data_3ATA
# 
_entry.id   3ATA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ATA         
RCSB  RCSB029668   
WWPDB D_1000029668 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3agw . unspecified 
PDB 2e4f . unspecified 
PDB 3AT8 . unspecified 
PDB 3AT9 . unspecified 
PDB 3ATB . unspecified 
PDB 3ATD . unspecified 
PDB 3ATE . unspecified 
PDB 3ATF . unspecified 
# 
_pdbx_database_status.entry_id                        3ATA 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-28 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Inanobe, A.' 1 
'Kurachi, Y.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                41801 
_citation.page_last                 41811 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21982822 
_citation.pdbx_database_id_DOI      10.1074/jbc.M111.278531 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Inanobe, A.'  1 
primary 'Nakagawa, A.' 2 
primary 'Kurachi, Y.'  3 
# 
_cell.length_a           81.691 
_cell.length_b           81.691 
_cell.length_c           172.429 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3ATA 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.entry_id                         3ATA 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                97 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Potassium inwardly-rectifying channel, subfamily J, member 6' 23748.988 1 ? ? 'RESIDUES 53-74, 200-381' 
;CYTOPLASMIC N- AND C-TERMINI (RESIDUES 53-74 AND 200-381, RESPECTIVELY) OF G-PROTEIN-GATED INWARD RECTIFIER POTASSIUM CHANNEL KIR3.2 ARE CONCATENATED DIRECTLY.
;
2 non-polymer syn 'BARIUM ION'                                                   137.327   1 ? ? ?                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'G protein-activated inward rectifier potassium channel 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ARG n 
1 6   LYS n 
1 7   ILE n 
1 8   GLN n 
1 9   ARG n 
1 10  TYR n 
1 11  VAL n 
1 12  ARG n 
1 13  LYS n 
1 14  ASP n 
1 15  GLY n 
1 16  LYS n 
1 17  CYS n 
1 18  ASN n 
1 19  VAL n 
1 20  HIS n 
1 21  HIS n 
1 22  GLY n 
1 23  ASN n 
1 24  VAL n 
1 25  ARG n 
1 26  GLU n 
1 27  LYS n 
1 28  ARG n 
1 29  ALA n 
1 30  GLU n 
1 31  THR n 
1 32  LEU n 
1 33  VAL n 
1 34  PHE n 
1 35  SER n 
1 36  THR n 
1 37  HIS n 
1 38  ALA n 
1 39  VAL n 
1 40  ILE n 
1 41  SER n 
1 42  MET n 
1 43  ARG n 
1 44  ASP n 
1 45  GLY n 
1 46  LYS n 
1 47  LEU n 
1 48  CYS n 
1 49  LEU n 
1 50  MET n 
1 51  PHE n 
1 52  ARG n 
1 53  VAL n 
1 54  GLY n 
1 55  ASP n 
1 56  LEU n 
1 57  ARG n 
1 58  ASN n 
1 59  SER n 
1 60  HIS n 
1 61  ILE n 
1 62  VAL n 
1 63  GLU n 
1 64  ALA n 
1 65  SER n 
1 66  ILE n 
1 67  ARG n 
1 68  ALA n 
1 69  LYS n 
1 70  LEU n 
1 71  ILE n 
1 72  LYS n 
1 73  SER n 
1 74  LYS n 
1 75  GLN n 
1 76  THR n 
1 77  SER n 
1 78  GLU n 
1 79  GLY n 
1 80  GLU n 
1 81  PHE n 
1 82  ILE n 
1 83  PRO n 
1 84  LEU n 
1 85  ASN n 
1 86  GLN n 
1 87  THR n 
1 88  ASP n 
1 89  ILE n 
1 90  ASN n 
1 91  VAL n 
1 92  GLY n 
1 93  TYR n 
1 94  TYR n 
1 95  THR n 
1 96  GLY n 
1 97  ASP n 
1 98  ASP n 
1 99  ARG n 
1 100 LEU n 
1 101 PHE n 
1 102 LEU n 
1 103 VAL n 
1 104 SER n 
1 105 PRO n 
1 106 LEU n 
1 107 ILE n 
1 108 ILE n 
1 109 SER n 
1 110 HIS n 
1 111 GLU n 
1 112 ILE n 
1 113 ASN n 
1 114 GLN n 
1 115 GLN n 
1 116 SER n 
1 117 PRO n 
1 118 PHE n 
1 119 TRP n 
1 120 GLU n 
1 121 ILE n 
1 122 SER n 
1 123 LYS n 
1 124 ALA n 
1 125 GLN n 
1 126 LEU n 
1 127 PRO n 
1 128 LYS n 
1 129 GLU n 
1 130 GLU n 
1 131 LEU n 
1 132 GLU n 
1 133 ILE n 
1 134 VAL n 
1 135 VAL n 
1 136 ILE n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 MET n 
1 141 VAL n 
1 142 GLU n 
1 143 ALA n 
1 144 THR n 
1 145 GLY n 
1 146 MET n 
1 147 THR n 
1 148 CYS n 
1 149 GLN n 
1 150 ALA n 
1 151 ARG n 
1 152 SER n 
1 153 SER n 
1 154 TYR n 
1 155 ILE n 
1 156 THR n 
1 157 SER n 
1 158 GLU n 
1 159 ILE n 
1 160 LEU n 
1 161 TRP n 
1 162 GLY n 
1 163 TYR n 
1 164 ARG n 
1 165 PHE n 
1 166 THR n 
1 167 PRO n 
1 168 VAL n 
1 169 LEU n 
1 170 THR n 
1 171 LEU n 
1 172 GLU n 
1 173 ASP n 
1 174 GLY n 
1 175 PHE n 
1 176 TYR n 
1 177 GLU n 
1 178 VAL n 
1 179 ASP n 
1 180 TYR n 
1 181 ASN n 
1 182 SER n 
1 183 PHE n 
1 184 HIS n 
1 185 GLU n 
1 186 THR n 
1 187 TYR n 
1 188 GLU n 
1 189 THR n 
1 190 SER n 
1 191 THR n 
1 192 PRO n 
1 193 SER n 
1 194 LEU n 
1 195 SER n 
1 196 ALA n 
1 197 LYS n 
1 198 GLU n 
1 199 LEU n 
1 200 ALA n 
1 201 GLU n 
1 202 LEU n 
1 203 ALA n 
1 204 ASN n 
1 205 ARG n 
1 206 ALA n 
1 207 GLU n 
1 208 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 5  26  mouse ? ? ? Balb/c ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'ROSSETA2 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
1 2 sample ? 27 208 mouse ? ? ? Balb/c ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'ROSSETA2 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q0VB45_MOUSE 
_struct_ref.pdbx_db_accession          Q0VB45 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RKIQRYVRKDGKCNVHHGNVRE 
_struct_ref.pdbx_align_begin           53 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ATA A 5  ? 26  ? Q0VB45 53  ? 74  ? 53  74  
2 1 3ATA A 27 ? 208 ? Q0VB45 200 ? 381 ? 200 381 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ATA GLY A 1 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 49 1 
1 3ATA SER A 2 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 50 2 
1 3ATA HIS A 3 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 51 3 
1 3ATA MET A 4 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 52 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BA  non-polymer         . 'BARIUM ION'    ? 'Ba 2'           137.327 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3ATA 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.03 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   59.38 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'hanging drop' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    'Ethanol, pH 8.0, hanging drop, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2010-06-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'double crystal' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.6000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44XU' 
_diffrn_source.pdbx_wavelength_list        1.6000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL44XU 
# 
_reflns.entry_id                     3ATA 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            3.49 
_reflns.d_resolution_low             50.00 
_reflns.number_all                   104396 
_reflns.number_obs                   104393 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.163 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              26.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  3.50 
_reflns_shell.d_res_low                   3.63 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.percent_possible_all        99.7 
_reflns_shell.Rmerge_I_obs                0.564 
_reflns_shell.meanI_over_sigI_obs         5.25 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_redundancy             17.9 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3ATA 
_refine.ls_d_res_high                            3.4900 
_refine.ls_d_res_low                             47.99 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.5500 
_refine.ls_number_reflns_obs                     3998 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2295 
_refine.ls_R_factor_R_work                       0.2212 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2802 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 14.1000 
_refine.ls_number_reflns_R_free                  562 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               83.5237 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.0300 
_refine.aniso_B[2][2]                            -0.0300 
_refine.aniso_B[3][3]                            0.0600 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9130 
_refine.correlation_coeff_Fo_to_Fc_free          0.8660 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  0.6970 
_refine.overall_SU_ML                            0.4950 
_refine.overall_SU_B                             31.8270 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                124.640 
_refine.B_iso_min                                67.010 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.250 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1568 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1569 
_refine_hist.d_res_high                       3.4900 
_refine_hist.d_res_low                        47.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       1605 0.009  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    2172 1.117  1.956  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 196  5.790  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 76   33.818 23.947 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 287  17.139 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 11   20.311 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         246  0.072  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   1203 0.004  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            977  0.443  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1587 0.821  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            628  0.760  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           584  1.382  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       3.4860 
_refine_ls_shell.d_res_low                        3.5760 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               95.6100 
_refine_ls_shell.number_reflns_R_work             242 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2760 
_refine_ls_shell.R_factor_R_free                  0.3150 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             41 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                283 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3ATA 
_struct.title                     
'Crystal Structure of the Kir3.2 Cytoplasmic Domain (Na+-free crystal soaked in 10 mM barium chloride and 10 mM Spermine)' 
_struct.pdbx_descriptor           'Potassium inwardly-rectifying channel, subfamily J, member 6' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ATA 
_struct_keywords.text            
'Cytoplasmic assembly, beta-barrel, ion transport, G protein beta-gamma subunits, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 125 ? GLU A 129 ? GLN A 298 GLU A 302 5 ? 5  
HELX_P HELX_P2 2 TYR A 180 ? PHE A 183 ? TYR A 353 PHE A 356 5 ? 4  
HELX_P HELX_P3 3 SER A 195 ? ASN A 204 ? SER A 368 ASN A 377 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 106 ? GLU A 111 ? LEU A 279 GLU A 284 
A 2 LYS A 46  ? VAL A 53  ? LYS A 219 VAL A 226 
A 3 ALA A 38  ? ARG A 43  ? ALA A 211 ARG A 216 
A 4 ILE A 159 ? TRP A 161 ? ILE A 332 TRP A 334 
B 1 GLN A 86  ? ILE A 89  ? GLN A 259 ILE A 262 
B 2 ILE A 61  ? ILE A 71  ? ILE A 234 ILE A 244 
B 3 GLU A 132 ? VAL A 141 ? GLU A 305 VAL A 314 
B 4 THR A 147 ? ILE A 155 ? THR A 320 ILE A 328 
C 1 LYS A 74  ? GLN A 75  ? LYS A 247 GLN A 248 
C 2 PHE A 81  ? ILE A 82  ? PHE A 254 ILE A 255 
D 1 TYR A 163 ? PHE A 165 ? TYR A 336 PHE A 338 
D 2 THR A 186 ? GLU A 188 ? THR A 359 GLU A 361 
E 1 LEU A 169 ? GLU A 172 ? LEU A 342 GLU A 345 
E 2 PHE A 175 ? VAL A 178 ? PHE A 348 VAL A 351 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 110 ? O HIS A 283 N LEU A 49  ? N LEU A 222 
A 2 3 O MET A 50  ? O MET A 223 N VAL A 39  ? N VAL A 212 
A 3 4 N ALA A 38  ? N ALA A 211 O LEU A 160 ? O LEU A 333 
B 1 2 O THR A 87  ? O THR A 260 N LEU A 70  ? N LEU A 243 
B 2 3 N ILE A 71  ? N ILE A 244 O GLU A 132 ? O GLU A 305 
B 3 4 N ILE A 133 ? N ILE A 306 O TYR A 154 ? O TYR A 327 
C 1 2 N LYS A 74  ? N LYS A 247 O ILE A 82  ? O ILE A 255 
D 1 2 N ARG A 164 ? N ARG A 337 O TYR A 187 ? O TYR A 360 
E 1 2 N THR A 170 ? N THR A 343 O GLU A 177 ? O GLU A 350 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'BINDING SITE FOR RESIDUE BA A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 GLU A 63  ? GLU A 236 . ? 4_455 ? 
2 AC1 8 GLU A 63  ? GLU A 236 . ? 3_565 ? 
3 AC1 8 GLU A 63  ? GLU A 236 . ? 1_555 ? 
4 AC1 8 GLU A 63  ? GLU A 236 . ? 2_465 ? 
5 AC1 8 MET A 140 ? MET A 313 . ? 3_565 ? 
6 AC1 8 MET A 140 ? MET A 313 . ? 1_555 ? 
7 AC1 8 MET A 140 ? MET A 313 . ? 4_455 ? 
8 AC1 8 MET A 140 ? MET A 313 . ? 2_465 ? 
# 
_atom_sites.entry_id                    3ATA 
_atom_sites.fract_transf_matrix[1][1]   0.012241 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012241 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005799 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
BA 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 7   ? -7.469  26.721 23.118 1.00 97.27  ? 55  ILE A N   1 
ATOM   2    C  CA  . ILE A 1 7   ? -8.892  27.167 22.972 1.00 97.18  ? 55  ILE A CA  1 
ATOM   3    C  C   . ILE A 1 7   ? -9.233  27.474 21.510 1.00 97.07  ? 55  ILE A C   1 
ATOM   4    O  O   . ILE A 1 7   ? -8.733  28.455 20.928 1.00 97.06  ? 55  ILE A O   1 
ATOM   5    C  CB  . ILE A 1 7   ? -9.214  28.409 23.878 1.00 97.29  ? 55  ILE A CB  1 
ATOM   6    C  CG1 . ILE A 1 7   ? -10.619 28.965 23.564 1.00 96.77  ? 55  ILE A CG1 1 
ATOM   7    C  CG2 . ILE A 1 7   ? -8.095  29.490 23.765 1.00 97.33  ? 55  ILE A CG2 1 
ATOM   8    C  CD1 . ILE A 1 7   ? -11.119 30.026 24.538 1.00 96.14  ? 55  ILE A CD1 1 
ATOM   9    N  N   . GLN A 1 8   ? -10.082 26.640 20.916 1.00 96.59  ? 56  GLN A N   1 
ATOM   10   C  CA  . GLN A 1 8   ? -10.515 26.899 19.550 1.00 96.38  ? 56  GLN A CA  1 
ATOM   11   C  C   . GLN A 1 8   ? -11.870 27.629 19.500 1.00 95.71  ? 56  GLN A C   1 
ATOM   12   O  O   . GLN A 1 8   ? -12.906 27.061 19.860 1.00 95.67  ? 56  GLN A O   1 
ATOM   13   C  CB  . GLN A 1 8   ? -10.508 25.608 18.721 1.00 96.68  ? 56  GLN A CB  1 
ATOM   14   C  CG  . GLN A 1 8   ? -11.218 25.686 17.347 1.00 98.46  ? 56  GLN A CG  1 
ATOM   15   C  CD  . GLN A 1 8   ? -10.719 26.819 16.436 1.00 100.23 ? 56  GLN A CD  1 
ATOM   16   O  OE1 . GLN A 1 8   ? -11.519 27.575 15.871 1.00 100.64 ? 56  GLN A OE1 1 
ATOM   17   N  NE2 . GLN A 1 8   ? -9.398  26.931 16.289 1.00 101.44 ? 56  GLN A NE2 1 
ATOM   18   N  N   . ARG A 1 9   ? -11.833 28.890 19.059 1.00 94.79  ? 57  ARG A N   1 
ATOM   19   C  CA  . ARG A 1 9   ? -13.016 29.732 18.871 1.00 93.88  ? 57  ARG A CA  1 
ATOM   20   C  C   . ARG A 1 9   ? -14.235 29.014 18.293 1.00 93.48  ? 57  ARG A C   1 
ATOM   21   O  O   . ARG A 1 9   ? -14.108 28.166 17.416 1.00 93.52  ? 57  ARG A O   1 
ATOM   22   C  CB  . ARG A 1 9   ? -12.669 30.854 17.908 1.00 93.81  ? 57  ARG A CB  1 
ATOM   23   C  CG  . ARG A 1 9   ? -12.142 32.112 18.519 1.00 93.60  ? 57  ARG A CG  1 
ATOM   24   C  CD  . ARG A 1 9   ? -12.458 33.234 17.552 1.00 94.38  ? 57  ARG A CD  1 
ATOM   25   N  NE  . ARG A 1 9   ? -11.715 34.462 17.798 1.00 95.17  ? 57  ARG A NE  1 
ATOM   26   C  CZ  . ARG A 1 9   ? -12.098 35.418 18.638 1.00 95.61  ? 57  ARG A CZ  1 
ATOM   27   N  NH1 . ARG A 1 9   ? -13.217 35.299 19.336 1.00 96.07  ? 57  ARG A NH1 1 
ATOM   28   N  NH2 . ARG A 1 9   ? -11.355 36.499 18.784 1.00 95.51  ? 57  ARG A NH2 1 
ATOM   29   N  N   . TYR A 1 10  ? -15.420 29.388 18.760 1.00 92.94  ? 58  TYR A N   1 
ATOM   30   C  CA  . TYR A 1 10  ? -16.674 28.920 18.165 1.00 92.52  ? 58  TYR A CA  1 
ATOM   31   C  C   . TYR A 1 10  ? -17.097 29.854 17.029 1.00 92.14  ? 58  TYR A C   1 
ATOM   32   O  O   . TYR A 1 10  ? -17.520 29.401 15.962 1.00 92.22  ? 58  TYR A O   1 
ATOM   33   C  CB  . TYR A 1 10  ? -17.756 28.875 19.242 1.00 92.74  ? 58  TYR A CB  1 
ATOM   34   C  CG  . TYR A 1 10  ? -19.062 28.166 18.913 1.00 92.85  ? 58  TYR A CG  1 
ATOM   35   C  CD1 . TYR A 1 10  ? -19.083 26.925 18.276 1.00 92.81  ? 58  TYR A CD1 1 
ATOM   36   C  CD2 . TYR A 1 10  ? -20.278 28.716 19.314 1.00 93.29  ? 58  TYR A CD2 1 
ATOM   37   C  CE1 . TYR A 1 10  ? -20.284 26.273 18.013 1.00 93.06  ? 58  TYR A CE1 1 
ATOM   38   C  CE2 . TYR A 1 10  ? -21.479 28.072 19.064 1.00 93.87  ? 58  TYR A CE2 1 
ATOM   39   C  CZ  . TYR A 1 10  ? -21.479 26.853 18.410 1.00 93.80  ? 58  TYR A CZ  1 
ATOM   40   O  OH  . TYR A 1 10  ? -22.687 26.227 18.164 1.00 94.37  ? 58  TYR A OH  1 
ATOM   41   N  N   . VAL A 1 11  ? -16.989 31.158 17.266 1.00 91.52  ? 59  VAL A N   1 
ATOM   42   C  CA  . VAL A 1 11  ? -17.296 32.145 16.245 1.00 90.95  ? 59  VAL A CA  1 
ATOM   43   C  C   . VAL A 1 11  ? -16.076 33.013 16.037 1.00 90.87  ? 59  VAL A C   1 
ATOM   44   O  O   . VAL A 1 11  ? -15.471 33.463 17.002 1.00 90.91  ? 59  VAL A O   1 
ATOM   45   C  CB  . VAL A 1 11  ? -18.479 33.036 16.651 1.00 90.76  ? 59  VAL A CB  1 
ATOM   46   C  CG1 . VAL A 1 11  ? -18.873 33.941 15.504 1.00 90.33  ? 59  VAL A CG1 1 
ATOM   47   C  CG2 . VAL A 1 11  ? -19.663 32.191 17.071 1.00 90.69  ? 59  VAL A CG2 1 
ATOM   48   N  N   . ARG A 1 12  ? -15.717 33.245 14.779 1.00 90.74  ? 60  ARG A N   1 
ATOM   49   C  CA  . ARG A 1 12  ? -14.571 34.089 14.453 1.00 90.87  ? 60  ARG A CA  1 
ATOM   50   C  C   . ARG A 1 12  ? -14.910 35.577 14.514 1.00 90.71  ? 60  ARG A C   1 
ATOM   51   O  O   . ARG A 1 12  ? -16.080 35.948 14.533 1.00 90.47  ? 60  ARG A O   1 
ATOM   52   C  CB  . ARG A 1 12  ? -14.012 33.709 13.084 1.00 91.04  ? 60  ARG A CB  1 
ATOM   53   C  CG  . ARG A 1 12  ? -13.430 32.299 13.061 1.00 91.80  ? 60  ARG A CG  1 
ATOM   54   C  CD  . ARG A 1 12  ? -12.748 31.963 11.752 1.00 92.90  ? 60  ARG A CD  1 
ATOM   55   N  NE  . ARG A 1 12  ? -13.702 31.908 10.647 1.00 94.57  ? 60  ARG A NE  1 
ATOM   56   C  CZ  . ARG A 1 12  ? -13.468 31.322 9.476  1.00 95.82  ? 60  ARG A CZ  1 
ATOM   57   N  NH1 . ARG A 1 12  ? -12.305 30.722 9.242  1.00 96.96  ? 60  ARG A NH1 1 
ATOM   58   N  NH2 . ARG A 1 12  ? -14.402 31.329 8.534  1.00 96.12  ? 60  ARG A NH2 1 
ATOM   59   N  N   . LYS A 1 13  ? -13.883 36.424 14.539 1.00 90.79  ? 61  LYS A N   1 
ATOM   60   C  CA  . LYS A 1 13  ? -14.078 37.871 14.724 1.00 90.90  ? 61  LYS A CA  1 
ATOM   61   C  C   . LYS A 1 13  ? -15.101 38.487 13.781 1.00 90.84  ? 61  LYS A C   1 
ATOM   62   O  O   . LYS A 1 13  ? -15.812 39.408 14.167 1.00 90.89  ? 61  LYS A O   1 
ATOM   63   C  CB  . LYS A 1 13  ? -12.755 38.654 14.622 1.00 90.97  ? 61  LYS A CB  1 
ATOM   64   C  CG  . LYS A 1 13  ? -11.725 38.340 15.717 1.00 90.87  ? 61  LYS A CG  1 
ATOM   65   C  CD  . LYS A 1 13  ? -12.288 38.494 17.134 1.00 89.83  ? 61  LYS A CD  1 
ATOM   66   C  CE  . LYS A 1 13  ? -12.080 39.881 17.700 1.00 89.32  ? 61  LYS A CE  1 
ATOM   67   N  NZ  . LYS A 1 13  ? -12.513 39.926 19.116 1.00 88.53  ? 61  LYS A NZ  1 
ATOM   68   N  N   . ASP A 1 14  ? -15.168 37.977 12.554 1.00 90.91  ? 62  ASP A N   1 
ATOM   69   C  CA  . ASP A 1 14  ? -16.058 38.531 11.525 1.00 91.04  ? 62  ASP A CA  1 
ATOM   70   C  C   . ASP A 1 14  ? -17.473 37.961 11.528 1.00 90.87  ? 62  ASP A C   1 
ATOM   71   O  O   . ASP A 1 14  ? -18.228 38.186 10.588 1.00 90.73  ? 62  ASP A O   1 
ATOM   72   C  CB  . ASP A 1 14  ? -15.444 38.370 10.125 1.00 91.33  ? 62  ASP A CB  1 
ATOM   73   C  CG  . ASP A 1 14  ? -15.099 36.917 9.778  1.00 91.89  ? 62  ASP A CG  1 
ATOM   74   O  OD1 . ASP A 1 14  ? -15.318 36.002 10.606 1.00 92.82  ? 62  ASP A OD1 1 
ATOM   75   O  OD2 . ASP A 1 14  ? -14.589 36.693 8.661  1.00 92.26  ? 62  ASP A OD2 1 
ATOM   76   N  N   . GLY A 1 15  ? -17.819 37.209 12.566 1.00 90.84  ? 63  GLY A N   1 
ATOM   77   C  CA  . GLY A 1 15  ? -19.158 36.642 12.690 1.00 90.99  ? 63  GLY A CA  1 
ATOM   78   C  C   . GLY A 1 15  ? -19.357 35.266 12.081 1.00 91.15  ? 63  GLY A C   1 
ATOM   79   O  O   . GLY A 1 15  ? -20.404 34.650 12.265 1.00 91.01  ? 63  GLY A O   1 
ATOM   80   N  N   . LYS A 1 16  ? -18.360 34.781 11.349 1.00 91.53  ? 64  LYS A N   1 
ATOM   81   C  CA  . LYS A 1 16  ? -18.431 33.458 10.730 1.00 91.86  ? 64  LYS A CA  1 
ATOM   82   C  C   . LYS A 1 16  ? -18.128 32.392 11.773 1.00 92.10  ? 64  LYS A C   1 
ATOM   83   O  O   . LYS A 1 16  ? -17.104 32.467 12.463 1.00 92.19  ? 64  LYS A O   1 
ATOM   84   C  CB  . LYS A 1 16  ? -17.441 33.355 9.569  1.00 91.84  ? 64  LYS A CB  1 
ATOM   85   C  CG  . LYS A 1 16  ? -17.556 34.475 8.543  1.00 92.24  ? 64  LYS A CG  1 
