data_3ATB
# 
_entry.id   3ATB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ATB         
RCSB  RCSB029669   
WWPDB D_1000029669 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3agw . unspecified 
PDB 2e4f . unspecified 
PDB 3AT8 . unspecified 
PDB 3AT9 . unspecified 
PDB 3ATA . unspecified 
PDB 3ATD . unspecified 
PDB 3ATE . unspecified 
PDB 3ATF . unspecified 
# 
_pdbx_database_status.entry_id                        3ATB 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-28 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Inanobe, A.' 1 
'Kurachi, Y.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                41801 
_citation.page_last                 41811 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21982822 
_citation.pdbx_database_id_DOI      10.1074/jbc.M111.278531 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Inanobe, A.'  1 
primary 'Nakagawa, A.' 2 
primary 'Kurachi, Y.'  3 
# 
_cell.length_a           82.373 
_cell.length_b           82.373 
_cell.length_c           172.810 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3ATB 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.entry_id                         3ATB 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                97 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Potassium inwardly-rectifying channel, subfamily J, member 6' 23748.988 1 ? ? 'RESIDUES 53-74, 200-381' 
;CYTOPLASMIC N- AND C-TERMINI (RESIDUES 53-74 AND 200-381, RESPECTIVELY) OF G-PROTEIN-GATED INWARD RECTIFIER POTASSIUM CHANNEL KIR3.2 ARE CONCATENATED DIRECTLY.
;
2 non-polymer syn 'GADOLINIUM ATOM'                                              157.250   2 ? ? ?                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'G protein-activated inward rectifier potassium channel 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ARG n 
1 6   LYS n 
1 7   ILE n 
1 8   GLN n 
1 9   ARG n 
1 10  TYR n 
1 11  VAL n 
1 12  ARG n 
1 13  LYS n 
1 14  ASP n 
1 15  GLY n 
1 16  LYS n 
1 17  CYS n 
1 18  ASN n 
1 19  VAL n 
1 20  HIS n 
1 21  HIS n 
1 22  GLY n 
1 23  ASN n 
1 24  VAL n 
1 25  ARG n 
1 26  GLU n 
1 27  LYS n 
1 28  ARG n 
1 29  ALA n 
1 30  GLU n 
1 31  THR n 
1 32  LEU n 
1 33  VAL n 
1 34  PHE n 
1 35  SER n 
1 36  THR n 
1 37  HIS n 
1 38  ALA n 
1 39  VAL n 
1 40  ILE n 
1 41  SER n 
1 42  MET n 
1 43  ARG n 
1 44  ASP n 
1 45  GLY n 
1 46  LYS n 
1 47  LEU n 
1 48  CYS n 
1 49  LEU n 
1 50  MET n 
1 51  PHE n 
1 52  ARG n 
1 53  VAL n 
1 54  GLY n 
1 55  ASP n 
1 56  LEU n 
1 57  ARG n 
1 58  ASN n 
1 59  SER n 
1 60  HIS n 
1 61  ILE n 
1 62  VAL n 
1 63  GLU n 
1 64  ALA n 
1 65  SER n 
1 66  ILE n 
1 67  ARG n 
1 68  ALA n 
1 69  LYS n 
1 70  LEU n 
1 71  ILE n 
1 72  LYS n 
1 73  SER n 
1 74  LYS n 
1 75  GLN n 
1 76  THR n 
1 77  SER n 
1 78  GLU n 
1 79  GLY n 
1 80  GLU n 
1 81  PHE n 
1 82  ILE n 
1 83  PRO n 
1 84  LEU n 
1 85  ASN n 
1 86  GLN n 
1 87  THR n 
1 88  ASP n 
1 89  ILE n 
1 90  ASN n 
1 91  VAL n 
1 92  GLY n 
1 93  TYR n 
1 94  TYR n 
1 95  THR n 
1 96  GLY n 
1 97  ASP n 
1 98  ASP n 
1 99  ARG n 
1 100 LEU n 
1 101 PHE n 
1 102 LEU n 
1 103 VAL n 
1 104 SER n 
1 105 PRO n 
1 106 LEU n 
1 107 ILE n 
1 108 ILE n 
1 109 SER n 
1 110 HIS n 
1 111 GLU n 
1 112 ILE n 
1 113 ASN n 
1 114 GLN n 
1 115 GLN n 
1 116 SER n 
1 117 PRO n 
1 118 PHE n 
1 119 TRP n 
1 120 GLU n 
1 121 ILE n 
1 122 SER n 
1 123 LYS n 
1 124 ALA n 
1 125 GLN n 
1 126 LEU n 
1 127 PRO n 
1 128 LYS n 
1 129 GLU n 
1 130 GLU n 
1 131 LEU n 
1 132 GLU n 
1 133 ILE n 
1 134 VAL n 
1 135 VAL n 
1 136 ILE n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 MET n 
1 141 VAL n 
1 142 GLU n 
1 143 ALA n 
1 144 THR n 
1 145 GLY n 
1 146 MET n 
1 147 THR n 
1 148 CYS n 
1 149 GLN n 
1 150 ALA n 
1 151 ARG n 
1 152 SER n 
1 153 SER n 
1 154 TYR n 
1 155 ILE n 
1 156 THR n 
1 157 SER n 
1 158 GLU n 
1 159 ILE n 
1 160 LEU n 
1 161 TRP n 
1 162 GLY n 
1 163 TYR n 
1 164 ARG n 
1 165 PHE n 
1 166 THR n 
1 167 PRO n 
1 168 VAL n 
1 169 LEU n 
1 170 THR n 
1 171 LEU n 
1 172 GLU n 
1 173 ASP n 
1 174 GLY n 
1 175 PHE n 
1 176 TYR n 
1 177 GLU n 
1 178 VAL n 
1 179 ASP n 
1 180 TYR n 
1 181 ASN n 
1 182 SER n 
1 183 PHE n 
1 184 HIS n 
1 185 GLU n 
1 186 THR n 
1 187 TYR n 
1 188 GLU n 
1 189 THR n 
1 190 SER n 
1 191 THR n 
1 192 PRO n 
1 193 SER n 
1 194 LEU n 
1 195 SER n 
1 196 ALA n 
1 197 LYS n 
1 198 GLU n 
1 199 LEU n 
1 200 ALA n 
1 201 GLU n 
1 202 LEU n 
1 203 ALA n 
1 204 ASN n 
1 205 ARG n 
1 206 ALA n 
1 207 GLU n 
1 208 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 5  26  mouse ? ? ? Balb/c ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'ROSSETA2 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
1 2 sample ? 27 208 mouse ? ? ? Balb/c ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'ROSSETA2 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q0VB45_MOUSE 
_struct_ref.pdbx_db_accession          Q0VB45 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RKIQRYVRKDGKCNVHHGNVRE 
_struct_ref.pdbx_align_begin           53 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ATB A 5  ? 26  ? Q0VB45 53  ? 74  ? 53  74  
2 1 3ATB A 27 ? 208 ? Q0VB45 200 ? 381 ? 200 381 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ATB GLY A 1 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 49 1 
1 3ATB SER A 2 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 50 2 
1 3ATB HIS A 3 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 51 3 
1 3ATB MET A 4 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 52 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GD  non-polymer         . 'GADOLINIUM ATOM' ? Gd               157.250 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3ATB 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.09 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   60.14 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'hanging drop' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    'Ethanol, pH 8.0, hanging drop, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2010-06-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'double crystal' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.4600 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44XU' 
_diffrn_source.pdbx_wavelength_list        1.4600 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL44XU 
# 
_reflns.entry_id                     3ATB 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            3.50 
_reflns.d_resolution_low             50.00 
_reflns.number_all                   104372 
_reflns.number_obs                   104368 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.172 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              26.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  3.50 
_reflns_shell.d_res_low                   3.63 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.percent_possible_all        99.0 
_reflns_shell.Rmerge_I_obs                0.846 
_reflns_shell.meanI_over_sigI_obs         3.11 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_redundancy             16.2 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3ATB 
_refine.ls_d_res_high                            3.5100 
_refine.ls_d_res_low                             48.30 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.7500 
_refine.ls_number_reflns_obs                     4015 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.3120 
_refine.ls_R_factor_R_work                       0.3038 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.3461 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 19.3000 
_refine.ls_number_reflns_R_free                  774 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               43.4867 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.0000 
_refine.aniso_B[2][2]                            0.0000 
_refine.aniso_B[3][3]                            0.0000 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.8300 
_refine.correlation_coeff_Fo_to_Fc_free          0.7320 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  0.9090 
_refine.overall_SU_ML                            0.4620 
_refine.overall_SU_B                             29.9380 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                124.540 
_refine.B_iso_min                                29.860 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.250 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1568 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1570 
_refine_hist.d_res_high                       3.5100 
_refine_hist.d_res_low                        48.30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       1605 0.012  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    2172 1.223  1.956  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 196  5.854  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 76   34.170 23.947 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 287  18.595 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 11   20.656 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         246  0.079  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   1203 0.004  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            977  0.407  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1587 0.769  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            628  0.979  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           584  1.618  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       3.5050 
_refine_ls_shell.d_res_low                        3.5960 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.2700 
_refine_ls_shell.number_reflns_R_work             221 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.4090 
_refine_ls_shell.R_factor_R_free                  0.4550 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             63 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                284 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3ATB 
_struct.title                     
'Crystal Structure of the Kir3.2 Cytoplasmic Domain (Na+-free crystal soaked in 10 mM Gadolinium chloride)' 
_struct.pdbx_descriptor           'Potassium inwardly-rectifying channel, subfamily J, member 6' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ATB 
_struct_keywords.text            
'Cytoplasmic assembly, beta-barrel, ion transport, G protein beta-gamma subunits, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        195 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        204 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         368 
_struct_conf.end_auth_comp_id        ASN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         377 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A GLU 185 OE2 ? ? ? 1_555 C GD . GD ? ? A GLU 358 A GD 2 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc2 metalc ? ? A GLU 63  OE2 ? ? ? 1_555 B GD . GD ? ? A GLU 236 A GD 1 1_555 ? ? ? ? ? ? ? 3.190 ? 
metalc3 metalc ? ? A GLU 185 OE1 ? ? ? 1_555 C GD . GD ? ? A GLU 358 A GD 2 1_555 ? ? ? ? ? ? ? 3.462 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 106 ? GLU A 111 ? LEU A 279 GLU A 284 
A 2 LYS A 46  ? VAL A 53  ? LYS A 219 VAL A 226 
A 3 ALA A 38  ? ARG A 43  ? ALA A 211 ARG A 216 
A 4 ILE A 159 ? TRP A 161 ? ILE A 332 TRP A 334 
B 1 PHE A 81  ? ILE A 89  ? PHE A 254 ILE A 262 
B 2 ILE A 61  ? GLN A 75  ? ILE A 234 GLN A 248 
B 3 GLU A 132 ? VAL A 141 ? GLU A 305 VAL A 314 
B 4 THR A 147 ? ILE A 155 ? THR A 320 ILE A 328 
C 1 TYR A 163 ? PHE A 165 ? TYR A 336 PHE A 338 
C 2 THR A 186 ? GLU A 188 ? THR A 359 GLU A 361 
D 1 LEU A 169 ? GLU A 172 ? LEU A 342 GLU A 345 
D 2 PHE A 175 ? VAL A 178 ? PHE A 348 VAL A 351 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 108 ? O ILE A 281 N PHE A 51  ? N PHE A 224 
A 2 3 O MET A 50  ? O MET A 223 N VAL A 39  ? N VAL A 212 
A 3 4 N ALA A 38  ? N ALA A 211 O LEU A 160 ? O LEU A 333 
B 1 2 O ILE A 82  ? O ILE A 255 N LYS A 74  ? N LYS A 247 
B 2 3 N ILE A 71  ? N ILE A 244 O GLU A 132 ? O GLU A 305 
B 3 4 N ILE A 133 ? N ILE A 306 O TYR A 154 ? O TYR A 327 
C 1 2 N ARG A 164 ? N ARG A 337 O TYR A 187 ? O TYR A 360 
D 1 2 N THR A 170 ? N THR A 343 O GLU A 177 ? O GLU A 350 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GD A 1' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE GD A 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 GLU A 63  ? GLU A 236 . ? 4_565 ? 
2 AC1 4 GLU A 63  ? GLU A 236 . ? 1_555 ? 
3 AC1 4 GLU A 63  ? GLU A 236 . ? 3_655 ? 
4 AC1 4 GLU A 63  ? GLU A 236 . ? 2_665 ? 
5 AC2 2 SER A 182 ? SER A 355 . ? 1_555 ? 
6 AC2 2 GLU A 185 ? GLU A 358 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3ATB 
_atom_sites.fract_transf_matrix[1][1]   0.012140 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012140 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005787 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
GD 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 7   ? 28.323 7.014  23.136 1.00 42.63  ? 55  ILE A N   1 
ATOM   2    C  CA  . ILE A 1 7   ? 28.402 8.520  23.081 1.00 42.75  ? 55  ILE A CA  1 
ATOM   3    C  C   . ILE A 1 7   ? 28.603 9.051  21.640 1.00 42.66  ? 55  ILE A C   1 
ATOM   4    O  O   . ILE A 1 7   ? 29.637 8.782  20.996 1.00 42.75  ? 55  ILE A O   1 
ATOM   5    C  CB  . ILE A 1 7   ? 29.496 9.099  24.085 1.00 42.87  ? 55  ILE A CB  1 
ATOM   6    C  CG1 . ILE A 1 7   ? 29.714 10.619 23.877 1.00 42.11  ? 55  ILE A CG1 1 
ATOM   7    C  CG2 . ILE A 1 7   ? 30.827 8.283  24.004 1.00 42.81  ? 55  ILE A CG2 1 
ATOM   8    C  CD1 . ILE A 1 7   ? 30.626 11.278 24.910 1.00 40.39  ? 55  ILE A CD1 1 
ATOM   9    N  N   . GLN A 1 8   ? 27.615 9.797  21.137 1.00 42.15  ? 56  GLN A N   1 
ATOM   10   C  CA  . GLN A 1 8   ? 27.742 10.387 19.804 1.00 41.76  ? 56  GLN A CA  1 
ATOM   11   C  C   . GLN A 1 8   ? 28.462 11.768 19.804 1.00 40.91  ? 56  GLN A C   1 
ATOM   12   O  O   . GLN A 1 8   ? 27.950 12.754 20.365 1.00 40.74  ? 56  GLN A O   1 
ATOM   13   C  CB  . GLN A 1 8   ? 26.362 10.440 19.119 1.00 42.14  ? 56  GLN A CB  1 
ATOM   14   C  CG  . GLN A 1 8   ? 26.314 11.241 17.795 1.00 43.71  ? 56  GLN A CG  1 
ATOM   15   C  CD  . GLN A 1 8   ? 27.377 10.805 16.774 1.00 45.08  ? 56  GLN A CD  1 
ATOM   16   O  OE1 . GLN A 1 8   ? 28.003 11.650 16.097 1.00 45.46  ? 56  GLN A OE1 1 
ATOM   17   N  NE2 . GLN A 1 8   ? 27.588 9.477  16.668 1.00 45.64  ? 56  GLN A NE2 1 
ATOM   18   N  N   . ARG A 1 9   ? 29.638 11.832 19.173 1.00 40.07  ? 57  ARG A N   1 
ATOM   19   C  CA  . ARG A 1 9   ? 30.369 13.094 18.994 1.00 39.36  ? 57  ARG A CA  1 
ATOM   20   C  C   . ARG A 1 9   ? 29.544 14.315 18.500 1.00 39.45  ? 57  ARG A C   1 
ATOM   21   O  O   . ARG A 1 9   ? 28.552 14.167 17.769 1.00 39.53  ? 57  ARG A O   1 
ATOM   22   C  CB  . ARG A 1 9   ? 31.509 12.871 18.014 1.00 39.00  ? 57  ARG A CB  1 
ATOM   23   C  CG  . ARG A 1 9   ? 32.798 12.517 18.648 1.00 37.45  ? 57  ARG A CG  1 
ATOM   24   C  CD  . ARG A 1 9   ? 33.903 12.661 17.625 1.00 35.48  ? 57  ARG A CD  1 
ATOM   25   N  NE  . ARG A 1 9   ? 34.965 11.715 17.920 1.00 34.53  ? 57  ARG A NE  1 
ATOM   26   C  CZ  . ARG A 1 9   ? 35.951 11.928 18.782 1.00 34.08  ? 57  ARG A CZ  1 
ATOM   27   N  NH1 . ARG A 1 9   ? 36.059 13.078 19.436 1.00 34.23  ? 57  ARG A NH1 1 
ATOM   28   N  NH2 . ARG A 1 9   ? 36.844 10.985 18.983 1.00 33.29  ? 57  ARG A NH2 1 
ATOM   29   N  N   . TYR A 1 10  ? 29.974 15.519 18.882 1.00 39.22  ? 58  TYR A N   1 
ATOM   30   C  CA  . TYR A 1 10  ? 29.441 16.744 18.300 1.00 39.32  ? 58  TYR A CA  1 
ATOM   31   C  C   . TYR A 1 10  ? 30.380 17.226 17.185 1.00 39.02  ? 58  TYR A C   1 
ATOM   32   O  O   . TYR A 1 10  ? 29.929 17.585 16.096 1.00 39.36  ? 58  TYR A O   1 
ATOM   33   C  CB  . TYR A 1 10  ? 29.268 17.794 19.399 1.00 39.64  ? 58  TYR A CB  1 
ATOM   34   C  CG  . TYR A 1 10  ? 28.540 19.095 19.048 1.00 41.42  ? 58  TYR A CG  1 
ATOM   35   C  CD1 . TYR A 1 10  ? 27.469 19.134 18.132 1.00 42.40  ? 58  TYR A CD1 1 
ATOM   36   C  CD2 . TYR A 1 10  ? 28.916 20.295 19.695 1.00 44.31  ? 58  TYR A CD2 1 
ATOM   37   C  CE1 . TYR A 1 10  ? 26.814 20.351 17.853 1.00 44.49  ? 58  TYR A CE1 1 
ATOM   38   C  CE2 . TYR A 1 10  ? 28.269 21.504 19.434 1.00 46.37  ? 58  TYR A CE2 1 
ATOM   39   C  CZ  . TYR A 1 10  ? 27.224 21.535 18.516 1.00 46.68  ? 58  TYR A CZ  1 
ATOM   40   O  OH  . TYR A 1 10  ? 26.622 22.765 18.280 1.00 48.43  ? 58  TYR A OH  1 
ATOM   41   N  N   . VAL A 1 11  ? 31.686 17.212 17.449 1.00 38.59  ? 59  VAL A N   1 
ATOM   42   C  CA  . VAL A 1 11  ? 32.686 17.596 16.444 1.00 37.94  ? 59  VAL A CA  1 
ATOM   43   C  C   . VAL A 1 11  ? 33.621 16.423 16.177 1.00 37.83  ? 59  VAL A C   1 
ATOM   44   O  O   . VAL A 1 11  ? 34.151 15.841 17.122 1.00 37.69  ? 59  VAL A O   1 
ATOM   45   C  CB  . VAL A 1 11  ? 33.532 18.813 16.902 1.00 37.80  ? 59  VAL A CB  1 
ATOM   46   C  CG1 . VAL A 1 11  ? 34.497 19.235 15.798 1.00 37.31  ? 59  VAL A CG1 1 
ATOM   47   C  CG2 . VAL A 1 11  ? 32.635 19.985 17.305 1.00 37.63  ? 59  VAL A CG2 1 
ATOM   48   N  N   . ARG A 1 12  ? 33.831 16.081 14.904 1.00 37.91  ? 60  ARG A N   1 
ATOM   49   C  CA  . ARG A 1 12  ? 34.693 14.934 14.548 1.00 38.26  ? 60  ARG A CA  1 
ATOM   50   C  C   . ARG A 1 12  ? 36.189 15.242 14.557 1.00 38.20  ? 60  ARG A C   1 
ATOM   51   O  O   . ARG A 1 12  ? 36.594 16.416 14.536 1.00 38.01  ? 60  ARG A O   1 
ATOM   52   C  CB  . ARG A 1 12  ? 34.299 14.332 13.193 1.00 38.39  ? 60  ARG A CB  1 
ATOM   53   C  CG  . ARG A 1 12  ? 33.032 13.459 13.262 1.00 38.78  ? 60  ARG A CG  1 
ATOM   54   C  CD  . ARG A 1 12  ? 32.651 12.887 11.908 1.00 38.76  ? 60  ARG A CD  1 
ATOM   55   N  NE  . ARG A 1 12  ? 32.609 13.922 10.872 1.00 38.81  ? 60  ARG A NE  1 
ATOM   56   C  CZ  . ARG A 1 12  ? 32.167 13.726 9.625  1.00 38.65  ? 60  ARG A CZ  1 
ATOM   57   N  NH1 . ARG A 1 12  ? 31.720 12.525 9.253  1.00 38.76  ? 60  ARG A NH1 1 
ATOM   58   N  NH2 . ARG A 1 12  ? 32.169 14.730 8.746  1.00 39.00  ? 60  ARG A NH2 1 
ATOM   59   N  N   . LYS A 1 13  ? 36.993 14.172 14.576 1.00 38.13  ? 61  LYS A N   1 
ATOM   60   C  CA  . LYS A 1 13  ? 38.456 14.287 14.680 1.00 38.03  ? 61  LYS A CA  1 
ATOM   61   C  C   . LYS A 1 13  ? 39.036 15.262 13.675 1.00 37.91  ? 61  LYS A C   1 
ATOM   62   O  O   . LYS A 1 13  ? 39.871 16.094 14.047 1.00 37.80  ? 61  LYS A O   1 
ATOM   63   C  CB  . LYS A 1 13  ? 39.158 12.925 14.561 1.00 38.10  ? 61  LYS A CB  1 
ATOM   64   C  CG  . LYS A 1 13  ? 38.819 11.935 15.693 1.00 38.25  ? 61  LYS A CG  1 
ATOM   65   C  CD  . LYS A 1 13  ? 39.037 12.514 17.103 1.00 37.22  ? 61  LYS A CD  1 
ATOM   66   C  CE  . LYS A 1 13  ? 40.429 12.196 17.647 1.00 36.99  ? 61  LYS A CE  1 
ATOM   67   N  NZ  . LYS A 1 13  ? 40.563 12.564 19.087 1.00 36.69  ? 61  LYS A NZ  1 
ATOM   68   N  N   . ASP A 1 14  ? 38.585 15.186 12.421 1.00 37.96  ? 62  ASP A N   1 
ATOM   69   C  CA  . ASP A 1 14  ? 39.079 16.104 11.381 1.00 37.75  ? 62  ASP A CA  1 
ATOM   70   C  C   . ASP A 1 14  ? 38.606 17.558 11.542 1.00 37.79  ? 62  ASP A C   1 
ATOM   71   O  O   . ASP A 1 14  ? 39.127 18.461 10.871 1.00 37.81  ? 62  ASP A O   1 
ATOM   72   C  CB  . ASP A 1 14  ? 38.792 15.583 9.955  1.00 37.56  ? 62  ASP A CB  1 
ATOM   73   C  CG  . ASP A 1 14  ? 37.294 15.351 9.677  1.00 36.63  ? 62  ASP A CG  1 
