.809 1.00 125.16 ? 252 ILE D O     1 
ATOM   8261 C CB    . ILE D 1 230 ? -34.926 -34.747 -78.309 1.00 124.94 ? 252 ILE D CB    1 
ATOM   8262 C CG1   . ILE D 1 230 ? -33.560 -34.060 -78.511 1.00 124.63 ? 252 ILE D CG1   1 
ATOM   8263 C CG2   . ILE D 1 230 ? -35.511 -34.280 -76.973 1.00 124.80 ? 252 ILE D CG2   1 
ATOM   8264 C CD1   . ILE D 1 230 ? -33.557 -32.511 -78.625 1.00 123.93 ? 252 ILE D CD1   1 
ATOM   8265 N N     . LEU D 1 231 ? -37.150 -36.489 -78.319 1.00 125.53 ? 253 LEU D N     1 
ATOM   8266 C CA    . LEU D 1 231 ? -38.440 -36.875 -77.811 1.00 125.90 ? 253 LEU D CA    1 
ATOM   8267 C C     . LEU D 1 231 ? -38.565 -38.392 -77.833 1.00 126.22 ? 253 LEU D C     1 
ATOM   8268 O O     . LEU D 1 231 ? -39.209 -38.980 -76.970 1.00 126.14 ? 253 LEU D O     1 
ATOM   8269 C CB    . LEU D 1 231 ? -39.540 -36.194 -78.631 1.00 125.94 ? 253 LEU D CB    1 
ATOM   8270 C CG    . LEU D 1 231 ? -39.512 -34.648 -78.632 1.00 125.86 ? 253 LEU D CG    1 
ATOM   8271 C CD1   . LEU D 1 231 ? -40.262 -34.062 -79.830 1.00 125.95 ? 253 LEU D CD1   1 
ATOM   8272 C CD2   . LEU D 1 231 ? -40.086 -34.086 -77.339 1.00 126.03 ? 253 LEU D CD2   1 
ATOM   8273 N N     . ASP D 1 232 ? -37.921 -39.021 -78.808 1.00 126.80 ? 254 ASP D N     1 
ATOM   8274 C CA    . ASP D 1 232 ? -37.876 -40.470 -78.868 1.00 127.51 ? 254 ASP D CA    1 
ATOM   8275 C C     . ASP D 1 232 ? -37.246 -40.999 -77.593 1.00 127.32 ? 254 ASP D C     1 
ATOM   8276 O O     . ASP D 1 232 ? -37.870 -41.767 -76.858 1.00 127.27 ? 254 ASP D O     1 
ATOM   8277 C CB    . ASP D 1 232 ? -37.059 -40.927 -80.072 1.00 128.10 ? 254 ASP D CB    1 
ATOM   8278 C CG    . ASP D 1 232 ? -37.248 -42.399 -80.374 1.00 129.97 ? 254 ASP D CG    1 
ATOM   8279 O OD1   . ASP D 1 232 ? -36.634 -43.251 -79.680 1.00 131.80 ? 254 ASP D OD1   1 
ATOM   8280 O OD2   . ASP D 1 232 ? -38.016 -42.701 -81.319 1.00 132.74 ? 254 ASP D OD2   1 
ATOM   8281 N N     . PHE D 1 233 ? -36.008 -40.563 -77.350 1.00 127.17 ? 255 PHE D N     1 
ATOM   8282 C CA    . PHE D 1 233 ? -35.220 -40.928 -76.173 1.00 126.92 ? 255 PHE D CA    1 
ATOM   8283 C C     . PHE D 1 233 ? -35.990 -40.717 -74.866 1.00 127.10 ? 255 PHE D C     1 
ATOM   8284 O O     . PHE D 1 233 ? -35.931 -41.553 -73.957 1.00 127.10 ? 255 PHE D O     1 
ATOM   8285 C CB    . PHE D 1 233 ? -33.905 -40.137 -76.187 1.00 126.70 ? 255 PHE D CB    1 
ATOM   8286 C CG    . PHE D 1 233 ? -33.223 -40.035 -74.852 1.00 125.94 ? 255 PHE D CG    1 
ATOM   8287 C CD1   . PHE D 1 233 ? -33.285 -38.854 -74.119 1.00 125.27 ? 255 PHE D CD1   1 
ATOM   8288 C CD2   . PHE D 1 233 ? -32.498 -41.105 -74.338 1.00 125.31 ? 255 PHE D CD2   1 
ATOM   8289 C CE1   . PHE D 1 233 ? -32.649 -38.746 -72.885 1.00 125.06 ? 255 PHE D CE1   1 
ATOM   8290 C CE2   . PHE D 1 233 ? -31.859 -41.007 -73.106 1.00 124.99 ? 255 PHE D CE2   1 
ATOM   8291 C CZ    . PHE D 1 233 ? -31.933 -39.826 -72.377 1.00 125.02 ? 255 PHE D CZ    1 
ATOM   8292 N N     . LEU D 1 234 ? -36.720 -39.602 -74.792 1.00 127.26 ? 256 LEU D N     1 
ATOM   8293 C CA    . LEU D 1 234 ? -37.568 -39.283 -73.639 1.00 127.33 ? 256 LEU D CA    1 
ATOM   8294 C C     . LEU D 1 234 ? -38.783 -40.223 -73.536 1.00 127.69 ? 256 LEU D C     1 
ATOM   8295 O O     . LEU D 1 234 ? -39.288 -40.484 -72.434 1.00 127.52 ? 256 LEU D O     1 
ATOM   8296 C CB    . LEU D 1 234 ? -38.058 -37.824 -73.735 1.00 127.16 ? 256 LEU D CB    1 
ATOM   8297 C CG    . LEU D 1 234 ? -37.050 -36.661 -73.731 1.00 126.50 ? 256 LEU D CG    1 
ATOM   8298 C CD1   . LEU D 1 234 ? -37.692 -35.344 -74.204 1.00 125.63 ? 256 LEU D CD1   1 
ATOM   8299 C CD2   . LEU D 1 234 ? -36.454 -36.494 -72.339 1.00 126.30 ? 256 LEU D CD2   1 
ATOM   8300 N N     . GLY D 1 235 ? -39.246 -40.717 -74.690 1.00 128.16 ? 257 GLY D N     1 
ATOM   8301 C CA    . GLY D 1 235 ? -40.469 -41.517 -74.761 1.00 128.65 ? 257 GLY D CA    1 
ATOM   8302 C C     . GLY D 1 235 ? -41.741 -40.681 -74.833 1.00 128.95 ? 257 GLY D C     1 
ATOM   8303 O O     . GLY D 1 235 ? -42.735 -41.028 -74.192 1.00 129.04 ? 257 GLY D O     1 
ATOM   8304 N N     . ILE D 1 236 ? -41.704 -39.584 -75.611 1.00 129.24 ? 258 ILE D N     1 
ATOM   8305 C CA    . ILE D 1 236 ? -42.857 -38.686 -75.801 1.00 129.51 ? 258 ILE D CA    1 
ATOM   8306 C C     . ILE D 1 236 ? -43.283 -38.656 -77.268 1.00 129.67 ? 258 ILE D C     1 
ATOM   8307 O O     . ILE D 1 236 ? -42.444 -38.560 -78.163 1.00 129.72 ? 258 ILE D O     1 
ATOM   8308 C CB    . ILE D 1 236 ? -42.550 -37.238 -75.312 1.00 129.46 ? 258 ILE D CB    1 
ATOM   8309 C CG1   . ILE D 1 236 ? -42.415 -37.215 -73.786 1.00 129.75 ? 258 ILE D CG1   1 
ATOM   8310 C CG2   . ILE D 1 236 ? -43.637 -36.244 -75.753 1.00 129.50 ? 258 ILE D CG2   1 
ATOM   8311 C CD1   . ILE D 1 236 ? -41.822 -35.933 -73.223 1.00 130.42 ? 258 ILE D CD1   1 
ATOM   8312 N N     . ALA D 1 237 ? -44.591 -38.738 -77.507 1.00 129.85 ? 259 ALA D N     1 
ATOM   8313 C CA    . ALA D 1 237 ? -45.137 -38.642 -78.858 1.00 129.94 ? 259 ALA D CA    1 
ATOM   8314 C C     . ALA D 1 237 ? -44.689 -37.345 -79.516 1.00 129.98 ? 259 ALA D C     1 
ATOM   8315 O O     . ALA D 1 237 ? -44.517 -36.317 -78.839 1.00 130.04 ? 259 ALA D O     1 
ATOM   8316 C CB    . ALA D 1 237 ? -46.643 -38.716 -78.818 1.00 129.98 ? 259 ALA D CB    1 
ATOM   8317 N N     . TRP D 1 238 ? -44.497 -37.400 -80.833 1.00 129.95 ? 260 TRP D N     1 
ATOM   8318 C CA    . TRP D 1 238 ? -44.016 -36.239 -81.573 1.00 129.94 ? 260 TRP D CA    1 
ATOM   8319 C C     . TRP D 1 238 ? -44.966 -35.033 -81.517 1.00 129.69 ? 260 TRP D C     1 
ATOM   8320 O O     . TRP D 1 238 ? -46.192 -35.194 -81.443 1.00 129.71 ? 260 TRP D O     1 
ATOM   8321 C CB    . TRP D 1 238 ? -43.733 -36.593 -83.034 1.00 130.07 ? 260 TRP D CB    1 
ATOM   8322 C CG    . TRP D 1 238 ? -43.580 -35.363 -83.862 1.00 130.68 ? 260 TRP D CG    1 
ATOM   8323 C CD1   . TRP D 1 238 ? -44.544 -34.749 -84.615 1.00 131.09 ? 260 TRP D CD1   1 
ATOM   8324 C CD2   . TRP D 1 238 ? -42.411 -34.553 -83.971 1.00 131.28 ? 260 TRP D CD2   1 
ATOM   8325 N NE1   . TRP D 1 238 ? -44.037 -33.617 -85.208 1.00 131.39 ? 260 TRP D NE1   1 
ATOM   8326 C CE2   . TRP D 1 238 ? -42.727 -33.473 -84.831 1.00 131.59 ? 260 TRP D CE2   1 
ATOM   8327 C CE3   . TRP D 1 238 ? -41.120 -34.641 -83.441 1.00 131.40 ? 260 TRP D CE3   1 
ATOM   8328 C CZ2   . TRP D 1 238 ? -41.795 -32.486 -85.174 1.00 131.74 ? 260 TRP D CZ2   1 
ATOM   8329 C CZ3   . TRP D 1 238 ? -40.195 -33.660 -83.779 1.00 131.87 ? 260 TRP D CZ3   1 
ATOM   8330 C CH2   . TRP D 1 238 ? -40.537 -32.598 -84.642 1.00 131.80 ? 260 TRP D CH2   1 
ATOM   8331 N N     . SER D 1 239 ? -44.372 -33.834 -81.550 1.00 129.37 ? 261 SER D N     1 
ATOM   8332 C CA    . SER D 1 239 ? -45.108 -32.584 -81.734 1.00 129.07 ? 261 SER D CA    1 
ATOM   8333 C C     . SER D 1 239 ? -44.299 -31.620 -82.577 1.00 128.86 ? 261 SER D C     1 
ATOM   8334 O O     . SER D 1 239 ? -43.131 -31.380 -82.309 1.00 128.77 ? 261 SER D O     1 
ATOM   8335 C CB    . SER D 1 239 ? -45.427 -31.926 -80.396 1.00 129.10 ? 261 SER D CB    1 
ATOM   8336 O OG    . SER D 1 239 ? -45.818 -30.566 -80.594 1.00 129.15 ? 261 SER D OG    1 
ATOM   8337 N N     . ASP D 1 240 ? -44.942 -31.058 -83.591 1.00 128.83 ? 262 ASP D N     1 
ATOM   8338 C CA    . ASP D 1 240 ? -44.289 -30.130 -84.497 1.00 128.76 ? 262 ASP D CA    1 
ATOM   8339 C C     . ASP D 1 240 ? -44.121 -28.743 -83.876 1.00 128.36 ? 262 ASP D C     1 
ATOM   8340 O O     . ASP D 1 240 ? -43.164 -28.039 -84.216 1.00 128.37 ? 262 ASP D O     1 
ATOM   8341 C CB    . ASP D 1 240 ? -45.080 -30.026 -85.804 1.00 129.08 ? 262 ASP D CB    1 
ATOM   8342 C CG    . ASP D 1 240 ? -44.425 -29.101 -86.811 1.00 130.09 ? 262 ASP D CG    1 
ATOM   8343 O OD1   . ASP D 1 240 ? -43.519 -29.557 -87.539 1.00 130.97 ? 262 ASP D OD1   1 
ATOM   8344 O OD2   . ASP D 1 240 ? -44.823 -27.916 -86.874 1.00 131.79 ? 262 ASP D OD2   1 
ATOM   8345 N N     . ALA D 1 241 ? -45.047 -28.348 -82.972 1.00 127.89 ? 263 ALA D N     1 
ATOM   8346 C CA    . ALA D 1 241 ? -44.981 -27.035 -82.322 1.00 127.59 ? 263 ALA D CA    1 
ATOM   8347 C C     . ALA D 1 241 ? -43.559 -26.784 -81.850 1.00 127.45 ? 263 ALA D C     1 
ATOM   8348 O O     . ALA D 1 241 ? -43.128 -25.635 -81.678 1.00 127.44 ? 263 ALA D O     1 
ATOM   8349 C CB    . ALA D 1 241 ? -45.945 -26.968 -81.155 1.00 127.62 ? 263 ALA D CB    1 
ATOM   8350 N N     . VAL D 1 242 ? -42.851 -27.895 -81.658 1.00 127.28 ? 264 VAL D N     1 
ATOM   8351 C CA    . VAL D 1 242 ? -41.437 -27.943 -81.318 1.00 127.07 ? 264 VAL D CA    1 
ATOM   8352 C C     . VAL D 1 242 ? -40.630 -26.904 -82.108 1.00 126.98 ? 264 VAL D C     1 
ATOM   8353 O O     . VAL D 1 242 ? -39.891 -26.087 -81.536 1.00 126.84 ? 264 VAL D O     1 
ATOM   8354 C CB    . VAL D 1 242 ? -40.903 -29.398 -81.571 1.00 127.00 ? 264 VAL D CB    1 
ATOM   8355 C CG1   . VAL D 1 242 ? -39.423 -29.342 -82.065 1.00 127.17 ? 264 VAL D CG1   1 
ATOM   8356 C CG2   . VAL D 1 242 ? -41.094 -30.284 -80.264 1.00 127.08 ? 264 VAL D CG2   1 
ATOM   8357 N N     . LEU D 1 243 ? -40.816 -26.916 -83.422 1.00 127.03 ? 265 LEU D N     1 
ATOM   8358 C CA    . LEU D 1 243 ? -40.001 -26.108 -84.310 1.00 127.17 ? 265 LEU D CA    1 
ATOM   8359 C C     . LEU D 1 243 ? -40.477 -24.666 -84.369 1.00 127.25 ? 265 LEU D C     1 
ATOM   8360 O O     . LEU D 1 243 ? -39.818 -23.806 -84.965 1.00 127.26 ? 265 LEU D O     1 
ATOM   8361 C CB    . LEU D 1 243 ? -39.986 -26.745 -85.694 1.00 127.08 ? 265 LEU D CB    1 
ATOM   8362 C CG    . LEU D 1 243 ? -39.616 -28.230 -85.599 1.00 127.42 ? 265 LEU D CG    1 
ATOM   8363 C CD1   . LEU D 1 243 ? -40.239 -29.035 -86.720 1.00 128.14 ? 265 LEU D CD1   1 
ATOM   8364 C CD2   . LEU D 1 243 ? -38.094 -28.439 -85.545 1.00 127.95 ? 265 LEU D CD2   1 
ATOM   8365 N N     . HIS D 1 244 ? -41.616 -24.413 -83.726 1.00 127.39 ? 266 HIS D N     1 
ATOM   8366 C CA    . HIS D 1 244 ? -42.231 -23.095 -83.722 1.00 127.47 ? 266 HIS D CA    1 
ATOM   8367 C C     . HIS D 1 244 ? -42.318 -22.588 -82.303 1.00 127.48 ? 266 HIS D C     1 
ATOM   8368 O O     . HIS D 1 244 ? -43.321 -22.008 -81.880 1.00 127.51 ? 266 HIS D O     1 
ATOM   8369 C CB    . HIS D 1 244 ? -43.613 -23.160 -84.357 1.00 127.45 ? 266 HIS D CB    1 
ATOM   8370 C CG    . HIS D 1 244 ? -43.585 -23.642 -85.765 1.00 127.54 ? 266 HIS D CG    1 
ATOM   8371 N ND1   . HIS D 1 244 ? -43.518 -22.783 -86.840 1.00 127.85 ? 266 HIS D ND1   1 
ATOM   8372 C CD2   . HIS D 1 244 ? -43.569 -24.896 -86.276 1.00 127.87 ? 266 HIS D CD2   1 
ATOM   8373 C CE1   . HIS D 1 244 ? -43.484 -23.487 -87.957 1.00 128.20 ? 266 HIS D CE1   1 
ATOM   8374 N NE2   . HIS D 1 244 ? -43.512 -24.772 -87.642 1.00 128.13 ? 266 HIS D NE2   1 
ATOM   8375 N N     . HIS D 1 245 ? -41.248 -22.817 -81.562 1.00 127.57 ? 267 HIS D N     1 
ATOM   8376 C CA    . HIS D 1 245 ? -41.177 -22.355 -80.199 1.00 127.82 ? 267 HIS D CA    1 
ATOM   8377 C C     . HIS D 1 245 ? -41.491 -20.860 -80.141 1.00 128.17 ? 267 HIS D C     1 
ATOM   8378 O O     . HIS D 1 245 ? -42.298 -20.417 -79.313 1.00 128.15 ? 267 HIS D O     1 
ATOM   8379 C CB    . HIS D 1 245 ? -39.776 -22.634 -79.636 1.00 127.69 ? 267 HIS D CB    1 
ATOM   8380 C CG    . HIS D 1 245 ? -38.679 -21.888 -80.347 1.00 127.00 ? 267 HIS D CG    1 
ATOM   8381 N ND1   . HIS D 1 245 ? -38.142 -20.721 -79.850 1.00 126.21 ? 267 HIS D ND1   1 
ATOM   8382 C CD2   . HIS D 1 245 ? -38.037 -22.128 -81.529 1.00 126.58 ? 267 HIS D CD2   1 
ATOM   8383 C CE1   . HIS D 1 245 ? -37.203 -20.283 -80.685 1.00 126.09 ? 267 HIS D CE1   1 
ATOM   8384 N NE2   . HIS D 1 245 ? -37.119 -21.119 -81.711 1.00 126.35 ? 267 HIS D NE2   1 
ATOM   8385 N N     . GLU D 1 246 ? -40.873 -20.105 -81.053 1.00 128.60 ? 268 GLU D N     1 
ATOM   8386 C CA    . GLU D 1 246 ? -40.907 -18.645 -81.055 1.00 129.14 ? 268 GLU D CA    1 
ATOM   8387 C C     . GLU D 1 246 ? -42.325 -18.097 -81.066 1.00 129.63 ? 268 GLU D C     1 
ATOM   8388 O O     . GLU D 1 246 ? -42.564 -16.972 -80.622 1.00 129.64 ? 268 GLU D O     1 
ATOM   8389 C CB    . GLU D 1 246 ? -40.109 -18.097 -82.244 1.00 129.10 ? 268 GLU D CB    1 
ATOM   8390 C CG    . GLU D 1 246 ? -40.709 -18.381 -83.628 1.00 129.35 ? 268 GLU D CG    1 
ATOM   8391 C CD    . GLU D 1 246 ? -40.560 -19.830 -84.100 1.00 129.70 ? 268 GLU D CD    1 
ATOM   8392 O OE1   . GLU D 1 246 ? -41.025 -20.119 -85.228 1.00 130.29 ? 268 GLU D OE1   1 
ATOM   8393 O OE2   . GLU D 1 246 ? -39.985 -20.673 -83.370 1.00 129.47 ? 268 GLU D OE2   1 
ATOM   8394 N N     . ASP D 1 247 ? -43.255 -18.912 -81.564 1.00 130.37 ? 269 ASP D N     1 
ATOM   8395 C CA    . ASP D 1 247 ? -44.668 -18.549 -81.655 1.00 131.06 ? 269 ASP D CA    1 
ATOM   8396 C C     . ASP D 1 247 ? -45.431 -18.818 -80.345 1.00 131.48 ? 269 ASP D C     1 
ATOM   8397 O O     . ASP D 1 247 ? -46.622 -18.535 -80.256 1.00 131.66 ? 269 ASP D O     1 
ATOM   8398 C CB    . ASP D 1 247 ? -45.341 -19.284 -82.836 1.00 131.03 ? 269 ASP D CB    1 
ATOM   8399 C CG    . ASP D 1 247 ? -44.876 -18.769 -84.220 1.00 131.56 ? 269 ASP D CG    1 
ATOM   8400 O OD1   . ASP D 1 247 ? -44.671 -17.526 -84.395 1.00 131.82 ? 269 ASP D OD1   1 
ATOM   8401 O OD2   . ASP D 1 247 ? -44.732 -19.612 -85.149 1.00 132.02 ? 269 ASP D OD2   1 
ATOM   8402 N N     . LEU D 1 248 ? -44.744 -19.342 -79.329 1.00 132.03 ? 270 LEU D N     1 
ATOM   8403 C CA    . LEU D 1 248 ? -45.405 -19.789 -78.097 1.00 132.54 ? 270 LEU D CA    1 
ATOM   8404 C C     . LEU D 1 248 ? -44.933 -19.100 -76.800 1.00 133.09 ? 270 LEU D C     1 
ATOM   8405 O O     . LEU D 1 248 ? -45.118 -19.638 -75.697 1.00 133.09 ? 270 LEU D O     1 
ATOM   8406 C CB    . LEU D 1 248 ? -45.301 -21.318 -77.986 1.00 132.41 ? 270 LEU D CB    1 
ATOM   8407 C CG    . LEU D 1 248 ? -46.119 -22.088 -79.030 1.00 132.29 ? 270 LEU D CG    1 
ATOM   8408 C CD1   . LEU D 1 248 ? -45.714 -23.542 -79.102 1.00 132.09 ? 270 LEU D CD1   1 
ATOM   8409 C CD2   . LEU D 1 248 ? -47.607 -21.967 -78.704 1.00 132.61 ? 270 LEU D CD2   1 
ATOM   8410 N N     . ILE D 1 249 ? -44.359 -17.899 -76.942 1.00 133.84 ? 271 ILE D N     1 
ATOM   8411 C CA    . ILE D 1 249 ? -43.791 -17.137 -75.813 1.00 134.48 ? 271 ILE D CA    1 
ATOM   8412 C C     . ILE D 1 249 ? -44.862 -16.382 -75.032 1.00 134.80 ? 271 ILE D C     1 
ATOM   8413 O O     . ILE D 1 249 ? -45.568 -15.539 -75.589 1.00 134.86 ? 271 ILE D O     1 
ATOM   8414 C CB    . ILE D 1 249 ? -42.695 -16.126 -76.282 1.00 134.53 ? 271 ILE D CB    1 
ATOM   8415 C CG1   . ILE D 1 249 ? -41.464 -16.859 -76.821 1.00 134.66 ? 271 ILE D CG1   1 
ATOM   8416 C CG2   . ILE D 1 249 ? -42.278 -15.194 -75.148 1.00 134.57 ? 271 ILE D CG2   1 
ATOM   8417 C CD1   . ILE D 1 249 ? -40.606 -15.998 -77.740 1.00 135.34 ? 271 ILE D CD1   1 
ATOM   8418 N N     . GLY D 1 250 ? -44.963 -16.682 -73.738 1.00 135.26 ? 272 GLY D N     1 
ATOM   8419 C CA    . GLY D 1 250 ? -45.932 -16.025 -72.862 1.00 135.90 ? 272 GLY D CA    1 
ATOM   8420 C C     . GLY D 1 250 ? -47.358 -16.528 -73.027 1.00 136.19 ? 272 GLY D C     1 
ATOM   8421 O O     . GLY D 1 250 ? -48.274 -16.046 -72.361 1.00 136.25 ? 272 GLY D O     1 
ATOM   8422 N N     . LYS D 1 251 ? -47.549 -17.490 -73.924 1.00 136.44 ? 273 LYS D N     1 
ATOM   8423 C CA    . LYS D 1 251 ? -48.854 -18.098 -74.126 1.00 136.63 ? 273 LYS D CA    1 
ATOM   8424 C C     . LYS D 1 251 ? -48.941 -19.336 -73.244 1.00 136.43 ? 273 LYS D C     1 
ATOM   8425 O O     . LYS D 1 251 ? -47.913 -19.963 -72.955 1.00 136.47 ? 273 LYS D O     1 
ATOM   8426 C CB    . LYS D 1 251 ? -49.072 -18.483 -75.595 1.00 136.89 ? 273 LYS D CB    1 
ATOM   8427 C CG    . LYS D 1 251 ? -48.570 -17.466 -76.603 1.00 138.01 ? 273 LYS D CG    1 
ATOM   8428 C CD    . LYS D 1 251 ? -48.967 -17.850 -78.020 1.00 139.61 ? 273 LYS D CD    1 
ATOM   8429 C CE    . LYS D 1 251 ? -50.085 -16.922 -78.533 1.00 140.74 ? 273 LYS D CE    1 
ATOM   8430 N NZ    . LYS D 1 251 ? -49.574 -15.514 -78.767 1.00 141.51 ? 273 LYS D NZ    1 
ATOM   8431 N N     . PRO D 1 252 ? -50.167 -19.677 -72.801 1.00 136.21 ? 274 PRO D N     1 
ATOM   8432 C CA    . PRO D 1 252 ? -50.494 -20.845 -71.966 1.00 135.84 ? 274 PRO D CA    1 
ATOM   8433 C C     . PRO D 1 252 ? -50.132 -22.205 -72.591 1.00 135.28 ? 274 PRO D C     1 
ATOM   8434 O O     . PRO D 1 252 ? -50.453 -22.459 -73.760 1.00 135.35 ? 274 PRO D O     1 
ATOM   8435 C CB    . PRO D 1 252 ? -52.013 -20.727 -71.797 1.00 136.00 ? 274 PRO D CB    1 
ATOM   8436 C CG    . PRO D 1 252 ? -52.289 -19.267 -71.923 1.00 136.22 ? 274 PRO D CG    1 
ATOM   8437 C CD    . PRO D 1 252 ? -51.332 -18.779 -72.959 1.00 136.29 ? 274 PRO D CD    1 
ATOM   8438 N N     . GLY D 1 253 ? -49.474 -23.061 -71.800 1.00 134.48 ? 275 GLY D N     1 
ATOM   8439 C CA    . GLY D 1 253 ? -49.001 -24.385 -72.248 1.00 133.42 ? 275 GLY D CA    1 
ATOM   8440 C C     . GLY D 1 253 ? -47.637 -24.361 -72.932 1.00 132.65 ? 275 GLY D C     1 
ATOM   8441 O O     . GLY D 1 253 ? -46.917 -25.389 -72.975 1.00 132.46 ? 275 GLY D O     1 
ATOM   8442 N N     . GLY D 1 254 ? -47.295 -23.173 -73.463 1.00 131.89 ? 276 GLY D N     1 
ATOM   8443 C CA    . GLY D 1 254 ? -46.088 -22.986 -74.242 1.00 130.83 ? 276 GLY D CA    1 
ATOM   8444 C C     . GLY D 1 254 ? -44.941 -22.547 -73.371 1.00 130.19 ? 276 GLY D C     1 
ATOM   8445 O O     . GLY D 1 254 ? -44.673 -23.160 -72.340 1.00 130.14 ? 276 GLY D O     1 
ATOM   8446 N N     . VAL D 1 255 ? -44.285 -21.459 -73.778 1.00 129.60 ? 277 VAL D N     1 
ATOM   8447 C CA    . VAL D 1 255 ? -42.981 -21.082 -73.226 1.00 128.98 ? 277 VAL D CA    1 
ATOM   8448 C C     . VAL D 1 255 ? -43.051 -19.869 -72.290 1.00 128.69 ? 277 VAL D C     1 
ATOM   8449 O O     . VAL D 1 255 ? -43.634 -18.816 -72.644 1.00 128.66 ? 277 VAL D O     1 
ATOM   8450 C CB    . VAL D 1 255 ? -41.942 -20.835 -74.362 1.00 128.95 ? 277 VAL D CB    1 
ATOM   8451 C CG1   . VAL D 1 255 ? -40.516 -20.832 -73.817 1.00 128.67 ? 277 VAL D CG1   1 
ATOM   8452 C CG2   . VAL D 1 255 ? -42.093 -21.874 -75.472 1.00 128.51 ? 277 VAL D CG2   1 
ATOM   8453 N N     . SER D 1 256 ? -42.442 -20.032 -71.101 1.00 128.25 ? 278 SER D N     1 
ATOM   8454 C CA    . SER D 1 256 ? -42.361 -18.954 -70.122 1.00 128.02 ? 278 SER D CA    1 
ATOM   8455 C C     . SER D 1 256 ? -40.918 -18.457 -69.959 1.00 127.90 ? 278 SER D C     1 
ATOM   8456 O O     . SER D 1 256 ? -40.012 -19.247 -69.678 1.00 127.93 ? 278 SER D O     1 
ATOM   8457 C CB    . SER D 1 256 ? -42.919 -19.431 -68.782 1.00 127.99 ? 278 SER D CB    1 
ATOM   8458 O OG    . SER D 1 256 ? -43.132 -18.337 -67.910 1.00 128.14 ? 278 SER D OG    1 
ATOM   8459 N N     . LEU D 1 257 ? -40.705 -17.153 -70.131 1.00 127.70 ? 279 LEU D N     1 
ATOM   8460 C CA    . LEU D 1 257 ? -39.353 -16.587 -70.085 1.00 127.54 ? 279 LEU D CA    1 