ATOM   86   C  CD  . LYS A 1 16  ? -16.497 34.338 7.452  1.00 92.86  ? 64  LYS A CD  1 
ATOM   87   C  CE  . LYS A 1 16  ? -16.559 35.496 6.452  1.00 92.79  ? 64  LYS A CE  1 
ATOM   88   N  NZ  . LYS A 1 16  ? -17.843 35.532 5.691  1.00 92.28  ? 64  LYS A NZ  1 
ATOM   89   N  N   . CYS A 1 17  ? -19.020 31.409 11.892 1.00 92.41  ? 65  CYS A N   1 
ATOM   90   C  CA  . CYS A 1 17  ? -18.885 30.364 12.913 1.00 92.74  ? 65  CYS A CA  1 
ATOM   91   C  C   . CYS A 1 17  ? -17.979 29.258 12.404 1.00 93.21  ? 65  CYS A C   1 
ATOM   92   O  O   . CYS A 1 17  ? -17.834 29.079 11.199 1.00 93.33  ? 65  CYS A O   1 
ATOM   93   C  CB  . CYS A 1 17  ? -20.254 29.798 13.287 1.00 92.63  ? 65  CYS A CB  1 
ATOM   94   S  SG  . CYS A 1 17  ? -21.592 31.024 13.274 1.00 92.07  ? 65  CYS A SG  1 
ATOM   95   N  N   . ASN A 1 18  ? -17.360 28.519 13.314 1.00 93.91  ? 66  ASN A N   1 
ATOM   96   C  CA  . ASN A 1 18  ? -16.450 27.456 12.907 1.00 94.85  ? 66  ASN A CA  1 
ATOM   97   C  C   . ASN A 1 18  ? -17.061 26.071 13.057 1.00 95.68  ? 66  ASN A C   1 
ATOM   98   O  O   . ASN A 1 18  ? -16.468 25.180 13.669 1.00 95.65  ? 66  ASN A O   1 
ATOM   99   C  CB  . ASN A 1 18  ? -15.122 27.565 13.658 1.00 94.70  ? 66  ASN A CB  1 
ATOM   100  C  CG  . ASN A 1 18  ? -14.301 28.764 13.216 1.00 94.69  ? 66  ASN A CG  1 
ATOM   101  O  OD1 . ASN A 1 18  ? -14.133 29.018 12.015 1.00 94.17  ? 66  ASN A OD1 1 
ATOM   102  N  ND2 . ASN A 1 18  ? -13.782 29.510 14.188 1.00 94.36  ? 66  ASN A ND2 1 
ATOM   103  N  N   . VAL A 1 19  ? -18.255 25.905 12.487 1.00 96.94  ? 67  VAL A N   1 
ATOM   104  C  CA  . VAL A 1 19  ? -18.990 24.630 12.521 1.00 98.14  ? 67  VAL A CA  1 
ATOM   105  C  C   . VAL A 1 19  ? -19.310 24.126 11.103 1.00 98.91  ? 67  VAL A C   1 
ATOM   106  O  O   . VAL A 1 19  ? -19.542 24.931 10.193 1.00 99.24  ? 67  VAL A O   1 
ATOM   107  C  CB  . VAL A 1 19  ? -20.316 24.735 13.319 1.00 98.05  ? 67  VAL A CB  1 
ATOM   108  C  CG1 . VAL A 1 19  ? -20.687 23.373 13.897 1.00 98.20  ? 67  VAL A CG1 1 
ATOM   109  C  CG2 . VAL A 1 19  ? -20.203 25.762 14.443 1.00 98.30  ? 67  VAL A CG2 1 
ATOM   110  N  N   . HIS A 1 20  ? -19.326 22.798 10.938 1.00 99.71  ? 68  HIS A N   1 
ATOM   111  C  CA  . HIS A 1 20  ? -19.564 22.117 9.645  1.00 100.40 ? 68  HIS A CA  1 
ATOM   112  C  C   . HIS A 1 20  ? -18.560 22.496 8.543  1.00 100.73 ? 68  HIS A C   1 
ATOM   113  O  O   . HIS A 1 20  ? -18.955 23.069 7.522  1.00 100.68 ? 68  HIS A O   1 
ATOM   114  C  CB  . HIS A 1 20  ? -20.996 22.356 9.123  1.00 100.52 ? 68  HIS A CB  1 
ATOM   115  C  CG  . HIS A 1 20  ? -22.080 22.131 10.137 1.00 100.80 ? 68  HIS A CG  1 
ATOM   116  N  ND1 . HIS A 1 20  ? -22.305 20.908 10.734 1.00 101.04 ? 68  HIS A ND1 1 
ATOM   117  C  CD2 . HIS A 1 20  ? -23.032 22.968 10.620 1.00 100.54 ? 68  HIS A CD2 1 
ATOM   118  C  CE1 . HIS A 1 20  ? -23.333 21.009 11.558 1.00 100.99 ? 68  HIS A CE1 1 
ATOM   119  N  NE2 . HIS A 1 20  ? -23.794 22.247 11.506 1.00 100.51 ? 68  HIS A NE2 1 
ATOM   120  N  N   . HIS A 1 21  ? -17.282 22.167 8.740  1.00 101.21 ? 69  HIS A N   1 
ATOM   121  C  CA  . HIS A 1 21  ? -16.227 22.547 7.787  1.00 101.82 ? 69  HIS A CA  1 
ATOM   122  C  C   . HIS A 1 21  ? -16.689 22.464 6.332  1.00 101.83 ? 69  HIS A C   1 
ATOM   123  O  O   . HIS A 1 21  ? -17.093 21.395 5.857  1.00 101.78 ? 69  HIS A O   1 
ATOM   124  C  CB  . HIS A 1 21  ? -14.937 21.734 7.990  1.00 102.07 ? 69  HIS A CB  1 
ATOM   125  C  CG  . HIS A 1 21  ? -13.920 21.933 6.902  1.00 103.22 ? 69  HIS A CG  1 
ATOM   126  N  ND1 . HIS A 1 21  ? -13.001 22.963 6.916  1.00 104.01 ? 69  HIS A ND1 1 
ATOM   127  C  CD2 . HIS A 1 21  ? -13.689 21.239 5.760  1.00 104.28 ? 69  HIS A CD2 1 
ATOM   128  C  CE1 . HIS A 1 21  ? -12.243 22.890 5.834  1.00 104.54 ? 69  HIS A CE1 1 
ATOM   129  N  NE2 . HIS A 1 21  ? -12.640 21.852 5.116  1.00 104.77 ? 69  HIS A NE2 1 
ATOM   130  N  N   . GLY A 1 22  ? -16.628 23.606 5.646  1.00 101.86 ? 70  GLY A N   1 
ATOM   131  C  CA  . GLY A 1 22  ? -17.073 23.725 4.262  1.00 101.83 ? 70  GLY A CA  1 
ATOM   132  C  C   . GLY A 1 22  ? -18.586 23.727 4.103  1.00 101.84 ? 70  GLY A C   1 
ATOM   133  O  O   . GLY A 1 22  ? -19.142 22.904 3.359  1.00 101.85 ? 70  GLY A O   1 
ATOM   134  N  N   . ASN A 1 23  ? -19.258 24.637 4.817  1.00 101.79 ? 71  ASN A N   1 
ATOM   135  C  CA  . ASN A 1 23  ? -20.694 24.858 4.608  1.00 101.67 ? 71  ASN A CA  1 
ATOM   136  C  C   . ASN A 1 23  ? -20.916 26.102 3.733  1.00 101.46 ? 71  ASN A C   1 
ATOM   137  O  O   . ASN A 1 23  ? -19.948 26.725 3.292  1.00 101.04 ? 71  ASN A O   1 
ATOM   138  C  CB  . ASN A 1 23  ? -21.464 24.926 5.944  1.00 101.77 ? 71  ASN A CB  1 
ATOM   139  C  CG  . ASN A 1 23  ? -21.056 26.120 6.811  1.00 101.65 ? 71  ASN A CG  1 
ATOM   140  O  OD1 . ASN A 1 23  ? -20.015 26.102 7.473  1.00 101.29 ? 71  ASN A OD1 1 
ATOM   141  N  ND2 . ASN A 1 23  ? -21.892 27.153 6.820  1.00 101.01 ? 71  ASN A ND2 1 
ATOM   142  N  N   . VAL A 1 24  ? -22.174 26.460 3.478  1.00 101.48 ? 72  VAL A N   1 
ATOM   143  C  CA  . VAL A 1 24  ? -22.470 27.531 2.512  1.00 101.61 ? 72  VAL A CA  1 
ATOM   144  C  C   . VAL A 1 24  ? -23.031 28.851 3.101  1.00 101.72 ? 72  VAL A C   1 
ATOM   145  O  O   . VAL A 1 24  ? -23.315 29.794 2.354  1.00 101.62 ? 72  VAL A O   1 
ATOM   146  C  CB  . VAL A 1 24  ? -23.370 27.000 1.338  1.00 101.61 ? 72  VAL A CB  1 
ATOM   147  C  CG1 . VAL A 1 24  ? -24.821 26.829 1.778  1.00 101.04 ? 72  VAL A CG1 1 
ATOM   148  C  CG2 . VAL A 1 24  ? -23.256 27.900 0.090  1.00 101.46 ? 72  VAL A CG2 1 
ATOM   149  N  N   . ARG A 1 25  ? -23.154 28.925 4.429  1.00 101.76 ? 73  ARG A N   1 
ATOM   150  C  CA  . ARG A 1 25  ? -23.835 30.048 5.103  1.00 101.78 ? 73  ARG A CA  1 
ATOM   151  C  C   . ARG A 1 25  ? -23.424 31.456 4.627  1.00 101.61 ? 73  ARG A C   1 
ATOM   152  O  O   . ARG A 1 25  ? -22.391 31.996 5.025  1.00 101.46 ? 73  ARG A O   1 
ATOM   153  C  CB  . ARG A 1 25  ? -23.722 29.911 6.629  1.00 101.87 ? 73  ARG A CB  1 
ATOM   154  C  CG  . ARG A 1 25  ? -24.573 28.771 7.202  1.00 102.15 ? 73  ARG A CG  1 
ATOM   155  C  CD  . ARG A 1 25  ? -24.229 28.452 8.658  1.00 102.68 ? 73  ARG A CD  1 
ATOM   156  N  NE  . ARG A 1 25  ? -25.097 27.410 9.212  1.00 102.78 ? 73  ARG A NE  1 
ATOM   157  C  CZ  . ARG A 1 25  ? -24.926 26.833 10.402 1.00 102.91 ? 73  ARG A CZ  1 
ATOM   158  N  NH1 . ARG A 1 25  ? -23.905 27.183 11.186 1.00 102.49 ? 73  ARG A NH1 1 
ATOM   159  N  NH2 . ARG A 1 25  ? -25.781 25.897 10.807 1.00 102.74 ? 73  ARG A NH2 1 
ATOM   160  N  N   . ALA A 1 29  ? -35.110 23.199 -0.392 1.00 103.61 ? 202 ALA A N   1 
ATOM   161  C  CA  . ALA A 1 29  ? -35.212 23.334 1.058  1.00 103.50 ? 202 ALA A CA  1 
ATOM   162  C  C   . ALA A 1 29  ? -34.716 22.090 1.821  1.00 103.49 ? 202 ALA A C   1 
ATOM   163  O  O   . ALA A 1 29  ? -34.978 20.941 1.431  1.00 103.33 ? 202 ALA A O   1 
ATOM   164  C  CB  . ALA A 1 29  ? -36.649 23.704 1.476  1.00 103.21 ? 202 ALA A CB  1 
ATOM   165  N  N   . GLU A 1 30  ? -33.969 22.350 2.896  1.00 103.49 ? 203 GLU A N   1 
ATOM   166  C  CA  . GLU A 1 30  ? -33.618 21.343 3.913  1.00 103.21 ? 203 GLU A CA  1 
ATOM   167  C  C   . GLU A 1 30  ? -34.361 21.649 5.225  1.00 102.46 ? 203 GLU A C   1 
ATOM   168  O  O   . GLU A 1 30  ? -34.474 22.812 5.638  1.00 102.32 ? 203 GLU A O   1 
ATOM   169  C  CB  . GLU A 1 30  ? -32.100 21.297 4.159  1.00 103.47 ? 203 GLU A CB  1 
ATOM   170  C  CG  . GLU A 1 30  ? -31.489 22.640 4.563  1.00 104.35 ? 203 GLU A CG  1 
ATOM   171  C  CD  . GLU A 1 30  ? -30.186 22.498 5.321  1.00 105.49 ? 203 GLU A CD  1 
ATOM   172  O  OE1 . GLU A 1 30  ? -29.335 23.411 5.179  1.00 106.24 ? 203 GLU A OE1 1 
ATOM   173  O  OE2 . GLU A 1 30  ? -30.022 21.490 6.055  1.00 104.88 ? 203 GLU A OE2 1 
ATOM   174  N  N   . THR A 1 31  ? -34.851 20.600 5.878  1.00 101.57 ? 204 THR A N   1 
ATOM   175  C  CA  . THR A 1 31  ? -35.731 20.770 7.031  1.00 100.57 ? 204 THR A CA  1 
ATOM   176  C  C   . THR A 1 31  ? -35.050 20.578 8.405  1.00 99.88  ? 204 THR A C   1 
ATOM   177  O  O   . THR A 1 31  ? -34.214 19.681 8.593  1.00 99.74  ? 204 THR A O   1 
ATOM   178  C  CB  . THR A 1 31  ? -37.016 19.909 6.886  1.00 100.62 ? 204 THR A CB  1 
ATOM   179  O  OG1 . THR A 1 31  ? -37.808 20.030 8.073  1.00 100.51 ? 204 THR A OG1 1 
ATOM   180  C  CG2 . THR A 1 31  ? -36.680 18.430 6.611  1.00 100.42 ? 204 THR A CG2 1 
ATOM   181  N  N   . LEU A 1 32  ? -35.428 21.446 9.347  1.00 98.87  ? 205 LEU A N   1 
ATOM   182  C  CA  . LEU A 1 32  ? -34.918 21.466 10.730 1.00 97.78  ? 205 LEU A CA  1 
ATOM   183  C  C   . LEU A 1 32  ? -35.482 20.322 11.603 1.00 96.85  ? 205 LEU A C   1 
ATOM   184  O  O   . LEU A 1 32  ? -36.694 20.092 11.614 1.00 96.99  ? 205 LEU A O   1 
ATOM   185  C  CB  . LEU A 1 32  ? -35.299 22.805 11.362 1.00 97.86  ? 205 LEU A CB  1 
ATOM   186  C  CG  . LEU A 1 32  ? -34.506 23.261 12.580 1.00 97.80  ? 205 LEU A CG  1 
ATOM   187  C  CD1 . LEU A 1 32  ? -33.643 24.429 12.179 1.00 97.95  ? 205 LEU A CD1 1 
ATOM   188  C  CD2 . LEU A 1 32  ? -35.444 23.662 13.693 1.00 97.48  ? 205 LEU A CD2 1 
ATOM   189  N  N   . VAL A 1 33  ? -34.632 19.624 12.355 1.00 95.45  ? 206 VAL A N   1 
ATOM   190  C  CA  . VAL A 1 33  ? -35.124 18.465 13.117 1.00 94.12  ? 206 VAL A CA  1 
ATOM   191  C  C   . VAL A 1 33  ? -35.117 18.645 14.643 1.00 93.22  ? 206 VAL A C   1 
ATOM   192  O  O   . VAL A 1 33  ? -34.238 19.299 15.201 1.00 93.31  ? 206 VAL A O   1 
ATOM   193  C  CB  . VAL A 1 33  ? -34.381 17.146 12.756 1.00 94.19  ? 206 VAL A CB  1 
ATOM   194  C  CG1 . VAL A 1 33  ? -35.395 16.013 12.572 1.00 93.69  ? 206 VAL A CG1 1 
ATOM   195  C  CG2 . VAL A 1 33  ? -33.525 17.309 11.499 1.00 94.17  ? 206 VAL A CG2 1 
ATOM   196  N  N   . PHE A 1 34  ? -36.116 18.068 15.304 1.00 91.81  ? 207 PHE A N   1 
ATOM   197  C  CA  . PHE A 1 34  ? -36.138 17.959 16.755 1.00 90.27  ? 207 PHE A CA  1 
ATOM   198  C  C   . PHE A 1 34  ? -35.884 16.515 17.094 1.00 89.54  ? 207 PHE A C   1 
ATOM   199  O  O   . PHE A 1 34  ? -36.339 15.630 16.379 1.00 89.63  ? 207 PHE A O   1 
ATOM   200  C  CB  . PHE A 1 34  ? -37.517 18.283 17.288 1.00 90.14  ? 207 PHE A CB  1 
ATOM   201  C  CG  . PHE A 1 34  ? -37.952 19.678 17.037 1.00 89.67  ? 207 PHE A CG  1 
ATOM   202  C  CD1 . PHE A 1 34  ? -37.655 20.676 17.943 1.00 89.66  ? 207 PHE A CD1 1 
ATOM   203  C  CD2 . PHE A 1 34  ? -38.685 19.994 15.912 1.00 89.67  ? 207 PHE A CD2 1 
ATOM   204  C  CE1 . PHE A 1 34  ? -38.067 21.973 17.726 1.00 89.77  ? 207 PHE A CE1 1 
ATOM   205  C  CE2 . PHE A 1 34  ? -39.103 21.288 15.687 1.00 89.88  ? 207 PHE A CE2 1 
ATOM   206  C  CZ  . PHE A 1 34  ? -38.792 22.281 16.597 1.00 89.82  ? 207 PHE A CZ  1 
ATOM   207  N  N   . SER A 1 35  ? -35.195 16.260 18.196 1.00 88.60  ? 208 SER A N   1 
ATOM   208  C  CA  . SER A 1 35  ? -35.032 14.886 18.641 1.00 87.64  ? 208 SER A CA  1 
ATOM   209  C  C   . SER A 1 35  ? -36.394 14.208 18.667 1.00 86.91  ? 208 SER A C   1 
ATOM   210  O  O   . SER A 1 35  ? -37.434 14.858 18.830 1.00 86.61  ? 208 SER A O   1 
ATOM   211  C  CB  . SER A 1 35  ? -34.363 14.804 20.017 1.00 87.72  ? 208 SER A CB  1 
ATOM   212  O  OG  . SER A 1 35  ? -35.198 15.312 21.039 1.00 87.84  ? 208 SER A OG  1 
ATOM   213  N  N   . THR A 1 36  ? -36.370 12.897 18.477 1.00 85.99  ? 209 THR A N   1 
ATOM   214  C  CA  . THR A 1 36  ? -37.565 12.078 18.514 1.00 84.96  ? 209 THR A CA  1 
ATOM   215  C  C   . THR A 1 36  ? -38.155 12.028 19.918 1.00 84.28  ? 209 THR A C   1 
ATOM   216  O  O   . THR A 1 36  ? -39.373 12.011 20.094 1.00 84.21  ? 209 THR A O   1 
ATOM   217  C  CB  . THR A 1 36  ? -37.220 10.664 18.104 1.00 84.98  ? 209 THR A CB  1 
ATOM   218  O  OG1 . THR A 1 36  ? -36.092 10.224 18.871 1.00 84.48  ? 209 THR A OG1 1 
ATOM   219  C  CG2 . THR A 1 36  ? -36.873 10.634 16.626 1.00 85.20  ? 209 THR A CG2 1 
ATOM   220  N  N   . HIS A 1 37  ? -37.284 12.004 20.918 1.00 83.22  ? 210 HIS A N   1 
ATOM   221  C  CA  . HIS A 1 37  ? -37.736 11.891 22.285 1.00 82.30  ? 210 HIS A CA  1 
ATOM   222  C  C   . HIS A 1 37  ? -37.298 13.092 23.094 1.00 81.38  ? 210 HIS A C   1 
ATOM   223  O  O   . HIS A 1 37  ? -36.434 13.850 22.671 1.00 81.26  ? 210 HIS A O   1 
ATOM   224  C  CB  . HIS A 1 37  ? -37.168 10.621 22.917 1.00 82.66  ? 210 HIS A CB  1 
ATOM   225  C  CG  . HIS A 1 37  ? -37.612 9.355  22.251 1.00 83.56  ? 210 HIS A CG  1 
ATOM   226  N  ND1 . HIS A 1 37  ? -38.694 8.619  22.695 1.00 84.75  ? 210 HIS A ND1 1 
ATOM   227  C  CD2 . HIS A 1 37  ? -37.116 8.688  21.181 1.00 83.94  ? 210 HIS A CD2 1 
ATOM   228  C  CE1 . HIS A 1 37  ? -38.848 7.556  21.925 1.00 84.82  ? 210 HIS A CE1 1 
ATOM   229  N  NE2 . HIS A 1 37  ? -37.903 7.575  20.999 1.00 85.14  ? 210 HIS A NE2 1 
ATOM   230  N  N   . ALA A 1 38  ? -37.913 13.253 24.259 1.00 80.45  ? 211 ALA A N   1 
ATOM   231  C  CA  . ALA A 1 38  ? -37.479 14.217 25.261 1.00 79.60  ? 211 ALA A CA  1 
ATOM   232  C  C   . ALA A 1 38  ? -37.133 13.455 26.536 1.00 79.06  ? 211 ALA A C   1 
ATOM   233  O  O   . ALA A 1 38  ? -37.726 12.406 26.810 1.00 79.07  ? 211 ALA A O   1 
ATOM   234  C  CB  . ALA A 1 38  ? -38.566 15.225 25.531 1.00 79.61  ? 211 ALA A CB  1 
ATOM   235  N  N   . VAL A 1 39  ? -36.174 13.982 27.305 1.00 78.23  ? 212 VAL A N   1 
ATOM   236  C  CA  . VAL A 1 39  ? -35.711 13.342 28.545 1.00 77.23  ? 212 VAL A CA  1 
ATOM   237  C  C   . VAL A 1 39  ? -35.991 14.211 29.758 1.00 76.85  ? 212 VAL A C   1 
ATOM   238  O  O   . VAL A 1 39  ? -36.146 15.426 29.636 1.00 76.95  ? 212 VAL A O   1 
ATOM   239  C  CB  . VAL A 1 39  ? -34.198 13.027 28.517 1.00 77.01  ? 212 VAL A CB  1 
ATOM   240  C  CG1 . VAL A 1 39  ? -33.858 12.186 27.322 1.00 77.05  ? 212 VAL A CG1 1 
ATOM   241  C  CG2 . VAL A 1 39  ? -33.380 14.295 28.498 1.00 76.64  ? 212 VAL A CG2 1 
ATOM   242  N  N   . ILE A 1 40  ? -36.055 13.577 30.925 1.00 76.25  ? 213 ILE A N   1 
ATOM   243  C  CA  . ILE A 1 40  ? -36.184 14.285 32.190 1.00 75.66  ? 213 ILE A CA  1 
ATOM   244  C  C   . ILE A 1 40  ? -35.076 13.828 33.107 1.00 75.54  ? 213 ILE A C   1 
ATOM   245  O  O   . ILE A 1 40  ? -34.884 12.640 33.271 1.00 75.83  ? 213 ILE A O   1 
ATOM   246  C  CB  . ILE A 1 40  ? -37.499 13.961 32.878 1.00 75.49  ? 213 ILE A CB  1 
ATOM   247  C  CG1 . ILE A 1 40  ? -38.673 14.540 32.087 1.00 75.16  ? 213 ILE A CG1 1 
ATOM   248  C  CG2 . ILE A 1 40  ? -37.473 14.485 34.305 1.00 75.44  ? 213 ILE A CG2 1 
ATOM   249  C  CD1 . ILE A 1 40  ? -40.010 14.002 32.516 1.00 74.44  ? 213 ILE A CD1 1 
ATOM   250  N  N   . SER A 1 41  ? -34.348 14.762 33.706 1.00 75.48  ? 214 SER A N   1 
ATOM   251  C  CA  . SER A 1 41  ? -33.243 14.414 34.604 1.00 75.43  ? 214 SER A CA  1 
ATOM   252  C  C   . SER A 1 41  ? -32.645 15.635 35.302 1.00 75.57  ? 214 SER A C   1 
ATOM   253  O  O   . SER A 1 41  ? -32.890 16.775 34.906 1.00 75.79  ? 214 SER A O   1 
ATOM   254  C  CB  . SER A 1 41  ? -32.147 13.633 33.861 1.00 75.37  ? 214 SER A CB  1 
ATOM   255  O  OG  . SER A 1 41  ? -31.862 14.208 32.599 1.00 74.82  ? 214 SER A OG  1 
ATOM   256  N  N   . MET A 1 42  ? -31.847 15.388 36.334 1.00 75.53  ? 215 MET A N   1 
ATOM   257  C  CA  . MET A 1 42  ? -31.287 16.457 37.150 1.00 75.36  ? 215 MET A CA  1 
ATOM   258  C  C   . MET A 1 42  ? -30.198 17.254 36.444 1.00 75.24  ? 215 MET A C   1 
ATOM   259  O  O   . MET A 1 42  ? -29.289 16.697 35.815 1.00 75.36  ? 215 MET A O   1 
ATOM   260  C  CB  . MET A 1 42  ? -30.735 15.889 38.455 1.00 75.45  ? 215 MET A CB  1 
ATOM   261  C  CG  . MET A 1 42  ? -31.741 15.083 39.249 1.00 76.01  ? 215 MET A CG  1 
ATOM   262  S  SD  . MET A 1 42  ? -32.966 16.142 40.028 1.00 76.54  ? 215 MET A SD  1 
ATOM   263  C  CE  . MET A 1 42  ? -32.048 16.627 41.486 1.00 77.14  ? 215 MET A CE  1 
ATOM   264  N  N   . ARG A 1 43  ? -30.316 18.570 36.551 1.00 75.00  ? 216 ARG A N   1 
ATOM   265  C  CA  . ARG A 1 43  ? -29.235 19.475 36.218 1.00 74.68  ? 216 ARG A CA  1 
ATOM   266  C  C   . ARG A 1 43  ? -29.090 20.432 37.380 1.00 74.51  ? 216 ARG A C   1 
ATOM   267  O  O   . ARG A 1 43  ? -29.995 21.215 37.660 1.00 74.46  ? 216 ARG A O   1 
ATOM   268  C  CB  . ARG A 1 43  ? -29.518 20.230 34.923 1.00 74.63  ? 216 ARG A CB  1 
ATOM   269  C  CG  . ARG A 1 43  ? -29.323 19.397 33.667 1.00 74.78  ? 216 ARG A CG  1 
ATOM   270  C  CD  . ARG A 1 43  ? -29.243 20.270 32.420 1.00 74.99  ? 216 ARG A CD  1 
ATOM   271  N  NE  . ARG A 1 43  ? -28.833 19.497 31.249 1.00 75.89  ? 216 ARG A NE  1 
ATOM   272  C  CZ  . ARG A 1 43  ? -28.830 19.951 29.996 1.00 76.59  ? 216 ARG A CZ  1 
ATOM   273  N  NH1 . ARG A 1 43  ? -29.220 21.194 29.723 1.00 77.02  ? 216 ARG A NH1 1 
ATOM   274  N  NH2 . ARG A 1 43  ? -28.440 19.153 29.007 1.00 76.68  ? 216 ARG A NH2 1 
ATOM   275  N  N   . ASP A 1 44  ? -27.958 20.332 38.075 1.00 74.47  ? 217 ASP A N   1 
ATOM   276  C  CA  . ASP A 1 44  ? -27.654 21.176 39.233 1.00 74.28  ? 217 ASP A CA  1 
ATOM   277  C  C   . ASP A 1 44  ? -28.780 21.157 40.271 1.00 74.20  ? 217 ASP A C   1 
ATOM   278  O  O   . ASP A 1 44  ? -29.289 22.203 40.676 1.00 74.20  ? 217 ASP A O   1 
ATOM   279  C  CB  . ASP A 1 44  ? -27.340 22.617 38.794 1.00 74.24  ? 217 ASP A CB  1 
ATOM   280  C  CG  . ASP A 1 44  ? -26.034 22.731 38.025 1.00 73.57  ? 217 ASP A CG  1 
ATOM   281  O  OD1 . ASP A 1 44  ? -25.078 21.993 38.326 1.00 73.59  ? 217 ASP A OD1 1 
ATOM   282  O  OD2 . ASP A 1 44  ? -25.957 23.577 37.120 1.00 72.82  ? 217 ASP A OD2 1 
ATOM   283  N  N   . GLY A 1 45  ? -29.180 19.960 40.681 1.00 74.07  ? 218 GLY A N   1 
ATOM   284  C  CA  . GLY A 1 45  ? -30.177 19.819 41.736 1.00 74.10  ? 218 GLY A CA  1 
ATOM   285  C  C   . GLY A 1 45  ? -31.591 20.230 41.361 1.00 74.03  ? 218 GLY A C   1 
ATOM   286  O  O   . GLY A 1 45  ? -32.487 20.213 42.203 1.00 73.94  ? 218 GLY A O   1 
ATOM   287  N  N   . LYS A 1 46  ? -31.793 20.599 40.099 1.00 74.00  ? 219 LYS A N   1 
ATOM   288  C  CA  . LYS A 1 46  ? -33.119 20.938 39.602 1.00 74.03  ? 219 LYS A CA  1 
ATOM   289  C  C   . LYS A 1 46  ? -33.542 19.883 38.607 1.00 73.55  ? 219 LYS A C   1 
ATOM   290  O  O   . LYS A 1 46  ? -32.760 19.515 37.731 1.00 73.50  ? 219 LYS A O   1 
ATOM   291  C  CB  . LYS A 1 46  ? -33.111 22.297 38.893 1.00 74.45  ? 219 LYS A CB  1 
ATOM   292  C  CG  . LYS A 1 46  ? -32.557 23.483 39.690 1.00 76.20  ? 219 LYS A CG  1 
ATOM   293  C  CD  . LYS A 1 46  ? -33.502 23.954 40.805 1.00 78.53  ? 219 LYS A CD  1 
ATOM   294  C  CE  . LYS A 1 46  ? -32.952 25.200 41.504 1.00 79.07  ? 219 LYS A CE  1 
ATOM   295  N  NZ  . LYS A 1 46  ? -33.145 25.079 42.974 1.00 79.82  ? 219 LYS A NZ  1 
ATOM   296  N  N   . LEU A 1 47  ? -34.775 19.401 38.727 1.00 73.14  ? 220 LEU A N   1 
ATOM   297  C  CA  . LEU A 1 47  ? -35.296 18.424 37.768 1.00 72.85  ? 220 LEU A CA  1 
ATOM   298  C  C   . LEU A 1 47  ? -35.721 19.115 36.473 1.00 72.49  ? 220 LEU A C   1 
ATOM   299  O  O   . LEU A 1 47  ? -36.342 20.175 36.501 1.00 72.67  ? 220 LEU A O   1 
ATOM   300  C  CB  . LEU A 1 47  ? -36.451 17.608 38.367 1.00 72.89  ? 220 LEU A CB  1 
ATOM   301  C  CG  . LEU A 1 47  ? -36.837 16.275 37.699 1.00 72.62  ? 220 LEU A CG  1 
ATOM   302  C  CD1 . LEU A 1 47  ? -35.749 15.224 37.836 1.00 71.88  ? 220 LEU A CD1 1 
ATOM   303  C  CD2 . LEU A 1 47  ? -38.144 15.747 38.273 1.00 72.60  ? 220 LEU A CD2 1 
ATOM   304  N  N   . CYS A 1 48  ? -35.383 18.511 35.338 1.00 72.00  ? 221 CYS A N   1 
ATOM   305  C  CA  . CYS A 1 48  ? -35.596 19.162 34.051 1.00 71.60  ? 221 CYS A CA  1 
ATOM   306  C  C   . CYS A 1 48  ? -36.161 18.267 32.963 1.00 71.37  ? 221 CYS A C   1 
ATOM   307  O  O   . CYS A 1 48  ? -35.862 17.079 32.894 1.00 71.48  ? 221 CYS A O   1 
ATOM   308  C  CB  . CYS A 1 48  ? -34.290 19.764 33.554 1.00 71.56  ? 221 CYS A CB  1 
ATOM   309  S  SG  . CYS A 1 48  ? -33.590 20.908 34.699 1.00 71.40  ? 221 CYS A SG  1 
ATOM   310  N  N   . LEU A 1 49  ? -36.984 18.862 32.113 1.00 71.00  ? 222 LEU A N   1 
ATOM   311  C  CA  . LEU A 1 49  ? -37.407 18.233 30.884 1.00 70.66  ? 222 LEU A CA  1 
ATOM   312  C  C   . LEU A 1 49  ? -36.622 18.900 29.767 1.00 70.67  ? 222 LEU A C   1 
ATOM   313  O  O   . LEU A 1 49  ? -36.522 20.121 29.716 1.00 70.61  ? 222 LEU A O   1 
ATOM   314  C  CB  . LEU A 1 49  ? -38.903 18.434 30.691 1.00 70.53  ? 222 LEU A CB  1 
ATOM   315  C  CG  . LEU A 1 49  ? -39.455 18.231 29.290 1.00 69.85  ? 222 LEU A CG  1 