ATOM   74   O  OD1 . ASP A 1 14  ? 36.418 15.880 10.409 1.00 36.26  ? 62  ASP A OD1 1 
ATOM   75   O  OD2 . ASP A 1 14  ? 36.993 14.630 8.697  1.00 34.98  ? 62  ASP A OD2 1 
ATOM   76   N  N   . GLY A 1 15  ? 37.620 17.776 12.422 1.00 37.85  ? 63  GLY A N   1 
ATOM   77   C  CA  . GLY A 1 15  ? 37.141 19.130 12.709 1.00 38.29  ? 63  GLY A CA  1 
ATOM   78   C  C   . GLY A 1 15  ? 35.775 19.450 12.132 1.00 38.65  ? 63  GLY A C   1 
ATOM   79   O  O   . GLY A 1 15  ? 35.190 20.496 12.436 1.00 38.62  ? 63  GLY A O   1 
ATOM   80   N  N   . LYS A 1 16  ? 35.268 18.553 11.292 1.00 38.94  ? 64  LYS A N   1 
ATOM   81   C  CA  . LYS A 1 16  ? 33.924 18.688 10.741 1.00 39.28  ? 64  LYS A CA  1 
ATOM   82   C  C   . LYS A 1 16  ? 32.899 18.345 11.821 1.00 39.73  ? 64  LYS A C   1 
ATOM   83   O  O   . LYS A 1 16  ? 32.984 17.280 12.454 1.00 39.61  ? 64  LYS A O   1 
ATOM   84   C  CB  . LYS A 1 16  ? 33.737 17.763 9.536  1.00 39.11  ? 64  LYS A CB  1 
ATOM   85   C  CG  . LYS A 1 16  ? 34.786 17.922 8.446  1.00 38.95  ? 64  LYS A CG  1 
ATOM   86   C  CD  . LYS A 1 16  ? 34.664 16.814 7.403  1.00 38.92  ? 64  LYS A CD  1 
ATOM   87   C  CE  . LYS A 1 16  ? 35.990 16.613 6.636  1.00 38.32  ? 64  LYS A CE  1 
ATOM   88   N  NZ  . LYS A 1 16  ? 36.386 17.753 5.728  1.00 37.39  ? 64  LYS A NZ  1 
ATOM   89   N  N   . CYS A 1 17  ? 31.940 19.252 12.028 1.00 40.28  ? 65  CYS A N   1 
ATOM   90   C  CA  . CYS A 1 17  ? 30.897 19.080 13.053 1.00 40.92  ? 65  CYS A CA  1 
ATOM   91   C  C   . CYS A 1 17  ? 29.821 18.109 12.570 1.00 41.32  ? 65  CYS A C   1 
ATOM   92   O  O   . CYS A 1 17  ? 29.759 17.788 11.388 1.00 41.56  ? 65  CYS A O   1 
ATOM   93   C  CB  . CYS A 1 17  ? 30.284 20.434 13.423 1.00 40.82  ? 65  CYS A CB  1 
ATOM   94   S  SG  . CYS A 1 17  ? 31.504 21.795 13.465 1.00 41.69  ? 65  CYS A SG  1 
ATOM   95   N  N   . ASN A 1 18  ? 28.983 17.622 13.474 1.00 41.99  ? 66  ASN A N   1 
ATOM   96   C  CA  . ASN A 1 18  ? 27.967 16.652 13.074 1.00 42.76  ? 66  ASN A CA  1 
ATOM   97   C  C   . ASN A 1 18  ? 26.573 17.219 13.216 1.00 43.96  ? 66  ASN A C   1 
ATOM   98   O  O   . ASN A 1 18  ? 25.707 16.613 13.859 1.00 44.05  ? 66  ASN A O   1 
ATOM   99   C  CB  . ASN A 1 18  ? 28.128 15.322 13.823 1.00 42.13  ? 66  ASN A CB  1 
ATOM   100  C  CG  . ASN A 1 18  ? 29.392 14.554 13.389 1.00 41.12  ? 66  ASN A CG  1 
ATOM   101  O  OD1 . ASN A 1 18  ? 29.719 14.462 12.189 1.00 39.55  ? 66  ASN A OD1 1 
ATOM   102  N  ND2 . ASN A 1 18  ? 30.109 14.005 14.371 1.00 39.89  ? 66  ASN A ND2 1 
ATOM   103  N  N   . VAL A 1 19  ? 26.384 18.392 12.601 1.00 45.51  ? 67  VAL A N   1 
ATOM   104  C  CA  . VAL A 1 19  ? 25.097 19.106 12.578 1.00 47.01  ? 67  VAL A CA  1 
ATOM   105  C  C   . VAL A 1 19  ? 24.614 19.372 11.142 1.00 48.06  ? 67  VAL A C   1 
ATOM   106  O  O   . VAL A 1 19  ? 25.430 19.455 10.212 1.00 48.13  ? 67  VAL A O   1 
ATOM   107  C  CB  . VAL A 1 19  ? 25.162 20.458 13.339 1.00 46.93  ? 67  VAL A CB  1 
ATOM   108  C  CG1 . VAL A 1 19  ? 23.752 20.903 13.771 1.00 47.09  ? 67  VAL A CG1 1 
ATOM   109  C  CG2 . VAL A 1 19  ? 26.087 20.355 14.553 1.00 47.34  ? 67  VAL A CG2 1 
ATOM   110  N  N   . HIS A 1 20  ? 23.288 19.511 10.990 1.00 49.55  ? 68  HIS A N   1 
ATOM   111  C  CA  . HIS A 1 20  ? 22.596 19.775 9.703  1.00 50.92  ? 68  HIS A CA  1 
ATOM   112  C  C   . HIS A 1 20  ? 22.969 18.787 8.596  1.00 51.48  ? 68  HIS A C   1 
ATOM   113  O  O   . HIS A 1 20  ? 23.543 19.199 7.576  1.00 51.34  ? 68  HIS A O   1 
ATOM   114  C  CB  . HIS A 1 20  ? 22.855 21.207 9.184  1.00 51.11  ? 68  HIS A CB  1 
ATOM   115  C  CG  . HIS A 1 20  ? 22.607 22.288 10.191 1.00 52.03  ? 68  HIS A CG  1 
ATOM   116  N  ND1 . HIS A 1 20  ? 21.347 22.590 10.666 1.00 53.11  ? 68  HIS A ND1 1 
ATOM   117  C  CD2 . HIS A 1 20  ? 23.455 23.157 10.793 1.00 52.58  ? 68  HIS A CD2 1 
ATOM   118  C  CE1 . HIS A 1 20  ? 21.433 23.589 11.528 1.00 53.26  ? 68  HIS A CE1 1 
ATOM   119  N  NE2 . HIS A 1 20  ? 22.700 23.953 11.622 1.00 52.88  ? 68  HIS A NE2 1 
ATOM   120  N  N   . HIS A 1 21  ? 22.643 17.507 8.784  1.00 52.48  ? 69  HIS A N   1 
ATOM   121  C  CA  . HIS A 1 21  ? 22.986 16.467 7.799  1.00 53.73  ? 69  HIS A CA  1 
ATOM   122  C  C   . HIS A 1 21  ? 23.006 16.968 6.325  1.00 54.43  ? 69  HIS A C   1 
ATOM   123  O  O   . HIS A 1 21  ? 21.996 17.512 5.820  1.00 54.74  ? 69  HIS A O   1 
ATOM   124  C  CB  . HIS A 1 21  ? 22.056 15.245 7.940  1.00 53.73  ? 69  HIS A CB  1 
ATOM   125  C  CG  . HIS A 1 21  ? 22.170 14.269 6.802  1.00 54.33  ? 69  HIS A CG  1 
ATOM   126  N  ND1 . HIS A 1 21  ? 22.941 13.124 6.876  1.00 54.63  ? 69  HIS A ND1 1 
ATOM   127  C  CD2 . HIS A 1 21  ? 21.628 14.279 5.555  1.00 54.82  ? 69  HIS A CD2 1 
ATOM   128  C  CE1 . HIS A 1 21  ? 22.862 12.468 5.728  1.00 54.99  ? 69  HIS A CE1 1 
ATOM   129  N  NE2 . HIS A 1 21  ? 22.076 13.150 4.908  1.00 55.00  ? 69  HIS A NE2 1 
ATOM   130  N  N   . GLY A 1 22  ? 24.162 16.790 5.664  1.00 55.15  ? 70  GLY A N   1 
ATOM   131  C  CA  . GLY A 1 22  ? 24.334 17.093 4.229  1.00 55.91  ? 70  GLY A CA  1 
ATOM   132  C  C   . GLY A 1 22  ? 24.472 18.553 3.772  1.00 56.51  ? 70  GLY A C   1 
ATOM   133  O  O   . GLY A 1 22  ? 24.275 18.853 2.586  1.00 56.47  ? 70  GLY A O   1 
ATOM   134  N  N   . ASN A 1 23  ? 24.809 19.461 4.695  1.00 57.00  ? 71  ASN A N   1 
ATOM   135  C  CA  . ASN A 1 23  ? 25.049 20.885 4.365  1.00 57.45  ? 71  ASN A CA  1 
ATOM   136  C  C   . ASN A 1 23  ? 26.388 21.107 3.611  1.00 57.70  ? 71  ASN A C   1 
ATOM   137  O  O   . ASN A 1 23  ? 27.066 20.133 3.232  1.00 57.80  ? 71  ASN A O   1 
ATOM   138  C  CB  . ASN A 1 23  ? 24.976 21.755 5.635  1.00 57.47  ? 71  ASN A CB  1 
ATOM   139  C  CG  . ASN A 1 23  ? 26.110 21.457 6.617  1.00 58.10  ? 71  ASN A CG  1 
ATOM   140  O  OD1 . ASN A 1 23  ? 26.111 20.421 7.300  1.00 59.24  ? 71  ASN A OD1 1 
ATOM   141  N  ND2 . ASN A 1 23  ? 27.087 22.363 6.679  1.00 58.37  ? 71  ASN A ND2 1 
ATOM   142  N  N   . VAL A 1 24  ? 26.777 22.371 3.404  1.00 58.03  ? 72  VAL A N   1 
ATOM   143  C  CA  . VAL A 1 24  ? 27.917 22.677 2.514  1.00 58.28  ? 72  VAL A CA  1 
ATOM   144  C  C   . VAL A 1 24  ? 29.176 23.304 3.165  1.00 58.47  ? 72  VAL A C   1 
ATOM   145  O  O   . VAL A 1 24  ? 30.077 23.753 2.444  1.00 58.70  ? 72  VAL A O   1 
ATOM   146  C  CB  . VAL A 1 24  ? 27.458 23.485 1.227  1.00 58.24  ? 72  VAL A CB  1 
ATOM   147  C  CG1 . VAL A 1 24  ? 27.346 24.997 1.516  1.00 58.05  ? 72  VAL A CG1 1 
ATOM   148  C  CG2 . VAL A 1 24  ? 28.401 23.208 0.030  1.00 57.94  ? 72  VAL A CG2 1 
ATOM   149  N  N   . ARG A 1 25  ? 29.255 23.311 4.506  1.00 58.46  ? 73  ARG A N   1 
ATOM   150  C  CA  . ARG A 1 25  ? 30.369 23.989 5.218  1.00 58.39  ? 73  ARG A CA  1 
ATOM   151  C  C   . ARG A 1 25  ? 31.778 23.499 4.825  1.00 58.12  ? 73  ARG A C   1 
ATOM   152  O  O   . ARG A 1 25  ? 32.119 22.325 5.002  1.00 57.80  ? 73  ARG A O   1 
ATOM   153  C  CB  . ARG A 1 25  ? 30.189 23.924 6.742  1.00 58.53  ? 73  ARG A CB  1 
ATOM   154  C  CG  . ARG A 1 25  ? 29.080 24.818 7.306  1.00 58.97  ? 73  ARG A CG  1 
ATOM   155  C  CD  . ARG A 1 25  ? 28.905 24.504 8.800  1.00 60.53  ? 73  ARG A CD  1 
ATOM   156  N  NE  . ARG A 1 25  ? 27.873 25.309 9.453  1.00 62.10  ? 73  ARG A NE  1 
ATOM   157  C  CZ  . ARG A 1 25  ? 27.423 25.077 10.693 1.00 63.09  ? 73  ARG A CZ  1 
ATOM   158  N  NH1 . ARG A 1 25  ? 27.913 24.058 11.414 1.00 62.77  ? 73  ARG A NH1 1 
ATOM   159  N  NH2 . ARG A 1 25  ? 26.478 25.860 11.216 1.00 63.89  ? 73  ARG A NH2 1 
ATOM   160  N  N   . ALA A 1 29  ? 23.425 34.535 0.088  1.00 61.63  ? 202 ALA A N   1 
ATOM   161  C  CA  . ALA A 1 29  ? 23.477 35.354 1.303  1.00 61.72  ? 202 ALA A CA  1 
ATOM   162  C  C   . ALA A 1 29  ? 22.365 34.971 2.318  1.00 61.78  ? 202 ALA A C   1 
ATOM   163  O  O   . ALA A 1 29  ? 21.242 35.507 2.277  1.00 61.74  ? 202 ALA A O   1 
ATOM   164  C  CB  . ALA A 1 29  ? 23.430 36.880 0.952  1.00 61.59  ? 202 ALA A CB  1 
ATOM   165  N  N   . GLU A 1 30  ? 22.693 34.029 3.214  1.00 61.87  ? 203 GLU A N   1 
ATOM   166  C  CA  . GLU A 1 30  ? 21.821 33.653 4.349  1.00 61.75  ? 203 GLU A CA  1 
ATOM   167  C  C   . GLU A 1 30  ? 22.115 34.491 5.600  1.00 61.25  ? 203 GLU A C   1 
ATOM   168  O  O   . GLU A 1 30  ? 23.279 34.657 6.008  1.00 61.10  ? 203 GLU A O   1 
ATOM   169  C  CB  . GLU A 1 30  ? 21.920 32.153 4.678  1.00 61.95  ? 203 GLU A CB  1 
ATOM   170  C  CG  . GLU A 1 30  ? 23.357 31.634 4.838  1.00 63.09  ? 203 GLU A CG  1 
ATOM   171  C  CD  . GLU A 1 30  ? 23.465 30.441 5.786  1.00 64.66  ? 203 GLU A CD  1 
ATOM   172  O  OE1 . GLU A 1 30  ? 24.527 29.753 5.747  1.00 64.57  ? 203 GLU A OE1 1 
ATOM   173  O  OE2 . GLU A 1 30  ? 22.497 30.209 6.568  1.00 64.96  ? 203 GLU A OE2 1 
ATOM   174  N  N   . THR A 1 31  ? 21.039 35.014 6.191  1.00 60.72  ? 204 THR A N   1 
ATOM   175  C  CA  . THR A 1 31  ? 21.118 35.909 7.350  1.00 59.96  ? 204 THR A CA  1 
ATOM   176  C  C   . THR A 1 31  ? 21.158 35.140 8.686  1.00 59.44  ? 204 THR A C   1 
ATOM   177  O  O   . THR A 1 31  ? 20.484 34.113 8.853  1.00 59.44  ? 204 THR A O   1 
ATOM   178  C  CB  . THR A 1 31  ? 19.948 36.968 7.343  1.00 60.01  ? 204 THR A CB  1 
ATOM   179  O  OG1 . THR A 1 31  ? 20.141 37.919 8.403  1.00 59.81  ? 204 THR A OG1 1 
ATOM   180  C  CG2 . THR A 1 31  ? 18.553 36.299 7.480  1.00 59.58  ? 204 THR A CG2 1 
ATOM   181  N  N   . LEU A 1 32  ? 21.968 35.636 9.622  1.00 58.68  ? 205 LEU A N   1 
ATOM   182  C  CA  . LEU A 1 32  ? 21.967 35.145 11.001 1.00 57.82  ? 205 LEU A CA  1 
ATOM   183  C  C   . LEU A 1 32  ? 20.716 35.638 11.756 1.00 57.23  ? 205 LEU A C   1 
ATOM   184  O  O   . LEU A 1 32  ? 20.168 36.701 11.432 1.00 57.55  ? 205 LEU A O   1 
ATOM   185  C  CB  . LEU A 1 32  ? 23.219 35.625 11.719 1.00 57.63  ? 205 LEU A CB  1 
ATOM   186  C  CG  . LEU A 1 32  ? 23.593 34.683 12.844 1.00 57.46  ? 205 LEU A CG  1 
ATOM   187  C  CD1 . LEU A 1 32  ? 24.725 33.808 12.369 1.00 57.71  ? 205 LEU A CD1 1 
ATOM   188  C  CD2 . LEU A 1 32  ? 23.980 35.468 14.073 1.00 57.40  ? 205 LEU A CD2 1 
ATOM   189  N  N   . VAL A 1 33  ? 20.263 34.880 12.758 1.00 56.16  ? 206 VAL A N   1 
ATOM   190  C  CA  . VAL A 1 33  ? 19.002 35.209 13.443 1.00 55.03  ? 206 VAL A CA  1 
ATOM   191  C  C   . VAL A 1 33  ? 19.135 35.373 14.966 1.00 54.14  ? 206 VAL A C   1 
ATOM   192  O  O   . VAL A 1 33  ? 19.873 34.640 15.627 1.00 54.11  ? 206 VAL A O   1 
ATOM   193  C  CB  . VAL A 1 33  ? 17.881 34.159 13.153 1.00 55.19  ? 206 VAL A CB  1 
ATOM   194  C  CG1 . VAL A 1 33  ? 16.551 34.867 12.894 1.00 55.15  ? 206 VAL A CG1 1 
ATOM   195  C  CG2 . VAL A 1 33  ? 18.246 33.239 11.973 1.00 55.05  ? 206 VAL A CG2 1 
ATOM   196  N  N   . PHE A 1 34  ? 18.417 36.338 15.518 1.00 52.91  ? 207 PHE A N   1 
ATOM   197  C  CA  . PHE A 1 34  ? 18.283 36.425 16.956 1.00 51.76  ? 207 PHE A CA  1 
ATOM   198  C  C   . PHE A 1 34  ? 16.849 36.126 17.288 1.00 51.54  ? 207 PHE A C   1 
ATOM   199  O  O   . PHE A 1 34  ? 15.952 36.589 16.594 1.00 51.57  ? 207 PHE A O   1 
ATOM   200  C  CB  . PHE A 1 34  ? 18.607 37.822 17.446 1.00 51.43  ? 207 PHE A CB  1 
ATOM   201  C  CG  . PHE A 1 34  ? 20.038 38.202 17.282 1.00 50.49  ? 207 PHE A CG  1 
ATOM   202  C  CD1 . PHE A 1 34  ? 20.944 38.007 18.315 1.00 49.10  ? 207 PHE A CD1 1 
ATOM   203  C  CD2 . PHE A 1 34  ? 20.481 38.764 16.098 1.00 49.34  ? 207 PHE A CD2 1 
ATOM   204  C  CE1 . PHE A 1 34  ? 22.265 38.365 18.169 1.00 48.20  ? 207 PHE A CE1 1 
ATOM   205  C  CE2 . PHE A 1 34  ? 21.801 39.124 15.946 1.00 48.29  ? 207 PHE A CE2 1 
ATOM   206  C  CZ  . PHE A 1 34  ? 22.697 38.923 16.984 1.00 48.24  ? 207 PHE A CZ  1 
ATOM   207  N  N   . SER A 1 35  ? 16.628 35.360 18.351 1.00 51.28  ? 208 SER A N   1 
ATOM   208  C  CA  . SER A 1 35  ? 15.277 35.134 18.842 1.00 50.95  ? 208 SER A CA  1 
ATOM   209  C  C   . SER A 1 35  ? 14.593 36.477 19.041 1.00 50.67  ? 208 SER A C   1 
ATOM   210  O  O   . SER A 1 35  ? 15.211 37.448 19.466 1.00 50.50  ? 208 SER A O   1 
ATOM   211  C  CB  . SER A 1 35  ? 15.263 34.310 20.138 1.00 51.00  ? 208 SER A CB  1 
ATOM   212  O  OG  . SER A 1 35  ? 15.761 35.049 21.245 1.00 51.57  ? 208 SER A OG  1 
ATOM   213  N  N   . THR A 1 36  ? 13.317 36.517 18.699 1.00 50.29  ? 209 THR A N   1 
ATOM   214  C  CA  . THR A 1 36  ? 12.505 37.722 18.770 1.00 49.96  ? 209 THR A CA  1 
ATOM   215  C  C   . THR A 1 36  ? 12.281 38.216 20.198 1.00 49.51  ? 209 THR A C   1 
ATOM   216  O  O   . THR A 1 36  ? 11.900 39.374 20.427 1.00 49.70  ? 209 THR A O   1 
ATOM   217  C  CB  . THR A 1 36  ? 11.136 37.438 18.157 1.00 50.08  ? 209 THR A CB  1 
ATOM   218  O  OG1 . THR A 1 36  ? 10.657 36.168 18.647 1.00 50.03  ? 209 THR A OG1 1 
ATOM   219  C  CG2 . THR A 1 36  ? 11.247 37.406 16.622 1.00 50.50  ? 209 THR A CG2 1 
ATOM   220  N  N   . HIS A 1 37  ? 12.514 37.329 21.157 1.00 48.62  ? 210 HIS A N   1 
ATOM   221  C  CA  . HIS A 1 37  ? 12.282 37.678 22.531 1.00 47.74  ? 210 HIS A CA  1 
ATOM   222  C  C   . HIS A 1 37  ? 13.435 37.281 23.403 1.00 47.05  ? 210 HIS A C   1 
ATOM   223  O  O   . HIS A 1 37  ? 14.149 36.329 23.109 1.00 47.13  ? 210 HIS A O   1 
ATOM   224  C  CB  . HIS A 1 37  ? 11.034 36.984 23.028 1.00 47.86  ? 210 HIS A CB  1 
ATOM   225  C  CG  . HIS A 1 37  ? 9.779  37.499 22.407 1.00 48.62  ? 210 HIS A CG  1 
ATOM   226  N  ND1 . HIS A 1 37  ? 9.230  38.726 22.765 1.00 50.20  ? 210 HIS A ND1 1 
ATOM   227  C  CD2 . HIS A 1 37  ? 8.959  36.956 21.461 1.00 49.26  ? 210 HIS A CD2 1 
ATOM   228  C  CE1 . HIS A 1 37  ? 8.120  38.913 22.068 1.00 50.87  ? 210 HIS A CE1 1 
ATOM   229  N  NE2 . HIS A 1 37  ? 7.934  37.854 21.269 1.00 51.06  ? 210 HIS A NE2 1 
ATOM   230  N  N   . ALA A 1 38  ? 13.601 38.034 24.482 1.00 46.13  ? 211 ALA A N   1 
ATOM   231  C  CA  . ALA A 1 38  ? 14.553 37.713 25.524 1.00 44.99  ? 211 ALA A CA  1 
ATOM   232  C  C   . ALA A 1 38  ? 13.776 37.194 26.723 1.00 44.14  ? 211 ALA A C   1 
ATOM   233  O  O   . ALA A 1 38  ? 12.632 37.588 26.944 1.00 44.28  ? 211 ALA A O   1 
ATOM   234  C  CB  . ALA A 1 38  ? 15.364 38.957 25.902 1.00 44.83  ? 211 ALA A CB  1 
ATOM   235  N  N   . VAL A 1 39  ? 14.385 36.308 27.500 1.00 42.72  ? 212 VAL A N   1 
ATOM   236  C  CA  . VAL A 1 39  ? 13.731 35.832 28.709 1.00 41.45  ? 212 VAL A CA  1 
ATOM   237  C  C   . VAL A 1 39  ? 14.564 36.074 29.964 1.00 40.94  ? 212 VAL A C   1 
ATOM   238  O  O   . VAL A 1 39  ? 15.788 36.148 29.912 1.00 41.12  ? 212 VAL A O   1 
ATOM   239  C  CB  . VAL A 1 39  ? 13.359 34.353 28.596 1.00 41.17  ? 212 VAL A CB  1 
ATOM   240  C  CG1 . VAL A 1 39  ? 12.480 34.135 27.384 1.00 41.30  ? 212 VAL A CG1 1 
ATOM   241  C  CG2 . VAL A 1 39  ? 14.597 33.497 28.499 1.00 40.63  ? 212 VAL A CG2 1 
ATOM   242  N  N   . ILE A 1 40  ? 13.883 36.219 31.089 1.00 39.91  ? 213 ILE A N   1 
ATOM   243  C  CA  . ILE A 1 40  ? 14.534 36.357 32.373 1.00 38.97  ? 213 ILE A CA  1 
ATOM   244  C  C   . ILE A 1 40  ? 14.080 35.189 33.218 1.00 38.97  ? 213 ILE A C   1 
ATOM   245  O  O   . ILE A 1 40  ? 12.899 34.907 33.282 1.00 39.09  ? 213 ILE A O   1 
ATOM   246  C  CB  . ILE A 1 40  ? 14.116 37.665 33.047 1.00 38.60  ? 213 ILE A CB  1 
ATOM   247  C  CG1 . ILE A 1 40  ? 14.819 38.851 32.355 1.00 37.33  ? 213 ILE A CG1 1 
ATOM   248  C  CG2 . ILE A 1 40  ? 14.402 37.600 34.553 1.00 38.73  ? 213 ILE A CG2 1 
ATOM   249  C  CD1 . ILE A 1 40  ? 14.323 40.214 32.773 1.00 34.89  ? 213 ILE A CD1 1 
ATOM   250  N  N   . SER A 1 41  ? 15.012 34.494 33.848 1.00 39.11  ? 214 SER A N   1 
ATOM   251  C  CA  . SER A 1 41  ? 14.673 33.378 34.719 1.00 39.46  ? 214 SER A CA  1 
ATOM   252  C  C   . SER A 1 41  ? 15.917 32.879 35.434 1.00 39.96  ? 214 SER A C   1 
ATOM   253  O  O   . SER A 1 41  ? 17.028 33.271 35.095 1.00 40.28  ? 214 SER A O   1 
ATOM   254  C  CB  . SER A 1 41  ? 14.021 32.250 33.920 1.00 39.40  ? 214 SER A CB  1 
ATOM   255  O  OG  . SER A 1 41  ? 14.622 32.130 32.648 1.00 38.80  ? 214 SER A OG  1 
ATOM   256  N  N   . MET A 1 42  ? 15.733 32.007 36.415 1.00 40.28  ? 215 MET A N   1 
ATOM   257  C  CA  . MET A 1 42  ? 16.844 31.521 37.223 1.00 40.15  ? 215 MET A CA  1 
ATOM   258  C  C   . MET A 1 42  ? 17.682 30.409 36.576 1.00 39.67  ? 215 MET A C   1 
ATOM   259  O  O   . MET A 1 42  ? 17.159 29.524 35.894 1.00 39.72  ? 215 MET A O   1 
ATOM   260  C  CB  . MET A 1 42  ? 16.314 31.046 38.569 1.00 40.57  ? 215 MET A CB  1 
ATOM   261  C  CG  . MET A 1 42  ? 15.574 32.113 39.327 1.00 42.00  ? 215 MET A CG  1 
ATOM   262  S  SD  . MET A 1 42  ? 16.745 33.179 40.167 1.00 43.24  ? 215 MET A SD  1 
ATOM   263  C  CE  . MET A 1 42  ? 17.041 32.191 41.629 1.00 43.52  ? 215 MET A CE  1 
ATOM   264  N  N   . ARG A 1 43  ? 18.990 30.469 36.808 1.00 39.06  ? 216 ARG A N   1 
ATOM   265  C  CA  . ARG A 1 43  ? 19.911 29.411 36.424 1.00 38.50  ? 216 ARG A CA  1 
ATOM   266  C  C   . ARG A 1 43  ? 20.877 29.192 37.564 1.00 38.50  ? 216 ARG A C   1 
ATOM   267  O  O   . ARG A 1 43  ? 21.725 30.038 37.831 1.00 38.63  ? 216 ARG A O   1 
ATOM   268  C  CB  . ARG A 1 43  ? 20.689 29.785 35.174 1.00 38.36  ? 216 ARG A CB  1 
ATOM   269  C  CG  . ARG A 1 43  ? 19.877 29.743 33.910 1.00 37.64  ? 216 ARG A CG  1 
ATOM   270  C  CD  . ARG A 1 43  ? 20.761 29.542 32.703 1.00 36.23  ? 216 ARG A CD  1 
ATOM   271  N  NE  . ARG A 1 43  ? 19.978 29.032 31.588 1.00 35.89  ? 216 ARG A NE  1 
ATOM   272  C  CZ  . ARG A 1 43  ? 20.390 29.019 30.325 1.00 35.77  ? 216 ARG A CZ  1 
ATOM   273  N  NH1 . ARG A 1 43  ? 21.594 29.495 30.006 1.00 36.45  ? 216 ARG A NH1 1 
ATOM   274  N  NH2 . ARG A 1 43  ? 19.593 28.536 29.381 1.00 35.93  ? 216 ARG A NH2 1 
ATOM   275  N  N   . ASP A 1 44  ? 20.739 28.050 38.231 1.00 38.54  ? 217 ASP A N   1 
ATOM   276  C  CA  . ASP A 1 44  ? 21.491 27.745 39.453 1.00 38.43  ? 217 ASP A CA  1 
ATOM   277  C  C   . ASP A 1 44  ? 21.548 28.906 40.459 1.00 38.45  ? 217 ASP A C   1 
ATOM   278  O  O   . ASP A 1 44  ? 22.624 29.309 40.891 1.00 38.68  ? 217 ASP A O   1 
ATOM   279  C  CB  . ASP A 1 44  ? 22.899 27.239 39.121 1.00 38.35  ? 217 ASP A CB  1 
ATOM   280  C  CG  . ASP A 1 44  ? 22.887 26.021 38.236 1.00 37.98  ? 217 ASP A CG  1 
ATOM   281  O  OD1 . ASP A 1 44  ? 22.135 25.080 38.527 1.00 38.21  ? 217 ASP A OD1 1 
ATOM   282  O  OD2 . ASP A 1 44  ? 23.639 25.998 37.247 1.00 38.22  ? 217 ASP A OD2 1 
ATOM   283  N  N   . GLY A 1 45  ? 20.391 29.448 40.821 1.00 38.30  ? 218 GLY A N   1 
ATOM   284  C  CA  . GLY A 1 45  ? 20.322 30.441 41.879 1.00 38.27  ? 218 GLY A CA  1 
ATOM   285  C  C   . GLY A 1 45  ? 20.657 31.854 41.453 1.00 38.40  ? 218 GLY A C   1 
ATOM   286  O  O   . GLY A 1 45  ? 20.721 32.760 42.279 1.00 38.45  ? 218 GLY A O   1 
ATOM   287  N  N   . LYS A 1 46  ? 20.880 32.059 40.165 1.00 38.51  ? 219 LYS A N   1 
ATOM   288  C  CA  . LYS A 1 46  ? 21.154 33.401 39.685 1.00 38.67  ? 219 LYS A CA  1 
ATOM   289  C  C   . LYS A 1 46  ? 20.062 33.764 38.719 1.00 38.28  ? 219 LYS A C   1 
ATOM   290  O  O   . LYS A 1 46  ? 19.707 32.955 37.861 1.00 38.80  ? 219 LYS A O   1 
ATOM   291  C  CB  . LYS A 1 46  ? 22.498 33.474 38.953 1.00 39.07  ? 219 LYS A CB  1 
ATOM   292  C  CG  . LYS A 1 46  ? 23.696 32.907 39.692 1.00 40.29  ? 219 LYS A CG  1 
ATOM   293  C  CD  . LYS A 1 46  ? 24.014 33.724 40.939 1.00 42.21  ? 219 LYS A CD  1 
ATOM   294  C  CE  . LYS A 1 46  ? 25.029 32.971 41.787 1.00 43.46  ? 219 LYS A CE  1 
ATOM   295  N  NZ  . LYS A 1 46  ? 24.572 32.948 43.197 1.00 44.63  ? 219 LYS A NZ  1 