ATOM   8461 C C     . LEU D 1 257 ? -39.181 -15.497 -69.037 1.00 127.60 ? 279 LEU D C     1 
ATOM   8462 O O     . LEU D 1 257 ? -40.115 -14.744 -68.752 1.00 127.74 ? 279 LEU D O     1 
ATOM   8463 C CB    . LEU D 1 257 ? -38.967 -16.022 -71.447 1.00 127.41 ? 279 LEU D CB    1 
ATOM   8464 C CG    . LEU D 1 257 ? -39.011 -16.967 -72.646 1.00 127.22 ? 279 LEU D CG    1 
ATOM   8465 C CD1   . LEU D 1 257 ? -38.846 -16.150 -73.912 1.00 127.30 ? 279 LEU D CD1   1 
ATOM   8466 C CD2   . LEU D 1 257 ? -37.920 -18.024 -72.545 1.00 126.91 ? 279 LEU D CD2   1 
ATOM   8467 N N     . SER D 1 258 ? -37.973 -15.420 -68.478 1.00 127.50 ? 280 SER D N     1 
ATOM   8468 C CA    . SER D 1 258 ? -37.600 -14.368 -67.541 1.00 127.45 ? 280 SER D CA    1 
ATOM   8469 C C     . SER D 1 258 ? -37.005 -13.205 -68.327 1.00 127.43 ? 280 SER D C     1 
ATOM   8470 O O     . SER D 1 258 ? -36.173 -13.427 -69.199 1.00 127.47 ? 280 SER D O     1 
ATOM   8471 C CB    . SER D 1 258 ? -36.584 -14.919 -66.545 1.00 127.49 ? 280 SER D CB    1 
ATOM   8472 O OG    . SER D 1 258 ? -35.753 -13.877 -66.021 1.00 127.75 ? 280 SER D OG    1 
ATOM   8473 N N     . LYS D 1 259 ? -37.418 -11.973 -68.025 1.00 127.49 ? 281 LYS D N     1 
ATOM   8474 C CA    . LYS D 1 259 ? -37.033 -10.824 -68.859 1.00 127.77 ? 281 LYS D CA    1 
ATOM   8475 C C     . LYS D 1 259 ? -35.621 -10.322 -68.581 1.00 127.39 ? 281 LYS D C     1 
ATOM   8476 O O     . LYS D 1 259 ? -35.140 -9.379  -69.228 1.00 127.53 ? 281 LYS D O     1 
ATOM   8477 C CB    . LYS D 1 259 ? -38.028 -9.668  -68.725 1.00 128.16 ? 281 LYS D CB    1 
ATOM   8478 C CG    . LYS D 1 259 ? -37.660 -8.664  -67.654 1.00 130.07 ? 281 LYS D CG    1 
ATOM   8479 C CD    . LYS D 1 259 ? -37.892 -7.224  -68.125 1.00 133.67 ? 281 LYS D CD    1 
ATOM   8480 C CE    . LYS D 1 259 ? -37.843 -6.288  -66.934 1.00 135.88 ? 281 LYS D CE    1 
ATOM   8481 N NZ    . LYS D 1 259 ? -39.042 -6.446  -66.052 1.00 137.55 ? 281 LYS D NZ    1 
ATOM   8482 N N     . ILE D 1 260 ? -34.961 -10.945 -67.611 1.00 126.89 ? 282 ILE D N     1 
ATOM   8483 C CA    . ILE D 1 260 ? -33.613 -10.536 -67.248 1.00 126.32 ? 282 ILE D CA    1 
ATOM   8484 C C     . ILE D 1 260 ? -32.609 -11.686 -67.304 1.00 125.87 ? 282 ILE D C     1 
ATOM   8485 O O     . ILE D 1 260 ? -31.424 -11.473 -67.075 1.00 125.94 ? 282 ILE D O     1 
ATOM   8486 C CB    . ILE D 1 260 ? -33.576 -9.827  -65.869 1.00 126.39 ? 282 ILE D CB    1 
ATOM   8487 C CG1   . ILE D 1 260 ? -34.299 -10.674 -64.809 1.00 126.45 ? 282 ILE D CG1   1 
ATOM   8488 C CG2   . ILE D 1 260 ? -34.166 -8.410  -65.983 1.00 126.29 ? 282 ILE D CG2   1 
ATOM   8489 C CD1   . ILE D 1 260 ? -33.993 -10.254 -63.366 1.00 126.69 ? 282 ILE D CD1   1 
ATOM   8490 N N     . GLU D 1 261 ? -33.073 -12.899 -67.604 1.00 125.31 ? 283 GLU D N     1 
ATOM   8491 C CA    . GLU D 1 261 ? -32.152 -13.987 -67.926 1.00 124.98 ? 283 GLU D CA    1 
ATOM   8492 C C     . GLU D 1 261 ? -31.345 -13.600 -69.165 1.00 124.94 ? 283 GLU D C     1 
ATOM   8493 O O     . GLU D 1 261 ? -31.827 -12.835 -70.001 1.00 124.99 ? 283 GLU D O     1 
ATOM   8494 C CB    . GLU D 1 261 ? -32.905 -15.286 -68.160 1.00 124.84 ? 283 GLU D CB    1 
ATOM   8495 C CG    . GLU D 1 261 ? -33.150 -16.068 -66.897 1.00 124.67 ? 283 GLU D CG    1 
ATOM   8496 C CD    . GLU D 1 261 ? -33.840 -17.391 -67.152 1.00 124.95 ? 283 GLU D CD    1 
ATOM   8497 O OE1   . GLU D 1 261 ? -33.766 -17.910 -68.287 1.00 125.01 ? 283 GLU D OE1   1 
ATOM   8498 O OE2   . GLU D 1 261 ? -34.454 -17.920 -66.203 1.00 125.32 ? 283 GLU D OE2   1 
ATOM   8499 N N     . ARG D 1 262 ? -30.125 -14.115 -69.284 1.00 124.77 ? 284 ARG D N     1 
ATOM   8500 C CA    . ARG D 1 262 ? -29.188 -13.614 -70.298 1.00 124.76 ? 284 ARG D CA    1 
ATOM   8501 C C     . ARG D 1 262 ? -29.383 -14.152 -71.709 1.00 124.45 ? 284 ARG D C     1 
ATOM   8502 O O     . ARG D 1 262 ? -28.767 -13.641 -72.662 1.00 124.37 ? 284 ARG D O     1 
ATOM   8503 C CB    . ARG D 1 262 ? -27.743 -13.820 -69.847 1.00 124.97 ? 284 ARG D CB    1 
ATOM   8504 C CG    . ARG D 1 262 ? -27.422 -13.126 -68.531 1.00 126.53 ? 284 ARG D CG    1 
ATOM   8505 C CD    . ARG D 1 262 ? -27.734 -11.621 -68.580 1.00 129.38 ? 284 ARG D CD    1 
ATOM   8506 N NE    . ARG D 1 262 ? -26.531 -10.798 -68.788 1.00 132.25 ? 284 ARG D NE    1 
ATOM   8507 C CZ    . ARG D 1 262 ? -26.220 -10.156 -69.921 1.00 133.59 ? 284 ARG D CZ    1 
ATOM   8508 N NH1   . ARG D 1 262 ? -27.017 -10.225 -70.985 1.00 134.14 ? 284 ARG D NH1   1 
ATOM   8509 N NH2   . ARG D 1 262 ? -25.100 -9.436  -69.985 1.00 134.52 ? 284 ARG D NH2   1 
ATOM   8510 N N     . SER D 1 263 ? -30.229 -15.179 -71.848 1.00 124.26 ? 285 SER D N     1 
ATOM   8511 C CA    . SER D 1 263 ? -30.503 -15.742 -73.164 1.00 124.03 ? 285 SER D CA    1 
ATOM   8512 C C     . SER D 1 263 ? -31.936 -15.444 -73.638 1.00 124.06 ? 285 SER D C     1 
ATOM   8513 O O     . SER D 1 263 ? -32.706 -16.363 -73.934 1.00 123.99 ? 285 SER D O     1 
ATOM   8514 C CB    . SER D 1 263 ? -30.198 -17.240 -73.173 1.00 123.99 ? 285 SER D CB    1 
ATOM   8515 O OG    . SER D 1 263 ? -28.813 -17.455 -73.000 1.00 123.03 ? 285 SER D OG    1 
ATOM   8516 N N     . THR D 1 264 ? -32.268 -14.152 -73.726 1.00 124.05 ? 286 THR D N     1 
ATOM   8517 C CA    . THR D 1 264 ? -33.620 -13.689 -74.103 1.00 124.08 ? 286 THR D CA    1 
ATOM   8518 C C     . THR D 1 264 ? -33.747 -13.153 -75.541 1.00 123.86 ? 286 THR D C     1 
ATOM   8519 O O     . THR D 1 264 ? -34.468 -13.738 -76.354 1.00 123.79 ? 286 THR D O     1 
ATOM   8520 C CB    . THR D 1 264 ? -34.206 -12.678 -73.058 1.00 124.19 ? 286 THR D CB    1 
ATOM   8521 O OG1   . THR D 1 264 ? -34.825 -13.403 -71.987 1.00 124.41 ? 286 THR D OG1   1 
ATOM   8522 C CG2   . THR D 1 264 ? -35.255 -11.751 -73.679 1.00 124.39 ? 286 THR D CG2   1 
ATOM   8523 N N     . ASP D 1 265 ? -33.065 -12.051 -75.857 1.00 123.67 ? 287 ASP D N     1 
ATOM   8524 C CA    . ASP D 1 265 ? -33.157 -11.483 -77.199 1.00 123.52 ? 287 ASP D CA    1 
ATOM   8525 C C     . ASP D 1 265 ? -32.732 -12.502 -78.267 1.00 123.52 ? 287 ASP D C     1 
ATOM   8526 O O     . ASP D 1 265 ? -32.934 -12.266 -79.455 1.00 123.66 ? 287 ASP D O     1 
ATOM   8527 C CB    . ASP D 1 265 ? -32.419 -10.129 -77.325 1.00 123.47 ? 287 ASP D CB    1 
ATOM   8528 C CG    . ASP D 1 265 ? -30.890 -10.254 -77.257 1.00 123.44 ? 287 ASP D CG    1 
ATOM   8529 O OD1   . ASP D 1 265 ? -30.302 -11.028 -78.044 1.00 123.33 ? 287 ASP D OD1   1 
ATOM   8530 O OD2   . ASP D 1 265 ? -30.263 -9.538  -76.440 1.00 122.95 ? 287 ASP D OD2   1 
ATOM   8531 N N     . GLN D 1 266 ? -32.176 -13.635 -77.825 1.00 123.46 ? 288 GLN D N     1 
ATOM   8532 C CA    . GLN D 1 266 ? -31.774 -14.731 -78.714 1.00 123.49 ? 288 GLN D CA    1 
ATOM   8533 C C     . GLN D 1 266 ? -32.830 -15.831 -78.851 1.00 123.60 ? 288 GLN D C     1 
ATOM   8534 O O     . GLN D 1 266 ? -33.072 -16.314 -79.954 1.00 123.64 ? 288 GLN D O     1 
ATOM   8535 C CB    . GLN D 1 266 ? -30.437 -15.345 -78.285 1.00 123.43 ? 288 GLN D CB    1 
ATOM   8536 C CG    . GLN D 1 266 ? -29.229 -14.425 -78.427 1.00 123.17 ? 288 GLN D CG    1 
ATOM   8537 C CD    . GLN D 1 266 ? -28.592 -14.077 -77.092 1.00 122.92 ? 288 GLN D CD    1 
ATOM   8538 O OE1   . GLN D 1 266 ? -28.767 -12.977 -76.574 1.00 123.01 ? 288 GLN D OE1   1 
ATOM   8539 N NE2   . GLN D 1 266 ? -27.847 -15.015 -76.529 1.00 122.57 ? 288 GLN D NE2   1 
ATOM   8540 N N     . VAL D 1 267 ? -33.440 -16.230 -77.734 1.00 123.79 ? 289 VAL D N     1 
ATOM   8541 C CA    . VAL D 1 267 ? -34.463 -17.295 -77.720 1.00 124.05 ? 289 VAL D CA    1 
ATOM   8542 C C     . VAL D 1 267 ? -35.822 -16.860 -78.311 1.00 124.21 ? 289 VAL D C     1 
ATOM   8543 O O     . VAL D 1 267 ? -36.561 -17.692 -78.850 1.00 124.22 ? 289 VAL D O     1 
ATOM   8544 C CB    . VAL D 1 267 ? -34.630 -17.927 -76.288 1.00 124.09 ? 289 VAL D CB    1 
ATOM   8545 C CG1   . VAL D 1 267 ? -35.989 -18.598 -76.104 1.00 123.99 ? 289 VAL D CG1   1 
ATOM   8546 C CG2   . VAL D 1 267 ? -33.527 -18.927 -76.003 1.00 124.03 ? 289 VAL D CG2   1 
ATOM   8547 N N     . ILE D 1 268 ? -36.142 -15.567 -78.219 1.00 124.38 ? 290 ILE D N     1 
ATOM   8548 C CA    . ILE D 1 268 ? -37.391 -15.037 -78.788 1.00 124.58 ? 290 ILE D CA    1 
ATOM   8549 C C     . ILE D 1 268 ? -37.540 -15.331 -80.282 1.00 124.65 ? 290 ILE D C     1 
ATOM   8550 O O     . ILE D 1 268 ? -38.657 -15.499 -80.786 1.00 124.70 ? 290 ILE D O     1 
ATOM   8551 C CB    . ILE D 1 268 ? -37.587 -13.516 -78.536 1.00 124.62 ? 290 ILE D CB    1 
ATOM   8552 C CG1   . ILE D 1 268 ? -36.379 -12.702 -79.023 1.00 125.01 ? 290 ILE D CG1   1 
ATOM   8553 C CG2   . ILE D 1 268 ? -37.884 -13.258 -77.072 1.00 124.68 ? 290 ILE D CG2   1 
ATOM   8554 C CD1   . ILE D 1 268 ? -36.685 -11.229 -79.277 1.00 125.67 ? 290 ILE D CD1   1 
ATOM   8555 N N     . LYS D 1 269 ? -36.404 -15.393 -80.975 1.00 124.60 ? 291 LYS D N     1 
ATOM   8556 C CA    . LYS D 1 269 ? -36.362 -15.719 -82.392 1.00 124.57 ? 291 LYS D CA    1 
ATOM   8557 C C     . LYS D 1 269 ? -36.354 -17.238 -82.594 1.00 124.22 ? 291 LYS D C     1 
ATOM   8558 O O     . LYS D 1 269 ? -35.949 -17.971 -81.691 1.00 124.15 ? 291 LYS D O     1 
ATOM   8559 C CB    . LYS D 1 269 ? -35.119 -15.096 -83.021 1.00 124.82 ? 291 LYS D CB    1 
ATOM   8560 C CG    . LYS D 1 269 ? -35.070 -13.564 -82.883 1.00 125.89 ? 291 LYS D CG    1 
ATOM   8561 C CD    . LYS D 1 269 ? -33.673 -13.051 -83.197 1.00 127.58 ? 291 LYS D CD    1 
ATOM   8562 C CE    . LYS D 1 269 ? -32.681 -13.389 -82.040 1.00 128.30 ? 291 LYS D CE    1 
ATOM   8563 N NZ    . LYS D 1 269 ? -31.260 -13.116 -82.402 1.00 129.10 ? 291 LYS D NZ    1 
ATOM   8564 N N     . PRO D 1 270 ? -36.808 -17.719 -83.775 1.00 123.96 ? 292 PRO D N     1 
ATOM   8565 C CA    . PRO D 1 270 ? -36.775 -19.160 -84.075 1.00 123.60 ? 292 PRO D CA    1 
ATOM   8566 C C     . PRO D 1 270 ? -35.347 -19.673 -84.253 1.00 123.22 ? 292 PRO D C     1 
ATOM   8567 O O     . PRO D 1 270 ? -34.412 -18.873 -84.391 1.00 123.03 ? 292 PRO D O     1 
ATOM   8568 C CB    . PRO D 1 270 ? -37.537 -19.264 -85.403 1.00 123.58 ? 292 PRO D CB    1 
ATOM   8569 C CG    . PRO D 1 270 ? -37.404 -17.916 -86.020 1.00 123.82 ? 292 PRO D CG    1 
ATOM   8570 C CD    . PRO D 1 270 ? -37.431 -16.951 -84.872 1.00 123.96 ? 292 PRO D CD    1 
ATOM   8571 N N     . VAL D 1 271 ? -35.197 -20.997 -84.247 1.00 122.87 ? 293 VAL D N     1 
ATOM   8572 C CA    . VAL D 1 271 ? -33.896 -21.648 -84.389 1.00 122.58 ? 293 VAL D CA    1 
ATOM   8573 C C     . VAL D 1 271 ? -33.108 -21.013 -85.532 1.00 122.58 ? 293 VAL D C     1 
ATOM   8574 O O     . VAL D 1 271 ? -33.442 -21.229 -86.696 1.00 122.72 ? 293 VAL D O     1 
ATOM   8575 C CB    . VAL D 1 271 ? -34.056 -23.166 -84.665 1.00 122.47 ? 293 VAL D CB    1 
ATOM   8576 C CG1   . VAL D 1 271 ? -32.701 -23.857 -84.694 1.00 122.28 ? 293 VAL D CG1   1 
ATOM   8577 C CG2   . VAL D 1 271 ? -34.963 -23.813 -83.629 1.00 122.37 ? 293 VAL D CG2   1 
ATOM   8578 N N     . ASN D 1 272 ? -32.091 -20.213 -85.202 1.00 122.53 ? 294 ASN D N     1 
ATOM   8579 C CA    . ASN D 1 272 ? -31.225 -19.599 -86.227 1.00 122.53 ? 294 ASN D CA    1 
ATOM   8580 C C     . ASN D 1 272 ? -29.735 -19.983 -86.142 1.00 122.70 ? 294 ASN D C     1 
ATOM   8581 O O     . ASN D 1 272 ? -29.309 -20.620 -85.173 1.00 122.63 ? 294 ASN D O     1 
ATOM   8582 C CB    . ASN D 1 272 ? -31.465 -18.076 -86.375 1.00 122.44 ? 294 ASN D CB    1 
ATOM   8583 C CG    . ASN D 1 272 ? -31.199 -17.292 -85.087 1.00 122.16 ? 294 ASN D CG    1 
ATOM   8584 O OD1   . ASN D 1 272 ? -32.056 -17.208 -84.193 1.00 121.52 ? 294 ASN D OD1   1 
ATOM   8585 N ND2   . ASN D 1 272 ? -30.022 -16.663 -85.015 1.00 122.04 ? 294 ASN D ND2   1 
ATOM   8586 N N     . LEU D 1 273 ? -28.961 -19.587 -87.164 1.00 123.01 ? 295 LEU D N     1 
ATOM   8587 C CA    . LEU D 1 273 ? -27.575 -20.060 -87.370 1.00 123.28 ? 295 LEU D CA    1 
ATOM   8588 C C     . LEU D 1 273 ? -26.462 -19.084 -86.954 1.00 123.39 ? 295 LEU D C     1 
ATOM   8589 O O     . LEU D 1 273 ? -25.288 -19.470 -86.876 1.00 123.49 ? 295 LEU D O     1 
ATOM   8590 C CB    . LEU D 1 273 ? -27.359 -20.429 -88.850 1.00 123.33 ? 295 LEU D CB    1 
ATOM   8591 C CG    . LEU D 1 273 ? -28.243 -21.486 -89.526 1.00 123.84 ? 295 LEU D CG    1 
ATOM   8592 C CD1   . LEU D 1 273 ? -28.349 -21.262 -91.046 1.00 124.20 ? 295 LEU D CD1   1 
ATOM   8593 C CD2   . LEU D 1 273 ? -27.744 -22.897 -89.206 1.00 124.20 ? 295 LEU D CD2   1 
ATOM   8594 N N     . GLU D 1 274 ? -26.826 -17.831 -86.694 1.00 123.51 ? 296 GLU D N     1 
ATOM   8595 C CA    . GLU D 1 274 ? -25.853 -16.747 -86.514 1.00 123.85 ? 296 GLU D CA    1 
ATOM   8596 C C     . GLU D 1 274 ? -24.766 -17.019 -85.482 1.00 123.63 ? 296 GLU D C     1 
ATOM   8597 O O     . GLU D 1 274 ? -23.596 -16.679 -85.696 1.00 123.67 ? 296 GLU D O     1 
ATOM   8598 C CB    . GLU D 1 274 ? -26.572 -15.452 -86.154 1.00 124.02 ? 296 GLU D CB    1 
ATOM   8599 C CG    . GLU D 1 274 ? -27.614 -15.059 -87.179 1.00 126.21 ? 296 GLU D CG    1 
ATOM   8600 C CD    . GLU D 1 274 ? -28.040 -13.614 -87.030 1.00 129.10 ? 296 GLU D CD    1 
ATOM   8601 O OE1   . GLU D 1 274 ? -27.147 -12.726 -87.037 1.00 130.37 ? 296 GLU D OE1   1 
ATOM   8602 O OE2   . GLU D 1 274 ? -29.270 -13.369 -86.925 1.00 130.56 ? 296 GLU D OE2   1 
ATOM   8603 N N     . ALA D 1 275 ? -25.161 -17.639 -84.369 1.00 123.46 ? 297 ALA D N     1 
ATOM   8604 C CA    . ALA D 1 275 ? -24.271 -17.813 -83.231 1.00 123.27 ? 297 ALA D CA    1 
ATOM   8605 C C     . ALA D 1 275 ? -23.224 -18.899 -83.452 1.00 123.17 ? 297 ALA D C     1 
ATOM   8606 O O     . ALA D 1 275 ? -22.159 -18.875 -82.815 1.00 123.23 ? 297 ALA D O     1 
ATOM   8607 C CB    . ALA D 1 275 ? -25.086 -18.109 -81.972 1.00 123.29 ? 297 ALA D CB    1 
ATOM   8608 N N     . LEU D 1 276 ? -23.520 -19.842 -84.354 1.00 122.95 ? 298 LEU D N     1 
ATOM   8609 C CA    . LEU D 1 276 ? -22.727 -21.062 -84.463 1.00 122.97 ? 298 LEU D CA    1 
ATOM   8610 C C     . LEU D 1 276 ? -21.203 -20.858 -84.382 1.00 122.96 ? 298 LEU D C     1 
ATOM   8611 O O     . LEU D 1 276 ? -20.528 -21.502 -83.577 1.00 122.85 ? 298 LEU D O     1 
ATOM   8612 C CB    . LEU D 1 276 ? -23.120 -21.840 -85.721 1.00 122.93 ? 298 LEU D CB    1 
ATOM   8613 C CG    . LEU D 1 276 ? -24.536 -22.428 -85.721 1.00 123.20 ? 298 LEU D CG    1 
ATOM   8614 C CD1   . LEU D 1 276 ? -24.859 -23.011 -87.085 1.00 123.46 ? 298 LEU D CD1   1 
ATOM   8615 C CD2   . LEU D 1 276 ? -24.717 -23.478 -84.633 1.00 123.21 ? 298 LEU D CD2   1 
ATOM   8616 N N     . SER D 1 277 ? -20.679 -19.936 -85.191 1.00 122.95 ? 299 SER D N     1 
ATOM   8617 C CA    . SER D 1 277 ? -19.235 -19.786 -85.352 1.00 122.78 ? 299 SER D CA    1 
ATOM   8618 C C     . SER D 1 277 ? -18.736 -18.339 -85.236 1.00 122.71 ? 299 SER D C     1 
ATOM   8619 O O     . SER D 1 277 ? -17.629 -18.030 -85.691 1.00 122.90 ? 299 SER D O     1 
ATOM   8620 C CB    . SER D 1 277 ? -18.800 -20.372 -86.705 1.00 122.84 ? 299 SER D CB    1 
ATOM   8621 O OG    . SER D 1 277 ? -19.277 -21.698 -86.882 1.00 122.96 ? 299 SER D OG    1 
ATOM   8622 N N     . LYS D 1 278 ? -19.529 -17.455 -84.629 1.00 122.49 ? 300 LYS D N     1 
ATOM   8623 C CA    . LYS D 1 278 ? -19.151 -16.030 -84.530 1.00 122.29 ? 300 LYS D CA    1 
ATOM   8624 C C     . LYS D 1 278 ? -17.973 -15.780 -83.569 1.00 122.08 ? 300 LYS D C     1 
ATOM   8625 O O     . LYS D 1 278 ? -17.483 -14.631 -83.419 1.00 122.01 ? 300 LYS D O     1 
ATOM   8626 C CB    . LYS D 1 278 ? -20.356 -15.168 -84.145 1.00 122.26 ? 300 LYS D CB    1 
ATOM   8627 C CG    . LYS D 1 278 ? -20.791 -15.351 -82.714 1.00 122.17 ? 300 LYS D CG    1 
ATOM   8628 C CD    . LYS D 1 278 ? -22.032 -14.547 -82.421 1.00 122.19 ? 300 LYS D CD    1 
ATOM   8629 C CE    . LYS D 1 278 ? -22.429 -14.732 -80.974 1.00 122.18 ? 300 LYS D CE    1 
ATOM   8630 N NZ    . LYS D 1 278 ? -23.794 -14.231 -80.726 1.00 122.16 ? 300 LYS D NZ    1 
ATOM   8631 N N     . TRP D 1 279 ? -17.533 -16.873 -82.931 1.00 121.83 ? 301 TRP D N     1 
ATOM   8632 C CA    . TRP D 1 279 ? -16.371 -16.866 -82.058 1.00 121.54 ? 301 TRP D CA    1 
ATOM   8633 C C     . TRP D 1 279 ? -15.067 -16.827 -82.849 1.00 121.77 ? 301 TRP D C     1 
ATOM   8634 O O     . TRP D 1 279 ? -14.100 -16.192 -82.427 1.00 121.66 ? 301 TRP D O     1 
ATOM   8635 C CB    . TRP D 1 279 ? -16.395 -18.110 -81.170 1.00 121.27 ? 301 TRP D CB    1 
ATOM   8636 C CG    . TRP D 1 279 ? -16.232 -19.393 -81.927 1.00 120.09 ? 301 TRP D CG    1 
ATOM   8637 C CD1   . TRP D 1 279 ? -17.223 -20.160 -82.464 1.00 119.56 ? 301 TRP D CD1   1 
ATOM   8638 C CD2   . TRP D 1 279 ? -15.001 -20.053 -82.235 1.00 119.01 ? 301 TRP D CD2   1 
ATOM   8639 N NE1   . TRP D 1 279 ? -16.687 -21.261 -83.086 1.00 118.85 ? 301 TRP D NE1   1 
ATOM   8640 C CE2   . TRP D 1 279 ? -15.324 -21.218 -82.959 1.00 118.75 ? 301 TRP D CE2   1 
ATOM   8641 C CE3   . TRP D 1 279 ? -13.653 -19.770 -81.971 1.00 118.16 ? 301 TRP D CE3   1 
ATOM   8642 C CZ2   . TRP D 1 279 ? -14.351 -22.105 -83.413 1.00 118.33 ? 301 TRP D CZ2   1 
ATOM   8643 C CZ3   . TRP D 1 279 ? -12.691 -20.645 -82.425 1.00 117.34 ? 301 TRP D CZ3   1 
ATOM   8644 C CH2   . TRP D 1 279 ? -13.042 -21.801 -83.140 1.00 117.54 ? 301 TRP D CH2   1 
ATOM   8645 N N     . THR D 1 280 ? -15.045 -17.521 -83.987 1.00 122.17 ? 302 THR D N     1 
ATOM   8646 C CA    . THR D 1 280 ? -13.822 -17.668 -84.782 1.00 122.76 ? 302 THR D CA    1 
ATOM   8647 C C     . THR D 1 280 ? -13.241 -16.308 -85.176 1.00 123.06 ? 302 THR D C     1 
ATOM   8648 O O     . THR D 1 280 ? -13.902 -15.530 -85.890 1.00 123.05 ? 302 THR D O     1 
ATOM   8649 C CB    . THR D 1 280 ? -13.998 -18.635 -86.041 1.00 122.81 ? 302 THR D CB    1 
ATOM   8650 O OG1   . THR D 1 280 ? -12.850 -18.511 -86.905 1.00 123.19 ? 302 THR D OG1   1 
ATOM   8651 C CG2   . THR D 1 280 ? -15.259 -18.294 -86.866 1.00 122.40 ? 302 THR D CG2   1 
ATOM   8652 N N     . GLY D 1 281 ? -12.021 -16.023 -84.669 1.00 123.34 ? 303 GLY D N     1 
ATOM   8653 C CA    . GLY D 1 281 ? -11.318 -14.792 -85.026 1.00 123.64 ? 303 GLY D CA    1 
ATOM   8654 C C     . GLY D 1 281 ? -11.087 -13.816 -83.884 1.00 123.81 ? 303 GLY D C     1 
ATOM   8655 O O     . GLY D 1 281 ? -10.284 -12.867 -84.024 1.00 123.97 ? 303 GLY D O     1 
ATOM   8656 N N     . HIS D 1 282 ? -11.782 -14.046 -82.757 1.00 123.87 ? 304 HIS D N     1 
ATOM   8657 C CA    . HIS D 1 282 ? -11.667 -13.179 -81.574 1.00 123.98 ? 304 HIS D CA    1 
ATOM   8658 C C     . HIS D 1 282 ? -10.792 -13.764 -80.462 1.00 123.35 ? 304 HIS D C     1 
ATOM   8659 O O     . HIS D 1 282 ? -10.483 -13.074 -79.483 1.00 123.23 ? 304 HIS D O     1 
ATOM   8660 C CB    . HIS D 1 282 ? -13.050 -12.857 -81.015 1.00 124.50 ? 304 HIS D CB    1 