ATOM   316  C  CD1 . LEU A 1 49  ? -39.640 16.764 29.028 1.00 70.05  ? 222 LEU A CD1 1 
ATOM   317  C  CD2 . LEU A 1 49  ? -40.767 18.939 29.209 1.00 69.67  ? 222 LEU A CD2 1 
ATOM   318  N  N   . MET A 1 50  ? -36.045 18.097 28.885 1.00 70.79  ? 223 MET A N   1 
ATOM   319  C  CA  . MET A 1 50  ? -35.182 18.629 27.851 1.00 71.06  ? 223 MET A CA  1 
ATOM   320  C  C   . MET A 1 50  ? -35.445 17.970 26.528 1.00 71.83  ? 223 MET A C   1 
ATOM   321  O  O   . MET A 1 50  ? -35.666 16.763 26.471 1.00 72.03  ? 223 MET A O   1 
ATOM   322  C  CB  . MET A 1 50  ? -33.734 18.377 28.211 1.00 70.77  ? 223 MET A CB  1 
ATOM   323  C  CG  . MET A 1 50  ? -33.235 19.189 29.357 1.00 69.68  ? 223 MET A CG  1 
ATOM   324  S  SD  . MET A 1 50  ? -31.777 18.417 30.024 1.00 67.01  ? 223 MET A SD  1 
ATOM   325  C  CE  . MET A 1 50  ? -32.514 17.081 30.953 1.00 67.21  ? 223 MET A CE  1 
ATOM   326  N  N   . PHE A 1 51  ? -35.415 18.762 25.462 1.00 72.65  ? 224 PHE A N   1 
ATOM   327  C  CA  . PHE A 1 51  ? -35.487 18.225 24.108 1.00 73.62  ? 224 PHE A CA  1 
ATOM   328  C  C   . PHE A 1 51  ? -34.410 18.892 23.275 1.00 74.34  ? 224 PHE A C   1 
ATOM   329  O  O   . PHE A 1 51  ? -33.939 19.977 23.632 1.00 74.51  ? 224 PHE A O   1 
ATOM   330  C  CB  . PHE A 1 51  ? -36.869 18.439 23.490 1.00 73.46  ? 224 PHE A CB  1 
ATOM   331  C  CG  . PHE A 1 51  ? -37.279 19.872 23.417 1.00 73.51  ? 224 PHE A CG  1 
ATOM   332  C  CD1 . PHE A 1 51  ? -36.842 20.685 22.375 1.00 74.02  ? 224 PHE A CD1 1 
ATOM   333  C  CD2 . PHE A 1 51  ? -38.104 20.416 24.386 1.00 73.22  ? 224 PHE A CD2 1 
ATOM   334  C  CE1 . PHE A 1 51  ? -37.217 22.022 22.305 1.00 73.88  ? 224 PHE A CE1 1 
ATOM   335  C  CE2 . PHE A 1 51  ? -38.486 21.745 24.327 1.00 73.27  ? 224 PHE A CE2 1 
ATOM   336  C  CZ  . PHE A 1 51  ? -38.041 22.552 23.284 1.00 73.72  ? 224 PHE A CZ  1 
ATOM   337  N  N   . ARG A 1 52  ? -34.006 18.243 22.184 1.00 75.12  ? 225 ARG A N   1 
ATOM   338  C  CA  . ARG A 1 52  ? -32.921 18.766 21.367 1.00 76.07  ? 225 ARG A CA  1 
ATOM   339  C  C   . ARG A 1 52  ? -33.460 19.384 20.108 1.00 76.74  ? 225 ARG A C   1 
ATOM   340  O  O   . ARG A 1 52  ? -34.386 18.859 19.505 1.00 77.02  ? 225 ARG A O   1 
ATOM   341  C  CB  . ARG A 1 52  ? -31.899 17.683 21.032 1.00 75.99  ? 225 ARG A CB  1 
ATOM   342  C  CG  . ARG A 1 52  ? -30.850 18.128 20.022 1.00 76.63  ? 225 ARG A CG  1 
ATOM   343  C  CD  . ARG A 1 52  ? -29.435 17.778 20.463 1.00 77.99  ? 225 ARG A CD  1 
ATOM   344  N  NE  . ARG A 1 52  ? -29.285 16.364 20.802 1.00 78.57  ? 225 ARG A NE  1 
ATOM   345  C  CZ  . ARG A 1 52  ? -28.225 15.849 21.417 1.00 78.74  ? 225 ARG A CZ  1 
ATOM   346  N  NH1 . ARG A 1 52  ? -27.205 16.625 21.770 1.00 78.61  ? 225 ARG A NH1 1 
ATOM   347  N  NH2 . ARG A 1 52  ? -28.186 14.551 21.684 1.00 79.15  ? 225 ARG A NH2 1 
ATOM   348  N  N   . VAL A 1 53  ? -32.878 20.505 19.712 1.00 77.68  ? 226 VAL A N   1 
ATOM   349  C  CA  . VAL A 1 53  ? -33.296 21.162 18.492 1.00 78.66  ? 226 VAL A CA  1 
ATOM   350  C  C   . VAL A 1 53  ? -32.104 21.325 17.559 1.00 79.61  ? 226 VAL A C   1 
ATOM   351  O  O   . VAL A 1 53  ? -31.069 21.862 17.942 1.00 79.67  ? 226 VAL A O   1 
ATOM   352  C  CB  . VAL A 1 53  ? -34.019 22.500 18.776 1.00 78.46  ? 226 VAL A CB  1 
ATOM   353  C  CG1 . VAL A 1 53  ? -33.085 23.509 19.417 1.00 78.44  ? 226 VAL A CG1 1 
ATOM   354  C  CG2 . VAL A 1 53  ? -34.619 23.053 17.508 1.00 78.56  ? 226 VAL A CG2 1 
ATOM   355  N  N   . GLY A 1 54  ? -32.259 20.834 16.336 1.00 80.91  ? 227 GLY A N   1 
ATOM   356  C  CA  . GLY A 1 54  ? -31.186 20.848 15.350 1.00 82.45  ? 227 GLY A CA  1 
ATOM   357  C  C   . GLY A 1 54  ? -31.064 22.182 14.663 1.00 83.54  ? 227 GLY A C   1 
ATOM   358  O  O   . GLY A 1 54  ? -31.937 23.028 14.783 1.00 83.44  ? 227 GLY A O   1 
ATOM   359  N  N   . ASP A 1 55  ? -29.965 22.375 13.952 1.00 85.02  ? 228 ASP A N   1 
ATOM   360  C  CA  . ASP A 1 55  ? -29.763 23.600 13.198 1.00 86.78  ? 228 ASP A CA  1 
ATOM   361  C  C   . ASP A 1 55  ? -30.058 23.323 11.737 1.00 87.60  ? 228 ASP A C   1 
ATOM   362  O  O   . ASP A 1 55  ? -30.415 22.201 11.375 1.00 87.65  ? 228 ASP A O   1 
ATOM   363  C  CB  . ASP A 1 55  ? -28.328 24.121 13.363 1.00 86.92  ? 228 ASP A CB  1 
ATOM   364  C  CG  . ASP A 1 55  ? -27.287 23.132 12.870 1.00 87.98  ? 228 ASP A CG  1 
ATOM   365  O  OD1 . ASP A 1 55  ? -27.354 21.946 13.269 1.00 88.77  ? 228 ASP A OD1 1 
ATOM   366  O  OD2 . ASP A 1 55  ? -26.402 23.539 12.081 1.00 89.21  ? 228 ASP A OD2 1 
ATOM   367  N  N   . LEU A 1 56  ? -29.932 24.354 10.908 1.00 88.83  ? 229 LEU A N   1 
ATOM   368  C  CA  . LEU A 1 56  ? -29.981 24.173 9.469  1.00 89.92  ? 229 LEU A CA  1 
ATOM   369  C  C   . LEU A 1 56  ? -28.559 24.269 8.967  1.00 90.82  ? 229 LEU A C   1 
ATOM   370  O  O   . LEU A 1 56  ? -27.921 25.331 9.059  1.00 90.86  ? 229 LEU A O   1 
ATOM   371  C  CB  . LEU A 1 56  ? -30.858 25.229 8.801  1.00 89.87  ? 229 LEU A CB  1 
ATOM   372  C  CG  . LEU A 1 56  ? -32.363 25.116 9.037  1.00 89.46  ? 229 LEU A CG  1 
ATOM   373  C  CD1 . LEU A 1 56  ? -33.056 26.333 8.448  1.00 89.29  ? 229 LEU A CD1 1 
ATOM   374  C  CD2 . LEU A 1 56  ? -32.930 23.817 8.471  1.00 88.71  ? 229 LEU A CD2 1 
ATOM   375  N  N   . ARG A 1 57  ? -28.069 23.143 8.454  1.00 91.90  ? 230 ARG A N   1 
ATOM   376  C  CA  . ARG A 1 57  ? -26.675 23.011 8.031  1.00 93.00  ? 230 ARG A CA  1 
ATOM   377  C  C   . ARG A 1 57  ? -26.224 24.179 7.140  1.00 93.05  ? 230 ARG A C   1 
ATOM   378  O  O   . ARG A 1 57  ? -25.074 24.629 7.220  1.00 93.13  ? 230 ARG A O   1 
ATOM   379  C  CB  . ARG A 1 57  ? -26.428 21.646 7.346  1.00 93.31  ? 230 ARG A CB  1 
ATOM   380  C  CG  . ARG A 1 57  ? -24.966 21.404 6.957  1.00 95.21  ? 230 ARG A CG  1 
ATOM   381  C  CD  . ARG A 1 57  ? -24.670 19.990 6.440  1.00 98.55  ? 230 ARG A CD  1 
ATOM   382  N  NE  . ARG A 1 57  ? -23.603 20.032 5.428  1.00 101.13 ? 230 ARG A NE  1 
ATOM   383  C  CZ  . ARG A 1 57  ? -22.287 19.979 5.678  1.00 102.26 ? 230 ARG A CZ  1 
ATOM   384  N  NH1 . ARG A 1 57  ? -21.826 19.852 6.926  1.00 102.25 ? 230 ARG A NH1 1 
ATOM   385  N  NH2 . ARG A 1 57  ? -21.422 20.049 4.666  1.00 102.81 ? 230 ARG A NH2 1 
ATOM   386  N  N   . ASN A 1 58  ? -27.133 24.690 6.315  1.00 93.10  ? 231 ASN A N   1 
ATOM   387  C  CA  . ASN A 1 58  ? -26.712 25.634 5.299  1.00 93.27  ? 231 ASN A CA  1 
ATOM   388  C  C   . ASN A 1 58  ? -27.405 26.983 5.316  1.00 93.02  ? 231 ASN A C   1 
ATOM   389  O  O   . ASN A 1 58  ? -27.666 27.574 4.269  1.00 93.05  ? 231 ASN A O   1 
ATOM   390  C  CB  . ASN A 1 58  ? -26.716 24.975 3.917  1.00 93.53  ? 231 ASN A CB  1 
ATOM   391  C  CG  . ASN A 1 58  ? -25.628 23.911 3.785  1.00 94.06  ? 231 ASN A CG  1 
ATOM   392  O  OD1 . ASN A 1 58  ? -25.931 22.719 3.655  1.00 94.52  ? 231 ASN A OD1 1 
ATOM   393  N  ND2 . ASN A 1 58  ? -24.353 24.333 3.850  1.00 93.32  ? 231 ASN A ND2 1 
ATOM   394  N  N   . SER A 1 59  ? -27.673 27.460 6.528  1.00 92.79  ? 232 SER A N   1 
ATOM   395  C  CA  . SER A 1 59  ? -28.057 28.851 6.775  1.00 92.57  ? 232 SER A CA  1 
ATOM   396  C  C   . SER A 1 59  ? -28.285 29.097 8.260  1.00 92.00  ? 232 SER A C   1 
ATOM   397  O  O   . SER A 1 59  ? -28.589 28.172 9.032  1.00 91.80  ? 232 SER A O   1 
ATOM   398  C  CB  . SER A 1 59  ? -29.304 29.263 5.976  1.00 92.79  ? 232 SER A CB  1 
ATOM   399  O  OG  . SER A 1 59  ? -30.366 28.337 6.165  1.00 93.80  ? 232 SER A OG  1 
ATOM   400  N  N   . HIS A 1 60  ? -28.120 30.356 8.651  1.00 91.33  ? 233 HIS A N   1 
ATOM   401  C  CA  . HIS A 1 60  ? -28.492 30.784 9.982  1.00 90.61  ? 233 HIS A CA  1 
ATOM   402  C  C   . HIS A 1 60  ? -29.980 31.070 9.997  1.00 89.64  ? 233 HIS A C   1 
ATOM   403  O  O   . HIS A 1 60  ? -30.624 31.223 8.943  1.00 89.41  ? 233 HIS A O   1 
ATOM   404  C  CB  . HIS A 1 60  ? -27.736 32.042 10.390 1.00 90.94  ? 233 HIS A CB  1 
ATOM   405  C  CG  . HIS A 1 60  ? -26.261 31.844 10.510 1.00 92.49  ? 233 HIS A CG  1 
ATOM   406  N  ND1 . HIS A 1 60  ? -25.662 31.426 11.679 1.00 94.11  ? 233 HIS A ND1 1 
ATOM   407  C  CD2 . HIS A 1 60  ? -25.260 32.009 9.611  1.00 93.94  ? 233 HIS A CD2 1 
ATOM   408  C  CE1 . HIS A 1 60  ? -24.355 31.342 11.496 1.00 94.79  ? 233 HIS A CE1 1 
ATOM   409  N  NE2 . HIS A 1 60  ? -24.085 31.687 10.248 1.00 94.90  ? 233 HIS A NE2 1 
ATOM   410  N  N   . ILE A 1 61  ? -30.513 31.130 11.211 1.00 88.30  ? 234 ILE A N   1 
ATOM   411  C  CA  . ILE A 1 61  ? -31.883 31.522 11.447 1.00 86.86  ? 234 ILE A CA  1 
ATOM   412  C  C   . ILE A 1 61  ? -31.843 32.669 12.445 1.00 86.16  ? 234 ILE A C   1 
ATOM   413  O  O   . ILE A 1 61  ? -31.431 32.518 13.596 1.00 85.96  ? 234 ILE A O   1 
ATOM   414  C  CB  . ILE A 1 61  ? -32.711 30.354 11.968 1.00 86.77  ? 234 ILE A CB  1 
ATOM   415  C  CG1 . ILE A 1 61  ? -32.498 29.137 11.075 1.00 86.45  ? 234 ILE A CG1 1 
ATOM   416  C  CG2 . ILE A 1 61  ? -34.173 30.716 11.989 1.00 86.66  ? 234 ILE A CG2 1 
ATOM   417  C  CD1 . ILE A 1 61  ? -32.394 27.852 11.842 1.00 86.69  ? 234 ILE A CD1 1 
ATOM   418  N  N   . VAL A 1 62  ? -32.254 33.829 11.965 1.00 85.33  ? 235 VAL A N   1 
ATOM   419  C  CA  . VAL A 1 62  ? -32.143 35.071 12.697 1.00 84.44  ? 235 VAL A CA  1 
ATOM   420  C  C   . VAL A 1 62  ? -33.422 35.281 13.488 1.00 83.95  ? 235 VAL A C   1 
ATOM   421  O  O   . VAL A 1 62  ? -34.474 34.768 13.110 1.00 83.76  ? 235 VAL A O   1 
ATOM   422  C  CB  . VAL A 1 62  ? -31.928 36.234 11.714 1.00 84.34  ? 235 VAL A CB  1 
ATOM   423  C  CG1 . VAL A 1 62  ? -31.677 37.526 12.450 1.00 84.46  ? 235 VAL A CG1 1 
ATOM   424  C  CG2 . VAL A 1 62  ? -30.768 35.924 10.784 1.00 83.87  ? 235 VAL A CG2 1 
ATOM   425  N  N   . GLU A 1 63  ? -33.323 36.029 14.588 1.00 83.38  ? 236 GLU A N   1 
ATOM   426  C  CA  . GLU A 1 63  ? -34.466 36.298 15.452 1.00 82.83  ? 236 GLU A CA  1 
ATOM   427  C  C   . GLU A 1 63  ? -35.105 34.942 15.726 1.00 82.04  ? 236 GLU A C   1 
ATOM   428  O  O   . GLU A 1 63  ? -36.327 34.789 15.661 1.00 82.05  ? 236 GLU A O   1 
ATOM   429  C  CB  . GLU A 1 63  ? -35.446 37.271 14.767 1.00 83.24  ? 236 GLU A CB  1 
ATOM   430  C  CG  . GLU A 1 63  ? -36.222 38.253 15.688 1.00 84.55  ? 236 GLU A CG  1 
ATOM   431  C  CD  . GLU A 1 63  ? -37.147 39.218 14.904 1.00 86.50  ? 236 GLU A CD  1 
ATOM   432  O  OE1 . GLU A 1 63  ? -36.652 39.920 13.986 1.00 86.65  ? 236 GLU A OE1 1 
ATOM   433  O  OE2 . GLU A 1 63  ? -38.370 39.281 15.207 1.00 87.23  ? 236 GLU A OE2 1 
ATOM   434  N  N   . ALA A 1 64  ? -34.250 33.957 16.002 1.00 80.91  ? 237 ALA A N   1 
ATOM   435  C  CA  . ALA A 1 64  ? -34.682 32.592 16.259 1.00 79.73  ? 237 ALA A CA  1 
ATOM   436  C  C   . ALA A 1 64  ? -35.173 32.466 17.689 1.00 78.99  ? 237 ALA A C   1 
ATOM   437  O  O   . ALA A 1 64  ? -34.543 32.973 18.608 1.00 78.94  ? 237 ALA A O   1 
ATOM   438  C  CB  . ALA A 1 64  ? -33.548 31.639 16.009 1.00 79.76  ? 237 ALA A CB  1 
ATOM   439  N  N   . SER A 1 65  ? -36.301 31.794 17.877 1.00 78.11  ? 238 SER A N   1 
ATOM   440  C  CA  . SER A 1 65  ? -36.867 31.644 19.205 1.00 77.36  ? 238 SER A CA  1 
ATOM   441  C  C   . SER A 1 65  ? -37.540 30.295 19.377 1.00 77.11  ? 238 SER A C   1 
ATOM   442  O  O   . SER A 1 65  ? -38.166 29.781 18.452 1.00 77.11  ? 238 SER A O   1 
ATOM   443  C  CB  . SER A 1 65  ? -37.885 32.743 19.468 1.00 77.20  ? 238 SER A CB  1 
ATOM   444  O  OG  . SER A 1 65  ? -39.168 32.317 19.064 1.00 76.82  ? 238 SER A OG  1 
ATOM   445  N  N   . ILE A 1 66  ? -37.411 29.731 20.572 1.00 76.82  ? 239 ILE A N   1 
ATOM   446  C  CA  . ILE A 1 66  ? -38.098 28.493 20.923 1.00 76.42  ? 239 ILE A CA  1 
ATOM   447  C  C   . ILE A 1 66  ? -39.180 28.739 21.983 1.00 76.49  ? 239 ILE A C   1 
ATOM   448  O  O   . ILE A 1 66  ? -39.015 29.544 22.902 1.00 76.42  ? 239 ILE A O   1 
ATOM   449  C  CB  . ILE A 1 66  ? -37.107 27.375 21.358 1.00 76.04  ? 239 ILE A CB  1 
ATOM   450  C  CG1 . ILE A 1 66  ? -37.814 26.031 21.517 1.00 75.84  ? 239 ILE A CG1 1 
ATOM   451  C  CG2 . ILE A 1 66  ? -36.447 27.715 22.656 1.00 75.98  ? 239 ILE A CG2 1 
ATOM   452  C  CD1 . ILE A 1 66  ? -38.359 25.451 20.236 1.00 75.67  ? 239 ILE A CD1 1 
ATOM   453  N  N   . ARG A 1 67  ? -40.302 28.053 21.818 1.00 76.67  ? 240 ARG A N   1 
ATOM   454  C  CA  . ARG A 1 67  ? -41.414 28.110 22.759 1.00 76.85  ? 240 ARG A CA  1 
ATOM   455  C  C   . ARG A 1 67  ? -42.039 26.716 22.786 1.00 76.73  ? 240 ARG A C   1 
ATOM   456  O  O   . ARG A 1 67  ? -41.795 25.914 21.878 1.00 76.59  ? 240 ARG A O   1 
ATOM   457  C  CB  . ARG A 1 67  ? -42.430 29.175 22.323 1.00 77.02  ? 240 ARG A CB  1 
ATOM   458  C  CG  . ARG A 1 67  ? -42.533 29.363 20.791 1.00 77.60  ? 240 ARG A CG  1 
ATOM   459  C  CD  . ARG A 1 67  ? -43.338 30.603 20.396 1.00 77.90  ? 240 ARG A CD  1 
ATOM   460  N  NE  . ARG A 1 67  ? -44.785 30.361 20.373 1.00 78.06  ? 240 ARG A NE  1 
ATOM   461  C  CZ  . ARG A 1 67  ? -45.612 30.777 19.410 1.00 78.21  ? 240 ARG A CZ  1 
ATOM   462  N  NH1 . ARG A 1 67  ? -45.160 31.479 18.377 1.00 78.48  ? 240 ARG A NH1 1 
ATOM   463  N  NH2 . ARG A 1 67  ? -46.908 30.508 19.486 1.00 77.93  ? 240 ARG A NH2 1 
ATOM   464  N  N   . ALA A 1 68  ? -42.813 26.411 23.826 1.00 76.65  ? 241 ALA A N   1 
ATOM   465  C  CA  . ALA A 1 68  ? -43.519 25.128 23.879 1.00 76.55  ? 241 ALA A CA  1 
ATOM   466  C  C   . ALA A 1 68  ? -44.873 25.246 24.557 1.00 76.60  ? 241 ALA A C   1 
ATOM   467  O  O   . ALA A 1 68  ? -45.037 25.999 25.519 1.00 76.72  ? 241 ALA A O   1 
ATOM   468  C  CB  . ALA A 1 68  ? -42.676 24.072 24.561 1.00 76.42  ? 241 ALA A CB  1 
ATOM   469  N  N   . LYS A 1 69  ? -45.843 24.502 24.038 1.00 76.57  ? 242 LYS A N   1 
ATOM   470  C  CA  . LYS A 1 69  ? -47.174 24.472 24.618 1.00 76.70  ? 242 LYS A CA  1 
ATOM   471  C  C   . LYS A 1 69  ? -47.425 23.103 25.207 1.00 76.70  ? 242 LYS A C   1 
ATOM   472  O  O   . LYS A 1 69  ? -47.051 22.085 24.623 1.00 76.70  ? 242 LYS A O   1 
ATOM   473  C  CB  . LYS A 1 69  ? -48.244 24.752 23.556 1.00 76.85  ? 242 LYS A CB  1 
ATOM   474  C  CG  . LYS A 1 69  ? -48.244 26.152 22.957 1.00 77.38  ? 242 LYS A CG  1 
ATOM   475  C  CD  . LYS A 1 69  ? -48.555 27.216 24.004 1.00 78.85  ? 242 LYS A CD  1 
ATOM   476  C  CE  . LYS A 1 69  ? -48.679 28.599 23.373 1.00 79.13  ? 242 LYS A CE  1 
ATOM   477  N  NZ  . LYS A 1 69  ? -48.752 29.674 24.405 1.00 79.37  ? 242 LYS A NZ  1 
ATOM   478  N  N   . LEU A 1 70  ? -48.057 23.075 26.370 1.00 76.79  ? 243 LEU A N   1 
ATOM   479  C  CA  . LEU A 1 70  ? -48.565 21.823 26.886 1.00 77.06  ? 243 LEU A CA  1 
ATOM   480  C  C   . LEU A 1 70  ? -50.009 21.658 26.454 1.00 77.41  ? 243 LEU A C   1 
ATOM   481  O  O   . LEU A 1 70  ? -50.864 22.506 26.734 1.00 77.42  ? 243 LEU A O   1 
ATOM   482  C  CB  . LEU A 1 70  ? -48.475 21.757 28.405 1.00 77.00  ? 243 LEU A CB  1 
ATOM   483  C  CG  . LEU A 1 70  ? -49.172 20.526 28.986 1.00 76.75  ? 243 LEU A CG  1 
ATOM   484  C  CD1 . LEU A 1 70  ? -48.284 19.300 28.856 1.00 77.22  ? 243 LEU A CD1 1 
ATOM   485  C  CD2 . LEU A 1 70  ? -49.568 20.758 30.425 1.00 76.48  ? 243 LEU A CD2 1 
ATOM   486  N  N   . ILE A 1 71  ? -50.271 20.560 25.761 1.00 77.77  ? 244 ILE A N   1 
ATOM   487  C  CA  . ILE A 1 71  ? -51.623 20.223 25.391 1.00 78.05  ? 244 ILE A CA  1 
ATOM   488  C  C   . ILE A 1 71  ? -52.098 19.131 26.341 1.00 78.45  ? 244 ILE A C   1 
ATOM   489  O  O   . ILE A 1 71  ? -51.516 18.051 26.411 1.00 78.39  ? 244 ILE A O   1 
ATOM   490  C  CB  . ILE A 1 71  ? -51.717 19.766 23.922 1.00 77.92  ? 244 ILE A CB  1 
ATOM   491  C  CG1 . ILE A 1 71  ? -50.916 20.688 23.013 1.00 77.44  ? 244 ILE A CG1 1 
ATOM   492  C  CG2 . ILE A 1 71  ? -53.148 19.774 23.465 1.00 78.18  ? 244 ILE A CG2 1 
ATOM   493  C  CD1 . ILE A 1 71  ? -51.475 22.078 22.924 1.00 77.70  ? 244 ILE A CD1 1 
ATOM   494  N  N   . LYS A 1 72  ? -53.137 19.441 27.099 1.00 79.07  ? 245 LYS A N   1 
ATOM   495  C  CA  . LYS A 1 72  ? -53.750 18.473 27.986 1.00 79.91  ? 245 LYS A CA  1 
ATOM   496  C  C   . LYS A 1 72  ? -55.164 18.915 28.338 1.00 80.18  ? 245 LYS A C   1 
ATOM   497  O  O   . LYS A 1 72  ? -55.371 20.013 28.885 1.00 80.28  ? 245 LYS A O   1 
ATOM   498  C  CB  . LYS A 1 72  ? -52.925 18.288 29.258 1.00 80.03  ? 245 LYS A CB  1 
ATOM   499  C  CG  . LYS A 1 72  ? -53.653 17.491 30.331 1.00 81.73  ? 245 LYS A CG  1 
ATOM   500  C  CD  . LYS A 1 72  ? -52.871 17.469 31.627 1.00 84.91  ? 245 LYS A CD  1 
ATOM   501  C  CE  . LYS A 1 72  ? -53.703 16.901 32.786 1.00 86.60  ? 245 LYS A CE  1 
ATOM   502  N  NZ  . LYS A 1 72  ? -52.831 16.631 33.988 1.00 87.49  ? 245 LYS A NZ  1 
ATOM   503  N  N   . SER A 1 73  ? -56.127 18.051 28.011 1.00 80.35  ? 246 SER A N   1 
ATOM   504  C  CA  . SER A 1 73  ? -57.527 18.260 28.361 1.00 80.39  ? 246 SER A CA  1 
ATOM   505  C  C   . SER A 1 73  ? -57.668 18.405 29.866 1.00 80.38  ? 246 SER A C   1 
ATOM   506  O  O   . SER A 1 73  ? -57.190 17.561 30.632 1.00 80.55  ? 246 SER A O   1 
ATOM   507  C  CB  . SER A 1 73  ? -58.384 17.093 27.862 1.00 80.48  ? 246 SER A CB  1 
ATOM   508  O  OG  . SER A 1 73  ? -58.477 17.094 26.446 1.00 80.44  ? 246 SER A OG  1 
ATOM   509  N  N   . LYS A 1 74  ? -58.306 19.482 30.299 1.00 80.34  ? 247 LYS A N   1 
ATOM   510  C  CA  . LYS A 1 74  ? -58.475 19.679 31.727 1.00 80.41  ? 247 LYS A CA  1 
ATOM   511  C  C   . LYS A 1 74  ? -59.894 20.067 32.123 1.00 80.66  ? 247 LYS A C   1 
ATOM   512  O  O   . LYS A 1 74  ? -60.693 20.528 31.296 1.00 80.56  ? 247 LYS A O   1 
ATOM   513  C  CB  . LYS A 1 74  ? -57.455 20.686 32.265 1.00 80.37  ? 247 LYS A CB  1 
ATOM   514  C  CG  . LYS A 1 74  ? -57.852 22.137 32.123 1.00 79.55  ? 247 LYS A CG  1 
ATOM   515  C  CD  . LYS A 1 74  ? -57.195 22.941 33.211 1.00 78.88  ? 247 LYS A CD  1 
ATOM   516  C  CE  . LYS A 1 74  ? -58.114 24.034 33.681 1.00 79.57  ? 247 LYS A CE  1 
ATOM   517  N  NZ  . LYS A 1 74  ? -57.862 24.350 35.108 1.00 80.26  ? 247 LYS A NZ  1 
ATOM   518  N  N   . GLN A 1 75  ? -60.194 19.860 33.401 1.00 80.80  ? 248 GLN A N   1 
ATOM   519  C  CA  . GLN A 1 75  ? -61.473 20.237 33.956 1.00 81.07  ? 248 GLN A CA  1 
ATOM   520  C  C   . GLN A 1 75  ? -61.282 21.260 35.070 1.00 80.63  ? 248 GLN A C   1 
ATOM   521  O  O   . GLN A 1 75  ? -60.486 21.065 35.982 1.00 80.71  ? 248 GLN A O   1 
ATOM   522  C  CB  . GLN A 1 75  ? -62.217 19.005 34.463 1.00 81.45  ? 248 GLN A CB  1 
ATOM   523  C  CG  . GLN A 1 75  ? -63.702 19.254 34.702 1.00 83.60  ? 248 GLN A CG  1 
ATOM   524  C  CD  . GLN A 1 75  ? -64.500 17.977 34.916 1.00 85.90  ? 248 GLN A CD  1 
ATOM   525  O  OE1 . GLN A 1 75  ? -65.658 17.875 34.494 1.00 86.68  ? 248 GLN A OE1 1 
ATOM   526  N  NE2 . GLN A 1 75  ? -63.884 16.994 35.574 1.00 87.04  ? 248 GLN A NE2 1 
ATOM   527  N  N   . THR A 1 76  ? -62.011 22.361 34.977 1.00 80.24  ? 249 THR A N   1 
ATOM   528  C  CA  . THR A 1 76  ? -61.928 23.403 35.975 1.00 79.94  ? 249 THR A CA  1 
ATOM   529  C  C   . THR A 1 76  ? -62.689 22.980 37.232 1.00 79.90  ? 249 THR A C   1 
ATOM   530  O  O   . THR A 1 76  ? -63.597 22.156 37.172 1.00 79.79  ? 249 THR A O   1 
ATOM   531  C  CB  . THR A 1 76  ? -62.468 24.748 35.432 1.00 79.92  ? 249 THR A CB  1 
ATOM   532  O  OG1 . THR A 1 76  ? -63.903 24.757 35.458 1.00 79.67  ? 249 THR A OG1 1 
ATOM   533  C  CG2 . THR A 1 76  ? -61.978 24.982 34.008 1.00 79.59  ? 249 THR A CG2 1 
ATOM   534  N  N   . SER A 1 77  ? -62.304 23.550 38.367 1.00 79.82  ? 250 SER A N   1 
ATOM   535  C  CA  . SER A 1 77  ? -62.966 23.296 39.636 1.00 79.75  ? 250 SER A CA  1 
ATOM   536  C  C   . SER A 1 77  ? -64.453 23.625 39.596 1.00 79.69  ? 250 SER A C   1 
ATOM   537  O  O   . SER A 1 77  ? -65.172 23.353 40.554 1.00 79.95  ? 250 SER A O   1 
ATOM   538  C  CB  . SER A 1 77  ? -62.290 24.096 40.758 1.00 79.93  ? 250 SER A CB  1 
ATOM   539  O  OG  . SER A 1 77  ? -62.275 25.488 40.479 1.00 79.93  ? 250 SER A OG  1 
ATOM   540  N  N   . GLU A 1 78  ? -64.904 24.227 38.500 1.00 79.53  ? 251 GLU A N   1 
ATOM   541  C  CA  . GLU A 1 78  ? -66.316 24.535 38.323 1.00 79.40  ? 251 GLU A CA  1 
ATOM   542  C  C   . GLU A 1 78  ? -66.945 23.593 37.310 1.00 79.42  ? 251 GLU A C   1 
ATOM   543  O  O   . GLU A 1 78  ? -68.089 23.773 36.899 1.00 79.45  ? 251 GLU A O   1 
ATOM   544  C  CB  . GLU A 1 78  ? -66.516 25.987 37.896 1.00 79.36  ? 251 GLU A CB  1 
ATOM   545  C  CG  . GLU A 1 78  ? -66.278 26.993 39.006 1.00 79.29  ? 251 GLU A CG  1 