ATOM   296  N  N   . LEU A 1 47  ? 19.527 34.974 38.845 1.00 37.59  ? 220 LEU A N   1 
ATOM   297  C  CA  . LEU A 1 47  ? 18.545 35.434 37.883 1.00 36.86  ? 220 LEU A CA  1 
ATOM   298  C  C   . LEU A 1 47  ? 19.282 35.796 36.599 1.00 36.28  ? 220 LEU A C   1 
ATOM   299  O  O   . LEU A 1 47  ? 20.354 36.375 36.650 1.00 36.36  ? 220 LEU A O   1 
ATOM   300  C  CB  . LEU A 1 47  ? 17.752 36.616 38.447 1.00 36.79  ? 220 LEU A CB  1 
ATOM   301  C  CG  . LEU A 1 47  ? 16.382 36.911 37.835 1.00 36.47  ? 220 LEU A CG  1 
ATOM   302  C  CD1 . LEU A 1 47  ? 15.362 35.918 38.307 1.00 36.70  ? 220 LEU A CD1 1 
ATOM   303  C  CD2 . LEU A 1 47  ? 15.942 38.297 38.201 1.00 36.57  ? 220 LEU A CD2 1 
ATOM   304  N  N   . CYS A 1 48  ? 18.730 35.431 35.452 1.00 35.75  ? 221 CYS A N   1 
ATOM   305  C  CA  . CYS A 1 48  ? 19.433 35.645 34.196 1.00 35.53  ? 221 CYS A CA  1 
ATOM   306  C  C   . CYS A 1 48  ? 18.589 36.175 33.033 1.00 35.61  ? 221 CYS A C   1 
ATOM   307  O  O   . CYS A 1 48  ? 17.444 35.782 32.853 1.00 35.85  ? 221 CYS A O   1 
ATOM   308  C  CB  . CYS A 1 48  ? 20.096 34.354 33.768 1.00 35.41  ? 221 CYS A CB  1 
ATOM   309  S  SG  . CYS A 1 48  ? 21.326 33.830 34.882 1.00 34.77  ? 221 CYS A SG  1 
ATOM   310  N  N   . LEU A 1 49  ? 19.179 37.056 32.234 1.00 35.46  ? 222 LEU A N   1 
ATOM   311  C  CA  . LEU A 1 49  ? 18.571 37.483 30.992 1.00 35.26  ? 222 LEU A CA  1 
ATOM   312  C  C   . LEU A 1 49  ? 19.175 36.646 29.890 1.00 35.42  ? 222 LEU A C   1 
ATOM   313  O  O   . LEU A 1 49  ? 20.377 36.469 29.838 1.00 35.48  ? 222 LEU A O   1 
ATOM   314  C  CB  . LEU A 1 49  ? 18.851 38.965 30.754 1.00 35.12  ? 222 LEU A CB  1 
ATOM   315  C  CG  . LEU A 1 49  ? 18.469 39.596 29.416 1.00 34.36  ? 222 LEU A CG  1 
ATOM   316  C  CD1 . LEU A 1 49  ? 17.003 39.920 29.370 1.00 34.03  ? 222 LEU A CD1 1 
ATOM   317  C  CD2 . LEU A 1 49  ? 19.265 40.845 29.210 1.00 33.52  ? 222 LEU A CD2 1 
ATOM   318  N  N   . MET A 1 50  ? 18.345 36.113 29.015 1.00 35.92  ? 223 MET A N   1 
ATOM   319  C  CA  . MET A 1 50  ? 18.843 35.278 27.938 1.00 36.60  ? 223 MET A CA  1 
ATOM   320  C  C   . MET A 1 50  ? 18.162 35.575 26.622 1.00 37.08  ? 223 MET A C   1 
ATOM   321  O  O   . MET A 1 50  ? 16.957 35.781 26.576 1.00 37.18  ? 223 MET A O   1 
ATOM   322  C  CB  . MET A 1 50  ? 18.631 33.812 28.273 1.00 36.63  ? 223 MET A CB  1 
ATOM   323  C  CG  . MET A 1 50  ? 19.429 33.345 29.444 1.00 36.94  ? 223 MET A CG  1 
ATOM   324  S  SD  . MET A 1 50  ? 18.669 31.925 30.208 1.00 37.54  ? 223 MET A SD  1 
ATOM   325  C  CE  . MET A 1 50  ? 17.424 32.719 31.220 1.00 37.89  ? 223 MET A CE  1 
ATOM   326  N  N   . PHE A 1 51  ? 18.950 35.594 25.554 1.00 37.84  ? 224 PHE A N   1 
ATOM   327  C  CA  . PHE A 1 51  ? 18.435 35.671 24.197 1.00 38.72  ? 224 PHE A CA  1 
ATOM   328  C  C   . PHE A 1 51  ? 19.148 34.586 23.402 1.00 39.79  ? 224 PHE A C   1 
ATOM   329  O  O   . PHE A 1 51  ? 20.175 34.081 23.855 1.00 40.09  ? 224 PHE A O   1 
ATOM   330  C  CB  . PHE A 1 51  ? 18.655 37.065 23.601 1.00 38.41  ? 224 PHE A CB  1 
ATOM   331  C  CG  . PHE A 1 51  ? 20.095 37.478 23.519 1.00 37.87  ? 224 PHE A CG  1 
ATOM   332  C  CD1 . PHE A 1 51  ? 20.832 37.241 22.369 1.00 37.95  ? 224 PHE A CD1 1 
ATOM   333  C  CD2 . PHE A 1 51  ? 20.714 38.120 24.580 1.00 36.91  ? 224 PHE A CD2 1 
ATOM   334  C  CE1 . PHE A 1 51  ? 22.160 37.617 22.289 1.00 37.14  ? 224 PHE A CE1 1 
ATOM   335  C  CE2 . PHE A 1 51  ? 22.036 38.496 24.506 1.00 36.18  ? 224 PHE A CE2 1 
ATOM   336  C  CZ  . PHE A 1 51  ? 22.758 38.243 23.361 1.00 36.75  ? 224 PHE A CZ  1 
ATOM   337  N  N   . ARG A 1 52  ? 18.607 34.194 22.251 1.00 41.08  ? 225 ARG A N   1 
ATOM   338  C  CA  . ARG A 1 52  ? 19.213 33.108 21.482 1.00 42.06  ? 225 ARG A CA  1 
ATOM   339  C  C   . ARG A 1 52  ? 19.782 33.589 20.163 1.00 42.43  ? 225 ARG A C   1 
ATOM   340  O  O   . ARG A 1 52  ? 19.153 34.347 19.455 1.00 42.68  ? 225 ARG A O   1 
ATOM   341  C  CB  . ARG A 1 52  ? 18.216 31.973 21.248 1.00 41.81  ? 225 ARG A CB  1 
ATOM   342  C  CG  . ARG A 1 52  ? 18.747 30.897 20.300 1.00 42.21  ? 225 ARG A CG  1 
ATOM   343  C  CD  . ARG A 1 52  ? 18.447 29.476 20.795 1.00 43.35  ? 225 ARG A CD  1 
ATOM   344  N  NE  . ARG A 1 52  ? 17.012 29.159 20.756 1.00 43.25  ? 225 ARG A NE  1 
ATOM   345  C  CZ  . ARG A 1 52  ? 16.465 28.056 21.269 1.00 42.58  ? 225 ARG A CZ  1 
ATOM   346  N  NH1 . ARG A 1 52  ? 17.222 27.128 21.876 1.00 41.35  ? 225 ARG A NH1 1 
ATOM   347  N  NH2 . ARG A 1 52  ? 15.147 27.888 21.175 1.00 43.15  ? 225 ARG A NH2 1 
ATOM   348  N  N   . VAL A 1 53  ? 20.979 33.141 19.829 1.00 43.09  ? 226 VAL A N   1 
ATOM   349  C  CA  . VAL A 1 53  ? 21.604 33.560 18.592 1.00 43.73  ? 226 VAL A CA  1 
ATOM   350  C  C   . VAL A 1 53  ? 21.774 32.357 17.669 1.00 44.59  ? 226 VAL A C   1 
ATOM   351  O  O   . VAL A 1 53  ? 22.307 31.316 18.064 1.00 44.50  ? 226 VAL A O   1 
ATOM   352  C  CB  . VAL A 1 53  ? 22.939 34.317 18.849 1.00 43.50  ? 226 VAL A CB  1 
ATOM   353  C  CG1 . VAL A 1 53  ? 24.065 33.368 19.263 1.00 42.99  ? 226 VAL A CG1 1 
ATOM   354  C  CG2 . VAL A 1 53  ? 23.339 35.118 17.633 1.00 43.63  ? 226 VAL A CG2 1 
ATOM   355  N  N   . GLY A 1 54  ? 21.294 32.510 16.439 1.00 45.71  ? 227 GLY A N   1 
ATOM   356  C  CA  . GLY A 1 54  ? 21.260 31.422 15.458 1.00 47.45  ? 227 GLY A CA  1 
ATOM   357  C  C   . GLY A 1 54  ? 22.560 31.235 14.713 1.00 48.60  ? 227 GLY A C   1 
ATOM   358  O  O   . GLY A 1 54  ? 23.367 32.150 14.627 1.00 48.67  ? 227 GLY A O   1 
ATOM   359  N  N   . ASP A 1 55  ? 22.769 30.037 14.184 1.00 50.02  ? 228 ASP A N   1 
ATOM   360  C  CA  . ASP A 1 55  ? 23.964 29.751 13.388 1.00 51.31  ? 228 ASP A CA  1 
ATOM   361  C  C   . ASP A 1 55  ? 23.731 30.071 11.912 1.00 52.01  ? 228 ASP A C   1 
ATOM   362  O  O   . ASP A 1 55  ? 22.632 30.497 11.521 1.00 51.99  ? 228 ASP A O   1 
ATOM   363  C  CB  . ASP A 1 55  ? 24.411 28.290 13.555 1.00 51.42  ? 228 ASP A CB  1 
ATOM   364  C  CG  . ASP A 1 55  ? 23.388 27.294 13.022 1.00 51.93  ? 228 ASP A CG  1 
ATOM   365  O  OD1 . ASP A 1 55  ? 22.281 27.201 13.606 1.00 52.25  ? 228 ASP A OD1 1 
ATOM   366  O  OD2 . ASP A 1 55  ? 23.699 26.598 12.025 1.00 52.54  ? 228 ASP A OD2 1 
ATOM   367  N  N   . LEU A 1 56  ? 24.775 29.885 11.103 1.00 53.02  ? 229 LEU A N   1 
ATOM   368  C  CA  . LEU A 1 56  ? 24.652 30.036 9.652  1.00 54.04  ? 229 LEU A CA  1 
ATOM   369  C  C   . LEU A 1 56  ? 24.693 28.682 8.968  1.00 54.67  ? 229 LEU A C   1 
ATOM   370  O  O   . LEU A 1 56  ? 25.759 28.049 8.847  1.00 54.82  ? 229 LEU A O   1 
ATOM   371  C  CB  . LEU A 1 56  ? 25.699 30.995 9.063  1.00 54.06  ? 229 LEU A CB  1 
ATOM   372  C  CG  . LEU A 1 56  ? 25.366 32.498 9.114  1.00 54.17  ? 229 LEU A CG  1 
ATOM   373  C  CD1 . LEU A 1 56  ? 26.165 33.231 8.036  1.00 54.33  ? 229 LEU A CD1 1 
ATOM   374  C  CD2 . LEU A 1 56  ? 23.858 32.811 8.983  1.00 53.84  ? 229 LEU A CD2 1 
ATOM   375  N  N   . ARG A 1 57  ? 23.508 28.267 8.516  1.00 55.43  ? 230 ARG A N   1 
ATOM   376  C  CA  . ARG A 1 57  ? 23.269 26.913 8.023  1.00 56.16  ? 230 ARG A CA  1 
ATOM   377  C  C   . ARG A 1 57  ? 24.366 26.365 7.073  1.00 56.12  ? 230 ARG A C   1 
ATOM   378  O  O   . ARG A 1 57  ? 24.610 25.139 7.030  1.00 56.15  ? 230 ARG A O   1 
ATOM   379  C  CB  . ARG A 1 57  ? 21.854 26.793 7.406  1.00 56.37  ? 230 ARG A CB  1 
ATOM   380  C  CG  . ARG A 1 57  ? 21.331 25.357 7.421  1.00 57.84  ? 230 ARG A CG  1 
ATOM   381  C  CD  . ARG A 1 57  ? 20.056 25.107 6.596  1.00 60.08  ? 230 ARG A CD  1 
ATOM   382  N  NE  . ARG A 1 57  ? 20.272 23.981 5.657  1.00 62.01  ? 230 ARG A NE  1 
ATOM   383  C  CZ  . ARG A 1 57  ? 20.481 22.696 5.996  1.00 62.60  ? 230 ARG A CZ  1 
ATOM   384  N  NH1 . ARG A 1 57  ? 20.495 22.319 7.278  1.00 62.54  ? 230 ARG A NH1 1 
ATOM   385  N  NH2 . ARG A 1 57  ? 20.678 21.769 5.042  1.00 62.70  ? 230 ARG A NH2 1 
ATOM   386  N  N   . ASN A 1 58  ? 25.047 27.262 6.347  1.00 56.12  ? 231 ASN A N   1 
ATOM   387  C  CA  . ASN A 1 58  ? 25.972 26.803 5.313  1.00 56.15  ? 231 ASN A CA  1 
ATOM   388  C  C   . ASN A 1 58  ? 27.401 27.314 5.375  1.00 55.89  ? 231 ASN A C   1 
ATOM   389  O  O   . ASN A 1 58  ? 28.166 27.151 4.414  1.00 55.70  ? 231 ASN A O   1 
ATOM   390  C  CB  . ASN A 1 58  ? 25.354 26.980 3.922  1.00 56.30  ? 231 ASN A CB  1 
ATOM   391  C  CG  . ASN A 1 58  ? 24.264 25.952 3.649  1.00 56.60  ? 231 ASN A CG  1 
ATOM   392  O  OD1 . ASN A 1 58  ? 23.081 26.299 3.522  1.00 57.09  ? 231 ASN A OD1 1 
ATOM   393  N  ND2 . ASN A 1 58  ? 24.654 24.669 3.594  1.00 56.41  ? 231 ASN A ND2 1 
ATOM   394  N  N   . SER A 1 59  ? 27.755 27.919 6.511  1.00 55.67  ? 232 SER A N   1 
ATOM   395  C  CA  . SER A 1 59  ? 29.154 28.282 6.791  1.00 55.55  ? 232 SER A CA  1 
ATOM   396  C  C   . SER A 1 59  ? 29.429 28.600 8.269  1.00 55.14  ? 232 SER A C   1 
ATOM   397  O  O   . SER A 1 59  ? 28.528 29.007 9.026  1.00 54.97  ? 232 SER A O   1 
ATOM   398  C  CB  . SER A 1 59  ? 29.659 29.428 5.880  1.00 55.66  ? 232 SER A CB  1 
ATOM   399  O  OG  . SER A 1 59  ? 29.107 30.692 6.236  1.00 56.32  ? 232 SER A OG  1 
ATOM   400  N  N   . HIS A 1 60  ? 30.687 28.395 8.658  1.00 54.69  ? 233 HIS A N   1 
ATOM   401  C  CA  . HIS A 1 60  ? 31.157 28.765 9.976  1.00 54.37  ? 233 HIS A CA  1 
ATOM   402  C  C   . HIS A 1 60  ? 31.427 30.247 10.005 1.00 53.79  ? 233 HIS A C   1 
ATOM   403  O  O   . HIS A 1 60  ? 31.637 30.885 8.962  1.00 53.72  ? 233 HIS A O   1 
ATOM   404  C  CB  . HIS A 1 60  ? 32.447 28.032 10.324 1.00 54.68  ? 233 HIS A CB  1 
ATOM   405  C  CG  . HIS A 1 60  ? 32.259 26.569 10.561 1.00 56.14  ? 233 HIS A CG  1 
ATOM   406  N  ND1 . HIS A 1 60  ? 31.704 26.071 11.720 1.00 57.11  ? 233 HIS A ND1 1 
ATOM   407  C  CD2 . HIS A 1 60  ? 32.543 25.490 9.786  1.00 57.10  ? 233 HIS A CD2 1 
ATOM   408  C  CE1 . HIS A 1 60  ? 31.656 24.749 11.651 1.00 57.74  ? 233 HIS A CE1 1 
ATOM   409  N  NE2 . HIS A 1 60  ? 32.159 24.371 10.488 1.00 57.72  ? 233 HIS A NE2 1 
ATOM   410  N  N   . ILE A 1 61  ? 31.410 30.781 11.220 1.00 52.95  ? 234 ILE A N   1 
ATOM   411  C  CA  . ILE A 1 61  ? 31.813 32.146 11.495 1.00 52.05  ? 234 ILE A CA  1 
ATOM   412  C  C   . ILE A 1 61  ? 33.014 32.034 12.418 1.00 51.60  ? 234 ILE A C   1 
ATOM   413  O  O   . ILE A 1 61  ? 32.941 31.406 13.469 1.00 51.60  ? 234 ILE A O   1 
ATOM   414  C  CB  . ILE A 1 61  ? 30.694 32.924 12.195 1.00 52.02  ? 234 ILE A CB  1 
ATOM   415  C  CG1 . ILE A 1 61  ? 29.385 32.783 11.412 1.00 51.54  ? 234 ILE A CG1 1 
ATOM   416  C  CG2 . ILE A 1 61  ? 31.075 34.386 12.339 1.00 52.03  ? 234 ILE A CG2 1 
ATOM   417  C  CD1 . ILE A 1 61  ? 28.183 32.580 12.294 1.00 50.78  ? 234 ILE A CD1 1 
ATOM   418  N  N   . VAL A 1 62  ? 34.126 32.630 12.016 1.00 51.04  ? 235 VAL A N   1 
ATOM   419  C  CA  . VAL A 1 62  ? 35.377 32.500 12.754 1.00 50.38  ? 235 VAL A CA  1 
ATOM   420  C  C   . VAL A 1 62  ? 35.663 33.774 13.543 1.00 50.00  ? 235 VAL A C   1 
ATOM   421  O  O   . VAL A 1 62  ? 35.127 34.834 13.229 1.00 49.95  ? 235 VAL A O   1 
ATOM   422  C  CB  . VAL A 1 62  ? 36.539 32.179 11.794 1.00 50.35  ? 235 VAL A CB  1 
ATOM   423  C  CG1 . VAL A 1 62  ? 37.765 31.735 12.572 1.00 50.30  ? 235 VAL A CG1 1 
ATOM   424  C  CG2 . VAL A 1 62  ? 36.117 31.091 10.792 1.00 50.18  ? 235 VAL A CG2 1 
ATOM   425  N  N   . GLU A 1 63  ? 36.499 33.660 14.573 1.00 49.66  ? 236 GLU A N   1 
ATOM   426  C  CA  . GLU A 1 63  ? 36.797 34.779 15.461 1.00 49.40  ? 236 GLU A CA  1 
ATOM   427  C  C   . GLU A 1 63  ? 35.458 35.422 15.848 1.00 48.93  ? 236 GLU A C   1 
ATOM   428  O  O   . GLU A 1 63  ? 35.352 36.645 15.967 1.00 49.11  ? 236 GLU A O   1 
ATOM   429  C  CB  . GLU A 1 63  ? 37.766 35.774 14.778 1.00 49.60  ? 236 GLU A CB  1 
ATOM   430  C  CG  . GLU A 1 63  ? 38.761 36.542 15.709 1.00 50.38  ? 236 GLU A CG  1 
ATOM   431  C  CD  . GLU A 1 63  ? 39.631 37.604 14.962 1.00 51.33  ? 236 GLU A CD  1 
ATOM   432  O  OE1 . GLU A 1 63  ? 40.362 37.227 14.015 1.00 51.18  ? 236 GLU A OE1 1 
ATOM   433  O  OE2 . GLU A 1 63  ? 39.598 38.814 15.324 1.00 50.77  ? 236 GLU A OE2 1 
ATOM   434  N  N   . ALA A 1 64  ? 34.441 34.571 16.034 1.00 48.24  ? 237 ALA A N   1 
ATOM   435  C  CA  . ALA A 1 64  ? 33.062 35.004 16.317 1.00 47.62  ? 237 ALA A CA  1 
ATOM   436  C  C   . ALA A 1 64  ? 32.842 35.395 17.784 1.00 47.24  ? 237 ALA A C   1 
ATOM   437  O  O   . ALA A 1 64  ? 33.254 34.669 18.696 1.00 47.17  ? 237 ALA A O   1 
ATOM   438  C  CB  . ALA A 1 64  ? 32.073 33.931 15.900 1.00 47.46  ? 237 ALA A CB  1 
ATOM   439  N  N   . SER A 1 65  ? 32.189 36.540 17.998 1.00 46.56  ? 238 SER A N   1 
ATOM   440  C  CA  . SER A 1 65  ? 31.989 37.085 19.341 1.00 45.97  ? 238 SER A CA  1 
ATOM   441  C  C   . SER A 1 65  ? 30.636 37.792 19.507 1.00 45.61  ? 238 SER A C   1 
ATOM   442  O  O   . SER A 1 65  ? 30.133 38.408 18.571 1.00 45.67  ? 238 SER A O   1 
ATOM   443  C  CB  . SER A 1 65  ? 33.123 38.048 19.689 1.00 45.91  ? 238 SER A CB  1 
ATOM   444  O  OG  . SER A 1 65  ? 32.754 39.380 19.388 1.00 46.00  ? 238 SER A OG  1 
ATOM   445  N  N   . ILE A 1 66  ? 30.062 37.695 20.706 1.00 45.00  ? 239 ILE A N   1 
ATOM   446  C  CA  . ILE A 1 66  ? 28.827 38.399 21.058 1.00 43.83  ? 239 ILE A CA  1 
ATOM   447  C  C   . ILE A 1 66  ? 29.086 39.502 22.101 1.00 43.60  ? 239 ILE A C   1 
ATOM   448  O  O   . ILE A 1 66  ? 29.959 39.385 22.960 1.00 43.53  ? 239 ILE A O   1 
ATOM   449  C  CB  . ILE A 1 66  ? 27.703 37.422 21.515 1.00 43.33  ? 239 ILE A CB  1 
ATOM   450  C  CG1 . ILE A 1 66  ? 26.387 38.147 21.742 1.00 42.64  ? 239 ILE A CG1 1 
ATOM   451  C  CG2 . ILE A 1 66  ? 28.061 36.740 22.789 1.00 43.24  ? 239 ILE A CG2 1 
ATOM   452  C  CD1 . ILE A 1 66  ? 25.779 38.715 20.509 1.00 42.28  ? 239 ILE A CD1 1 
ATOM   453  N  N   . ARG A 1 67  ? 28.333 40.591 21.983 1.00 43.28  ? 240 ARG A N   1 
ATOM   454  C  CA  . ARG A 1 67  ? 28.396 41.727 22.895 1.00 42.82  ? 240 ARG A CA  1 
ATOM   455  C  C   . ARG A 1 67  ? 27.004 42.327 22.913 1.00 42.46  ? 240 ARG A C   1 
ATOM   456  O  O   . ARG A 1 67  ? 26.235 42.108 21.978 1.00 42.46  ? 240 ARG A O   1 
ATOM   457  C  CB  . ARG A 1 67  ? 29.424 42.747 22.409 1.00 42.94  ? 240 ARG A CB  1 
ATOM   458  C  CG  . ARG A 1 67  ? 29.691 42.714 20.887 1.00 43.66  ? 240 ARG A CG  1 
ATOM   459  C  CD  . ARG A 1 67  ? 30.973 43.474 20.475 1.00 44.05  ? 240 ARG A CD  1 
ATOM   460  N  NE  . ARG A 1 67  ? 30.835 44.931 20.638 1.00 44.58  ? 240 ARG A NE  1 
ATOM   461  C  CZ  . ARG A 1 67  ? 31.008 45.834 19.672 1.00 44.30  ? 240 ARG A CZ  1 
ATOM   462  N  NH1 . ARG A 1 67  ? 31.347 45.462 18.441 1.00 44.21  ? 240 ARG A NH1 1 
ATOM   463  N  NH2 . ARG A 1 67  ? 30.854 47.126 19.943 1.00 44.63  ? 240 ARG A NH2 1 
ATOM   464  N  N   . ALA A 1 68  ? 26.655 43.047 23.975 1.00 42.11  ? 241 ALA A N   1 
ATOM   465  C  CA  . ALA A 1 68  ? 25.318 43.651 24.072 1.00 41.73  ? 241 ALA A CA  1 
ATOM   466  C  C   . ALA A 1 68  ? 25.390 45.023 24.694 1.00 41.53  ? 241 ALA A C   1 
ATOM   467  O  O   . ALA A 1 68  ? 26.160 45.245 25.622 1.00 41.62  ? 241 ALA A O   1 
ATOM   468  C  CB  . ALA A 1 68  ? 24.364 42.768 24.862 1.00 41.64  ? 241 ALA A CB  1 
ATOM   469  N  N   . LYS A 1 69  ? 24.584 45.943 24.176 1.00 41.34  ? 242 LYS A N   1 
ATOM   470  C  CA  . LYS A 1 69  ? 24.533 47.302 24.700 1.00 41.17  ? 242 LYS A CA  1 
ATOM   471  C  C   . LYS A 1 69  ? 23.174 47.646 25.303 1.00 41.22  ? 242 LYS A C   1 
ATOM   472  O  O   . LYS A 1 69  ? 22.124 47.363 24.717 1.00 41.28  ? 242 LYS A O   1 
ATOM   473  C  CB  . LYS A 1 69  ? 24.853 48.308 23.596 1.00 41.05  ? 242 LYS A CB  1 
ATOM   474  C  CG  . LYS A 1 69  ? 26.249 48.232 23.051 1.00 40.84  ? 242 LYS A CG  1 
ATOM   475  C  CD  . LYS A 1 69  ? 27.273 48.515 24.123 1.00 41.41  ? 242 LYS A CD  1 
ATOM   476  C  CE  . LYS A 1 69  ? 28.611 48.872 23.482 1.00 41.92  ? 242 LYS A CE  1 
ATOM   477  N  NZ  . LYS A 1 69  ? 29.714 48.739 24.482 1.00 42.51  ? 242 LYS A NZ  1 
ATOM   478  N  N   . LEU A 1 70  ? 23.187 48.261 26.477 1.00 41.26  ? 243 LEU A N   1 
ATOM   479  C  CA  . LEU A 1 70  ? 21.960 48.812 27.010 1.00 41.51  ? 243 LEU A CA  1 
ATOM   480  C  C   . LEU A 1 70  ? 21.837 50.249 26.552 1.00 41.96  ? 243 LEU A C   1 
ATOM   481  O  O   . LEU A 1 70  ? 22.659 51.089 26.905 1.00 42.09  ? 243 LEU A O   1 
ATOM   482  C  CB  . LEU A 1 70  ? 21.914 48.749 28.537 1.00 41.27  ? 243 LEU A CB  1 
ATOM   483  C  CG  . LEU A 1 70  ? 20.571 49.227 29.097 1.00 40.57  ? 243 LEU A CG  1 
ATOM   484  C  CD1 . LEU A 1 70  ? 19.497 48.162 28.943 1.00 40.34  ? 243 LEU A CD1 1 
ATOM   485  C  CD2 . LEU A 1 70  ? 20.708 49.641 30.534 1.00 39.91  ? 243 LEU A CD2 1 
ATOM   486  N  N   . ILE A 1 71  ? 20.814 50.526 25.753 1.00 42.47  ? 244 ILE A N   1 
ATOM   487  C  CA  . ILE A 1 71  ? 20.487 51.899 25.404 1.00 42.46  ? 244 ILE A CA  1 
ATOM   488  C  C   . ILE A 1 71  ? 19.440 52.398 26.396 1.00 42.56  ? 244 ILE A C   1 
ATOM   489  O  O   . ILE A 1 71  ? 18.337 51.844 26.476 1.00 42.51  ? 244 ILE A O   1 
ATOM   490  C  CB  . ILE A 1 71  ? 19.917 52.017 23.983 1.00 42.30  ? 244 ILE A CB  1 
ATOM   491  C  CG1 . ILE A 1 71  ? 20.611 51.057 23.011 1.00 42.15  ? 244 ILE A CG1 1 
ATOM   492  C  CG2 . ILE A 1 71  ? 20.065 53.431 23.498 1.00 42.29  ? 244 ILE A CG2 1 
ATOM   493  C  CD1 . ILE A 1 71  ? 21.999 51.481 22.643 1.00 42.33  ? 244 ILE A CD1 1 
ATOM   494  N  N   . LYS A 1 72  ? 19.786 53.426 27.162 1.00 42.67  ? 245 LYS A N   1 
ATOM   495  C  CA  . LYS A 1 72  ? 18.868 53.970 28.158 1.00 42.83  ? 245 LYS A CA  1 
ATOM   496  C  C   . LYS A 1 72  ? 19.212 55.414 28.456 1.00 42.52  ? 245 LYS A C   1 
ATOM   497  O  O   . LYS A 1 72  ? 20.311 55.697 28.954 1.00 42.53  ? 245 LYS A O   1 
ATOM   498  C  CB  . LYS A 1 72  ? 18.914 53.143 29.450 1.00 43.17  ? 245 LYS A CB  1 
ATOM   499  C  CG  . LYS A 1 72  ? 18.043 53.678 30.580 1.00 44.36  ? 245 LYS A CG  1 
ATOM   500  C  CD  . LYS A 1 72  ? 17.721 52.580 31.600 1.00 46.89  ? 245 LYS A CD  1 
ATOM   501  C  CE  . LYS A 1 72  ? 17.353 53.166 32.982 1.00 48.24  ? 245 LYS A CE  1 
ATOM   502  N  NZ  . LYS A 1 72  ? 16.866 52.137 33.978 1.00 48.15  ? 245 LYS A NZ  1 
ATOM   503  N  N   . SER A 1 73  ? 18.274 56.314 28.140 1.00 42.01  ? 246 SER A N   1 
ATOM   504  C  CA  . SER A 1 73  ? 18.402 57.741 28.440 1.00 41.12  ? 246 SER A CA  1 
ATOM   505  C  C   . SER A 1 73  ? 18.488 57.930 29.936 1.00 40.69  ? 246 SER A C   1 
ATOM   506  O  O   . SER A 1 73  ? 17.704 57.332 30.681 1.00 40.61  ? 246 SER A O   1 
ATOM   507  C  CB  . SER A 1 73  ? 17.204 58.511 27.904 1.00 41.08  ? 246 SER A CB  1 
ATOM   508  O  OG  . SER A 1 73  ? 17.161 58.432 26.496 1.00 40.66  ? 246 SER A OG  1 
ATOM   509  N  N   . LYS A 1 74  ? 19.438 58.746 30.384 1.00 40.24  ? 247 LYS A N   1 
ATOM   510  C  CA  . LYS A 1 74  ? 19.690 58.848 31.814 1.00 40.08  ? 247 LYS A CA  1 
ATOM   511  C  C   . LYS A 1 74  ? 20.099 60.217 32.270 1.00 39.92  ? 247 LYS A C   1 
ATOM   512  O  O   . LYS A 1 74  ? 20.595 61.028 31.489 1.00 40.00  ? 247 LYS A O   1 
ATOM   513  C  CB  . LYS A 1 74  ? 20.757 57.848 32.251 1.00 40.27  ? 247 LYS A CB  1 
ATOM   514  C  CG  . LYS A 1 74  ? 22.181 58.354 32.160 1.00 40.41  ? 247 LYS A CG  1 
ATOM   515  C  CD  . LYS A 1 74  ? 23.057 57.546 33.081 1.00 42.77  ? 247 LYS A CD  1 
ATOM   516  C  CE  . LYS A 1 74  ? 23.972 58.446 33.875 1.00 43.02  ? 247 LYS A CE  1 