ATOM   8661 C CG    . HIS D 1 282 ? -13.987 -12.290 -82.029 1.00 126.36 ? 304 HIS D CG    1 
ATOM   8662 N ND1   . HIS D 1 282 ? -14.069 -10.918 -82.261 1.00 128.07 ? 304 HIS D ND1   1 
ATOM   8663 C CD2   . HIS D 1 282 ? -14.878 -12.911 -82.881 1.00 128.30 ? 304 HIS D CD2   1 
ATOM   8664 C CE1   . HIS D 1 282 ? -14.977 -10.718 -83.209 1.00 129.42 ? 304 HIS D CE1   1 
ATOM   8665 N NE2   . HIS D 1 282 ? -15.483 -11.911 -83.602 1.00 129.56 ? 304 HIS D NE2   1 
ATOM   8666 N N     . ILE D 1 283 ? -10.411 -15.038 -80.628 1.00 122.73 ? 305 ILE D N     1 
ATOM   8667 C CA    . ILE D 1 283 ? -9.530  -15.761 -79.696 1.00 122.00 ? 305 ILE D CA    1 
ATOM   8668 C C     . ILE D 1 283 ? -8.079  -15.240 -79.789 1.00 121.56 ? 305 ILE D C     1 
ATOM   8669 O O     . ILE D 1 283 ? -7.530  -15.114 -80.888 1.00 121.52 ? 305 ILE D O     1 
ATOM   8670 C CB    . ILE D 1 283 ? -9.541  -17.313 -79.970 1.00 121.98 ? 305 ILE D CB    1 
ATOM   8671 C CG1   . ILE D 1 283 ? -10.937 -17.831 -80.372 1.00 121.92 ? 305 ILE D CG1   1 
ATOM   8672 C CG2   . ILE D 1 283 ? -8.951  -18.097 -78.798 1.00 121.72 ? 305 ILE D CG2   1 
ATOM   8673 C CD1   . ILE D 1 283 ? -11.927 -17.999 -79.236 1.00 121.63 ? 305 ILE D CD1   1 
ATOM   8674 N N     . PRO D 1 284 ? -7.455  -14.932 -78.637 1.00 121.10 ? 306 PRO D N     1 
ATOM   8675 C CA    . PRO D 1 284 ? -6.052  -14.540 -78.619 1.00 120.75 ? 306 PRO D CA    1 
ATOM   8676 C C     . PRO D 1 284 ? -5.203  -15.654 -79.179 1.00 120.49 ? 306 PRO D C     1 
ATOM   8677 O O     . PRO D 1 284 ? -5.327  -16.808 -78.755 1.00 120.34 ? 306 PRO D O     1 
ATOM   8678 C CB    . PRO D 1 284 ? -5.753  -14.382 -77.133 1.00 120.70 ? 306 PRO D CB    1 
ATOM   8679 C CG    . PRO D 1 284 ? -7.046  -14.060 -76.529 1.00 120.88 ? 306 PRO D CG    1 
ATOM   8680 C CD    . PRO D 1 284 ? -8.060  -14.848 -77.296 1.00 121.13 ? 306 PRO D CD    1 
ATOM   8681 N N     . GLY D 1 285 ? -4.356  -15.299 -80.137 1.00 120.31 ? 307 GLY D N     1 
ATOM   8682 C CA    . GLY D 1 285 ? -3.535  -16.268 -80.833 1.00 120.22 ? 307 GLY D CA    1 
ATOM   8683 C C     . GLY D 1 285 ? -3.026  -17.365 -79.916 1.00 120.23 ? 307 GLY D C     1 
ATOM   8684 O O     . GLY D 1 285 ? -3.300  -18.558 -80.149 1.00 120.29 ? 307 GLY D O     1 
ATOM   8685 N N     . ASP D 1 286 ? -2.309  -16.958 -78.860 1.00 120.09 ? 308 ASP D N     1 
ATOM   8686 C CA    . ASP D 1 286 ? -1.643  -17.899 -77.952 1.00 119.99 ? 308 ASP D CA    1 
ATOM   8687 C C     . ASP D 1 286 ? -2.577  -18.992 -77.440 1.00 119.79 ? 308 ASP D C     1 
ATOM   8688 O O     . ASP D 1 286 ? -2.150  -20.118 -77.168 1.00 119.52 ? 308 ASP D O     1 
ATOM   8689 C CB    . ASP D 1 286 ? -1.021  -17.146 -76.775 1.00 120.20 ? 308 ASP D CB    1 
ATOM   8690 C CG    . ASP D 1 286 ? -2.039  -16.285 -76.026 1.00 120.84 ? 308 ASP D CG    1 
ATOM   8691 O OD1   . ASP D 1 286 ? -2.658  -15.402 -76.668 1.00 121.72 ? 308 ASP D OD1   1 
ATOM   8692 O OD2   . ASP D 1 286 ? -2.218  -16.492 -74.795 1.00 121.24 ? 308 ASP D OD2   1 
ATOM   8693 N N     . VAL D 1 287 ? -3.855  -18.646 -77.321 1.00 119.77 ? 309 VAL D N     1 
ATOM   8694 C CA    . VAL D 1 287 ? -4.865  -19.575 -76.833 1.00 119.79 ? 309 VAL D CA    1 
ATOM   8695 C C     . VAL D 1 287 ? -5.224  -20.560 -77.926 1.00 119.80 ? 309 VAL D C     1 
ATOM   8696 O O     . VAL D 1 287 ? -5.349  -21.764 -77.683 1.00 119.55 ? 309 VAL D O     1 
ATOM   8697 C CB    . VAL D 1 287 ? -6.128  -18.837 -76.371 1.00 119.71 ? 309 VAL D CB    1 
ATOM   8698 C CG1   . VAL D 1 287 ? -7.189  -19.830 -75.978 1.00 119.69 ? 309 VAL D CG1   1 
ATOM   8699 C CG2   . VAL D 1 287 ? -5.810  -17.917 -75.197 1.00 119.83 ? 309 VAL D CG2   1 
ATOM   8700 N N     . VAL D 1 288 ? -5.376  -20.035 -79.135 1.00 120.07 ? 310 VAL D N     1 
ATOM   8701 C CA    . VAL D 1 288 ? -5.615  -20.868 -80.300 1.00 120.51 ? 310 VAL D CA    1 
ATOM   8702 C C     . VAL D 1 288 ? -4.444  -21.840 -80.467 1.00 120.86 ? 310 VAL D C     1 
ATOM   8703 O O     . VAL D 1 288 ? -4.622  -22.952 -80.969 1.00 120.92 ? 310 VAL D O     1 
ATOM   8704 C CB    . VAL D 1 288 ? -5.744  -20.035 -81.593 1.00 120.44 ? 310 VAL D CB    1 
ATOM   8705 C CG1   . VAL D 1 288 ? -6.578  -20.813 -82.634 1.00 120.40 ? 310 VAL D CG1   1 
ATOM   8706 C CG2   . VAL D 1 288 ? -6.388  -18.673 -81.295 1.00 120.52 ? 310 VAL D CG2   1 
ATOM   8707 N N     . ARG D 1 289 ? -3.255  -21.406 -80.038 1.00 121.26 ? 311 ARG D N     1 
ATOM   8708 C CA    . ARG D 1 289 ? -2.025  -22.188 -80.161 1.00 121.60 ? 311 ARG D CA    1 
ATOM   8709 C C     . ARG D 1 289 ? -2.022  -23.329 -79.154 1.00 121.61 ? 311 ARG D C     1 
ATOM   8710 O O     . ARG D 1 289 ? -1.702  -24.469 -79.494 1.00 121.66 ? 311 ARG D O     1 
ATOM   8711 C CB    . ARG D 1 289 ? -0.808  -21.274 -79.954 1.00 121.83 ? 311 ARG D CB    1 
ATOM   8712 C CG    . ARG D 1 289 ? 0.583   -21.894 -80.220 1.00 122.58 ? 311 ARG D CG    1 
ATOM   8713 C CD    . ARG D 1 289 ? 1.705   -20.992 -79.652 1.00 123.51 ? 311 ARG D CD    1 
ATOM   8714 N NE    . ARG D 1 289 ? 1.760   -21.018 -78.168 1.00 124.49 ? 311 ARG D NE    1 
ATOM   8715 C CZ    . ARG D 1 289 ? 2.105   -19.987 -77.389 1.00 124.64 ? 311 ARG D CZ    1 
ATOM   8716 N NH1   . ARG D 1 289 ? 2.112   -20.138 -76.057 1.00 124.70 ? 311 ARG D NH1   1 
ATOM   8717 N NH2   . ARG D 1 289 ? 2.428   -18.802 -77.923 1.00 124.83 ? 311 ARG D NH2   1 
ATOM   8718 N N     . ASP D 1 290 ? -2.393  -23.018 -77.917 1.00 121.56 ? 312 ASP D N     1 
ATOM   8719 C CA    . ASP D 1 290 ? -2.392  -24.007 -76.857 1.00 121.65 ? 312 ASP D CA    1 
ATOM   8720 C C     . ASP D 1 290 ? -3.714  -24.729 -76.774 1.00 121.61 ? 312 ASP D C     1 
ATOM   8721 O O     . ASP D 1 290 ? -3.981  -25.436 -75.810 1.00 121.72 ? 312 ASP D O     1 
ATOM   8722 C CB    . ASP D 1 290 ? -2.112  -23.329 -75.528 1.00 121.78 ? 312 ASP D CB    1 
ATOM   8723 C CG    . ASP D 1 290 ? -0.809  -22.611 -75.524 1.00 122.15 ? 312 ASP D CG    1 
ATOM   8724 O OD1   . ASP D 1 290 ? 0.056   -22.975 -76.345 1.00 122.77 ? 312 ASP D OD1   1 
ATOM   8725 O OD2   . ASP D 1 290 ? -0.647  -21.688 -74.704 1.00 122.63 ? 312 ASP D OD2   1 
ATOM   8726 N N     . MET D 1 291 ? -4.536  -24.562 -77.795 1.00 121.57 ? 313 MET D N     1 
ATOM   8727 C CA    . MET D 1 291 ? -5.893  -25.063 -77.764 1.00 121.73 ? 313 MET D CA    1 
ATOM   8728 C C     . MET D 1 291 ? -6.070  -26.490 -77.232 1.00 121.96 ? 313 MET D C     1 
ATOM   8729 O O     . MET D 1 291 ? -6.955  -26.729 -76.419 1.00 122.30 ? 313 MET D O     1 
ATOM   8730 C CB    . MET D 1 291 ? -6.535  -24.927 -79.138 1.00 121.72 ? 313 MET D CB    1 
ATOM   8731 C CG    . MET D 1 291 ? -8.053  -25.020 -79.119 1.00 121.61 ? 313 MET D CG    1 
ATOM   8732 S SD    . MET D 1 291 ? -8.808  -23.915 -77.907 1.00 121.43 ? 313 MET D SD    1 
ATOM   8733 C CE    . MET D 1 291 ? -8.533  -22.305 -78.660 1.00 121.20 ? 313 MET D CE    1 
ATOM   8734 N N     . ALA D 1 292 ? -5.240  -27.429 -77.670 1.00 122.20 ? 314 ALA D N     1 
ATOM   8735 C CA    . ALA D 1 292 ? -5.433  -28.834 -77.294 1.00 122.57 ? 314 ALA D CA    1 
ATOM   8736 C C     . ALA D 1 292 ? -4.934  -29.186 -75.883 1.00 122.89 ? 314 ALA D C     1 
ATOM   8737 O O     . ALA D 1 292 ? -5.259  -30.255 -75.350 1.00 123.01 ? 314 ALA D O     1 
ATOM   8738 C CB    . ALA D 1 292 ? -4.808  -29.749 -78.325 1.00 122.71 ? 314 ALA D CB    1 
ATOM   8739 N N     . GLN D 1 293 ? -4.139  -28.295 -75.291 1.00 123.18 ? 315 GLN D N     1 
ATOM   8740 C CA    . GLN D 1 293 ? -3.732  -28.425 -73.890 1.00 123.50 ? 315 GLN D CA    1 
ATOM   8741 C C     . GLN D 1 293 ? -4.783  -27.768 -73.010 1.00 123.23 ? 315 GLN D C     1 
ATOM   8742 O O     . GLN D 1 293 ? -5.184  -28.327 -71.989 1.00 123.31 ? 315 GLN D O     1 
ATOM   8743 C CB    . GLN D 1 293 ? -2.371  -27.757 -73.637 1.00 123.89 ? 315 GLN D CB    1 
ATOM   8744 C CG    . GLN D 1 293 ? -1.177  -28.400 -74.347 1.00 125.11 ? 315 GLN D CG    1 
ATOM   8745 C CD    . GLN D 1 293 ? -1.292  -28.335 -75.864 1.00 126.61 ? 315 GLN D CD    1 
ATOM   8746 O OE1   . GLN D 1 293 ? -1.699  -29.332 -76.497 1.00 127.68 ? 315 GLN D OE1   1 
ATOM   8747 N NE2   . GLN D 1 293 ? -0.970  -27.150 -76.451 1.00 126.75 ? 315 GLN D NE2   1 
ATOM   8748 N N     . ILE D 1 294 ? -5.216  -26.576 -73.420 1.00 122.89 ? 316 ILE D N     1 
ATOM   8749 C CA    . ILE D 1 294 ? -6.234  -25.815 -72.707 1.00 122.55 ? 316 ILE D CA    1 
ATOM   8750 C C     . ILE D 1 294 ? -7.557  -26.558 -72.694 1.00 122.44 ? 316 ILE D C     1 
ATOM   8751 O O     . ILE D 1 294 ? -8.204  -26.641 -71.657 1.00 122.76 ? 316 ILE D O     1 
ATOM   8752 C CB    . ILE D 1 294 ? -6.431  -24.406 -73.301 1.00 122.42 ? 316 ILE D CB    1 
ATOM   8753 C CG1   . ILE D 1 294 ? -5.110  -23.634 -73.271 1.00 122.39 ? 316 ILE D CG1   1 
ATOM   8754 C CG2   . ILE D 1 294 ? -7.494  -23.638 -72.525 1.00 122.17 ? 316 ILE D CG2   1 
ATOM   8755 C CD1   . ILE D 1 294 ? -5.127  -22.370 -74.097 1.00 122.24 ? 316 ILE D CD1   1 
ATOM   8756 N N     . ALA D 1 295 ? -7.950  -27.117 -73.829 1.00 122.16 ? 317 ALA D N     1 
ATOM   8757 C CA    . ALA D 1 295 ? -9.203  -27.845 -73.888 1.00 122.12 ? 317 ALA D CA    1 
ATOM   8758 C C     . ALA D 1 295 ? -9.096  -29.199 -74.596 1.00 122.16 ? 317 ALA D C     1 
ATOM   8759 O O     . ALA D 1 295 ? -9.559  -29.332 -75.733 1.00 122.15 ? 317 ALA D O     1 
ATOM   8760 C CB    . ALA D 1 295 ? -10.277 -26.979 -74.526 1.00 122.09 ? 317 ALA D CB    1 
ATOM   8761 N N     . PRO D 1 296 ? -8.495  -30.212 -73.926 1.00 122.19 ? 318 PRO D N     1 
ATOM   8762 C CA    . PRO D 1 296 ? -8.473  -31.585 -74.460 1.00 122.35 ? 318 PRO D CA    1 
ATOM   8763 C C     . PRO D 1 296 ? -9.856  -32.275 -74.518 1.00 122.58 ? 318 PRO D C     1 
ATOM   8764 O O     . PRO D 1 296 ? -9.992  -33.347 -75.146 1.00 122.70 ? 318 PRO D O     1 
ATOM   8765 C CB    . PRO D 1 296 ? -7.543  -32.328 -73.486 1.00 122.21 ? 318 PRO D CB    1 
ATOM   8766 C CG    . PRO D 1 296 ? -7.547  -31.521 -72.255 1.00 122.21 ? 318 PRO D CG    1 
ATOM   8767 C CD    . PRO D 1 296 ? -7.680  -30.103 -72.699 1.00 122.10 ? 318 PRO D CD    1 
ATOM   8768 N N     . MET D 1 297 ? -10.864 -31.675 -73.875 1.00 122.75 ? 319 MET D N     1 
ATOM   8769 C CA    . MET D 1 297 ? -12.249 -32.142 -74.018 1.00 122.85 ? 319 MET D CA    1 
ATOM   8770 C C     . MET D 1 297 ? -12.783 -31.914 -75.435 1.00 122.90 ? 319 MET D C     1 
ATOM   8771 O O     . MET D 1 297 ? -13.443 -32.798 -75.995 1.00 122.97 ? 319 MET D O     1 
ATOM   8772 C CB    . MET D 1 297 ? -13.183 -31.492 -72.987 1.00 122.84 ? 319 MET D CB    1 
ATOM   8773 C CG    . MET D 1 297 ? -13.133 -32.116 -71.592 1.00 123.15 ? 319 MET D CG    1 
ATOM   8774 S SD    . MET D 1 297 ? -13.259 -33.919 -71.573 1.00 123.75 ? 319 MET D SD    1 
ATOM   8775 C CE    . MET D 1 297 ? -15.006 -34.184 -71.812 1.00 122.94 ? 319 MET D CE    1 
ATOM   8776 N N     . LEU D 1 298 ? -12.495 -30.740 -76.007 1.00 122.86 ? 320 LEU D N     1 
ATOM   8777 C CA    . LEU D 1 298 ? -12.882 -30.435 -77.383 1.00 122.76 ? 320 LEU D CA    1 
ATOM   8778 C C     . LEU D 1 298 ? -12.726 -31.675 -78.231 1.00 123.08 ? 320 LEU D C     1 
ATOM   8779 O O     . LEU D 1 298 ? -13.695 -32.186 -78.775 1.00 123.02 ? 320 LEU D O     1 
ATOM   8780 C CB    . LEU D 1 298 ? -12.025 -29.311 -77.963 1.00 122.47 ? 320 LEU D CB    1 
ATOM   8781 C CG    . LEU D 1 298 ? -12.412 -27.866 -77.647 1.00 121.85 ? 320 LEU D CG    1 
ATOM   8782 C CD1   . LEU D 1 298 ? -11.321 -26.944 -78.120 1.00 121.20 ? 320 LEU D CD1   1 
ATOM   8783 C CD2   . LEU D 1 298 ? -13.720 -27.491 -78.311 1.00 120.91 ? 320 LEU D CD2   1 
ATOM   8784 N N     . ALA D 1 299 ? -11.497 -32.170 -78.306 1.00 123.67 ? 321 ALA D N     1 
ATOM   8785 C CA    . ALA D 1 299 ? -11.184 -33.352 -79.088 1.00 124.36 ? 321 ALA D CA    1 
ATOM   8786 C C     . ALA D 1 299 ? -12.122 -34.516 -78.778 1.00 124.82 ? 321 ALA D C     1 
ATOM   8787 O O     . ALA D 1 299 ? -12.828 -35.023 -79.675 1.00 124.71 ? 321 ALA D O     1 
ATOM   8788 C CB    . ALA D 1 299 ? -9.724  -33.756 -78.875 1.00 124.39 ? 321 ALA D CB    1 
ATOM   8789 N N     . GLN D 1 300 ? -12.147 -34.916 -77.503 1.00 125.52 ? 322 GLN D N     1 
ATOM   8790 C CA    . GLN D 1 300 ? -12.896 -36.093 -77.087 1.00 126.37 ? 322 GLN D CA    1 
ATOM   8791 C C     . GLN D 1 300 ? -14.398 -35.961 -77.356 1.00 126.21 ? 322 GLN D C     1 
ATOM   8792 O O     . GLN D 1 300 ? -15.081 -36.957 -77.602 1.00 126.27 ? 322 GLN D O     1 
ATOM   8793 C CB    . GLN D 1 300 ? -12.632 -36.384 -75.615 1.00 126.76 ? 322 GLN D CB    1 
ATOM   8794 C CG    . GLN D 1 300 ? -11.157 -36.452 -75.290 1.00 129.45 ? 322 GLN D CG    1 
ATOM   8795 C CD    . GLN D 1 300 ? -10.879 -37.305 -74.079 1.00 133.35 ? 322 GLN D CD    1 
ATOM   8796 O OE1   . GLN D 1 300 ? -10.332 -36.848 -73.094 1.00 134.96 ? 322 GLN D OE1   1 
ATOM   8797 N NE2   . GLN D 1 300 ? -11.390 -38.557 -74.134 1.00 134.87 ? 322 GLN D NE2   1 
ATOM   8798 N N     . LEU D 1 301 ? -14.900 -34.729 -77.322 1.00 126.05 ? 323 LEU D N     1 
ATOM   8799 C CA    . LEU D 1 301 ? -16.295 -34.453 -77.660 1.00 125.94 ? 323 LEU D CA    1 
ATOM   8800 C C     . LEU D 1 301 ? -16.538 -34.386 -79.172 1.00 125.85 ? 323 LEU D C     1 
ATOM   8801 O O     . LEU D 1 301 ? -17.671 -34.169 -79.623 1.00 125.82 ? 323 LEU D O     1 
ATOM   8802 C CB    . LEU D 1 301 ? -16.754 -33.140 -77.020 1.00 125.99 ? 323 LEU D CB    1 
ATOM   8803 C CG    . LEU D 1 301 ? -17.170 -33.092 -75.538 1.00 126.07 ? 323 LEU D CG    1 
ATOM   8804 C CD1   . LEU D 1 301 ? -17.427 -31.642 -75.121 1.00 125.98 ? 323 LEU D CD1   1 
ATOM   8805 C CD2   . LEU D 1 301 ? -18.408 -33.964 -75.240 1.00 126.01 ? 323 LEU D CD2   1 
ATOM   8806 N N     . GLY D 1 302 ? -15.472 -34.556 -79.951 1.00 125.73 ? 324 GLY D N     1 
ATOM   8807 C CA    . GLY D 1 302 ? -15.580 -34.515 -81.404 1.00 125.53 ? 324 GLY D CA    1 
ATOM   8808 C C     . GLY D 1 302 ? -15.457 -33.129 -82.016 1.00 125.35 ? 324 GLY D C     1 
ATOM   8809 O O     . GLY D 1 302 ? -15.802 -32.940 -83.180 1.00 125.38 ? 324 GLY D O     1 
ATOM   8810 N N     . TYR D 1 303 ? -14.975 -32.162 -81.233 1.00 125.17 ? 325 TYR D N     1 
ATOM   8811 C CA    . TYR D 1 303 ? -14.622 -30.838 -81.752 1.00 124.89 ? 325 TYR D CA    1 
ATOM   8812 C C     . TYR D 1 303 ? -13.119 -30.769 -82.022 1.00 125.19 ? 325 TYR D C     1 
ATOM   8813 O O     . TYR D 1 303 ? -12.313 -30.833 -81.081 1.00 125.34 ? 325 TYR D O     1 
ATOM   8814 C CB    . TYR D 1 303 ? -15.012 -29.737 -80.762 1.00 124.56 ? 325 TYR D CB    1 
ATOM   8815 C CG    . TYR D 1 303 ? -16.484 -29.664 -80.460 1.00 123.20 ? 325 TYR D CG    1 
ATOM   8816 C CD1   . TYR D 1 303 ? -17.329 -28.856 -81.240 1.00 122.15 ? 325 TYR D CD1   1 
ATOM   8817 C CD2   . TYR D 1 303 ? -17.031 -30.395 -79.384 1.00 122.26 ? 325 TYR D CD2   1 
ATOM   8818 C CE1   . TYR D 1 303 ? -18.683 -28.779 -80.965 1.00 121.65 ? 325 TYR D CE1   1 
ATOM   8819 C CE2   . TYR D 1 303 ? -18.383 -30.328 -79.099 1.00 121.42 ? 325 TYR D CE2   1 
ATOM   8820 C CZ    . TYR D 1 303 ? -19.205 -29.516 -79.893 1.00 121.43 ? 325 TYR D CZ    1 
ATOM   8821 O OH    . TYR D 1 303 ? -20.553 -29.441 -79.625 1.00 121.39 ? 325 TYR D OH    1 
ATOM   8822 N N     . ASP D 1 304 ? -12.747 -30.650 -83.301 1.00 125.34 ? 326 ASP D N     1 
ATOM   8823 C CA    . ASP D 1 304 ? -11.341 -30.518 -83.694 1.00 125.57 ? 326 ASP D CA    1 
ATOM   8824 C C     . ASP D 1 304 ? -10.760 -29.226 -83.115 1.00 125.69 ? 326 ASP D C     1 
ATOM   8825 O O     . ASP D 1 304 ? -11.211 -28.127 -83.470 1.00 125.71 ? 326 ASP D O     1 
ATOM   8826 C CB    . ASP D 1 304 ? -11.197 -30.546 -85.222 1.00 125.63 ? 326 ASP D CB    1 
ATOM   8827 C CG    . ASP D 1 304 ? -9.737  -30.343 -85.692 1.00 125.77 ? 326 ASP D CG    1 
ATOM   8828 O OD1   . ASP D 1 304 ? -9.505  -30.296 -86.940 1.00 126.21 ? 326 ASP D OD1   1 
ATOM   8829 O OD2   . ASP D 1 304 ? -8.824  -30.222 -84.842 1.00 125.71 ? 326 ASP D OD2   1 
ATOM   8830 N N     . PRO D 1 305 ? -9.754  -29.359 -82.221 1.00 125.79 ? 327 PRO D N     1 
ATOM   8831 C CA    . PRO D 1 305 ? -9.208  -28.197 -81.511 1.00 125.91 ? 327 PRO D CA    1 
ATOM   8832 C C     . PRO D 1 305 ? -8.540  -27.214 -82.472 1.00 126.08 ? 327 PRO D C     1 
ATOM   8833 O O     . PRO D 1 305 ? -8.610  -25.978 -82.275 1.00 125.95 ? 327 PRO D O     1 
ATOM   8834 C CB    . PRO D 1 305 ? -8.158  -28.825 -80.572 1.00 125.94 ? 327 PRO D CB    1 
ATOM   8835 C CG    . PRO D 1 305 ? -7.787  -30.130 -81.212 1.00 125.83 ? 327 PRO D CG    1 
ATOM   8836 C CD    . PRO D 1 305 ? -9.037  -30.610 -81.884 1.00 125.71 ? 327 PRO D CD    1 
ATOM   8837 N N     . TYR D 1 306 ? -7.922  -27.776 -83.518 1.00 126.42 ? 328 TYR D N     1 
ATOM   8838 C CA    . TYR D 1 306 ? -7.134  -26.978 -84.447 1.00 126.79 ? 328 TYR D CA    1 
ATOM   8839 C C     . TYR D 1 306 ? -7.937  -26.492 -85.654 1.00 126.47 ? 328 TYR D C     1 
ATOM   8840 O O     . TYR D 1 306 ? -7.427  -25.721 -86.465 1.00 126.55 ? 328 TYR D O     1 
ATOM   8841 C CB    . TYR D 1 306 ? -5.842  -27.722 -84.848 1.00 127.15 ? 328 TYR D CB    1 
ATOM   8842 C CG    . TYR D 1 306 ? -4.928  -27.966 -83.652 1.00 128.84 ? 328 TYR D CG    1 
ATOM   8843 C CD1   . TYR D 1 306 ? -4.534  -26.881 -82.840 1.00 130.65 ? 328 TYR D CD1   1 
ATOM   8844 C CD2   . TYR D 1 306 ? -4.461  -29.269 -83.326 1.00 130.29 ? 328 TYR D CD2   1 
ATOM   8845 C CE1   . TYR D 1 306 ? -3.702  -27.080 -81.728 1.00 131.73 ? 328 TYR D CE1   1 
ATOM   8846 C CE2   . TYR D 1 306 ? -3.622  -29.480 -82.215 1.00 131.63 ? 328 TYR D CE2   1 
ATOM   8847 C CZ    . TYR D 1 306 ? -3.248  -28.378 -81.416 1.00 132.08 ? 328 TYR D CZ    1 
ATOM   8848 O OH    . TYR D 1 306 ? -2.428  -28.551 -80.310 1.00 132.36 ? 328 TYR D OH    1 
ATOM   8849 N N     . ALA D 1 307 ? -9.189  -26.935 -85.763 1.00 126.12 ? 329 ALA D N     1 
ATOM   8850 C CA    . ALA D 1 307 ? -10.102 -26.384 -86.756 1.00 125.93 ? 329 ALA D CA    1 
ATOM   8851 C C     . ALA D 1 307 ? -10.711 -25.100 -86.206 1.00 125.89 ? 329 ALA D C     1 
ATOM   8852 O O     . ALA D 1 307 ? -11.197 -25.085 -85.083 1.00 125.97 ? 329 ALA D O     1 
ATOM   8853 C CB    . ALA D 1 307 ? -11.172 -27.377 -87.089 1.00 125.82 ? 329 ALA D CB    1 
ATOM   8854 N N     . ASN D 1 308 ? -10.678 -24.025 -86.994 1.00 125.95 ? 330 ASN D N     1 
ATOM   8855 C CA    . ASN D 1 308 ? -11.041 -22.689 -86.503 1.00 126.08 ? 330 ASN D CA    1 
ATOM   8856 C C     . ASN D 1 308 ? -11.931 -21.871 -87.447 1.00 125.94 ? 330 ASN D C     1 
ATOM   8857 O O     . ASN D 1 308 ? -11.430 -20.987 -88.140 1.00 126.05 ? 330 ASN D O     1 
ATOM   8858 C CB    . ASN D 1 308 ? -9.773  -21.877 -86.199 1.00 126.31 ? 330 ASN D CB    1 
ATOM   8859 C CG    . ASN D 1 308 ? -9.258  -22.086 -84.784 1.00 127.13 ? 330 ASN D CG    1 
ATOM   8860 O OD1   . ASN D 1 308 ? -9.298  -21.162 -83.969 1.00 128.23 ? 330 ASN D OD1   1 
ATOM   8861 N ND2   . ASN D 1 308 ? -8.757  -23.291 -84.488 1.00 127.83 ? 330 ASN D ND2   1 