ATOM   546  C  CD  . GLU A 1 78  ? -64.839 27.460 39.074 1.00 79.38  ? 251 GLU A CD  1 
ATOM   547  O  OE1 . GLU A 1 78  ? -64.078 27.149 38.128 1.00 79.09  ? 251 GLU A OE1 1 
ATOM   548  O  OE2 . GLU A 1 78  ? -64.476 28.142 40.066 1.00 79.14  ? 251 GLU A OE2 1 
ATOM   549  N  N   . GLY A 1 79  ? -66.188 22.585 36.902 1.00 79.48  ? 252 GLY A N   1 
ATOM   550  C  CA  . GLY A 1 79  ? -66.729 21.548 36.040 1.00 79.63  ? 252 GLY A CA  1 
ATOM   551  C  C   . GLY A 1 79  ? -66.675 21.830 34.554 1.00 79.67  ? 252 GLY A C   1 
ATOM   552  O  O   . GLY A 1 79  ? -67.116 21.005 33.764 1.00 79.53  ? 252 GLY A O   1 
ATOM   553  N  N   . GLU A 1 80  ? -66.143 22.989 34.167 1.00 79.96  ? 253 GLU A N   1 
ATOM   554  C  CA  . GLU A 1 80  ? -65.935 23.291 32.747 1.00 80.21  ? 253 GLU A CA  1 
ATOM   555  C  C   . GLU A 1 80  ? -64.850 22.373 32.215 1.00 80.36  ? 253 GLU A C   1 
ATOM   556  O  O   . GLU A 1 80  ? -63.772 22.279 32.796 1.00 80.57  ? 253 GLU A O   1 
ATOM   557  C  CB  . GLU A 1 80  ? -65.535 24.756 32.530 1.00 80.18  ? 253 GLU A CB  1 
ATOM   558  C  CG  . GLU A 1 80  ? -65.415 25.181 31.055 1.00 80.25  ? 253 GLU A CG  1 
ATOM   559  C  CD  . GLU A 1 80  ? -65.012 26.655 30.886 1.00 80.83  ? 253 GLU A CD  1 
ATOM   560  O  OE1 . GLU A 1 80  ? -64.706 27.319 31.906 1.00 80.74  ? 253 GLU A OE1 1 
ATOM   561  O  OE2 . GLU A 1 80  ? -65.011 27.154 29.732 1.00 80.53  ? 253 GLU A OE2 1 
ATOM   562  N  N   . PHE A 1 81  ? -65.147 21.677 31.125 1.00 80.55  ? 254 PHE A N   1 
ATOM   563  C  CA  . PHE A 1 81  ? -64.177 20.786 30.508 1.00 80.49  ? 254 PHE A CA  1 
ATOM   564  C  C   . PHE A 1 81  ? -63.542 21.469 29.304 1.00 80.48  ? 254 PHE A C   1 
ATOM   565  O  O   . PHE A 1 81  ? -64.253 21.878 28.375 1.00 80.61  ? 254 PHE A O   1 
ATOM   566  C  CB  . PHE A 1 81  ? -64.830 19.470 30.082 1.00 80.39  ? 254 PHE A CB  1 
ATOM   567  C  CG  . PHE A 1 81  ? -63.862 18.492 29.489 1.00 80.70  ? 254 PHE A CG  1 
ATOM   568  C  CD1 . PHE A 1 81  ? -63.018 17.747 30.310 1.00 80.99  ? 254 PHE A CD1 1 
ATOM   569  C  CD2 . PHE A 1 81  ? -63.769 18.330 28.109 1.00 80.87  ? 254 PHE A CD2 1 
ATOM   570  C  CE1 . PHE A 1 81  ? -62.102 16.844 29.762 1.00 80.71  ? 254 PHE A CE1 1 
ATOM   571  C  CE2 . PHE A 1 81  ? -62.856 17.432 27.553 1.00 80.65  ? 254 PHE A CE2 1 
ATOM   572  C  CZ  . PHE A 1 81  ? -62.023 16.688 28.384 1.00 80.67  ? 254 PHE A CZ  1 
ATOM   573  N  N   . ILE A 1 82  ? -62.212 21.592 29.329 1.00 80.22  ? 255 ILE A N   1 
ATOM   574  C  CA  . ILE A 1 82  ? -61.462 22.150 28.202 1.00 79.89  ? 255 ILE A CA  1 
ATOM   575  C  C   . ILE A 1 82  ? -60.714 21.057 27.451 1.00 79.64  ? 255 ILE A C   1 
ATOM   576  O  O   . ILE A 1 82  ? -59.655 20.618 27.899 1.00 79.61  ? 255 ILE A O   1 
ATOM   577  C  CB  . ILE A 1 82  ? -60.419 23.197 28.642 1.00 79.91  ? 255 ILE A CB  1 
ATOM   578  C  CG1 . ILE A 1 82  ? -60.882 23.974 29.884 1.00 79.99  ? 255 ILE A CG1 1 
ATOM   579  C  CG2 . ILE A 1 82  ? -60.054 24.098 27.463 1.00 79.83  ? 255 ILE A CG2 1 
ATOM   580  C  CD1 . ILE A 1 82  ? -61.922 25.049 29.617 1.00 80.94  ? 255 ILE A CD1 1 
ATOM   581  N  N   . PRO A 1 83  ? -61.262 20.608 26.306 1.00 79.42  ? 256 PRO A N   1 
ATOM   582  C  CA  . PRO A 1 83  ? -60.516 19.641 25.529 1.00 79.24  ? 256 PRO A CA  1 
ATOM   583  C  C   . PRO A 1 83  ? -59.198 20.246 25.068 1.00 79.07  ? 256 PRO A C   1 
ATOM   584  O  O   . PRO A 1 83  ? -59.145 21.416 24.678 1.00 79.07  ? 256 PRO A O   1 
ATOM   585  C  CB  . PRO A 1 83  ? -61.435 19.350 24.332 1.00 79.18  ? 256 PRO A CB  1 
ATOM   586  C  CG  . PRO A 1 83  ? -62.385 20.457 24.272 1.00 79.21  ? 256 PRO A CG  1 
ATOM   587  C  CD  . PRO A 1 83  ? -62.556 20.934 25.681 1.00 79.52  ? 256 PRO A CD  1 
ATOM   588  N  N   . LEU A 1 84  ? -58.139 19.456 25.166 1.00 78.79  ? 257 LEU A N   1 
ATOM   589  C  CA  . LEU A 1 84  ? -56.829 19.850 24.674 1.00 78.52  ? 257 LEU A CA  1 
ATOM   590  C  C   . LEU A 1 84  ? -56.411 21.287 25.029 1.00 78.23  ? 257 LEU A C   1 
ATOM   591  O  O   . LEU A 1 84  ? -55.809 21.986 24.213 1.00 78.35  ? 257 LEU A O   1 
ATOM   592  C  CB  . LEU A 1 84  ? -56.756 19.612 23.165 1.00 78.52  ? 257 LEU A CB  1 
ATOM   593  C  CG  . LEU A 1 84  ? -56.276 18.225 22.737 1.00 78.57  ? 257 LEU A CG  1 
ATOM   594  C  CD1 . LEU A 1 84  ? -57.183 17.098 23.253 1.00 78.52  ? 257 LEU A CD1 1 
ATOM   595  C  CD2 . LEU A 1 84  ? -56.155 18.196 21.225 1.00 78.42  ? 257 LEU A CD2 1 
ATOM   596  N  N   . ASN A 1 85  ? -56.723 21.710 26.251 1.00 77.81  ? 258 ASN A N   1 
ATOM   597  C  CA  . ASN A 1 85  ? -56.251 22.985 26.777 1.00 77.43  ? 258 ASN A CA  1 
ATOM   598  C  C   . ASN A 1 85  ? -54.755 23.226 26.541 1.00 77.33  ? 258 ASN A C   1 
ATOM   599  O  O   . ASN A 1 85  ? -53.945 22.300 26.617 1.00 77.32  ? 258 ASN A O   1 
ATOM   600  C  CB  . ASN A 1 85  ? -56.541 23.068 28.270 1.00 77.35  ? 258 ASN A CB  1 
ATOM   601  C  CG  . ASN A 1 85  ? -56.487 24.483 28.789 1.00 77.11  ? 258 ASN A CG  1 
ATOM   602  O  OD1 . ASN A 1 85  ? -57.203 25.358 28.313 1.00 76.46  ? 258 ASN A OD1 1 
ATOM   603  N  ND2 . ASN A 1 85  ? -55.635 24.717 29.774 1.00 77.69  ? 258 ASN A ND2 1 
ATOM   604  N  N   . GLN A 1 86  ? -54.398 24.474 26.253 1.00 77.10  ? 259 GLN A N   1 
ATOM   605  C  CA  . GLN A 1 86  ? -53.005 24.845 26.067 1.00 76.93  ? 259 GLN A CA  1 
ATOM   606  C  C   . GLN A 1 86  ? -52.518 25.748 27.189 1.00 76.84  ? 259 GLN A C   1 
ATOM   607  O  O   . GLN A 1 86  ? -53.190 26.713 27.548 1.00 76.81  ? 259 GLN A O   1 
ATOM   608  C  CB  . GLN A 1 86  ? -52.829 25.608 24.767 1.00 76.96  ? 259 GLN A CB  1 
ATOM   609  C  CG  . GLN A 1 86  ? -53.205 24.888 23.515 1.00 77.35  ? 259 GLN A CG  1 
ATOM   610  C  CD  . GLN A 1 86  ? -52.851 25.697 22.285 1.00 78.39  ? 259 GLN A CD  1 
ATOM   611  O  OE1 . GLN A 1 86  ? -53.484 25.560 21.242 1.00 79.94  ? 259 GLN A OE1 1 
ATOM   612  N  NE2 . GLN A 1 86  ? -51.842 26.557 22.404 1.00 78.16  ? 259 GLN A NE2 1 
ATOM   613  N  N   . THR A 1 87  ? -51.347 25.440 27.735 1.00 76.77  ? 260 THR A N   1 
ATOM   614  C  CA  . THR A 1 87  ? -50.636 26.373 28.607 1.00 76.80  ? 260 THR A CA  1 
ATOM   615  C  C   . THR A 1 87  ? -49.160 26.383 28.239 1.00 77.06  ? 260 THR A C   1 
ATOM   616  O  O   . THR A 1 87  ? -48.632 25.399 27.721 1.00 77.11  ? 260 THR A O   1 
ATOM   617  C  CB  . THR A 1 87  ? -50.786 26.034 30.093 1.00 76.61  ? 260 THR A CB  1 
ATOM   618  O  OG1 . THR A 1 87  ? -50.434 24.667 30.295 1.00 76.48  ? 260 THR A OG1 1 
ATOM   619  C  CG2 . THR A 1 87  ? -52.220 26.279 30.577 1.00 76.37  ? 260 THR A CG2 1 
ATOM   620  N  N   . ASP A 1 88  ? -48.494 27.501 28.504 1.00 77.44  ? 261 ASP A N   1 
ATOM   621  C  CA  . ASP A 1 88  ? -47.123 27.681 28.038 1.00 77.77  ? 261 ASP A CA  1 
ATOM   622  C  C   . ASP A 1 88  ? -46.138 26.949 28.929 1.00 77.78  ? 261 ASP A C   1 
ATOM   623  O  O   . ASP A 1 88  ? -46.263 26.976 30.144 1.00 77.91  ? 261 ASP A O   1 
ATOM   624  C  CB  . ASP A 1 88  ? -46.758 29.171 27.940 1.00 77.78  ? 261 ASP A CB  1 
ATOM   625  C  CG  . ASP A 1 88  ? -45.840 29.471 26.758 1.00 77.78  ? 261 ASP A CG  1 
ATOM   626  O  OD1 . ASP A 1 88  ? -46.351 29.922 25.708 1.00 77.51  ? 261 ASP A OD1 1 
ATOM   627  O  OD2 . ASP A 1 88  ? -44.617 29.231 26.867 1.00 77.85  ? 261 ASP A OD2 1 
ATOM   628  N  N   . ILE A 1 89  ? -45.173 26.280 28.312 1.00 77.82  ? 262 ILE A N   1 
ATOM   629  C  CA  . ILE A 1 89  ? -44.059 25.695 29.038 1.00 77.99  ? 262 ILE A CA  1 
ATOM   630  C  C   . ILE A 1 89  ? -42.903 26.692 29.009 1.00 78.24  ? 262 ILE A C   1 
ATOM   631  O  O   . ILE A 1 89  ? -42.577 27.237 27.953 1.00 78.52  ? 262 ILE A O   1 
ATOM   632  C  CB  . ILE A 1 89  ? -43.637 24.348 28.419 1.00 77.94  ? 262 ILE A CB  1 
ATOM   633  C  CG1 . ILE A 1 89  ? -44.694 23.284 28.717 1.00 77.88  ? 262 ILE A CG1 1 
ATOM   634  C  CG2 . ILE A 1 89  ? -42.272 23.904 28.939 1.00 77.95  ? 262 ILE A CG2 1 
ATOM   635  C  CD1 . ILE A 1 89  ? -44.518 22.000 27.934 1.00 77.72  ? 262 ILE A CD1 1 
ATOM   636  N  N   . ASN A 1 90  ? -42.302 26.944 30.169 1.00 78.32  ? 263 ASN A N   1 
ATOM   637  C  CA  . ASN A 1 90  ? -41.213 27.901 30.268 1.00 78.43  ? 263 ASN A CA  1 
ATOM   638  C  C   . ASN A 1 90  ? -39.913 27.305 29.775 1.00 78.22  ? 263 ASN A C   1 
ATOM   639  O  O   . ASN A 1 90  ? -39.351 26.425 30.416 1.00 78.38  ? 263 ASN A O   1 
ATOM   640  C  CB  . ASN A 1 90  ? -41.047 28.383 31.712 1.00 78.71  ? 263 ASN A CB  1 
ATOM   641  C  CG  . ASN A 1 90  ? -39.978 29.466 31.853 1.00 79.82  ? 263 ASN A CG  1 
ATOM   642  O  OD1 . ASN A 1 90  ? -39.348 29.877 30.871 1.00 81.28  ? 263 ASN A OD1 1 
ATOM   643  N  ND2 . ASN A 1 90  ? -39.777 29.939 33.079 1.00 80.42  ? 263 ASN A ND2 1 
ATOM   644  N  N   . VAL A 1 91  ? -39.431 27.783 28.636 1.00 78.13  ? 264 VAL A N   1 
ATOM   645  C  CA  . VAL A 1 91  ? -38.114 27.360 28.151 1.00 78.12  ? 264 VAL A CA  1 
ATOM   646  C  C   . VAL A 1 91  ? -37.203 28.554 27.877 1.00 78.20  ? 264 VAL A C   1 
ATOM   647  O  O   . VAL A 1 91  ? -36.463 28.594 26.887 1.00 78.04  ? 264 VAL A O   1 
ATOM   648  C  CB  . VAL A 1 91  ? -38.182 26.408 26.932 1.00 77.99  ? 264 VAL A CB  1 
ATOM   649  C  CG1 . VAL A 1 91  ? -38.905 25.128 27.301 1.00 77.82  ? 264 VAL A CG1 1 
ATOM   650  C  CG2 . VAL A 1 91  ? -38.839 27.084 25.744 1.00 78.21  ? 264 VAL A CG2 1 
ATOM   651  N  N   . GLY A 1 92  ? -37.277 29.528 28.777 1.00 78.43  ? 265 GLY A N   1 
ATOM   652  C  CA  . GLY A 1 92  ? -36.330 30.628 28.806 1.00 78.57  ? 265 GLY A CA  1 
ATOM   653  C  C   . GLY A 1 92  ? -36.943 31.972 28.506 1.00 78.64  ? 265 GLY A C   1 
ATOM   654  O  O   . GLY A 1 92  ? -36.222 32.945 28.293 1.00 78.88  ? 265 GLY A O   1 
ATOM   655  N  N   . TYR A 1 93  ? -38.273 32.032 28.491 1.00 78.67  ? 266 TYR A N   1 
ATOM   656  C  CA  . TYR A 1 93  ? -38.977 33.268 28.149 1.00 78.57  ? 266 TYR A CA  1 
ATOM   657  C  C   . TYR A 1 93  ? -38.541 34.449 29.014 1.00 78.26  ? 266 TYR A C   1 
ATOM   658  O  O   . TYR A 1 93  ? -38.319 35.552 28.515 1.00 78.25  ? 266 TYR A O   1 
ATOM   659  C  CB  . TYR A 1 93  ? -40.494 33.069 28.242 1.00 78.69  ? 266 TYR A CB  1 
ATOM   660  C  CG  . TYR A 1 93  ? -41.317 34.305 27.906 1.00 79.18  ? 266 TYR A CG  1 
ATOM   661  C  CD1 . TYR A 1 93  ? -41.048 35.073 26.768 1.00 79.52  ? 266 TYR A CD1 1 
ATOM   662  C  CD2 . TYR A 1 93  ? -42.383 34.691 28.711 1.00 79.78  ? 266 TYR A CD2 1 
ATOM   663  C  CE1 . TYR A 1 93  ? -41.812 36.198 26.456 1.00 78.88  ? 266 TYR A CE1 1 
ATOM   664  C  CE2 . TYR A 1 93  ? -43.151 35.817 28.402 1.00 79.46  ? 266 TYR A CE2 1 
ATOM   665  C  CZ  . TYR A 1 93  ? -42.857 36.558 27.279 1.00 78.71  ? 266 TYR A CZ  1 
ATOM   666  O  OH  . TYR A 1 93  ? -43.618 37.656 26.986 1.00 78.44  ? 266 TYR A OH  1 
ATOM   667  N  N   . TYR A 1 94  ? -38.393 34.198 30.307 1.00 77.93  ? 267 TYR A N   1 
ATOM   668  C  CA  . TYR A 1 94  ? -38.139 35.259 31.258 1.00 77.60  ? 267 TYR A CA  1 
ATOM   669  C  C   . TYR A 1 94  ? -36.751 35.877 31.167 1.00 77.45  ? 267 TYR A C   1 
ATOM   670  O  O   . TYR A 1 94  ? -36.569 37.031 31.532 1.00 77.73  ? 267 TYR A O   1 
ATOM   671  C  CB  . TYR A 1 94  ? -38.378 34.742 32.668 1.00 77.65  ? 267 TYR A CB  1 
ATOM   672  C  CG  . TYR A 1 94  ? -39.830 34.487 32.985 1.00 77.52  ? 267 TYR A CG  1 
ATOM   673  C  CD1 . TYR A 1 94  ? -40.741 35.540 33.049 1.00 77.27  ? 267 TYR A CD1 1 
ATOM   674  C  CD2 . TYR A 1 94  ? -40.292 33.198 33.234 1.00 77.36  ? 267 TYR A CD2 1 
ATOM   675  C  CE1 . TYR A 1 94  ? -42.073 35.318 33.346 1.00 77.03  ? 267 TYR A CE1 1 
ATOM   676  C  CE2 . TYR A 1 94  ? -41.629 32.967 33.532 1.00 77.21  ? 267 TYR A CE2 1 
ATOM   677  C  CZ  . TYR A 1 94  ? -42.508 34.035 33.586 1.00 76.88  ? 267 TYR A CZ  1 
ATOM   678  O  OH  . TYR A 1 94  ? -43.830 33.836 33.880 1.00 77.24  ? 267 TYR A OH  1 
ATOM   679  N  N   . THR A 1 95  ? -35.773 35.115 30.694 1.00 77.22  ? 268 THR A N   1 
ATOM   680  C  CA  . THR A 1 95  ? -34.387 35.567 30.711 1.00 76.81  ? 268 THR A CA  1 
ATOM   681  C  C   . THR A 1 95  ? -33.787 35.671 29.321 1.00 76.95  ? 268 THR A C   1 
ATOM   682  O  O   . THR A 1 95  ? -32.592 35.920 29.182 1.00 77.52  ? 268 THR A O   1 
ATOM   683  C  CB  . THR A 1 95  ? -33.514 34.621 31.523 1.00 76.54  ? 268 THR A CB  1 
ATOM   684  O  OG1 . THR A 1 95  ? -33.574 33.319 30.937 1.00 76.07  ? 268 THR A OG1 1 
ATOM   685  C  CG2 . THR A 1 95  ? -34.002 34.553 32.954 1.00 76.56  ? 268 THR A CG2 1 
ATOM   686  N  N   . GLY A 1 96  ? -34.607 35.475 28.293 1.00 76.77  ? 269 GLY A N   1 
ATOM   687  C  CA  . GLY A 1 96  ? -34.137 35.560 26.916 1.00 76.48  ? 269 GLY A CA  1 
ATOM   688  C  C   . GLY A 1 96  ? -33.279 34.381 26.485 1.00 76.33  ? 269 GLY A C   1 
ATOM   689  O  O   . GLY A 1 96  ? -32.593 34.442 25.466 1.00 76.58  ? 269 GLY A O   1 
ATOM   690  N  N   . ASP A 1 97  ? -33.315 33.304 27.263 1.00 75.95  ? 270 ASP A N   1 
ATOM   691  C  CA  . ASP A 1 97  ? -32.647 32.064 26.890 1.00 75.55  ? 270 ASP A CA  1 
ATOM   692  C  C   . ASP A 1 97  ? -33.488 31.219 25.928 1.00 75.30  ? 270 ASP A C   1 
ATOM   693  O  O   . ASP A 1 97  ? -33.142 30.079 25.626 1.00 75.27  ? 270 ASP A O   1 
ATOM   694  C  CB  . ASP A 1 97  ? -32.290 31.267 28.140 1.00 75.58  ? 270 ASP A CB  1 
ATOM   695  C  CG  . ASP A 1 97  ? -30.926 31.614 28.669 1.00 75.99  ? 270 ASP A CG  1 
ATOM   696  O  OD1 . ASP A 1 97  ? -29.940 31.070 28.140 1.00 77.11  ? 270 ASP A OD1 1 
ATOM   697  O  OD2 . ASP A 1 97  ? -30.830 32.433 29.604 1.00 76.50  ? 270 ASP A OD2 1 
ATOM   698  N  N   . ASP A 1 98  ? -34.602 31.775 25.461 1.00 74.97  ? 271 ASP A N   1 
ATOM   699  C  CA  . ASP A 1 98  ? -35.390 31.136 24.418 1.00 74.50  ? 271 ASP A CA  1 
ATOM   700  C  C   . ASP A 1 98  ? -35.063 31.798 23.097 1.00 74.49  ? 271 ASP A C   1 
ATOM   701  O  O   . ASP A 1 98  ? -35.503 31.360 22.038 1.00 74.39  ? 271 ASP A O   1 
ATOM   702  C  CB  . ASP A 1 98  ? -36.887 31.201 24.721 1.00 74.35  ? 271 ASP A CB  1 
ATOM   703  C  CG  . ASP A 1 98  ? -37.389 32.610 24.935 1.00 73.88  ? 271 ASP A CG  1 
ATOM   704  O  OD1 . ASP A 1 98  ? -36.584 33.542 25.143 1.00 73.43  ? 271 ASP A OD1 1 
ATOM   705  O  OD2 . ASP A 1 98  ? -38.618 32.779 24.907 1.00 73.65  ? 271 ASP A OD2 1 
ATOM   706  N  N   . ARG A 1 99  ? -34.274 32.863 23.179 1.00 74.65  ? 272 ARG A N   1 
ATOM   707  C  CA  . ARG A 1 99  ? -33.715 33.497 21.997 1.00 74.92  ? 272 ARG A CA  1 
ATOM   708  C  C   . ARG A 1 99  ? -32.452 32.758 21.606 1.00 75.05  ? 272 ARG A C   1 
ATOM   709  O  O   . ARG A 1 99  ? -31.355 33.086 22.060 1.00 74.99  ? 272 ARG A O   1 
ATOM   710  C  CB  . ARG A 1 99  ? -33.418 34.968 22.261 1.00 74.85  ? 272 ARG A CB  1 
ATOM   711  C  CG  . ARG A 1 99  ? -34.653 35.841 22.312 1.00 74.96  ? 272 ARG A CG  1 
ATOM   712  C  CD  . ARG A 1 99  ? -34.280 37.214 22.786 1.00 75.59  ? 272 ARG A CD  1 
ATOM   713  N  NE  . ARG A 1 99  ? -33.576 37.147 24.066 1.00 76.23  ? 272 ARG A NE  1 
ATOM   714  C  CZ  . ARG A 1 99  ? -32.752 38.086 24.522 1.00 76.78  ? 272 ARG A CZ  1 
ATOM   715  N  NH1 . ARG A 1 99  ? -32.505 39.178 23.797 1.00 76.95  ? 272 ARG A NH1 1 
ATOM   716  N  NH2 . ARG A 1 99  ? -32.163 37.928 25.705 1.00 77.44  ? 272 ARG A NH2 1 
ATOM   717  N  N   . LEU A 1 100 ? -32.626 31.754 20.755 1.00 75.33  ? 273 LEU A N   1 
ATOM   718  C  CA  . LEU A 1 100 ? -31.576 30.797 20.468 1.00 75.87  ? 273 LEU A CA  1 
ATOM   719  C  C   . LEU A 1 100 ? -30.484 31.326 19.539 1.00 76.38  ? 273 LEU A C   1 
ATOM   720  O  O   . LEU A 1 100 ? -30.749 32.115 18.628 1.00 76.72  ? 273 LEU A O   1 
ATOM   721  C  CB  . LEU A 1 100 ? -32.198 29.534 19.881 1.00 75.72  ? 273 LEU A CB  1 
ATOM   722  C  CG  . LEU A 1 100 ? -33.313 28.905 20.720 1.00 75.85  ? 273 LEU A CG  1 
ATOM   723  C  CD1 . LEU A 1 100 ? -33.929 27.742 19.988 1.00 76.46  ? 273 LEU A CD1 1 
ATOM   724  C  CD2 . LEU A 1 100 ? -32.800 28.446 22.076 1.00 76.26  ? 273 LEU A CD2 1 
ATOM   725  N  N   . PHE A 1 101 ? -29.250 30.897 19.784 1.00 76.79  ? 274 PHE A N   1 
ATOM   726  C  CA  . PHE A 1 101 ? -28.182 31.118 18.823 1.00 77.02  ? 274 PHE A CA  1 
ATOM   727  C  C   . PHE A 1 101 ? -27.919 29.785 18.172 1.00 77.21  ? 274 PHE A C   1 
ATOM   728  O  O   . PHE A 1 101 ? -27.081 28.999 18.631 1.00 77.26  ? 274 PHE A O   1 
ATOM   729  C  CB  . PHE A 1 101 ? -26.929 31.644 19.501 1.00 77.19  ? 274 PHE A CB  1 
ATOM   730  C  CG  . PHE A 1 101 ? -25.768 31.814 18.574 1.00 77.14  ? 274 PHE A CG  1 
ATOM   731  C  CD1 . PHE A 1 101 ? -25.902 32.548 17.404 1.00 77.01  ? 274 PHE A CD1 1 
ATOM   732  C  CD2 . PHE A 1 101 ? -24.535 31.251 18.882 1.00 77.04  ? 274 PHE A CD2 1 
ATOM   733  C  CE1 . PHE A 1 101 ? -24.829 32.717 16.555 1.00 77.36  ? 274 PHE A CE1 1 
ATOM   734  C  CE2 . PHE A 1 101 ? -23.452 31.422 18.045 1.00 77.17  ? 274 PHE A CE2 1 
ATOM   735  C  CZ  . PHE A 1 101 ? -23.597 32.156 16.877 1.00 77.46  ? 274 PHE A CZ  1 
ATOM   736  N  N   . LEU A 1 102 ? -28.667 29.531 17.105 1.00 77.37  ? 275 LEU A N   1 
ATOM   737  C  CA  . LEU A 1 102 ? -28.713 28.211 16.501 1.00 77.39  ? 275 LEU A CA  1 
ATOM   738  C  C   . LEU A 1 102 ? -27.653 28.052 15.419 1.00 77.40  ? 275 LEU A C   1 
ATOM   739  O  O   . LEU A 1 102 ? -27.822 28.507 14.285 1.00 77.40  ? 275 LEU A O   1 
ATOM   740  C  CB  . LEU A 1 102 ? -30.115 27.929 15.958 1.00 77.29  ? 275 LEU A CB  1 
ATOM   741  C  CG  . LEU A 1 102 ? -30.460 26.472 15.651 1.00 77.29  ? 275 LEU A CG  1 
ATOM   742  C  CD1 . LEU A 1 102 ? -30.189 25.555 16.838 1.00 76.72  ? 275 LEU A CD1 1 
ATOM   743  C  CD2 . LEU A 1 102 ? -31.910 26.373 15.210 1.00 77.40  ? 275 LEU A CD2 1 
ATOM   744  N  N   . VAL A 1 103 ? -26.549 27.417 15.796 1.00 77.34  ? 276 VAL A N   1 
ATOM   745  C  CA  . VAL A 1 103 ? -25.448 27.179 14.881 1.00 77.38  ? 276 VAL A CA  1 
ATOM   746  C  C   . VAL A 1 103 ? -24.929 25.776 15.090 1.00 77.41  ? 276 VAL A C   1 
ATOM   747  O  O   . VAL A 1 103 ? -23.878 25.406 14.557 1.00 77.57  ? 276 VAL A O   1 
ATOM   748  C  CB  . VAL A 1 103 ? -24.315 28.150 15.123 1.00 77.33  ? 276 VAL A CB  1 
ATOM   749  C  CG1 . VAL A 1 103 ? -24.673 29.503 14.560 1.00 77.61  ? 276 VAL A CG1 1 
ATOM   750  C  CG2 . VAL A 1 103 ? -24.045 28.244 16.600 1.00 77.55  ? 276 VAL A CG2 1 
ATOM   751  N  N   . SER A 1 104 ? -25.674 25.017 15.890 1.00 77.25  ? 277 SER A N   1 
ATOM   752  C  CA  . SER A 1 104 ? -25.471 23.585 16.075 1.00 76.96  ? 277 SER A CA  1 
ATOM   753  C  C   . SER A 1 104 ? -26.589 23.087 16.980 1.00 76.52  ? 277 SER A C   1 
ATOM   754  O  O   . SER A 1 104 ? -27.252 23.890 17.626 1.00 76.63  ? 277 SER A O   1 
ATOM   755  C  CB  . SER A 1 104 ? -24.122 23.320 16.732 1.00 77.06  ? 277 SER A CB  1 
ATOM   756  O  OG  . SER A 1 104 ? -24.068 23.979 17.983 1.00 77.77  ? 277 SER A OG  1 
ATOM   757  N  N   . PRO A 1 105 ? -26.792 21.762 17.047 1.00 76.10  ? 278 PRO A N   1 
ATOM   758  C  CA  . PRO A 1 105 ? -27.854 21.185 17.874 1.00 75.68  ? 278 PRO A CA  1 
ATOM   759  C  C   . PRO A 1 105 ? -27.748 21.612 19.323 1.00 75.10  ? 278 PRO A C   1 
ATOM   760  O  O   . PRO A 1 105 ? -26.696 21.449 19.941 1.00 75.07  ? 278 PRO A O   1 
ATOM   761  C  CB  . PRO A 1 105 ? -27.603 19.675 17.784 1.00 75.76  ? 278 PRO A CB  1 
ATOM   762  C  CG  . PRO A 1 105 ? -26.819 19.485 16.560 1.00 76.13  ? 278 PRO A CG  1 
ATOM   763  C  CD  . PRO A 1 105 ? -25.998 20.725 16.369 1.00 76.20  ? 278 PRO A CD  1 
ATOM   764  N  N   . LEU A 1 106 ? -28.846 22.138 19.854 1.00 74.41  ? 279 LEU A N   1 
ATOM   765  C  CA  . LEU A 1 106 ? -28.893 22.593 21.228 1.00 73.76  ? 279 LEU A CA  1 
ATOM   766  C  C   . LEU A 1 106 ? -29.912 21.809 22.033 1.00 73.43  ? 279 LEU A C   1 
ATOM   767  O  O   . LEU A 1 106 ? -30.981 21.461 21.532 1.00 73.21  ? 279 LEU A O   1 
ATOM   768  C  CB  . LEU A 1 106 ? -29.221 24.087 21.282 1.00 73.67  ? 279 LEU A CB  1 
ATOM   769  C  CG  . LEU A 1 106 ? -28.256 25.064 20.596 1.00 73.64  ? 279 LEU A CG  1 
ATOM   770  C  CD1 . LEU A 1 106 ? -28.831 26.478 20.540 1.00 73.67  ? 279 LEU A CD1 1 
ATOM   771  C  CD2 . LEU A 1 106 ? -26.879 25.076 21.254 1.00 73.93  ? 279 LEU A CD2 1 
ATOM   772  N  N   . ILE A 1 107 ? -29.564 21.516 23.282 1.00 73.23  ? 280 ILE A N   1 
ATOM   773  C  CA  . ILE A 1 107 ? -30.527 20.952 24.217 1.00 73.00  ? 280 ILE A CA  1 
ATOM   774  C  C   . ILE A 1 107 ? -31.257 22.093 24.894 1.00 72.63  ? 280 ILE A C   1 
ATOM   775  O  O   . ILE A 1 107 ? -30.658 22.895 25.611 1.00 72.68  ? 280 ILE A O   1 