ATOM   517  N  NZ  . LYS A 1 74  ? 24.185 57.906 35.245 1.00 43.58  ? 247 LYS A NZ  1 
ATOM   518  N  N   . GLN A 1 75  ? 19.905 60.455 33.560 1.00 39.50  ? 248 GLN A N   1 
ATOM   519  C  CA  . GLN A 1 75  ? 20.292 61.714 34.158 1.00 38.91  ? 248 GLN A CA  1 
ATOM   520  C  C   . GLN A 1 75  ? 21.358 61.496 35.212 1.00 38.30  ? 248 GLN A C   1 
ATOM   521  O  O   . GLN A 1 75  ? 21.215 60.643 36.074 1.00 38.39  ? 248 GLN A O   1 
ATOM   522  C  CB  . GLN A 1 75  ? 19.079 62.422 34.759 1.00 38.93  ? 248 GLN A CB  1 
ATOM   523  C  CG  . GLN A 1 75  ? 19.304 63.913 34.985 1.00 39.60  ? 248 GLN A CG  1 
ATOM   524  C  CD  . GLN A 1 75  ? 18.017 64.701 34.944 1.00 40.18  ? 248 GLN A CD  1 
ATOM   525  O  OE1 . GLN A 1 75  ? 17.984 65.847 34.470 1.00 40.30  ? 248 GLN A OE1 1 
ATOM   526  N  NE2 . GLN A 1 75  ? 16.936 64.085 35.429 1.00 40.40  ? 248 GLN A NE2 1 
ATOM   527  N  N   . THR A 1 76  ? 22.433 62.265 35.128 1.00 37.43  ? 249 THR A N   1 
ATOM   528  C  CA  . THR A 1 76  ? 23.498 62.165 36.100 1.00 36.59  ? 249 THR A CA  1 
ATOM   529  C  C   . THR A 1 76  ? 23.110 62.976 37.329 1.00 36.46  ? 249 THR A C   1 
ATOM   530  O  O   . THR A 1 76  ? 22.330 63.919 37.227 1.00 36.29  ? 249 THR A O   1 
ATOM   531  C  CB  . THR A 1 76  ? 24.861 62.611 35.506 1.00 36.42  ? 249 THR A CB  1 
ATOM   532  O  OG1 . THR A 1 76  ? 25.019 64.031 35.609 1.00 35.71  ? 249 THR A OG1 1 
ATOM   533  C  CG2 . THR A 1 76  ? 24.974 62.202 34.044 1.00 36.08  ? 249 THR A CG2 1 
ATOM   534  N  N   . SER A 1 77  ? 23.636 62.595 38.488 1.00 36.29  ? 250 SER A N   1 
ATOM   535  C  CA  . SER A 1 77  ? 23.354 63.283 39.753 1.00 36.08  ? 250 SER A CA  1 
ATOM   536  C  C   . SER A 1 77  ? 23.657 64.781 39.724 1.00 35.75  ? 250 SER A C   1 
ATOM   537  O  O   . SER A 1 77  ? 23.305 65.507 40.648 1.00 35.62  ? 250 SER A O   1 
ATOM   538  C  CB  . SER A 1 77  ? 24.150 62.634 40.892 1.00 36.54  ? 250 SER A CB  1 
ATOM   539  O  OG  . SER A 1 77  ? 25.537 62.594 40.582 1.00 37.03  ? 250 SER A OG  1 
ATOM   540  N  N   . GLU A 1 78  ? 24.333 65.232 38.674 1.00 35.56  ? 251 GLU A N   1 
ATOM   541  C  CA  . GLU A 1 78  ? 24.622 66.647 38.503 1.00 35.37  ? 251 GLU A CA  1 
ATOM   542  C  C   . GLU A 1 78  ? 23.728 67.214 37.418 1.00 35.51  ? 251 GLU A C   1 
ATOM   543  O  O   . GLU A 1 78  ? 24.074 68.208 36.763 1.00 35.26  ? 251 GLU A O   1 
ATOM   544  C  CB  . GLU A 1 78  ? 26.086 66.864 38.131 1.00 35.22  ? 251 GLU A CB  1 
ATOM   545  C  CG  . GLU A 1 78  ? 27.064 66.341 39.151 1.00 35.25  ? 251 GLU A CG  1 
ATOM   546  C  CD  . GLU A 1 78  ? 27.498 64.926 38.867 1.00 35.30  ? 251 GLU A CD  1 
ATOM   547  O  OE1 . GLU A 1 78  ? 27.054 64.340 37.830 1.00 34.70  ? 251 GLU A OE1 1 
ATOM   548  O  OE2 . GLU A 1 78  ? 28.297 64.415 39.695 1.00 35.46  ? 251 GLU A OE2 1 
ATOM   549  N  N   . GLY A 1 79  ? 22.585 66.556 37.223 1.00 35.90  ? 252 GLY A N   1 
ATOM   550  C  CA  . GLY A 1 79  ? 21.547 67.043 36.328 1.00 36.60  ? 252 GLY A CA  1 
ATOM   551  C  C   . GLY A 1 79  ? 21.843 66.963 34.843 1.00 37.05  ? 252 GLY A C   1 
ATOM   552  O  O   . GLY A 1 79  ? 21.075 67.504 34.045 1.00 37.10  ? 252 GLY A O   1 
ATOM   553  N  N   . GLU A 1 80  ? 22.948 66.310 34.461 1.00 37.62  ? 253 GLU A N   1 
ATOM   554  C  CA  . GLU A 1 80  ? 23.258 66.094 33.035 1.00 38.22  ? 253 GLU A CA  1 
ATOM   555  C  C   . GLU A 1 80  ? 22.413 64.956 32.472 1.00 38.69  ? 253 GLU A C   1 
ATOM   556  O  O   . GLU A 1 80  ? 22.453 63.828 32.969 1.00 38.74  ? 253 GLU A O   1 
ATOM   557  C  CB  . GLU A 1 80  ? 24.748 65.802 32.804 1.00 38.01  ? 253 GLU A CB  1 
ATOM   558  C  CG  . GLU A 1 80  ? 25.139 65.664 31.307 1.00 39.04  ? 253 GLU A CG  1 
ATOM   559  C  CD  . GLU A 1 80  ? 26.607 65.232 31.089 1.00 41.06  ? 253 GLU A CD  1 
ATOM   560  O  OE1 . GLU A 1 80  ? 27.263 64.848 32.087 1.00 41.77  ? 253 GLU A OE1 1 
ATOM   561  O  OE2 . GLU A 1 80  ? 27.103 65.272 29.928 1.00 41.79  ? 253 GLU A OE2 1 
ATOM   562  N  N   . PHE A 1 81  ? 21.649 65.259 31.434 1.00 39.47  ? 254 PHE A N   1 
ATOM   563  C  CA  . PHE A 1 81  ? 20.800 64.267 30.816 1.00 39.97  ? 254 PHE A CA  1 
ATOM   564  C  C   . PHE A 1 81  ? 21.484 63.658 29.576 1.00 39.77  ? 254 PHE A C   1 
ATOM   565  O  O   . PHE A 1 81  ? 21.863 64.382 28.653 1.00 39.88  ? 254 PHE A O   1 
ATOM   566  C  CB  . PHE A 1 81  ? 19.432 64.880 30.483 1.00 40.28  ? 254 PHE A CB  1 
ATOM   567  C  CG  . PHE A 1 81  ? 18.556 63.984 29.663 1.00 42.15  ? 254 PHE A CG  1 
ATOM   568  C  CD1 . PHE A 1 81  ? 17.941 62.858 30.251 1.00 43.72  ? 254 PHE A CD1 1 
ATOM   569  C  CD2 . PHE A 1 81  ? 18.357 64.243 28.302 1.00 43.57  ? 254 PHE A CD2 1 
ATOM   570  C  CE1 . PHE A 1 81  ? 17.134 62.001 29.496 1.00 44.51  ? 254 PHE A CE1 1 
ATOM   571  C  CE2 . PHE A 1 81  ? 17.553 63.397 27.539 1.00 44.64  ? 254 PHE A CE2 1 
ATOM   572  C  CZ  . PHE A 1 81  ? 16.940 62.272 28.140 1.00 45.28  ? 254 PHE A CZ  1 
ATOM   573  N  N   . ILE A 1 82  ? 21.653 62.333 29.574 1.00 39.53  ? 255 ILE A N   1 
ATOM   574  C  CA  . ILE A 1 82  ? 22.224 61.613 28.434 1.00 39.41  ? 255 ILE A CA  1 
ATOM   575  C  C   . ILE A 1 82  ? 21.138 60.830 27.713 1.00 39.53  ? 255 ILE A C   1 
ATOM   576  O  O   . ILE A 1 82  ? 20.776 59.738 28.142 1.00 39.90  ? 255 ILE A O   1 
ATOM   577  C  CB  . ILE A 1 82  ? 23.285 60.578 28.873 1.00 39.39  ? 255 ILE A CB  1 
ATOM   578  C  CG1 . ILE A 1 82  ? 24.132 61.088 30.053 1.00 39.70  ? 255 ILE A CG1 1 
ATOM   579  C  CG2 . ILE A 1 82  ? 24.109 60.130 27.669 1.00 39.34  ? 255 ILE A CG2 1 
ATOM   580  C  CD1 . ILE A 1 82  ? 25.183 62.104 29.689 1.00 40.52  ? 255 ILE A CD1 1 
ATOM   581  N  N   . PRO A 1 83  ? 20.608 61.380 26.618 1.00 39.38  ? 256 PRO A N   1 
ATOM   582  C  CA  . PRO A 1 83  ? 19.638 60.638 25.827 1.00 39.38  ? 256 PRO A CA  1 
ATOM   583  C  C   . PRO A 1 83  ? 20.245 59.336 25.322 1.00 39.45  ? 256 PRO A C   1 
ATOM   584  O  O   . PRO A 1 83  ? 21.393 59.329 24.874 1.00 39.17  ? 256 PRO A O   1 
ATOM   585  C  CB  . PRO A 1 83  ? 19.371 61.570 24.640 1.00 39.30  ? 256 PRO A CB  1 
ATOM   586  C  CG  . PRO A 1 83  ? 20.538 62.500 24.596 1.00 39.02  ? 256 PRO A CG  1 
ATOM   587  C  CD  . PRO A 1 83  ? 20.919 62.689 26.026 1.00 39.34  ? 256 PRO A CD  1 
ATOM   588  N  N   . LEU A 1 84  ? 19.499 58.240 25.416 1.00 39.73  ? 257 LEU A N   1 
ATOM   589  C  CA  . LEU A 1 84  ? 19.947 56.955 24.877 1.00 40.28  ? 257 LEU A CA  1 
ATOM   590  C  C   . LEU A 1 84  ? 21.387 56.560 25.238 1.00 40.29  ? 257 LEU A C   1 
ATOM   591  O  O   . LEU A 1 84  ? 22.136 56.073 24.394 1.00 40.01  ? 257 LEU A O   1 
ATOM   592  C  CB  . LEU A 1 84  ? 19.789 56.955 23.358 1.00 40.58  ? 257 LEU A CB  1 
ATOM   593  C  CG  . LEU A 1 84  ? 18.458 56.513 22.762 1.00 41.31  ? 257 LEU A CG  1 
ATOM   594  C  CD1 . LEU A 1 84  ? 17.287 57.304 23.306 1.00 42.98  ? 257 LEU A CD1 1 
ATOM   595  C  CD2 . LEU A 1 84  ? 18.531 56.599 21.246 1.00 42.74  ? 257 LEU A CD2 1 
ATOM   596  N  N   . ASN A 1 85  ? 21.771 56.777 26.490 1.00 40.64  ? 258 ASN A N   1 
ATOM   597  C  CA  . ASN A 1 85  ? 23.081 56.381 26.973 1.00 41.06  ? 258 ASN A CA  1 
ATOM   598  C  C   . ASN A 1 85  ? 23.289 54.894 26.723 1.00 41.62  ? 258 ASN A C   1 
ATOM   599  O  O   . ASN A 1 85  ? 22.357 54.101 26.885 1.00 41.80  ? 258 ASN A O   1 
ATOM   600  C  CB  . ASN A 1 85  ? 23.193 56.675 28.466 1.00 40.98  ? 258 ASN A CB  1 
ATOM   601  C  CG  . ASN A 1 85  ? 24.604 56.573 28.967 1.00 40.50  ? 258 ASN A CG  1 
ATOM   602  O  OD1 . ASN A 1 85  ? 25.520 57.114 28.361 1.00 39.86  ? 258 ASN A OD1 1 
ATOM   603  N  ND2 . ASN A 1 85  ? 24.796 55.879 30.084 1.00 40.18  ? 258 ASN A ND2 1 
ATOM   604  N  N   . GLN A 1 86  ? 24.499 54.524 26.307 1.00 42.02  ? 259 GLN A N   1 
ATOM   605  C  CA  . GLN A 1 86  ? 24.880 53.118 26.114 1.00 42.39  ? 259 GLN A CA  1 
ATOM   606  C  C   . GLN A 1 86  ? 25.694 52.613 27.303 1.00 42.89  ? 259 GLN A C   1 
ATOM   607  O  O   . GLN A 1 86  ? 26.496 53.352 27.855 1.00 43.16  ? 259 GLN A O   1 
ATOM   608  C  CB  . GLN A 1 86  ? 25.764 52.971 24.882 1.00 42.21  ? 259 GLN A CB  1 
ATOM   609  C  CG  . GLN A 1 86  ? 25.117 53.197 23.544 1.00 42.48  ? 259 GLN A CG  1 
ATOM   610  C  CD  . GLN A 1 86  ? 26.058 52.839 22.404 1.00 42.67  ? 259 GLN A CD  1 
ATOM   611  O  OE1 . GLN A 1 86  ? 26.140 53.553 21.410 1.00 43.42  ? 259 GLN A OE1 1 
ATOM   612  N  NE2 . GLN A 1 86  ? 26.787 51.731 22.550 1.00 42.17  ? 259 GLN A NE2 1 
ATOM   613  N  N   . THR A 1 87  ? 25.507 51.361 27.696 1.00 43.54  ? 260 THR A N   1 
ATOM   614  C  CA  . THR A 1 87  ? 26.423 50.720 28.643 1.00 44.07  ? 260 THR A CA  1 
ATOM   615  C  C   . THR A 1 87  ? 26.478 49.232 28.363 1.00 44.45  ? 260 THR A C   1 
ATOM   616  O  O   . THR A 1 87  ? 25.470 48.624 27.991 1.00 44.61  ? 260 THR A O   1 
ATOM   617  C  CB  . THR A 1 87  ? 26.029 50.918 30.117 1.00 43.93  ? 260 THR A CB  1 
ATOM   618  O  OG1 . THR A 1 87  ? 24.643 50.597 30.289 1.00 44.49  ? 260 THR A OG1 1 
ATOM   619  C  CG2 . THR A 1 87  ? 26.306 52.350 30.583 1.00 43.78  ? 260 THR A CG2 1 
ATOM   620  N  N   . ASP A 1 88  ? 27.661 48.646 28.549 1.00 44.88  ? 261 ASP A N   1 
ATOM   621  C  CA  . ASP A 1 88  ? 27.891 47.241 28.209 1.00 45.00  ? 261 ASP A CA  1 
ATOM   622  C  C   . ASP A 1 88  ? 27.138 46.309 29.158 1.00 44.84  ? 261 ASP A C   1 
ATOM   623  O  O   . ASP A 1 88  ? 27.164 46.501 30.366 1.00 44.82  ? 261 ASP A O   1 
ATOM   624  C  CB  . ASP A 1 88  ? 29.399 46.918 28.197 1.00 45.06  ? 261 ASP A CB  1 
ATOM   625  C  CG  . ASP A 1 88  ? 29.820 46.104 26.970 1.00 45.25  ? 261 ASP A CG  1 
ATOM   626  O  OD1 . ASP A 1 88  ? 30.364 46.712 26.023 1.00 45.52  ? 261 ASP A OD1 1 
ATOM   627  O  OD2 . ASP A 1 88  ? 29.595 44.866 26.936 1.00 45.69  ? 261 ASP A OD2 1 
ATOM   628  N  N   . ILE A 1 89  ? 26.441 45.333 28.581 1.00 44.88  ? 262 ILE A N   1 
ATOM   629  C  CA  . ILE A 1 89  ? 25.848 44.211 29.309 1.00 44.91  ? 262 ILE A CA  1 
ATOM   630  C  C   . ILE A 1 89  ? 26.864 43.068 29.326 1.00 45.34  ? 262 ILE A C   1 
ATOM   631  O  O   . ILE A 1 89  ? 27.440 42.743 28.282 1.00 45.84  ? 262 ILE A O   1 
ATOM   632  C  CB  . ILE A 1 89  ? 24.587 43.707 28.594 1.00 44.56  ? 262 ILE A CB  1 
ATOM   633  C  CG1 . ILE A 1 89  ? 23.490 44.759 28.675 1.00 44.48  ? 262 ILE A CG1 1 
ATOM   634  C  CG2 . ILE A 1 89  ? 24.092 42.427 29.206 1.00 44.25  ? 262 ILE A CG2 1 
ATOM   635  C  CD1 . ILE A 1 89  ? 22.236 44.334 27.997 1.00 44.38  ? 262 ILE A CD1 1 
ATOM   636  N  N   . ASN A 1 90  ? 27.107 42.459 30.485 1.00 45.43  ? 263 ASN A N   1 
ATOM   637  C  CA  . ASN A 1 90  ? 28.081 41.373 30.541 1.00 45.54  ? 263 ASN A CA  1 
ATOM   638  C  C   . ASN A 1 90  ? 27.521 40.112 29.919 1.00 45.52  ? 263 ASN A C   1 
ATOM   639  O  O   . ASN A 1 90  ? 26.505 39.606 30.366 1.00 45.64  ? 263 ASN A O   1 
ATOM   640  C  CB  . ASN A 1 90  ? 28.538 41.088 31.976 1.00 45.65  ? 263 ASN A CB  1 
ATOM   641  C  CG  . ASN A 1 90  ? 29.728 40.121 32.034 1.00 46.19  ? 263 ASN A CG  1 
ATOM   642  O  OD1 . ASN A 1 90  ? 30.022 39.413 31.061 1.00 47.31  ? 263 ASN A OD1 1 
ATOM   643  N  ND2 . ASN A 1 90  ? 30.417 40.094 33.174 1.00 46.02  ? 263 ASN A ND2 1 
ATOM   644  N  N   . VAL A 1 91  ? 28.168 39.609 28.878 1.00 45.61  ? 264 VAL A N   1 
ATOM   645  C  CA  . VAL A 1 91  ? 27.746 38.330 28.324 1.00 45.80  ? 264 VAL A CA  1 
ATOM   646  C  C   . VAL A 1 91  ? 28.925 37.406 28.052 1.00 46.14  ? 264 VAL A C   1 
ATOM   647  O  O   . VAL A 1 91  ? 28.998 36.755 26.997 1.00 46.24  ? 264 VAL A O   1 
ATOM   648  C  CB  . VAL A 1 91  ? 26.865 38.465 27.058 1.00 45.68  ? 264 VAL A CB  1 
ATOM   649  C  CG1 . VAL A 1 91  ? 25.505 39.059 27.399 1.00 45.31  ? 264 VAL A CG1 1 
ATOM   650  C  CG2 . VAL A 1 91  ? 27.570 39.269 25.994 1.00 46.12  ? 264 VAL A CG2 1 
ATOM   651  N  N   . GLY A 1 92  ? 29.840 37.357 29.021 1.00 46.62  ? 265 GLY A N   1 
ATOM   652  C  CA  . GLY A 1 92  ? 30.932 36.377 29.042 1.00 47.06  ? 265 GLY A CA  1 
ATOM   653  C  C   . GLY A 1 92  ? 32.295 36.939 28.675 1.00 47.26  ? 265 GLY A C   1 
ATOM   654  O  O   . GLY A 1 92  ? 33.214 36.189 28.349 1.00 47.58  ? 265 GLY A O   1 
ATOM   655  N  N   . TYR A 1 93  ? 32.420 38.260 28.735 1.00 47.31  ? 266 TYR A N   1 
ATOM   656  C  CA  . TYR A 1 93  ? 33.616 38.958 28.280 1.00 47.24  ? 266 TYR A CA  1 
ATOM   657  C  C   . TYR A 1 93  ? 34.831 38.567 29.106 1.00 46.89  ? 266 TYR A C   1 
ATOM   658  O  O   . TYR A 1 93  ? 35.907 38.320 28.567 1.00 46.63  ? 266 TYR A O   1 
ATOM   659  C  CB  . TYR A 1 93  ? 33.365 40.475 28.322 1.00 47.54  ? 266 TYR A CB  1 
ATOM   660  C  CG  . TYR A 1 93  ? 34.561 41.396 28.065 1.00 48.53  ? 266 TYR A CG  1 
ATOM   661  C  CD1 . TYR A 1 93  ? 35.437 41.190 26.987 1.00 49.06  ? 266 TYR A CD1 1 
ATOM   662  C  CD2 . TYR A 1 93  ? 34.782 42.508 28.880 1.00 49.41  ? 266 TYR A CD2 1 
ATOM   663  C  CE1 . TYR A 1 93  ? 36.514 42.054 26.754 1.00 48.66  ? 266 TYR A CE1 1 
ATOM   664  C  CE2 . TYR A 1 93  ? 35.853 43.368 28.649 1.00 49.66  ? 266 TYR A CE2 1 
ATOM   665  C  CZ  . TYR A 1 93  ? 36.708 43.136 27.591 1.00 49.08  ? 266 TYR A CZ  1 
ATOM   666  O  OH  . TYR A 1 93  ? 37.752 44.002 27.389 1.00 49.59  ? 266 TYR A OH  1 
ATOM   667  N  N   . TYR A 1 94  ? 34.647 38.481 30.415 1.00 46.76  ? 267 TYR A N   1 
ATOM   668  C  CA  . TYR A 1 94  ? 35.775 38.270 31.300 1.00 46.77  ? 267 TYR A CA  1 
ATOM   669  C  C   . TYR A 1 94  ? 36.336 36.851 31.257 1.00 46.67  ? 267 TYR A C   1 
ATOM   670  O  O   . TYR A 1 94  ? 37.509 36.653 31.576 1.00 47.03  ? 267 TYR A O   1 
ATOM   671  C  CB  . TYR A 1 94  ? 35.402 38.611 32.736 1.00 46.93  ? 267 TYR A CB  1 
ATOM   672  C  CG  . TYR A 1 94  ? 35.024 40.045 32.989 1.00 47.03  ? 267 TYR A CG  1 
ATOM   673  C  CD1 . TYR A 1 94  ? 35.995 41.001 33.263 1.00 47.12  ? 267 TYR A CD1 1 
ATOM   674  C  CD2 . TYR A 1 94  ? 33.685 40.436 32.994 1.00 47.58  ? 267 TYR A CD2 1 
ATOM   675  C  CE1 . TYR A 1 94  ? 35.643 42.314 33.516 1.00 47.70  ? 267 TYR A CE1 1 
ATOM   676  C  CE2 . TYR A 1 94  ? 33.327 41.745 33.243 1.00 47.81  ? 267 TYR A CE2 1 
ATOM   677  C  CZ  . TYR A 1 94  ? 34.308 42.676 33.504 1.00 47.71  ? 267 TYR A CZ  1 
ATOM   678  O  OH  . TYR A 1 94  ? 33.947 43.972 33.754 1.00 48.69  ? 267 TYR A OH  1 
ATOM   679  N  N   . THR A 1 95  ? 35.504 35.871 30.892 1.00 46.31  ? 268 THR A N   1 
ATOM   680  C  CA  . THR A 1 95  ? 35.921 34.458 30.844 1.00 45.62  ? 268 THR A CA  1 
ATOM   681  C  C   . THR A 1 95  ? 36.112 33.926 29.414 1.00 45.58  ? 268 THR A C   1 
ATOM   682  O  O   . THR A 1 95  ? 36.496 32.772 29.217 1.00 45.90  ? 268 THR A O   1 
ATOM   683  C  CB  . THR A 1 95  ? 34.933 33.547 31.588 1.00 45.30  ? 268 THR A CB  1 
ATOM   684  O  OG1 . THR A 1 95  ? 33.604 33.891 31.205 1.00 45.22  ? 268 THR A OG1 1 
ATOM   685  C  CG2 . THR A 1 95  ? 35.070 33.713 33.082 1.00 44.88  ? 268 THR A CG2 1 
ATOM   686  N  N   . GLY A 1 96  ? 35.858 34.776 28.422 1.00 45.31  ? 269 GLY A N   1 
ATOM   687  C  CA  . GLY A 1 96  ? 36.000 34.394 27.023 1.00 44.62  ? 269 GLY A CA  1 
ATOM   688  C  C   . GLY A 1 96  ? 34.785 33.624 26.563 1.00 44.25  ? 269 GLY A C   1 
ATOM   689  O  O   . GLY A 1 96  ? 34.793 33.007 25.505 1.00 44.42  ? 269 GLY A O   1 
ATOM   690  N  N   . ASP A 1 97  ? 33.731 33.660 27.366 1.00 43.81  ? 270 ASP A N   1 
ATOM   691  C  CA  . ASP A 1 97  ? 32.499 32.974 27.016 1.00 43.40  ? 270 ASP A CA  1 
ATOM   692  C  C   . ASP A 1 97  ? 31.652 33.783 26.031 1.00 43.13  ? 270 ASP A C   1 
ATOM   693  O  O   . ASP A 1 97  ? 30.583 33.351 25.592 1.00 43.15  ? 270 ASP A O   1 
ATOM   694  C  CB  . ASP A 1 97  ? 31.716 32.596 28.274 1.00 43.37  ? 270 ASP A CB  1 
ATOM   695  C  CG  . ASP A 1 97  ? 32.071 31.213 28.777 1.00 43.01  ? 270 ASP A CG  1 
ATOM   696  O  OD1 . ASP A 1 97  ? 31.570 30.229 28.206 1.00 43.15  ? 270 ASP A OD1 1 
ATOM   697  O  OD2 . ASP A 1 97  ? 32.853 31.105 29.736 1.00 42.97  ? 270 ASP A OD2 1 
ATOM   698  N  N   . ASP A 1 98  ? 32.136 34.962 25.671 1.00 42.65  ? 271 ASP A N   1 
ATOM   699  C  CA  . ASP A 1 98  ? 31.482 35.699 24.624 1.00 42.23  ? 271 ASP A CA  1 
ATOM   700  C  C   . ASP A 1 98  ? 32.112 35.302 23.308 1.00 42.12  ? 271 ASP A C   1 
ATOM   701  O  O   . ASP A 1 98  ? 31.672 35.739 22.248 1.00 41.98  ? 271 ASP A O   1 
ATOM   702  C  CB  . ASP A 1 98  ? 31.531 37.211 24.878 1.00 42.22  ? 271 ASP A CB  1 
ATOM   703  C  CG  . ASP A 1 98  ? 32.933 37.757 24.985 1.00 41.92  ? 271 ASP A CG  1 
ATOM   704  O  OD1 . ASP A 1 98  ? 33.882 36.992 25.260 1.00 42.53  ? 271 ASP A OD1 1 
ATOM   705  O  OD2 . ASP A 1 98  ? 33.076 38.979 24.802 1.00 41.51  ? 271 ASP A OD2 1 
ATOM   706  N  N   . ARG A 1 99  ? 33.141 34.456 23.387 1.00 41.34  ? 272 ARG A N   1 
ATOM   707  C  CA  . ARG A 1 99  ? 33.837 33.945 22.196 1.00 40.66  ? 272 ARG A CA  1 
ATOM   708  C  C   . ARG A 1 99  ? 33.210 32.634 21.746 1.00 40.15  ? 272 ARG A C   1 
ATOM   709  O  O   . ARG A 1 99  ? 33.543 31.557 22.237 1.00 39.90  ? 272 ARG A O   1 
ATOM   710  C  CB  . ARG A 1 99  ? 35.337 33.776 22.447 1.00 40.66  ? 272 ARG A CB  1 
ATOM   711  C  CG  . ARG A 1 99  ? 36.132 35.073 22.554 1.00 40.84  ? 272 ARG A CG  1 
ATOM   712  C  CD  . ARG A 1 99  ? 37.541 34.750 23.000 1.00 42.37  ? 272 ARG A CD  1 
ATOM   713  N  NE  . ARG A 1 99  ? 37.537 33.827 24.143 1.00 43.76  ? 272 ARG A NE  1 
ATOM   714  C  CZ  . ARG A 1 99  ? 38.535 33.000 24.468 1.00 44.09  ? 272 ARG A CZ  1 
ATOM   715  N  NH1 . ARG A 1 99  ? 39.643 32.956 23.740 1.00 44.78  ? 272 ARG A NH1 1 
ATOM   716  N  NH2 . ARG A 1 99  ? 38.424 32.210 25.527 1.00 44.87  ? 272 ARG A NH2 1 
ATOM   717  N  N   . LEU A 1 100 ? 32.309 32.746 20.785 1.00 39.69  ? 273 LEU A N   1 
ATOM   718  C  CA  . LEU A 1 100 ? 31.345 31.706 20.538 1.00 39.60  ? 273 LEU A CA  1 
ATOM   719  C  C   . LEU A 1 100 ? 31.817 30.632 19.560 1.00 39.82  ? 273 LEU A C   1 
ATOM   720  O  O   . LEU A 1 100 ? 32.524 30.918 18.584 1.00 40.19  ? 273 LEU A O   1 
ATOM   721  C  CB  . LEU A 1 100 ? 30.046 32.343 20.044 1.00 39.38  ? 273 LEU A CB  1 
ATOM   722  C  CG  . LEU A 1 100 ? 29.411 33.491 20.842 1.00 39.05  ? 273 LEU A CG  1 
ATOM   723  C  CD1 . LEU A 1 100 ? 28.191 34.004 20.111 1.00 39.93  ? 273 LEU A CD1 1 
ATOM   724  C  CD2 . LEU A 1 100 ? 29.026 33.085 22.254 1.00 38.48  ? 273 LEU A CD2 1 
ATOM   725  N  N   . PHE A 1 101 ? 31.422 29.390 19.834 1.00 39.55  ? 274 PHE A N   1 
ATOM   726  C  CA  . PHE A 1 101 ? 31.601 28.300 18.882 1.00 39.07  ? 274 PHE A CA  1 
ATOM   727  C  C   . PHE A 1 101 ? 30.264 27.981 18.243 1.00 39.16  ? 274 PHE A C   1 
ATOM   728  O  O   . PHE A 1 101 ? 29.556 27.059 18.664 1.00 39.27  ? 274 PHE A O   1 
ATOM   729  C  CB  . PHE A 1 101 ? 32.145 27.065 19.569 1.00 38.94  ? 274 PHE A CB  1 
ATOM   730  C  CG  . PHE A 1 101 ? 32.357 25.913 18.646 1.00 37.36  ? 274 PHE A CG  1 
ATOM   731  C  CD1 . PHE A 1 101 ? 33.074 26.073 17.474 1.00 36.40  ? 274 PHE A CD1 1 
ATOM   732  C  CD2 . PHE A 1 101 ? 31.853 24.662 18.957 1.00 36.42  ? 274 PHE A CD2 1 
ATOM   733  C  CE1 . PHE A 1 101 ? 33.282 25.007 16.624 1.00 36.37  ? 274 PHE A CE1 1 
ATOM   734  C  CE2 . PHE A 1 101 ? 32.067 23.587 18.115 1.00 36.48  ? 274 PHE A CE2 1 
ATOM   735  C  CZ  . PHE A 1 101 ? 32.782 23.761 16.946 1.00 36.35  ? 274 PHE A CZ  1 
ATOM   736  N  N   . LEU A 1 102 ? 29.934 28.754 17.215 1.00 39.08  ? 275 LEU A N   1 
ATOM   737  C  CA  . LEU A 1 102 ? 28.592 28.787 16.676 1.00 38.96  ? 275 LEU A CA  1 
ATOM   738  C  C   . LEU A 1 102 ? 28.369 27.686 15.650 1.00 39.06  ? 275 LEU A C   1 