ATOM   8862 N N     . PRO D 1 309 ? -13.257 -22.132 -87.461 1.00 125.80 ? 331 PRO D N     1 
ATOM   8863 C CA    . PRO D 1 309 ? -13.991 -23.140 -86.705 1.00 125.68 ? 331 PRO D CA    1 
ATOM   8864 C C     . PRO D 1 309 ? -13.835 -24.529 -87.324 1.00 125.58 ? 331 PRO D C     1 
ATOM   8865 O O     . PRO D 1 309 ? -13.062 -24.683 -88.280 1.00 125.75 ? 331 PRO D O     1 
ATOM   8866 C CB    . PRO D 1 309 ? -15.441 -22.658 -86.810 1.00 125.55 ? 331 PRO D CB    1 
ATOM   8867 C CG    . PRO D 1 309 ? -15.508 -21.954 -88.078 1.00 125.52 ? 331 PRO D CG    1 
ATOM   8868 C CD    . PRO D 1 309 ? -14.173 -21.299 -88.288 1.00 125.80 ? 331 PRO D CD    1 
ATOM   8869 N N     . PRO D 1 310 ? -14.520 -25.550 -86.760 1.00 125.33 ? 332 PRO D N     1 
ATOM   8870 C CA    . PRO D 1 310 ? -14.578 -26.790 -87.528 1.00 125.00 ? 332 PRO D CA    1 
ATOM   8871 C C     . PRO D 1 310 ? -15.669 -26.660 -88.553 1.00 124.67 ? 332 PRO D C     1 
ATOM   8872 O O     . PRO D 1 310 ? -16.402 -25.661 -88.566 1.00 124.57 ? 332 PRO D O     1 
ATOM   8873 C CB    . PRO D 1 310 ? -14.989 -27.848 -86.492 1.00 124.98 ? 332 PRO D CB    1 
ATOM   8874 C CG    . PRO D 1 310 ? -14.709 -27.207 -85.164 1.00 125.30 ? 332 PRO D CG    1 
ATOM   8875 C CD    . PRO D 1 310 ? -14.984 -25.739 -85.357 1.00 125.41 ? 332 PRO D CD    1 
ATOM   8876 N N     . ASN D 1 311 ? -15.766 -27.659 -89.418 1.00 124.41 ? 333 ASN D N     1 
ATOM   8877 C CA    . ASN D 1 311 ? -16.909 -27.758 -90.291 1.00 124.17 ? 333 ASN D CA    1 
ATOM   8878 C C     . ASN D 1 311 ? -18.023 -28.478 -89.525 1.00 123.99 ? 333 ASN D C     1 
ATOM   8879 O O     . ASN D 1 311 ? -18.040 -29.712 -89.438 1.00 123.78 ? 333 ASN D O     1 
ATOM   8880 C CB    . ASN D 1 311 ? -16.525 -28.473 -91.600 1.00 124.11 ? 333 ASN D CB    1 
ATOM   8881 C CG    . ASN D 1 311 ? -17.577 -28.251 -92.698 1.00 124.05 ? 333 ASN D CG    1 
ATOM   8882 O OD1   . ASN D 1 311 ? -17.685 -29.056 -93.621 1.00 124.18 ? 333 ASN D OD1   1 
ATOM   8883 N ND2   . ASN D 1 311 ? -18.369 -27.162 -92.601 1.00 123.91 ? 333 ASN D ND2   1 
ATOM   8884 N N     . TYR D 1 312 ? -18.923 -27.691 -88.934 1.00 123.93 ? 334 TYR D N     1 
ATOM   8885 C CA    . TYR D 1 312 ? -20.027 -28.229 -88.126 1.00 123.99 ? 334 TYR D CA    1 
ATOM   8886 C C     . TYR D 1 312 ? -21.017 -29.082 -88.941 1.00 124.23 ? 334 TYR D C     1 
ATOM   8887 O O     . TYR D 1 312 ? -21.519 -30.098 -88.444 1.00 124.19 ? 334 TYR D O     1 
ATOM   8888 C CB    . TYR D 1 312 ? -20.792 -27.105 -87.397 1.00 123.85 ? 334 TYR D CB    1 
ATOM   8889 C CG    . TYR D 1 312 ? -20.000 -26.319 -86.368 1.00 123.32 ? 334 TYR D CG    1 
ATOM   8890 C CD1   . TYR D 1 312 ? -19.271 -26.967 -85.375 1.00 123.04 ? 334 TYR D CD1   1 
ATOM   8891 C CD2   . TYR D 1 312 ? -20.012 -24.924 -86.372 1.00 122.89 ? 334 TYR D CD2   1 
ATOM   8892 C CE1   . TYR D 1 312 ? -18.548 -26.246 -84.429 1.00 123.18 ? 334 TYR D CE1   1 
ATOM   8893 C CE2   . TYR D 1 312 ? -19.299 -24.195 -85.426 1.00 122.82 ? 334 TYR D CE2   1 
ATOM   8894 C CZ    . TYR D 1 312 ? -18.565 -24.860 -84.460 1.00 123.16 ? 334 TYR D CZ    1 
ATOM   8895 O OH    . TYR D 1 312 ? -17.843 -24.148 -83.524 1.00 123.26 ? 334 TYR D OH    1 
ATOM   8896 N N     . GLY D 1 313 ? -21.294 -28.664 -90.180 1.00 124.40 ? 335 GLY D N     1 
ATOM   8897 C CA    . GLY D 1 313 ? -22.220 -29.382 -91.061 1.00 124.66 ? 335 GLY D CA    1 
ATOM   8898 C C     . GLY D 1 313 ? -22.999 -28.455 -91.976 1.00 124.97 ? 335 GLY D C     1 
ATOM   8899 O O     . GLY D 1 313 ? -22.567 -27.320 -92.233 1.00 124.98 ? 335 GLY D O     1 
ATOM   8900 N N     . ASN D 1 314 ? -24.154 -28.938 -92.455 1.00 125.20 ? 336 ASN D N     1 
ATOM   8901 C CA    . ASN D 1 314 ? -24.974 -28.203 -93.422 1.00 125.46 ? 336 ASN D CA    1 
ATOM   8902 C C     . ASN D 1 314 ? -26.415 -27.987 -92.975 1.00 125.43 ? 336 ASN D C     1 
ATOM   8903 O O     . ASN D 1 314 ? -27.135 -28.961 -92.735 1.00 125.38 ? 336 ASN D O     1 
ATOM   8904 C CB    . ASN D 1 314 ? -24.957 -28.906 -94.786 1.00 125.68 ? 336 ASN D CB    1 
ATOM   8905 C CG    . ASN D 1 314 ? -23.580 -28.905 -95.433 1.00 126.52 ? 336 ASN D CG    1 
ATOM   8906 O OD1   . ASN D 1 314 ? -22.923 -27.861 -95.552 1.00 127.62 ? 336 ASN D OD1   1 
ATOM   8907 N ND2   . ASN D 1 314 ? -23.136 -30.080 -95.861 1.00 127.29 ? 336 ASN D ND2   1 
ATOM   8908 N N     . PRO D 1 315 ? -26.843 -26.704 -92.888 1.00 125.54 ? 337 PRO D N     1 
ATOM   8909 C CA    . PRO D 1 315 ? -28.173 -26.312 -92.380 1.00 125.66 ? 337 PRO D CA    1 
ATOM   8910 C C     . PRO D 1 315 ? -29.389 -26.789 -93.176 1.00 125.68 ? 337 PRO D C     1 
ATOM   8911 O O     . PRO D 1 315 ? -29.366 -26.819 -94.409 1.00 125.62 ? 337 PRO D O     1 
ATOM   8912 C CB    . PRO D 1 315 ? -28.123 -24.772 -92.396 1.00 125.69 ? 337 PRO D CB    1 
ATOM   8913 C CG    . PRO D 1 315 ? -27.033 -24.421 -93.347 1.00 125.57 ? 337 PRO D CG    1 
ATOM   8914 C CD    . PRO D 1 315 ? -25.995 -25.507 -93.170 1.00 125.43 ? 337 PRO D CD    1 
ATOM   8915 N N     . ASP D 1 316 ? -30.442 -27.153 -92.445 1.00 125.77 ? 338 ASP D N     1 
ATOM   8916 C CA    . ASP D 1 316 ? -31.743 -27.423 -93.030 1.00 125.80 ? 338 ASP D CA    1 
ATOM   8917 C C     . ASP D 1 316 ? -32.273 -26.123 -93.618 1.00 125.65 ? 338 ASP D C     1 
ATOM   8918 O O     . ASP D 1 316 ? -32.143 -25.059 -92.995 1.00 125.47 ? 338 ASP D O     1 
ATOM   8919 C CB    . ASP D 1 316 ? -32.725 -27.960 -91.980 1.00 125.89 ? 338 ASP D CB    1 
ATOM   8920 C CG    . ASP D 1 316 ? -32.438 -29.406 -91.567 1.00 126.27 ? 338 ASP D CG    1 
ATOM   8921 O OD1   . ASP D 1 316 ? -31.706 -30.133 -92.279 1.00 127.12 ? 338 ASP D OD1   1 
ATOM   8922 O OD2   . ASP D 1 316 ? -32.965 -29.824 -90.517 1.00 126.51 ? 338 ASP D OD2   1 
ATOM   8923 N N     . PRO D 1 317 ? -32.851 -26.203 -94.832 1.00 125.62 ? 339 PRO D N     1 
ATOM   8924 C CA    . PRO D 1 317 ? -33.505 -25.071 -95.478 1.00 125.65 ? 339 PRO D CA    1 
ATOM   8925 C C     . PRO D 1 317 ? -34.398 -24.333 -94.494 1.00 125.69 ? 339 PRO D C     1 
ATOM   8926 O O     . PRO D 1 317 ? -34.375 -23.097 -94.440 1.00 125.55 ? 339 PRO D O     1 
ATOM   8927 C CB    . PRO D 1 317 ? -34.333 -25.744 -96.569 1.00 125.68 ? 339 PRO D CB    1 
ATOM   8928 C CG    . PRO D 1 317 ? -33.473 -26.880 -96.977 1.00 125.69 ? 339 PRO D CG    1 
ATOM   8929 C CD    . PRO D 1 317 ? -32.853 -27.395 -95.703 1.00 125.52 ? 339 PRO D CD    1 
ATOM   8930 N N     . PHE D 1 318 ? -35.154 -25.107 -93.707 1.00 125.84 ? 340 PHE D N     1 
ATOM   8931 C CA    . PHE D 1 318 ? -35.938 -24.566 -92.612 1.00 126.11 ? 340 PHE D CA    1 
ATOM   8932 C C     . PHE D 1 318 ? -35.145 -23.533 -91.804 1.00 126.11 ? 340 PHE D C     1 
ATOM   8933 O O     . PHE D 1 318 ? -35.647 -22.438 -91.526 1.00 126.19 ? 340 PHE D O     1 
ATOM   8934 C CB    . PHE D 1 318 ? -36.428 -25.706 -91.709 1.00 126.25 ? 340 PHE D CB    1 
ATOM   8935 C CG    . PHE D 1 318 ? -37.103 -25.242 -90.442 1.00 126.94 ? 340 PHE D CG    1 
ATOM   8936 C CD1   . PHE D 1 318 ? -36.611 -25.641 -89.197 1.00 127.75 ? 340 PHE D CD1   1 
ATOM   8937 C CD2   . PHE D 1 318 ? -38.229 -24.409 -90.495 1.00 127.91 ? 340 PHE D CD2   1 
ATOM   8938 C CE1   . PHE D 1 318 ? -37.234 -25.217 -88.019 1.00 128.58 ? 340 PHE D CE1   1 
ATOM   8939 C CE2   . PHE D 1 318 ? -38.856 -23.974 -89.327 1.00 128.61 ? 340 PHE D CE2   1 
ATOM   8940 C CZ    . PHE D 1 318 ? -38.362 -24.382 -88.084 1.00 128.77 ? 340 PHE D CZ    1 
ATOM   8941 N N     . VAL D 1 319 ? -33.904 -23.880 -91.456 1.00 125.96 ? 341 VAL D N     1 
ATOM   8942 C CA    . VAL D 1 319 ? -33.080 -23.054 -90.576 1.00 125.67 ? 341 VAL D CA    1 
ATOM   8943 C C     . VAL D 1 319 ? -32.589 -21.839 -91.316 1.00 125.35 ? 341 VAL D C     1 
ATOM   8944 O O     . VAL D 1 319 ? -32.659 -20.713 -90.817 1.00 125.15 ? 341 VAL D O     1 
ATOM   8945 C CB    . VAL D 1 319 ? -31.863 -23.821 -90.056 1.00 125.72 ? 341 VAL D CB    1 
ATOM   8946 C CG1   . VAL D 1 319 ? -31.311 -23.121 -88.832 1.00 126.02 ? 341 VAL D CG1   1 
ATOM   8947 C CG2   . VAL D 1 319 ? -32.252 -25.236 -89.704 1.00 125.93 ? 341 VAL D CG2   1 
ATOM   8948 N N     . ILE D 1 320 ? -32.089 -22.085 -92.519 1.00 125.18 ? 342 ILE D N     1 
ATOM   8949 C CA    . ILE D 1 320 ? -31.669 -21.009 -93.372 1.00 125.13 ? 342 ILE D CA    1 
ATOM   8950 C C     . ILE D 1 320 ? -32.818 -20.011 -93.452 1.00 125.24 ? 342 ILE D C     1 
ATOM   8951 O O     . ILE D 1 320 ? -32.638 -18.832 -93.136 1.00 125.27 ? 342 ILE D O     1 
ATOM   8952 C CB    . ILE D 1 320 ? -31.267 -21.535 -94.754 1.00 125.04 ? 342 ILE D CB    1 
ATOM   8953 C CG1   . ILE D 1 320 ? -30.215 -22.642 -94.589 1.00 124.80 ? 342 ILE D CG1   1 
ATOM   8954 C CG2   . ILE D 1 320 ? -30.738 -20.394 -95.618 1.00 124.87 ? 342 ILE D CG2   1 
ATOM   8955 C CD1   . ILE D 1 320 ? -30.137 -23.634 -95.727 1.00 124.43 ? 342 ILE D CD1   1 
ATOM   8956 N N     . ASN D 1 321 ? -34.003 -20.502 -93.818 1.00 125.28 ? 343 ASN D N     1 
ATOM   8957 C CA    . ASN D 1 321 ? -35.175 -19.649 -93.995 1.00 125.45 ? 343 ASN D CA    1 
ATOM   8958 C C     . ASN D 1 321 ? -35.582 -18.901 -92.743 1.00 125.05 ? 343 ASN D C     1 
ATOM   8959 O O     . ASN D 1 321 ? -36.024 -17.756 -92.813 1.00 125.09 ? 343 ASN D O     1 
ATOM   8960 C CB    . ASN D 1 321 ? -36.357 -20.452 -94.538 1.00 125.92 ? 343 ASN D CB    1 
ATOM   8961 C CG    . ASN D 1 321 ? -36.340 -20.531 -96.091 1.00 127.30 ? 343 ASN D CG    1 
ATOM   8962 O OD1   . ASN D 1 321 ? -35.361 -20.115 -96.722 1.00 128.76 ? 343 ASN D OD1   1 
ATOM   8963 N ND2   . ASN D 1 321 ? -37.430 -21.064 -96.714 1.00 128.40 ? 343 ASN D ND2   1 
ATOM   8964 N N     . ASN D 1 322 ? -35.433 -19.550 -91.597 1.00 124.60 ? 344 ASN D N     1 
ATOM   8965 C CA    . ASN D 1 322 ? -35.677 -18.879 -90.344 1.00 124.19 ? 344 ASN D CA    1 
ATOM   8966 C C     . ASN D 1 322 ? -34.668 -17.765 -90.186 1.00 124.01 ? 344 ASN D C     1 
ATOM   8967 O O     . ASN D 1 322 ? -35.024 -16.640 -89.843 1.00 123.83 ? 344 ASN D O     1 
ATOM   8968 C CB    . ASN D 1 322 ? -35.590 -19.866 -89.187 1.00 124.19 ? 344 ASN D CB    1 
ATOM   8969 C CG    . ASN D 1 322 ? -36.751 -20.842 -89.163 1.00 124.11 ? 344 ASN D CG    1 
ATOM   8970 O OD1   . ASN D 1 322 ? -37.749 -20.667 -89.860 1.00 123.69 ? 344 ASN D OD1   1 
ATOM   8971 N ND2   . ASN D 1 322 ? -36.622 -21.877 -88.355 1.00 124.55 ? 344 ASN D ND2   1 
ATOM   8972 N N     . THR D 1 323 ? -33.412 -18.082 -90.487 1.00 123.97 ? 345 THR D N     1 
ATOM   8973 C CA    . THR D 1 323 ? -32.316 -17.136 -90.349 1.00 123.96 ? 345 THR D CA    1 
ATOM   8974 C C     . THR D 1 323 ? -32.628 -15.848 -91.098 1.00 124.24 ? 345 THR D C     1 
ATOM   8975 O O     . THR D 1 323 ? -32.559 -14.750 -90.522 1.00 124.18 ? 345 THR D O     1 
ATOM   8976 C CB    . THR D 1 323 ? -30.998 -17.724 -90.867 1.00 123.82 ? 345 THR D CB    1 
ATOM   8977 O OG1   . THR D 1 323 ? -30.922 -19.124 -90.517 1.00 123.15 ? 345 THR D OG1   1 
ATOM   8978 C CG2   . THR D 1 323 ? -29.814 -16.970 -90.264 1.00 123.66 ? 345 THR D CG2   1 
ATOM   8979 N N     . GLN D 1 324 ? -32.985 -15.998 -92.382 1.00 124.63 ? 346 GLN D N     1 
ATOM   8980 C CA    . GLN D 1 324 ? -33.357 -14.857 -93.216 1.00 125.16 ? 346 GLN D CA    1 
ATOM   8981 C C     . GLN D 1 324 ? -34.426 -14.014 -92.516 1.00 125.42 ? 346 GLN D C     1 
ATOM   8982 O O     . GLN D 1 324 ? -34.256 -12.788 -92.331 1.00 125.28 ? 346 GLN D O     1 
ATOM   8983 C CB    . GLN D 1 324 ? -33.869 -15.324 -94.599 1.00 125.28 ? 346 GLN D CB    1 
ATOM   8984 C CG    . GLN D 1 324 ? -32.808 -15.990 -95.528 1.00 125.73 ? 346 GLN D CG    1 
ATOM   8985 C CD    . GLN D 1 324 ? -31.799 -14.997 -96.175 1.00 125.92 ? 346 GLN D CD    1 
ATOM   8986 O OE1   . GLN D 1 324 ? -32.182 -13.929 -96.663 1.00 125.71 ? 346 GLN D OE1   1 
ATOM   8987 N NE2   . GLN D 1 324 ? -30.503 -15.363 -96.190 1.00 125.76 ? 346 GLN D NE2   1 
ATOM   8988 N N     . ARG D 1 325 ? -35.512 -14.690 -92.115 1.00 125.93 ? 347 ARG D N     1 
ATOM   8989 C CA    . ARG D 1 325 ? -36.635 -14.042 -91.432 1.00 126.50 ? 347 ARG D CA    1 
ATOM   8990 C C     . ARG D 1 325 ? -36.149 -13.219 -90.256 1.00 126.71 ? 347 ARG D C     1 
ATOM   8991 O O     . ARG D 1 325 ? -36.690 -12.147 -89.968 1.00 126.73 ? 347 ARG D O     1 
ATOM   8992 C CB    . ARG D 1 325 ? -37.641 -15.074 -90.921 1.00 126.59 ? 347 ARG D CB    1 
ATOM   8993 C CG    . ARG D 1 325 ? -38.454 -15.770 -91.993 1.00 127.41 ? 347 ARG D CG    1 
ATOM   8994 C CD    . ARG D 1 325 ? -39.777 -16.269 -91.423 1.00 129.05 ? 347 ARG D CD    1 
ATOM   8995 N NE    . ARG D 1 325 ? -39.643 -16.865 -90.089 1.00 130.30 ? 347 ARG D NE    1 
ATOM   8996 C CZ    . ARG D 1 325 ? -39.264 -18.127 -89.852 1.00 131.06 ? 347 ARG D CZ    1 
ATOM   8997 N NH1   . ARG D 1 325 ? -38.961 -18.948 -90.859 1.00 131.43 ? 347 ARG D NH1   1 
ATOM   8998 N NH2   . ARG D 1 325 ? -39.186 -18.570 -88.600 1.00 131.13 ? 347 ARG D NH2   1 
ATOM   8999 N N     . VAL D 1 326 ? -35.130 -13.735 -89.576 1.00 127.08 ? 348 VAL D N     1 
ATOM   9000 C CA    . VAL D 1 326 ? -34.533 -13.036 -88.454 1.00 127.55 ? 348 VAL D CA    1 
ATOM   9001 C C     . VAL D 1 326 ? -33.828 -11.798 -88.969 1.00 128.02 ? 348 VAL D C     1 
ATOM   9002 O O     . VAL D 1 326 ? -33.898 -10.730 -88.360 1.00 127.93 ? 348 VAL D O     1 
ATOM   9003 C CB    . VAL D 1 326 ? -33.558 -13.940 -87.674 1.00 127.47 ? 348 VAL D CB    1 
ATOM   9004 C CG1   . VAL D 1 326 ? -32.684 -13.113 -86.748 1.00 127.21 ? 348 VAL D CG1   1 
ATOM   9005 C CG2   . VAL D 1 326 ? -34.332 -14.993 -86.879 1.00 127.51 ? 348 VAL D CG2   1 
ATOM   9006 N N     . LEU D 1 327 ? -33.174 -11.943 -90.113 1.00 128.84 ? 349 LEU D N     1 
ATOM   9007 C CA    . LEU D 1 327 ? -32.493 -10.821 -90.725 1.00 129.94 ? 349 LEU D CA    1 
ATOM   9008 C C     . LEU D 1 327 ? -33.483 -9.783  -91.255 1.00 131.17 ? 349 LEU D C     1 
ATOM   9009 O O     . LEU D 1 327 ? -33.166 -8.591  -91.301 1.00 131.25 ? 349 LEU D O     1 
ATOM   9010 C CB    . LEU D 1 327 ? -31.549 -11.304 -91.827 1.00 129.59 ? 349 LEU D CB    1 
ATOM   9011 C CG    . LEU D 1 327 ? -30.486 -12.325 -91.393 1.00 128.66 ? 349 LEU D CG    1 
ATOM   9012 C CD1   . LEU D 1 327 ? -29.752 -12.899 -92.603 1.00 127.65 ? 349 LEU D CD1   1 
ATOM   9013 C CD2   . LEU D 1 327 ? -29.500 -11.734 -90.388 1.00 127.26 ? 349 LEU D CD2   1 
ATOM   9014 N N     . LYS D 1 328 ? -34.680 -10.242 -91.628 1.00 132.79 ? 350 LYS D N     1 
ATOM   9015 C CA    . LYS D 1 328 ? -35.745 -9.364  -92.148 1.00 134.52 ? 350 LYS D CA    1 
ATOM   9016 C C     . LYS D 1 328 ? -36.452 -8.499  -91.094 1.00 135.53 ? 350 LYS D C     1 
ATOM   9017 O O     . LYS D 1 328 ? -37.069 -7.473  -91.424 1.00 135.57 ? 350 LYS D O     1 
ATOM   9018 C CB    . LYS D 1 328 ? -36.776 -10.168 -92.952 1.00 134.52 ? 350 LYS D CB    1 
ATOM   9019 C CG    . LYS D 1 328 ? -36.396 -10.336 -94.416 1.00 135.35 ? 350 LYS D CG    1 
ATOM   9020 C CD    . LYS D 1 328 ? -37.126 -11.509 -95.050 1.00 136.41 ? 350 LYS D CD    1 
ATOM   9021 C CE    . LYS D 1 328 ? -36.484 -11.834 -96.439 1.00 136.97 ? 350 LYS D CE    1 
ATOM   9022 N NZ    . LYS D 1 328 ? -36.910 -13.210 -96.876 1.00 137.48 ? 350 LYS D NZ    1 
ATOM   9023 N N     . GLY D 1 329 ? -36.368 -8.926  -89.836 1.00 136.78 ? 351 GLY D N     1 
ATOM   9024 C CA    . GLY D 1 329 ? -36.984 -8.205  -88.729 1.00 138.28 ? 351 GLY D CA    1 
ATOM   9025 C C     . GLY D 1 329 ? -38.384 -8.687  -88.389 1.00 139.30 ? 351 GLY D C     1 
ATOM   9026 O O     . GLY D 1 329 ? -39.353 -7.827  -88.349 1.00 139.44 ? 351 GLY D O     1 
ATOM   9027 N N     . ASP D 1 330 ? -38.485 -10.061 -88.149 1.00 140.28 ? 352 ASP D N     1 
ATOM   9028 C CA    . ASP D 1 330 ? -39.742 -10.681 -87.707 1.00 141.22 ? 352 ASP D CA    1 
ATOM   9029 C C     . ASP D 1 330 ? -39.788 -10.812 -86.187 1.00 141.33 ? 352 ASP D C     1 
ATOM   9030 O O     . ASP D 1 330 ? -40.860 -10.733 -85.575 1.00 141.44 ? 352 ASP D O     1 
ATOM   9031 C CB    . ASP D 1 330 ? -39.928 -12.064 -88.352 1.00 141.56 ? 352 ASP D CB    1 
ATOM   9032 C CG    . ASP D 1 330 ? -40.337 -11.967 -89.834 1.00 142.84 ? 352 ASP D CG    1 
ATOM   9033 O OD1   . ASP D 1 330 ? -40.222 -10.872 -90.445 1.00 144.44 ? 352 ASP D OD1   1 
ATOM   9034 O OD2   . ASP D 1 330 ? -40.775 -12.995 -90.397 1.00 143.94 ? 352 ASP D OD2   1 
HETATM 9035 P P1    . A3P E 2 .   ? -10.931 -7.212  13.571  1.00 56.35  ? 1   A3P A P1    1 
HETATM 9036 O O1P   . A3P E 2 .   ? -10.976 -6.526  12.218  1.00 54.53  ? 1   A3P A O1P   1 
HETATM 9037 O O2P   . A3P E 2 .   ? -10.028 -6.588  14.633  1.00 54.96  ? 1   A3P A O2P   1 
HETATM 9038 O O3P   . A3P E 2 .   ? -12.284 -7.545  14.182  1.00 55.72  ? 1   A3P A O3P   1 
HETATM 9039 P P2    . A3P E 2 .   ? -7.907  -11.700 8.766   1.00 53.90  ? 1   A3P A P2    1 
HETATM 9040 O O4P   . A3P E 2 .   ? -8.282  -10.556 7.819   1.00 52.38  ? 1   A3P A O4P   1 
HETATM 9041 O O5P   . A3P E 2 .   ? -8.543  -13.001 8.327   1.00 53.96  ? 1   A3P A O5P   1 
HETATM 9042 O O6P   . A3P E 2 .   ? -6.495  -11.800 9.341   1.00 54.79  ? 1   A3P A O6P   1 
HETATM 9043 O "O5'" . A3P E 2 .   ? -8.574  -11.362 10.176  1.00 52.47  ? 1   A3P A "O5'" 1 
HETATM 9044 C "C5'" . A3P E 2 .   ? -8.836  -10.016 10.514  1.00 52.09  ? 1   A3P A "C5'" 1 
HETATM 9045 C "C4'" . A3P E 2 .   ? -8.599  -9.918  12.001  1.00 52.32  ? 1   A3P A "C4'" 1 
HETATM 9046 O "O4'" . A3P E 2 .   ? -7.207  -10.064 12.293  1.00 51.45  ? 1   A3P A "O4'" 1 
HETATM 9047 C "C3'" . A3P E 2 .   ? -8.965  -8.550  12.548  1.00 51.79  ? 1   A3P A "C3'" 1 
HETATM 9048 O "O3'" . A3P E 2 .   ? -10.238 -8.615  13.170  1.00 53.63  ? 1   A3P A "O3'" 1 
HETATM 9049 C "C2'" . A3P E 2 .   ? -7.854  -8.241  13.541  1.00 49.97  ? 1   A3P A "C2'" 1 
HETATM 9050 O "O2'" . A3P E 2 .   ? -8.319  -7.882  14.834  1.00 46.43  ? 1   A3P A "O2'" 1 
HETATM 9051 C "C1'" . A3P E 2 .   ? -7.194  -9.584  13.635  1.00 51.07  ? 1   A3P A "C1'" 1 
HETATM 9052 N N9    . A3P E 2 .   ? -5.826  -9.474  14.162  1.00 53.34  ? 1   A3P A N9    1 
HETATM 9053 C C8    . A3P E 2 .   ? -4.712  -9.200  13.448  1.00 54.26  ? 1   A3P A C8    1 
HETATM 9054 N N7    . A3P E 2 .   ? -3.607  -9.200  14.245  1.00 53.97  ? 1   A3P A N7    1 
HETATM 9055 C C5    . A3P E 2 .   ? -4.031  -9.478  15.478  1.00 53.61  ? 1   A3P A C5    1 
HETATM 9056 C C6    . A3P E 2 .   ? -3.383  -9.615  16.778  1.00 54.78  ? 1   A3P A C6    1 
HETATM 9057 N N6    . A3P E 2 .   ? -2.034  -9.448  16.852  1.00 54.58  ? 1   A3P A N6    1 
HETATM 9058 N N1    . A3P E 2 .   ? -4.189  -9.915  17.848  1.00 56.36  ? 1   A3P A N1    1 
HETATM 9059 C C2    . A3P E 2 .   ? -5.536  -10.077 17.754  1.00 54.97  ? 1   A3P A C2    1 
HETATM 9060 N N3    . A3P E 2 .   ? -6.180  -9.956  16.580  1.00 54.19  ? 1   A3P A N3    1 
HETATM 9061 C C4    . A3P E 2 .   ? -5.491  -9.668  15.440  1.00 53.69  ? 1   A3P A C4    1 