ATOM   776  C  CB  . ILE A 1 107 ? -29.883 20.050 25.300 1.00 73.06  ? 280 ILE A CB  1 
ATOM   777  C  CG1 . ILE A 1 107 ? -29.075 18.926 24.666 1.00 72.97  ? 280 ILE A CG1 1 
ATOM   778  C  CG2 . ILE A 1 107 ? -30.962 19.422 26.176 1.00 73.03  ? 280 ILE A CG2 1 
ATOM   779  C  CD1 . ILE A 1 107 ? -28.379 18.081 25.677 1.00 73.40  ? 280 ILE A CD1 1 
ATOM   780  N  N   . ILE A 1 108 ? -32.554 22.160 24.649 1.00 72.17  ? 281 ILE A N   1 
ATOM   781  C  CA  . ILE A 1 108 ? -33.402 23.140 25.293 1.00 71.90  ? 281 ILE A CA  1 
ATOM   782  C  C   . ILE A 1 108 ? -33.850 22.533 26.622 1.00 71.87  ? 281 ILE A C   1 
ATOM   783  O  O   . ILE A 1 108 ? -34.135 21.331 26.686 1.00 72.12  ? 281 ILE A O   1 
ATOM   784  C  CB  . ILE A 1 108 ? -34.607 23.463 24.390 1.00 71.76  ? 281 ILE A CB  1 
ATOM   785  C  CG1 . ILE A 1 108 ? -34.151 23.706 22.949 1.00 71.40  ? 281 ILE A CG1 1 
ATOM   786  C  CG2 . ILE A 1 108 ? -35.384 24.643 24.909 1.00 71.82  ? 281 ILE A CG2 1 
ATOM   787  C  CD1 . ILE A 1 108 ? -32.960 24.633 22.801 1.00 71.11  ? 281 ILE A CD1 1 
ATOM   788  N  N   . SER A 1 109 ? -33.893 23.342 27.680 1.00 71.56  ? 282 SER A N   1 
ATOM   789  C  CA  . SER A 1 109 ? -34.256 22.834 29.009 1.00 71.41  ? 282 SER A CA  1 
ATOM   790  C  C   . SER A 1 109 ? -35.362 23.616 29.707 1.00 71.52  ? 282 SER A C   1 
ATOM   791  O  O   . SER A 1 109 ? -35.310 24.842 29.851 1.00 71.54  ? 282 SER A O   1 
ATOM   792  C  CB  . SER A 1 109 ? -33.029 22.737 29.926 1.00 71.46  ? 282 SER A CB  1 
ATOM   793  O  OG  . SER A 1 109 ? -33.381 22.307 31.232 1.00 70.74  ? 282 SER A OG  1 
ATOM   794  N  N   . HIS A 1 110 ? -36.372 22.884 30.145 1.00 71.58  ? 283 HIS A N   1 
ATOM   795  C  CA  . HIS A 1 110 ? -37.428 23.466 30.926 1.00 71.61  ? 283 HIS A CA  1 
ATOM   796  C  C   . HIS A 1 110 ? -37.240 22.953 32.325 1.00 71.96  ? 283 HIS A C   1 
ATOM   797  O  O   . HIS A 1 110 ? -37.403 21.761 32.568 1.00 72.16  ? 283 HIS A O   1 
ATOM   798  C  CB  . HIS A 1 110 ? -38.786 23.023 30.407 1.00 71.29  ? 283 HIS A CB  1 
ATOM   799  C  CG  . HIS A 1 110 ? -39.863 23.121 31.430 1.00 71.02  ? 283 HIS A CG  1 
ATOM   800  N  ND1 . HIS A 1 110 ? -40.395 24.325 31.831 1.00 72.05  ? 283 HIS A ND1 1 
ATOM   801  C  CD2 . HIS A 1 110 ? -40.480 22.173 32.169 1.00 71.16  ? 283 HIS A CD2 1 
ATOM   802  C  CE1 . HIS A 1 110 ? -41.312 24.113 32.757 1.00 71.69  ? 283 HIS A CE1 1 
ATOM   803  N  NE2 . HIS A 1 110 ? -41.383 22.815 32.981 1.00 70.97  ? 283 HIS A NE2 1 
ATOM   804  N  N   . GLU A 1 111 ? -36.881 23.839 33.245 1.00 72.31  ? 284 GLU A N   1 
ATOM   805  C  CA  . GLU A 1 111 ? -36.717 23.439 34.629 1.00 72.68  ? 284 GLU A CA  1 
ATOM   806  C  C   . GLU A 1 111 ? -38.080 23.225 35.289 1.00 72.62  ? 284 GLU A C   1 
ATOM   807  O  O   . GLU A 1 111 ? -38.947 24.106 35.258 1.00 72.67  ? 284 GLU A O   1 
ATOM   808  C  CB  . GLU A 1 111 ? -35.901 24.469 35.385 1.00 72.80  ? 284 GLU A CB  1 
ATOM   809  C  CG  . GLU A 1 111 ? -35.812 24.176 36.859 1.00 74.87  ? 284 GLU A CG  1 
ATOM   810  C  CD  . GLU A 1 111 ? -35.201 25.315 37.635 1.00 77.67  ? 284 GLU A CD  1 
ATOM   811  O  OE1 . GLU A 1 111 ? -34.166 25.849 37.164 1.00 78.85  ? 284 GLU A OE1 1 
ATOM   812  O  OE2 . GLU A 1 111 ? -35.755 25.670 38.709 1.00 78.31  ? 284 GLU A OE2 1 
ATOM   813  N  N   . ILE A 1 112 ? -38.254 22.043 35.876 1.00 72.62  ? 285 ILE A N   1 
ATOM   814  C  CA  . ILE A 1 112 ? -39.545 21.606 36.404 1.00 72.74  ? 285 ILE A CA  1 
ATOM   815  C  C   . ILE A 1 112 ? -39.795 22.207 37.787 1.00 73.30  ? 285 ILE A C   1 
ATOM   816  O  O   . ILE A 1 112 ? -39.630 21.535 38.795 1.00 73.48  ? 285 ILE A O   1 
ATOM   817  C  CB  . ILE A 1 112 ? -39.655 20.039 36.426 1.00 72.37  ? 285 ILE A CB  1 
ATOM   818  C  CG1 . ILE A 1 112 ? -39.469 19.473 35.023 1.00 71.28  ? 285 ILE A CG1 1 
ATOM   819  C  CG2 . ILE A 1 112 ? -41.000 19.572 36.961 1.00 72.16  ? 285 ILE A CG2 1 
ATOM   820  C  CD1 . ILE A 1 112 ? -39.660 18.012 34.953 1.00 69.73  ? 285 ILE A CD1 1 
ATOM   821  N  N   . ASN A 1 113 ? -40.195 23.473 37.828 1.00 74.01  ? 286 ASN A N   1 
ATOM   822  C  CA  . ASN A 1 113 ? -40.410 24.160 39.100 1.00 74.82  ? 286 ASN A CA  1 
ATOM   823  C  C   . ASN A 1 113 ? -41.878 24.346 39.401 1.00 75.51  ? 286 ASN A C   1 
ATOM   824  O  O   . ASN A 1 113 ? -42.726 23.852 38.673 1.00 75.71  ? 286 ASN A O   1 
ATOM   825  C  CB  . ASN A 1 113 ? -39.711 25.514 39.104 1.00 74.81  ? 286 ASN A CB  1 
ATOM   826  C  CG  . ASN A 1 113 ? -40.220 26.432 38.019 1.00 74.82  ? 286 ASN A CG  1 
ATOM   827  O  OD1 . ASN A 1 113 ? -41.371 26.328 37.581 1.00 74.76  ? 286 ASN A OD1 1 
ATOM   828  N  ND2 . ASN A 1 113 ? -39.361 27.344 37.574 1.00 74.67  ? 286 ASN A ND2 1 
ATOM   829  N  N   . GLN A 1 114 ? -42.174 25.085 40.464 1.00 76.51  ? 287 GLN A N   1 
ATOM   830  C  CA  . GLN A 1 114 ? -43.545 25.206 40.966 1.00 77.43  ? 287 GLN A CA  1 
ATOM   831  C  C   . GLN A 1 114 ? -44.569 25.679 39.937 1.00 77.50  ? 287 GLN A C   1 
ATOM   832  O  O   . GLN A 1 114 ? -45.723 25.263 39.984 1.00 77.45  ? 287 GLN A O   1 
ATOM   833  C  CB  . GLN A 1 114 ? -43.589 26.100 42.208 1.00 77.81  ? 287 GLN A CB  1 
ATOM   834  C  CG  . GLN A 1 114 ? -44.990 26.303 42.771 1.00 79.49  ? 287 GLN A CG  1 
ATOM   835  C  CD  . GLN A 1 114 ? -44.986 26.597 44.255 1.00 81.87  ? 287 GLN A CD  1 
ATOM   836  O  OE1 . GLN A 1 114 ? -44.116 27.312 44.761 1.00 82.65  ? 287 GLN A OE1 1 
ATOM   837  N  NE2 . GLN A 1 114 ? -45.965 26.041 44.968 1.00 83.10  ? 287 GLN A NE2 1 
ATOM   838  N  N   . GLN A 1 115 ? -44.156 26.545 39.017 1.00 77.86  ? 288 GLN A N   1 
ATOM   839  C  CA  . GLN A 1 115 ? -45.080 27.034 37.994 1.00 78.25  ? 288 GLN A CA  1 
ATOM   840  C  C   . GLN A 1 115 ? -45.087 26.136 36.764 1.00 78.24  ? 288 GLN A C   1 
ATOM   841  O  O   . GLN A 1 115 ? -45.868 26.360 35.843 1.00 78.56  ? 288 GLN A O   1 
ATOM   842  C  CB  . GLN A 1 115 ? -44.794 28.488 37.597 1.00 78.36  ? 288 GLN A CB  1 
ATOM   843  C  CG  . GLN A 1 115 ? -45.017 29.507 38.705 1.00 79.34  ? 288 GLN A CG  1 
ATOM   844  C  CD  . GLN A 1 115 ? -43.853 29.558 39.691 1.00 81.09  ? 288 GLN A CD  1 
ATOM   845  O  OE1 . GLN A 1 115 ? -42.696 29.318 39.322 1.00 81.80  ? 288 GLN A OE1 1 
ATOM   846  N  NE2 . GLN A 1 115 ? -44.155 29.870 40.951 1.00 81.50  ? 288 GLN A NE2 1 
ATOM   847  N  N   . SER A 1 116 ? -44.218 25.127 36.747 1.00 78.14  ? 289 SER A N   1 
ATOM   848  C  CA  . SER A 1 116 ? -44.227 24.124 35.682 1.00 77.91  ? 289 SER A CA  1 
ATOM   849  C  C   . SER A 1 116 ? -45.391 23.166 35.850 1.00 77.77  ? 289 SER A C   1 
ATOM   850  O  O   . SER A 1 116 ? -45.771 22.848 36.971 1.00 77.74  ? 289 SER A O   1 
ATOM   851  C  CB  . SER A 1 116 ? -42.933 23.319 35.677 1.00 77.97  ? 289 SER A CB  1 
ATOM   852  O  OG  . SER A 1 116 ? -43.073 22.162 34.870 1.00 77.62  ? 289 SER A OG  1 
ATOM   853  N  N   . PRO A 1 117 ? -45.955 22.696 34.729 1.00 77.75  ? 290 PRO A N   1 
ATOM   854  C  CA  . PRO A 1 117 ? -47.055 21.729 34.746 1.00 77.78  ? 290 PRO A CA  1 
ATOM   855  C  C   . PRO A 1 117 ? -46.677 20.328 35.243 1.00 77.72  ? 290 PRO A C   1 
ATOM   856  O  O   . PRO A 1 117 ? -47.549 19.583 35.687 1.00 77.43  ? 290 PRO A O   1 
ATOM   857  C  CB  . PRO A 1 117 ? -47.489 21.668 33.280 1.00 77.88  ? 290 PRO A CB  1 
ATOM   858  C  CG  . PRO A 1 117 ? -46.312 22.155 32.508 1.00 77.77  ? 290 PRO A CG  1 
ATOM   859  C  CD  . PRO A 1 117 ? -45.676 23.187 33.369 1.00 77.72  ? 290 PRO A CD  1 
ATOM   860  N  N   . PHE A 1 118 ? -45.394 19.984 35.178 1.00 77.85  ? 291 PHE A N   1 
ATOM   861  C  CA  . PHE A 1 118 ? -44.922 18.660 35.585 1.00 77.90  ? 291 PHE A CA  1 
ATOM   862  C  C   . PHE A 1 118 ? -44.535 18.595 37.062 1.00 78.11  ? 291 PHE A C   1 
ATOM   863  O  O   . PHE A 1 118 ? -44.164 17.539 37.575 1.00 78.04  ? 291 PHE A O   1 
ATOM   864  C  CB  . PHE A 1 118 ? -43.728 18.259 34.741 1.00 77.71  ? 291 PHE A CB  1 
ATOM   865  C  CG  . PHE A 1 118 ? -43.999 18.238 33.271 1.00 77.60  ? 291 PHE A CG  1 
ATOM   866  C  CD1 . PHE A 1 118 ? -44.244 17.041 32.616 1.00 78.03  ? 291 PHE A CD1 1 
ATOM   867  C  CD2 . PHE A 1 118 ? -43.975 19.405 32.530 1.00 77.18  ? 291 PHE A CD2 1 
ATOM   868  C  CE1 . PHE A 1 118 ? -44.469 17.009 31.242 1.00 77.93  ? 291 PHE A CE1 1 
ATOM   869  C  CE2 . PHE A 1 118 ? -44.204 19.381 31.166 1.00 77.17  ? 291 PHE A CE2 1 
ATOM   870  C  CZ  . PHE A 1 118 ? -44.449 18.183 30.521 1.00 77.43  ? 291 PHE A CZ  1 
ATOM   871  N  N   . TRP A 1 119 ? -44.634 19.734 37.736 1.00 78.49  ? 292 TRP A N   1 
ATOM   872  C  CA  . TRP A 1 119 ? -44.274 19.869 39.143 1.00 78.92  ? 292 TRP A CA  1 
ATOM   873  C  C   . TRP A 1 119 ? -44.747 18.718 40.037 1.00 79.26  ? 292 TRP A C   1 
ATOM   874  O  O   . TRP A 1 119 ? -44.029 18.305 40.948 1.00 79.33  ? 292 TRP A O   1 
ATOM   875  C  CB  . TRP A 1 119 ? -44.795 21.210 39.666 1.00 78.86  ? 292 TRP A CB  1 
ATOM   876  C  CG  . TRP A 1 119 ? -44.612 21.417 41.114 1.00 79.21  ? 292 TRP A CG  1 
ATOM   877  C  CD1 . TRP A 1 119 ? -45.568 21.331 42.068 1.00 79.64  ? 292 TRP A CD1 1 
ATOM   878  C  CD2 . TRP A 1 119 ? -43.392 21.747 41.791 1.00 80.27  ? 292 TRP A CD2 1 
ATOM   879  N  NE1 . TRP A 1 119 ? -45.029 21.586 43.306 1.00 80.48  ? 292 TRP A NE1 1 
ATOM   880  C  CE2 . TRP A 1 119 ? -43.692 21.847 43.164 1.00 80.52  ? 292 TRP A CE2 1 
ATOM   881  C  CE3 . TRP A 1 119 ? -42.072 21.958 41.372 1.00 80.87  ? 292 TRP A CE3 1 
ATOM   882  C  CZ2 . TRP A 1 119 ? -42.722 22.154 44.128 1.00 80.75  ? 292 TRP A CZ2 1 
ATOM   883  C  CZ3 . TRP A 1 119 ? -41.106 22.268 42.330 1.00 81.08  ? 292 TRP A CZ3 1 
ATOM   884  C  CH2 . TRP A 1 119 ? -41.439 22.359 43.693 1.00 80.91  ? 292 TRP A CH2 1 
ATOM   885  N  N   . GLU A 1 120 ? -45.940 18.193 39.767 1.00 79.67  ? 293 GLU A N   1 
ATOM   886  C  CA  . GLU A 1 120 ? -46.530 17.142 40.606 1.00 80.02  ? 293 GLU A CA  1 
ATOM   887  C  C   . GLU A 1 120 ? -46.460 15.740 39.974 1.00 80.02  ? 293 GLU A C   1 
ATOM   888  O  O   . GLU A 1 120 ? -47.122 14.799 40.437 1.00 80.15  ? 293 GLU A O   1 
ATOM   889  C  CB  . GLU A 1 120 ? -47.977 17.499 40.974 1.00 80.02  ? 293 GLU A CB  1 
ATOM   890  C  CG  . GLU A 1 120 ? -48.126 18.868 41.638 1.00 81.27  ? 293 GLU A CG  1 
ATOM   891  C  CD  . GLU A 1 120 ? -49.385 18.990 42.498 1.00 82.92  ? 293 GLU A CD  1 
ATOM   892  O  OE1 . GLU A 1 120 ? -50.474 18.612 42.015 1.00 83.79  ? 293 GLU A OE1 1 
ATOM   893  O  OE2 . GLU A 1 120 ? -49.290 19.473 43.655 1.00 82.96  ? 293 GLU A OE2 1 
ATOM   894  N  N   . ILE A 1 121 ? -45.641 15.590 38.936 1.00 79.86  ? 294 ILE A N   1 
ATOM   895  C  CA  . ILE A 1 121 ? -45.618 14.342 38.191 1.00 79.72  ? 294 ILE A CA  1 
ATOM   896  C  C   . ILE A 1 121 ? -44.408 13.478 38.485 1.00 79.91  ? 294 ILE A C   1 
ATOM   897  O  O   . ILE A 1 121 ? -43.296 13.795 38.076 1.00 79.91  ? 294 ILE A O   1 
ATOM   898  C  CB  . ILE A 1 121 ? -45.719 14.600 36.700 1.00 79.60  ? 294 ILE A CB  1 
ATOM   899  C  CG1 . ILE A 1 121 ? -47.148 15.049 36.370 1.00 79.66  ? 294 ILE A CG1 1 
ATOM   900  C  CG2 . ILE A 1 121 ? -45.316 13.346 35.929 1.00 79.55  ? 294 ILE A CG2 1 
ATOM   901  C  CD1 . ILE A 1 121 ? -47.342 15.586 34.969 1.00 79.76  ? 294 ILE A CD1 1 
ATOM   902  N  N   . SER A 1 122 ? -44.642 12.379 39.197 1.00 80.19  ? 295 SER A N   1 
ATOM   903  C  CA  . SER A 1 122 ? -43.578 11.439 39.539 1.00 80.29  ? 295 SER A CA  1 
ATOM   904  C  C   . SER A 1 122 ? -43.292 10.519 38.361 1.00 80.32  ? 295 SER A C   1 
ATOM   905  O  O   . SER A 1 122 ? -43.992 10.563 37.356 1.00 80.40  ? 295 SER A O   1 
ATOM   906  C  CB  . SER A 1 122 ? -43.953 10.627 40.780 1.00 80.38  ? 295 SER A CB  1 
ATOM   907  O  OG  . SER A 1 122 ? -44.973 9.685  40.498 1.00 80.48  ? 295 SER A OG  1 
ATOM   908  N  N   . LYS A 1 123 ? -42.262 9.691  38.485 1.00 80.44  ? 296 LYS A N   1 
ATOM   909  C  CA  . LYS A 1 123 ? -41.869 8.799  37.404 1.00 80.72  ? 296 LYS A CA  1 
ATOM   910  C  C   . LYS A 1 123 ? -42.977 7.802  37.122 1.00 80.88  ? 296 LYS A C   1 
ATOM   911  O  O   . LYS A 1 123 ? -43.331 7.556  35.966 1.00 80.85  ? 296 LYS A O   1 
ATOM   912  C  CB  . LYS A 1 123 ? -40.569 8.065  37.748 1.00 80.82  ? 296 LYS A CB  1 
ATOM   913  C  CG  . LYS A 1 123 ? -40.156 7.011  36.728 1.00 81.14  ? 296 LYS A CG  1 
ATOM   914  C  CD  . LYS A 1 123 ? -38.849 6.342  37.107 1.00 82.47  ? 296 LYS A CD  1 
ATOM   915  C  CE  . LYS A 1 123 ? -38.642 5.062  36.298 1.00 83.50  ? 296 LYS A CE  1 
ATOM   916  N  NZ  . LYS A 1 123 ? -37.194 4.735  36.098 1.00 84.04  ? 296 LYS A NZ  1 
ATOM   917  N  N   . ALA A 1 124 ? -43.521 7.231  38.191 1.00 81.18  ? 297 ALA A N   1 
ATOM   918  C  CA  . ALA A 1 124 ? -44.589 6.247  38.077 1.00 81.43  ? 297 ALA A CA  1 
ATOM   919  C  C   . ALA A 1 124 ? -45.783 6.901  37.420 1.00 81.56  ? 297 ALA A C   1 
ATOM   920  O  O   . ALA A 1 124 ? -46.499 6.276  36.632 1.00 81.61  ? 297 ALA A O   1 
ATOM   921  C  CB  . ALA A 1 124 ? -44.969 5.728  39.450 1.00 81.51  ? 297 ALA A CB  1 
ATOM   922  N  N   . GLN A 1 125 ? -45.952 8.181  37.752 1.00 81.68  ? 298 GLN A N   1 
ATOM   923  C  CA  . GLN A 1 125 ? -47.108 8.984  37.378 1.00 81.59  ? 298 GLN A CA  1 
ATOM   924  C  C   . GLN A 1 125 ? -47.113 9.346  35.903 1.00 81.36  ? 298 GLN A C   1 
ATOM   925  O  O   . GLN A 1 125 ? -48.165 9.437  35.285 1.00 81.20  ? 298 GLN A O   1 
ATOM   926  C  CB  . GLN A 1 125 ? -47.149 10.253 38.241 1.00 81.64  ? 298 GLN A CB  1 
ATOM   927  C  CG  . GLN A 1 125 ? -48.482 10.975 38.248 1.00 82.12  ? 298 GLN A CG  1 
ATOM   928  C  CD  . GLN A 1 125 ? -49.654 10.044 37.982 1.00 82.72  ? 298 GLN A CD  1 
ATOM   929  O  OE1 . GLN A 1 125 ? -50.377 10.221 37.002 1.00 83.14  ? 298 GLN A OE1 1 
ATOM   930  N  NE2 . GLN A 1 125 ? -49.835 9.035  38.838 1.00 82.69  ? 298 GLN A NE2 1 
ATOM   931  N  N   . LEU A 1 126 ? -45.923 9.535  35.351 1.00 81.41  ? 299 LEU A N   1 
ATOM   932  C  CA  . LEU A 1 126 ? -45.756 9.958  33.969 1.00 81.53  ? 299 LEU A CA  1 
ATOM   933  C  C   . LEU A 1 126 ? -46.627 9.187  32.968 1.00 81.73  ? 299 LEU A C   1 
ATOM   934  O  O   . LEU A 1 126 ? -47.456 9.792  32.295 1.00 81.91  ? 299 LEU A O   1 
ATOM   935  C  CB  . LEU A 1 126 ? -44.273 9.909  33.569 1.00 81.48  ? 299 LEU A CB  1 
ATOM   936  C  CG  . LEU A 1 126 ? -43.888 10.404 32.175 1.00 81.18  ? 299 LEU A CG  1 
ATOM   937  C  CD1 . LEU A 1 126 ? -44.200 11.885 32.054 1.00 80.74  ? 299 LEU A CD1 1 
ATOM   938  C  CD2 . LEU A 1 126 ? -42.428 10.106 31.835 1.00 80.43  ? 299 LEU A CD2 1 
ATOM   939  N  N   . PRO A 1 127 ? -46.458 7.854  32.875 1.00 81.83  ? 300 PRO A N   1 
ATOM   940  C  CA  . PRO A 1 127 ? -47.148 7.080  31.834 1.00 81.92  ? 300 PRO A CA  1 
ATOM   941  C  C   . PRO A 1 127 ? -48.672 7.073  31.981 1.00 81.99  ? 300 PRO A C   1 
ATOM   942  O  O   . PRO A 1 127 ? -49.387 6.628  31.083 1.00 82.02  ? 300 PRO A O   1 
ATOM   943  C  CB  . PRO A 1 127 ? -46.596 5.665  32.030 1.00 82.03  ? 300 PRO A CB  1 
ATOM   944  C  CG  . PRO A 1 127 ? -45.319 5.857  32.815 1.00 82.15  ? 300 PRO A CG  1 
ATOM   945  C  CD  . PRO A 1 127 ? -45.617 6.988  33.721 1.00 81.86  ? 300 PRO A CD  1 
ATOM   946  N  N   . LYS A 1 128 ? -49.160 7.560  33.112 1.00 82.02  ? 301 LYS A N   1 
ATOM   947  C  CA  . LYS A 1 128 ? -50.587 7.608  33.364 1.00 82.09  ? 301 LYS A CA  1 
ATOM   948  C  C   . LYS A 1 128 ? -51.223 8.874  32.801 1.00 82.04  ? 301 LYS A C   1 
ATOM   949  O  O   . LYS A 1 128 ? -52.431 8.935  32.623 1.00 82.33  ? 301 LYS A O   1 
ATOM   950  C  CB  . LYS A 1 128 ? -50.856 7.500  34.868 1.00 82.11  ? 301 LYS A CB  1 
ATOM   951  C  CG  . LYS A 1 128 ? -50.620 6.104  35.422 1.00 82.69  ? 301 LYS A CG  1 
ATOM   952  C  CD  . LYS A 1 128 ? -50.317 6.120  36.910 1.00 83.69  ? 301 LYS A CD  1 
ATOM   953  C  CE  . LYS A 1 128 ? -49.791 4.763  37.372 1.00 84.49  ? 301 LYS A CE  1 
ATOM   954  N  NZ  . LYS A 1 128 ? -49.034 4.887  38.649 1.00 85.21  ? 301 LYS A NZ  1 
ATOM   955  N  N   . GLU A 1 129 ? -50.408 9.882  32.515 1.00 81.94  ? 302 GLU A N   1 
ATOM   956  C  CA  . GLU A 1 129 ? -50.923 11.196 32.150 1.00 81.62  ? 302 GLU A CA  1 
ATOM   957  C  C   . GLU A 1 129 ? -51.189 11.304 30.669 1.00 81.48  ? 302 GLU A C   1 
ATOM   958  O  O   . GLU A 1 129 ? -50.425 10.793 29.843 1.00 81.46  ? 302 GLU A O   1 
ATOM   959  C  CB  . GLU A 1 129 ? -49.946 12.288 32.566 1.00 81.63  ? 302 GLU A CB  1 
ATOM   960  C  CG  . GLU A 1 129 ? -49.708 12.365 34.058 1.00 82.01  ? 302 GLU A CG  1 
ATOM   961  C  CD  . GLU A 1 129 ? -50.827 13.066 34.806 1.00 82.59  ? 302 GLU A CD  1 
ATOM   962  O  OE1 . GLU A 1 129 ? -51.759 13.588 34.144 1.00 83.01  ? 302 GLU A OE1 1 
ATOM   963  O  OE2 . GLU A 1 129 ? -50.764 13.100 36.060 1.00 82.29  ? 302 GLU A OE2 1 
ATOM   964  N  N   . GLU A 1 130 ? -52.275 11.986 30.340 1.00 81.26  ? 303 GLU A N   1 
ATOM   965  C  CA  . GLU A 1 130 ? -52.653 12.182 28.957 1.00 81.30  ? 303 GLU A CA  1 
ATOM   966  C  C   . GLU A 1 130 ? -52.268 13.584 28.513 1.00 81.25  ? 303 GLU A C   1 
ATOM   967  O  O   . GLU A 1 130 ? -53.031 14.540 28.718 1.00 81.51  ? 303 GLU A O   1 
ATOM   968  C  CB  . GLU A 1 130 ? -54.150 11.965 28.793 1.00 81.32  ? 303 GLU A CB  1 
ATOM   969  C  CG  . GLU A 1 130 ? -54.599 11.893 27.359 1.00 81.70  ? 303 GLU A CG  1 
ATOM   970  C  CD  . GLU A 1 130 ? -55.784 10.991 27.202 1.00 82.70  ? 303 GLU A CD  1 
ATOM   971  O  OE1 . GLU A 1 130 ? -56.290 10.512 28.245 1.00 83.13  ? 303 GLU A OE1 1 
ATOM   972  O  OE2 . GLU A 1 130 ? -56.202 10.756 26.044 1.00 83.59  ? 303 GLU A OE2 1 
ATOM   973  N  N   . LEU A 1 131 ? -51.088 13.706 27.908 1.00 80.91  ? 304 LEU A N   1 
ATOM   974  C  CA  . LEU A 1 131 ? -50.570 15.020 27.527 1.00 80.51  ? 304 LEU A CA  1 
ATOM   975  C  C   . LEU A 1 131 ? -49.584 15.008 26.357 1.00 80.29  ? 304 LEU A C   1 
ATOM   976  O  O   . LEU A 1 131 ? -49.034 13.966 25.986 1.00 80.54  ? 304 LEU A O   1 
ATOM   977  C  CB  . LEU A 1 131 ? -49.953 15.722 28.741 1.00 80.53  ? 304 LEU A CB  1 
ATOM   978  C  CG  . LEU A 1 131 ? -48.797 15.028 29.452 1.00 80.16  ? 304 LEU A CG  1 
ATOM   979  C  CD1 . LEU A 1 131 ? -47.489 15.288 28.731 1.00 79.99  ? 304 LEU A CD1 1 
ATOM   980  C  CD2 . LEU A 1 131 ? -48.735 15.545 30.863 1.00 80.50  ? 304 LEU A CD2 1 
ATOM   981  N  N   . GLU A 1 132 ? -49.358 16.192 25.798 1.00 79.71  ? 305 GLU A N   1 
ATOM   982  C  CA  . GLU A 1 132 ? -48.542 16.352 24.612 1.00 78.92  ? 305 GLU A CA  1 
ATOM   983  C  C   . GLU A 1 132 ? -47.764 17.641 24.762 1.00 78.43  ? 305 GLU A C   1 
ATOM   984  O  O   . GLU A 1 132 ? -48.297 18.658 25.205 1.00 78.28  ? 305 GLU A O   1 
ATOM   985  C  CB  . GLU A 1 132 ? -49.442 16.408 23.373 1.00 78.93  ? 305 GLU A CB  1 
ATOM   986  C  CG  . GLU A 1 132 ? -48.726 16.270 22.040 1.00 78.46  ? 305 GLU A CG  1 
ATOM   987  C  CD  . GLU A 1 132 ? -49.690 16.130 20.870 1.00 77.68  ? 305 GLU A CD  1 
ATOM   988  O  OE1 . GLU A 1 132 ? -50.869 15.792 21.117 1.00 77.84  ? 305 GLU A OE1 1 
ATOM   989  O  OE2 . GLU A 1 132 ? -49.269 16.355 19.709 1.00 76.73  ? 305 GLU A OE2 1 
ATOM   990  N  N   . ILE A 1 133 ? -46.491 17.588 24.414 1.00 77.93  ? 306 ILE A N   1 
ATOM   991  C  CA  . ILE A 1 133 ? -45.667 18.779 24.430 1.00 77.49  ? 306 ILE A CA  1 
ATOM   992  C  C   . ILE A 1 133 ? -45.395 19.150 22.991 1.00 77.31  ? 306 ILE A C   1 
ATOM   993  O  O   . ILE A 1 133 ? -44.753 18.392 22.260 1.00 77.34  ? 306 ILE A O   1 
ATOM   994  C  CB  . ILE A 1 133 ? -44.341 18.554 25.187 1.00 77.37  ? 306 ILE A CB  1 
ATOM   995  C  CG1 . ILE A 1 133 ? -44.623 18.243 26.653 1.00 77.03  ? 306 ILE A CG1 1 
ATOM   996  C  CG2 . ILE A 1 133 ? -43.459 19.777 25.093 1.00 76.97  ? 306 ILE A CG2 1 
ATOM   997  C  CD1 . ILE A 1 133 ? -43.581 17.384 27.286 1.00 76.92  ? 306 ILE A CD1 1 
ATOM   998  N  N   . VAL A 1 134 ? -45.912 20.306 22.586 1.00 77.01  ? 307 VAL A N   1 
ATOM   999  C  CA  . VAL A 1 134 ? -45.678 20.836 21.242 1.00 76.60  ? 307 VAL A CA  1 
ATOM   1000 C  C   . VAL A 1 134 ? -44.507 21.821 21.275 1.00 76.17  ? 307 VAL A C   1 
ATOM   1001 O  O   . VAL A 1 134 ? -44.531 22.813 22.004 1.00 76.11  ? 307 VAL A O   1 
ATOM   1002 C  CB  . VAL A 1 134 ? -46.950 21.519 20.654 1.00 76.57  ? 307 VAL A CB  1 
ATOM   1003 C  CG1 . VAL A 1 134 ? -46.700 22.004 19.233 1.00 76.68  ? 307 VAL A CG1 1 
ATOM   1004 C  CG2 . VAL A 1 134 ? -48.135 20.569 20.671 1.00 76.45  ? 307 VAL A CG2 1 
ATOM   1005 N  N   . VAL A 1 135 ? -43.476 21.533 20.499 1.00 75.60  ? 308 VAL A N   1 