ATOM   739  O  O   . LEU A 1 102 ? 28.674 27.850 14.468 1.00 39.03  ? 275 LEU A O   1 
ATOM   740  C  CB  . LEU A 1 102 ? 28.320 30.158 16.068 1.00 38.59  ? 275 LEU A CB  1 
ATOM   741  C  CG  . LEU A 1 102 ? 26.849 30.525 16.000 1.00 37.85  ? 275 LEU A CG  1 
ATOM   742  C  CD1 . LEU A 1 102 ? 26.230 30.484 17.389 1.00 36.34  ? 275 LEU A CD1 1 
ATOM   743  C  CD2 . LEU A 1 102 ? 26.729 31.901 15.411 1.00 38.46  ? 275 LEU A CD2 1 
ATOM   744  N  N   . VAL A 1 103 ? 27.825 26.565 16.105 1.00 39.21  ? 276 VAL A N   1 
ATOM   745  C  CA  . VAL A 1 103 ? 27.583 25.429 15.225 1.00 39.68  ? 276 VAL A CA  1 
ATOM   746  C  C   . VAL A 1 103 ? 26.165 24.893 15.387 1.00 39.93  ? 276 VAL A C   1 
ATOM   747  O  O   . VAL A 1 103 ? 25.825 23.824 14.867 1.00 40.00  ? 276 VAL A O   1 
ATOM   748  C  CB  . VAL A 1 103 ? 28.578 24.327 15.500 1.00 39.73  ? 276 VAL A CB  1 
ATOM   749  C  CG1 . VAL A 1 103 ? 29.875 24.647 14.805 1.00 40.27  ? 276 VAL A CG1 1 
ATOM   750  C  CG2 . VAL A 1 103 ? 28.787 24.211 16.990 1.00 39.90  ? 276 VAL A CG2 1 
ATOM   751  N  N   . SER A 1 104 ? 25.352 25.659 16.111 1.00 40.00  ? 277 SER A N   1 
ATOM   752  C  CA  . SER A 1 104 ? 23.928 25.401 16.298 1.00 39.88  ? 277 SER A CA  1 
ATOM   753  C  C   . SER A 1 104 ? 23.463 26.516 17.213 1.00 39.44  ? 277 SER A C   1 
ATOM   754  O  O   . SER A 1 104 ? 24.252 27.003 18.023 1.00 39.52  ? 277 SER A O   1 
ATOM   755  C  CB  . SER A 1 104 ? 23.711 24.072 16.998 1.00 39.95  ? 277 SER A CB  1 
ATOM   756  O  OG  . SER A 1 104 ? 24.325 24.129 18.277 1.00 41.06  ? 277 SER A OG  1 
ATOM   757  N  N   . PRO A 1 105 ? 22.185 26.910 17.115 1.00 39.08  ? 278 PRO A N   1 
ATOM   758  C  CA  . PRO A 1 105 ? 21.681 28.030 17.909 1.00 38.82  ? 278 PRO A CA  1 
ATOM   759  C  C   . PRO A 1 105 ? 22.122 27.918 19.368 1.00 38.52  ? 278 PRO A C   1 
ATOM   760  O  O   . PRO A 1 105 ? 22.037 26.836 19.961 1.00 38.61  ? 278 PRO A O   1 
ATOM   761  C  CB  . PRO A 1 105 ? 20.163 27.878 17.804 1.00 38.90  ? 278 PRO A CB  1 
ATOM   762  C  CG  . PRO A 1 105 ? 19.946 27.120 16.541 1.00 38.92  ? 278 PRO A CG  1 
ATOM   763  C  CD  . PRO A 1 105 ? 21.104 26.194 16.413 1.00 39.06  ? 278 PRO A CD  1 
ATOM   764  N  N   . LEU A 1 106 ? 22.608 29.019 19.930 1.00 38.07  ? 279 LEU A N   1 
ATOM   765  C  CA  . LEU A 1 106 ? 23.093 29.010 21.298 1.00 37.94  ? 279 LEU A CA  1 
ATOM   766  C  C   . LEU A 1 106 ? 22.275 29.955 22.136 1.00 38.07  ? 279 LEU A C   1 
ATOM   767  O  O   . LEU A 1 106 ? 21.856 30.997 21.659 1.00 37.80  ? 279 LEU A O   1 
ATOM   768  C  CB  . LEU A 1 106 ? 24.559 29.437 21.356 1.00 37.92  ? 279 LEU A CB  1 
ATOM   769  C  CG  . LEU A 1 106 ? 25.661 28.579 20.723 1.00 37.93  ? 279 LEU A CG  1 
ATOM   770  C  CD1 . LEU A 1 106 ? 26.988 29.317 20.725 1.00 37.28  ? 279 LEU A CD1 1 
ATOM   771  C  CD2 . LEU A 1 106 ? 25.796 27.250 21.438 1.00 38.93  ? 279 LEU A CD2 1 
ATOM   772  N  N   . ILE A 1 107 ? 22.036 29.600 23.387 1.00 38.60  ? 280 ILE A N   1 
ATOM   773  C  CA  . ILE A 1 107 ? 21.429 30.561 24.286 1.00 39.11  ? 280 ILE A CA  1 
ATOM   774  C  C   . ILE A 1 107 ? 22.547 31.344 24.954 1.00 38.87  ? 280 ILE A C   1 
ATOM   775  O  O   . ILE A 1 107 ? 23.410 30.764 25.617 1.00 39.01  ? 280 ILE A O   1 
ATOM   776  C  CB  . ILE A 1 107 ? 20.499 29.902 25.339 1.00 39.26  ? 280 ILE A CB  1 
ATOM   777  C  CG1 . ILE A 1 107 ? 19.369 29.144 24.651 1.00 39.24  ? 280 ILE A CG1 1 
ATOM   778  C  CG2 . ILE A 1 107 ? 19.896 30.957 26.289 1.00 38.90  ? 280 ILE A CG2 1 
ATOM   779  C  CD1 . ILE A 1 107 ? 18.510 28.385 25.614 1.00 40.22  ? 280 ILE A CD1 1 
ATOM   780  N  N   . ILE A 1 108 ? 22.537 32.657 24.749 1.00 38.47  ? 281 ILE A N   1 
ATOM   781  C  CA  . ILE A 1 108 ? 23.449 33.556 25.442 1.00 38.16  ? 281 ILE A CA  1 
ATOM   782  C  C   . ILE A 1 108 ? 22.815 33.973 26.767 1.00 38.15  ? 281 ILE A C   1 
ATOM   783  O  O   . ILE A 1 108 ? 21.587 34.071 26.871 1.00 38.23  ? 281 ILE A O   1 
ATOM   784  C  CB  . ILE A 1 108 ? 23.772 34.787 24.581 1.00 37.98  ? 281 ILE A CB  1 
ATOM   785  C  CG1 . ILE A 1 108 ? 24.319 34.348 23.227 1.00 37.82  ? 281 ILE A CG1 1 
ATOM   786  C  CG2 . ILE A 1 108 ? 24.747 35.707 25.278 1.00 37.75  ? 281 ILE A CG2 1 
ATOM   787  C  CD1 . ILE A 1 108 ? 25.200 33.104 23.279 1.00 37.94  ? 281 ILE A CD1 1 
ATOM   788  N  N   . SER A 1 109 ? 23.650 34.206 27.778 1.00 37.93  ? 282 SER A N   1 
ATOM   789  C  CA  . SER A 1 109 ? 23.153 34.429 29.117 1.00 37.94  ? 282 SER A CA  1 
ATOM   790  C  C   . SER A 1 109 ? 23.972 35.446 29.871 1.00 38.06  ? 282 SER A C   1 
ATOM   791  O  O   . SER A 1 109 ? 25.173 35.307 30.015 1.00 38.16  ? 282 SER A O   1 
ATOM   792  C  CB  . SER A 1 109 ? 23.144 33.118 29.890 1.00 37.96  ? 282 SER A CB  1 
ATOM   793  O  OG  . SER A 1 109 ? 22.884 33.344 31.264 1.00 38.70  ? 282 SER A OG  1 
ATOM   794  N  N   . HIS A 1 110 ? 23.297 36.466 30.370 1.00 38.46  ? 283 HIS A N   1 
ATOM   795  C  CA  . HIS A 1 110 ? 23.917 37.508 31.154 1.00 38.68  ? 283 HIS A CA  1 
ATOM   796  C  C   . HIS A 1 110 ? 23.387 37.361 32.558 1.00 38.90  ? 283 HIS A C   1 
ATOM   797  O  O   . HIS A 1 110 ? 22.190 37.504 32.784 1.00 39.12  ? 283 HIS A O   1 
ATOM   798  C  CB  . HIS A 1 110 ? 23.548 38.864 30.557 1.00 38.76  ? 283 HIS A CB  1 
ATOM   799  C  CG  . HIS A 1 110 ? 23.510 39.984 31.547 1.00 39.29  ? 283 HIS A CG  1 
ATOM   800  N  ND1 . HIS A 1 110 ? 24.649 40.535 32.089 1.00 40.51  ? 283 HIS A ND1 1 
ATOM   801  C  CD2 . HIS A 1 110 ? 22.470 40.680 32.069 1.00 39.81  ? 283 HIS A CD2 1 
ATOM   802  C  CE1 . HIS A 1 110 ? 24.313 41.510 32.918 1.00 40.34  ? 283 HIS A CE1 1 
ATOM   803  N  NE2 . HIS A 1 110 ? 22.996 41.619 32.923 1.00 39.58  ? 283 HIS A NE2 1 
ATOM   804  N  N   . GLU A 1 111 ? 24.265 37.045 33.500 1.00 39.29  ? 284 GLU A N   1 
ATOM   805  C  CA  . GLU A 1 111 ? 23.859 36.940 34.896 1.00 39.72  ? 284 GLU A CA  1 
ATOM   806  C  C   . GLU A 1 111 ? 23.594 38.327 35.482 1.00 39.76  ? 284 GLU A C   1 
ATOM   807  O  O   . GLU A 1 111 ? 24.471 39.192 35.461 1.00 39.95  ? 284 GLU A O   1 
ATOM   808  C  CB  . GLU A 1 111 ? 24.911 36.188 35.719 1.00 39.80  ? 284 GLU A CB  1 
ATOM   809  C  CG  . GLU A 1 111 ? 24.634 36.219 37.242 1.00 40.94  ? 284 GLU A CG  1 
ATOM   810  C  CD  . GLU A 1 111 ? 25.779 35.640 38.060 1.00 42.39  ? 284 GLU A CD  1 
ATOM   811  O  OE1 . GLU A 1 111 ? 26.470 34.733 37.550 1.00 43.75  ? 284 GLU A OE1 1 
ATOM   812  O  OE2 . GLU A 1 111 ? 25.988 36.086 39.212 1.00 42.72  ? 284 GLU A OE2 1 
ATOM   813  N  N   . ILE A 1 112 ? 22.380 38.527 35.992 1.00 39.83  ? 285 ILE A N   1 
ATOM   814  C  CA  . ILE A 1 112 ? 21.964 39.814 36.533 1.00 39.93  ? 285 ILE A CA  1 
ATOM   815  C  C   . ILE A 1 112 ? 22.544 39.984 37.929 1.00 40.51  ? 285 ILE A C   1 
ATOM   816  O  O   . ILE A 1 112 ? 21.926 39.565 38.898 1.00 40.91  ? 285 ILE A O   1 
ATOM   817  C  CB  . ILE A 1 112 ? 20.422 39.929 36.555 1.00 39.54  ? 285 ILE A CB  1 
ATOM   818  C  CG1 . ILE A 1 112 ? 19.890 40.044 35.134 1.00 39.10  ? 285 ILE A CG1 1 
ATOM   819  C  CG2 . ILE A 1 112 ? 19.975 41.142 37.317 1.00 39.45  ? 285 ILE A CG2 1 
ATOM   820  C  CD1 . ILE A 1 112 ? 18.408 40.046 35.040 1.00 38.21  ? 285 ILE A CD1 1 
ATOM   821  N  N   . ASN A 1 113 ? 23.737 40.579 38.027 1.00 41.09  ? 286 ASN A N   1 
ATOM   822  C  CA  . ASN A 1 113 ? 24.424 40.760 39.315 1.00 41.55  ? 286 ASN A CA  1 
ATOM   823  C  C   . ASN A 1 113 ? 24.594 42.216 39.681 1.00 42.02  ? 286 ASN A C   1 
ATOM   824  O  O   . ASN A 1 113 ? 24.134 43.082 38.959 1.00 42.38  ? 286 ASN A O   1 
ATOM   825  C  CB  . ASN A 1 113 ? 25.788 40.088 39.298 1.00 41.47  ? 286 ASN A CB  1 
ATOM   826  C  CG  . ASN A 1 113 ? 26.658 40.573 38.165 1.00 41.31  ? 286 ASN A CG  1 
ATOM   827  O  OD1 . ASN A 1 113 ? 26.501 41.689 37.672 1.00 41.19  ? 286 ASN A OD1 1 
ATOM   828  N  ND2 . ASN A 1 113 ? 27.587 39.729 37.743 1.00 41.61  ? 286 ASN A ND2 1 
ATOM   829  N  N   . GLN A 1 114 ? 25.267 42.486 40.793 1.00 42.64  ? 287 GLN A N   1 
ATOM   830  C  CA  . GLN A 1 114 ? 25.399 43.854 41.293 1.00 43.38  ? 287 GLN A CA  1 
ATOM   831  C  C   . GLN A 1 114 ? 25.913 44.841 40.248 1.00 43.52  ? 287 GLN A C   1 
ATOM   832  O  O   . GLN A 1 114 ? 25.728 46.048 40.385 1.00 43.54  ? 287 GLN A O   1 
ATOM   833  C  CB  . GLN A 1 114 ? 26.290 43.889 42.535 1.00 43.71  ? 287 GLN A CB  1 
ATOM   834  C  CG  . GLN A 1 114 ? 26.353 45.249 43.233 1.00 45.30  ? 287 GLN A CG  1 
ATOM   835  C  CD  . GLN A 1 114 ? 26.725 45.149 44.714 1.00 47.49  ? 287 GLN A CD  1 
ATOM   836  O  OE1 . GLN A 1 114 ? 27.278 44.142 45.169 1.00 48.22  ? 287 GLN A OE1 1 
ATOM   837  N  NE2 . GLN A 1 114 ? 26.413 46.200 45.473 1.00 48.32  ? 287 GLN A NE2 1 
ATOM   838  N  N   . GLN A 1 115 ? 26.548 44.326 39.201 1.00 43.97  ? 288 GLN A N   1 
ATOM   839  C  CA  . GLN A 1 115 ? 27.159 45.181 38.182 1.00 44.45  ? 288 GLN A CA  1 
ATOM   840  C  C   . GLN A 1 115 ? 26.288 45.293 36.934 1.00 44.44  ? 288 GLN A C   1 
ATOM   841  O  O   . GLN A 1 115 ? 26.538 46.128 36.059 1.00 44.70  ? 288 GLN A O   1 
ATOM   842  C  CB  . GLN A 1 115 ? 28.564 44.684 37.818 1.00 44.67  ? 288 GLN A CB  1 
ATOM   843  C  CG  . GLN A 1 115 ? 29.637 44.920 38.899 1.00 45.76  ? 288 GLN A CG  1 
ATOM   844  C  CD  . GLN A 1 115 ? 29.654 43.838 39.983 1.00 47.16  ? 288 GLN A CD  1 
ATOM   845  O  OE1 . GLN A 1 115 ? 29.551 42.648 39.685 1.00 48.54  ? 288 GLN A OE1 1 
ATOM   846  N  NE2 . GLN A 1 115 ? 29.784 44.252 41.248 1.00 47.26  ? 288 GLN A NE2 1 
ATOM   847  N  N   . SER A 1 116 ? 25.263 44.449 36.866 1.00 44.30  ? 289 SER A N   1 
ATOM   848  C  CA  . SER A 1 116 ? 24.307 44.455 35.764 1.00 43.86  ? 289 SER A CA  1 
ATOM   849  C  C   . SER A 1 116 ? 23.277 45.578 35.897 1.00 43.36  ? 289 SER A C   1 
ATOM   850  O  O   . SER A 1 116 ? 22.845 45.911 37.006 1.00 43.28  ? 289 SER A O   1 
ATOM   851  C  CB  . SER A 1 116 ? 23.586 43.115 35.713 1.00 43.97  ? 289 SER A CB  1 
ATOM   852  O  OG  . SER A 1 116 ? 22.473 43.182 34.846 1.00 44.95  ? 289 SER A OG  1 
ATOM   853  N  N   . PRO A 1 117 ? 22.869 46.161 34.758 1.00 43.01  ? 290 PRO A N   1 
ATOM   854  C  CA  . PRO A 1 117 ? 21.889 47.254 34.737 1.00 42.77  ? 290 PRO A CA  1 
ATOM   855  C  C   . PRO A 1 117 ? 20.464 46.844 35.112 1.00 42.51  ? 290 PRO A C   1 
ATOM   856  O  O   . PRO A 1 117 ? 19.576 47.687 35.169 1.00 42.53  ? 290 PRO A O   1 
ATOM   857  C  CB  . PRO A 1 117 ? 21.936 47.746 33.287 1.00 42.72  ? 290 PRO A CB  1 
ATOM   858  C  CG  . PRO A 1 117 ? 22.500 46.622 32.517 1.00 42.75  ? 290 PRO A CG  1 
ATOM   859  C  CD  . PRO A 1 117 ? 23.448 45.912 33.426 1.00 42.93  ? 290 PRO A CD  1 
ATOM   860  N  N   . PHE A 1 118 ? 20.261 45.563 35.383 1.00 42.26  ? 291 PHE A N   1 
ATOM   861  C  CA  . PHE A 1 118 ? 18.954 45.045 35.742 1.00 41.73  ? 291 PHE A CA  1 
ATOM   862  C  C   . PHE A 1 118 ? 18.902 44.690 37.223 1.00 42.02  ? 291 PHE A C   1 
ATOM   863  O  O   . PHE A 1 118 ? 17.878 44.260 37.735 1.00 42.08  ? 291 PHE A O   1 
ATOM   864  C  CB  . PHE A 1 118 ? 18.629 43.852 34.853 1.00 41.16  ? 291 PHE A CB  1 
ATOM   865  C  CG  . PHE A 1 118 ? 18.612 44.199 33.402 1.00 40.04  ? 291 PHE A CG  1 
ATOM   866  C  CD1 . PHE A 1 118 ? 17.431 44.511 32.769 1.00 39.75  ? 291 PHE A CD1 1 
ATOM   867  C  CD2 . PHE A 1 118 ? 19.776 44.256 32.676 1.00 39.28  ? 291 PHE A CD2 1 
ATOM   868  C  CE1 . PHE A 1 118 ? 17.407 44.848 31.431 1.00 38.85  ? 291 PHE A CE1 1 
ATOM   869  C  CE2 . PHE A 1 118 ? 19.756 44.595 31.345 1.00 38.85  ? 291 PHE A CE2 1 
ATOM   870  C  CZ  . PHE A 1 118 ? 18.568 44.891 30.725 1.00 38.64  ? 291 PHE A CZ  1 
ATOM   871  N  N   . TRP A 1 119 ? 20.010 44.922 37.916 1.00 42.42  ? 292 TRP A N   1 
ATOM   872  C  CA  . TRP A 1 119 ? 20.156 44.528 39.309 1.00 42.83  ? 292 TRP A CA  1 
ATOM   873  C  C   . TRP A 1 119 ? 18.951 44.877 40.163 1.00 43.41  ? 292 TRP A C   1 
ATOM   874  O  O   . TRP A 1 119 ? 18.565 44.103 41.021 1.00 43.68  ? 292 TRP A O   1 
ATOM   875  C  CB  . TRP A 1 119 ? 21.424 45.151 39.891 1.00 42.75  ? 292 TRP A CB  1 
ATOM   876  C  CG  . TRP A 1 119 ? 21.662 44.912 41.357 1.00 42.11  ? 292 TRP A CG  1 
ATOM   877  C  CD1 . TRP A 1 119 ? 21.654 45.849 42.341 1.00 41.79  ? 292 TRP A CD1 1 
ATOM   878  C  CD2 . TRP A 1 119 ? 21.982 43.668 41.992 1.00 41.86  ? 292 TRP A CD2 1 
ATOM   879  N  NE1 . TRP A 1 119 ? 21.937 45.269 43.552 1.00 41.68  ? 292 TRP A NE1 1 
ATOM   880  C  CE2 . TRP A 1 119 ? 22.139 43.929 43.365 1.00 41.74  ? 292 TRP A CE2 1 
ATOM   881  C  CE3 . TRP A 1 119 ? 22.141 42.356 41.534 1.00 42.00  ? 292 TRP A CE3 1 
ATOM   882  C  CZ2 . TRP A 1 119 ? 22.445 42.930 44.286 1.00 41.99  ? 292 TRP A CZ2 1 
ATOM   883  C  CZ3 . TRP A 1 119 ? 22.450 41.363 42.449 1.00 41.98  ? 292 TRP A CZ3 1 
ATOM   884  C  CH2 . TRP A 1 119 ? 22.596 41.655 43.808 1.00 41.76  ? 292 TRP A CH2 1 
ATOM   885  N  N   . GLU A 1 120 ? 18.349 46.034 39.927 1.00 44.19  ? 293 GLU A N   1 
ATOM   886  C  CA  . GLU A 1 120 ? 17.261 46.498 40.784 1.00 45.11  ? 293 GLU A CA  1 
ATOM   887  C  C   . GLU A 1 120 ? 15.883 46.442 40.112 1.00 44.88  ? 293 GLU A C   1 
ATOM   888  O  O   . GLU A 1 120 ? 14.892 46.961 40.647 1.00 44.78  ? 293 GLU A O   1 
ATOM   889  C  CB  . GLU A 1 120 ? 17.550 47.910 41.279 1.00 45.16  ? 293 GLU A CB  1 
ATOM   890  C  CG  . GLU A 1 120 ? 19.019 48.150 41.542 1.00 46.96  ? 293 GLU A CG  1 
ATOM   891  C  CD  . GLU A 1 120 ? 19.249 49.351 42.418 1.00 49.96  ? 293 GLU A CD  1 
ATOM   892  O  OE1 . GLU A 1 120 ? 18.611 50.399 42.171 1.00 52.09  ? 293 GLU A OE1 1 
ATOM   893  O  OE2 . GLU A 1 120 ? 20.066 49.253 43.359 1.00 50.96  ? 293 GLU A OE2 1 
ATOM   894  N  N   . ILE A 1 121 ? 15.816 45.803 38.947 1.00 44.47  ? 294 ILE A N   1 
ATOM   895  C  CA  . ILE A 1 121 ? 14.567 45.738 38.209 1.00 43.88  ? 294 ILE A CA  1 
ATOM   896  C  C   . ILE A 1 121 ? 13.809 44.472 38.538 1.00 43.58  ? 294 ILE A C   1 
ATOM   897  O  O   . ILE A 1 121 ? 14.283 43.353 38.320 1.00 43.52  ? 294 ILE A O   1 
ATOM   898  C  CB  . ILE A 1 121 ? 14.779 45.870 36.703 1.00 43.84  ? 294 ILE A CB  1 
ATOM   899  C  CG1 . ILE A 1 121 ? 15.152 47.339 36.384 1.00 44.39  ? 294 ILE A CG1 1 
ATOM   900  C  CG2 . ILE A 1 121 ? 13.502 45.482 35.965 1.00 43.89  ? 294 ILE A CG2 1 
ATOM   901  C  CD1 . ILE A 1 121 ? 15.591 47.573 34.937 1.00 44.51  ? 294 ILE A CD1 1 
ATOM   902  N  N   . SER A 1 122 ? 12.623 44.682 39.095 1.00 43.22  ? 295 SER A N   1 
ATOM   903  C  CA  . SER A 1 122 ? 11.727 43.607 39.468 1.00 42.79  ? 295 SER A CA  1 
ATOM   904  C  C   . SER A 1 122 ? 10.860 43.258 38.277 1.00 42.40  ? 295 SER A C   1 
ATOM   905  O  O   . SER A 1 122 ? 11.030 43.818 37.191 1.00 42.22  ? 295 SER A O   1 
ATOM   906  C  CB  . SER A 1 122 ? 10.846 44.046 40.637 1.00 42.94  ? 295 SER A CB  1 
ATOM   907  O  OG  . SER A 1 122 ? 9.875  44.984 40.213 1.00 43.21  ? 295 SER A OG  1 
ATOM   908  N  N   . LYS A 1 123 ? 9.932  42.330 38.495 1.00 42.03  ? 296 LYS A N   1 
ATOM   909  C  CA  . LYS A 1 123 ? 9.015  41.909 37.453 1.00 41.80  ? 296 LYS A CA  1 
ATOM   910  C  C   . LYS A 1 123 ? 8.012  43.016 37.198 1.00 41.86  ? 296 LYS A C   1 
ATOM   911  O  O   . LYS A 1 123 ? 7.792  43.421 36.058 1.00 41.69  ? 296 LYS A O   1 
ATOM   912  C  CB  . LYS A 1 123 ? 8.282  40.625 37.842 1.00 41.75  ? 296 LYS A CB  1 
ATOM   913  C  CG  . LYS A 1 123 ? 7.250  40.208 36.809 1.00 41.44  ? 296 LYS A CG  1 
ATOM   914  C  CD  . LYS A 1 123 ? 6.506  38.964 37.221 1.00 41.52  ? 296 LYS A CD  1 
ATOM   915  C  CE  . LYS A 1 123 ? 5.696  38.427 36.049 1.00 41.68  ? 296 LYS A CE  1 
ATOM   916  N  NZ  . LYS A 1 123 ? 5.335  36.978 36.241 1.00 41.67  ? 296 LYS A NZ  1 
ATOM   917  N  N   . ALA A 1 124 ? 7.406  43.506 38.271 1.00 42.12  ? 297 ALA A N   1 
ATOM   918  C  CA  . ALA A 1 124 ? 6.410  44.563 38.162 1.00 42.37  ? 297 ALA A CA  1 
ATOM   919  C  C   . ALA A 1 124 ? 7.036  45.809 37.548 1.00 42.44  ? 297 ALA A C   1 
ATOM   920  O  O   . ALA A 1 124 ? 6.409  46.494 36.736 1.00 42.32  ? 297 ALA A O   1 
ATOM   921  C  CB  . ALA A 1 124 ? 5.832  44.877 39.532 1.00 42.50  ? 297 ALA A CB  1 
ATOM   922  N  N   . GLN A 1 125 ? 8.288  46.064 37.936 1.00 42.73  ? 298 GLN A N   1 
ATOM   923  C  CA  . GLN A 1 125 ? 9.028  47.274 37.580 1.00 43.00  ? 298 GLN A CA  1 
ATOM   924  C  C   . GLN A 1 125 ? 9.540  47.255 36.140 1.00 42.90  ? 298 GLN A C   1 
ATOM   925  O  O   . GLN A 1 125 ? 9.798  48.302 35.556 1.00 42.76  ? 298 GLN A O   1 
ATOM   926  C  CB  . GLN A 1 125 ? 10.179 47.468 38.580 1.00 43.12  ? 298 GLN A CB  1 
ATOM   927  C  CG  . GLN A 1 125 ? 11.020 48.729 38.409 1.00 43.81  ? 298 GLN A CG  1 
ATOM   928  C  CD  . GLN A 1 125 ? 10.208 50.011 38.346 1.00 44.57  ? 298 GLN A CD  1 
ATOM   929  O  OE1 . GLN A 1 125 ? 10.567 50.932 37.615 1.00 45.19  ? 298 GLN A OE1 1 
ATOM   930  N  NE2 . GLN A 1 125 ? 9.116  50.082 39.109 1.00 43.59  ? 298 GLN A NE2 1 
ATOM   931  N  N   . LEU A 1 126 ? 9.671  46.059 35.577 1.00 43.11  ? 299 LEU A N   1 
ATOM   932  C  CA  . LEU A 1 126 ? 10.164 45.896 34.216 1.00 43.28  ? 299 LEU A CA  1 
ATOM   933  C  C   . LEU A 1 126 ? 9.338  46.663 33.183 1.00 43.61  ? 299 LEU A C   1 
ATOM   934  O  O   . LEU A 1 126 ? 9.896  47.468 32.449 1.00 43.74  ? 299 LEU A O   1 
ATOM   935  C  CB  . LEU A 1 126 ? 10.261 44.417 33.832 1.00 43.23  ? 299 LEU A CB  1 
ATOM   936  C  CG  . LEU A 1 126 ? 10.722 44.150 32.402 1.00 42.66  ? 299 LEU A CG  1 
ATOM   937  C  CD1 . LEU A 1 126 ? 12.176 44.541 32.290 1.00 41.95  ? 299 LEU A CD1 1 
ATOM   938  C  CD2 . LEU A 1 126 ? 10.489 42.691 31.990 1.00 42.34  ? 299 LEU A CD2 1 
ATOM   939  N  N   . PRO A 1 127 ? 8.013  46.411 33.107 1.00 44.07  ? 300 PRO A N   1 
ATOM   940  C  CA  . PRO A 1 127 ? 7.231  47.082 32.053 1.00 44.42  ? 300 PRO A CA  1 
ATOM   941  C  C   . PRO A 1 127 ? 7.244  48.604 32.163 1.00 44.64  ? 300 PRO A C   1 
ATOM   942  O  O   . PRO A 1 127 ? 7.062  49.300 31.166 1.00 44.87  ? 300 PRO A O   1 
ATOM   943  C  CB  . PRO A 1 127 ? 5.814  46.531 32.264 1.00 44.53  ? 300 PRO A CB  1 
ATOM   944  C  CG  . PRO A 1 127 ? 6.043  45.167 32.878 1.00 44.60  ? 300 PRO A CG  1 
ATOM   945  C  CD  . PRO A 1 127 ? 7.200  45.405 33.826 1.00 44.20  ? 300 PRO A CD  1 
ATOM   946  N  N   . LYS A 1 128 ? 7.473  49.112 33.366 1.00 44.86  ? 301 LYS A N   1 
ATOM   947  C  CA  . LYS A 1 128 ? 7.581  50.548 33.568 1.00 44.96  ? 301 LYS A CA  1 
ATOM   948  C  C   . LYS A 1 128 ? 8.809  51.153 32.872 1.00 44.92  ? 301 LYS A C   1 
ATOM   949  O  O   . LYS A 1 128 ? 8.775  52.301 32.438 1.00 45.13  ? 301 LYS A O   1 
ATOM   950  C  CB  . LYS A 1 128 ? 7.579  50.871 35.070 1.00 44.97  ? 301 LYS A CB  1 
ATOM   951  C  CG  . LYS A 1 128 ? 6.196  50.740 35.703 1.00 44.92  ? 301 LYS A CG  1 
ATOM   952  C  CD  . LYS A 1 128 ? 6.255  50.501 37.206 1.00 45.46  ? 301 LYS A CD  1 
ATOM   953  C  CE  . LYS A 1 128 ? 4.902  49.983 37.717 1.00 45.73  ? 301 LYS A CE  1 
ATOM   954  N  NZ  . LYS A 1 128 ? 5.026  49.365 39.072 1.00 46.12  ? 301 LYS A NZ  1 
ATOM   955  N  N   . GLU A 1 129 ? 9.876  50.367 32.743 1.00 44.70  ? 302 GLU A N   1 
ATOM   956  C  CA  . GLU A 1 129 ? 11.178 50.859 32.266 1.00 44.46  ? 302 GLU A CA  1 
ATOM   957  C  C   . GLU A 1 129 ? 11.218 51.216 30.791 1.00 44.14  ? 302 GLU A C   1 
ATOM   958  O  O   . GLU A 1 129 ? 10.563 50.585 29.962 1.00 44.04  ? 302 GLU A O   1 
ATOM   959  C  CB  . GLU A 1 129 ? 12.286 49.841 32.563 1.00 44.55  ? 302 GLU A CB  1 
ATOM   960  C  CG  . GLU A 1 129 ? 12.599 49.674 34.047 1.00 45.50  ? 302 GLU A CG  1 