HETATM 9062 P P1    . A3P F 2 .   ? -11.694 -25.416 -45.426 1.00 119.03 ? 1   A3P B P1    1 
HETATM 9063 O O1P   . A3P F 2 .   ? -12.673 -25.277 -44.263 1.00 116.41 ? 1   A3P B O1P   1 
HETATM 9064 O O2P   . A3P F 2 .   ? -11.809 -26.739 -46.163 1.00 117.67 ? 1   A3P B O2P   1 
HETATM 9065 O O3P   . A3P F 2 .   ? -11.707 -24.239 -46.418 1.00 116.26 ? 1   A3P B O3P   1 
HETATM 9066 P P2    . A3P F 2 .   ? -7.440  -25.541 -39.371 1.00 118.70 ? 1   A3P B P2    1 
HETATM 9067 O O4P   . A3P F 2 .   ? -8.823  -25.060 -38.936 1.00 117.45 ? 1   A3P B O4P   1 
HETATM 9068 O O5P   . A3P F 2 .   ? -6.378  -24.459 -39.550 1.00 117.59 ? 1   A3P B O5P   1 
HETATM 9069 O O6P   . A3P F 2 .   ? -6.974  -26.753 -38.589 1.00 118.12 ? 1   A3P B O6P   1 
HETATM 9070 O "O5'" . A3P F 2 .   ? -7.603  -26.155 -40.850 1.00 115.86 ? 1   A3P B "O5'" 1 
HETATM 9071 C "C5'" . A3P F 2 .   ? -8.881  -26.273 -41.458 1.00 116.41 ? 1   A3P B "C5'" 1 
HETATM 9072 C "C4'" . A3P F 2 .   ? -8.567  -26.254 -42.941 1.00 117.96 ? 1   A3P B "C4'" 1 
HETATM 9073 O "O4'" . A3P F 2 .   ? -7.499  -27.215 -43.130 1.00 118.97 ? 1   A3P B "O4'" 1 
HETATM 9074 C "C3'" . A3P F 2 .   ? -9.764  -26.612 -43.848 1.00 117.98 ? 1   A3P B "C3'" 1 
HETATM 9075 O "O3'" . A3P F 2 .   ? -10.218 -25.508 -44.687 1.00 117.72 ? 1   A3P B "O3'" 1 
HETATM 9076 C "C2'" . A3P F 2 .   ? -9.249  -27.819 -44.638 1.00 118.24 ? 1   A3P B "C2'" 1 
HETATM 9077 O "O2'" . A3P F 2 .   ? -9.540  -27.758 -46.044 1.00 114.85 ? 1   A3P B "O2'" 1 
HETATM 9078 C "C1'" . A3P F 2 .   ? -7.726  -27.885 -44.389 1.00 120.12 ? 1   A3P B "C1'" 1 
HETATM 9079 N N9    . A3P F 2 .   ? -7.220  -29.307 -44.538 1.00 120.51 ? 1   A3P B N9    1 
HETATM 9080 C C8    . A3P F 2 .   ? -7.298  -30.319 -43.625 1.00 119.74 ? 1   A3P B C8    1 
HETATM 9081 N N7    . A3P F 2 .   ? -6.769  -31.476 -44.124 1.00 119.02 ? 1   A3P B N7    1 
HETATM 9082 C C5    . A3P F 2 .   ? -6.340  -31.228 -45.391 1.00 119.40 ? 1   A3P B C5    1 
HETATM 9083 C C6    . A3P F 2 .   ? -5.685  -31.999 -46.496 1.00 118.66 ? 1   A3P B C6    1 
HETATM 9084 N N6    . A3P F 2 .   ? -5.375  -33.307 -46.319 1.00 118.20 ? 1   A3P B N6    1 
HETATM 9085 N N1    . A3P F 2 .   ? -5.409  -31.360 -47.672 1.00 117.21 ? 1   A3P B N1    1 
HETATM 9086 C C2    . A3P F 2 .   ? -5.713  -30.058 -47.859 1.00 117.23 ? 1   A3P B C2    1 
HETATM 9087 N N3    . A3P F 2 .   ? -6.308  -29.293 -46.916 1.00 118.23 ? 1   A3P B N3    1 
HETATM 9088 C C4    . A3P F 2 .   ? -6.643  -29.800 -45.675 1.00 119.88 ? 1   A3P B C4    1 
HETATM 9089 P P1    . A3P G 2 .   ? -24.777 -25.771 -17.569 1.00 72.39  ? 1   A3P C P1    1 
HETATM 9090 O O1P   . A3P G 2 .   ? -23.876 -25.940 -18.783 1.00 70.37  ? 1   A3P C O1P   1 
HETATM 9091 O O2P   . A3P G 2 .   ? -24.814 -26.918 -16.555 1.00 73.49  ? 1   A3P C O2P   1 
HETATM 9092 O O3P   . A3P G 2 .   ? -24.589 -24.432 -16.833 1.00 73.09  ? 1   A3P C O3P   1 
HETATM 9093 P P2    . A3P G 2 .   ? -29.005 -26.000 -23.661 1.00 70.90  ? 1   A3P C P2    1 
HETATM 9094 O O4P   . A3P G 2 .   ? -27.675 -26.204 -24.387 1.00 68.84  ? 1   A3P C O4P   1 
HETATM 9095 O O5P   . A3P G 2 .   ? -29.735 -24.739 -24.129 1.00 69.72  ? 1   A3P C O5P   1 
HETATM 9096 O O6P   . A3P G 2 .   ? -29.927 -27.202 -23.520 1.00 72.18  ? 1   A3P C O6P   1 
HETATM 9097 O "O5'" . A3P G 2 .   ? -28.651 -25.767 -22.083 1.00 68.92  ? 1   A3P C "O5'" 1 
HETATM 9098 C "C5'" . A3P G 2 .   ? -27.823 -26.661 -21.319 1.00 67.98  ? 1   A3P C "C5'" 1 
HETATM 9099 C "C4'" . A3P G 2 .   ? -28.069 -26.496 -19.807 1.00 68.67  ? 1   A3P C "C4'" 1 
HETATM 9100 O "O4'" . A3P G 2 .   ? -29.242 -27.237 -19.365 1.00 67.84  ? 1   A3P C "O4'" 1 
HETATM 9101 C "C3'" . A3P G 2 .   ? -26.891 -26.908 -18.892 1.00 68.05  ? 1   A3P C "C3'" 1 
HETATM 9102 O "O3'" . A3P G 2 .   ? -26.254 -25.775 -18.276 1.00 70.15  ? 1   A3P C "O3'" 1 
HETATM 9103 C "C2'" . A3P G 2 .   ? -27.543 -27.776 -17.820 1.00 66.86  ? 1   A3P C "C2'" 1 
HETATM 9104 O "O2'" . A3P G 2 .   ? -27.172 -27.416 -16.481 1.00 65.65  ? 1   A3P C "O2'" 1 
HETATM 9105 C "C1'" . A3P G 2 .   ? -29.051 -27.625 -17.991 1.00 66.22  ? 1   A3P C "C1'" 1 
HETATM 9106 N N9    . A3P G 2 .   ? -29.621 -28.947 -17.625 1.00 65.17  ? 1   A3P C N9    1 
HETATM 9107 C C8    . A3P G 2 .   ? -29.625 -30.078 -18.370 1.00 65.01  ? 1   A3P C C8    1 
HETATM 9108 N N7    . A3P G 2 .   ? -30.216 -31.104 -17.706 1.00 65.21  ? 1   A3P C N7    1 
HETATM 9109 C C5    . A3P G 2 .   ? -30.579 -30.632 -16.495 1.00 66.96  ? 1   A3P C C5    1 
HETATM 9110 C C6    . A3P G 2 .   ? -31.254 -31.174 -15.279 1.00 69.15  ? 1   A3P C C6    1 
HETATM 9111 N N6    . A3P G 2 .   ? -31.657 -32.470 -15.225 1.00 71.19  ? 1   A3P C N6    1 
HETATM 9112 N N1    . A3P G 2 .   ? -31.459 -30.334 -14.226 1.00 69.15  ? 1   A3P C N1    1 
HETATM 9113 C C2    . A3P G 2 .   ? -31.056 -29.041 -14.276 1.00 68.01  ? 1   A3P C C2    1 
HETATM 9114 N N3    . A3P G 2 .   ? -30.448 -28.480 -15.341 1.00 65.95  ? 1   A3P C N3    1 
HETATM 9115 C C4    . A3P G 2 .   ? -30.184 -29.210 -16.452 1.00 65.67  ? 1   A3P C C4    1 
HETATM 9116 P P1    . A3P H 2 .   ? -24.415 -16.873 -77.881 1.00 60.83  ? 1   A3P D P1    1 
HETATM 9117 O O1P   . A3P H 2 .   ? -24.446 -16.083 -76.564 1.00 58.45  ? 1   A3P D O1P   1 
HETATM 9118 O O2P   . A3P H 2 .   ? -25.223 -16.285 -79.042 1.00 59.45  ? 1   A3P D O2P   1 
HETATM 9119 O O3P   . A3P H 2 .   ? -23.046 -17.357 -78.399 1.00 58.70  ? 1   A3P D O3P   1 
HETATM 9120 P P2    . A3P H 2 .   ? -27.786 -20.949 -72.898 1.00 65.37  ? 1   A3P D P2    1 
HETATM 9121 O O4P   . A3P H 2 .   ? -27.435 -19.794 -71.972 1.00 65.36  ? 1   A3P D O4P   1 
HETATM 9122 O O5P   . A3P H 2 .   ? -27.191 -22.277 -72.456 1.00 65.65  ? 1   A3P D O5P   1 
HETATM 9123 O O6P   . A3P H 2 .   ? -29.215 -20.970 -73.381 1.00 64.85  ? 1   A3P D O6P   1 
HETATM 9124 O "O5'" . A3P H 2 .   ? -27.099 -20.641 -74.318 1.00 63.69  ? 1   A3P D "O5'" 1 
HETATM 9125 C "C5'" . A3P H 2 .   ? -27.063 -19.302 -74.797 1.00 61.98  ? 1   A3P D "C5'" 1 
HETATM 9126 C "C4'" . A3P H 2 .   ? -26.861 -19.398 -76.289 1.00 60.48  ? 1   A3P D "C4'" 1 
HETATM 9127 O "O4'" . A3P H 2 .   ? -28.056 -19.891 -76.899 1.00 60.86  ? 1   A3P D "O4'" 1 
HETATM 9128 C "C3'" . A3P H 2 .   ? -26.577 -18.051 -76.911 1.00 58.91  ? 1   A3P D "C3'" 1 
HETATM 9129 O "O3'" . A3P H 2 .   ? -25.243 -18.175 -77.389 1.00 59.18  ? 1   A3P D "O3'" 1 
HETATM 9130 C "C2'" . A3P H 2 .   ? -27.603 -17.902 -78.028 1.00 57.80  ? 1   A3P D "C2'" 1 
HETATM 9131 O "O2'" . A3P H 2 .   ? -27.002 -17.529 -79.265 1.00 53.28  ? 1   A3P D "O2'" 1 
HETATM 9132 C "C1'" . A3P H 2 .   ? -28.190 -19.287 -78.189 1.00 60.50  ? 1   A3P D "C1'" 1 
HETATM 9133 N N9    . A3P H 2 .   ? -29.610 -19.226 -78.633 1.00 63.89  ? 1   A3P D N9    1 
HETATM 9134 C C8    . A3P H 2 .   ? -30.694 -18.974 -77.870 1.00 65.25  ? 1   A3P D C8    1 
HETATM 9135 N N7    . A3P H 2 .   ? -31.841 -18.994 -78.600 1.00 66.15  ? 1   A3P D N7    1 
HETATM 9136 C C5    . A3P H 2 .   ? -31.489 -19.263 -79.859 1.00 66.82  ? 1   A3P D C5    1 
HETATM 9137 C C6    . A3P H 2 .   ? -32.205 -19.420 -81.138 1.00 68.90  ? 1   A3P D C6    1 
HETATM 9138 N N6    . A3P H 2 .   ? -33.562 -19.295 -81.181 1.00 70.40  ? 1   A3P D N6    1 
HETATM 9139 N N1    . A3P H 2 .   ? -31.458 -19.694 -82.244 1.00 69.65  ? 1   A3P D N1    1 
HETATM 9140 C C2    . A3P H 2 .   ? -30.113 -19.825 -82.195 1.00 69.10  ? 1   A3P D C2    1 
HETATM 9141 N N3    . A3P H 2 .   ? -29.402 -19.690 -81.059 1.00 68.13  ? 1   A3P D N3    1 
HETATM 9142 C C4    . A3P H 2 .   ? -30.026 -19.416 -79.883 1.00 66.07  ? 1   A3P D C4    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   23  ?   ?   ?   A . n 
A 1 2   GLY 2   24  ?   ?   ?   A . n 
A 1 3   SER 3   25  ?   ?   ?   A . n 
A 1 4   SER 4   26  ?   ?   ?   A . n 
A 1 5   HIS 5   27  ?   ?   ?   A . n 
A 1 6   HIS 6   28  ?   ?   ?   A . n 
A 1 7   HIS 7   29  ?   ?   ?   A . n 
A 1 8   HIS 8   30  ?   ?   ?   A . n 
A 1 9   HIS 9   31  ?   ?   ?   A . n 
A 1 10  HIS 10  32  ?   ?   ?   A . n 
A 1 11  SER 11  33  ?   ?   ?   A . n 
A 1 12  SER 12  34  ?   ?   ?   A . n 
A 1 13  GLY 13  35  ?   ?   ?   A . n 
A 1 14  VAL 14  36  ?   ?   ?   A . n 
A 1 15  PRO 15  37  ?   ?   ?   A . n 
A 1 16  ARG 16  38  ?   ?   ?   A . n 
A 1 17  GLY 17  39  ?   ?   ?   A . n 
A 1 18  SER 18  40  ?   ?   ?   A . n 
A 1 19  HIS 19  41  ?   ?   ?   A . n 
A 1 20  MET 20  42  ?   ?   ?   A . n 
A 1 21  GLY 21  43  ?   ?   ?   A . n 
A 1 22  ALA 22  44  ?   ?   ?   A . n 
A 1 23  MET 23  45  ?   ?   ?   A . n 
A 1 24  ARG 24  46  ?   ?   ?   A . n 
A 1 25  PRO 25  47  ?   ?   ?   A . n 
A 1 26  GLU 26  48  ?   ?   ?   A . n 
A 1 27  GLN 27  49  ?   ?   ?   A . n 
A 1 28  GLU 28  50  ?   ?   ?   A . n 
A 1 29  GLU 29  51  ?   ?   ?   A . n 
A 1 30  LEU 30  52  ?   ?   ?   A . n 
A 1 31  VAL 31  53  ?   ?   ?   A . n 
A 1 32  MET 32  54  ?   ?   ?   A . n 
A 1 33  VAL 33  55  ?   ?   ?   A . n 
A 1 34  GLY 34  56  ?   ?   ?   A . n 
A 1 35  THR 35  57  ?   ?   ?   A . n 
A 1 36  ASN 36  58  ?   ?   ?   A . n 
A 1 37  HIS 37  59  ?   ?   ?   A . n 
A 1 38  VAL 38  60  ?   ?   ?   A . n 
A 1 39  VAL 39  61  61  VAL VAL A . n 
A 1 40  TYR 40  62  62  TYR TYR A . n 
A 1 41  ARG 41  63  63  ARG ARG A . n 
A 1 42  TYR 42  64  64  TYR TYR A . n 
A 1 43  GLY 43  65  65  GLY GLY A . n 
A 1 44  LYS 44  66  66  LYS LYS A . n 
A 1 45  ALA 45  67  67  ALA ALA A . n 
A 1 46  MET 46  68  68  MET MET A . n 
A 1 47  PRO 47  69  69  PRO PRO A . n 
A 1 48  LEU 48  70  70  LEU LEU A . n 
A 1 49  ILE 49  71  71  ILE ILE A . n 
A 1 50  PHE 50  72  72  PHE PHE A . n 
A 1 51  VAL 51  73  73  VAL VAL A . n 
A 1 52  GLY 52  74  74  GLY GLY A . n 
A 1 53  GLY 53  75  75  GLY GLY A . n 
A 1 54  VAL 54  76  76  VAL VAL A . n 
A 1 55  PRO 55  77  77  PRO PRO A . n 
A 1 56  ARG 56  78  78  ARG ARG A . n 
A 1 57  SER 57  79  79  SER SER A . n 
A 1 58  GLY 58  80  80  GLY GLY A . n 
A 1 59  THR 59  81  81  THR THR A . n 
A 1 60  THR 60  82  82  THR THR A . n 
A 1 61  LEU 61  83  83  LEU LEU A . n 
A 1 62  MET 62  84  84  MET MET A . n 
A 1 63  ARG 63  85  85  ARG ARG A . n 
A 1 64  ALA 64  86  86  ALA ALA A . n 
A 1 65  MET 65  87  87  MET MET A . n 
A 1 66  LEU 66  88  88  LEU LEU A . n 
A 1 67  ASP 67  89  89  ASP ASP A . n 
A 1 68  ALA 68  90  90  ALA ALA A . n 
A 1 69  HIS 69  91  91  HIS HIS A . n 
A 1 70  PRO 70  92  92  PRO PRO A . n 
A 1 71  GLU 71  93  93  GLU GLU A . n 
A 1 72  VAL 72  94  94  VAL VAL A . n 
A 1 73  ARG 73  95  95  ARG ARG A . n 
A 1 74  CYS 74  96  96  CYS CYS A . n 
A 1 75  GLY 75  97  97  GLY GLY A . n 
A 1 76  GLU 76  98  98  GLU GLU A . n 
A 1 77  GLU 77  99  99  GLU GLU A . n 
A 1 78  THR 78  100 100 THR THR A . n 
A 1 79  ARG 79  101 101 ARG ARG A . n 
A 1 80  ILE 80  102 102 ILE ILE A . n 
A 1 81  ILE 81  103 103 ILE ILE A . n 
A 1 82  PRO 82  104 104 PRO PRO A . n 
A 1 83  ARG 83  105 105 ARG ARG A . n 
A 1 84  VAL 84  106 106 VAL VAL A . n 
A 1 85  LEU 85  107 107 LEU LEU A . n 
A 1 86  ALA 86  108 108 ALA ALA A . n 
A 1 87  MET 87  109 109 MET MET A . n 
A 1 88  ARG 88  110 110 ARG ARG A . n 
A 1 89  GLN 89  111 111 GLN GLN A . n 
A 1 90  ALA 90  112 112 ALA ALA A . n 
A 1 91  TRP 91  113 113 TRP TRP A . n 
A 1 92  SER 92  114 114 SER SER A . n 
A 1 93  LYS 93  115 ?   ?   ?   A . n 
A 1 94  SER 94  116 ?   ?   ?   A . n 
A 1 95  GLY 95  117 ?   ?   ?   A . n 
A 1 96  ARG 96  118 ?   ?   ?   A . n 
A 1 97  GLU 97  119 ?   ?   ?   A . n 
A 1 98  LYS 98  120 ?   ?   ?   A . n 
A 1 99  LEU 99  121 ?   ?   ?   A . n 
A 1 100 ARG 100 122 ?   ?   ?   A . n 
A 1 101 LEU 101 123 ?   ?   ?   A . n 
A 1 102 ASP 102 124 ?   ?   ?   A . n 
A 1 103 GLU 103 125 125 GLU GLU A . n 
A 1 104 ALA 104 126 126 ALA ALA A . n 
A 1 105 GLY 105 127 127 GLY GLY A . n 
A 1 106 VAL 106 128 128 VAL VAL A . n 
A 1 107 THR 107 129 129 THR THR A . n 
A 1 108 ASP 108 130 130 ASP ASP A . n 
A 1 109 GLU 109 131 131 GLU GLU A . n 
A 1 110 VAL 110 132 132 VAL VAL A . n 
A 1 111 LEU 111 133 133 LEU LEU A . n 
A 1 112 ASP 112 134 134 ASP ASP A . n 
A 1 113 ALA 113 135 135 ALA ALA A . n 
A 1 114 ALA 114 136 136 ALA ALA A . n 
A 1 115 MET 115 137 137 MET MET A . n 
A 1 116 GLN 116 138 138 GLN GLN A . n 
A 1 117 ALA 117 139 139 ALA ALA A . n 
A 1 118 PHE 118 140 140 PHE PHE A . n 
A 1 119 ILE 119 141 141 ILE ILE A . n 
A 1 120 LEU 120 142 142 LEU LEU A . n 
A 1 121 GLU 121 143 143 GLU GLU A . n 
A 1 122 VAL 122 144 144 VAL VAL A . n 
A 1 123 ILE 123 145 145 ILE ILE A . n 
A 1 124 ALA 124 146 146 ALA ALA A . n 
A 1 125 LYS 125 147 147 LYS LYS A . n 
A 1 126 HIS 126 148 148 HIS HIS A . n 
A 1 127 GLY 127 149 149 GLY GLY A . n 
A 1 128 GLU 128 150 150 GLU GLU A . n 
A 1 129 PRO 129 151 151 PRO PRO A . n 
A 1 130 ALA 130 152 152 ALA ALA A . n 
A 1 131 ARG 131 153 153 ARG ARG A . n 
A 1 132 VAL 132 154 154 VAL VAL A . n 
A 1 133 LEU 133 155 155 LEU LEU A . n 
A 1 134 CYS 134 156 156 CYS CYS A . n 
A 1 135 ASN 135 157 157 ASN ASN A . n 
A 1 136 LYS 136 158 158 LYS LYS A . n 
A 1 137 ASP 137 159 159 ASP ASP A . n 
A 1 138 PRO 138 160 160 PRO PRO A . n 
A 1 139 PHE 139 161 161 PHE PHE A . n 
A 1 140 THR 140 162 162 THR THR A . n 
A 1 141 LEU 141 163 163 LEU LEU A . n 
A 1 142 LYS 142 164 164 LYS LYS A . n 
A 1 143 SER 143 165 165 SER SER A . n 
A 1 144 SER 144 166 166 SER SER A . n 
A 1 145 VAL 145 167 167 VAL VAL A . n 
A 1 146 TYR 146 168 168 TYR TYR A . n 
A 1 147 LEU 147 169 169 LEU LEU A . n 
A 1 148 SER 148 170 170 SER SER A . n 
A 1 149 ARG 149 171 171 ARG ARG A . n 
A 1 150 LEU 150 172 172 LEU LEU A . n 
A 1 151 PHE 151 173 173 PHE PHE A . n 
A 1 152 PRO 152 174 174 PRO PRO A . n 
A 1 153 ASN 153 175 175 ASN ASN A . n 
A 1 154 SER 154 176 176 SER SER A . n 
A 1 155 LYS 155 177 177 LYS LYS A . n 
A 1 156 PHE 156 178 178 PHE PHE A . n 
A 1 157 LEU 157 179 179 LEU LEU A . n 
A 1 158 LEU 158 180 180 LEU LEU A . n 
A 1 159 MET 159 181 181 MET MET A . n 
A 1 160 VAL 160 182 182 VAL VAL A . n 
A 1 161 ARG 161 183 183 ARG ARG A . n 
A 1 162 ASP 162 184 184 ASP ASP A . n 
A 1 163 GLY 163 185 185 GLY GLY A . n 
A 1 164 ARG 164 186 186 ARG ARG A . n 
A 1 165 ALA 165 187 187 ALA ALA A . n 
A 1 166 SER 166 188 188 SER SER A . n 
A 1 167 VAL 167 189 189 VAL VAL A . n 
A 1 168 HIS 168 190 190 HIS HIS A . n 
A 1 169 SER 169 191 191 SER SER A . n 
A 1 170 MET 170 192 192 MET MET A . n 
A 1 171 ILE 171 193 193 ILE ILE A . n 
A 1 172 THR 172 194 194 THR THR A . n 
A 1 173 ARG 173 195 195 ARG ARG A . n 
A 1 174 LYS 174 196 196 LYS LYS A . n 
A 1 175 VAL 175 197 197 VAL VAL A . n 
A 1 176 THR 176 198 198 THR THR A . n 
A 1 177 ILE 177 199 199 ILE ILE A . n 
A 1 178 ALA 178 200 200 ALA ALA A . n 
A 1 179 GLY 179 201 201 GLY GLY A . n 
A 1 180 PHE 180 202 202 PHE PHE A . n 
A 1 181 ASP 181 203 203 ASP ASP A . n 
A 1 182 LEU 182 204 204 LEU LEU A . n 
A 1 183 SER 183 205 205 SER SER A . n 
A 1 184 SER 184 206 206 SER SER A . n 
A 1 185 TYR 185 207 207 TYR TYR A . n 
A 1 186 ARG 186 208 208 ARG ARG A . n 
A 1 187 ASP 187 209 209 ASP ASP A . n 
A 1 188 CYS 188 210 210 CYS CYS A . n 
A 1 189 LEU 189 211 211 LEU LEU A . n 
A 1 190 THR 190 212 212 THR THR A . n 
A 1 191 LYS 191 213 213 LYS LYS A . n 
A 1 192 TRP 192 214 214 TRP TRP A . n 
A 1 193 ASN 193 215 215 ASN ASN A . n 
A 1 194 LYS 194 216 216 LYS LYS A . n 
A 1 195 ALA 195 217 217 ALA ALA A . n 
A 1 196 ILE 196 218 218 ILE ILE A . n 
A 1 197 GLU 197 219 219 GLU GLU A . n 
A 1 198 VAL 198 220 220 VAL VAL A . n 
A 1 199 MET 199 221 221 MET MET A . n 
A 1 200 TYR 200 222 222 TYR TYR A . n 
A 1 201 ALA 201 223 223 ALA ALA A . n 
A 1 202 GLN 202 224 224 GLN GLN A . n 
A 1 203 CYS 203 225 225 CYS CYS A . n 
A 1 204 MET 204 226 226 MET MET A . n 
A 1 205 GLU 205 227 227 GLU GLU A . n 
A 1 206 VAL 206 228 228 VAL VAL A . n 
A 1 207 GLY 207 229 229 GLY GLY A . n 
A 1 208 LYS 208 230 230 LYS LYS A . n 
A 1 209 GLU 209 231 231 GLU GLU A . n 
A 1 210 LYS 210 232 232 LYS LYS A . n 
A 1 211 CYS 211 233 233 CYS CYS A . n 
A 1 212 LEU 212 234 234 LEU LEU A . n 
A 1 213 PRO 213 235 235 PRO PRO A . n 
A 1 214 VAL 214 236 236 VAL VAL A . n 
A 1 215 TYR 215 237 237 TYR TYR A . n 
A 1 216 TYR 216 238 238 TYR TYR A . n 
A 1 217 GLU 217 239 239 GLU GLU A . n 
A 1 218 GLN 218 240 240 GLN GLN A . n 
A 1 219 LEU 219 241 241 LEU LEU A . n 
A 1 220 VAL 220 242 242 VAL VAL A . n 
A 1 221 LEU 221 243 243 LEU LEU A . n 
A 1 222 HIS 222 244 244 HIS HIS A . n 
A 1 223 PRO 223 245 245 PRO PRO A . n 
A 1 224 ARG 224 246 246 ARG ARG A . n 
A 1 225 ARG 225 247 247 ARG ARG A . n 
A 1 226 SER 226 248 248 SER SER A . n 
A 1 227 LEU 227 249 249 LEU LEU A . n 
A 1 228 LYS 228 250 250 LYS LYS A . n 
A 1 229 LEU 229 251 251 LEU LEU A . n 
A 1 230 ILE 230 252 252 ILE ILE A . n 
A 1 231 LEU 231 253 253 LEU LEU A . n 
A 1 232 ASP 232 254 254 ASP ASP A . n 
A 1 233 PHE 233 255 255 PHE PHE A . n 
A 1 234 LEU 234 256 256 LEU LEU A . n 
A 1 235 GLY 235 257 257 GLY GLY A . n 
A 1 236 ILE 236 258 258 ILE ILE A . n 
A 1 237 ALA 237 259 259 ALA ALA A . n 
A 1 238 TRP 238 260 260 TRP TRP A . n 
A 1 239 SER 239 261 261 SER SER A . n 
A 1 240 ASP 240 262 262 ASP ASP A . n 
A 1 241 ALA 241 263 263 ALA ALA A . n 
A 1 242 VAL 242 264 264 VAL VAL A . n 
A 1 243 LEU 243 265 265 LEU LEU A . n 
A 1 244 HIS 244 266 266 HIS HIS A . n 
A 1 245 HIS 245 267 267 HIS HIS A . n 
A 1 246 GLU 246 268 268 GLU GLU A . n 
A 1 247 ASP 247 269 269 ASP ASP A . n 
A 1 248 LEU 248 270 270 LEU LEU A . n 
A 1 249 ILE 249 271 271 ILE ILE A . n 
A 1 250 GLY 250 272 272 GLY GLY A . n 
A 1 251 LYS 251 273 273 LYS LYS A . n 
A 1 252 PRO 252 274 274 PRO PRO A . n 
A 1 253 GLY 253 275 275 GLY GLY A . n 
A 1 254 GLY 254 276 276 GLY GLY A . n 
A 1 255 VAL 255 277 277 VAL VAL A . n 
A 1 256 SER 256 278 278 SER SER A . n 
A 1 257 LEU 257 279 279 LEU LEU A . n 
A 1 258 SER 258 280 280 SER SER A . n 
A 1 259 LYS 259 281 281 LYS LYS A . n 
A 1 260 ILE 260 282 282 ILE ILE A . n 
A 1 261 GLU 261 283 283 GLU GLU A . n 
A 1 262 ARG 262 284 284 ARG ARG A . n 
A 1 263 SER 263 285 285 SER SER A . n 
A 1 264 THR 264 286 286 THR THR A . n 
A 1 265 ASP 265 287 287 ASP ASP A . n 
A 1 266 GLN 266 288 288 GLN GLN A . n 
A 1 267 VAL 267 289 289 VAL VAL A . n 
A 1 268 ILE 268 290 290 ILE ILE A . n 
A 1 269 LYS 269 291 291 LYS LYS A . n 
A 1 270 PRO 270 292 292 PRO PRO A . n 
A 1 271 VAL 271 293 293 VAL VAL A . n 
A 1 272 ASN 272 294 294 ASN ASN A . n 
A 1 273 LEU 273 295 295 LEU LEU A . n 
A 1 274 GLU 274 296 296 GLU GLU A . n 
A 1 275 ALA 275 297 297 ALA ALA A . n 
A 1 276 LEU 276 298 298 LEU LEU A . n 
A 1 277 SER 277 299 299 SER SER A . n 
A 1 278 LYS 278 300 300 LYS LYS A . n 
A 1 279 TRP 279 301 301 TRP TRP A . n 
A 1 280 THR 280 302 302 THR THR A . n 
A 1 281 GLY 281 303 303 GLY GLY A . n 
A 1 282 HIS 282 304 304 HIS HIS A . n 
A 1 283 ILE 283 305 305 ILE ILE A . n 