ATOM   1006 C  CA  . VAL A 1 135 ? -42.342 22.417 20.454 1.00 75.49  ? 308 VAL A CA  1 
ATOM   1007 C  C   . VAL A 1 135 ? -42.362 23.163 19.145 1.00 75.71  ? 308 VAL A C   1 
ATOM   1008 O  O   . VAL A 1 135 ? -42.594 22.574 18.102 1.00 75.75  ? 308 VAL A O   1 
ATOM   1009 C  CB  . VAL A 1 135 ? -41.031 21.665 20.622 1.00 75.30  ? 308 VAL A CB  1 
ATOM   1010 C  CG1 . VAL A 1 135 ? -41.060 20.867 21.900 1.00 75.06  ? 308 VAL A CG1 1 
ATOM   1011 C  CG2 . VAL A 1 135 ? -40.788 20.760 19.446 1.00 75.31  ? 308 VAL A CG2 1 
ATOM   1012 N  N   . ILE A 1 136 ? -42.117 24.466 19.210 1.00 76.24  ? 309 ILE A N   1 
ATOM   1013 C  CA  . ILE A 1 136 ? -42.284 25.345 18.057 1.00 76.70  ? 309 ILE A CA  1 
ATOM   1014 C  C   . ILE A 1 136 ? -41.129 26.329 17.886 1.00 77.32  ? 309 ILE A C   1 
ATOM   1015 O  O   . ILE A 1 136 ? -40.937 27.227 18.706 1.00 77.43  ? 309 ILE A O   1 
ATOM   1016 C  CB  . ILE A 1 136 ? -43.579 26.155 18.175 1.00 76.52  ? 309 ILE A CB  1 
ATOM   1017 C  CG1 . ILE A 1 136 ? -44.754 25.238 18.538 1.00 76.13  ? 309 ILE A CG1 1 
ATOM   1018 C  CG2 . ILE A 1 136 ? -43.823 26.919 16.889 1.00 76.43  ? 309 ILE A CG2 1 
ATOM   1019 C  CD1 . ILE A 1 136 ? -45.957 25.956 19.108 1.00 75.44  ? 309 ILE A CD1 1 
ATOM   1020 N  N   . LEU A 1 137 ? -40.380 26.168 16.801 1.00 78.07  ? 310 LEU A N   1 
ATOM   1021 C  CA  . LEU A 1 137 ? -39.228 27.017 16.531 1.00 78.79  ? 310 LEU A CA  1 
ATOM   1022 C  C   . LEU A 1 137 ? -39.535 28.000 15.419 1.00 79.36  ? 310 LEU A C   1 
ATOM   1023 O  O   . LEU A 1 137 ? -39.920 27.607 14.321 1.00 79.59  ? 310 LEU A O   1 
ATOM   1024 C  CB  . LEU A 1 137 ? -38.025 26.173 16.133 1.00 78.68  ? 310 LEU A CB  1 
ATOM   1025 C  CG  . LEU A 1 137 ? -36.777 27.012 15.887 1.00 78.97  ? 310 LEU A CG  1 
ATOM   1026 C  CD1 . LEU A 1 137 ? -35.707 26.676 16.897 1.00 79.15  ? 310 LEU A CD1 1 
ATOM   1027 C  CD2 . LEU A 1 137 ? -36.266 26.772 14.491 1.00 79.69  ? 310 LEU A CD2 1 
ATOM   1028 N  N   . GLU A 1 138 ? -39.348 29.281 15.700 1.00 80.13  ? 311 GLU A N   1 
ATOM   1029 C  CA  . GLU A 1 138 ? -39.658 30.323 14.730 1.00 80.90  ? 311 GLU A CA  1 
ATOM   1030 C  C   . GLU A 1 138 ? -38.464 31.231 14.505 1.00 81.65  ? 311 GLU A C   1 
ATOM   1031 O  O   . GLU A 1 138 ? -37.831 31.681 15.459 1.00 81.97  ? 311 GLU A O   1 
ATOM   1032 C  CB  . GLU A 1 138 ? -40.823 31.165 15.223 1.00 80.63  ? 311 GLU A CB  1 
ATOM   1033 C  CG  . GLU A 1 138 ? -41.909 30.381 15.912 1.00 80.59  ? 311 GLU A CG  1 
ATOM   1034 C  CD  . GLU A 1 138 ? -43.196 31.153 15.951 1.00 80.92  ? 311 GLU A CD  1 
ATOM   1035 O  OE1 . GLU A 1 138 ? -43.132 32.395 15.877 1.00 81.69  ? 311 GLU A OE1 1 
ATOM   1036 O  OE2 . GLU A 1 138 ? -44.273 30.533 16.038 1.00 81.13  ? 311 GLU A OE2 1 
ATOM   1037 N  N   . GLY A 1 139 ? -38.162 31.510 13.243 1.00 82.42  ? 312 GLY A N   1 
ATOM   1038 C  CA  . GLY A 1 139 ? -37.051 32.390 12.911 1.00 83.39  ? 312 GLY A CA  1 
ATOM   1039 C  C   . GLY A 1 139 ? -37.164 32.915 11.501 1.00 84.27  ? 312 GLY A C   1 
ATOM   1040 O  O   . GLY A 1 139 ? -38.192 32.752 10.853 1.00 84.24  ? 312 GLY A O   1 
ATOM   1041 N  N   . MET A 1 140 ? -36.105 33.563 11.030 1.00 85.04  ? 313 MET A N   1 
ATOM   1042 C  CA  A MET A 1 140 ? -36.057 34.106 9.672  0.50 85.20  ? 313 MET A CA  1 
ATOM   1043 C  CA  B MET A 1 140 ? -36.089 34.080 9.667  0.50 85.57  ? 313 MET A CA  1 
ATOM   1044 C  C   . MET A 1 140 ? -34.867 33.511 8.932  1.00 86.04  ? 313 MET A C   1 
ATOM   1045 O  O   . MET A 1 140 ? -33.730 33.938 9.151  1.00 86.17  ? 313 MET A O   1 
ATOM   1046 C  CB  A MET A 1 140 ? -35.930 35.637 9.717  0.50 85.20  ? 313 MET A CB  1 
ATOM   1047 C  CB  B MET A 1 140 ? -36.152 35.628 9.648  0.50 85.48  ? 313 MET A CB  1 
ATOM   1048 C  CG  A MET A 1 140 ? -36.244 36.355 8.401  0.50 84.82  ? 313 MET A CG  1 
ATOM   1049 C  CG  B MET A 1 140 ? -37.468 36.216 10.432 0.50 85.17  ? 313 MET A CG  1 
ATOM   1050 S  SD  A MET A 1 140 ? -34.970 36.210 7.129  0.50 83.55  ? 313 MET A SD  1 
ATOM   1051 S  SD  B MET A 1 140 ? -37.619 38.044 10.356 0.50 84.68  ? 313 MET A SD  1 
ATOM   1052 C  CE  A MET A 1 140 ? -33.786 37.448 7.646  0.50 83.94  ? 313 MET A CE  1 
ATOM   1053 C  CE  B MET A 1 140 ? -38.789 38.405 11.740 0.50 83.39  ? 313 MET A CE  1 
ATOM   1054 N  N   . VAL A 1 141 ? -35.117 32.518 8.073  1.00 86.87  ? 314 VAL A N   1 
ATOM   1055 C  CA  . VAL A 1 141 ? -34.042 31.845 7.333  1.00 87.84  ? 314 VAL A CA  1 
ATOM   1056 C  C   . VAL A 1 141 ? -33.267 32.887 6.552  1.00 88.63  ? 314 VAL A C   1 
ATOM   1057 O  O   . VAL A 1 141 ? -33.818 33.525 5.659  1.00 88.85  ? 314 VAL A O   1 
ATOM   1058 C  CB  . VAL A 1 141 ? -34.577 30.766 6.372  1.00 87.66  ? 314 VAL A CB  1 
ATOM   1059 C  CG1 . VAL A 1 141 ? -33.426 30.074 5.672  1.00 87.92  ? 314 VAL A CG1 1 
ATOM   1060 C  CG2 . VAL A 1 141 ? -35.424 29.748 7.118  1.00 87.68  ? 314 VAL A CG2 1 
ATOM   1061 N  N   . GLU A 1 142 ? -31.994 33.061 6.903  1.00 89.79  ? 315 GLU A N   1 
ATOM   1062 C  CA  . GLU A 1 142 ? -31.185 34.196 6.424  1.00 90.90  ? 315 GLU A CA  1 
ATOM   1063 C  C   . GLU A 1 142 ? -31.113 34.293 4.901  1.00 91.41  ? 315 GLU A C   1 
ATOM   1064 O  O   . GLU A 1 142 ? -31.372 35.353 4.315  1.00 91.02  ? 315 GLU A O   1 
ATOM   1065 C  CB  . GLU A 1 142 ? -29.773 34.108 7.006  1.00 91.00  ? 315 GLU A CB  1 
ATOM   1066 C  CG  . GLU A 1 142 ? -28.934 35.353 6.798  1.00 91.12  ? 315 GLU A CG  1 
ATOM   1067 C  CD  . GLU A 1 142 ? -27.547 35.163 7.335  1.00 91.49  ? 315 GLU A CD  1 
ATOM   1068 O  OE1 . GLU A 1 142 ? -26.955 34.096 7.061  1.00 92.04  ? 315 GLU A OE1 1 
ATOM   1069 O  OE2 . GLU A 1 142 ? -27.054 36.067 8.041  1.00 91.69  ? 315 GLU A OE2 1 
ATOM   1070 N  N   . ALA A 1 143 ? -30.748 33.164 4.294  1.00 92.37  ? 316 ALA A N   1 
ATOM   1071 C  CA  . ALA A 1 143 ? -30.720 32.978 2.847  1.00 93.32  ? 316 ALA A CA  1 
ATOM   1072 C  C   . ALA A 1 143 ? -32.093 33.201 2.168  1.00 93.86  ? 316 ALA A C   1 
ATOM   1073 O  O   . ALA A 1 143 ? -32.184 33.917 1.158  1.00 94.42  ? 316 ALA A O   1 
ATOM   1074 C  CB  . ALA A 1 143 ? -30.157 31.582 2.504  1.00 93.15  ? 316 ALA A CB  1 
ATOM   1075 N  N   . THR A 1 144 ? -33.149 32.606 2.729  1.00 93.93  ? 317 THR A N   1 
ATOM   1076 C  CA  . THR A 1 144 ? -34.517 32.729 2.197  1.00 93.85  ? 317 THR A CA  1 
ATOM   1077 C  C   . THR A 1 144 ? -35.182 34.110 2.333  1.00 93.56  ? 317 THR A C   1 
ATOM   1078 O  O   . THR A 1 144 ? -36.079 34.448 1.563  1.00 93.38  ? 317 THR A O   1 
ATOM   1079 C  CB  . THR A 1 144 ? -35.429 31.616 2.787  1.00 94.09  ? 317 THR A CB  1 
ATOM   1080 O  OG1 . THR A 1 144 ? -35.936 30.805 1.722  1.00 94.97  ? 317 THR A OG1 1 
ATOM   1081 C  CG2 . THR A 1 144 ? -36.602 32.186 3.568  1.00 93.93  ? 317 THR A CG2 1 
ATOM   1082 N  N   . GLY A 1 145 ? -34.744 34.900 3.306  1.00 93.51  ? 318 GLY A N   1 
ATOM   1083 C  CA  . GLY A 1 145 ? -35.396 36.168 3.602  1.00 93.53  ? 318 GLY A CA  1 
ATOM   1084 C  C   . GLY A 1 145 ? -36.688 36.022 4.404  1.00 93.56  ? 318 GLY A C   1 
ATOM   1085 O  O   . GLY A 1 145 ? -37.050 36.931 5.162  1.00 93.71  ? 318 GLY A O   1 
ATOM   1086 N  N   . MET A 1 146 ? -37.374 34.882 4.258  1.00 93.29  ? 319 MET A N   1 
ATOM   1087 C  CA  . MET A 1 146 ? -38.712 34.671 4.850  1.00 92.94  ? 319 MET A CA  1 
ATOM   1088 C  C   . MET A 1 146 ? -38.709 34.045 6.234  1.00 91.91  ? 319 MET A C   1 
ATOM   1089 O  O   . MET A 1 146 ? -37.792 33.312 6.609  1.00 91.84  ? 319 MET A O   1 
ATOM   1090 C  CB  . MET A 1 146 ? -39.577 33.777 3.968  1.00 93.42  ? 319 MET A CB  1 
ATOM   1091 C  CG  . MET A 1 146 ? -39.671 34.162 2.514  1.00 95.72  ? 319 MET A CG  1 
ATOM   1092 S  SD  . MET A 1 146 ? -40.371 32.754 1.616  1.00 101.12 ? 319 MET A SD  1 
ATOM   1093 C  CE  . MET A 1 146 ? -38.907 31.840 1.069  1.00 99.33  ? 319 MET A CE  1 
ATOM   1094 N  N   . THR A 1 147 ? -39.783 34.319 6.967  1.00 90.66  ? 320 THR A N   1 
ATOM   1095 C  CA  . THR A 1 147 ? -39.994 33.772 8.292  1.00 89.39  ? 320 THR A CA  1 
ATOM   1096 C  C   . THR A 1 147 ? -40.427 32.308 8.173  1.00 88.35  ? 320 THR A C   1 
ATOM   1097 O  O   . THR A 1 147 ? -41.376 32.007 7.462  1.00 88.26  ? 320 THR A O   1 
ATOM   1098 C  CB  . THR A 1 147 ? -41.049 34.610 9.046  1.00 89.45  ? 320 THR A CB  1 
ATOM   1099 O  OG1 . THR A 1 147 ? -40.649 35.987 9.046  1.00 89.45  ? 320 THR A OG1 1 
ATOM   1100 C  CG2 . THR A 1 147 ? -41.212 34.141 10.483 1.00 89.63  ? 320 THR A CG2 1 
ATOM   1101 N  N   . CYS A 1 148 ? -39.710 31.411 8.854  1.00 87.09  ? 321 CYS A N   1 
ATOM   1102 C  CA  . CYS A 1 148 ? -40.040 29.979 8.892  1.00 85.72  ? 321 CYS A CA  1 
ATOM   1103 C  C   . CYS A 1 148 ? -40.641 29.564 10.242 1.00 84.61  ? 321 CYS A C   1 
ATOM   1104 O  O   . CYS A 1 148 ? -40.524 30.283 11.231 1.00 84.46  ? 321 CYS A O   1 
ATOM   1105 C  CB  . CYS A 1 148 ? -38.785 29.139 8.614  1.00 85.84  ? 321 CYS A CB  1 
ATOM   1106 S  SG  . CYS A 1 148 ? -37.807 28.649 10.100 1.00 86.18  ? 321 CYS A SG  1 
ATOM   1107 N  N   . GLN A 1 149 ? -41.282 28.402 10.279 1.00 83.31  ? 322 GLN A N   1 
ATOM   1108 C  CA  . GLN A 1 149 ? -41.670 27.782 11.549 1.00 82.19  ? 322 GLN A CA  1 
ATOM   1109 C  C   . GLN A 1 149 ? -41.560 26.264 11.461 1.00 81.50  ? 322 GLN A C   1 
ATOM   1110 O  O   . GLN A 1 149 ? -42.006 25.655 10.483 1.00 81.78  ? 322 GLN A O   1 
ATOM   1111 C  CB  . GLN A 1 149 ? -43.090 28.173 11.968 1.00 82.09  ? 322 GLN A CB  1 
ATOM   1112 C  CG  . GLN A 1 149 ? -43.464 27.744 13.387 1.00 81.79  ? 322 GLN A CG  1 
ATOM   1113 C  CD  . GLN A 1 149 ? -44.937 27.971 13.720 1.00 82.02  ? 322 GLN A CD  1 
ATOM   1114 O  OE1 . GLN A 1 149 ? -45.780 27.101 13.497 1.00 82.41  ? 322 GLN A OE1 1 
ATOM   1115 N  NE2 . GLN A 1 149 ? -45.247 29.135 14.276 1.00 81.76  ? 322 GLN A NE2 1 
ATOM   1116 N  N   . ALA A 1 150 ? -40.957 25.658 12.480 1.00 80.14  ? 323 ALA A N   1 
ATOM   1117 C  CA  . ALA A 1 150 ? -40.921 24.211 12.592 1.00 78.66  ? 323 ALA A CA  1 
ATOM   1118 C  C   . ALA A 1 150 ? -41.586 23.803 13.896 1.00 77.74  ? 323 ALA A C   1 
ATOM   1119 O  O   . ALA A 1 150 ? -41.543 24.538 14.883 1.00 77.50  ? 323 ALA A O   1 
ATOM   1120 C  CB  . ALA A 1 150 ? -39.500 23.700 12.520 1.00 78.59  ? 323 ALA A CB  1 
ATOM   1121 N  N   . ARG A 1 151 ? -42.220 22.636 13.877 1.00 76.70  ? 324 ARG A N   1 
ATOM   1122 C  CA  . ARG A 1 151 ? -42.939 22.112 15.026 1.00 75.63  ? 324 ARG A CA  1 
ATOM   1123 C  C   . ARG A 1 151 ? -42.642 20.639 15.192 1.00 74.77  ? 324 ARG A C   1 
ATOM   1124 O  O   . ARG A 1 151 ? -42.242 19.967 14.244 1.00 74.74  ? 324 ARG A O   1 
ATOM   1125 C  CB  . ARG A 1 151 ? -44.447 22.282 14.834 1.00 75.74  ? 324 ARG A CB  1 
ATOM   1126 C  CG  . ARG A 1 151 ? -44.914 23.718 14.647 1.00 76.39  ? 324 ARG A CG  1 
ATOM   1127 C  CD  . ARG A 1 151 ? -46.358 23.802 14.158 1.00 77.72  ? 324 ARG A CD  1 
ATOM   1128 N  NE  . ARG A 1 151 ? -46.497 23.239 12.822 1.00 79.83  ? 324 ARG A NE  1 
ATOM   1129 C  CZ  . ARG A 1 151 ? -46.133 23.855 11.699 1.00 81.67  ? 324 ARG A CZ  1 
ATOM   1130 N  NH1 . ARG A 1 151 ? -45.609 25.078 11.725 1.00 81.70  ? 324 ARG A NH1 1 
ATOM   1131 N  NH2 . ARG A 1 151 ? -46.293 23.240 10.536 1.00 83.26  ? 324 ARG A NH2 1 
ATOM   1132 N  N   . SER A 1 152 ? -42.825 20.143 16.406 1.00 73.96  ? 325 SER A N   1 
ATOM   1133 C  CA  . SER A 1 152 ? -42.899 18.705 16.641 1.00 73.38  ? 325 SER A CA  1 
ATOM   1134 C  C   . SER A 1 152 ? -43.725 18.423 17.879 1.00 73.08  ? 325 SER A C   1 
ATOM   1135 O  O   . SER A 1 152 ? -44.327 19.327 18.460 1.00 72.93  ? 325 SER A O   1 
ATOM   1136 C  CB  . SER A 1 152 ? -41.520 18.045 16.750 1.00 73.33  ? 325 SER A CB  1 
ATOM   1137 O  OG  . SER A 1 152 ? -41.651 16.649 16.989 1.00 72.68  ? 325 SER A OG  1 
ATOM   1138 N  N   . SER A 1 153 ? -43.746 17.163 18.285 1.00 72.77  ? 326 SER A N   1 
ATOM   1139 C  CA  . SER A 1 153 ? -44.632 16.758 19.345 1.00 72.60  ? 326 SER A CA  1 
ATOM   1140 C  C   . SER A 1 153 ? -44.038 15.642 20.181 1.00 72.48  ? 326 SER A C   1 
ATOM   1141 O  O   . SER A 1 153 ? -43.381 14.741 19.663 1.00 72.39  ? 326 SER A O   1 
ATOM   1142 C  CB  . SER A 1 153 ? -45.973 16.348 18.754 1.00 72.56  ? 326 SER A CB  1 
ATOM   1143 O  OG  . SER A 1 153 ? -46.777 15.710 19.719 1.00 72.75  ? 326 SER A OG  1 
ATOM   1144 N  N   . TYR A 1 154 ? -44.259 15.738 21.486 1.00 72.44  ? 327 TYR A N   1 
ATOM   1145 C  CA  . TYR A 1 154 ? -43.847 14.711 22.419 1.00 72.51  ? 327 TYR A CA  1 
ATOM   1146 C  C   . TYR A 1 154 ? -45.051 14.283 23.238 1.00 73.07  ? 327 TYR A C   1 
ATOM   1147 O  O   . TYR A 1 154 ? -45.668 15.091 23.943 1.00 73.12  ? 327 TYR A O   1 
ATOM   1148 C  CB  . TYR A 1 154 ? -42.733 15.216 23.332 1.00 72.13  ? 327 TYR A CB  1 
ATOM   1149 C  CG  . TYR A 1 154 ? -41.482 15.617 22.595 1.00 71.19  ? 327 TYR A CG  1 
ATOM   1150 C  CD1 . TYR A 1 154 ? -40.672 14.665 21.988 1.00 70.80  ? 327 TYR A CD1 1 
ATOM   1151 C  CD2 . TYR A 1 154 ? -41.102 16.950 22.508 1.00 70.15  ? 327 TYR A CD2 1 
ATOM   1152 C  CE1 . TYR A 1 154 ? -39.520 15.032 21.308 1.00 70.06  ? 327 TYR A CE1 1 
ATOM   1153 C  CE2 . TYR A 1 154 ? -39.947 17.326 21.833 1.00 69.07  ? 327 TYR A CE2 1 
ATOM   1154 C  CZ  . TYR A 1 154 ? -39.167 16.363 21.236 1.00 69.11  ? 327 TYR A CZ  1 
ATOM   1155 O  OH  . TYR A 1 154 ? -38.027 16.726 20.566 1.00 68.76  ? 327 TYR A OH  1 
ATOM   1156 N  N   . ILE A 1 155 ? -45.402 13.008 23.114 1.00 73.61  ? 328 ILE A N   1 
ATOM   1157 C  CA  . ILE A 1 155 ? -46.484 12.441 23.907 1.00 73.96  ? 328 ILE A CA  1 
ATOM   1158 C  C   . ILE A 1 155 ? -45.904 11.688 25.094 1.00 74.17  ? 328 ILE A C   1 
ATOM   1159 O  O   . ILE A 1 155 ? -44.705 11.404 25.138 1.00 74.22  ? 328 ILE A O   1 
ATOM   1160 C  CB  . ILE A 1 155 ? -47.416 11.526 23.077 1.00 73.91  ? 328 ILE A CB  1 
ATOM   1161 C  CG1 . ILE A 1 155 ? -46.607 10.523 22.242 1.00 73.76  ? 328 ILE A CG1 1 
ATOM   1162 C  CG2 . ILE A 1 155 ? -48.296 12.375 22.181 1.00 74.06  ? 328 ILE A CG2 1 
ATOM   1163 C  CD1 . ILE A 1 155 ? -47.281 9.168  22.089 1.00 74.01  ? 328 ILE A CD1 1 
ATOM   1164 N  N   . THR A 1 156 ? -46.768 11.372 26.050 1.00 74.40  ? 329 THR A N   1 
ATOM   1165 C  CA  . THR A 1 156 ? -46.360 10.744 27.290 1.00 74.51  ? 329 THR A CA  1 
ATOM   1166 C  C   . THR A 1 156 ? -45.339 9.653  27.039 1.00 74.60  ? 329 THR A C   1 
ATOM   1167 O  O   . THR A 1 156 ? -44.269 9.657  27.637 1.00 74.71  ? 329 THR A O   1 
ATOM   1168 C  CB  . THR A 1 156 ? -47.563 10.147 28.031 1.00 74.65  ? 329 THR A CB  1 
ATOM   1169 O  OG1 . THR A 1 156 ? -48.663 11.069 28.003 1.00 74.60  ? 329 THR A OG1 1 
ATOM   1170 C  CG2 . THR A 1 156 ? -47.191 9.856  29.466 1.00 74.71  ? 329 THR A CG2 1 
ATOM   1171 N  N   . SER A 1 157 ? -45.664 8.737  26.132 1.00 74.86  ? 330 SER A N   1 
ATOM   1172 C  CA  . SER A 1 157 ? -44.790 7.602  25.828 1.00 75.31  ? 330 SER A CA  1 
ATOM   1173 C  C   . SER A 1 157 ? -43.446 7.976  25.156 1.00 75.45  ? 330 SER A C   1 
ATOM   1174 O  O   . SER A 1 157 ? -42.558 7.125  24.998 1.00 75.57  ? 330 SER A O   1 
ATOM   1175 C  CB  . SER A 1 157 ? -45.552 6.536  25.019 1.00 75.32  ? 330 SER A CB  1 
ATOM   1176 O  OG  . SER A 1 157 ? -45.969 7.020  23.754 1.00 75.48  ? 330 SER A OG  1 
ATOM   1177 N  N   . GLU A 1 158 ? -43.295 9.247  24.789 1.00 75.48  ? 331 GLU A N   1 
ATOM   1178 C  CA  . GLU A 1 158 ? -42.069 9.722  24.160 1.00 75.58  ? 331 GLU A CA  1 
ATOM   1179 C  C   . GLU A 1 158 ? -41.198 10.516 25.110 1.00 75.43  ? 331 GLU A C   1 
ATOM   1180 O  O   . GLU A 1 158 ? -40.132 10.988 24.729 1.00 75.60  ? 331 GLU A O   1 
ATOM   1181 C  CB  . GLU A 1 158 ? -42.392 10.569 22.943 1.00 75.75  ? 331 GLU A CB  1 
ATOM   1182 C  CG  . GLU A 1 158 ? -42.632 9.754  21.698 1.00 77.00  ? 331 GLU A CG  1 
ATOM   1183 C  CD  . GLU A 1 158 ? -43.614 10.416 20.760 1.00 78.11  ? 331 GLU A CD  1 
ATOM   1184 O  OE1 . GLU A 1 158 ? -44.155 9.714  19.894 1.00 78.39  ? 331 GLU A OE1 1 
ATOM   1185 O  OE2 . GLU A 1 158 ? -43.864 11.632 20.888 1.00 79.29  ? 331 GLU A OE2 1 
ATOM   1186 N  N   . ILE A 1 159 ? -41.647 10.672 26.345 1.00 75.28  ? 332 ILE A N   1 
ATOM   1187 C  CA  . ILE A 1 159 ? -40.819 11.315 27.345 1.00 75.26  ? 332 ILE A CA  1 
ATOM   1188 C  C   . ILE A 1 159 ? -40.100 10.259 28.179 1.00 75.63  ? 332 ILE A C   1 
ATOM   1189 O  O   . ILE A 1 159 ? -40.751 9.413  28.808 1.00 76.02  ? 332 ILE A O   1 
ATOM   1190 C  CB  . ILE A 1 159 ? -41.636 12.210 28.243 1.00 75.03  ? 332 ILE A CB  1 
ATOM   1191 C  CG1 . ILE A 1 159 ? -42.304 13.291 27.400 1.00 75.03  ? 332 ILE A CG1 1 
ATOM   1192 C  CG2 . ILE A 1 159 ? -40.742 12.831 29.286 1.00 74.89  ? 332 ILE A CG2 1 
ATOM   1193 C  CD1 . ILE A 1 159 ? -43.541 13.884 28.027 1.00 74.87  ? 332 ILE A CD1 1 
ATOM   1194 N  N   . LEU A 1 160 ? -38.762 10.321 28.180 1.00 75.49  ? 333 LEU A N   1 
ATOM   1195 C  CA  . LEU A 1 160 ? -37.909 9.325  28.835 1.00 75.05  ? 333 LEU A CA  1 
ATOM   1196 C  C   . LEU A 1 160 ? -37.350 9.802  30.154 1.00 74.80  ? 333 LEU A C   1 
ATOM   1197 O  O   . LEU A 1 160 ? -36.466 10.653 30.191 1.00 74.50  ? 333 LEU A O   1 
ATOM   1198 C  CB  . LEU A 1 160 ? -36.748 8.959  27.931 1.00 75.16  ? 333 LEU A CB  1 
ATOM   1199 C  CG  . LEU A 1 160 ? -37.135 8.539  26.521 1.00 75.68  ? 333 LEU A CG  1 
ATOM   1200 C  CD1 . LEU A 1 160 ? -35.867 8.188  25.739 1.00 76.34  ? 333 LEU A CD1 1 
ATOM   1201 C  CD2 . LEU A 1 160 ? -38.138 7.379  26.552 1.00 75.78  ? 333 LEU A CD2 1 
ATOM   1202 N  N   . TRP A 1 161 ? -37.858 9.217  31.232 1.00 74.76  ? 334 TRP A N   1 
ATOM   1203 C  CA  . TRP A 1 161 ? -37.502 9.633  32.574 1.00 74.76  ? 334 TRP A CA  1 
ATOM   1204 C  C   . TRP A 1 161 ? -36.162 9.076  33.002 1.00 74.86  ? 334 TRP A C   1 
ATOM   1205 O  O   . TRP A 1 161 ? -35.900 7.891  32.860 1.00 75.10  ? 334 TRP A O   1 
ATOM   1206 C  CB  . TRP A 1 161 ? -38.568 9.180  33.560 1.00 74.72  ? 334 TRP A CB  1 
ATOM   1207 C  CG  . TRP A 1 161 ? -38.379 9.737  34.929 1.00 74.55  ? 334 TRP A CG  1 
ATOM   1208 C  CD1 . TRP A 1 161 ? -37.402 9.403  35.825 1.00 74.80  ? 334 TRP A CD1 1 
ATOM   1209 C  CD2 . TRP A 1 161 ? -39.194 10.720 35.572 1.00 74.14  ? 334 TRP A CD2 1 
ATOM   1210 N  NE1 . TRP A 1 161 ? -37.558 10.123 36.985 1.00 74.94  ? 334 TRP A NE1 1 
ATOM   1211 C  CE2 . TRP A 1 161 ? -38.651 10.939 36.856 1.00 74.35  ? 334 TRP A CE2 1 
ATOM   1212 C  CE3 . TRP A 1 161 ? -40.332 11.439 35.188 1.00 73.51  ? 334 TRP A CE3 1 
ATOM   1213 C  CZ2 . TRP A 1 161 ? -39.208 11.844 37.758 1.00 73.92  ? 334 TRP A CZ2 1 
ATOM   1214 C  CZ3 . TRP A 1 161 ? -40.882 12.337 36.084 1.00 73.33  ? 334 TRP A CZ3 1 
ATOM   1215 C  CH2 . TRP A 1 161 ? -40.320 12.534 37.352 1.00 73.69  ? 334 TRP A CH2 1 
ATOM   1216 N  N   . GLY A 1 162 ? -35.325 9.943  33.549 1.00 75.01  ? 335 GLY A N   1 
ATOM   1217 C  CA  . GLY A 1 162 ? -34.053 9.538  34.099 1.00 75.29  ? 335 GLY A CA  1 
ATOM   1218 C  C   . GLY A 1 162 ? -33.002 9.337  33.042 1.00 75.64  ? 335 GLY A C   1 
ATOM   1219 O  O   . GLY A 1 162 ? -32.078 8.563  33.244 1.00 76.06  ? 335 GLY A O   1 
ATOM   1220 N  N   . TYR A 1 163 ? -33.134 10.032 31.919 1.00 75.95  ? 336 TYR A N   1 
ATOM   1221 C  CA  . TYR A 1 163 ? -32.149 9.943  30.847 1.00 76.52  ? 336 TYR A CA  1 
ATOM   1222 C  C   . TYR A 1 163 ? -31.514 11.286 30.530 1.00 76.80  ? 336 TYR A C   1 
ATOM   1223 O  O   . TYR A 1 163 ? -31.977 12.320 31.015 1.00 76.86  ? 336 TYR A O   1 
ATOM   1224 C  CB  . TYR A 1 163 ? -32.800 9.409  29.589 1.00 76.64  ? 336 TYR A CB  1 
ATOM   1225 C  CG  . TYR A 1 163 ? -33.171 7.965  29.655 1.00 77.45  ? 336 TYR A CG  1 
ATOM   1226 C  CD1 . TYR A 1 163 ? -32.348 6.996  29.100 1.00 78.78  ? 336 TYR A CD1 1 
ATOM   1227 C  CD2 . TYR A 1 163 ? -34.352 7.559  30.256 1.00 78.34  ? 336 TYR A CD2 1 
ATOM   1228 C  CE1 . TYR A 1 163 ? -32.688 5.643  29.145 1.00 79.56  ? 336 TYR A CE1 1 
ATOM   1229 C  CE2 . TYR A 1 163 ? -34.707 6.208  30.304 1.00 79.33  ? 336 TYR A CE2 1 
ATOM   1230 C  CZ  . TYR A 1 163 ? -33.870 5.258  29.744 1.00 79.50  ? 336 TYR A CZ  1 
ATOM   1231 O  OH  . TYR A 1 163 ? -34.210 3.926  29.783 1.00 79.77  ? 336 TYR A OH  1 
ATOM   1232 N  N   . ARG A 1 164 ? -30.459 11.260 29.708 1.00 77.20  ? 337 ARG A N   1 
ATOM   1233 C  CA  . ARG A 1 164 ? -29.773 12.481 29.234 1.00 77.66  ? 337 ARG A CA  1 
ATOM   1234 C  C   . ARG A 1 164 ? -29.460 12.392 27.734 1.00 77.82  ? 337 ARG A C   1 
ATOM   1235 O  O   . ARG A 1 164 ? -29.417 11.299 27.176 1.00 77.74  ? 337 ARG A O   1 