ATOM   961  C  CD  . GLU A 1 129 ? 12.988 50.977 34.732 1.00 46.74  ? 302 GLU A CD  1 
ATOM   962  O  OE1 . GLU A 1 129 ? 13.663 51.818 34.097 1.00 47.18  ? 302 GLU A OE1 1 
ATOM   963  O  OE2 . GLU A 1 129 ? 12.625 51.148 35.912 1.00 46.89  ? 302 GLU A OE2 1 
ATOM   964  N  N   . GLU A 1 130 ? 12.015 52.228 30.479 1.00 43.76  ? 303 GLU A N   1 
ATOM   965  C  CA  . GLU A 1 130 ? 12.212 52.644 29.100 1.00 43.55  ? 303 GLU A CA  1 
ATOM   966  C  C   . GLU A 1 130 ? 13.623 52.306 28.631 1.00 43.11  ? 303 GLU A C   1 
ATOM   967  O  O   . GLU A 1 130 ? 14.521 53.158 28.683 1.00 43.38  ? 303 GLU A O   1 
ATOM   968  C  CB  . GLU A 1 130 ? 11.973 54.145 28.970 1.00 43.67  ? 303 GLU A CB  1 
ATOM   969  C  CG  . GLU A 1 130 ? 11.978 54.629 27.533 1.00 45.23  ? 303 GLU A CG  1 
ATOM   970  C  CD  . GLU A 1 130 ? 11.035 55.784 27.314 1.00 48.01  ? 303 GLU A CD  1 
ATOM   971  O  OE1 . GLU A 1 130 ? 10.574 56.394 28.343 1.00 48.56  ? 303 GLU A OE1 1 
ATOM   972  O  OE2 . GLU A 1 130 ? 10.752 56.074 26.111 1.00 50.14  ? 303 GLU A OE2 1 
ATOM   973  N  N   . LEU A 1 131 ? 13.814 51.074 28.164 1.00 42.34  ? 304 LEU A N   1 
ATOM   974  C  CA  . LEU A 1 131 ? 15.155 50.611 27.823 1.00 41.71  ? 304 LEU A CA  1 
ATOM   975  C  C   . LEU A 1 131 ? 15.197 49.657 26.634 1.00 41.38  ? 304 LEU A C   1 
ATOM   976  O  O   . LEU A 1 131 ? 14.187 49.066 26.260 1.00 41.39  ? 304 LEU A O   1 
ATOM   977  C  CB  . LEU A 1 131 ? 15.807 49.971 29.046 1.00 41.66  ? 304 LEU A CB  1 
ATOM   978  C  CG  . LEU A 1 131 ? 15.161 48.676 29.525 1.00 41.89  ? 304 LEU A CG  1 
ATOM   979  C  CD1 . LEU A 1 131 ? 15.753 47.476 28.786 1.00 42.36  ? 304 LEU A CD1 1 
ATOM   980  C  CD2 . LEU A 1 131 ? 15.354 48.526 31.015 1.00 43.35  ? 304 LEU A CD2 1 
ATOM   981  N  N   . GLU A 1 132 ? 16.383 49.509 26.052 1.00 41.03  ? 305 GLU A N   1 
ATOM   982  C  CA  . GLU A 1 132 ? 16.571 48.690 24.870 1.00 40.56  ? 305 GLU A CA  1 
ATOM   983  C  C   . GLU A 1 132 ? 17.914 47.976 24.951 1.00 40.39  ? 305 GLU A C   1 
ATOM   984  O  O   . GLU A 1 132 ? 18.941 48.593 25.227 1.00 40.25  ? 305 GLU A O   1 
ATOM   985  C  CB  . GLU A 1 132 ? 16.499 49.562 23.612 1.00 40.49  ? 305 GLU A CB  1 
ATOM   986  C  CG  . GLU A 1 132 ? 16.777 48.811 22.290 1.00 40.90  ? 305 GLU A CG  1 
ATOM   987  C  CD  . GLU A 1 132 ? 16.522 49.692 21.054 1.00 41.97  ? 305 GLU A CD  1 
ATOM   988  O  OE1 . GLU A 1 132 ? 16.140 50.891 21.205 1.00 42.38  ? 305 GLU A OE1 1 
ATOM   989  O  OE2 . GLU A 1 132 ? 16.710 49.180 19.924 1.00 42.23  ? 305 GLU A OE2 1 
ATOM   990  N  N   . ILE A 1 133 ? 17.886 46.666 24.725 1.00 40.16  ? 306 ILE A N   1 
ATOM   991  C  CA  . ILE A 1 133 ? 19.090 45.842 24.652 1.00 39.46  ? 306 ILE A CA  1 
ATOM   992  C  C   . ILE A 1 133 ? 19.411 45.625 23.197 1.00 39.31  ? 306 ILE A C   1 
ATOM   993  O  O   . ILE A 1 133 ? 18.601 45.060 22.468 1.00 39.33  ? 306 ILE A O   1 
ATOM   994  C  CB  . ILE A 1 133 ? 18.857 44.452 25.266 1.00 39.29  ? 306 ILE A CB  1 
ATOM   995  C  CG1 . ILE A 1 133 ? 18.635 44.576 26.767 1.00 39.12  ? 306 ILE A CG1 1 
ATOM   996  C  CG2 . ILE A 1 133 ? 20.023 43.520 24.972 1.00 38.39  ? 306 ILE A CG2 1 
ATOM   997  C  CD1 . ILE A 1 133 ? 17.742 43.511 27.315 1.00 39.43  ? 306 ILE A CD1 1 
ATOM   998  N  N   . VAL A 1 134 ? 20.585 46.074 22.774 1.00 38.97  ? 307 VAL A N   1 
ATOM   999  C  CA  . VAL A 1 134 ? 21.053 45.809 21.414 1.00 38.53  ? 307 VAL A CA  1 
ATOM   1000 C  C   . VAL A 1 134 ? 21.993 44.610 21.429 1.00 38.43  ? 307 VAL A C   1 
ATOM   1001 O  O   . VAL A 1 134 ? 22.940 44.549 22.214 1.00 38.20  ? 307 VAL A O   1 
ATOM   1002 C  CB  . VAL A 1 134 ? 21.763 47.041 20.784 1.00 38.17  ? 307 VAL A CB  1 
ATOM   1003 C  CG1 . VAL A 1 134 ? 22.149 46.770 19.334 1.00 38.32  ? 307 VAL A CG1 1 
ATOM   1004 C  CG2 . VAL A 1 134 ? 20.873 48.276 20.868 1.00 38.22  ? 307 VAL A CG2 1 
ATOM   1005 N  N   . VAL A 1 135 ? 21.712 43.648 20.565 1.00 38.30  ? 308 VAL A N   1 
ATOM   1006 C  CA  . VAL A 1 135 ? 22.537 42.461 20.479 1.00 38.32  ? 308 VAL A CA  1 
ATOM   1007 C  C   . VAL A 1 135 ? 23.330 42.443 19.188 1.00 38.52  ? 308 VAL A C   1 
ATOM   1008 O  O   . VAL A 1 135 ? 22.775 42.587 18.106 1.00 38.60  ? 308 VAL A O   1 
ATOM   1009 C  CB  . VAL A 1 135 ? 21.716 41.176 20.626 1.00 38.04  ? 308 VAL A CB  1 
ATOM   1010 C  CG1 . VAL A 1 135 ? 20.992 41.173 21.964 1.00 37.72  ? 308 VAL A CG1 1 
ATOM   1011 C  CG2 . VAL A 1 135 ? 20.748 41.026 19.488 1.00 38.30  ? 308 VAL A CG2 1 
ATOM   1012 N  N   . ILE A 1 136 ? 24.639 42.257 19.319 1.00 38.56  ? 309 ILE A N   1 
ATOM   1013 C  CA  . ILE A 1 136 ? 25.562 42.469 18.220 1.00 38.66  ? 309 ILE A CA  1 
ATOM   1014 C  C   . ILE A 1 136 ? 26.496 41.287 18.057 1.00 38.92  ? 309 ILE A C   1 
ATOM   1015 O  O   . ILE A 1 136 ? 27.375 41.075 18.879 1.00 39.06  ? 309 ILE A O   1 
ATOM   1016 C  CB  . ILE A 1 136 ? 26.405 43.735 18.471 1.00 38.62  ? 309 ILE A CB  1 
ATOM   1017 C  CG1 . ILE A 1 136 ? 25.492 44.922 18.788 1.00 38.01  ? 309 ILE A CG1 1 
ATOM   1018 C  CG2 . ILE A 1 136 ? 27.306 44.014 17.284 1.00 38.65  ? 309 ILE A CG2 1 
ATOM   1019 C  CD1 . ILE A 1 136 ? 26.181 46.070 19.413 1.00 37.04  ? 309 ILE A CD1 1 
ATOM   1020 N  N   . LEU A 1 137 ? 26.297 40.513 16.998 1.00 39.33  ? 310 LEU A N   1 
ATOM   1021 C  CA  . LEU A 1 137 ? 27.208 39.418 16.679 1.00 39.95  ? 310 LEU A CA  1 
ATOM   1022 C  C   . LEU A 1 137 ? 28.245 39.880 15.662 1.00 40.61  ? 310 LEU A C   1 
ATOM   1023 O  O   . LEU A 1 137 ? 27.909 40.487 14.656 1.00 40.87  ? 310 LEU A O   1 
ATOM   1024 C  CB  . LEU A 1 137 ? 26.459 38.204 16.126 1.00 39.63  ? 310 LEU A CB  1 
ATOM   1025 C  CG  . LEU A 1 137 ? 27.397 37.016 15.941 1.00 39.60  ? 310 LEU A CG  1 
ATOM   1026 C  CD1 . LEU A 1 137 ? 26.978 35.838 16.798 1.00 39.07  ? 310 LEU A CD1 1 
ATOM   1027 C  CD2 . LEU A 1 137 ? 27.445 36.625 14.494 1.00 39.60  ? 310 LEU A CD2 1 
ATOM   1028 N  N   . GLU A 1 138 ? 29.509 39.595 15.925 1.00 41.44  ? 311 GLU A N   1 
ATOM   1029 C  CA  . GLU A 1 138 ? 30.552 39.913 14.961 1.00 42.41  ? 311 GLU A CA  1 
ATOM   1030 C  C   . GLU A 1 138 ? 31.480 38.729 14.774 1.00 42.60  ? 311 GLU A C   1 
ATOM   1031 O  O   . GLU A 1 138 ? 31.993 38.162 15.749 1.00 42.71  ? 311 GLU A O   1 
ATOM   1032 C  CB  . GLU A 1 138 ? 31.382 41.101 15.424 1.00 42.79  ? 311 GLU A CB  1 
ATOM   1033 C  CG  . GLU A 1 138 ? 30.612 42.360 15.734 1.00 44.49  ? 311 GLU A CG  1 
ATOM   1034 C  CD  . GLU A 1 138 ? 31.561 43.535 15.873 1.00 46.11  ? 311 GLU A CD  1 
ATOM   1035 O  OE1 . GLU A 1 138 ? 32.784 43.312 15.720 1.00 47.07  ? 311 GLU A OE1 1 
ATOM   1036 O  OE2 . GLU A 1 138 ? 31.098 44.676 16.115 1.00 46.14  ? 311 GLU A OE2 1 
ATOM   1037 N  N   . GLY A 1 139 ? 31.702 38.363 13.517 1.00 42.81  ? 312 GLY A N   1 
ATOM   1038 C  CA  . GLY A 1 139 ? 32.647 37.312 13.198 1.00 43.26  ? 312 GLY A CA  1 
ATOM   1039 C  C   . GLY A 1 139 ? 33.078 37.465 11.767 1.00 43.70  ? 312 GLY A C   1 
ATOM   1040 O  O   . GLY A 1 139 ? 32.611 38.360 11.072 1.00 44.00  ? 312 GLY A O   1 
ATOM   1041 N  N   . MET A 1 140 ? 33.984 36.603 11.330 1.00 44.20  ? 313 MET A N   1 
ATOM   1042 C  CA  A MET A 1 140 ? 34.444 36.594 9.904  0.50 45.20  ? 313 MET A CA  1 
ATOM   1043 C  CA  B MET A 1 140 ? 34.391 36.614 9.900  0.50 45.57  ? 313 MET A CA  1 
ATOM   1044 C  C   . MET A 1 140 ? 33.753 35.394 9.279  1.00 45.12  ? 313 MET A C   1 
ATOM   1045 O  O   . MET A 1 140 ? 33.818 34.305 9.849  1.00 45.35  ? 313 MET A O   1 
ATOM   1046 C  CB  A MET A 1 140 ? 35.963 36.357 9.883  0.50 45.20  ? 313 MET A CB  1 
ATOM   1047 C  CB  B MET A 1 140 ? 35.921 36.551 9.802  0.50 45.86  ? 313 MET A CB  1 
ATOM   1048 C  CG  A MET A 1 140 ? 36.632 36.611 8.517  0.50 47.05  ? 313 MET A CG  1 
ATOM   1049 C  CG  B MET A 1 140 ? 36.559 37.956 9.610  0.50 49.33  ? 313 MET A CG  1 
ATOM   1050 S  SD  A MET A 1 140 ? 36.472 35.217 7.359  0.50 54.56  ? 313 MET A SD  1 
ATOM   1051 S  SD  B MET A 1 140 ? 38.336 37.978 10.000 0.50 56.85  ? 313 MET A SD  1 
ATOM   1052 C  CE  A MET A 1 140 ? 37.576 33.965 8.089  0.50 51.24  ? 313 MET A CE  1 
ATOM   1053 C  CE  B MET A 1 140 ? 38.269 38.281 11.798 0.50 50.79  ? 313 MET A CE  1 
ATOM   1054 N  N   . VAL A 1 141 ? 33.108 35.575 8.133  1.00 45.64  ? 314 VAL A N   1 
ATOM   1055 C  CA  . VAL A 1 141 ? 32.445 34.444 7.497  1.00 45.98  ? 314 VAL A CA  1 
ATOM   1056 C  C   . VAL A 1 141 ? 33.466 33.587 6.769  1.00 46.11  ? 314 VAL A C   1 
ATOM   1057 O  O   . VAL A 1 141 ? 34.136 34.073 5.858  1.00 46.14  ? 314 VAL A O   1 
ATOM   1058 C  CB  . VAL A 1 141 ? 31.344 34.887 6.532  1.00 45.97  ? 314 VAL A CB  1 
ATOM   1059 C  CG1 . VAL A 1 141 ? 30.699 33.669 5.864  1.00 46.10  ? 314 VAL A CG1 1 
ATOM   1060 C  CG2 . VAL A 1 141 ? 30.308 35.719 7.276  1.00 46.19  ? 314 VAL A CG2 1 
ATOM   1061 N  N   . GLU A 1 142 ? 33.574 32.321 7.181  1.00 46.38  ? 315 GLU A N   1 
ATOM   1062 C  CA  . GLU A 1 142 ? 34.618 31.405 6.698  1.00 46.88  ? 315 GLU A CA  1 
ATOM   1063 C  C   . GLU A 1 142 ? 34.761 31.433 5.168  1.00 47.05  ? 315 GLU A C   1 
ATOM   1064 O  O   . GLU A 1 142 ? 35.850 31.732 4.638  1.00 46.75  ? 315 GLU A O   1 
ATOM   1065 C  CB  . GLU A 1 142 ? 34.318 29.976 7.173  1.00 47.01  ? 315 GLU A CB  1 
ATOM   1066 C  CG  . GLU A 1 142 ? 35.428 28.954 6.893  1.00 47.44  ? 315 GLU A CG  1 
ATOM   1067 C  CD  . GLU A 1 142 ? 35.246 27.686 7.710  1.00 48.53  ? 315 GLU A CD  1 
ATOM   1068 O  OE1 . GLU A 1 142 ? 34.185 27.016 7.546  1.00 48.82  ? 315 GLU A OE1 1 
ATOM   1069 O  OE2 . GLU A 1 142 ? 36.160 27.374 8.524  1.00 49.07  ? 315 GLU A OE2 1 
ATOM   1070 N  N   . ALA A 1 143 ? 33.646 31.122 4.485  1.00 47.32  ? 316 ALA A N   1 
ATOM   1071 C  CA  . ALA A 1 143 ? 33.553 31.133 3.018  1.00 47.43  ? 316 ALA A CA  1 
ATOM   1072 C  C   . ALA A 1 143 ? 33.951 32.501 2.408  1.00 47.59  ? 316 ALA A C   1 
ATOM   1073 O  O   . ALA A 1 143 ? 35.039 32.636 1.804  1.00 47.64  ? 316 ALA A O   1 
ATOM   1074 C  CB  . ALA A 1 143 ? 32.128 30.717 2.575  1.00 47.33  ? 316 ALA A CB  1 
ATOM   1075 N  N   . THR A 1 144 ? 33.081 33.503 2.606  1.00 47.69  ? 317 THR A N   1 
ATOM   1076 C  CA  . THR A 1 144 ? 33.257 34.838 2.029  1.00 47.79  ? 317 THR A CA  1 
ATOM   1077 C  C   . THR A 1 144 ? 34.626 35.483 2.285  1.00 47.82  ? 317 THR A C   1 
ATOM   1078 O  O   . THR A 1 144 ? 35.108 36.268 1.461  1.00 47.80  ? 317 THR A O   1 
ATOM   1079 C  CB  . THR A 1 144 ? 32.132 35.814 2.494  1.00 47.89  ? 317 THR A CB  1 
ATOM   1080 O  OG1 . THR A 1 144 ? 31.817 36.741 1.442  1.00 48.22  ? 317 THR A OG1 1 
ATOM   1081 C  CG2 . THR A 1 144 ? 32.531 36.596 3.759  1.00 47.65  ? 317 THR A CG2 1 
ATOM   1082 N  N   . GLY A 1 145 ? 35.242 35.165 3.423  1.00 47.93  ? 318 GLY A N   1 
ATOM   1083 C  CA  . GLY A 1 145 ? 36.496 35.807 3.810  1.00 48.02  ? 318 GLY A CA  1 
ATOM   1084 C  C   . GLY A 1 145 ? 36.315 37.127 4.560  1.00 47.98  ? 318 GLY A C   1 
ATOM   1085 O  O   . GLY A 1 145 ? 37.223 37.577 5.277  1.00 48.14  ? 318 GLY A O   1 
ATOM   1086 N  N   . MET A 1 146 ? 35.147 37.750 4.423  1.00 47.68  ? 319 MET A N   1 
ATOM   1087 C  CA  . MET A 1 146 ? 34.950 39.082 4.992  1.00 47.41  ? 319 MET A CA  1 
ATOM   1088 C  C   . MET A 1 146 ? 34.288 39.083 6.381  1.00 46.79  ? 319 MET A C   1 
ATOM   1089 O  O   . MET A 1 146 ? 33.532 38.159 6.726  1.00 46.80  ? 319 MET A O   1 
ATOM   1090 C  CB  . MET A 1 146 ? 34.153 39.942 4.023  1.00 47.70  ? 319 MET A CB  1 
ATOM   1091 C  CG  . MET A 1 146 ? 34.360 39.561 2.567  1.00 49.16  ? 319 MET A CG  1 
ATOM   1092 S  SD  . MET A 1 146 ? 33.161 40.444 1.534  1.00 52.87  ? 319 MET A SD  1 
ATOM   1093 C  CE  . MET A 1 146 ? 31.564 39.775 2.092  1.00 52.63  ? 319 MET A CE  1 
ATOM   1094 N  N   . THR A 1 147 ? 34.578 40.129 7.160  1.00 45.96  ? 320 THR A N   1 
ATOM   1095 C  CA  . THR A 1 147 ? 34.019 40.302 8.498  1.00 44.97  ? 320 THR A CA  1 
ATOM   1096 C  C   . THR A 1 147 ? 32.555 40.719 8.429  1.00 44.35  ? 320 THR A C   1 
ATOM   1097 O  O   . THR A 1 147 ? 32.228 41.723 7.802  1.00 44.49  ? 320 THR A O   1 
ATOM   1098 C  CB  . THR A 1 147 ? 34.769 41.388 9.275  1.00 44.92  ? 320 THR A CB  1 
ATOM   1099 O  OG1 . THR A 1 147 ? 36.058 41.587 8.684  1.00 45.14  ? 320 THR A OG1 1 
ATOM   1100 C  CG2 . THR A 1 147 ? 34.921 40.998 10.749 1.00 44.61  ? 320 THR A CG2 1 
ATOM   1101 N  N   . CYS A 1 148 ? 31.688 39.942 9.077  1.00 43.42  ? 321 CYS A N   1 
ATOM   1102 C  CA  . CYS A 1 148 ? 30.262 40.260 9.208  1.00 42.39  ? 321 CYS A CA  1 
ATOM   1103 C  C   . CYS A 1 148 ? 29.936 41.012 10.517 1.00 41.85  ? 321 CYS A C   1 
ATOM   1104 O  O   . CYS A 1 148 ? 30.764 41.114 11.433 1.00 41.74  ? 321 CYS A O   1 
ATOM   1105 C  CB  . CYS A 1 148 ? 29.410 38.977 9.100  1.00 42.46  ? 321 CYS A CB  1 
ATOM   1106 S  SG  . CYS A 1 148 ? 29.063 38.072 10.671 1.00 41.89  ? 321 CYS A SG  1 
ATOM   1107 N  N   . GLN A 1 149 ? 28.729 41.564 10.569 1.00 41.19  ? 322 GLN A N   1 
ATOM   1108 C  CA  . GLN A 1 149 ? 28.113 42.021 11.813 1.00 40.29  ? 322 GLN A CA  1 
ATOM   1109 C  C   . GLN A 1 149 ? 26.617 41.802 11.659 1.00 39.80  ? 322 GLN A C   1 
ATOM   1110 O  O   . GLN A 1 149 ? 26.058 42.034 10.588 1.00 40.05  ? 322 GLN A O   1 
ATOM   1111 C  CB  . GLN A 1 149 ? 28.391 43.498 12.099 1.00 40.24  ? 322 GLN A CB  1 
ATOM   1112 C  CG  . GLN A 1 149 ? 28.002 43.922 13.509 1.00 39.37  ? 322 GLN A CG  1 
ATOM   1113 C  CD  . GLN A 1 149 ? 28.252 45.400 13.788 1.00 38.51  ? 322 GLN A CD  1 
ATOM   1114 O  OE1 . GLN A 1 149 ? 27.478 46.253 13.376 1.00 38.27  ? 322 GLN A OE1 1 
ATOM   1115 N  NE2 . GLN A 1 149 ? 29.322 45.700 14.513 1.00 37.98  ? 322 GLN A NE2 1 
ATOM   1116 N  N   . ALA A 1 150 ? 25.976 41.329 12.718 1.00 38.93  ? 323 ALA A N   1 
ATOM   1117 C  CA  . ALA A 1 150 ? 24.535 41.183 12.726 1.00 38.22  ? 323 ALA A CA  1 
ATOM   1118 C  C   . ALA A 1 150 ? 24.035 41.834 13.987 1.00 37.89  ? 323 ALA A C   1 
ATOM   1119 O  O   . ALA A 1 150 ? 24.651 41.724 15.047 1.00 37.75  ? 323 ALA A O   1 
ATOM   1120 C  CB  . ALA A 1 150 ? 24.140 39.724 12.677 1.00 38.14  ? 323 ALA A CB  1 
ATOM   1121 N  N   . ARG A 1 151 ? 22.924 42.538 13.859 1.00 37.73  ? 324 ARG A N   1 
ATOM   1122 C  CA  . ARG A 1 151 ? 22.346 43.247 14.981 1.00 37.42  ? 324 ARG A CA  1 
ATOM   1123 C  C   . ARG A 1 151 ? 20.877 42.889 15.162 1.00 37.24  ? 324 ARG A C   1 
ATOM   1124 O  O   . ARG A 1 151 ? 20.215 42.417 14.232 1.00 37.66  ? 324 ARG A O   1 
ATOM   1125 C  CB  . ARG A 1 151 ? 22.489 44.754 14.786 1.00 37.50  ? 324 ARG A CB  1 
ATOM   1126 C  CG  . ARG A 1 151 ? 23.923 45.237 14.653 1.00 37.33  ? 324 ARG A CG  1 
ATOM   1127 C  CD  . ARG A 1 151 ? 24.003 46.675 14.120 1.00 37.77  ? 324 ARG A CD  1 
ATOM   1128 N  NE  . ARG A 1 151 ? 23.586 46.775 12.724 1.00 38.95  ? 324 ARG A NE  1 
ATOM   1129 C  CZ  . ARG A 1 151 ? 24.300 46.336 11.681 1.00 41.31  ? 324 ARG A CZ  1 
ATOM   1130 N  NH1 . ARG A 1 151 ? 25.483 45.756 11.847 1.00 41.78  ? 324 ARG A NH1 1 
ATOM   1131 N  NH2 . ARG A 1 151 ? 23.825 46.470 10.451 1.00 42.88  ? 324 ARG A NH2 1 
ATOM   1132 N  N   . SER A 1 152 ? 20.379 43.089 16.382 1.00 36.48  ? 325 SER A N   1 
ATOM   1133 C  CA  . SER A 1 152 ? 18.950 43.097 16.613 1.00 36.07  ? 325 SER A CA  1 
ATOM   1134 C  C   . SER A 1 152 ? 18.694 43.796 17.922 1.00 35.70  ? 325 SER A C   1 
ATOM   1135 O  O   . SER A 1 152 ? 19.634 44.224 18.606 1.00 35.09  ? 325 SER A O   1 
ATOM   1136 C  CB  . SER A 1 152 ? 18.371 41.683 16.625 1.00 35.95  ? 325 SER A CB  1 
ATOM   1137 O  OG  . SER A 1 152 ? 16.981 41.722 16.999 1.00 35.73  ? 325 SER A OG  1 
ATOM   1138 N  N   . SER A 1 153 ? 17.426 43.905 18.285 1.00 35.77  ? 326 SER A N   1 
ATOM   1139 C  CA  . SER A 1 153 ? 17.078 44.719 19.436 1.00 35.69  ? 326 SER A CA  1 
ATOM   1140 C  C   . SER A 1 153 ? 15.923 44.202 20.263 1.00 35.96  ? 326 SER A C   1 
ATOM   1141 O  O   . SER A 1 153 ? 14.941 43.714 19.720 1.00 35.78  ? 326 SER A O   1 
ATOM   1142 C  CB  . SER A 1 153 ? 16.753 46.131 18.987 1.00 35.52  ? 326 SER A CB  1 
ATOM   1143 O  OG  . SER A 1 153 ? 15.872 46.739 19.924 1.00 34.73  ? 326 SER A OG  1 
ATOM   1144 N  N   . TYR A 1 154 ? 16.069 44.343 21.583 1.00 36.50  ? 327 TYR A N   1 
ATOM   1145 C  CA  . TYR A 1 154 ? 15.045 43.987 22.559 1.00 36.94  ? 327 TYR A CA  1 
ATOM   1146 C  C   . TYR A 1 154 ? 14.573 45.216 23.346 1.00 37.03  ? 327 TYR A C   1 
ATOM   1147 O  O   . TYR A 1 154 ? 15.326 45.825 24.115 1.00 36.90  ? 327 TYR A O   1 
ATOM   1148 C  CB  . TYR A 1 154 ? 15.548 42.890 23.503 1.00 36.82  ? 327 TYR A CB  1 
ATOM   1149 C  CG  . TYR A 1 154 ? 15.995 41.658 22.770 1.00 37.60  ? 327 TYR A CG  1 
ATOM   1150 C  CD1 . TYR A 1 154 ? 15.066 40.767 22.245 1.00 38.99  ? 327 TYR A CD1 1 
ATOM   1151 C  CD2 . TYR A 1 154 ? 17.349 41.389 22.582 1.00 37.84  ? 327 TYR A CD2 1 
ATOM   1152 C  CE1 . TYR A 1 154 ? 15.482 39.632 21.559 1.00 38.55  ? 327 TYR A CE1 1 
ATOM   1153 C  CE2 . TYR A 1 154 ? 17.769 40.254 21.898 1.00 37.66  ? 327 TYR A CE2 1 
ATOM   1154 C  CZ  . TYR A 1 154 ? 16.836 39.389 21.391 1.00 37.51  ? 327 TYR A CZ  1 
ATOM   1155 O  OH  . TYR A 1 154 ? 17.254 38.275 20.720 1.00 37.39  ? 327 TYR A OH  1 
ATOM   1156 N  N   . ILE A 1 155 ? 13.319 45.592 23.119 1.00 37.19  ? 328 ILE A N   1 
ATOM   1157 C  CA  . ILE A 1 155 ? 12.685 46.631 23.911 1.00 37.17  ? 328 ILE A CA  1 
ATOM   1158 C  C   . ILE A 1 155 ? 11.991 45.971 25.095 1.00 37.44  ? 328 ILE A C   1 
ATOM   1159 O  O   . ILE A 1 155 ? 11.756 44.761 25.103 1.00 37.61  ? 328 ILE A O   1 
ATOM   1160 C  CB  . ILE A 1 155 ? 11.690 47.504 23.081 1.00 36.96  ? 328 ILE A CB  1 
ATOM   1161 C  CG1 . ILE A 1 155 ? 10.855 46.637 22.131 1.00 36.57  ? 328 ILE A CG1 1 
ATOM   1162 C  CG2 . ILE A 1 155 ? 12.440 48.550 22.273 1.00 36.44  ? 328 ILE A CG2 1 
ATOM   1163 C  CD1 . ILE A 1 155 ? 9.527  47.254 21.720 1.00 37.68  ? 328 ILE A CD1 1 
ATOM   1164 N  N   . THR A 1 156 ? 11.676 46.781 26.095 1.00 37.77  ? 329 THR A N   1 
ATOM   1165 C  CA  . THR A 1 156 ? 11.047 46.325 27.321 1.00 38.11  ? 329 THR A CA  1 
ATOM   1166 C  C   . THR A 1 156 ? 10.023 45.250 27.045 1.00 37.78  ? 329 THR A C   1 
ATOM   1167 O  O   . THR A 1 156 ? 10.176 44.106 27.481 1.00 37.69  ? 329 THR A O   1 
ATOM   1168 C  CB  . THR A 1 156 ? 10.331 47.490 28.025 1.00 38.52  ? 329 THR A CB  1 
ATOM   1169 O  OG1 . THR A 1 156 ? 11.290 48.500 28.417 1.00 39.37  ? 329 THR A OG1 1 
ATOM   1170 C  CG2 . THR A 1 156 ? 9.571  46.973 29.246 1.00 39.15  ? 329 THR A CG2 1 
ATOM   1171 N  N   . SER A 1 157 ? 8.989  45.626 26.300 1.00 37.46  ? 330 SER A N   1 
ATOM   1172 C  CA  . SER A 1 157 ? 7.869  44.739 26.013 1.00 37.43  ? 330 SER A CA  1 
ATOM   1173 C  C   . SER A 1 157 ? 8.237  43.405 25.334 1.00 37.45  ? 330 SER A C   1 
ATOM   1174 O  O   . SER A 1 157 ? 7.380  42.540 25.155 1.00 37.59  ? 330 SER A O   1 
ATOM   1175 C  CB  . SER A 1 157 ? 6.822  45.488 25.188 1.00 37.49  ? 330 SER A CB  1 
ATOM   1176 O  OG  . SER A 1 157 ? 7.378  45.962 23.972 1.00 37.41  ? 330 SER A OG  1 
ATOM   1177 N  N   . GLU A 1 158 ? 9.501  43.226 24.975 1.00 37.64  ? 331 GLU A N   1 
ATOM   1178 C  CA  . GLU A 1 158 ? 9.908  41.999 24.315 1.00 37.81  ? 331 GLU A CA  1 
ATOM   1179 C  C   . GLU A 1 158 ? 10.785 41.120 25.191 1.00 37.85  ? 331 GLU A C   1 
ATOM   1180 O  O   . GLU A 1 158 ? 11.194 40.028 24.779 1.00 37.85  ? 331 GLU A O   1 
ATOM   1181 C  CB  . GLU A 1 158 ? 10.626 42.317 23.020 1.00 37.95  ? 331 GLU A CB  1 
ATOM   1182 C  CG  . GLU A 1 158 ? 9.770  43.067 22.038 1.00 38.52  ? 331 GLU A CG  1 