A 1 284 PRO 284 306 306 PRO PRO A . n 
A 1 285 GLY 285 307 307 GLY GLY A . n 
A 1 286 ASP 286 308 308 ASP ASP A . n 
A 1 287 VAL 287 309 309 VAL VAL A . n 
A 1 288 VAL 288 310 310 VAL VAL A . n 
A 1 289 ARG 289 311 311 ARG ARG A . n 
A 1 290 ASP 290 312 312 ASP ASP A . n 
A 1 291 MET 291 313 313 MET MET A . n 
A 1 292 ALA 292 314 314 ALA ALA A . n 
A 1 293 GLN 293 315 315 GLN GLN A . n 
A 1 294 ILE 294 316 316 ILE ILE A . n 
A 1 295 ALA 295 317 317 ALA ALA A . n 
A 1 296 PRO 296 318 318 PRO PRO A . n 
A 1 297 MET 297 319 319 MET MET A . n 
A 1 298 LEU 298 320 320 LEU LEU A . n 
A 1 299 ALA 299 321 321 ALA ALA A . n 
A 1 300 GLN 300 322 322 GLN GLN A . n 
A 1 301 LEU 301 323 323 LEU LEU A . n 
A 1 302 GLY 302 324 324 GLY GLY A . n 
A 1 303 TYR 303 325 325 TYR TYR A . n 
A 1 304 ASP 304 326 326 ASP ASP A . n 
A 1 305 PRO 305 327 327 PRO PRO A . n 
A 1 306 TYR 306 328 328 TYR TYR A . n 
A 1 307 ALA 307 329 329 ALA ALA A . n 
A 1 308 ASN 308 330 330 ASN ASN A . n 
A 1 309 PRO 309 331 331 PRO PRO A . n 
A 1 310 PRO 310 332 332 PRO PRO A . n 
A 1 311 ASN 311 333 333 ASN ASN A . n 
A 1 312 TYR 312 334 334 TYR TYR A . n 
A 1 313 GLY 313 335 335 GLY GLY A . n 
A 1 314 ASN 314 336 336 ASN ASN A . n 
A 1 315 PRO 315 337 337 PRO PRO A . n 
A 1 316 ASP 316 338 338 ASP ASP A . n 
A 1 317 PRO 317 339 339 PRO PRO A . n 
A 1 318 PHE 318 340 340 PHE PHE A . n 
A 1 319 VAL 319 341 341 VAL VAL A . n 
A 1 320 ILE 320 342 342 ILE ILE A . n 
A 1 321 ASN 321 343 343 ASN ASN A . n 
A 1 322 ASN 322 344 344 ASN ASN A . n 
A 1 323 THR 323 345 345 THR THR A . n 
A 1 324 GLN 324 346 346 GLN GLN A . n 
A 1 325 ARG 325 347 347 ARG ARG A . n 
A 1 326 VAL 326 348 348 VAL VAL A . n 
A 1 327 LEU 327 349 349 LEU LEU A . n 
A 1 328 LYS 328 350 350 LYS LYS A . n 
A 1 329 GLY 329 351 351 GLY GLY A . n 
A 1 330 ASP 330 352 352 ASP ASP A . n 
A 1 331 TYR 331 353 ?   ?   ?   A . n 
A 1 332 LYS 332 354 ?   ?   ?   A . n 
A 1 333 THR 333 355 ?   ?   ?   A . n 
A 1 334 PRO 334 356 ?   ?   ?   A . n 
A 1 335 ALA 335 357 ?   ?   ?   A . n 
A 1 336 ASN 336 358 ?   ?   ?   A . n 
A 1 337 LEU 337 359 ?   ?   ?   A . n 
A 1 338 LYS 338 360 ?   ?   ?   A . n 
A 1 339 GLY 339 361 ?   ?   ?   A . n 
A 1 340 TYR 340 362 ?   ?   ?   A . n 
A 1 341 PHE 341 363 ?   ?   ?   A . n 
A 1 342 GLN 342 364 ?   ?   ?   A . n 
A 1 343 VAL 343 365 ?   ?   ?   A . n 
A 1 344 ASN 344 366 ?   ?   ?   A . n 
A 1 345 GLN 345 367 ?   ?   ?   A . n 
A 1 346 ASN 346 368 ?   ?   ?   A . n 
A 1 347 SER 347 369 ?   ?   ?   A . n 
A 1 348 THR 348 370 ?   ?   ?   A . n 
A 1 349 SER 349 371 ?   ?   ?   A . n 
A 1 350 SER 350 372 ?   ?   ?   A . n 
A 1 351 HIS 351 373 ?   ?   ?   A . n 
A 1 352 LEU 352 374 ?   ?   ?   A . n 
A 1 353 GLY 353 375 ?   ?   ?   A . n 
A 1 354 SER 354 376 ?   ?   ?   A . n 
A 1 355 SER 355 377 ?   ?   ?   A . n 
B 1 1   MET 1   23  ?   ?   ?   B . n 
B 1 2   GLY 2   24  ?   ?   ?   B . n 
B 1 3   SER 3   25  ?   ?   ?   B . n 
B 1 4   SER 4   26  ?   ?   ?   B . n 
B 1 5   HIS 5   27  ?   ?   ?   B . n 
B 1 6   HIS 6   28  ?   ?   ?   B . n 
B 1 7   HIS 7   29  ?   ?   ?   B . n 
B 1 8   HIS 8   30  ?   ?   ?   B . n 
B 1 9   HIS 9   31  ?   ?   ?   B . n 
B 1 10  HIS 10  32  ?   ?   ?   B . n 
B 1 11  SER 11  33  ?   ?   ?   B . n 
B 1 12  SER 12  34  ?   ?   ?   B . n 
B 1 13  GLY 13  35  ?   ?   ?   B . n 
B 1 14  VAL 14  36  ?   ?   ?   B . n 
B 1 15  PRO 15  37  ?   ?   ?   B . n 
B 1 16  ARG 16  38  ?   ?   ?   B . n 
B 1 17  GLY 17  39  ?   ?   ?   B . n 
B 1 18  SER 18  40  ?   ?   ?   B . n 
B 1 19  HIS 19  41  ?   ?   ?   B . n 
B 1 20  MET 20  42  ?   ?   ?   B . n 
B 1 21  GLY 21  43  ?   ?   ?   B . n 
B 1 22  ALA 22  44  ?   ?   ?   B . n 
B 1 23  MET 23  45  ?   ?   ?   B . n 
B 1 24  ARG 24  46  ?   ?   ?   B . n 
B 1 25  PRO 25  47  ?   ?   ?   B . n 
B 1 26  GLU 26  48  ?   ?   ?   B . n 
B 1 27  GLN 27  49  ?   ?   ?   B . n 
B 1 28  GLU 28  50  ?   ?   ?   B . n 
B 1 29  GLU 29  51  ?   ?   ?   B . n 
B 1 30  LEU 30  52  ?   ?   ?   B . n 
B 1 31  VAL 31  53  ?   ?   ?   B . n 
B 1 32  MET 32  54  ?   ?   ?   B . n 
B 1 33  VAL 33  55  ?   ?   ?   B . n 
B 1 34  GLY 34  56  ?   ?   ?   B . n 
B 1 35  THR 35  57  ?   ?   ?   B . n 
B 1 36  ASN 36  58  ?   ?   ?   B . n 
B 1 37  HIS 37  59  ?   ?   ?   B . n 
B 1 38  VAL 38  60  ?   ?   ?   B . n 
B 1 39  VAL 39  61  61  VAL VAL B . n 
B 1 40  TYR 40  62  62  TYR TYR B . n 
B 1 41  ARG 41  63  63  ARG ARG B . n 
B 1 42  TYR 42  64  64  TYR TYR B . n 
B 1 43  GLY 43  65  65  GLY GLY B . n 
B 1 44  LYS 44  66  66  LYS LYS B . n 
B 1 45  ALA 45  67  67  ALA ALA B . n 
B 1 46  MET 46  68  68  MET MET B . n 
B 1 47  PRO 47  69  69  PRO PRO B . n 
B 1 48  LEU 48  70  70  LEU LEU B . n 
B 1 49  ILE 49  71  71  ILE ILE B . n 
B 1 50  PHE 50  72  72  PHE PHE B . n 
B 1 51  VAL 51  73  73  VAL VAL B . n 
B 1 52  GLY 52  74  74  GLY GLY B . n 
B 1 53  GLY 53  75  75  GLY GLY B . n 
B 1 54  VAL 54  76  76  VAL VAL B . n 
B 1 55  PRO 55  77  77  PRO PRO B . n 
B 1 56  ARG 56  78  78  ARG ARG B . n 
B 1 57  SER 57  79  79  SER SER B . n 
B 1 58  GLY 58  80  80  GLY GLY B . n 
B 1 59  THR 59  81  81  THR THR B . n 
B 1 60  THR 60  82  82  THR THR B . n 
B 1 61  LEU 61  83  83  LEU LEU B . n 
B 1 62  MET 62  84  84  MET MET B . n 
B 1 63  ARG 63  85  85  ARG ARG B . n 
B 1 64  ALA 64  86  86  ALA ALA B . n 
B 1 65  MET 65  87  87  MET MET B . n 
B 1 66  LEU 66  88  88  LEU LEU B . n 
B 1 67  ASP 67  89  89  ASP ASP B . n 
B 1 68  ALA 68  90  90  ALA ALA B . n 
B 1 69  HIS 69  91  91  HIS HIS B . n 
B 1 70  PRO 70  92  92  PRO PRO B . n 
B 1 71  GLU 71  93  93  GLU GLU B . n 
B 1 72  VAL 72  94  94  VAL VAL B . n 
B 1 73  ARG 73  95  95  ARG ARG B . n 
B 1 74  CYS 74  96  96  CYS CYS B . n 
B 1 75  GLY 75  97  97  GLY GLY B . n 
B 1 76  GLU 76  98  98  GLU GLU B . n 
B 1 77  GLU 77  99  99  GLU GLU B . n 
B 1 78  THR 78  100 100 THR THR B . n 
B 1 79  ARG 79  101 101 ARG ARG B . n 
B 1 80  ILE 80  102 102 ILE ILE B . n 
B 1 81  ILE 81  103 103 ILE ILE B . n 
B 1 82  PRO 82  104 104 PRO PRO B . n 
B 1 83  ARG 83  105 105 ARG ARG B . n 
B 1 84  VAL 84  106 106 VAL VAL B . n 
B 1 85  LEU 85  107 107 LEU LEU B . n 
B 1 86  ALA 86  108 108 ALA ALA B . n 
B 1 87  MET 87  109 109 MET MET B . n 
B 1 88  ARG 88  110 110 ARG ARG B . n 
B 1 89  GLN 89  111 111 GLN GLN B . n 
B 1 90  ALA 90  112 112 ALA ALA B . n 
B 1 91  TRP 91  113 113 TRP TRP B . n 
B 1 92  SER 92  114 114 SER SER B . n 
B 1 93  LYS 93  115 115 LYS LYS B . n 
B 1 94  SER 94  116 116 SER SER B . n 
B 1 95  GLY 95  117 117 GLY GLY B . n 
B 1 96  ARG 96  118 118 ARG ARG B . n 
B 1 97  GLU 97  119 119 GLU GLU B . n 
B 1 98  LYS 98  120 120 LYS LYS B . n 
B 1 99  LEU 99  121 121 LEU LEU B . n 
B 1 100 ARG 100 122 122 ARG ARG B . n 
B 1 101 LEU 101 123 123 LEU LEU B . n 
B 1 102 ASP 102 124 124 ASP ASP B . n 
B 1 103 GLU 103 125 125 GLU GLU B . n 
B 1 104 ALA 104 126 126 ALA ALA B . n 
B 1 105 GLY 105 127 127 GLY GLY B . n 
B 1 106 VAL 106 128 128 VAL VAL B . n 
B 1 107 THR 107 129 129 THR THR B . n 
B 1 108 ASP 108 130 130 ASP ASP B . n 
B 1 109 GLU 109 131 131 GLU GLU B . n 
B 1 110 VAL 110 132 132 VAL VAL B . n 
B 1 111 LEU 111 133 133 LEU LEU B . n 
B 1 112 ASP 112 134 134 ASP ASP B . n 
B 1 113 ALA 113 135 135 ALA ALA B . n 
B 1 114 ALA 114 136 136 ALA ALA B . n 
B 1 115 MET 115 137 137 MET MET B . n 
B 1 116 GLN 116 138 138 GLN GLN B . n 
B 1 117 ALA 117 139 139 ALA ALA B . n 
B 1 118 PHE 118 140 140 PHE PHE B . n 
B 1 119 ILE 119 141 141 ILE ILE B . n 
B 1 120 LEU 120 142 142 LEU LEU B . n 
B 1 121 GLU 121 143 143 GLU GLU B . n 
B 1 122 VAL 122 144 144 VAL VAL B . n 
B 1 123 ILE 123 145 145 ILE ILE B . n 
B 1 124 ALA 124 146 146 ALA ALA B . n 
B 1 125 LYS 125 147 147 LYS LYS B . n 
B 1 126 HIS 126 148 148 HIS HIS B . n 
B 1 127 GLY 127 149 149 GLY GLY B . n 
B 1 128 GLU 128 150 150 GLU GLU B . n 
B 1 129 PRO 129 151 151 PRO PRO B . n 
B 1 130 ALA 130 152 152 ALA ALA B . n 
B 1 131 ARG 131 153 153 ARG ARG B . n 
B 1 132 VAL 132 154 154 VAL VAL B . n 
B 1 133 LEU 133 155 155 LEU LEU B . n 
B 1 134 CYS 134 156 156 CYS CYS B . n 
B 1 135 ASN 135 157 157 ASN ASN B . n 
B 1 136 LYS 136 158 158 LYS LYS B . n 
B 1 137 ASP 137 159 159 ASP ASP B . n 
B 1 138 PRO 138 160 160 PRO PRO B . n 
B 1 139 PHE 139 161 161 PHE PHE B . n 
B 1 140 THR 140 162 162 THR THR B . n 
B 1 141 LEU 141 163 163 LEU LEU B . n 
B 1 142 LYS 142 164 164 LYS LYS B . n 
B 1 143 SER 143 165 165 SER SER B . n 
B 1 144 SER 144 166 166 SER SER B . n 
B 1 145 VAL 145 167 167 VAL VAL B . n 
B 1 146 TYR 146 168 168 TYR TYR B . n 
B 1 147 LEU 147 169 169 LEU LEU B . n 
B 1 148 SER 148 170 170 SER SER B . n 
B 1 149 ARG 149 171 171 ARG ARG B . n 
B 1 150 LEU 150 172 172 LEU LEU B . n 
B 1 151 PHE 151 173 173 PHE PHE B . n 
B 1 152 PRO 152 174 174 PRO PRO B . n 
B 1 153 ASN 153 175 175 ASN ASN B . n 
B 1 154 SER 154 176 176 SER SER B . n 
B 1 155 LYS 155 177 177 LYS LYS B . n 
B 1 156 PHE 156 178 178 PHE PHE B . n 
B 1 157 LEU 157 179 179 LEU LEU B . n 
B 1 158 LEU 158 180 180 LEU LEU B . n 
B 1 159 MET 159 181 181 MET MET B . n 
B 1 160 VAL 160 182 182 VAL VAL B . n 
B 1 161 ARG 161 183 183 ARG ARG B . n 
B 1 162 ASP 162 184 184 ASP ASP B . n 
B 1 163 GLY 163 185 185 GLY GLY B . n 
B 1 164 ARG 164 186 186 ARG ARG B . n 
B 1 165 ALA 165 187 187 ALA ALA B . n 
B 1 166 SER 166 188 188 SER SER B . n 
B 1 167 VAL 167 189 189 VAL VAL B . n 
B 1 168 HIS 168 190 190 HIS HIS B . n 
B 1 169 SER 169 191 191 SER SER B . n 
B 1 170 MET 170 192 192 MET MET B . n 
B 1 171 ILE 171 193 193 ILE ILE B . n 
B 1 172 THR 172 194 194 THR THR B . n 
B 1 173 ARG 173 195 195 ARG ARG B . n 
B 1 174 LYS 174 196 ?   ?   ?   B . n 
B 1 175 VAL 175 197 ?   ?   ?   B . n 
B 1 176 THR 176 198 ?   ?   ?   B . n 
B 1 177 ILE 177 199 199 ILE ILE B . n 
B 1 178 ALA 178 200 200 ALA ALA B . n 
B 1 179 GLY 179 201 201 GLY GLY B . n 
B 1 180 PHE 180 202 202 PHE PHE B . n 
B 1 181 ASP 181 203 203 ASP ASP B . n 
B 1 182 LEU 182 204 204 LEU LEU B . n 
B 1 183 SER 183 205 205 SER SER B . n 
B 1 184 SER 184 206 206 SER SER B . n 
B 1 185 TYR 185 207 207 TYR TYR B . n 
B 1 186 ARG 186 208 208 ARG ARG B . n 
B 1 187 ASP 187 209 209 ASP ASP B . n 
B 1 188 CYS 188 210 210 CYS CYS B . n 
B 1 189 LEU 189 211 211 LEU LEU B . n 
B 1 190 THR 190 212 212 THR THR B . n 
B 1 191 LYS 191 213 213 LYS LYS B . n 
B 1 192 TRP 192 214 214 TRP TRP B . n 
B 1 193 ASN 193 215 215 ASN ASN B . n 
B 1 194 LYS 194 216 216 LYS LYS B . n 
B 1 195 ALA 195 217 217 ALA ALA B . n 
B 1 196 ILE 196 218 218 ILE ILE B . n 
B 1 197 GLU 197 219 219 GLU GLU B . n 
B 1 198 VAL 198 220 220 VAL VAL B . n 
B 1 199 MET 199 221 221 MET MET B . n 
B 1 200 TYR 200 222 222 TYR TYR B . n 
B 1 201 ALA 201 223 223 ALA ALA B . n 
B 1 202 GLN 202 224 224 GLN GLN B . n 
B 1 203 CYS 203 225 225 CYS CYS B . n 
B 1 204 MET 204 226 226 MET MET B . n 
B 1 205 GLU 205 227 227 GLU GLU B . n 
B 1 206 VAL 206 228 228 VAL VAL B . n 
B 1 207 GLY 207 229 229 GLY GLY B . n 
B 1 208 LYS 208 230 230 LYS LYS B . n 
B 1 209 GLU 209 231 231 GLU GLU B . n 
B 1 210 LYS 210 232 232 LYS LYS B . n 
B 1 211 CYS 211 233 233 CYS CYS B . n 
B 1 212 LEU 212 234 234 LEU LEU B . n 
B 1 213 PRO 213 235 235 PRO PRO B . n 
B 1 214 VAL 214 236 236 VAL VAL B . n 
B 1 215 TYR 215 237 237 TYR TYR B . n 
B 1 216 TYR 216 238 238 TYR TYR B . n 
B 1 217 GLU 217 239 239 GLU GLU B . n 
B 1 218 GLN 218 240 240 GLN GLN B . n 
B 1 219 LEU 219 241 241 LEU LEU B . n 
B 1 220 VAL 220 242 242 VAL VAL B . n 
B 1 221 LEU 221 243 243 LEU LEU B . n 
B 1 222 HIS 222 244 244 HIS HIS B . n 
B 1 223 PRO 223 245 245 PRO PRO B . n 
B 1 224 ARG 224 246 246 ARG ARG B . n 
B 1 225 ARG 225 247 247 ARG ARG B . n 
B 1 226 SER 226 248 248 SER SER B . n 
B 1 227 LEU 227 249 249 LEU LEU B . n 
B 1 228 LYS 228 250 250 LYS LYS B . n 
B 1 229 LEU 229 251 251 LEU LEU B . n 
B 1 230 ILE 230 252 252 ILE ILE B . n 
B 1 231 LEU 231 253 253 LEU LEU B . n 
B 1 232 ASP 232 254 254 ASP ASP B . n 
B 1 233 PHE 233 255 255 PHE PHE B . n 
B 1 234 LEU 234 256 256 LEU LEU B . n 
B 1 235 GLY 235 257 257 GLY GLY B . n 
B 1 236 ILE 236 258 258 ILE ILE B . n 
B 1 237 ALA 237 259 259 ALA ALA B . n 
B 1 238 TRP 238 260 260 TRP TRP B . n 
B 1 239 SER 239 261 261 SER SER B . n 
B 1 240 ASP 240 262 262 ASP ASP B . n 
B 1 241 ALA 241 263 263 ALA ALA B . n 
B 1 242 VAL 242 264 264 VAL VAL B . n 
B 1 243 LEU 243 265 265 LEU LEU B . n 
B 1 244 HIS 244 266 266 HIS HIS B . n 
B 1 245 HIS 245 267 267 HIS HIS B . n 
B 1 246 GLU 246 268 268 GLU GLU B . n 
B 1 247 ASP 247 269 269 ASP ASP B . n 
B 1 248 LEU 248 270 270 LEU LEU B . n 
B 1 249 ILE 249 271 271 ILE ILE B . n 
B 1 250 GLY 250 272 272 GLY GLY B . n 
B 1 251 LYS 251 273 273 LYS LYS B . n 
B 1 252 PRO 252 274 274 PRO PRO B . n 
B 1 253 GLY 253 275 275 GLY GLY B . n 
B 1 254 GLY 254 276 276 GLY GLY B . n 
B 1 255 VAL 255 277 277 VAL VAL B . n 
B 1 256 SER 256 278 278 SER SER B . n 
B 1 257 LEU 257 279 279 LEU LEU B . n 
B 1 258 SER 258 280 280 SER SER B . n 
B 1 259 LYS 259 281 281 LYS LYS B . n 
B 1 260 ILE 260 282 282 ILE ILE B . n 
B 1 261 GLU 261 283 283 GLU GLU B . n 
B 1 262 ARG 262 284 284 ARG ARG B . n 
B 1 263 SER 263 285 ?   ?   ?   B . n 
B 1 264 THR 264 286 ?   ?   ?   B . n 
B 1 265 ASP 265 287 ?   ?   ?   B . n 
B 1 266 GLN 266 288 ?   ?   ?   B . n 
B 1 267 VAL 267 289 289 VAL VAL B . n 
B 1 268 ILE 268 290 290 ILE ILE B . n 
B 1 269 LYS 269 291 291 LYS LYS B . n 
B 1 270 PRO 270 292 292 PRO PRO B . n 
B 1 271 VAL 271 293 293 VAL VAL B . n 
B 1 272 ASN 272 294 294 ASN ASN B . n 
B 1 273 LEU 273 295 295 LEU LEU B . n 
B 1 274 GLU 274 296 296 GLU GLU B . n 
B 1 275 ALA 275 297 297 ALA ALA B . n 
B 1 276 LEU 276 298 298 LEU LEU B . n 
B 1 277 SER 277 299 299 SER SER B . n 
B 1 278 LYS 278 300 300 LYS LYS B . n 
B 1 279 TRP 279 301 301 TRP TRP B . n 
B 1 280 THR 280 302 302 THR THR B . n 
B 1 281 GLY 281 303 303 GLY GLY B . n 
B 1 282 HIS 282 304 304 HIS HIS B . n 
B 1 283 ILE 283 305 305 ILE ILE B . n 
B 1 284 PRO 284 306 306 PRO PRO B . n 
B 1 285 GLY 285 307 307 GLY GLY B . n 
B 1 286 ASP 286 308 308 ASP ASP B . n 
B 1 287 VAL 287 309 309 VAL VAL B . n 
B 1 288 VAL 288 310 310 VAL VAL B . n 
B 1 289 ARG 289 311 311 ARG ARG B . n 
B 1 290 ASP 290 312 312 ASP ASP B . n 
B 1 291 MET 291 313 313 MET MET B . n 
B 1 292 ALA 292 314 314 ALA ALA B . n 
B 1 293 GLN 293 315 315 GLN GLN B . n 
B 1 294 ILE 294 316 316 ILE ILE B . n 
B 1 295 ALA 295 317 317 ALA ALA B . n 
B 1 296 PRO 296 318 318 PRO PRO B . n 
B 1 297 MET 297 319 319 MET MET B . n 
B 1 298 LEU 298 320 320 LEU LEU B . n 
B 1 299 ALA 299 321 321 ALA ALA B . n 
B 1 300 GLN 300 322 322 GLN GLN B . n 
B 1 301 LEU 301 323 323 LEU LEU B . n 
B 1 302 GLY 302 324 324 GLY GLY B . n 
B 1 303 TYR 303 325 325 TYR TYR B . n 
B 1 304 ASP 304 326 326 ASP ASP B . n 
B 1 305 PRO 305 327 327 PRO PRO B . n 
B 1 306 TYR 306 328 328 TYR TYR B . n 
B 1 307 ALA 307 329 329 ALA ALA B . n 
B 1 308 ASN 308 330 330 ASN ASN B . n 
B 1 309 PRO 309 331 331 PRO PRO B . n 
B 1 310 PRO 310 332 332 PRO PRO B . n 
B 1 311 ASN 311 333 333 ASN ASN B . n 
B 1 312 TYR 312 334 334 TYR TYR B . n 
B 1 313 GLY 313 335 335 GLY GLY B . n 
B 1 314 ASN 314 336 336 ASN ASN B . n 
B 1 315 PRO 315 337 337 PRO PRO B . n 
B 1 316 ASP 316 338 338 ASP ASP B . n 
B 1 317 PRO 317 339 339 PRO PRO B . n 
B 1 318 PHE 318 340 340 PHE PHE B . n 
B 1 319 VAL 319 341 341 VAL VAL B . n 
B 1 320 ILE 320 342 342 ILE ILE B . n 
B 1 321 ASN 321 343 343 ASN ASN B . n 
B 1 322 ASN 322 344 344 ASN ASN B . n 
B 1 323 THR 323 345 345 THR THR B . n 
B 1 324 GLN 324 346 346 GLN GLN B . n 
B 1 325 ARG 325 347 347 ARG ARG B . n 
B 1 326 VAL 326 348 348 VAL VAL B . n 
B 1 327 LEU 327 349 349 LEU LEU B . n 
B 1 328 LYS 328 350 350 LYS LYS B . n 
B 1 329 GLY 329 351 351 GLY GLY B . n 
B 1 330 ASP 330 352 352 ASP ASP B . n 
B 1 331 TYR 331 353 ?   ?   ?   B . n 
B 1 332 LYS 332 354 ?   ?   ?   B . n 
B 1 333 THR 333 355 ?   ?   ?   B . n 
B 1 334 PRO 334 356 ?   ?   ?   B . n 
B 1 335 ALA 335 357 ?   ?   ?   B . n 
B 1 336 ASN 336 358 ?   ?   ?   B . n 
B 1 337 LEU 337 359 ?   ?   ?   B . n 
B 1 338 LYS 338 360 ?   ?   ?   B . n 
B 1 339 GLY 339 361 ?   ?   ?   B . n 
B 1 340 TYR 340 362 ?   ?   ?   B . n 
B 1 341 PHE 341 363 ?   ?   ?   B . n 
B 1 342 GLN 342 364 ?   ?   ?   B . n 
B 1 343 VAL 343 365 ?   ?   ?   B . n 
B 1 344 ASN 344 366 ?   ?   ?   B . n 
B 1 345 GLN 345 367 ?   ?   ?   B . n 
B 1 346 ASN 346 368 ?   ?   ?   B . n 
B 1 347 SER 347 369 ?   ?   ?   B . n 
B 1 348 THR 348 370 ?   ?   ?   B . n 
B 1 349 SER 349 371 ?   ?   ?   B . n 
B 1 350 SER 350 372 ?   ?   ?   B . n 
B 1 351 HIS 351 373 ?   ?   ?   B . n 
B 1 352 LEU 352 374 ?   ?   ?   B . n 
B 1 353 GLY 353 375 ?   ?   ?   B . n 
B 1 354 SER 354 376 ?   ?   ?   B . n 
B 1 355 SER 355 377 ?   ?   ?   B . n 
C 1 1   MET 1   23  ?   ?   ?   C . n 
C 1 2   GLY 2   24  ?   ?   ?   C . n 
C 1 3   SER 3   25  ?   ?   ?   C . n 
C 1 4   SER 4   26  ?   ?   ?   C . n 
C 1 5   HIS 5   27  ?   ?   ?   C . n 
C 1 6   HIS 6   28  ?   ?   ?   C . n 
C 1 7   HIS 7   29  ?   ?   ?   C . n 
C 1 8   HIS 8   30  ?   ?   ?   C . n 
C 1 9   HIS 9   31  ?   ?   ?   C . n 
C 1 10  HIS 10  32  ?   ?   ?   C . n 
C 1 11  SER 11  33  ?   ?   ?   C . n 
C 1 12  SER 12  34  ?   ?   ?   C . n 
C 1 13  GLY 13  35  ?   ?   ?   C . n 
C 1 14  VAL 14  36  ?   ?   ?   C . n 
C 1 15  PRO 15  37  ?   ?   ?   C . n 
C 1 16  ARG 16  38  ?   ?   ?   C . n 
C 1 17  GLY 17  39  ?   ?   ?   C . n 
C 1 18  SER 18  40  ?   ?   ?   C . n 
C 1 19  HIS 19  41  ?   ?   ?   C . n 
C 1 20  MET 20  42  ?   ?   ?   C . n 
C 1 21  GLY 21  43  ?   ?   ?   C . n 
C 1 22  ALA 22  44  ?   ?   ?   C . n 
C 1 23  MET 23  45  ?   ?   ?   C . n 
C 1 24  ARG 24  46  ?   ?   ?   C . n 
C 1 25  PRO 25  47  ?   ?   ?   C . n 
C 1 26  GLU 26  48  ?   ?   ?   C . n 
C 1 27  GLN 27  49  ?   ?   ?   C . n 
C 1 28  GLU 28  50  ?   ?   ?   C . n 
C 1 29  GLU 29  51  ?   ?   ?   C . n 
C 1 30  LEU 30  52  ?   ?   ?   C . n 
C 1 31  VAL 31  53  ?   ?   ?   C . n 
C 1 32  MET 32  54  ?   ?   ?   C . n 
C 1 33  VAL 33  55  ?   ?   ?   C . n 
C 1 34  GLY 34  56  ?   ?   ?   C . n 
C 1 35  THR 35  57  ?   ?   ?   C . n 
C 1 36  ASN 36  58  ?   ?   ?   C . n 
C 1 37  HIS 37  59  ?   ?   ?   C . n 
C 1 38  VAL 38  60  ?   ?   ?   C . n 
C 1 39  VAL 39  61  61  VAL VAL C . n 
C 1 40  TYR 40  62  62  TYR TYR C . n 
C 1 41  ARG 41  63  63  ARG ARG C . n 
C 1 42  TYR 42  64  64  TYR TYR C . n 
C 1 43  GLY 43  65  65  GLY GLY C . n 
C 1 44  LYS 44  66  66  LYS LYS C . n 
C 1 45  ALA 45  67  67  ALA ALA C . n 
C 1 46  MET 46  68  68  MET MET C . n 
C 1 47  PRO 47  69  69  PRO PRO C . n 
C 1 48  LEU 48  70  70  LEU LEU C . n 
C 1 49  ILE 49  71  71  ILE ILE C . n 
C 1 50  PHE 50  72  72  PHE PHE C . n 
C 1 51  VAL 51  73  73  VAL VAL C . n 