ATOM   1236 C  CB  . ARG A 1 164 ? -28.486 12.759 30.042 1.00 77.65  ? 337 ARG A CB  1 
ATOM   1237 C  CG  . ARG A 1 164 ? -28.671 12.770 31.573 1.00 77.66  ? 337 ARG A CG  1 
ATOM   1238 C  CD  . ARG A 1 164 ? -27.669 13.670 32.308 1.00 77.75  ? 337 ARG A CD  1 
ATOM   1239 N  NE  . ARG A 1 164 ? -26.348 13.067 32.525 1.00 77.06  ? 337 ARG A NE  1 
ATOM   1240 C  CZ  . ARG A 1 164 ? -25.775 12.906 33.718 1.00 76.44  ? 337 ARG A CZ  1 
ATOM   1241 N  NH1 . ARG A 1 164 ? -26.394 13.295 34.827 1.00 76.21  ? 337 ARG A NH1 1 
ATOM   1242 N  NH2 . ARG A 1 164 ? -24.571 12.361 33.804 1.00 76.29  ? 337 ARG A NH2 1 
ATOM   1243 N  N   . PHE A 1 165 ? -29.257 13.530 27.077 1.00 78.18  ? 338 PHE A N   1 
ATOM   1244 C  CA  . PHE A 1 165 ? -28.897 13.500 25.664 1.00 78.78  ? 338 PHE A CA  1 
ATOM   1245 C  C   . PHE A 1 165 ? -27.418 13.226 25.529 1.00 79.37  ? 338 PHE A C   1 
ATOM   1246 O  O   . PHE A 1 165 ? -26.624 13.693 26.340 1.00 79.40  ? 338 PHE A O   1 
ATOM   1247 C  CB  . PHE A 1 165 ? -29.264 14.805 24.950 1.00 78.73  ? 338 PHE A CB  1 
ATOM   1248 C  CG  . PHE A 1 165 ? -30.730 14.928 24.621 1.00 78.37  ? 338 PHE A CG  1 
ATOM   1249 C  CD1 . PHE A 1 165 ? -31.577 15.678 25.429 1.00 77.66  ? 338 PHE A CD1 1 
ATOM   1250 C  CD2 . PHE A 1 165 ? -31.266 14.288 23.507 1.00 77.50  ? 338 PHE A CD2 1 
ATOM   1251 C  CE1 . PHE A 1 165 ? -32.928 15.786 25.135 1.00 76.83  ? 338 PHE A CE1 1 
ATOM   1252 C  CE2 . PHE A 1 165 ? -32.620 14.393 23.210 1.00 76.81  ? 338 PHE A CE2 1 
ATOM   1253 C  CZ  . PHE A 1 165 ? -33.450 15.144 24.025 1.00 76.64  ? 338 PHE A CZ  1 
ATOM   1254 N  N   . THR A 1 166 ? -27.055 12.446 24.518 1.00 80.31  ? 339 THR A N   1 
ATOM   1255 C  CA  . THR A 1 166 ? -25.657 12.131 24.252 1.00 81.37  ? 339 THR A CA  1 
ATOM   1256 C  C   . THR A 1 166 ? -25.027 13.364 23.609 1.00 82.11  ? 339 THR A C   1 
ATOM   1257 O  O   . THR A 1 166 ? -25.701 14.051 22.840 1.00 82.19  ? 339 THR A O   1 
ATOM   1258 C  CB  . THR A 1 166 ? -25.534 10.916 23.299 1.00 81.39  ? 339 THR A CB  1 
ATOM   1259 O  OG1 . THR A 1 166 ? -26.454 9.889  23.693 1.00 81.74  ? 339 THR A OG1 1 
ATOM   1260 C  CG2 . THR A 1 166 ? -24.132 10.347 23.321 1.00 81.67  ? 339 THR A CG2 1 
ATOM   1261 N  N   . PRO A 1 167 ? -23.753 13.678 23.947 1.00 82.94  ? 340 PRO A N   1 
ATOM   1262 C  CA  . PRO A 1 167 ? -23.066 14.798 23.277 1.00 83.54  ? 340 PRO A CA  1 
ATOM   1263 C  C   . PRO A 1 167 ? -22.842 14.506 21.802 1.00 84.12  ? 340 PRO A C   1 
ATOM   1264 O  O   . PRO A 1 167 ? -22.609 13.358 21.427 1.00 84.12  ? 340 PRO A O   1 
ATOM   1265 C  CB  . PRO A 1 167 ? -21.718 14.892 24.008 1.00 83.37  ? 340 PRO A CB  1 
ATOM   1266 C  CG  . PRO A 1 167 ? -21.964 14.275 25.328 1.00 83.36  ? 340 PRO A CG  1 
ATOM   1267 C  CD  . PRO A 1 167 ? -22.967 13.165 25.085 1.00 83.10  ? 340 PRO A CD  1 
ATOM   1268 N  N   . VAL A 1 168 ? -22.928 15.539 20.975 1.00 84.92  ? 341 VAL A N   1 
ATOM   1269 C  CA  . VAL A 1 168 ? -22.809 15.362 19.538 1.00 85.75  ? 341 VAL A CA  1 
ATOM   1270 C  C   . VAL A 1 168 ? -21.733 16.279 18.986 1.00 86.37  ? 341 VAL A C   1 
ATOM   1271 O  O   . VAL A 1 168 ? -21.360 16.181 17.816 1.00 86.57  ? 341 VAL A O   1 
ATOM   1272 C  CB  . VAL A 1 168 ? -24.156 15.621 18.807 1.00 85.72  ? 341 VAL A CB  1 
ATOM   1273 C  CG1 . VAL A 1 168 ? -25.276 14.778 19.414 1.00 85.57  ? 341 VAL A CG1 1 
ATOM   1274 C  CG2 . VAL A 1 168 ? -24.521 17.101 18.837 1.00 86.05  ? 341 VAL A CG2 1 
ATOM   1275 N  N   . LEU A 1 169 ? -21.227 17.167 19.831 1.00 87.10  ? 342 LEU A N   1 
ATOM   1276 C  CA  . LEU A 1 169 ? -20.259 18.138 19.366 1.00 88.09  ? 342 LEU A CA  1 
ATOM   1277 C  C   . LEU A 1 169 ? -18.822 17.703 19.638 1.00 88.76  ? 342 LEU A C   1 
ATOM   1278 O  O   . LEU A 1 169 ? -18.476 17.332 20.760 1.00 88.86  ? 342 LEU A O   1 
ATOM   1279 C  CB  . LEU A 1 169 ? -20.549 19.509 19.970 1.00 88.17  ? 342 LEU A CB  1 
ATOM   1280 C  CG  . LEU A 1 169 ? -20.017 20.730 19.206 1.00 88.46  ? 342 LEU A CG  1 
ATOM   1281 C  CD1 . LEU A 1 169 ? -20.687 20.911 17.840 1.00 88.69  ? 342 LEU A CD1 1 
ATOM   1282 C  CD2 . LEU A 1 169 ? -20.206 21.978 20.045 1.00 88.90  ? 342 LEU A CD2 1 
ATOM   1283 N  N   . THR A 1 170 ? -17.998 17.742 18.591 1.00 89.65  ? 343 THR A N   1 
ATOM   1284 C  CA  . THR A 1 170 ? -16.588 17.363 18.672 1.00 90.44  ? 343 THR A CA  1 
ATOM   1285 C  C   . THR A 1 170 ? -15.737 18.286 17.808 1.00 91.21  ? 343 THR A C   1 
ATOM   1286 O  O   . THR A 1 170 ? -16.104 18.593 16.666 1.00 91.04  ? 343 THR A O   1 
ATOM   1287 C  CB  . THR A 1 170 ? -16.355 15.915 18.198 1.00 90.39  ? 343 THR A CB  1 
ATOM   1288 O  OG1 . THR A 1 170 ? -17.030 15.715 16.951 1.00 89.82  ? 343 THR A OG1 1 
ATOM   1289 C  CG2 . THR A 1 170 ? -16.857 14.894 19.237 1.00 90.39  ? 343 THR A CG2 1 
ATOM   1290 N  N   . LEU A 1 171 ? -14.600 18.717 18.363 1.00 92.29  ? 344 LEU A N   1 
ATOM   1291 C  CA  . LEU A 1 171 ? -13.655 19.599 17.664 1.00 93.25  ? 344 LEU A CA  1 
ATOM   1292 C  C   . LEU A 1 171 ? -12.654 18.813 16.822 1.00 94.39  ? 344 LEU A C   1 
ATOM   1293 O  O   . LEU A 1 171 ? -11.847 18.028 17.338 1.00 94.51  ? 344 LEU A O   1 
ATOM   1294 C  CB  . LEU A 1 171 ? -12.914 20.523 18.642 1.00 92.77  ? 344 LEU A CB  1 
ATOM   1295 C  CG  . LEU A 1 171 ? -11.775 21.384 18.081 1.00 91.99  ? 344 LEU A CG  1 
ATOM   1296 C  CD1 . LEU A 1 171 ? -12.201 22.211 16.865 1.00 91.25  ? 344 LEU A CD1 1 
ATOM   1297 C  CD2 . LEU A 1 171 ? -11.182 22.269 19.158 1.00 90.58  ? 344 LEU A CD2 1 
ATOM   1298 N  N   . GLU A 1 172 ? -12.713 19.046 15.516 1.00 95.77  ? 345 GLU A N   1 
ATOM   1299 C  CA  . GLU A 1 172 ? -11.809 18.390 14.588 1.00 97.15  ? 345 GLU A CA  1 
ATOM   1300 C  C   . GLU A 1 172 ? -11.199 19.370 13.589 1.00 97.60  ? 345 GLU A C   1 
ATOM   1301 O  O   . GLU A 1 172 ? -11.894 19.915 12.717 1.00 97.63  ? 345 GLU A O   1 
ATOM   1302 C  CB  . GLU A 1 172 ? -12.512 17.227 13.872 1.00 97.47  ? 345 GLU A CB  1 
ATOM   1303 C  CG  . GLU A 1 172 ? -12.290 15.860 14.543 1.00 98.75  ? 345 GLU A CG  1 
ATOM   1304 C  CD  . GLU A 1 172 ? -13.191 14.769 13.969 1.00 100.12 ? 345 GLU A CD  1 
ATOM   1305 O  OE1 . GLU A 1 172 ? -12.978 14.340 12.806 1.00 100.02 ? 345 GLU A OE1 1 
ATOM   1306 O  OE2 . GLU A 1 172 ? -14.116 14.338 14.694 1.00 101.34 ? 345 GLU A OE2 1 
ATOM   1307 N  N   . ASP A 1 173 ? -9.894  19.591 13.748 1.00 98.21  ? 346 ASP A N   1 
ATOM   1308 C  CA  . ASP A 1 173 ? -9.084  20.344 12.785 1.00 98.76  ? 346 ASP A CA  1 
ATOM   1309 C  C   . ASP A 1 173 ? -9.466  21.844 12.732 1.00 98.81  ? 346 ASP A C   1 
ATOM   1310 O  O   . ASP A 1 173 ? -9.535  22.454 11.647 1.00 98.85  ? 346 ASP A O   1 
ATOM   1311 C  CB  . ASP A 1 173 ? -9.147  19.664 11.392 1.00 98.87  ? 346 ASP A CB  1 
ATOM   1312 C  CG  . ASP A 1 173 ? -7.774  19.564 10.710 1.00 99.24  ? 346 ASP A CG  1 
ATOM   1313 O  OD1 . ASP A 1 173 ? -7.724  19.072 9.563  1.00 98.85  ? 346 ASP A OD1 1 
ATOM   1314 O  OD2 . ASP A 1 173 ? -6.749  19.972 11.308 1.00 100.31 ? 346 ASP A OD2 1 
ATOM   1315 N  N   . GLY A 1 174 ? -9.703  22.425 13.912 1.00 98.74  ? 347 GLY A N   1 
ATOM   1316 C  CA  . GLY A 1 174 ? -10.070 23.842 14.032 1.00 98.64  ? 347 GLY A CA  1 
ATOM   1317 C  C   . GLY A 1 174 ? -11.456 24.172 13.494 1.00 98.47  ? 347 GLY A C   1 
ATOM   1318 O  O   . GLY A 1 174 ? -11.749 25.331 13.170 1.00 98.50  ? 347 GLY A O   1 
ATOM   1319 N  N   . PHE A 1 175 ? -12.292 23.137 13.380 1.00 98.12  ? 348 PHE A N   1 
ATOM   1320 C  CA  . PHE A 1 175 ? -13.707 23.259 13.014 1.00 97.80  ? 348 PHE A CA  1 
ATOM   1321 C  C   . PHE A 1 175 ? -14.514 22.325 13.917 1.00 97.15  ? 348 PHE A C   1 
ATOM   1322 O  O   . PHE A 1 175 ? -14.075 21.214 14.222 1.00 97.45  ? 348 PHE A O   1 
ATOM   1323 C  CB  . PHE A 1 175 ? -13.935 22.892 11.537 1.00 97.98  ? 348 PHE A CB  1 
ATOM   1324 C  CG  . PHE A 1 175 ? -13.954 24.078 10.598 1.00 98.87  ? 348 PHE A CG  1 
ATOM   1325 C  CD1 . PHE A 1 175 ? -15.167 24.677 10.237 1.00 99.43  ? 348 PHE A CD1 1 
ATOM   1326 C  CD2 . PHE A 1 175 ? -12.763 24.585 10.060 1.00 99.65  ? 348 PHE A CD2 1 
ATOM   1327 C  CE1 . PHE A 1 175 ? -15.195 25.769 9.359  1.00 100.24 ? 348 PHE A CE1 1 
ATOM   1328 C  CE2 . PHE A 1 175 ? -12.774 25.678 9.179  1.00 100.11 ? 348 PHE A CE2 1 
ATOM   1329 C  CZ  . PHE A 1 175 ? -13.991 26.272 8.828  1.00 100.60 ? 348 PHE A CZ  1 
ATOM   1330 N  N   . TYR A 1 176 ? -15.683 22.767 14.360 1.00 96.11  ? 349 TYR A N   1 
ATOM   1331 C  CA  . TYR A 1 176 ? -16.510 21.910 15.191 1.00 95.20  ? 349 TYR A CA  1 
ATOM   1332 C  C   . TYR A 1 176 ? -17.437 21.087 14.305 1.00 94.86  ? 349 TYR A C   1 
ATOM   1333 O  O   . TYR A 1 176 ? -18.195 21.639 13.509 1.00 94.73  ? 349 TYR A O   1 
ATOM   1334 C  CB  . TYR A 1 176 ? -17.317 22.740 16.201 1.00 95.16  ? 349 TYR A CB  1 
ATOM   1335 C  CG  . TYR A 1 176 ? -16.526 23.226 17.401 1.00 93.99  ? 349 TYR A CG  1 
ATOM   1336 C  CD1 . TYR A 1 176 ? -16.572 22.542 18.618 1.00 92.60  ? 349 TYR A CD1 1 
ATOM   1337 C  CD2 . TYR A 1 176 ? -15.738 24.377 17.321 1.00 93.40  ? 349 TYR A CD2 1 
ATOM   1338 C  CE1 . TYR A 1 176 ? -15.847 22.991 19.723 1.00 92.12  ? 349 TYR A CE1 1 
ATOM   1339 C  CE2 . TYR A 1 176 ? -15.011 24.832 18.418 1.00 92.45  ? 349 TYR A CE2 1 
ATOM   1340 C  CZ  . TYR A 1 176 ? -15.071 24.135 19.612 1.00 91.97  ? 349 TYR A CZ  1 
ATOM   1341 O  OH  . TYR A 1 176 ? -14.344 24.581 20.688 1.00 91.57  ? 349 TYR A OH  1 
ATOM   1342 N  N   . GLU A 1 177 ? -17.374 19.765 14.440 1.00 94.37  ? 350 GLU A N   1 
ATOM   1343 C  CA  . GLU A 1 177 ? -18.257 18.895 13.665 1.00 93.98  ? 350 GLU A CA  1 
ATOM   1344 C  C   . GLU A 1 177 ? -19.309 18.208 14.523 1.00 93.42  ? 350 GLU A C   1 
ATOM   1345 O  O   . GLU A 1 177 ? -19.090 17.904 15.695 1.00 93.21  ? 350 GLU A O   1 
ATOM   1346 C  CB  . GLU A 1 177 ? -17.464 17.864 12.850 1.00 94.18  ? 350 GLU A CB  1 
ATOM   1347 C  CG  . GLU A 1 177 ? -16.458 18.461 11.860 1.00 94.71  ? 350 GLU A CG  1 
ATOM   1348 C  CD  . GLU A 1 177 ? -17.105 19.189 10.681 1.00 95.33  ? 350 GLU A CD  1 
ATOM   1349 O  OE1 . GLU A 1 177 ? -16.380 19.954 10.005 1.00 95.89  ? 350 GLU A OE1 1 
ATOM   1350 O  OE2 . GLU A 1 177 ? -18.319 19.003 10.426 1.00 94.95  ? 350 GLU A OE2 1 
ATOM   1351 N  N   . VAL A 1 178 ? -20.450 17.950 13.905 1.00 92.92  ? 351 VAL A N   1 
ATOM   1352 C  CA  . VAL A 1 178 ? -21.590 17.391 14.592 1.00 92.56  ? 351 VAL A CA  1 
ATOM   1353 C  C   . VAL A 1 178 ? -21.833 15.955 14.148 1.00 92.25  ? 351 VAL A C   1 
ATOM   1354 O  O   . VAL A 1 178 ? -22.158 15.711 12.989 1.00 92.18  ? 351 VAL A O   1 
ATOM   1355 C  CB  . VAL A 1 178 ? -22.847 18.222 14.285 1.00 92.63  ? 351 VAL A CB  1 
ATOM   1356 C  CG1 . VAL A 1 178 ? -24.030 17.725 15.101 1.00 92.66  ? 351 VAL A CG1 1 
ATOM   1357 C  CG2 . VAL A 1 178 ? -22.580 19.694 14.555 1.00 92.74  ? 351 VAL A CG2 1 
ATOM   1358 N  N   . ASP A 1 179 ? -21.686 15.009 15.067 1.00 91.93  ? 352 ASP A N   1 
ATOM   1359 C  CA  . ASP A 1 179 ? -22.001 13.618 14.762 1.00 91.81  ? 352 ASP A CA  1 
ATOM   1360 C  C   . ASP A 1 179 ? -23.516 13.385 14.735 1.00 91.38  ? 352 ASP A C   1 
ATOM   1361 O  O   . ASP A 1 179 ? -24.092 12.857 15.691 1.00 91.24  ? 352 ASP A O   1 
ATOM   1362 C  CB  . ASP A 1 179 ? -21.320 12.669 15.752 1.00 92.08  ? 352 ASP A CB  1 
ATOM   1363 C  CG  . ASP A 1 179 ? -21.611 11.202 15.450 1.00 93.07  ? 352 ASP A CG  1 
ATOM   1364 O  OD1 . ASP A 1 179 ? -22.016 10.887 14.309 1.00 94.50  ? 352 ASP A OD1 1 
ATOM   1365 O  OD2 . ASP A 1 179 ? -21.440 10.358 16.353 1.00 93.89  ? 352 ASP A OD2 1 
ATOM   1366 N  N   . TYR A 1 180 ? -24.139 13.758 13.617 1.00 90.97  ? 353 TYR A N   1 
ATOM   1367 C  CA  . TYR A 1 180 ? -25.598 13.710 13.448 1.00 90.72  ? 353 TYR A CA  1 
ATOM   1368 C  C   . TYR A 1 180 ? -26.248 12.339 13.665 1.00 90.36  ? 353 TYR A C   1 
ATOM   1369 O  O   . TYR A 1 180 ? -27.460 12.250 13.871 1.00 90.24  ? 353 TYR A O   1 
ATOM   1370 C  CB  . TYR A 1 180 ? -25.998 14.266 12.078 1.00 90.84  ? 353 TYR A CB  1 
ATOM   1371 C  CG  . TYR A 1 180 ? -25.985 15.780 11.995 1.00 91.51  ? 353 TYR A CG  1 
ATOM   1372 C  CD1 . TYR A 1 180 ? -26.777 16.546 12.853 1.00 92.07  ? 353 TYR A CD1 1 
ATOM   1373 C  CD2 . TYR A 1 180 ? -25.201 16.449 11.048 1.00 91.96  ? 353 TYR A CD2 1 
ATOM   1374 C  CE1 . TYR A 1 180 ? -26.783 17.938 12.787 1.00 92.04  ? 353 TYR A CE1 1 
ATOM   1375 C  CE2 . TYR A 1 180 ? -25.201 17.847 10.973 1.00 92.51  ? 353 TYR A CE2 1 
ATOM   1376 C  CZ  . TYR A 1 180 ? -25.997 18.581 11.854 1.00 92.48  ? 353 TYR A CZ  1 
ATOM   1377 O  OH  . TYR A 1 180 ? -26.025 19.956 11.811 1.00 92.55  ? 353 TYR A OH  1 
ATOM   1378 N  N   . ASN A 1 181 ? -25.445 11.281 13.609 1.00 89.97  ? 354 ASN A N   1 
ATOM   1379 C  CA  . ASN A 1 181 ? -25.914 9.942  13.945 1.00 89.58  ? 354 ASN A CA  1 
ATOM   1380 C  C   . ASN A 1 181 ? -26.472 9.887  15.358 1.00 89.21  ? 354 ASN A C   1 
ATOM   1381 O  O   . ASN A 1 181 ? -27.429 9.165  15.635 1.00 89.40  ? 354 ASN A O   1 
ATOM   1382 C  CB  . ASN A 1 181 ? -24.771 8.929  13.834 1.00 89.77  ? 354 ASN A CB  1 
ATOM   1383 C  CG  . ASN A 1 181 ? -24.713 8.246  12.480 1.00 89.90  ? 354 ASN A CG  1 
ATOM   1384 O  OD1 . ASN A 1 181 ? -25.572 8.456  11.620 1.00 89.91  ? 354 ASN A OD1 1 
ATOM   1385 N  ND2 . ASN A 1 181 ? -23.692 7.415  12.288 1.00 90.18  ? 354 ASN A ND2 1 
ATOM   1386 N  N   . SER A 1 182 ? -25.862 10.649 16.256 1.00 88.49  ? 355 SER A N   1 
ATOM   1387 C  CA  . SER A 1 182 ? -26.196 10.553 17.662 1.00 87.89  ? 355 SER A CA  1 
ATOM   1388 C  C   . SER A 1 182 ? -27.204 11.605 18.087 1.00 87.33  ? 355 SER A C   1 
ATOM   1389 O  O   . SER A 1 182 ? -27.627 11.637 19.244 1.00 87.27  ? 355 SER A O   1 
ATOM   1390 C  CB  . SER A 1 182 ? -24.926 10.660 18.492 1.00 88.05  ? 355 SER A CB  1 
ATOM   1391 O  OG  . SER A 1 182 ? -23.923 9.829  17.933 1.00 88.58  ? 355 SER A OG  1 
ATOM   1392 N  N   . PHE A 1 183 ? -27.596 12.453 17.141 1.00 86.70  ? 356 PHE A N   1 
ATOM   1393 C  CA  . PHE A 1 183 ? -28.545 13.528 17.404 1.00 86.05  ? 356 PHE A CA  1 
ATOM   1394 C  C   . PHE A 1 183 ? -29.676 13.062 18.302 1.00 85.61  ? 356 PHE A C   1 
ATOM   1395 O  O   . PHE A 1 183 ? -29.963 13.714 19.300 1.00 85.73  ? 356 PHE A O   1 
ATOM   1396 C  CB  . PHE A 1 183 ? -29.107 14.089 16.099 1.00 85.99  ? 356 PHE A CB  1 
ATOM   1397 C  CG  . PHE A 1 183 ? -30.054 15.248 16.284 1.00 86.40  ? 356 PHE A CG  1 
ATOM   1398 C  CD1 . PHE A 1 183 ? -29.581 16.557 16.292 1.00 86.80  ? 356 PHE A CD1 1 
ATOM   1399 C  CD2 . PHE A 1 183 ? -31.426 15.034 16.427 1.00 87.09  ? 356 PHE A CD2 1 
ATOM   1400 C  CE1 . PHE A 1 183 ? -30.456 17.635 16.445 1.00 87.03  ? 356 PHE A CE1 1 
ATOM   1401 C  CE2 . PHE A 1 183 ? -32.312 16.108 16.582 1.00 87.14  ? 356 PHE A CE2 1 
ATOM   1402 C  CZ  . PHE A 1 183 ? -31.825 17.408 16.588 1.00 87.30  ? 356 PHE A CZ  1 
ATOM   1403 N  N   . HIS A 1 184 ? -30.297 11.932 17.959 1.00 84.96  ? 357 HIS A N   1 
ATOM   1404 C  CA  . HIS A 1 184 ? -31.479 11.451 18.671 1.00 84.35  ? 357 HIS A CA  1 
ATOM   1405 C  C   . HIS A 1 184 ? -31.168 10.572 19.852 1.00 84.16  ? 357 HIS A C   1 
ATOM   1406 O  O   . HIS A 1 184 ? -32.061 10.234 20.617 1.00 84.13  ? 357 HIS A O   1 
ATOM   1407 C  CB  . HIS A 1 184 ? -32.383 10.675 17.734 1.00 84.24  ? 357 HIS A CB  1 
ATOM   1408 C  CG  . HIS A 1 184 ? -32.930 11.498 16.619 1.00 84.14  ? 357 HIS A CG  1 
ATOM   1409 N  ND1 . HIS A 1 184 ? -34.056 12.280 16.759 1.00 83.50  ? 357 HIS A ND1 1 
ATOM   1410 C  CD2 . HIS A 1 184 ? -32.500 11.672 15.347 1.00 83.95  ? 357 HIS A CD2 1 
ATOM   1411 C  CE1 . HIS A 1 184 ? -34.300 12.896 15.617 1.00 83.83  ? 357 HIS A CE1 1 
ATOM   1412 N  NE2 . HIS A 1 184 ? -33.372 12.542 14.743 1.00 83.70  ? 357 HIS A NE2 1 
ATOM   1413 N  N   . GLU A 1 185 ? -29.908 10.191 20.003 1.00 84.13  ? 358 GLU A N   1 
ATOM   1414 C  CA  . GLU A 1 185 ? -29.558 9.179  20.993 1.00 84.11  ? 358 GLU A CA  1 
ATOM   1415 C  C   . GLU A 1 185 ? -29.475 9.688  22.417 1.00 83.44  ? 358 GLU A C   1 
ATOM   1416 O  O   . GLU A 1 185 ? -28.980 10.783 22.681 1.00 83.34  ? 358 GLU A O   1 
ATOM   1417 C  CB  . GLU A 1 185 ? -28.266 8.467  20.620 1.00 84.48  ? 358 GLU A CB  1 
ATOM   1418 C  CG  . GLU A 1 185 ? -28.458 7.332  19.632 1.00 86.36  ? 358 GLU A CG  1 
ATOM   1419 C  CD  . GLU A 1 185 ? -27.144 6.634  19.313 1.00 89.90  ? 358 GLU A CD  1 
ATOM   1420 O  OE1 . GLU A 1 185 ? -26.111 7.337  19.092 1.00 90.73  ? 358 GLU A OE1 1 
ATOM   1421 O  OE2 . GLU A 1 185 ? -27.146 5.376  19.291 1.00 91.13  ? 358 GLU A OE2 1 
ATOM   1422 N  N   . THR A 1 186 ? -29.963 8.861  23.330 1.00 82.77  ? 359 THR A N   1 
ATOM   1423 C  CA  . THR A 1 186 ? -29.959 9.174  24.745 1.00 82.10  ? 359 THR A CA  1 
ATOM   1424 C  C   . THR A 1 186 ? -29.308 8.043  25.542 1.00 81.60  ? 359 THR A C   1 
ATOM   1425 O  O   . THR A 1 186 ? -29.249 6.901  25.077 1.00 81.49  ? 359 THR A O   1 
ATOM   1426 C  CB  . THR A 1 186 ? -31.399 9.438  25.254 1.00 82.16  ? 359 THR A CB  1 
ATOM   1427 O  OG1 . THR A 1 186 ? -32.317 8.529  24.634 1.00 82.02  ? 359 THR A OG1 1 
ATOM   1428 C  CG2 . THR A 1 186 ? -31.826 10.829 24.893 1.00 82.33  ? 359 THR A CG2 1 
ATOM   1429 N  N   . TYR A 1 187 ? -28.797 8.374  26.727 1.00 81.09  ? 360 TYR A N   1 
ATOM   1430 C  CA  . TYR A 1 187 ? -28.326 7.369  27.688 1.00 80.49  ? 360 TYR A CA  1 
ATOM   1431 C  C   . TYR A 1 187 ? -28.994 7.536  29.046 1.00 80.33  ? 360 TYR A C   1 
ATOM   1432 O  O   . TYR A 1 187 ? -29.473 8.621  29.375 1.00 80.36  ? 360 TYR A O   1 
ATOM   1433 C  CB  . TYR A 1 187 ? -26.802 7.398  27.837 1.00 80.29  ? 360 TYR A CB  1 
ATOM   1434 C  CG  . TYR A 1 187 ? -26.222 8.664  28.418 1.00 79.31  ? 360 TYR A CG  1 
ATOM   1435 C  CD1 . TYR A 1 187 ? -25.921 8.760  29.767 1.00 78.62  ? 360 TYR A CD1 1 
ATOM   1436 C  CD2 . TYR A 1 187 ? -25.932 9.749  27.607 1.00 79.26  ? 360 TYR A CD2 1 
ATOM   1437 C  CE1 . TYR A 1 187 ? -25.365 9.915  30.300 1.00 78.54  ? 360 TYR A CE1 1 
ATOM   1438 C  CE2 . TYR A 1 187 ? -25.378 10.909 28.129 1.00 79.12  ? 360 TYR A CE2 1 
ATOM   1439 C  CZ  . TYR A 1 187 ? -25.099 10.987 29.473 1.00 78.67  ? 360 TYR A CZ  1 
ATOM   1440 O  OH  . TYR A 1 187 ? -24.551 12.146 29.978 1.00 78.79  ? 360 TYR A OH  1 
ATOM   1441 N  N   . GLU A 1 188 ? -29.035 6.459  29.826 1.00 80.02  ? 361 GLU A N   1 
ATOM   1442 C  CA  . GLU A 1 188 ? -29.636 6.504  31.158 1.00 79.77  ? 361 GLU A CA  1 
ATOM   1443 C  C   . GLU A 1 188 ? -28.677 7.124  32.172 1.00 79.43  ? 361 GLU A C   1 
ATOM   1444 O  O   . GLU A 1 188 ? -27.466 7.039  32.011 1.00 79.56  ? 361 GLU A O   1 
ATOM   1445 C  CB  . GLU A 1 188 ? -30.049 5.099  31.606 1.00 79.86  ? 361 GLU A CB  1 
ATOM   1446 C  CG  . GLU A 1 188 ? -31.094 5.077  32.728 1.00 80.37  ? 361 GLU A CG  1 
ATOM   1447 C  CD  . GLU A 1 188 ? -31.565 3.671  33.079 1.00 81.13  ? 361 GLU A CD  1 
ATOM   1448 O  OE1 . GLU A 1 188 ? -30.936 2.693  32.604 1.00 81.54  ? 361 GLU A OE1 1 
ATOM   1449 O  OE2 . GLU A 1 188 ? -32.562 3.547  33.830 1.00 80.73  ? 361 GLU A OE2 1 
ATOM   1450 N  N   . THR A 1 189 ? -29.215 7.766  33.205 1.00 79.08  ? 362 THR A N   1 
ATOM   1451 C  CA  . THR A 1 189 ? -28.395 8.214  34.327 1.00 78.87  ? 362 THR A CA  1 
ATOM   1452 C  C   . THR A 1 189 ? -29.180 8.173  35.624 1.00 78.91  ? 362 THR A C   1 
ATOM   1453 O  O   . THR A 1 189 ? -30.414 8.214  35.602 1.00 78.92  ? 362 THR A O   1 
ATOM   1454 C  CB  . THR A 1 189 ? -27.842 9.613  34.122 1.00 78.71  ? 362 THR A CB  1 
ATOM   1455 O  OG1 . THR A 1 189 ? -26.733 9.794  35.004 1.00 78.89  ? 362 THR A OG1 1 
ATOM   1456 C  CG2 . THR A 1 189 ? -28.900 10.657 34.421 1.00 78.60  ? 362 THR A CG2 1 
ATOM   1457 N  N   . SER A 1 190 ? -28.473 8.082  36.750 1.00 78.92  ? 363 SER A N   1 
ATOM   1458 C  CA  . SER A 1 190 ? -29.156 7.961  38.033 1.00 79.19  ? 363 SER A CA  1 
ATOM   1459 C  C   . SER A 1 190 ? -30.017 9.185  38.280 1.00 79.38  ? 363 SER A C   1 
ATOM   1460 O  O   . SER A 1 190 ? -29.534 10.318 38.259 1.00 79.47  ? 363 SER A O   1 
ATOM   1461 C  CB  . SER A 1 190 ? -28.185 7.746  39.191 1.00 79.29  ? 363 SER A CB  1 
ATOM   1462 O  OG  . SER A 1 190 ? -28.887 7.406  40.382 1.00 79.21  ? 363 SER A OG  1 
ATOM   1463 N  N   . THR A 1 191 ? -31.302 8.940  38.502 1.00 79.52  ? 364 THR A N   1 
ATOM   1464 C  CA  . THR A 1 191 ? -32.275 9.998  38.646 1.00 79.66  ? 364 THR A CA  1 
ATOM   1465 C  C   . THR A 1 191 ? -33.350 9.534  39.606 1.00 79.90  ? 364 THR A C   1 