ATOM   1183 C  CD  . GLU A 1 158 ? 10.590 43.590 20.883 1.00 39.01  ? 331 GLU A CD  1 
ATOM   1184 O  OE1 . GLU A 1 158 ? 10.058 43.662 19.753 1.00 38.62  ? 331 GLU A OE1 1 
ATOM   1185 O  OE2 . GLU A 1 158 ? 11.775 43.928 21.099 1.00 40.01  ? 331 GLU A OE2 1 
ATOM   1186 N  N   . ILE A 1 159 ? 11.085 41.603 26.391 1.00 37.69  ? 332 ILE A N   1 
ATOM   1187 C  CA  . ILE A 1 159 ? 11.744 40.777 27.392 1.00 37.54  ? 332 ILE A CA  1 
ATOM   1188 C  C   . ILE A 1 159 ? 10.663 40.122 28.257 1.00 37.65  ? 332 ILE A C   1 
ATOM   1189 O  O   . ILE A 1 159 ? 9.839  40.822 28.865 1.00 38.02  ? 332 ILE A O   1 
ATOM   1190 C  CB  . ILE A 1 159 ? 12.708 41.599 28.254 1.00 37.37  ? 332 ILE A CB  1 
ATOM   1191 C  CG1 . ILE A 1 159 ? 13.762 42.261 27.365 1.00 37.27  ? 332 ILE A CG1 1 
ATOM   1192 C  CG2 . ILE A 1 159 ? 13.355 40.715 29.323 1.00 37.09  ? 332 ILE A CG2 1 
ATOM   1193 C  CD1 . ILE A 1 159 ? 14.241 43.609 27.874 1.00 36.01  ? 332 ILE A CD1 1 
ATOM   1194 N  N   . LEU A 1 160 ? 10.656 38.790 28.303 1.00 37.35  ? 333 LEU A N   1 
ATOM   1195 C  CA  . LEU A 1 160 ? 9.601  38.077 28.990 1.00 37.16  ? 333 LEU A CA  1 
ATOM   1196 C  C   . LEU A 1 160 ? 10.078 37.593 30.335 1.00 37.03  ? 333 LEU A C   1 
ATOM   1197 O  O   . LEU A 1 160 ? 10.961 36.744 30.401 1.00 37.18  ? 333 LEU A O   1 
ATOM   1198 C  CB  . LEU A 1 160 ? 9.164  36.884 28.164 1.00 37.27  ? 333 LEU A CB  1 
ATOM   1199 C  CG  . LEU A 1 160 ? 8.893  37.095 26.678 1.00 37.53  ? 333 LEU A CG  1 
ATOM   1200 C  CD1 . LEU A 1 160 ? 8.548  35.756 26.018 1.00 37.50  ? 333 LEU A CD1 1 
ATOM   1201 C  CD2 . LEU A 1 160 ? 7.801  38.119 26.449 1.00 37.37  ? 333 LEU A CD2 1 
ATOM   1202 N  N   . TRP A 1 161 ? 9.486  38.124 31.407 1.00 36.84  ? 334 TRP A N   1 
ATOM   1203 C  CA  . TRP A 1 161 ? 9.877  37.732 32.759 1.00 36.68  ? 334 TRP A CA  1 
ATOM   1204 C  C   . TRP A 1 161 ? 9.356  36.350 33.087 1.00 36.84  ? 334 TRP A C   1 
ATOM   1205 O  O   . TRP A 1 161 ? 8.170  36.105 32.965 1.00 37.25  ? 334 TRP A O   1 
ATOM   1206 C  CB  . TRP A 1 161 ? 9.350  38.723 33.799 1.00 36.49  ? 334 TRP A CB  1 
ATOM   1207 C  CG  . TRP A 1 161 ? 9.918  38.468 35.155 1.00 35.47  ? 334 TRP A CG  1 
ATOM   1208 C  CD1 . TRP A 1 161 ? 9.557  37.481 36.012 1.00 35.35  ? 334 TRP A CD1 1 
ATOM   1209 C  CD2 . TRP A 1 161 ? 10.968 39.200 35.803 1.00 34.11  ? 334 TRP A CD2 1 
ATOM   1210 N  NE1 . TRP A 1 161 ? 10.307 37.549 37.161 1.00 35.30  ? 334 TRP A NE1 1 
ATOM   1211 C  CE2 . TRP A 1 161 ? 11.186 38.594 37.056 1.00 34.48  ? 334 TRP A CE2 1 
ATOM   1212 C  CE3 . TRP A 1 161 ? 11.750 40.304 35.443 1.00 33.62  ? 334 TRP A CE3 1 
ATOM   1213 C  CZ2 . TRP A 1 161 ? 12.145 39.058 37.958 1.00 33.95  ? 334 TRP A CZ2 1 
ATOM   1214 C  CZ3 . TRP A 1 161 ? 12.706 40.764 36.340 1.00 33.23  ? 334 TRP A CZ3 1 
ATOM   1215 C  CH2 . TRP A 1 161 ? 12.893 40.142 37.583 1.00 33.10  ? 334 TRP A CH2 1 
ATOM   1216 N  N   . GLY A 1 162 ? 10.238 35.448 33.496 1.00 37.02  ? 335 GLY A N   1 
ATOM   1217 C  CA  . GLY A 1 162 ? 9.823  34.158 34.029 1.00 37.38  ? 335 GLY A CA  1 
ATOM   1218 C  C   . GLY A 1 162 ? 9.625  33.094 32.981 1.00 37.80  ? 335 GLY A C   1 
ATOM   1219 O  O   . GLY A 1 162 ? 8.813  32.195 33.161 1.00 38.03  ? 335 GLY A O   1 
ATOM   1220 N  N   . TYR A 1 163 ? 10.372 33.189 31.891 1.00 38.17  ? 336 TYR A N   1 
ATOM   1221 C  CA  . TYR A 1 163 ? 10.305 32.197 30.827 1.00 38.82  ? 336 TYR A CA  1 
ATOM   1222 C  C   . TYR A 1 163 ? 11.654 31.545 30.546 1.00 39.16  ? 336 TYR A C   1 
ATOM   1223 O  O   . TYR A 1 163 ? 12.690 32.038 31.005 1.00 39.39  ? 336 TYR A O   1 
ATOM   1224 C  CB  . TYR A 1 163 ? 9.791  32.853 29.553 1.00 38.91  ? 336 TYR A CB  1 
ATOM   1225 C  CG  . TYR A 1 163 ? 8.330  33.158 29.599 1.00 39.45  ? 336 TYR A CG  1 
ATOM   1226 C  CD1 . TYR A 1 163 ? 7.415  32.321 28.972 1.00 40.37  ? 336 TYR A CD1 1 
ATOM   1227 C  CD2 . TYR A 1 163 ? 7.853  34.274 30.279 1.00 40.71  ? 336 TYR A CD2 1 
ATOM   1228 C  CE1 . TYR A 1 163 ? 6.048  32.582 29.016 1.00 41.79  ? 336 TYR A CE1 1 
ATOM   1229 C  CE2 . TYR A 1 163 ? 6.485  34.556 30.325 1.00 41.87  ? 336 TYR A CE2 1 
ATOM   1230 C  CZ  . TYR A 1 163 ? 5.586  33.704 29.690 1.00 41.78  ? 336 TYR A CZ  1 
ATOM   1231 O  OH  . TYR A 1 163 ? 4.233  33.970 29.724 1.00 40.81  ? 336 TYR A OH  1 
ATOM   1232 N  N   . ARG A 1 164 ? 11.636 30.441 29.792 1.00 39.32  ? 337 ARG A N   1 
ATOM   1233 C  CA  . ARG A 1 164 ? 12.869 29.783 29.322 1.00 39.59  ? 337 ARG A CA  1 
ATOM   1234 C  C   . ARG A 1 164 ? 12.738 29.390 27.857 1.00 39.70  ? 337 ARG A C   1 
ATOM   1235 O  O   . ARG A 1 164 ? 11.637 29.167 27.371 1.00 39.66  ? 337 ARG A O   1 
ATOM   1236 C  CB  . ARG A 1 164 ? 13.229 28.546 30.171 1.00 39.60  ? 337 ARG A CB  1 
ATOM   1237 C  CG  . ARG A 1 164 ? 13.399 28.835 31.665 1.00 39.47  ? 337 ARG A CG  1 
ATOM   1238 C  CD  . ARG A 1 164 ? 14.102 27.721 32.449 1.00 39.49  ? 337 ARG A CD  1 
ATOM   1239 N  NE  . ARG A 1 164 ? 13.330 26.479 32.575 1.00 39.24  ? 337 ARG A NE  1 
ATOM   1240 C  CZ  . ARG A 1 164 ? 13.341 25.696 33.654 1.00 40.00  ? 337 ARG A CZ  1 
ATOM   1241 N  NH1 . ARG A 1 164 ? 14.055 26.027 34.722 1.00 41.17  ? 337 ARG A NH1 1 
ATOM   1242 N  NH2 . ARG A 1 164 ? 12.623 24.584 33.681 1.00 40.80  ? 337 ARG A NH2 1 
ATOM   1243 N  N   . PHE A 1 165 ? 13.865 29.310 27.157 1.00 39.83  ? 338 PHE A N   1 
ATOM   1244 C  CA  . PHE A 1 165 ? 13.865 28.972 25.737 1.00 40.17  ? 338 PHE A CA  1 
ATOM   1245 C  C   . PHE A 1 165 ? 13.642 27.494 25.556 1.00 40.28  ? 338 PHE A C   1 
ATOM   1246 O  O   . PHE A 1 165 ? 14.250 26.685 26.245 1.00 40.21  ? 338 PHE A O   1 
ATOM   1247 C  CB  . PHE A 1 165 ? 15.187 29.360 25.066 1.00 40.30  ? 338 PHE A CB  1 
ATOM   1248 C  CG  . PHE A 1 165 ? 15.279 30.811 24.688 1.00 40.58  ? 338 PHE A CG  1 
ATOM   1249 C  CD1 . PHE A 1 165 ? 16.060 31.686 25.434 1.00 40.34  ? 338 PHE A CD1 1 
ATOM   1250 C  CD2 . PHE A 1 165 ? 14.586 31.303 23.582 1.00 40.74  ? 338 PHE A CD2 1 
ATOM   1251 C  CE1 . PHE A 1 165 ? 16.137 33.032 25.088 1.00 40.28  ? 338 PHE A CE1 1 
ATOM   1252 C  CE2 . PHE A 1 165 ? 14.664 32.649 23.232 1.00 40.52  ? 338 PHE A CE2 1 
ATOM   1253 C  CZ  . PHE A 1 165 ? 15.440 33.510 23.985 1.00 40.27  ? 338 PHE A CZ  1 
ATOM   1254 N  N   . THR A 1 166 ? 12.765 27.137 24.630 1.00 40.56  ? 339 THR A N   1 
ATOM   1255 C  CA  . THR A 1 166 ? 12.536 25.734 24.325 1.00 41.24  ? 339 THR A CA  1 
ATOM   1256 C  C   . THR A 1 166 ? 13.811 25.211 23.668 1.00 41.49  ? 339 THR A C   1 
ATOM   1257 O  O   . THR A 1 166 ? 14.484 25.954 22.958 1.00 41.48  ? 339 THR A O   1 
ATOM   1258 C  CB  . THR A 1 166 ? 11.312 25.536 23.384 1.00 41.45  ? 339 THR A CB  1 
ATOM   1259 O  OG1 . THR A 1 166 ? 10.236 26.423 23.760 1.00 42.26  ? 339 THR A OG1 1 
ATOM   1260 C  CG2 . THR A 1 166 ? 10.817 24.097 23.444 1.00 41.99  ? 339 THR A CG2 1 
ATOM   1261 N  N   . PRO A 1 167 ? 14.171 23.946 23.934 1.00 42.00  ? 340 PRO A N   1 
ATOM   1262 C  CA  . PRO A 1 167 ? 15.357 23.330 23.315 1.00 42.31  ? 340 PRO A CA  1 
ATOM   1263 C  C   . PRO A 1 167 ? 15.134 23.010 21.847 1.00 42.59  ? 340 PRO A C   1 
ATOM   1264 O  O   . PRO A 1 167 ? 14.057 22.538 21.475 1.00 42.60  ? 340 PRO A O   1 
ATOM   1265 C  CB  . PRO A 1 167 ? 15.542 22.019 24.093 1.00 42.20  ? 340 PRO A CB  1 
ATOM   1266 C  CG  . PRO A 1 167 ? 14.642 22.121 25.282 1.00 41.99  ? 340 PRO A CG  1 
ATOM   1267 C  CD  . PRO A 1 167 ? 13.530 23.049 24.910 1.00 41.89  ? 340 PRO A CD  1 
ATOM   1268 N  N   . VAL A 1 168 ? 16.147 23.258 21.024 1.00 42.74  ? 341 VAL A N   1 
ATOM   1269 C  CA  . VAL A 1 168 ? 16.010 23.053 19.587 1.00 42.97  ? 341 VAL A CA  1 
ATOM   1270 C  C   . VAL A 1 168 ? 16.891 21.924 19.090 1.00 43.16  ? 341 VAL A C   1 
ATOM   1271 O  O   . VAL A 1 168 ? 16.745 21.468 17.950 1.00 43.27  ? 341 VAL A O   1 
ATOM   1272 C  CB  . VAL A 1 168 ? 16.294 24.339 18.767 1.00 42.91  ? 341 VAL A CB  1 
ATOM   1273 C  CG1 . VAL A 1 168 ? 15.263 25.410 19.084 1.00 43.24  ? 341 VAL A CG1 1 
ATOM   1274 C  CG2 . VAL A 1 168 ? 17.694 24.844 19.015 1.00 43.22  ? 341 VAL A CG2 1 
ATOM   1275 N  N   . LEU A 1 169 ? 17.796 21.470 19.951 1.00 43.51  ? 342 LEU A N   1 
ATOM   1276 C  CA  . LEU A 1 169 ? 18.731 20.409 19.586 1.00 43.78  ? 342 LEU A CA  1 
ATOM   1277 C  C   . LEU A 1 169 ? 18.209 18.982 19.886 1.00 44.15  ? 342 LEU A C   1 
ATOM   1278 O  O   . LEU A 1 169 ? 17.697 18.708 20.979 1.00 44.07  ? 342 LEU A O   1 
ATOM   1279 C  CB  . LEU A 1 169 ? 20.074 20.654 20.271 1.00 43.52  ? 342 LEU A CB  1 
ATOM   1280 C  CG  . LEU A 1 169 ? 21.280 20.038 19.574 1.00 43.33  ? 342 LEU A CG  1 
ATOM   1281 C  CD1 . LEU A 1 169 ? 21.418 20.584 18.151 1.00 43.83  ? 342 LEU A CD1 1 
ATOM   1282 C  CD2 . LEU A 1 169 ? 22.536 20.306 20.386 1.00 42.61  ? 342 LEU A CD2 1 
ATOM   1283 N  N   . THR A 1 170 ? 18.321 18.091 18.895 1.00 44.73  ? 343 THR A N   1 
ATOM   1284 C  CA  . THR A 1 170 ? 17.952 16.671 19.039 1.00 45.32  ? 343 THR A CA  1 
ATOM   1285 C  C   . THR A 1 170 ? 18.779 15.781 18.116 1.00 45.80  ? 343 THR A C   1 
ATOM   1286 O  O   . THR A 1 170 ? 19.049 16.136 16.947 1.00 45.87  ? 343 THR A O   1 
ATOM   1287 C  CB  . THR A 1 170 ? 16.498 16.399 18.678 1.00 45.30  ? 343 THR A CB  1 
ATOM   1288 O  OG1 . THR A 1 170 ? 16.274 16.827 17.327 1.00 45.24  ? 343 THR A OG1 1 
ATOM   1289 C  CG2 . THR A 1 170 ? 15.534 17.105 19.656 1.00 45.06  ? 343 THR A CG2 1 
ATOM   1290 N  N   . LEU A 1 171 ? 19.143 14.609 18.652 1.00 46.24  ? 344 LEU A N   1 
ATOM   1291 C  CA  . LEU A 1 171 ? 20.044 13.652 17.989 1.00 46.61  ? 344 LEU A CA  1 
ATOM   1292 C  C   . LEU A 1 171 ? 19.286 12.667 17.099 1.00 47.25  ? 344 LEU A C   1 
ATOM   1293 O  O   . LEU A 1 171 ? 18.584 11.771 17.601 1.00 47.31  ? 344 LEU A O   1 
ATOM   1294 C  CB  . LEU A 1 171 ? 20.886 12.896 19.033 1.00 46.19  ? 344 LEU A CB  1 
ATOM   1295 C  CG  . LEU A 1 171 ? 21.927 11.842 18.564 1.00 45.83  ? 344 LEU A CG  1 
ATOM   1296 C  CD1 . LEU A 1 171 ? 22.756 12.288 17.324 1.00 44.66  ? 344 LEU A CD1 1 
ATOM   1297 C  CD2 . LEU A 1 171 ? 22.845 11.512 19.744 1.00 44.31  ? 344 LEU A CD2 1 
ATOM   1298 N  N   . GLU A 1 172 ? 19.426 12.855 15.781 1.00 48.02  ? 345 GLU A N   1 
ATOM   1299 C  CA  . GLU A 1 172 ? 18.758 12.009 14.791 1.00 48.78  ? 345 GLU A CA  1 
ATOM   1300 C  C   . GLU A 1 172 ? 19.794 11.393 13.841 1.00 49.05  ? 345 GLU A C   1 
ATOM   1301 O  O   . GLU A 1 172 ? 20.450 12.118 13.061 1.00 49.00  ? 345 GLU A O   1 
ATOM   1302 C  CB  . GLU A 1 172 ? 17.688 12.807 13.998 1.00 49.07  ? 345 GLU A CB  1 
ATOM   1303 C  CG  . GLU A 1 172 ? 16.205 12.689 14.516 1.00 49.71  ? 345 GLU A CG  1 
ATOM   1304 C  CD  . GLU A 1 172 ? 15.155 13.379 13.586 1.00 50.11  ? 345 GLU A CD  1 
ATOM   1305 O  OE1 . GLU A 1 172 ? 14.916 12.898 12.436 1.00 49.79  ? 345 GLU A OE1 1 
ATOM   1306 O  OE2 . GLU A 1 172 ? 14.546 14.397 14.017 1.00 49.97  ? 345 GLU A OE2 1 
ATOM   1307 N  N   . ASP A 1 173 ? 19.947 10.065 13.940 1.00 49.52  ? 346 ASP A N   1 
ATOM   1308 C  CA  . ASP A 1 173 ? 20.679 9.235  12.945 1.00 50.02  ? 346 ASP A CA  1 
ATOM   1309 C  C   . ASP A 1 173 ? 22.204 9.555  12.847 1.00 50.29  ? 346 ASP A C   1 
ATOM   1310 O  O   . ASP A 1 173 ? 22.761 9.778  11.742 1.00 50.28  ? 346 ASP A O   1 
ATOM   1311 C  CB  . ASP A 1 173 ? 19.963 9.292  11.558 1.00 49.97  ? 346 ASP A CB  1 
ATOM   1312 C  CG  . ASP A 1 173 ? 19.809 7.901  10.871 1.00 49.68  ? 346 ASP A CG  1 
ATOM   1313 O  OD1 . ASP A 1 173 ? 19.267 7.886  9.741  1.00 49.56  ? 346 ASP A OD1 1 
ATOM   1314 O  OD2 . ASP A 1 173 ? 20.214 6.842  11.432 1.00 49.27  ? 346 ASP A OD2 1 
ATOM   1315 N  N   . GLY A 1 174 ? 22.867 9.564  14.010 1.00 50.48  ? 347 GLY A N   1 
ATOM   1316 C  CA  . GLY A 1 174 ? 24.298 9.869  14.077 1.00 50.76  ? 347 GLY A CA  1 
ATOM   1317 C  C   . GLY A 1 174 ? 24.600 11.347 13.867 1.00 51.00  ? 347 GLY A C   1 
ATOM   1318 O  O   . GLY A 1 174 ? 25.712 11.801 14.165 1.00 51.04  ? 347 GLY A O   1 
ATOM   1319 N  N   . PHE A 1 175 ? 23.606 12.083 13.343 1.00 51.24  ? 348 PHE A N   1 
ATOM   1320 C  CA  . PHE A 1 175 ? 23.666 13.550 13.138 1.00 51.47  ? 348 PHE A CA  1 
ATOM   1321 C  C   . PHE A 1 175 ? 22.836 14.308 14.193 1.00 51.11  ? 348 PHE A C   1 
ATOM   1322 O  O   . PHE A 1 175 ? 21.876 13.759 14.764 1.00 51.31  ? 348 PHE A O   1 
ATOM   1323 C  CB  . PHE A 1 175 ? 23.165 13.942 11.728 1.00 51.78  ? 348 PHE A CB  1 
ATOM   1324 C  CG  . PHE A 1 175 ? 24.249 13.958 10.667 1.00 52.87  ? 348 PHE A CG  1 
ATOM   1325 C  CD1 . PHE A 1 175 ? 24.910 15.173 10.325 1.00 53.31  ? 348 PHE A CD1 1 
ATOM   1326 C  CD2 . PHE A 1 175 ? 24.597 12.755 9.994  1.00 53.95  ? 348 PHE A CD2 1 
ATOM   1327 C  CE1 . PHE A 1 175 ? 25.914 15.188 9.330  1.00 53.91  ? 348 PHE A CE1 1 
ATOM   1328 C  CE2 . PHE A 1 175 ? 25.600 12.755 8.995  1.00 53.96  ? 348 PHE A CE2 1 
ATOM   1329 C  CZ  . PHE A 1 175 ? 26.257 13.971 8.662  1.00 54.08  ? 348 PHE A CZ  1 
ATOM   1330 N  N   . TYR A 1 176 ? 23.206 15.563 14.451 1.00 50.53  ? 349 TYR A N   1 
ATOM   1331 C  CA  . TYR A 1 176 ? 22.397 16.411 15.309 1.00 50.21  ? 349 TYR A CA  1 
ATOM   1332 C  C   . TYR A 1 176 ? 21.578 17.328 14.434 1.00 49.76  ? 349 TYR A C   1 
ATOM   1333 O  O   . TYR A 1 176 ? 22.101 17.943 13.498 1.00 49.65  ? 349 TYR A O   1 
ATOM   1334 C  CB  . TYR A 1 176 ? 23.266 17.218 16.271 1.00 50.48  ? 349 TYR A CB  1 
ATOM   1335 C  CG  . TYR A 1 176 ? 23.741 16.420 17.463 1.00 51.48  ? 349 TYR A CG  1 
ATOM   1336 C  CD1 . TYR A 1 176 ? 22.948 16.323 18.610 1.00 51.97  ? 349 TYR A CD1 1 
ATOM   1337 C  CD2 . TYR A 1 176 ? 24.989 15.780 17.437 1.00 52.64  ? 349 TYR A CD2 1 
ATOM   1338 C  CE1 . TYR A 1 176 ? 23.385 15.580 19.706 1.00 52.62  ? 349 TYR A CE1 1 
ATOM   1339 C  CE2 . TYR A 1 176 ? 25.434 15.052 18.528 1.00 52.52  ? 349 TYR A CE2 1 
ATOM   1340 C  CZ  . TYR A 1 176 ? 24.627 14.959 19.658 1.00 52.43  ? 349 TYR A CZ  1 
ATOM   1341 O  OH  . TYR A 1 176 ? 25.054 14.245 20.749 1.00 52.35  ? 349 TYR A OH  1 
ATOM   1342 N  N   . GLU A 1 177 ? 20.285 17.405 14.740 1.00 49.28  ? 350 GLU A N   1 
ATOM   1343 C  CA  . GLU A 1 177 ? 19.360 18.216 13.950 1.00 48.69  ? 350 GLU A CA  1 
ATOM   1344 C  C   . GLU A 1 177 ? 18.630 19.283 14.759 1.00 47.97  ? 350 GLU A C   1 
ATOM   1345 O  O   . GLU A 1 177 ? 18.266 19.086 15.920 1.00 47.70  ? 350 GLU A O   1 
ATOM   1346 C  CB  . GLU A 1 177 ? 18.366 17.328 13.191 1.00 48.93  ? 350 GLU A CB  1 
ATOM   1347 C  CG  . GLU A 1 177 ? 19.028 16.236 12.320 1.00 49.87  ? 350 GLU A CG  1 
ATOM   1348 C  CD  . GLU A 1 177 ? 19.843 16.783 11.111 1.00 51.35  ? 350 GLU A CD  1 
ATOM   1349 O  OE1 . GLU A 1 177 ? 20.487 15.945 10.402 1.00 51.71  ? 350 GLU A OE1 1 
ATOM   1350 O  OE2 . GLU A 1 177 ? 19.839 18.025 10.859 1.00 51.82  ? 350 GLU A OE2 1 
ATOM   1351 N  N   . VAL A 1 178 ? 18.424 20.415 14.106 1.00 47.31  ? 351 VAL A N   1 
ATOM   1352 C  CA  . VAL A 1 178 ? 17.899 21.603 14.740 1.00 46.75  ? 351 VAL A CA  1 
ATOM   1353 C  C   . VAL A 1 178 ? 16.426 21.780 14.387 1.00 46.50  ? 351 VAL A C   1 
ATOM   1354 O  O   . VAL A 1 178 ? 16.100 21.997 13.216 1.00 46.53  ? 351 VAL A O   1 
ATOM   1355 C  CB  . VAL A 1 178 ? 18.676 22.853 14.229 1.00 46.68  ? 351 VAL A CB  1 
ATOM   1356 C  CG1 . VAL A 1 178 ? 18.092 24.137 14.832 1.00 46.64  ? 351 VAL A CG1 1 
ATOM   1357 C  CG2 . VAL A 1 178 ? 20.184 22.732 14.522 1.00 46.51  ? 351 VAL A CG2 1 
ATOM   1358 N  N   . ASP A 1 179 ? 15.533 21.714 15.372 1.00 46.19  ? 352 ASP A N   1 
ATOM   1359 C  CA  . ASP A 1 179 ? 14.156 22.119 15.092 1.00 45.92  ? 352 ASP A CA  1 
ATOM   1360 C  C   . ASP A 1 179 ? 13.964 23.640 15.106 1.00 45.41  ? 352 ASP A C   1 
ATOM   1361 O  O   . ASP A 1 179 ? 13.526 24.221 16.112 1.00 45.33  ? 352 ASP A O   1 
ATOM   1362 C  CB  . ASP A 1 179 ? 13.127 21.458 16.010 1.00 46.13  ? 352 ASP A CB  1 
ATOM   1363 C  CG  . ASP A 1 179 ? 11.699 21.886 15.661 1.00 46.78  ? 352 ASP A CG  1 
ATOM   1364 O  OD1 . ASP A 1 179 ? 11.409 22.094 14.454 1.00 47.56  ? 352 ASP A OD1 1 
ATOM   1365 O  OD2 . ASP A 1 179 ? 10.866 22.038 16.577 1.00 48.17  ? 352 ASP A OD2 1 
ATOM   1366 N  N   . TYR A 1 180 ? 14.253 24.260 13.960 1.00 44.81  ? 353 TYR A N   1 
ATOM   1367 C  CA  . TYR A 1 180 ? 14.179 25.707 13.800 1.00 44.19  ? 353 TYR A CA  1 
ATOM   1368 C  C   . TYR A 1 180 ? 12.792 26.331 13.989 1.00 43.49  ? 353 TYR A C   1 
ATOM   1369 O  O   . TYR A 1 180 ? 12.654 27.561 14.037 1.00 43.56  ? 353 TYR A O   1 
ATOM   1370 C  CB  . TYR A 1 180 ? 14.724 26.076 12.432 1.00 44.35  ? 353 TYR A CB  1 
ATOM   1371 C  CG  . TYR A 1 180 ? 16.223 26.050 12.380 1.00 44.84  ? 353 TYR A CG  1 
ATOM   1372 C  CD1 . TYR A 1 180 ? 16.961 27.036 13.029 1.00 45.23  ? 353 TYR A CD1 1 
ATOM   1373 C  CD2 . TYR A 1 180 ? 16.911 25.058 11.677 1.00 45.23  ? 353 TYR A CD2 1 
ATOM   1374 C  CE1 . TYR A 1 180 ? 18.350 27.045 12.993 1.00 45.46  ? 353 TYR A CE1 1 
ATOM   1375 C  CE2 . TYR A 1 180 ? 18.312 25.058 11.628 1.00 45.78  ? 353 TYR A CE2 1 
ATOM   1376 C  CZ  . TYR A 1 180 ? 19.026 26.060 12.297 1.00 45.51  ? 353 TYR A CZ  1 
ATOM   1377 O  OH  . TYR A 1 180 ? 20.408 26.101 12.277 1.00 45.04  ? 353 TYR A OH  1 
ATOM   1378 N  N   . ASN A 1 181 ? 11.768 25.488 14.077 1.00 42.43  ? 354 ASN A N   1 
ATOM   1379 C  CA  . ASN A 1 181 ? 10.432 25.970 14.390 1.00 41.63  ? 354 ASN A CA  1 
ATOM   1380 C  C   . ASN A 1 181 ? 10.358 26.383 15.847 1.00 41.07  ? 354 ASN A C   1 
ATOM   1381 O  O   . ASN A 1 181 ? 9.625  27.303 16.214 1.00 41.01  ? 354 ASN A O   1 
ATOM   1382 C  CB  . ASN A 1 181 ? 9.371  24.902 14.098 1.00 41.79  ? 354 ASN A CB  1 
ATOM   1383 C  CG  . ASN A 1 181 ? 8.878  24.929 12.648 1.00 41.78  ? 354 ASN A CG  1 
ATOM   1384 O  OD1 . ASN A 1 181 ? 9.138  25.878 11.883 1.00 41.98  ? 354 ASN A OD1 1 
ATOM   1385 N  ND2 . ASN A 1 181 ? 8.157  23.876 12.266 1.00 41.77  ? 354 ASN A ND2 1 
ATOM   1386 N  N   . SER A 1 182 ? 11.125 25.697 16.683 1.00 40.46  ? 355 SER A N   1 
ATOM   1387 C  CA  . SER A 1 182 ? 11.125 26.005 18.110 1.00 39.80  ? 355 SER A CA  1 
ATOM   1388 C  C   . SER A 1 182 ? 12.126 27.107 18.466 1.00 39.26  ? 355 SER A C   1 
ATOM   1389 O  O   . SER A 1 182 ? 12.267 27.470 19.641 1.00 39.23  ? 355 SER A O   1 
ATOM   1390 C  CB  . SER A 1 182 ? 11.412 24.736 18.919 1.00 39.89  ? 355 SER A CB  1 
ATOM   1391 O  OG  . SER A 1 182 ? 10.402 23.771 18.689 1.00 39.33  ? 355 SER A OG  1 
ATOM   1392 N  N   . PHE A 1 183 ? 12.813 27.640 17.449 1.00 38.67  ? 356 PHE A N   1 
ATOM   1393 C  CA  . PHE A 1 183 ? 13.871 28.614 17.681 1.00 38.07  ? 356 PHE A CA  1 
ATOM   1394 C  C   . PHE A 1 183 ? 13.395 29.726 18.591 1.00 37.73  ? 356 PHE A C   1 
ATOM   1395 O  O   . PHE A 1 183 ? 13.938 29.897 19.679 1.00 37.59  ? 356 PHE A O   1 
ATOM   1396 C  CB  . PHE A 1 183 ? 14.382 29.184 16.366 1.00 38.03  ? 356 PHE A CB  1 
ATOM   1397 C  CG  . PHE A 1 183 ? 15.509 30.152 16.525 1.00 38.34  ? 356 PHE A CG  1 
ATOM   1398 C  CD1 . PHE A 1 183 ? 16.812 29.703 16.629 1.00 38.98  ? 356 PHE A CD1 1 
ATOM   1399 C  CD2 . PHE A 1 183 ? 15.265 31.518 16.558 1.00 38.69  ? 356 PHE A CD2 1 
ATOM   1400 C  CE1 . PHE A 1 183 ? 17.850 30.593 16.763 1.00 39.26  ? 356 PHE A CE1 1 
ATOM   1401 C  CE2 . PHE A 1 183 ? 16.305 32.423 16.693 1.00 38.17  ? 356 PHE A CE2 1 
ATOM   1402 C  CZ  . PHE A 1 183 ? 17.598 31.958 16.794 1.00 39.21  ? 356 PHE A CZ  1 
ATOM   1403 N  N   . HIS A 1 184 ? 12.371 30.463 18.155 1.00 37.37  ? 357 HIS A N   1 
ATOM   1404 C  CA  . HIS A 1 184 ? 11.855 31.596 18.923 1.00 37.24  ? 357 HIS A CA  1 