C 1 52  GLY 52  74  74  GLY GLY C . n 
C 1 53  GLY 53  75  75  GLY GLY C . n 
C 1 54  VAL 54  76  76  VAL VAL C . n 
C 1 55  PRO 55  77  77  PRO PRO C . n 
C 1 56  ARG 56  78  78  ARG ARG C . n 
C 1 57  SER 57  79  79  SER SER C . n 
C 1 58  GLY 58  80  80  GLY GLY C . n 
C 1 59  THR 59  81  81  THR THR C . n 
C 1 60  THR 60  82  82  THR THR C . n 
C 1 61  LEU 61  83  83  LEU LEU C . n 
C 1 62  MET 62  84  84  MET MET C . n 
C 1 63  ARG 63  85  85  ARG ARG C . n 
C 1 64  ALA 64  86  86  ALA ALA C . n 
C 1 65  MET 65  87  87  MET MET C . n 
C 1 66  LEU 66  88  88  LEU LEU C . n 
C 1 67  ASP 67  89  89  ASP ASP C . n 
C 1 68  ALA 68  90  90  ALA ALA C . n 
C 1 69  HIS 69  91  91  HIS HIS C . n 
C 1 70  PRO 70  92  92  PRO PRO C . n 
C 1 71  GLU 71  93  93  GLU GLU C . n 
C 1 72  VAL 72  94  94  VAL VAL C . n 
C 1 73  ARG 73  95  95  ARG ARG C . n 
C 1 74  CYS 74  96  96  CYS CYS C . n 
C 1 75  GLY 75  97  97  GLY GLY C . n 
C 1 76  GLU 76  98  98  GLU GLU C . n 
C 1 77  GLU 77  99  99  GLU GLU C . n 
C 1 78  THR 78  100 100 THR THR C . n 
C 1 79  ARG 79  101 101 ARG ARG C . n 
C 1 80  ILE 80  102 102 ILE ILE C . n 
C 1 81  ILE 81  103 103 ILE ILE C . n 
C 1 82  PRO 82  104 104 PRO PRO C . n 
C 1 83  ARG 83  105 105 ARG ARG C . n 
C 1 84  VAL 84  106 106 VAL VAL C . n 
C 1 85  LEU 85  107 107 LEU LEU C . n 
C 1 86  ALA 86  108 108 ALA ALA C . n 
C 1 87  MET 87  109 109 MET MET C . n 
C 1 88  ARG 88  110 110 ARG ARG C . n 
C 1 89  GLN 89  111 111 GLN GLN C . n 
C 1 90  ALA 90  112 112 ALA ALA C . n 
C 1 91  TRP 91  113 113 TRP TRP C . n 
C 1 92  SER 92  114 114 SER SER C . n 
C 1 93  LYS 93  115 115 LYS LYS C . n 
C 1 94  SER 94  116 116 SER SER C . n 
C 1 95  GLY 95  117 117 GLY GLY C . n 
C 1 96  ARG 96  118 118 ARG ARG C . n 
C 1 97  GLU 97  119 119 GLU GLU C . n 
C 1 98  LYS 98  120 120 LYS LYS C . n 
C 1 99  LEU 99  121 121 LEU LEU C . n 
C 1 100 ARG 100 122 122 ARG ARG C . n 
C 1 101 LEU 101 123 123 LEU LEU C . n 
C 1 102 ASP 102 124 124 ASP ASP C . n 
C 1 103 GLU 103 125 125 GLU GLU C . n 
C 1 104 ALA 104 126 126 ALA ALA C . n 
C 1 105 GLY 105 127 127 GLY GLY C . n 
C 1 106 VAL 106 128 128 VAL VAL C . n 
C 1 107 THR 107 129 129 THR THR C . n 
C 1 108 ASP 108 130 130 ASP ASP C . n 
C 1 109 GLU 109 131 131 GLU GLU C . n 
C 1 110 VAL 110 132 132 VAL VAL C . n 
C 1 111 LEU 111 133 133 LEU LEU C . n 
C 1 112 ASP 112 134 134 ASP ASP C . n 
C 1 113 ALA 113 135 135 ALA ALA C . n 
C 1 114 ALA 114 136 136 ALA ALA C . n 
C 1 115 MET 115 137 137 MET MET C . n 
C 1 116 GLN 116 138 138 GLN GLN C . n 
C 1 117 ALA 117 139 139 ALA ALA C . n 
C 1 118 PHE 118 140 140 PHE PHE C . n 
C 1 119 ILE 119 141 141 ILE ILE C . n 
C 1 120 LEU 120 142 142 LEU LEU C . n 
C 1 121 GLU 121 143 143 GLU GLU C . n 
C 1 122 VAL 122 144 144 VAL VAL C . n 
C 1 123 ILE 123 145 145 ILE ILE C . n 
C 1 124 ALA 124 146 146 ALA ALA C . n 
C 1 125 LYS 125 147 147 LYS LYS C . n 
C 1 126 HIS 126 148 148 HIS HIS C . n 
C 1 127 GLY 127 149 149 GLY GLY C . n 
C 1 128 GLU 128 150 150 GLU GLU C . n 
C 1 129 PRO 129 151 151 PRO PRO C . n 
C 1 130 ALA 130 152 152 ALA ALA C . n 
C 1 131 ARG 131 153 153 ARG ARG C . n 
C 1 132 VAL 132 154 154 VAL VAL C . n 
C 1 133 LEU 133 155 155 LEU LEU C . n 
C 1 134 CYS 134 156 156 CYS CYS C . n 
C 1 135 ASN 135 157 157 ASN ASN C . n 
C 1 136 LYS 136 158 158 LYS LYS C . n 
C 1 137 ASP 137 159 159 ASP ASP C . n 
C 1 138 PRO 138 160 160 PRO PRO C . n 
C 1 139 PHE 139 161 161 PHE PHE C . n 
C 1 140 THR 140 162 162 THR THR C . n 
C 1 141 LEU 141 163 163 LEU LEU C . n 
C 1 142 LYS 142 164 164 LYS LYS C . n 
C 1 143 SER 143 165 165 SER SER C . n 
C 1 144 SER 144 166 166 SER SER C . n 
C 1 145 VAL 145 167 167 VAL VAL C . n 
C 1 146 TYR 146 168 168 TYR TYR C . n 
C 1 147 LEU 147 169 169 LEU LEU C . n 
C 1 148 SER 148 170 170 SER SER C . n 
C 1 149 ARG 149 171 171 ARG ARG C . n 
C 1 150 LEU 150 172 172 LEU LEU C . n 
C 1 151 PHE 151 173 173 PHE PHE C . n 
C 1 152 PRO 152 174 174 PRO PRO C . n 
C 1 153 ASN 153 175 175 ASN ASN C . n 
C 1 154 SER 154 176 176 SER SER C . n 
C 1 155 LYS 155 177 177 LYS LYS C . n 
C 1 156 PHE 156 178 178 PHE PHE C . n 
C 1 157 LEU 157 179 179 LEU LEU C . n 
C 1 158 LEU 158 180 180 LEU LEU C . n 
C 1 159 MET 159 181 181 MET MET C . n 
C 1 160 VAL 160 182 182 VAL VAL C . n 
C 1 161 ARG 161 183 183 ARG ARG C . n 
C 1 162 ASP 162 184 184 ASP ASP C . n 
C 1 163 GLY 163 185 185 GLY GLY C . n 
C 1 164 ARG 164 186 186 ARG ARG C . n 
C 1 165 ALA 165 187 187 ALA ALA C . n 
C 1 166 SER 166 188 188 SER SER C . n 
C 1 167 VAL 167 189 189 VAL VAL C . n 
C 1 168 HIS 168 190 190 HIS HIS C . n 
C 1 169 SER 169 191 191 SER SER C . n 
C 1 170 MET 170 192 192 MET MET C . n 
C 1 171 ILE 171 193 193 ILE ILE C . n 
C 1 172 THR 172 194 194 THR THR C . n 
C 1 173 ARG 173 195 195 ARG ARG C . n 
C 1 174 LYS 174 196 196 LYS LYS C . n 
C 1 175 VAL 175 197 197 VAL VAL C . n 
C 1 176 THR 176 198 198 THR THR C . n 
C 1 177 ILE 177 199 199 ILE ILE C . n 
C 1 178 ALA 178 200 ?   ?   ?   C . n 
C 1 179 GLY 179 201 ?   ?   ?   C . n 
C 1 180 PHE 180 202 ?   ?   ?   C . n 
C 1 181 ASP 181 203 ?   ?   ?   C . n 
C 1 182 LEU 182 204 ?   ?   ?   C . n 
C 1 183 SER 183 205 ?   ?   ?   C . n 
C 1 184 SER 184 206 206 SER SER C . n 
C 1 185 TYR 185 207 207 TYR TYR C . n 
C 1 186 ARG 186 208 208 ARG ARG C . n 
C 1 187 ASP 187 209 209 ASP ASP C . n 
C 1 188 CYS 188 210 210 CYS CYS C . n 
C 1 189 LEU 189 211 211 LEU LEU C . n 
C 1 190 THR 190 212 212 THR THR C . n 
C 1 191 LYS 191 213 213 LYS LYS C . n 
C 1 192 TRP 192 214 214 TRP TRP C . n 
C 1 193 ASN 193 215 215 ASN ASN C . n 
C 1 194 LYS 194 216 216 LYS LYS C . n 
C 1 195 ALA 195 217 217 ALA ALA C . n 
C 1 196 ILE 196 218 218 ILE ILE C . n 
C 1 197 GLU 197 219 219 GLU GLU C . n 
C 1 198 VAL 198 220 220 VAL VAL C . n 
C 1 199 MET 199 221 221 MET MET C . n 
C 1 200 TYR 200 222 222 TYR TYR C . n 
C 1 201 ALA 201 223 223 ALA ALA C . n 
C 1 202 GLN 202 224 224 GLN GLN C . n 
C 1 203 CYS 203 225 225 CYS CYS C . n 
C 1 204 MET 204 226 226 MET MET C . n 
C 1 205 GLU 205 227 227 GLU GLU C . n 
C 1 206 VAL 206 228 228 VAL VAL C . n 
C 1 207 GLY 207 229 229 GLY GLY C . n 
C 1 208 LYS 208 230 230 LYS LYS C . n 
C 1 209 GLU 209 231 231 GLU GLU C . n 
C 1 210 LYS 210 232 232 LYS LYS C . n 
C 1 211 CYS 211 233 233 CYS CYS C . n 
C 1 212 LEU 212 234 234 LEU LEU C . n 
C 1 213 PRO 213 235 235 PRO PRO C . n 
C 1 214 VAL 214 236 236 VAL VAL C . n 
C 1 215 TYR 215 237 237 TYR TYR C . n 
C 1 216 TYR 216 238 238 TYR TYR C . n 
C 1 217 GLU 217 239 239 GLU GLU C . n 
C 1 218 GLN 218 240 240 GLN GLN C . n 
C 1 219 LEU 219 241 241 LEU LEU C . n 
C 1 220 VAL 220 242 242 VAL VAL C . n 
C 1 221 LEU 221 243 243 LEU LEU C . n 
C 1 222 HIS 222 244 244 HIS HIS C . n 
C 1 223 PRO 223 245 245 PRO PRO C . n 
C 1 224 ARG 224 246 246 ARG ARG C . n 
C 1 225 ARG 225 247 247 ARG ARG C . n 
C 1 226 SER 226 248 248 SER SER C . n 
C 1 227 LEU 227 249 249 LEU LEU C . n 
C 1 228 LYS 228 250 250 LYS LYS C . n 
C 1 229 LEU 229 251 251 LEU LEU C . n 
C 1 230 ILE 230 252 252 ILE ILE C . n 
C 1 231 LEU 231 253 253 LEU LEU C . n 
C 1 232 ASP 232 254 254 ASP ASP C . n 
C 1 233 PHE 233 255 255 PHE PHE C . n 
C 1 234 LEU 234 256 256 LEU LEU C . n 
C 1 235 GLY 235 257 257 GLY GLY C . n 
C 1 236 ILE 236 258 258 ILE ILE C . n 
C 1 237 ALA 237 259 259 ALA ALA C . n 
C 1 238 TRP 238 260 260 TRP TRP C . n 
C 1 239 SER 239 261 261 SER SER C . n 
C 1 240 ASP 240 262 262 ASP ASP C . n 
C 1 241 ALA 241 263 263 ALA ALA C . n 
C 1 242 VAL 242 264 264 VAL VAL C . n 
C 1 243 LEU 243 265 265 LEU LEU C . n 
C 1 244 HIS 244 266 266 HIS HIS C . n 
C 1 245 HIS 245 267 267 HIS HIS C . n 
C 1 246 GLU 246 268 268 GLU GLU C . n 
C 1 247 ASP 247 269 269 ASP ASP C . n 
C 1 248 LEU 248 270 270 LEU LEU C . n 
C 1 249 ILE 249 271 271 ILE ILE C . n 
C 1 250 GLY 250 272 272 GLY GLY C . n 
C 1 251 LYS 251 273 273 LYS LYS C . n 
C 1 252 PRO 252 274 274 PRO PRO C . n 
C 1 253 GLY 253 275 275 GLY GLY C . n 
C 1 254 GLY 254 276 276 GLY GLY C . n 
C 1 255 VAL 255 277 277 VAL VAL C . n 
C 1 256 SER 256 278 278 SER SER C . n 
C 1 257 LEU 257 279 279 LEU LEU C . n 
C 1 258 SER 258 280 280 SER SER C . n 
C 1 259 LYS 259 281 281 LYS LYS C . n 
C 1 260 ILE 260 282 282 ILE ILE C . n 
C 1 261 GLU 261 283 283 GLU GLU C . n 
C 1 262 ARG 262 284 284 ARG ARG C . n 
C 1 263 SER 263 285 285 SER SER C . n 
C 1 264 THR 264 286 286 THR THR C . n 
C 1 265 ASP 265 287 287 ASP ASP C . n 
C 1 266 GLN 266 288 288 GLN GLN C . n 
C 1 267 VAL 267 289 289 VAL VAL C . n 
C 1 268 ILE 268 290 290 ILE ILE C . n 
C 1 269 LYS 269 291 291 LYS LYS C . n 
C 1 270 PRO 270 292 292 PRO PRO C . n 
C 1 271 VAL 271 293 293 VAL VAL C . n 
C 1 272 ASN 272 294 294 ASN ASN C . n 
C 1 273 LEU 273 295 295 LEU LEU C . n 
C 1 274 GLU 274 296 296 GLU GLU C . n 
C 1 275 ALA 275 297 297 ALA ALA C . n 
C 1 276 LEU 276 298 298 LEU LEU C . n 
C 1 277 SER 277 299 299 SER SER C . n 
C 1 278 LYS 278 300 300 LYS LYS C . n 
C 1 279 TRP 279 301 301 TRP TRP C . n 
C 1 280 THR 280 302 302 THR THR C . n 
C 1 281 GLY 281 303 303 GLY GLY C . n 
C 1 282 HIS 282 304 304 HIS HIS C . n 
C 1 283 ILE 283 305 305 ILE ILE C . n 
C 1 284 PRO 284 306 306 PRO PRO C . n 
C 1 285 GLY 285 307 307 GLY GLY C . n 
C 1 286 ASP 286 308 308 ASP ASP C . n 
C 1 287 VAL 287 309 309 VAL VAL C . n 
C 1 288 VAL 288 310 310 VAL VAL C . n 
C 1 289 ARG 289 311 311 ARG ARG C . n 
C 1 290 ASP 290 312 312 ASP ASP C . n 
C 1 291 MET 291 313 313 MET MET C . n 
C 1 292 ALA 292 314 314 ALA ALA C . n 
C 1 293 GLN 293 315 315 GLN GLN C . n 
C 1 294 ILE 294 316 316 ILE ILE C . n 
C 1 295 ALA 295 317 317 ALA ALA C . n 
C 1 296 PRO 296 318 318 PRO PRO C . n 
C 1 297 MET 297 319 319 MET MET C . n 
C 1 298 LEU 298 320 320 LEU LEU C . n 
C 1 299 ALA 299 321 321 ALA ALA C . n 
C 1 300 GLN 300 322 322 GLN GLN C . n 
C 1 301 LEU 301 323 323 LEU LEU C . n 
C 1 302 GLY 302 324 324 GLY GLY C . n 
C 1 303 TYR 303 325 325 TYR TYR C . n 
C 1 304 ASP 304 326 326 ASP ASP C . n 
C 1 305 PRO 305 327 327 PRO PRO C . n 
C 1 306 TYR 306 328 328 TYR TYR C . n 
C 1 307 ALA 307 329 329 ALA ALA C . n 
C 1 308 ASN 308 330 330 ASN ASN C . n 
C 1 309 PRO 309 331 331 PRO PRO C . n 
C 1 310 PRO 310 332 332 PRO PRO C . n 
C 1 311 ASN 311 333 333 ASN ASN C . n 
C 1 312 TYR 312 334 334 TYR TYR C . n 
C 1 313 GLY 313 335 335 GLY GLY C . n 
C 1 314 ASN 314 336 336 ASN ASN C . n 
C 1 315 PRO 315 337 337 PRO PRO C . n 
C 1 316 ASP 316 338 338 ASP ASP C . n 
C 1 317 PRO 317 339 339 PRO PRO C . n 
C 1 318 PHE 318 340 340 PHE PHE C . n 
C 1 319 VAL 319 341 341 VAL VAL C . n 
C 1 320 ILE 320 342 342 ILE ILE C . n 
C 1 321 ASN 321 343 343 ASN ASN C . n 
C 1 322 ASN 322 344 344 ASN ASN C . n 
C 1 323 THR 323 345 345 THR THR C . n 
C 1 324 GLN 324 346 346 GLN GLN C . n 
C 1 325 ARG 325 347 347 ARG ARG C . n 
C 1 326 VAL 326 348 348 VAL VAL C . n 
C 1 327 LEU 327 349 349 LEU LEU C . n 
C 1 328 LYS 328 350 350 LYS LYS C . n 
C 1 329 GLY 329 351 351 GLY GLY C . n 
C 1 330 ASP 330 352 352 ASP ASP C . n 
C 1 331 TYR 331 353 ?   ?   ?   C . n 
C 1 332 LYS 332 354 ?   ?   ?   C . n 
C 1 333 THR 333 355 ?   ?   ?   C . n 
C 1 334 PRO 334 356 ?   ?   ?   C . n 
C 1 335 ALA 335 357 ?   ?   ?   C . n 
C 1 336 ASN 336 358 ?   ?   ?   C . n 
C 1 337 LEU 337 359 ?   ?   ?   C . n 
C 1 338 LYS 338 360 ?   ?   ?   C . n 
C 1 339 GLY 339 361 ?   ?   ?   C . n 
C 1 340 TYR 340 362 ?   ?   ?   C . n 
C 1 341 PHE 341 363 ?   ?   ?   C . n 
C 1 342 GLN 342 364 ?   ?   ?   C . n 
C 1 343 VAL 343 365 ?   ?   ?   C . n 
C 1 344 ASN 344 366 ?   ?   ?   C . n 
C 1 345 GLN 345 367 ?   ?   ?   C . n 
C 1 346 ASN 346 368 ?   ?   ?   C . n 
C 1 347 SER 347 369 ?   ?   ?   C . n 
C 1 348 THR 348 370 ?   ?   ?   C . n 
C 1 349 SER 349 371 ?   ?   ?   C . n 
C 1 350 SER 350 372 ?   ?   ?   C . n 
C 1 351 HIS 351 373 ?   ?   ?   C . n 
C 1 352 LEU 352 374 ?   ?   ?   C . n 
C 1 353 GLY 353 375 ?   ?   ?   C . n 
C 1 354 SER 354 376 ?   ?   ?   C . n 
C 1 355 SER 355 377 ?   ?   ?   C . n 
D 1 1   MET 1   23  ?   ?   ?   D . n 
D 1 2   GLY 2   24  ?   ?   ?   D . n 
D 1 3   SER 3   25  ?   ?   ?   D . n 
D 1 4   SER 4   26  ?   ?   ?   D . n 
D 1 5   HIS 5   27  ?   ?   ?   D . n 
D 1 6   HIS 6   28  ?   ?   ?   D . n 
D 1 7   HIS 7   29  ?   ?   ?   D . n 
D 1 8   HIS 8   30  ?   ?   ?   D . n 
D 1 9   HIS 9   31  ?   ?   ?   D . n 
D 1 10  HIS 10  32  ?   ?   ?   D . n 
D 1 11  SER 11  33  ?   ?   ?   D . n 
D 1 12  SER 12  34  ?   ?   ?   D . n 
D 1 13  GLY 13  35  ?   ?   ?   D . n 
D 1 14  VAL 14  36  ?   ?   ?   D . n 
D 1 15  PRO 15  37  ?   ?   ?   D . n 
D 1 16  ARG 16  38  ?   ?   ?   D . n 
D 1 17  GLY 17  39  ?   ?   ?   D . n 
D 1 18  SER 18  40  ?   ?   ?   D . n 
D 1 19  HIS 19  41  ?   ?   ?   D . n 
D 1 20  MET 20  42  ?   ?   ?   D . n 
D 1 21  GLY 21  43  ?   ?   ?   D . n 
D 1 22  ALA 22  44  ?   ?   ?   D . n 
D 1 23  MET 23  45  ?   ?   ?   D . n 
D 1 24  ARG 24  46  ?   ?   ?   D . n 
D 1 25  PRO 25  47  ?   ?   ?   D . n 
D 1 26  GLU 26  48  ?   ?   ?   D . n 
D 1 27  GLN 27  49  ?   ?   ?   D . n 
D 1 28  GLU 28  50  ?   ?   ?   D . n 
D 1 29  GLU 29  51  ?   ?   ?   D . n 
D 1 30  LEU 30  52  ?   ?   ?   D . n 
D 1 31  VAL 31  53  ?   ?   ?   D . n 
D 1 32  MET 32  54  ?   ?   ?   D . n 
D 1 33  VAL 33  55  ?   ?   ?   D . n 
D 1 34  GLY 34  56  ?   ?   ?   D . n 
D 1 35  THR 35  57  ?   ?   ?   D . n 
D 1 36  ASN 36  58  ?   ?   ?   D . n 
D 1 37  HIS 37  59  ?   ?   ?   D . n 
D 1 38  VAL 38  60  ?   ?   ?   D . n 
D 1 39  VAL 39  61  61  VAL VAL D . n 
D 1 40  TYR 40  62  62  TYR TYR D . n 
D 1 41  ARG 41  63  63  ARG ARG D . n 
D 1 42  TYR 42  64  64  TYR TYR D . n 
D 1 43  GLY 43  65  65  GLY GLY D . n 
D 1 44  LYS 44  66  66  LYS LYS D . n 
D 1 45  ALA 45  67  67  ALA ALA D . n 
D 1 46  MET 46  68  68  MET MET D . n 
D 1 47  PRO 47  69  69  PRO PRO D . n 
D 1 48  LEU 48  70  70  LEU LEU D . n 
D 1 49  ILE 49  71  71  ILE ILE D . n 
D 1 50  PHE 50  72  72  PHE PHE D . n 
D 1 51  VAL 51  73  73  VAL VAL D . n 
D 1 52  GLY 52  74  74  GLY GLY D . n 
D 1 53  GLY 53  75  75  GLY GLY D . n 
D 1 54  VAL 54  76  76  VAL VAL D . n 
D 1 55  PRO 55  77  77  PRO PRO D . n 
D 1 56  ARG 56  78  78  ARG ARG D . n 
D 1 57  SER 57  79  79  SER SER D . n 
D 1 58  GLY 58  80  80  GLY GLY D . n 
D 1 59  THR 59  81  81  THR THR D . n 
D 1 60  THR 60  82  82  THR THR D . n 
D 1 61  LEU 61  83  83  LEU LEU D . n 
D 1 62  MET 62  84  84  MET MET D . n 
D 1 63  ARG 63  85  85  ARG ARG D . n 
D 1 64  ALA 64  86  86  ALA ALA D . n 
D 1 65  MET 65  87  87  MET MET D . n 
D 1 66  LEU 66  88  88  LEU LEU D . n 
D 1 67  ASP 67  89  89  ASP ASP D . n 
D 1 68  ALA 68  90  90  ALA ALA D . n 
D 1 69  HIS 69  91  91  HIS HIS D . n 
D 1 70  PRO 70  92  92  PRO PRO D . n 
D 1 71  GLU 71  93  93  GLU GLU D . n 
D 1 72  VAL 72  94  94  VAL VAL D . n 
D 1 73  ARG 73  95  95  ARG ARG D . n 
D 1 74  CYS 74  96  96  CYS CYS D . n 
D 1 75  GLY 75  97  97  GLY GLY D . n 
D 1 76  GLU 76  98  98  GLU GLU D . n 
D 1 77  GLU 77  99  99  GLU GLU D . n 
D 1 78  THR 78  100 100 THR THR D . n 
D 1 79  ARG 79  101 101 ARG ARG D . n 
D 1 80  ILE 80  102 102 ILE ILE D . n 
D 1 81  ILE 81  103 103 ILE ILE D . n 
D 1 82  PRO 82  104 104 PRO PRO D . n 
D 1 83  ARG 83  105 105 ARG ARG D . n 
D 1 84  VAL 84  106 106 VAL VAL D . n 
D 1 85  LEU 85  107 107 LEU LEU D . n 
D 1 86  ALA 86  108 108 ALA ALA D . n 
D 1 87  MET 87  109 109 MET MET D . n 
D 1 88  ARG 88  110 110 ARG ARG D . n 
D 1 89  GLN 89  111 111 GLN GLN D . n 
D 1 90  ALA 90  112 112 ALA ALA D . n 
D 1 91  TRP 91  113 113 TRP TRP D . n 
D 1 92  SER 92  114 114 SER SER D . n 
D 1 93  LYS 93  115 115 LYS LYS D . n 
D 1 94  SER 94  116 116 SER SER D . n 
D 1 95  GLY 95  117 117 GLY GLY D . n 
D 1 96  ARG 96  118 118 ARG ARG D . n 
D 1 97  GLU 97  119 119 GLU GLU D . n 
D 1 98  LYS 98  120 120 LYS LYS D . n 
D 1 99  LEU 99  121 121 LEU LEU D . n 
D 1 100 ARG 100 122 122 ARG ARG D . n 
D 1 101 LEU 101 123 123 LEU LEU D . n 
D 1 102 ASP 102 124 124 ASP ASP D . n 
D 1 103 GLU 103 125 125 GLU GLU D . n 
D 1 104 ALA 104 126 126 ALA ALA D . n 
D 1 105 GLY 105 127 127 GLY GLY D . n 
D 1 106 VAL 106 128 128 VAL VAL D . n 
D 1 107 THR 107 129 129 THR THR D . n 
D 1 108 ASP 108 130 130 ASP ASP D . n 
D 1 109 GLU 109 131 131 GLU GLU D . n 
D 1 110 VAL 110 132 132 VAL VAL D . n 
D 1 111 LEU 111 133 133 LEU LEU D . n 
D 1 112 ASP 112 134 134 ASP ASP D . n 
D 1 113 ALA 113 135 135 ALA ALA D . n 
D 1 114 ALA 114 136 136 ALA ALA D . n 
D 1 115 MET 115 137 137 MET MET D . n 
D 1 116 GLN 116 138 138 GLN GLN D . n 
D 1 117 ALA 117 139 139 ALA ALA D . n 
D 1 118 PHE 118 140 140 PHE PHE D . n 
D 1 119 ILE 119 141 141 ILE ILE D . n 
D 1 120 LEU 120 142 142 LEU LEU D . n 
D 1 121 GLU 121 143 143 GLU GLU D . n 
D 1 122 VAL 122 144 144 VAL VAL D . n 
D 1 123 ILE 123 145 145 ILE ILE D . n 
D 1 124 ALA 124 146 146 ALA ALA D . n 
D 1 125 LYS 125 147 147 LYS LYS D . n 
D 1 126 HIS 126 148 148 HIS HIS D . n 
D 1 127 GLY 127 149 149 GLY GLY D . n 
D 1 128 GLU 128 150 150 GLU GLU D . n 
D 1 129 PRO 129 151 151 PRO PRO D . n 
D 1 130 ALA 130 152 152 ALA ALA D . n 
D 1 131 ARG 131 153 153 ARG ARG D . n 
D 1 132 VAL 132 154 154 VAL VAL D . n 
D 1 133 LEU 133 155 155 LEU LEU D . n 
D 1 134 CYS 134 156 156 CYS CYS D . n 
D 1 135 ASN 135 157 157 ASN ASN D . n 
D 1 136 LYS 136 158 158 LYS LYS D . n 
D 1 137 ASP 137 159 159 ASP ASP D . n 
D 1 138 PRO 138 160 160 PRO PRO D . n 
D 1 139 PHE 139 161 161 PHE PHE D . n 
D 1 140 THR 140 162 162 THR THR D . n 
D 1 141 LEU 141 163 163 LEU LEU D . n 
D 1 142 LYS 142 164 164 LYS LYS D . n 
D 1 143 SER 143 165 165 SER SER D . n 
D 1 144 SER 144 166 166 SER SER D . n 
D 1 145 VAL 145 167 167 VAL VAL D . n 
D 1 146 TYR 146 168 168 TYR TYR D . n 
D 1 147 LEU 147 169 169 LEU LEU D . n 
D 1 148 SER 148 170 170 SER SER D . n 
D 1 149 ARG 149 171 171 ARG ARG D . n 
D 1 150 LEU 150 172 172 LEU LEU D . n 
D 1 151 PHE 151 173 173 PHE PHE D . n 
D 1 152 PRO 152 174 174 PRO PRO D . n 
D 1 153 ASN 153 175 175 ASN ASN D . n 
D 1 154 SER 154 176 176 SER SER D . n 
D 1 155 LYS 155 177 177 LYS LYS D . n 
D 1 156 PHE 156 178 178 PHE PHE D . n 
D 1 157 LEU 157 179 179 LEU LEU D . n 
D 1 158 LEU 158 180 180 LEU LEU D . n 
D 1 159 MET 159 181 181 MET MET D . n 
D 1 160 VAL 160 182 182 VAL VAL D . n 
D 1 161 ARG 161 183 183 ARG ARG D . n 
D 1 162 ASP 162 184 184 ASP ASP D . n 
D 1 163 GLY 163 185 185 GLY GLY D . n 
D 1 164 ARG 164 186 186 ARG ARG D . n 
D 1 165 ALA 165 187 187 ALA ALA D . n 
D 1 166 SER 166 188 188 SER SER D . n 
D 1 167 VAL 167 189 189 VAL VAL D . n 
D 1 168 HIS 168 190 190 HIS HIS D . n 
D 1 169 SER 169 191 191 SER SER D . n 
D 1 170 MET 170 192 192 MET MET D . n 
D 1 171 ILE 171 193 193 ILE ILE D . n 
D 1 172 THR 172 194 194 THR THR D . n 
D 1 173 ARG 173 195 195 ARG ARG D . n 
D 1 174 LYS 174 196 196 LYS LYS D . n 