ATOM   1466 O  O   . THR A 1 191 ? -33.921 8.470  39.399 1.00 79.77  ? 364 THR A O   1 
ATOM   1467 C  CB  . THR A 1 191 ? -32.908 10.298 37.303 1.00 79.58  ? 364 THR A CB  1 
ATOM   1468 O  OG1 . THR A 1 191 ? -31.910 10.828 36.422 1.00 79.59  ? 364 THR A OG1 1 
ATOM   1469 C  CG2 . THR A 1 191 ? -34.023 11.296 37.458 1.00 79.85  ? 364 THR A CG2 1 
ATOM   1470 N  N   . PRO A 1 192 ? -33.624 10.324 40.666 1.00 80.34  ? 365 PRO A N   1 
ATOM   1471 C  CA  . PRO A 1 192 ? -34.647 9.928  41.637 1.00 80.64  ? 365 PRO A CA  1 
ATOM   1472 C  C   . PRO A 1 192 ? -35.958 9.730  40.913 1.00 81.00  ? 365 PRO A C   1 
ATOM   1473 O  O   . PRO A 1 192 ? -36.123 10.242 39.811 1.00 81.16  ? 365 PRO A O   1 
ATOM   1474 C  CB  . PRO A 1 192 ? -34.737 11.129 42.587 1.00 80.50  ? 365 PRO A CB  1 
ATOM   1475 C  CG  . PRO A 1 192 ? -34.033 12.246 41.898 1.00 80.35  ? 365 PRO A CG  1 
ATOM   1476 C  CD  . PRO A 1 192 ? -33.029 11.635 40.988 1.00 80.39  ? 365 PRO A CD  1 
ATOM   1477 N  N   . SER A 1 193 ? -36.878 8.985  41.506 1.00 81.46  ? 366 SER A N   1 
ATOM   1478 C  CA  . SER A 1 193 ? -38.135 8.698  40.829 1.00 81.99  ? 366 SER A CA  1 
ATOM   1479 C  C   . SER A 1 193 ? -39.293 9.539  41.373 1.00 82.28  ? 366 SER A C   1 
ATOM   1480 O  O   . SER A 1 193 ? -40.414 9.458  40.877 1.00 82.51  ? 366 SER A O   1 
ATOM   1481 C  CB  . SER A 1 193 ? -38.455 7.212  40.934 1.00 81.98  ? 366 SER A CB  1 
ATOM   1482 O  OG  . SER A 1 193 ? -38.652 6.849  42.289 1.00 82.47  ? 366 SER A OG  1 
ATOM   1483 N  N   . LEU A 1 194 ? -39.016 10.340 42.395 1.00 82.59  ? 367 LEU A N   1 
ATOM   1484 C  CA  . LEU A 1 194 ? -40.017 11.223 42.982 1.00 82.88  ? 367 LEU A CA  1 
ATOM   1485 C  C   . LEU A 1 194 ? -40.308 12.398 42.065 1.00 83.24  ? 367 LEU A C   1 
ATOM   1486 O  O   . LEU A 1 194 ? -39.479 12.751 41.235 1.00 83.12  ? 367 LEU A O   1 
ATOM   1487 C  CB  . LEU A 1 194 ? -39.519 11.764 44.320 1.00 82.83  ? 367 LEU A CB  1 
ATOM   1488 C  CG  . LEU A 1 194 ? -39.895 11.077 45.630 1.00 82.37  ? 367 LEU A CG  1 
ATOM   1489 C  CD1 . LEU A 1 194 ? -39.772 9.554  45.557 1.00 81.93  ? 367 LEU A CD1 1 
ATOM   1490 C  CD2 . LEU A 1 194 ? -39.003 11.651 46.718 1.00 81.93  ? 367 LEU A CD2 1 
ATOM   1491 N  N   . SER A 1 195 ? -41.486 13.001 42.234 1.00 83.80  ? 368 SER A N   1 
ATOM   1492 C  CA  . SER A 1 195 ? -41.871 14.220 41.516 1.00 84.24  ? 368 SER A CA  1 
ATOM   1493 C  C   . SER A 1 195 ? -41.023 15.415 41.950 1.00 84.63  ? 368 SER A C   1 
ATOM   1494 O  O   . SER A 1 195 ? -40.419 15.397 43.025 1.00 84.57  ? 368 SER A O   1 
ATOM   1495 C  CB  . SER A 1 195 ? -43.346 14.532 41.768 1.00 84.21  ? 368 SER A CB  1 
ATOM   1496 O  OG  . SER A 1 195 ? -43.561 14.962 43.103 1.00 83.77  ? 368 SER A OG  1 
ATOM   1497 N  N   . ALA A 1 196 ? -40.988 16.455 41.123 1.00 85.09  ? 369 ALA A N   1 
ATOM   1498 C  CA  . ALA A 1 196 ? -40.273 17.673 41.490 1.00 85.71  ? 369 ALA A CA  1 
ATOM   1499 C  C   . ALA A 1 196 ? -40.790 18.217 42.810 1.00 86.23  ? 369 ALA A C   1 
ATOM   1500 O  O   . ALA A 1 196 ? -40.006 18.671 43.637 1.00 86.43  ? 369 ALA A O   1 
ATOM   1501 C  CB  . ALA A 1 196 ? -40.395 18.714 40.413 1.00 85.64  ? 369 ALA A CB  1 
ATOM   1502 N  N   . LYS A 1 197 ? -42.108 18.161 43.000 1.00 86.93  ? 370 LYS A N   1 
ATOM   1503 C  CA  . LYS A 1 197 ? -42.752 18.597 44.245 1.00 87.60  ? 370 LYS A CA  1 
ATOM   1504 C  C   . LYS A 1 197 ? -42.268 17.735 45.406 1.00 88.04  ? 370 LYS A C   1 
ATOM   1505 O  O   . LYS A 1 197 ? -41.865 18.249 46.457 1.00 87.97  ? 370 LYS A O   1 
ATOM   1506 C  CB  . LYS A 1 197 ? -44.280 18.531 44.096 1.00 87.57  ? 370 LYS A CB  1 
ATOM   1507 C  CG  . LYS A 1 197 ? -45.126 18.741 45.364 1.00 87.79  ? 370 LYS A CG  1 
ATOM   1508 C  CD  . LYS A 1 197 ? -46.608 18.419 45.043 1.00 88.31  ? 370 LYS A CD  1 
ATOM   1509 C  CE  . LYS A 1 197 ? -47.428 17.939 46.238 1.00 87.51  ? 370 LYS A CE  1 
ATOM   1510 N  NZ  . LYS A 1 197 ? -47.717 19.054 47.178 1.00 87.69  ? 370 LYS A NZ  1 
ATOM   1511 N  N   . GLU A 1 198 ? -42.284 16.422 45.190 1.00 88.68  ? 371 GLU A N   1 
ATOM   1512 C  CA  . GLU A 1 198 ? -41.901 15.468 46.224 1.00 89.40  ? 371 GLU A CA  1 
ATOM   1513 C  C   . GLU A 1 198 ? -40.453 15.657 46.671 1.00 89.57  ? 371 GLU A C   1 
ATOM   1514 O  O   . GLU A 1 198 ? -40.152 15.519 47.861 1.00 89.73  ? 371 GLU A O   1 
ATOM   1515 C  CB  . GLU A 1 198 ? -42.144 14.027 45.759 1.00 89.49  ? 371 GLU A CB  1 
ATOM   1516 C  CG  . GLU A 1 198 ? -43.583 13.535 45.945 1.00 90.30  ? 371 GLU A CG  1 
ATOM   1517 C  CD  . GLU A 1 198 ? -43.814 12.144 45.356 1.00 91.43  ? 371 GLU A CD  1 
ATOM   1518 O  OE1 . GLU A 1 198 ? -43.552 11.951 44.148 1.00 91.52  ? 371 GLU A OE1 1 
ATOM   1519 O  OE2 . GLU A 1 198 ? -44.266 11.245 46.101 1.00 91.88  ? 371 GLU A OE2 1 
ATOM   1520 N  N   . LEU A 1 199 ? -39.576 15.984 45.720 1.00 89.74  ? 372 LEU A N   1 
ATOM   1521 C  CA  . LEU A 1 199 ? -38.147 16.197 45.995 1.00 89.73  ? 372 LEU A CA  1 
ATOM   1522 C  C   . LEU A 1 199 ? -37.924 17.457 46.805 1.00 89.97  ? 372 LEU A C   1 
ATOM   1523 O  O   . LEU A 1 199 ? -37.033 17.509 47.656 1.00 89.76  ? 372 LEU A O   1 
ATOM   1524 C  CB  . LEU A 1 199 ? -37.345 16.293 44.696 1.00 89.48  ? 372 LEU A CB  1 
ATOM   1525 C  CG  . LEU A 1 199 ? -37.257 15.050 43.819 1.00 88.78  ? 372 LEU A CG  1 
ATOM   1526 C  CD1 . LEU A 1 199 ? -36.496 15.383 42.573 1.00 87.88  ? 372 LEU A CD1 1 
ATOM   1527 C  CD2 . LEU A 1 199 ? -36.575 13.929 44.565 1.00 89.13  ? 372 LEU A CD2 1 
ATOM   1528 N  N   . ALA A 1 200 ? -38.747 18.464 46.525 1.00 90.44  ? 373 ALA A N   1 
ATOM   1529 C  CA  . ALA A 1 200 ? -38.664 19.757 47.180 1.00 91.10  ? 373 ALA A CA  1 
ATOM   1530 C  C   . ALA A 1 200 ? -39.065 19.643 48.641 1.00 91.51  ? 373 ALA A C   1 
ATOM   1531 O  O   . ALA A 1 200 ? -38.352 20.124 49.527 1.00 91.55  ? 373 ALA A O   1 
ATOM   1532 C  CB  . ALA A 1 200 ? -39.544 20.769 46.460 1.00 91.23  ? 373 ALA A CB  1 
ATOM   1533 N  N   . GLU A 1 201 ? -40.209 19.004 48.880 1.00 92.02  ? 374 GLU A N   1 
ATOM   1534 C  CA  . GLU A 1 201 ? -40.689 18.734 50.238 1.00 92.68  ? 374 GLU A CA  1 
ATOM   1535 C  C   . GLU A 1 201 ? -39.655 17.973 51.078 1.00 92.78  ? 374 GLU A C   1 
ATOM   1536 O  O   . GLU A 1 201 ? -39.244 18.448 52.150 1.00 92.72  ? 374 GLU A O   1 
ATOM   1537 C  CB  . GLU A 1 201 ? -42.021 17.977 50.189 1.00 92.82  ? 374 GLU A CB  1 
ATOM   1538 C  CG  . GLU A 1 201 ? -43.231 18.904 50.049 1.00 94.02  ? 374 GLU A CG  1 
ATOM   1539 C  CD  . GLU A 1 201 ? -44.396 18.288 49.271 1.00 95.27  ? 374 GLU A CD  1 
ATOM   1540 O  OE1 . GLU A 1 201 ? -44.442 17.046 49.107 1.00 95.05  ? 374 GLU A OE1 1 
ATOM   1541 O  OE2 . GLU A 1 201 ? -45.273 19.064 48.822 1.00 96.37  ? 374 GLU A OE2 1 
ATOM   1542 N  N   . LEU A 1 202 ? -39.241 16.807 50.572 1.00 92.87  ? 375 LEU A N   1 
ATOM   1543 C  CA  . LEU A 1 202 ? -38.191 16.002 51.185 1.00 92.87  ? 375 LEU A CA  1 
ATOM   1544 C  C   . LEU A 1 202 ? -36.949 16.845 51.426 1.00 93.37  ? 375 LEU A C   1 
ATOM   1545 O  O   . LEU A 1 202 ? -36.373 16.803 52.509 1.00 93.54  ? 375 LEU A O   1 
ATOM   1546 C  CB  . LEU A 1 202 ? -37.859 14.785 50.317 1.00 92.56  ? 375 LEU A CB  1 
ATOM   1547 C  CG  . LEU A 1 202 ? -37.024 13.643 50.910 1.00 91.75  ? 375 LEU A CG  1 
ATOM   1548 C  CD1 . LEU A 1 202 ? -37.654 13.092 52.180 1.00 91.42  ? 375 LEU A CD1 1 
ATOM   1549 C  CD2 . LEU A 1 202 ? -36.833 12.522 49.895 1.00 90.59  ? 375 LEU A CD2 1 
ATOM   1550 N  N   . ALA A 1 203 ? -36.554 17.633 50.431 1.00 93.99  ? 376 ALA A N   1 
ATOM   1551 C  CA  . ALA A 1 203 ? -35.391 18.501 50.578 1.00 94.82  ? 376 ALA A CA  1 
ATOM   1552 C  C   . ALA A 1 203 ? -35.531 19.511 51.716 1.00 95.52  ? 376 ALA A C   1 
ATOM   1553 O  O   . ALA A 1 203 ? -34.528 19.961 52.258 1.00 95.45  ? 376 ALA A O   1 
ATOM   1554 C  CB  . ALA A 1 203 ? -35.085 19.218 49.274 1.00 94.77  ? 376 ALA A CB  1 
ATOM   1555 N  N   . ASN A 1 204 ? -36.765 19.856 52.086 1.00 96.65  ? 377 ASN A N   1 
ATOM   1556 C  CA  . ASN A 1 204 ? -36.998 20.958 53.037 1.00 97.65  ? 377 ASN A CA  1 
ATOM   1557 C  C   . ASN A 1 204 ? -37.325 20.580 54.466 1.00 98.18  ? 377 ASN A C   1 
ATOM   1558 O  O   . ASN A 1 204 ? -38.358 20.987 55.011 1.00 98.25  ? 377 ASN A O   1 
ATOM   1559 C  CB  . ASN A 1 204 ? -38.015 21.958 52.493 1.00 97.63  ? 377 ASN A CB  1 
ATOM   1560 C  CG  . ASN A 1 204 ? -37.394 22.898 51.494 1.00 98.28  ? 377 ASN A CG  1 
ATOM   1561 O  OD1 . ASN A 1 204 ? -36.347 23.506 51.757 1.00 98.56  ? 377 ASN A OD1 1 
ATOM   1562 N  ND2 . ASN A 1 204 ? -38.013 23.005 50.325 1.00 98.95  ? 377 ASN A ND2 1 
ATOM   1563 N  N   . ARG A 1 205 ? -36.418 19.792 55.045 1.00 98.93  ? 378 ARG A N   1 
ATOM   1564 C  CA  . ARG A 1 205 ? -36.427 19.384 56.459 1.00 99.48  ? 378 ARG A CA  1 
ATOM   1565 C  C   . ARG A 1 205 ? -35.149 18.581 56.780 1.00 99.54  ? 378 ARG A C   1 
ATOM   1566 O  O   . ARG A 1 205 ? -34.063 18.887 56.269 1.00 99.50  ? 378 ARG A O   1 
ATOM   1567 C  CB  . ARG A 1 205 ? -37.709 18.606 56.836 1.00 99.58  ? 378 ARG A CB  1 
ATOM   1568 C  CG  . ARG A 1 205 ? -38.284 17.700 55.743 1.00 99.88  ? 378 ARG A CG  1 
ATOM   1569 C  CD  . ARG A 1 205 ? -39.728 17.313 56.062 1.00 101.05 ? 378 ARG A CD  1 
ATOM   1570 N  NE  . ARG A 1 205 ? -40.367 16.558 54.981 1.00 102.22 ? 378 ARG A NE  1 
ATOM   1571 C  CZ  . ARG A 1 205 ? -40.125 15.273 54.704 1.00 102.79 ? 378 ARG A CZ  1 
ATOM   1572 N  NH1 . ARG A 1 205 ? -39.239 14.580 55.418 1.00 102.90 ? 378 ARG A NH1 1 
ATOM   1573 N  NH2 . ARG A 1 205 ? -40.760 14.679 53.697 1.00 102.64 ? 378 ARG A NH2 1 
HETATM 1574 BA BA  . BA  B 2 .   ? -40.846 40.846 13.180 0.25 124.64 ? 1   BA  A BA  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   49  ?   ?   ?   A . n 
A 1 2   SER 2   50  ?   ?   ?   A . n 
A 1 3   HIS 3   51  ?   ?   ?   A . n 
A 1 4   MET 4   52  ?   ?   ?   A . n 
A 1 5   ARG 5   53  ?   ?   ?   A . n 
A 1 6   LYS 6   54  ?   ?   ?   A . n 
A 1 7   ILE 7   55  55  ILE ILE A . n 
A 1 8   GLN 8   56  56  GLN GLN A . n 
A 1 9   ARG 9   57  57  ARG ARG A . n 
A 1 10  TYR 10  58  58  TYR TYR A . n 
A 1 11  VAL 11  59  59  VAL VAL A . n 
A 1 12  ARG 12  60  60  ARG ARG A . n 
A 1 13  LYS 13  61  61  LYS LYS A . n 
A 1 14  ASP 14  62  62  ASP ASP A . n 
A 1 15  GLY 15  63  63  GLY GLY A . n 
A 1 16  LYS 16  64  64  LYS LYS A . n 
A 1 17  CYS 17  65  65  CYS CYS A . n 
A 1 18  ASN 18  66  66  ASN ASN A . n 
A 1 19  VAL 19  67  67  VAL VAL A . n 
A 1 20  HIS 20  68  68  HIS HIS A . n 
A 1 21  HIS 21  69  69  HIS HIS A . n 
A 1 22  GLY 22  70  70  GLY GLY A . n 
A 1 23  ASN 23  71  71  ASN ASN A . n 
A 1 24  VAL 24  72  72  VAL VAL A . n 
A 1 25  ARG 25  73  73  ARG ARG A . n 
A 1 26  GLU 26  74  ?   ?   ?   A . n 
A 1 27  LYS 27  200 ?   ?   ?   A . n 
A 1 28  ARG 28  201 ?   ?   ?   A . n 
A 1 29  ALA 29  202 202 ALA ALA A . n 
A 1 30  GLU 30  203 203 GLU GLU A . n 
A 1 31  THR 31  204 204 THR THR A . n 
A 1 32  LEU 32  205 205 LEU LEU A . n 
A 1 33  VAL 33  206 206 VAL VAL A . n 
A 1 34  PHE 34  207 207 PHE PHE A . n 
A 1 35  SER 35  208 208 SER SER A . n 
A 1 36  THR 36  209 209 THR THR A . n 
A 1 37  HIS 37  210 210 HIS HIS A . n 
A 1 38  ALA 38  211 211 ALA ALA A . n 
A 1 39  VAL 39  212 212 VAL VAL A . n 
A 1 40  ILE 40  213 213 ILE ILE A . n 
A 1 41  SER 41  214 214 SER SER A . n 
A 1 42  MET 42  215 215 MET MET A . n 
A 1 43  ARG 43  216 216 ARG ARG A . n 
A 1 44  ASP 44  217 217 ASP ASP A . n 
A 1 45  GLY 45  218 218 GLY GLY A . n 
A 1 46  LYS 46  219 219 LYS LYS A . n 
A 1 47  LEU 47  220 220 LEU LEU A . n 
A 1 48  CYS 48  221 221 CYS CYS A . n 
A 1 49  LEU 49  222 222 LEU LEU A . n 
A 1 50  MET 50  223 223 MET MET A . n 
A 1 51  PHE 51  224 224 PHE PHE A . n 
A 1 52  ARG 52  225 225 ARG ARG A . n 
A 1 53  VAL 53  226 226 VAL VAL A . n 
A 1 54  GLY 54  227 227 GLY GLY A . n 
A 1 55  ASP 55  228 228 ASP ASP A . n 
A 1 56  LEU 56  229 229 LEU LEU A . n 
A 1 57  ARG 57  230 230 ARG ARG A . n 
A 1 58  ASN 58  231 231 ASN ASN A . n 
A 1 59  SER 59  232 232 SER SER A . n 
A 1 60  HIS 60  233 233 HIS HIS A . n 
A 1 61  ILE 61  234 234 ILE ILE A . n 
A 1 62  VAL 62  235 235 VAL VAL A . n 
A 1 63  GLU 63  236 236 GLU GLU A . n 
A 1 64  ALA 64  237 237 ALA ALA A . n 
A 1 65  SER 65  238 238 SER SER A . n 
A 1 66  ILE 66  239 239 ILE ILE A . n 
A 1 67  ARG 67  240 240 ARG ARG A . n 
A 1 68  ALA 68  241 241 ALA ALA A . n 
A 1 69  LYS 69  242 242 LYS LYS A . n 
A 1 70  LEU 70  243 243 LEU LEU A . n 
A 1 71  ILE 71  244 244 ILE ILE A . n 
A 1 72  LYS 72  245 245 LYS LYS A . n 
A 1 73  SER 73  246 246 SER SER A . n 
A 1 74  LYS 74  247 247 LYS LYS A . n 
A 1 75  GLN 75  248 248 GLN GLN A . n 
A 1 76  THR 76  249 249 THR THR A . n 
A 1 77  SER 77  250 250 SER SER A . n 
A 1 78  GLU 78  251 251 GLU GLU A . n 
A 1 79  GLY 79  252 252 GLY GLY A . n 
A 1 80  GLU 80  253 253 GLU GLU A . n 
A 1 81  PHE 81  254 254 PHE PHE A . n 
A 1 82  ILE 82  255 255 ILE ILE A . n 
A 1 83  PRO 83  256 256 PRO PRO A . n 
A 1 84  LEU 84  257 257 LEU LEU A . n 
A 1 85  ASN 85  258 258 ASN ASN A . n 
A 1 86  GLN 86  259 259 GLN GLN A . n 
A 1 87  THR 87  260 260 THR THR A . n 
A 1 88  ASP 88  261 261 ASP ASP A . n 
A 1 89  ILE 89  262 262 ILE ILE A . n 
A 1 90  ASN 90  263 263 ASN ASN A . n 
A 1 91  VAL 91  264 264 VAL VAL A . n 
A 1 92  GLY 92  265 265 GLY GLY A . n 
A 1 93  TYR 93  266 266 TYR TYR A . n 
A 1 94  TYR 94  267 267 TYR TYR A . n 
A 1 95  THR 95  268 268 THR THR A . n 
A 1 96  GLY 96  269 269 GLY GLY A . n 
A 1 97  ASP 97  270 270 ASP ASP A . n 
A 1 98  ASP 98  271 271 ASP ASP A . n 
A 1 99  ARG 99  272 272 ARG ARG A . n 
A 1 100 LEU 100 273 273 LEU LEU A . n 
A 1 101 PHE 101 274 274 PHE PHE A . n 
A 1 102 LEU 102 275 275 LEU LEU A . n 
A 1 103 VAL 103 276 276 VAL VAL A . n 
A 1 104 SER 104 277 277 SER SER A . n 
A 1 105 PRO 105 278 278 PRO PRO A . n 
A 1 106 LEU 106 279 279 LEU LEU A . n 
A 1 107 ILE 107 280 280 ILE ILE A . n 
A 1 108 ILE 108 281 281 ILE ILE A . n 
A 1 109 SER 109 282 282 SER SER A . n 
A 1 110 HIS 110 283 283 HIS HIS A . n 
A 1 111 GLU 111 284 284 GLU GLU A . n 
A 1 112 ILE 112 285 285 ILE ILE A . n 
A 1 113 ASN 113 286 286 ASN ASN A . n 
A 1 114 GLN 114 287 287 GLN GLN A . n 
A 1 115 GLN 115 288 288 GLN GLN A . n 
A 1 116 SER 116 289 289 SER SER A . n 
A 1 117 PRO 117 290 290 PRO PRO A . n 
A 1 118 PHE 118 291 291 PHE PHE A . n 
A 1 119 TRP 119 292 292 TRP TRP A . n 
A 1 120 GLU 120 293 293 GLU GLU A . n 
A 1 121 ILE 121 294 294 ILE ILE A . n 
A 1 122 SER 122 295 295 SER SER A . n 
A 1 123 LYS 123 296 296 LYS LYS A . n 
A 1 124 ALA 124 297 297 ALA ALA A . n 
A 1 125 GLN 125 298 298 GLN GLN A . n 
A 1 126 LEU 126 299 299 LEU LEU A . n 
A 1 127 PRO 127 300 300 PRO PRO A . n 
A 1 128 LYS 128 301 301 LYS LYS A . n 
A 1 129 GLU 129 302 302 GLU GLU A . n 
A 1 130 GLU 130 303 303 GLU GLU A . n 
A 1 131 LEU 131 304 304 LEU LEU A . n 
A 1 132 GLU 132 305 305 GLU GLU A . n 
A 1 133 ILE 133 306 306 ILE ILE A . n 
A 1 134 VAL 134 307 307 VAL VAL A . n 
A 1 135 VAL 135 308 308 VAL VAL A . n 
A 1 136 ILE 136 309 309 ILE ILE A . n 
A 1 137 LEU 137 310 310 LEU LEU A . n 
A 1 138 GLU 138 311 311 GLU GLU A . n 
A 1 139 GLY 139 312 312 GLY GLY A . n 
A 1 140 MET 140 313 313 MET MET A . n 
A 1 141 VAL 141 314 314 VAL VAL A . n 
A 1 142 GLU 142 315 315 GLU GLU A . n 
A 1 143 ALA 143 316 316 ALA ALA A . n 
A 1 144 THR 144 317 317 THR THR A . n 
A 1 145 GLY 145 318 318 GLY GLY A . n 
A 1 146 MET 146 319 319 MET MET A . n 
A 1 147 THR 147 320 320 THR THR A . n 
A 1 148 CYS 148 321 321 CYS CYS A . n 
A 1 149 GLN 149 322 322 GLN GLN A . n 
A 1 150 ALA 150 323 323 ALA ALA A . n 
A 1 151 ARG 151 324 324 ARG ARG A . n 
A 1 152 SER 152 325 325 SER SER A . n 
A 1 153 SER 153 326 326 SER SER A . n 
A 1 154 TYR 154 327 327 TYR TYR A . n 
A 1 155 ILE 155 328 328 ILE ILE A . n 
A 1 156 THR 156 329 329 THR THR A . n 
A 1 157 SER 157 330 330 SER SER A . n 
A 1 158 GLU 158 331 331 GLU GLU A . n 
A 1 159 ILE 159 332 332 ILE ILE A . n 
A 1 160 LEU 160 333 333 LEU LEU A . n 
A 1 161 TRP 161 334 334 TRP TRP A . n 
A 1 162 GLY 162 335 335 GLY GLY A . n 
A 1 163 TYR 163 336 336 TYR TYR A . n 
A 1 164 ARG 164 337 337 ARG ARG A . n 
A 1 165 PHE 165 338 338 PHE PHE A . n 
A 1 166 THR 166 339 339 THR THR A . n 
A 1 167 PRO 167 340 340 PRO PRO A . n 
A 1 168 VAL 168 341 341 VAL VAL A . n 
A 1 169 LEU 169 342 342 LEU LEU A . n 
A 1 170 THR 170 343 343 THR THR A . n 
A 1 171 LEU 171 344 344 LEU LEU A . n 
A 1 172 GLU 172 345 345 GLU GLU A . n 
A 1 173 ASP 173 346 346 ASP ASP A . n 
A 1 174 GLY 174 347 347 GLY GLY A . n 
A 1 175 PHE 175 348 348 PHE PHE A . n 
A 1 176 TYR 176 349 349 TYR TYR A . n 
A 1 177 GLU 177 350 350 GLU GLU A . n 
A 1 178 VAL 178 351 351 VAL VAL A . n 
A 1 179 ASP 179 352 352 ASP ASP A . n 
A 1 180 TYR 180 353 353 TYR TYR A . n 
A 1 181 ASN 181 354 354 ASN ASN A . n 
A 1 182 SER 182 355 355 SER SER A . n 
A 1 183 PHE 183 356 356 PHE PHE A . n 
A 1 184 HIS 184 357 357 HIS HIS A . n 
A 1 185 GLU 185 358 358 GLU GLU A . n 
A 1 186 THR 186 359 359 THR THR A . n 
A 1 187 TYR 187 360 360 TYR TYR A . n 
A 1 188 GLU 188 361 361 GLU GLU A . n 
A 1 189 THR 189 362 362 THR THR A . n 
A 1 190 SER 190 363 363 SER SER A . n 
A 1 191 THR 191 364 364 THR THR A . n 
A 1 192 PRO 192 365 365 PRO PRO A . n 
A 1 193 SER 193 366 366 SER SER A . n 
A 1 194 LEU 194 367 367 LEU LEU A . n 
A 1 195 SER 195 368 368 SER SER A . n 
A 1 196 ALA 196 369 369 ALA ALA A . n 
A 1 197 LYS 197 370 370 LYS LYS A . n 
A 1 198 GLU 198 371 371 GLU GLU A . n 
A 1 199 LEU 199 372 372 LEU LEU A . n 
A 1 200 ALA 200 373 373 ALA ALA A . n 
A 1 201 GLU 201 374 374 GLU GLU A . n 
A 1 202 LEU 202 375 375 LEU LEU A . n 
A 1 203 ALA 203 376 376 ALA ALA A . n 
A 1 204 ASN 204 377 377 ASN ASN A . n 
A 1 205 ARG 205 378 378 ARG ARG A . n 
A 1 206 ALA 206 379 ?   ?   ?   A . n 
A 1 207 GLU 207 380 ?   ?   ?   A . n 
A 1 208 LEU 208 381 ?   ?   ?   A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          BA 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     1 
_pdbx_nonpoly_scheme.auth_seq_num    1 
_pdbx_nonpoly_scheme.pdb_mon_id      BA 
_pdbx_nonpoly_scheme.auth_mon_id     BA 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12080 ? 
1 MORE         -14   ? 
1 'SSA (A^2)'  34390 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_465 -x-1,-y+1,z -1.0000000000 0.0000000000  0.0000000000 -81.6910000000 0.0000000000  
-1.0000000000 0.0000000000 81.6910000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_565 -y,x+1,z    0.0000000000  -1.0000000000 0.0000000000 0.0000000000   1.0000000000  
0.0000000000  0.0000000000 81.6910000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_455 y-1,-x,z    0.0000000000  1.0000000000  0.0000000000 -81.6910000000 -1.0000000000 
0.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    BA 
_pdbx_struct_special_symmetry.auth_seq_id     1 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   B 
_pdbx_struct_special_symmetry.label_comp_id   BA 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-10-19 
2 'Structure model' 1 1 2013-06-05 
3 'Structure model' 1 2 2017-08-16 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
3 3 'Structure model' 'Source and taxonomy'    
4 4 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen 
2 3 'Structure model' software       
3 4 'Structure model' software       
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .        ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 REFMAC      5.5.0109 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
3 PDB_EXTRACT 3.10     'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
4 DENZO       .        ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 57  ? ? -39.45  143.20 
2 1 ASN A 66  ? ? -103.99 51.77  
3 1 HIS A 69  ? ? -37.74  120.38 
4 1 SER A 250 ? ? -57.31  -7.47  
5 1 ASN A 377 ? ? -102.17 55.77  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 49  ? A GLY 1   
2  1 Y 1 A SER 50  ? A SER 2   
3  1 Y 1 A HIS 51  ? A HIS 3   
4  1 Y 1 A MET 52  ? A MET 4   
5  1 Y 1 A ARG 53  ? A ARG 5   
6  1 Y 1 A LYS 54  ? A LYS 6   
7  1 Y 1 A GLU 74  ? A GLU 26  
8  1 Y 1 A LYS 200 ? A LYS 27  
9  1 Y 1 A ARG 201 ? A ARG 28  
10 1 Y 1 A ALA 379 ? A ALA 206 
11 1 Y 1 A GLU 380 ? A GLU 207 
12 1 Y 1 A LEU 381 ? A LEU 208 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'BARIUM ION' 
_pdbx_entity_nonpoly.comp_id     BA 
#