D 1 175 VAL 175 197 197 VAL VAL D . n 
D 1 176 THR 176 198 198 THR THR D . n 
D 1 177 ILE 177 199 199 ILE ILE D . n 
D 1 178 ALA 178 200 200 ALA ALA D . n 
D 1 179 GLY 179 201 201 GLY GLY D . n 
D 1 180 PHE 180 202 202 PHE PHE D . n 
D 1 181 ASP 181 203 203 ASP ASP D . n 
D 1 182 LEU 182 204 204 LEU LEU D . n 
D 1 183 SER 183 205 205 SER SER D . n 
D 1 184 SER 184 206 206 SER SER D . n 
D 1 185 TYR 185 207 207 TYR TYR D . n 
D 1 186 ARG 186 208 208 ARG ARG D . n 
D 1 187 ASP 187 209 209 ASP ASP D . n 
D 1 188 CYS 188 210 210 CYS CYS D . n 
D 1 189 LEU 189 211 211 LEU LEU D . n 
D 1 190 THR 190 212 212 THR THR D . n 
D 1 191 LYS 191 213 213 LYS LYS D . n 
D 1 192 TRP 192 214 214 TRP TRP D . n 
D 1 193 ASN 193 215 215 ASN ASN D . n 
D 1 194 LYS 194 216 216 LYS LYS D . n 
D 1 195 ALA 195 217 217 ALA ALA D . n 
D 1 196 ILE 196 218 218 ILE ILE D . n 
D 1 197 GLU 197 219 219 GLU GLU D . n 
D 1 198 VAL 198 220 220 VAL VAL D . n 
D 1 199 MET 199 221 221 MET MET D . n 
D 1 200 TYR 200 222 222 TYR TYR D . n 
D 1 201 ALA 201 223 223 ALA ALA D . n 
D 1 202 GLN 202 224 224 GLN GLN D . n 
D 1 203 CYS 203 225 225 CYS CYS D . n 
D 1 204 MET 204 226 226 MET MET D . n 
D 1 205 GLU 205 227 227 GLU GLU D . n 
D 1 206 VAL 206 228 228 VAL VAL D . n 
D 1 207 GLY 207 229 229 GLY GLY D . n 
D 1 208 LYS 208 230 230 LYS LYS D . n 
D 1 209 GLU 209 231 231 GLU GLU D . n 
D 1 210 LYS 210 232 232 LYS LYS D . n 
D 1 211 CYS 211 233 233 CYS CYS D . n 
D 1 212 LEU 212 234 234 LEU LEU D . n 
D 1 213 PRO 213 235 235 PRO PRO D . n 
D 1 214 VAL 214 236 236 VAL VAL D . n 
D 1 215 TYR 215 237 237 TYR TYR D . n 
D 1 216 TYR 216 238 238 TYR TYR D . n 
D 1 217 GLU 217 239 239 GLU GLU D . n 
D 1 218 GLN 218 240 240 GLN GLN D . n 
D 1 219 LEU 219 241 241 LEU LEU D . n 
D 1 220 VAL 220 242 242 VAL VAL D . n 
D 1 221 LEU 221 243 243 LEU LEU D . n 
D 1 222 HIS 222 244 244 HIS HIS D . n 
D 1 223 PRO 223 245 245 PRO PRO D . n 
D 1 224 ARG 224 246 246 ARG ARG D . n 
D 1 225 ARG 225 247 247 ARG ARG D . n 
D 1 226 SER 226 248 248 SER SER D . n 
D 1 227 LEU 227 249 249 LEU LEU D . n 
D 1 228 LYS 228 250 250 LYS LYS D . n 
D 1 229 LEU 229 251 251 LEU LEU D . n 
D 1 230 ILE 230 252 252 ILE ILE D . n 
D 1 231 LEU 231 253 253 LEU LEU D . n 
D 1 232 ASP 232 254 254 ASP ASP D . n 
D 1 233 PHE 233 255 255 PHE PHE D . n 
D 1 234 LEU 234 256 256 LEU LEU D . n 
D 1 235 GLY 235 257 257 GLY GLY D . n 
D 1 236 ILE 236 258 258 ILE ILE D . n 
D 1 237 ALA 237 259 259 ALA ALA D . n 
D 1 238 TRP 238 260 260 TRP TRP D . n 
D 1 239 SER 239 261 261 SER SER D . n 
D 1 240 ASP 240 262 262 ASP ASP D . n 
D 1 241 ALA 241 263 263 ALA ALA D . n 
D 1 242 VAL 242 264 264 VAL VAL D . n 
D 1 243 LEU 243 265 265 LEU LEU D . n 
D 1 244 HIS 244 266 266 HIS HIS D . n 
D 1 245 HIS 245 267 267 HIS HIS D . n 
D 1 246 GLU 246 268 268 GLU GLU D . n 
D 1 247 ASP 247 269 269 ASP ASP D . n 
D 1 248 LEU 248 270 270 LEU LEU D . n 
D 1 249 ILE 249 271 271 ILE ILE D . n 
D 1 250 GLY 250 272 272 GLY GLY D . n 
D 1 251 LYS 251 273 273 LYS LYS D . n 
D 1 252 PRO 252 274 274 PRO PRO D . n 
D 1 253 GLY 253 275 275 GLY GLY D . n 
D 1 254 GLY 254 276 276 GLY GLY D . n 
D 1 255 VAL 255 277 277 VAL VAL D . n 
D 1 256 SER 256 278 278 SER SER D . n 
D 1 257 LEU 257 279 279 LEU LEU D . n 
D 1 258 SER 258 280 280 SER SER D . n 
D 1 259 LYS 259 281 281 LYS LYS D . n 
D 1 260 ILE 260 282 282 ILE ILE D . n 
D 1 261 GLU 261 283 283 GLU GLU D . n 
D 1 262 ARG 262 284 284 ARG ARG D . n 
D 1 263 SER 263 285 285 SER SER D . n 
D 1 264 THR 264 286 286 THR THR D . n 
D 1 265 ASP 265 287 287 ASP ASP D . n 
D 1 266 GLN 266 288 288 GLN GLN D . n 
D 1 267 VAL 267 289 289 VAL VAL D . n 
D 1 268 ILE 268 290 290 ILE ILE D . n 
D 1 269 LYS 269 291 291 LYS LYS D . n 
D 1 270 PRO 270 292 292 PRO PRO D . n 
D 1 271 VAL 271 293 293 VAL VAL D . n 
D 1 272 ASN 272 294 294 ASN ASN D . n 
D 1 273 LEU 273 295 295 LEU LEU D . n 
D 1 274 GLU 274 296 296 GLU GLU D . n 
D 1 275 ALA 275 297 297 ALA ALA D . n 
D 1 276 LEU 276 298 298 LEU LEU D . n 
D 1 277 SER 277 299 299 SER SER D . n 
D 1 278 LYS 278 300 300 LYS LYS D . n 
D 1 279 TRP 279 301 301 TRP TRP D . n 
D 1 280 THR 280 302 302 THR THR D . n 
D 1 281 GLY 281 303 303 GLY GLY D . n 
D 1 282 HIS 282 304 304 HIS HIS D . n 
D 1 283 ILE 283 305 305 ILE ILE D . n 
D 1 284 PRO 284 306 306 PRO PRO D . n 
D 1 285 GLY 285 307 307 GLY GLY D . n 
D 1 286 ASP 286 308 308 ASP ASP D . n 
D 1 287 VAL 287 309 309 VAL VAL D . n 
D 1 288 VAL 288 310 310 VAL VAL D . n 
D 1 289 ARG 289 311 311 ARG ARG D . n 
D 1 290 ASP 290 312 312 ASP ASP D . n 
D 1 291 MET 291 313 313 MET MET D . n 
D 1 292 ALA 292 314 314 ALA ALA D . n 
D 1 293 GLN 293 315 315 GLN GLN D . n 
D 1 294 ILE 294 316 316 ILE ILE D . n 
D 1 295 ALA 295 317 317 ALA ALA D . n 
D 1 296 PRO 296 318 318 PRO PRO D . n 
D 1 297 MET 297 319 319 MET MET D . n 
D 1 298 LEU 298 320 320 LEU LEU D . n 
D 1 299 ALA 299 321 321 ALA ALA D . n 
D 1 300 GLN 300 322 322 GLN GLN D . n 
D 1 301 LEU 301 323 323 LEU LEU D . n 
D 1 302 GLY 302 324 324 GLY GLY D . n 
D 1 303 TYR 303 325 325 TYR TYR D . n 
D 1 304 ASP 304 326 326 ASP ASP D . n 
D 1 305 PRO 305 327 327 PRO PRO D . n 
D 1 306 TYR 306 328 328 TYR TYR D . n 
D 1 307 ALA 307 329 329 ALA ALA D . n 
D 1 308 ASN 308 330 330 ASN ASN D . n 
D 1 309 PRO 309 331 331 PRO PRO D . n 
D 1 310 PRO 310 332 332 PRO PRO D . n 
D 1 311 ASN 311 333 333 ASN ASN D . n 
D 1 312 TYR 312 334 334 TYR TYR D . n 
D 1 313 GLY 313 335 335 GLY GLY D . n 
D 1 314 ASN 314 336 336 ASN ASN D . n 
D 1 315 PRO 315 337 337 PRO PRO D . n 
D 1 316 ASP 316 338 338 ASP ASP D . n 
D 1 317 PRO 317 339 339 PRO PRO D . n 
D 1 318 PHE 318 340 340 PHE PHE D . n 
D 1 319 VAL 319 341 341 VAL VAL D . n 
D 1 320 ILE 320 342 342 ILE ILE D . n 
D 1 321 ASN 321 343 343 ASN ASN D . n 
D 1 322 ASN 322 344 344 ASN ASN D . n 
D 1 323 THR 323 345 345 THR THR D . n 
D 1 324 GLN 324 346 346 GLN GLN D . n 
D 1 325 ARG 325 347 347 ARG ARG D . n 
D 1 326 VAL 326 348 348 VAL VAL D . n 
D 1 327 LEU 327 349 349 LEU LEU D . n 
D 1 328 LYS 328 350 350 LYS LYS D . n 
D 1 329 GLY 329 351 351 GLY GLY D . n 
D 1 330 ASP 330 352 352 ASP ASP D . n 
D 1 331 TYR 331 353 ?   ?   ?   D . n 
D 1 332 LYS 332 354 ?   ?   ?   D . n 
D 1 333 THR 333 355 ?   ?   ?   D . n 
D 1 334 PRO 334 356 ?   ?   ?   D . n 
D 1 335 ALA 335 357 ?   ?   ?   D . n 
D 1 336 ASN 336 358 ?   ?   ?   D . n 
D 1 337 LEU 337 359 ?   ?   ?   D . n 
D 1 338 LYS 338 360 ?   ?   ?   D . n 
D 1 339 GLY 339 361 ?   ?   ?   D . n 
D 1 340 TYR 340 362 ?   ?   ?   D . n 
D 1 341 PHE 341 363 ?   ?   ?   D . n 
D 1 342 GLN 342 364 ?   ?   ?   D . n 
D 1 343 VAL 343 365 ?   ?   ?   D . n 
D 1 344 ASN 344 366 ?   ?   ?   D . n 
D 1 345 GLN 345 367 ?   ?   ?   D . n 
D 1 346 ASN 346 368 ?   ?   ?   D . n 
D 1 347 SER 347 369 ?   ?   ?   D . n 
D 1 348 THR 348 370 ?   ?   ?   D . n 
D 1 349 SER 349 371 ?   ?   ?   D . n 
D 1 350 SER 350 372 ?   ?   ?   D . n 
D 1 351 HIS 351 373 ?   ?   ?   D . n 
D 1 352 LEU 352 374 ?   ?   ?   D . n 
D 1 353 GLY 353 375 ?   ?   ?   D . n 
D 1 354 SER 354 376 ?   ?   ?   D . n 
D 1 355 SER 355 377 ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F 
2 1 C,D,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2450  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  24790 ? 
2 'ABSA (A^2)' 2690  ? 
2 MORE         -22   ? 
2 'SSA (A^2)'  25020 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-10-26 
2 'Structure model' 1 1 2013-03-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum  ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.5.0102 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A TYR 328 ? ? CD2 A TYR 328 ? ? 1.465 1.387 0.078  0.013 N 
2 1 CZ B ARG 247 ? A NH1 B ARG 247 ? A 1.233 1.326 -0.093 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 247 ? B CZ A ARG 247 ? B NH1 A ARG 247 ? B 127.20 120.30 6.90  0.50 N 
2 1 NE C ARG 63  ? ? CZ C ARG 63  ? ? NH2 C ARG 63  ? ? 116.91 120.30 -3.39 0.50 N 
3 1 NE D ARG 247 ? A CZ D ARG 247 ? A NH2 D ARG 247 ? A 115.86 120.30 -4.44 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 77  ? ? -46.10  157.31 
2  1 SER A 79  ? ? -99.62  39.30  
3  1 ARG A 101 ? ? 74.99   -34.75 
4  1 GLN A 138 ? ? -39.68  -70.31 
5  1 LEU A 163 ? ? -57.21  -8.02  
6  1 PRO A 174 ? ? -56.84  -2.81  
7  1 ALA A 200 ? ? -62.82  83.15  
8  1 HIS A 244 ? ? -118.04 63.76  
9  1 ASP A 287 ? ? -58.33  -5.01  
10 1 VAL A 293 ? ? -40.49  102.70 
11 1 LYS B 66  ? ? -22.06  -43.09 
12 1 ARG B 101 ? ? 80.28   -27.20 
13 1 GLN B 138 ? ? -44.29  -70.16 
14 1 PHE B 140 ? ? -57.83  -70.16 
15 1 VAL B 293 ? ? -47.40  98.34  
16 1 LYS C 66  ? ? -14.10  -57.62 
17 1 ARG C 101 ? ? 68.07   -37.38 
18 1 ARG C 118 ? ? -86.57  -74.10 
19 1 PHE C 140 ? ? -61.45  -71.68 
20 1 LEU C 163 ? ? -52.35  -4.22  
21 1 ASP C 254 ? ? -56.85  -71.89 
22 1 ASP C 287 ? ? -145.29 29.33  
23 1 VAL C 293 ? ? -42.48  104.99 
24 1 PRO D 77  ? ? -49.28  159.93 
25 1 SER D 79  ? ? -94.66  34.91  
26 1 ARG D 101 ? ? 71.96   -28.23 
27 1 PRO D 160 ? ? -27.13  -65.05 
28 1 LEU D 163 ? ? -58.25  -8.93  
29 1 ALA D 200 ? ? -41.66  80.82  
30 1 HIS D 244 ? ? -113.25 67.28  
31 1 SER D 248 ? ? -58.25  -73.89 
32 1 SER D 285 ? ? -110.55 58.60  
33 1 THR D 286 ? ? -104.29 -64.45 
34 1 ASP D 287 ? ? -57.95  -9.33  
35 1 VAL D 293 ? ? -46.07  105.89 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 23  ? A MET 1   
2   1 Y 1 A GLY 24  ? A GLY 2   
3   1 Y 1 A SER 25  ? A SER 3   
4   1 Y 1 A SER 26  ? A SER 4   
5   1 Y 1 A HIS 27  ? A HIS 5   
6   1 Y 1 A HIS 28  ? A HIS 6   
7   1 Y 1 A HIS 29  ? A HIS 7   
8   1 Y 1 A HIS 30  ? A HIS 8   
9   1 Y 1 A HIS 31  ? A HIS 9   
10  1 Y 1 A HIS 32  ? A HIS 10  
11  1 Y 1 A SER 33  ? A SER 11  
12  1 Y 1 A SER 34  ? A SER 12  
13  1 Y 1 A GLY 35  ? A GLY 13  
14  1 Y 1 A VAL 36  ? A VAL 14  
15  1 Y 1 A PRO 37  ? A PRO 15  
16  1 Y 1 A ARG 38  ? A ARG 16  
17  1 Y 1 A GLY 39  ? A GLY 17  
18  1 Y 1 A SER 40  ? A SER 18  
19  1 Y 1 A HIS 41  ? A HIS 19  
20  1 Y 1 A MET 42  ? A MET 20  
21  1 Y 1 A GLY 43  ? A GLY 21  
22  1 Y 1 A ALA 44  ? A ALA 22  
23  1 Y 1 A MET 45  ? A MET 23  
24  1 Y 1 A ARG 46  ? A ARG 24  
25  1 Y 1 A PRO 47  ? A PRO 25  
26  1 Y 1 A GLU 48  ? A GLU 26  
27  1 Y 1 A GLN 49  ? A GLN 27  
28  1 Y 1 A GLU 50  ? A GLU 28  
29  1 Y 1 A GLU 51  ? A GLU 29  
30  1 Y 1 A LEU 52  ? A LEU 30  
31  1 Y 1 A VAL 53  ? A VAL 31  
32  1 Y 1 A MET 54  ? A MET 32  
33  1 Y 1 A VAL 55  ? A VAL 33  
34  1 Y 1 A GLY 56  ? A GLY 34  
35  1 Y 1 A THR 57  ? A THR 35  
36  1 Y 1 A ASN 58  ? A ASN 36  
37  1 Y 1 A HIS 59  ? A HIS 37  
38  1 Y 1 A VAL 60  ? A VAL 38  
39  1 Y 1 A LYS 115 ? A LYS 93  
40  1 Y 1 A SER 116 ? A SER 94  
41  1 Y 1 A GLY 117 ? A GLY 95  
42  1 Y 1 A ARG 118 ? A ARG 96  
43  1 Y 1 A GLU 119 ? A GLU 97  
44  1 Y 1 A LYS 120 ? A LYS 98  
45  1 Y 1 A LEU 121 ? A LEU 99  
46  1 Y 1 A ARG 122 ? A ARG 100 
47  1 Y 1 A LEU 123 ? A LEU 101 
48  1 Y 1 A ASP 124 ? A ASP 102 
49  1 Y 1 A TYR 353 ? A TYR 331 
50  1 Y 1 A LYS 354 ? A LYS 332 
51  1 Y 1 A THR 355 ? A THR 333 
52  1 Y 1 A PRO 356 ? A PRO 334 
53  1 Y 1 A ALA 357 ? A ALA 335 
54  1 Y 1 A ASN 358 ? A ASN 336 
55  1 Y 1 A LEU 359 ? A LEU 337 
56  1 Y 1 A LYS 360 ? A LYS 338 
57  1 Y 1 A GLY 361 ? A GLY 339 
58  1 Y 1 A TYR 362 ? A TYR 340 
59  1 Y 1 A PHE 363 ? A PHE 341 
60  1 Y 1 A GLN 364 ? A GLN 342 
61  1 Y 1 A VAL 365 ? A VAL 343 
62  1 Y 1 A ASN 366 ? A ASN 344 
63  1 Y 1 A GLN 367 ? A GLN 345 
64  1 Y 1 A ASN 368 ? A ASN 346 
65  1 Y 1 A SER 369 ? A SER 347 
66  1 Y 1 A THR 370 ? A THR 348 
67  1 Y 1 A SER 371 ? A SER 349 
68  1 Y 1 A SER 372 ? A SER 350 
69  1 Y 1 A HIS 373 ? A HIS 351 
70  1 Y 1 A LEU 374 ? A LEU 352 
71  1 Y 1 A GLY 375 ? A GLY 353 
72  1 Y 1 A SER 376 ? A SER 354 
73  1 Y 1 A SER 377 ? A SER 355 
74  1 Y 1 B MET 23  ? B MET 1   
75  1 Y 1 B GLY 24  ? B GLY 2   
76  1 Y 1 B SER 25  ? B SER 3   
77  1 Y 1 B SER 26  ? B SER 4   
78  1 Y 1 B HIS 27  ? B HIS 5   
79  1 Y 1 B HIS 28  ? B HIS 6   
80  1 Y 1 B HIS 29  ? B HIS 7   
81  1 Y 1 B HIS 30  ? B HIS 8   
82  1 Y 1 B HIS 31  ? B HIS 9   
83  1 Y 1 B HIS 32  ? B HIS 10  
84  1 Y 1 B SER 33  ? B SER 11  
85  1 Y 1 B SER 34  ? B SER 12  
86  1 Y 1 B GLY 35  ? B GLY 13  
87  1 Y 1 B VAL 36  ? B VAL 14  
88  1 Y 1 B PRO 37  ? B PRO 15  
89  1 Y 1 B ARG 38  ? B ARG 16  
90  1 Y 1 B GLY 39  ? B GLY 17  
91  1 Y 1 B SER 40  ? B SER 18  
92  1 Y 1 B HIS 41  ? B HIS 19  
93  1 Y 1 B MET 42  ? B MET 20  
94  1 Y 1 B GLY 43  ? B GLY 21  
95  1 Y 1 B ALA 44  ? B ALA 22  
96  1 Y 1 B MET 45  ? B MET 23  
97  1 Y 1 B ARG 46  ? B ARG 24  
98  1 Y 1 B PRO 47  ? B PRO 25  
99  1 Y 1 B GLU 48  ? B GLU 26  
100 1 Y 1 B GLN 49  ? B GLN 27  
101 1 Y 1 B GLU 50  ? B GLU 28  
102 1 Y 1 B GLU 51  ? B GLU 29  
103 1 Y 1 B LEU 52  ? B LEU 30  
104 1 Y 1 B VAL 53  ? B VAL 31  
105 1 Y 1 B MET 54  ? B MET 32  
106 1 Y 1 B VAL 55  ? B VAL 33  
107 1 Y 1 B GLY 56  ? B GLY 34  
108 1 Y 1 B THR 57  ? B THR 35  
109 1 Y 1 B ASN 58  ? B ASN 36  
110 1 Y 1 B HIS 59  ? B HIS 37  
111 1 Y 1 B VAL 60  ? B VAL 38  
112 1 Y 1 B LYS 196 ? B LYS 174 
113 1 Y 1 B VAL 197 ? B VAL 175 
114 1 Y 1 B THR 198 ? B THR 176 
115 1 Y 1 B SER 285 ? B SER 263 
116 1 Y 1 B THR 286 ? B THR 264 
117 1 Y 1 B ASP 287 ? B ASP 265 
118 1 Y 1 B GLN 288 ? B GLN 266 
119 1 Y 1 B TYR 353 ? B TYR 331 
120 1 Y 1 B LYS 354 ? B LYS 332 
121 1 Y 1 B THR 355 ? B THR 333 
122 1 Y 1 B PRO 356 ? B PRO 334 
123 1 Y 1 B ALA 357 ? B ALA 335 
124 1 Y 1 B ASN 358 ? B ASN 336 
125 1 Y 1 B LEU 359 ? B LEU 337 
126 1 Y 1 B LYS 360 ? B LYS 338 
127 1 Y 1 B GLY 361 ? B GLY 339 
128 1 Y 1 B TYR 362 ? B TYR 340 
129 1 Y 1 B PHE 363 ? B PHE 341 
130 1 Y 1 B GLN 364 ? B GLN 342 
131 1 Y 1 B VAL 365 ? B VAL 343 
132 1 Y 1 B ASN 366 ? B ASN 344 
133 1 Y 1 B GLN 367 ? B GLN 345 
134 1 Y 1 B ASN 368 ? B ASN 346 
135 1 Y 1 B SER 369 ? B SER 347 
136 1 Y 1 B THR 370 ? B THR 348 
137 1 Y 1 B SER 371 ? B SER 349 
138 1 Y 1 B SER 372 ? B SER 350 
139 1 Y 1 B HIS 373 ? B HIS 351 
140 1 Y 1 B LEU 374 ? B LEU 352 
141 1 Y 1 B GLY 375 ? B GLY 353 
142 1 Y 1 B SER 376 ? B SER 354 
143 1 Y 1 B SER 377 ? B SER 355 
144 1 Y 1 C MET 23  ? C MET 1   
145 1 Y 1 C GLY 24  ? C GLY 2   
146 1 Y 1 C SER 25  ? C SER 3   
147 1 Y 1 C SER 26  ? C SER 4   
148 1 Y 1 C HIS 27  ? C HIS 5   
149 1 Y 1 C HIS 28  ? C HIS 6   
150 1 Y 1 C HIS 29  ? C HIS 7   
151 1 Y 1 C HIS 30  ? C HIS 8   
152 1 Y 1 C HIS 31  ? C HIS 9   
153 1 Y 1 C HIS 32  ? C HIS 10  
154 1 Y 1 C SER 33  ? C SER 11  
155 1 Y 1 C SER 34  ? C SER 12  
156 1 Y 1 C GLY 35  ? C GLY 13  
157 1 Y 1 C VAL 36  ? C VAL 14  
158 1 Y 1 C PRO 37  ? C PRO 15  
159 1 Y 1 C ARG 38  ? C ARG 16  
160 1 Y 1 C GLY 39  ? C GLY 17  
161 1 Y 1 C SER 40  ? C SER 18  
162 1 Y 1 C HIS 41  ? C HIS 19  
163 1 Y 1 C MET 42  ? C MET 20  
164 1 Y 1 C GLY 43  ? C GLY 21  
165 1 Y 1 C ALA 44  ? C ALA 22  
166 1 Y 1 C MET 45  ? C MET 23  
167 1 Y 1 C ARG 46  ? C ARG 24  
168 1 Y 1 C PRO 47  ? C PRO 25  
169 1 Y 1 C GLU 48  ? C GLU 26  
170 1 Y 1 C GLN 49  ? C GLN 27  
171 1 Y 1 C GLU 50  ? C GLU 28  
172 1 Y 1 C GLU 51  ? C GLU 29  
173 1 Y 1 C LEU 52  ? C LEU 30  
174 1 Y 1 C VAL 53  ? C VAL 31  
175 1 Y 1 C MET 54  ? C MET 32  
176 1 Y 1 C VAL 55  ? C VAL 33  
177 1 Y 1 C GLY 56  ? C GLY 34  
178 1 Y 1 C THR 57  ? C THR 35  
179 1 Y 1 C ASN 58  ? C ASN 36  
180 1 Y 1 C HIS 59  ? C HIS 37  
181 1 Y 1 C VAL 60  ? C VAL 38  
182 1 Y 1 C ALA 200 ? C ALA 178 
183 1 Y 1 C GLY 201 ? C GLY 179 
184 1 Y 1 C PHE 202 ? C PHE 180 
185 1 Y 1 C ASP 203 ? C ASP 181 
186 1 Y 1 C LEU 204 ? C LEU 182 
187 1 Y 1 C SER 205 ? C SER 183 
188 1 Y 1 C TYR 353 ? C TYR 331 
189 1 Y 1 C LYS 354 ? C LYS 332 
190 1 Y 1 C THR 355 ? C THR 333 
191 1 Y 1 C PRO 356 ? C PRO 334 
192 1 Y 1 C ALA 357 ? C ALA 335 
193 1 Y 1 C ASN 358 ? C ASN 336 
194 1 Y 1 C LEU 359 ? C LEU 337 
195 1 Y 1 C LYS 360 ? C LYS 338 
196 1 Y 1 C GLY 361 ? C GLY 339 
197 1 Y 1 C TYR 362 ? C TYR 340 
198 1 Y 1 C PHE 363 ? C PHE 341 
199 1 Y 1 C GLN 364 ? C GLN 342 
200 1 Y 1 C VAL 365 ? C VAL 343 
201 1 Y 1 C ASN 366 ? C ASN 344 
202 1 Y 1 C GLN 367 ? C GLN 345 
203 1 Y 1 C ASN 368 ? C ASN 346 
204 1 Y 1 C SER 369 ? C SER 347 
205 1 Y 1 C THR 370 ? C THR 348 
206 1 Y 1 C SER 371 ? C SER 349 
207 1 Y 1 C SER 372 ? C SER 350 
208 1 Y 1 C HIS 373 ? C HIS 351 
209 1 Y 1 C LEU 374 ? C LEU 352 
210 1 Y 1 C GLY 375 ? C GLY 353 
211 1 Y 1 C SER 376 ? C SER 354 
212 1 Y 1 C SER 377 ? C SER 355 
213 1 Y 1 D MET 23  ? D MET 1   
214 1 Y 1 D GLY 24  ? D GLY 2   
215 1 Y 1 D SER 25  ? D SER 3   
216 1 Y 1 D SER 26  ? D SER 4   
217 1 Y 1 D HIS 27  ? D HIS 5   
218 1 Y 1 D HIS 28  ? D HIS 6   
219 1 Y 1 D HIS 29  ? D HIS 7   
220 1 Y 1 D HIS 30  ? D HIS 8   
221 1 Y 1 D HIS 31  ? D HIS 9   
222 1 Y 1 D HIS 32  ? D HIS 10  
223 1 Y 1 D SER 33  ? D SER 11  
224 1 Y 1 D SER 34  ? D SER 12  
225 1 Y 1 D GLY 35  ? D GLY 13  
226 1 Y 1 D VAL 36  ? D VAL 14  
227 1 Y 1 D PRO 37  ? D PRO 15  
228 1 Y 1 D ARG 38  ? D ARG 16  
229 1 Y 1 D GLY 39  ? D GLY 17  
230 1 Y 1 D SER 40  ? D SER 18  
231 1 Y 1 D HIS 41  ? D HIS 19  
232 1 Y 1 D MET 42  ? D MET 20  
233 1 Y 1 D GLY 43  ? D GLY 21  
234 1 Y 1 D ALA 44  ? D ALA 22  
235 1 Y 1 D MET 45  ? D MET 23  
236 1 Y 1 D ARG 46  ? D ARG 24  
237 1 Y 1 D PRO 47  ? D PRO 25  
238 1 Y 1 D GLU 48  ? D GLU 26  
239 1 Y 1 D GLN 49  ? D GLN 27  
240 1 Y 1 D GLU 50  ? D GLU 28  
241 1 Y 1 D GLU 51  ? D GLU 29  
242 1 Y 1 D LEU 52  ? D LEU 30  
243 1 Y 1 D VAL 53  ? D VAL 31  
244 1 Y 1 D MET 54  ? D MET 32  
245 1 Y 1 D VAL 55  ? D VAL 33  
246 1 Y 1 D GLY 56  ? D GLY 34  
247 1 Y 1 D THR 57  ? D THR 35  
248 1 Y 1 D ASN 58  ? D ASN 36  
249 1 Y 1 D HIS 59  ? D HIS 37  
250 1 Y 1 D VAL 60  ? D VAL 38  
251 1 Y 1 D TYR 353 ? D TYR 331 
252 1 Y 1 D LYS 354 ? D LYS 332 
253 1 Y 1 D THR 355 ? D THR 333 
254 1 Y 1 D PRO 356 ? D PRO 334 
255 1 Y 1 D ALA 357 ? D ALA 335 
256 1 Y 1 D ASN 358 ? D ASN 336 
257 1 Y 1 D LEU 359 ? D LEU 337 
258 1 Y 1 D LYS 360 ? D LYS 338 
259 1 Y 1 D GLY 361 ? D GLY 339 
260 1 Y 1 D TYR 362 ? D TYR 340 
261 1 Y 1 D PHE 363 ? D PHE 341 
262 1 Y 1 D GLN 364 ? D GLN 342 
263 1 Y 1 D VAL 365 ? D VAL 343 
264 1 Y 1 D ASN 366 ? D ASN 344 
265 1 Y 1 D GLN 367 ? D GLN 345 
266 1 Y 1 D ASN 368 ? D ASN 346 
267 1 Y 1 D SER 369 ? D SER 347 
268 1 Y 1 D THR 370 ? D THR 348 
269 1 Y 1 D SER 371 ? D SER 349 
270 1 Y 1 D SER 372 ? D SER 350 
271 1 Y 1 D HIS 373 ? D HIS 351 
272 1 Y 1 D LEU 374 ? D LEU 352 
273 1 Y 1 D GLY 375 ? D GLY 353 
274 1 Y 1 D SER 376 ? D SER 354 
275 1 Y 1 D SER 377 ? D SER 355 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        "ADENOSINE-3'-5'-DIPHOSPHATE" 
_pdbx_entity_nonpoly.comp_id     A3P 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 A3P 1 1 1 A3P A3P A . 
F 2 A3P 1 1 1 A3P A3P B . 
G 2 A3P 1 1 1 A3P A3P C . 
H 2 A3P 1 1 1 A3P A3P D . 
#