ATOM   1405 C  C   . HIS A 1 184 ? 10.961 31.143 20.071 1.00 37.31  ? 357 HIS A C   1 
ATOM   1406 O  O   . HIS A 1 184 ? 10.490 31.974 20.862 1.00 37.29  ? 357 HIS A O   1 
ATOM   1407 C  CB  . HIS A 1 184 ? 11.059 32.543 18.026 1.00 37.09  ? 357 HIS A CB  1 
ATOM   1408 C  CG  . HIS A 1 184 ? 11.840 33.088 16.871 1.00 37.10  ? 357 HIS A CG  1 
ATOM   1409 N  ND1 . HIS A 1 184 ? 12.678 34.176 16.996 1.00 37.23  ? 357 HIS A ND1 1 
ATOM   1410 C  CD2 . HIS A 1 184 ? 11.892 32.709 15.564 1.00 36.57  ? 357 HIS A CD2 1 
ATOM   1411 C  CE1 . HIS A 1 184 ? 13.225 34.436 15.820 1.00 36.98  ? 357 HIS A CE1 1 
ATOM   1412 N  NE2 . HIS A 1 184 ? 12.763 33.562 14.933 1.00 36.02  ? 357 HIS A NE2 1 
ATOM   1413 N  N   . GLU A 1 185 ? 10.726 29.830 20.158 1.00 37.37  ? 358 GLU A N   1 
ATOM   1414 C  CA  . GLU A 1 185 ? 9.768  29.276 21.135 1.00 37.42  ? 358 GLU A CA  1 
ATOM   1415 C  C   . GLU A 1 185 ? 10.254 29.270 22.577 1.00 37.05  ? 358 GLU A C   1 
ATOM   1416 O  O   . GLU A 1 185 ? 11.377 28.862 22.872 1.00 36.91  ? 358 GLU A O   1 
ATOM   1417 C  CB  . GLU A 1 185 ? 9.306  27.870 20.727 1.00 37.65  ? 358 GLU A CB  1 
ATOM   1418 C  CG  . GLU A 1 185 ? 8.136  27.871 19.722 1.00 39.58  ? 358 GLU A CG  1 
ATOM   1419 C  CD  . GLU A 1 185 ? 7.591  26.471 19.441 1.00 41.67  ? 358 GLU A CD  1 
ATOM   1420 O  OE1 . GLU A 1 185 ? 7.427  26.135 18.243 1.00 41.09  ? 358 GLU A OE1 1 
ATOM   1421 O  OE2 . GLU A 1 185 ? 7.334  25.708 20.412 1.00 43.24  ? 358 GLU A OE2 1 
ATOM   1422 N  N   . THR A 1 186 ? 9.387  29.741 23.462 1.00 36.64  ? 359 THR A N   1 
ATOM   1423 C  CA  . THR A 1 186 ? 9.690  29.809 24.875 1.00 36.08  ? 359 THR A CA  1 
ATOM   1424 C  C   . THR A 1 186 ? 8.501  29.292 25.648 1.00 35.91  ? 359 THR A C   1 
ATOM   1425 O  O   . THR A 1 186 ? 7.372  29.385 25.174 1.00 35.79  ? 359 THR A O   1 
ATOM   1426 C  CB  . THR A 1 186 ? 9.932  31.257 25.338 1.00 35.93  ? 359 THR A CB  1 
ATOM   1427 O  OG1 . THR A 1 186 ? 8.819  32.072 24.959 1.00 35.83  ? 359 THR A OG1 1 
ATOM   1428 C  CG2 . THR A 1 186 ? 11.191 31.821 24.723 1.00 35.96  ? 359 THR A CG2 1 
ATOM   1429 N  N   . TYR A 1 187 ? 8.760  28.760 26.842 1.00 35.85  ? 360 TYR A N   1 
ATOM   1430 C  CA  . TYR A 1 187 ? 7.707  28.366 27.787 1.00 35.34  ? 360 TYR A CA  1 
ATOM   1431 C  C   . TYR A 1 187 ? 7.872  29.105 29.097 1.00 35.66  ? 360 TYR A C   1 
ATOM   1432 O  O   . TYR A 1 187 ? 8.920  29.692 29.369 1.00 35.43  ? 360 TYR A O   1 
ATOM   1433 C  CB  . TYR A 1 187 ? 7.720  26.857 28.051 1.00 34.77  ? 360 TYR A CB  1 
ATOM   1434 C  CG  . TYR A 1 187 ? 8.988  26.339 28.683 1.00 32.45  ? 360 TYR A CG  1 
ATOM   1435 C  CD1 . TYR A 1 187 ? 9.037  26.003 30.036 1.00 31.26  ? 360 TYR A CD1 1 
ATOM   1436 C  CD2 . TYR A 1 187 ? 10.136 26.174 27.919 1.00 30.60  ? 360 TYR A CD2 1 
ATOM   1437 C  CE1 . TYR A 1 187 ? 10.208 25.513 30.611 1.00 30.46  ? 360 TYR A CE1 1 
ATOM   1438 C  CE2 . TYR A 1 187 ? 11.305 25.696 28.478 1.00 30.83  ? 360 TYR A CE2 1 
ATOM   1439 C  CZ  . TYR A 1 187 ? 11.342 25.365 29.820 1.00 30.18  ? 360 TYR A CZ  1 
ATOM   1440 O  OH  . TYR A 1 187 ? 12.524 24.890 30.346 1.00 29.86  ? 360 TYR A OH  1 
ATOM   1441 N  N   . GLU A 1 188 ? 6.830  29.077 29.909 1.00 35.93  ? 361 GLU A N   1 
ATOM   1442 C  CA  . GLU A 1 188 ? 6.897  29.713 31.208 1.00 36.35  ? 361 GLU A CA  1 
ATOM   1443 C  C   . GLU A 1 188 ? 7.538  28.780 32.241 1.00 36.29  ? 361 GLU A C   1 
ATOM   1444 O  O   . GLU A 1 188 ? 7.472  27.551 32.117 1.00 36.28  ? 361 GLU A O   1 
ATOM   1445 C  CB  . GLU A 1 188 ? 5.503  30.176 31.652 1.00 36.46  ? 361 GLU A CB  1 
ATOM   1446 C  CG  . GLU A 1 188 ? 5.536  31.292 32.698 1.00 37.00  ? 361 GLU A CG  1 
ATOM   1447 C  CD  . GLU A 1 188 ? 4.166  31.614 33.259 1.00 37.46  ? 361 GLU A CD  1 
ATOM   1448 O  OE1 . GLU A 1 188 ? 3.219  30.832 32.991 1.00 36.66  ? 361 GLU A OE1 1 
ATOM   1449 O  OE2 . GLU A 1 188 ? 4.041  32.646 33.972 1.00 37.50  ? 361 GLU A OE2 1 
ATOM   1450 N  N   . THR A 1 189 ? 8.188  29.367 33.242 1.00 36.29  ? 362 THR A N   1 
ATOM   1451 C  CA  . THR A 1 189 ? 8.641  28.586 34.379 1.00 36.40  ? 362 THR A CA  1 
ATOM   1452 C  C   . THR A 1 189 ? 8.472  29.377 35.668 1.00 36.55  ? 362 THR A C   1 
ATOM   1453 O  O   . THR A 1 189 ? 8.488  30.622 35.649 1.00 36.40  ? 362 THR A O   1 
ATOM   1454 C  CB  . THR A 1 189 ? 10.090 28.074 34.213 1.00 36.30  ? 362 THR A CB  1 
ATOM   1455 O  OG1 . THR A 1 189 ? 10.339 27.046 35.178 1.00 36.86  ? 362 THR A OG1 1 
ATOM   1456 C  CG2 . THR A 1 189 ? 11.107 29.201 34.391 1.00 36.18  ? 362 THR A CG2 1 
ATOM   1457 N  N   . SER A 1 190 ? 8.282  28.649 36.774 1.00 36.56  ? 363 SER A N   1 
ATOM   1458 C  CA  . SER A 1 190 ? 8.148  29.267 38.088 1.00 36.40  ? 363 SER A CA  1 
ATOM   1459 C  C   . SER A 1 190 ? 9.417  30.072 38.368 1.00 36.46  ? 363 SER A C   1 
ATOM   1460 O  O   . SER A 1 190 ? 10.531 29.532 38.383 1.00 36.48  ? 363 SER A O   1 
ATOM   1461 C  CB  . SER A 1 190 ? 7.919  28.216 39.178 1.00 36.31  ? 363 SER A CB  1 
ATOM   1462 O  OG  . SER A 1 190 ? 7.661  28.817 40.443 1.00 35.78  ? 363 SER A OG  1 
ATOM   1463 N  N   . THR A 1 191 ? 9.243  31.372 38.569 1.00 36.39  ? 364 THR A N   1 
ATOM   1464 C  CA  . THR A 1 191 ? 10.355 32.274 38.709 1.00 36.47  ? 364 THR A CA  1 
ATOM   1465 C  C   . THR A 1 191 ? 9.949  33.390 39.652 1.00 36.53  ? 364 THR A C   1 
ATOM   1466 O  O   . THR A 1 191 ? 8.893  33.992 39.473 1.00 36.40  ? 364 THR A O   1 
ATOM   1467 C  CB  . THR A 1 191 ? 10.698 32.854 37.354 1.00 36.53  ? 364 THR A CB  1 
ATOM   1468 O  OG1 . THR A 1 191 ? 11.139 31.801 36.492 1.00 36.80  ? 364 THR A OG1 1 
ATOM   1469 C  CG2 . THR A 1 191 ? 11.790 33.876 37.483 1.00 37.17  ? 364 THR A CG2 1 
ATOM   1470 N  N   . PRO A 1 192 ? 10.786 33.671 40.668 1.00 36.93  ? 365 PRO A N   1 
ATOM   1471 C  CA  . PRO A 1 192 ? 10.432 34.721 41.634 1.00 37.13  ? 365 PRO A CA  1 
ATOM   1472 C  C   . PRO A 1 192 ? 10.280 36.053 40.929 1.00 37.30  ? 365 PRO A C   1 
ATOM   1473 O  O   . PRO A 1 192 ? 10.882 36.260 39.877 1.00 37.32  ? 365 PRO A O   1 
ATOM   1474 C  CB  . PRO A 1 192 ? 11.629 34.754 42.590 1.00 37.26  ? 365 PRO A CB  1 
ATOM   1475 C  CG  . PRO A 1 192 ? 12.763 34.151 41.799 1.00 37.09  ? 365 PRO A CG  1 
ATOM   1476 C  CD  . PRO A 1 192 ? 12.139 33.120 40.905 1.00 36.91  ? 365 PRO A CD  1 
ATOM   1477 N  N   . SER A 1 193 ? 9.471  36.940 41.491 1.00 37.30  ? 366 SER A N   1 
ATOM   1478 C  CA  . SER A 1 193 ? 9.202  38.227 40.856 1.00 37.37  ? 366 SER A CA  1 
ATOM   1479 C  C   . SER A 1 193 ? 9.947  39.365 41.561 1.00 37.52  ? 366 SER A C   1 
ATOM   1480 O  O   . SER A 1 193 ? 9.831  40.531 41.181 1.00 37.65  ? 366 SER A O   1 
ATOM   1481 C  CB  . SER A 1 193 ? 7.708  38.497 40.868 1.00 37.19  ? 366 SER A CB  1 
ATOM   1482 O  OG  . SER A 1 193 ? 7.287  38.652 42.211 1.00 37.44  ? 366 SER A OG  1 
ATOM   1483 N  N   . LEU A 1 194 ? 10.702 39.013 42.598 1.00 37.80  ? 367 LEU A N   1 
ATOM   1484 C  CA  . LEU A 1 194 ? 11.631 39.937 43.247 1.00 38.23  ? 367 LEU A CA  1 
ATOM   1485 C  C   . LEU A 1 194 ? 12.766 40.294 42.300 1.00 38.53  ? 367 LEU A C   1 
ATOM   1486 O  O   . LEU A 1 194 ? 13.140 39.483 41.450 1.00 38.74  ? 367 LEU A O   1 
ATOM   1487 C  CB  . LEU A 1 194 ? 12.222 39.306 44.515 1.00 38.11  ? 367 LEU A CB  1 
ATOM   1488 C  CG  . LEU A 1 194 ? 11.682 39.719 45.886 1.00 37.96  ? 367 LEU A CG  1 
ATOM   1489 C  CD1 . LEU A 1 194 ? 10.170 40.000 45.865 1.00 38.04  ? 367 LEU A CD1 1 
ATOM   1490 C  CD2 . LEU A 1 194 ? 12.049 38.683 46.936 1.00 37.07  ? 367 LEU A CD2 1 
ATOM   1491 N  N   . SER A 1 195 ? 13.308 41.505 42.454 1.00 38.87  ? 368 SER A N   1 
ATOM   1492 C  CA  . SER A 1 195 ? 14.492 41.932 41.705 1.00 39.18  ? 368 SER A CA  1 
ATOM   1493 C  C   . SER A 1 195 ? 15.703 41.166 42.204 1.00 39.40  ? 368 SER A C   1 
ATOM   1494 O  O   . SER A 1 195 ? 15.711 40.686 43.333 1.00 39.23  ? 368 SER A O   1 
ATOM   1495 C  CB  . SER A 1 195 ? 14.731 43.425 41.903 1.00 39.07  ? 368 SER A CB  1 
ATOM   1496 O  OG  . SER A 1 195 ? 15.309 43.678 43.174 1.00 38.75  ? 368 SER A OG  1 
ATOM   1497 N  N   . ALA A 1 196 ? 16.728 41.056 41.373 1.00 39.75  ? 369 ALA A N   1 
ATOM   1498 C  CA  . ALA A 1 196 ? 17.913 40.329 41.773 1.00 40.28  ? 369 ALA A CA  1 
ATOM   1499 C  C   . ALA A 1 196 ? 18.434 40.838 43.114 1.00 40.65  ? 369 ALA A C   1 
ATOM   1500 O  O   . ALA A 1 196 ? 18.785 40.047 43.985 1.00 40.48  ? 369 ALA A O   1 
ATOM   1501 C  CB  . ALA A 1 196 ? 18.958 40.432 40.718 1.00 40.30  ? 369 ALA A CB  1 
ATOM   1502 N  N   . LYS A 1 197 ? 18.461 42.161 43.268 1.00 41.32  ? 370 LYS A N   1 
ATOM   1503 C  CA  . LYS A 1 197 ? 18.839 42.831 44.518 1.00 42.07  ? 370 LYS A CA  1 
ATOM   1504 C  C   . LYS A 1 197 ? 17.955 42.347 45.648 1.00 42.39  ? 370 LYS A C   1 
ATOM   1505 O  O   . LYS A 1 197 ? 18.443 41.947 46.711 1.00 42.46  ? 370 LYS A O   1 
ATOM   1506 C  CB  . LYS A 1 197 ? 18.696 44.353 44.363 1.00 42.20  ? 370 LYS A CB  1 
ATOM   1507 C  CG  . LYS A 1 197 ? 18.773 45.208 45.659 1.00 42.46  ? 370 LYS A CG  1 
ATOM   1508 C  CD  . LYS A 1 197 ? 19.157 46.662 45.292 1.00 42.80  ? 370 LYS A CD  1 
ATOM   1509 C  CE  . LYS A 1 197 ? 18.451 47.730 46.128 1.00 42.78  ? 370 LYS A CE  1 
ATOM   1510 N  NZ  . LYS A 1 197 ? 19.202 48.070 47.360 1.00 43.67  ? 370 LYS A NZ  1 
ATOM   1511 N  N   . GLU A 1 198 ? 16.649 42.387 45.400 1.00 42.79  ? 371 GLU A N   1 
ATOM   1512 C  CA  . GLU A 1 198 ? 15.662 41.941 46.372 1.00 43.30  ? 371 GLU A CA  1 
ATOM   1513 C  C   . GLU A 1 198 ? 15.861 40.475 46.733 1.00 43.62  ? 371 GLU A C   1 
ATOM   1514 O  O   . GLU A 1 198 ? 15.783 40.122 47.910 1.00 43.80  ? 371 GLU A O   1 
ATOM   1515 C  CB  . GLU A 1 198 ? 14.243 42.189 45.862 1.00 43.32  ? 371 GLU A CB  1 
ATOM   1516 C  CG  . GLU A 1 198 ? 13.780 43.630 46.016 1.00 43.53  ? 371 GLU A CG  1 
ATOM   1517 C  CD  . GLU A 1 198 ? 12.439 43.878 45.355 1.00 43.10  ? 371 GLU A CD  1 
ATOM   1518 O  OE1 . GLU A 1 198 ? 12.279 43.534 44.165 1.00 42.11  ? 371 GLU A OE1 1 
ATOM   1519 O  OE2 . GLU A 1 198 ? 11.542 44.421 46.030 1.00 43.49  ? 371 GLU A OE2 1 
ATOM   1520 N  N   . LEU A 1 199 ? 16.131 39.636 45.728 1.00 44.09  ? 372 LEU A N   1 
ATOM   1521 C  CA  . LEU A 1 199 ? 16.409 38.215 45.954 1.00 44.29  ? 372 LEU A CA  1 
ATOM   1522 C  C   . LEU A 1 199 ? 17.652 38.033 46.808 1.00 44.52  ? 372 LEU A C   1 
ATOM   1523 O  O   . LEU A 1 199 ? 17.666 37.190 47.712 1.00 44.32  ? 372 LEU A O   1 
ATOM   1524 C  CB  . LEU A 1 199 ? 16.576 37.453 44.633 1.00 44.22  ? 372 LEU A CB  1 
ATOM   1525 C  CG  . LEU A 1 199 ? 15.348 37.233 43.736 1.00 43.73  ? 372 LEU A CG  1 
ATOM   1526 C  CD1 . LEU A 1 199 ? 15.689 36.443 42.475 1.00 43.30  ? 372 LEU A CD1 1 
ATOM   1527 C  CD2 . LEU A 1 199 ? 14.245 36.536 44.499 1.00 44.12  ? 372 LEU A CD2 1 
ATOM   1528 N  N   . ALA A 1 200 ? 18.679 38.840 46.518 1.00 44.86  ? 373 ALA A N   1 
ATOM   1529 C  CA  . ALA A 1 200 ? 19.964 38.769 47.216 1.00 45.19  ? 373 ALA A CA  1 
ATOM   1530 C  C   . ALA A 1 200 ? 19.862 39.250 48.648 1.00 45.34  ? 373 ALA A C   1 
ATOM   1531 O  O   . ALA A 1 200 ? 20.376 38.607 49.560 1.00 45.26  ? 373 ALA A O   1 
ATOM   1532 C  CB  . ALA A 1 200 ? 21.013 39.569 46.473 1.00 45.35  ? 373 ALA A CB  1 
ATOM   1533 N  N   . GLU A 1 201 ? 19.207 40.389 48.835 1.00 45.80  ? 374 GLU A N   1 
ATOM   1534 C  CA  . GLU A 1 201 ? 18.915 40.902 50.172 1.00 46.86  ? 374 GLU A CA  1 
ATOM   1535 C  C   . GLU A 1 201 ? 18.266 39.844 51.070 1.00 46.90  ? 374 GLU A C   1 
ATOM   1536 O  O   . GLU A 1 201 ? 18.740 39.604 52.197 1.00 47.14  ? 374 GLU A O   1 
ATOM   1537 C  CB  . GLU A 1 201 ? 18.000 42.137 50.080 1.00 47.24  ? 374 GLU A CB  1 
ATOM   1538 C  CG  . GLU A 1 201 ? 18.646 43.420 50.604 1.00 49.59  ? 374 GLU A CG  1 
ATOM   1539 C  CD  . GLU A 1 201 ? 18.357 44.646 49.743 1.00 51.94  ? 374 GLU A CD  1 
ATOM   1540 O  OE1 . GLU A 1 201 ? 17.233 44.753 49.207 1.00 53.10  ? 374 GLU A OE1 1 
ATOM   1541 O  OE2 . GLU A 1 201 ? 19.265 45.505 49.610 1.00 52.43  ? 374 GLU A OE2 1 
ATOM   1542 N  N   . LEU A 1 202 ? 17.199 39.220 50.547 1.00 46.86  ? 375 LEU A N   1 
ATOM   1543 C  CA  . LEU A 1 202 ? 16.404 38.206 51.246 1.00 46.59  ? 375 LEU A CA  1 
ATOM   1544 C  C   . LEU A 1 202 ? 17.189 36.936 51.537 1.00 47.01  ? 375 LEU A C   1 
ATOM   1545 O  O   . LEU A 1 202 ? 17.157 36.428 52.656 1.00 47.00  ? 375 LEU A O   1 
ATOM   1546 C  CB  . LEU A 1 202 ? 15.177 37.853 50.417 1.00 46.27  ? 375 LEU A CB  1 
ATOM   1547 C  CG  . LEU A 1 202 ? 14.074 37.054 51.094 1.00 45.58  ? 375 LEU A CG  1 
ATOM   1548 C  CD1 . LEU A 1 202 ? 13.276 37.933 52.028 1.00 45.55  ? 375 LEU A CD1 1 
ATOM   1549 C  CD2 . LEU A 1 202 ? 13.176 36.435 50.043 1.00 44.45  ? 375 LEU A CD2 1 
ATOM   1550 N  N   . ALA A 1 203 ? 17.886 36.419 50.528 1.00 47.58  ? 376 ALA A N   1 
ATOM   1551 C  CA  . ALA A 1 203 ? 18.761 35.267 50.719 1.00 48.30  ? 376 ALA A CA  1 
ATOM   1552 C  C   . ALA A 1 203 ? 19.817 35.552 51.786 1.00 48.92  ? 376 ALA A C   1 
ATOM   1553 O  O   . ALA A 1 203 ? 20.278 34.633 52.466 1.00 49.02  ? 376 ALA A O   1 
ATOM   1554 C  CB  . ALA A 1 203 ? 19.425 34.878 49.410 1.00 48.23  ? 376 ALA A CB  1 
ATOM   1555 N  N   . ASN A 1 204 ? 20.188 36.827 51.929 1.00 49.90  ? 377 ASN A N   1 
ATOM   1556 C  CA  . ASN A 1 204 ? 21.201 37.234 52.906 1.00 50.72  ? 377 ASN A CA  1 
ATOM   1557 C  C   . ASN A 1 204 ? 20.635 37.552 54.282 1.00 50.99  ? 377 ASN A C   1 
ATOM   1558 O  O   . ASN A 1 204 ? 20.864 38.636 54.836 1.00 51.07  ? 377 ASN A O   1 
ATOM   1559 C  CB  . ASN A 1 204 ? 22.080 38.364 52.363 1.00 50.79  ? 377 ASN A CB  1 
ATOM   1560 C  CG  . ASN A 1 204 ? 23.170 37.840 51.440 1.00 51.89  ? 377 ASN A CG  1 
ATOM   1561 O  OD1 . ASN A 1 204 ? 24.096 37.149 51.883 1.00 52.88  ? 377 ASN A OD1 1 
ATOM   1562 N  ND2 . ASN A 1 204 ? 23.049 38.136 50.146 1.00 52.93  ? 377 ASN A ND2 1 
ATOM   1563 N  N   . ARG A 1 205 ? 19.875 36.580 54.799 1.00 51.50  ? 378 ARG A N   1 
ATOM   1564 C  CA  . ARG A 1 205 ? 19.394 36.526 56.194 1.00 52.04  ? 378 ARG A CA  1 
ATOM   1565 C  C   . ARG A 1 205 ? 18.651 35.196 56.479 1.00 52.06  ? 378 ARG A C   1 
ATOM   1566 O  O   . ARG A 1 205 ? 19.186 34.099 56.160 1.00 51.96  ? 378 ARG A O   1 
ATOM   1567 C  CB  . ARG A 1 205 ? 18.563 37.776 56.587 1.00 52.13  ? 378 ARG A CB  1 
ATOM   1568 C  CG  . ARG A 1 205 ? 17.561 38.260 55.548 1.00 52.72  ? 378 ARG A CG  1 
ATOM   1569 C  CD  . ARG A 1 205 ? 17.285 39.755 55.739 1.00 54.08  ? 378 ARG A CD  1 
ATOM   1570 N  NE  . ARG A 1 205 ? 16.363 40.313 54.737 1.00 54.98  ? 378 ARG A NE  1 
ATOM   1571 C  CZ  . ARG A 1 205 ? 15.047 40.060 54.687 1.00 54.76  ? 378 ARG A CZ  1 
ATOM   1572 N  NH1 . ARG A 1 205 ? 14.477 39.237 55.575 1.00 54.34  ? 378 ARG A NH1 1 
ATOM   1573 N  NH2 . ARG A 1 205 ? 14.299 40.624 53.741 1.00 54.67  ? 378 ARG A NH2 1 
HETATM 1574 GD GD  . GD  B 2 .   ? 41.187 41.187 13.902 0.25 107.52 ? 1   GD  A GD  1 
HETATM 1575 GD GD  . GD  C 2 .   ? 7.001  22.926 19.470 1.00 124.54 ? 2   GD  A GD  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   49  ?   ?   ?   A . n 
A 1 2   SER 2   50  ?   ?   ?   A . n 
A 1 3   HIS 3   51  ?   ?   ?   A . n 
A 1 4   MET 4   52  ?   ?   ?   A . n 
A 1 5   ARG 5   53  ?   ?   ?   A . n 
A 1 6   LYS 6   54  ?   ?   ?   A . n 
A 1 7   ILE 7   55  55  ILE ILE A . n 
A 1 8   GLN 8   56  56  GLN GLN A . n 
A 1 9   ARG 9   57  57  ARG ARG A . n 
A 1 10  TYR 10  58  58  TYR TYR A . n 
A 1 11  VAL 11  59  59  VAL VAL A . n 
A 1 12  ARG 12  60  60  ARG ARG A . n 
A 1 13  LYS 13  61  61  LYS LYS A . n 
A 1 14  ASP 14  62  62  ASP ASP A . n 
A 1 15  GLY 15  63  63  GLY GLY A . n 
A 1 16  LYS 16  64  64  LYS LYS A . n 
A 1 17  CYS 17  65  65  CYS CYS A . n 
A 1 18  ASN 18  66  66  ASN ASN A . n 
A 1 19  VAL 19  67  67  VAL VAL A . n 
A 1 20  HIS 20  68  68  HIS HIS A . n 
A 1 21  HIS 21  69  69  HIS HIS A . n 
A 1 22  GLY 22  70  70  GLY GLY A . n 
A 1 23  ASN 23  71  71  ASN ASN A . n 
A 1 24  VAL 24  72  72  VAL VAL A . n 
A 1 25  ARG 25  73  73  ARG ARG A . n 
A 1 26  GLU 26  74  ?   ?   ?   A . n 
A 1 27  LYS 27  200 ?   ?   ?   A . n 
A 1 28  ARG 28  201 ?   ?   ?   A . n 
A 1 29  ALA 29  202 202 ALA ALA A . n 
A 1 30  GLU 30  203 203 GLU GLU A . n 
A 1 31  THR 31  204 204 THR THR A . n 
A 1 32  LEU 32  205 205 LEU LEU A . n 
A 1 33  VAL 33  206 206 VAL VAL A . n 
A 1 34  PHE 34  207 207 PHE PHE A . n 
A 1 35  SER 35  208 208 SER SER A . n 
A 1 36  THR 36  209 209 THR THR A . n 
A 1 37  HIS 37  210 210 HIS HIS A . n 
A 1 38  ALA 38  211 211 ALA ALA A . n 
A 1 39  VAL 39  212 212 VAL VAL A . n 
A 1 40  ILE 40  213 213 ILE ILE A . n 
A 1 41  SER 41  214 214 SER SER A . n 
A 1 42  MET 42  215 215 MET MET A . n 
A 1 43  ARG 43  216 216 ARG ARG A . n 
A 1 44  ASP 44  217 217 ASP ASP A . n 
A 1 45  GLY 45  218 218 GLY GLY A . n 
A 1 46  LYS 46  219 219 LYS LYS A . n 
A 1 47  LEU 47  220 220 LEU LEU A . n 
A 1 48  CYS 48  221 221 CYS CYS A . n 
A 1 49  LEU 49  222 222 LEU LEU A . n 
A 1 50  MET 50  223 223 MET MET A . n 
A 1 51  PHE 51  224 224 PHE PHE A . n 
A 1 52  ARG 52  225 225 ARG ARG A . n 
A 1 53  VAL 53  226 226 VAL VAL A . n 
A 1 54  GLY 54  227 227 GLY GLY A . n 
A 1 55  ASP 55  228 228 ASP ASP A . n 
A 1 56  LEU 56  229 229 LEU LEU A . n 
A 1 57  ARG 57  230 230 ARG ARG A . n 
A 1 58  ASN 58  231 231 ASN ASN A . n 
A 1 59  SER 59  232 232 SER SER A . n 
A 1 60  HIS 60  233 233 HIS HIS A . n 
A 1 61  ILE 61  234 234 ILE ILE A . n 
A 1 62  VAL 62  235 235 VAL VAL A . n 
A 1 63  GLU 63  236 236 GLU GLU A . n 
A 1 64  ALA 64  237 237 ALA ALA A . n 
A 1 65  SER 65  238 238 SER SER A . n 
A 1 66  ILE 66  239 239 ILE ILE A . n 
A 1 67  ARG 67  240 240 ARG ARG A . n 
A 1 68  ALA 68  241 241 ALA ALA A . n 
A 1 69  LYS 69  242 242 LYS LYS A . n 
A 1 70  LEU 70  243 243 LEU LEU A . n 
A 1 71  ILE 71  244 244 ILE ILE A . n 
A 1 72  LYS 72  245 245 LYS LYS A . n 
A 1 73  SER 73  246 246 SER SER A . n 
A 1 74  LYS 74  247 247 LYS LYS A . n 
A 1 75  GLN 75  248 248 GLN GLN A . n 
A 1 76  THR 76  249 249 THR THR A . n 
A 1 77  SER 77  250 250 SER SER A . n 
A 1 78  GLU 78  251 251 GLU GLU A . n 
A 1 79  GLY 79  252 252 GLY GLY A . n 
A 1 80  GLU 80  253 253 GLU GLU A . n 
A 1 81  PHE 81  254 254 PHE PHE A . n 
A 1 82  ILE 82  255 255 ILE ILE A . n 
A 1 83  PRO 83  256 256 PRO PRO A . n 
A 1 84  LEU 84  257 257 LEU LEU A . n 
A 1 85  ASN 85  258 258 ASN ASN A . n 
A 1 86  GLN 86  259 259 GLN GLN A . n 
A 1 87  THR 87  260 260 THR THR A . n 
A 1 88  ASP 88  261 261 ASP ASP A . n 
A 1 89  ILE 89  262 262 ILE ILE A . n 
A 1 90  ASN 90  263 263 ASN ASN A . n 
A 1 91  VAL 91  264 264 VAL VAL A . n 
A 1 92  GLY 92  265 265 GLY GLY A . n 
A 1 93  TYR 93  266 266 TYR TYR A . n 
A 1 94  TYR 94  267 267 TYR TYR A . n 
A 1 95  THR 95  268 268 THR THR A . n 
A 1 96  GLY 96  269 269 GLY GLY A . n 
A 1 97  ASP 97  270 270 ASP ASP A . n 
A 1 98  ASP 98  271 271 ASP ASP A . n 
A 1 99  ARG 99  272 272 ARG ARG A . n 
A 1 100 LEU 100 273 273 LEU LEU A . n 
A 1 101 PHE 101 274 274 PHE PHE A . n 
A 1 102 LEU 102 275 275 LEU LEU A . n 
A 1 103 VAL 103 276 276 VAL VAL A . n 
A 1 104 SER 104 277 277 SER SER A . n 
A 1 105 PRO 105 278 278 PRO PRO A . n 
A 1 106 LEU 106 279 279 LEU LEU A . n 
A 1 107 ILE 107 280 280 ILE ILE A . n 
A 1 108 ILE 108 281 281 ILE ILE A . n 
A 1 109 SER 109 282 282 SER SER A . n 
A 1 110 HIS 110 283 283 HIS HIS A . n 
A 1 111 GLU 111 284 284 GLU GLU A . n 
A 1 112 ILE 112 285 285 ILE ILE A . n 
A 1 113 ASN 113 286 286 ASN ASN A . n 
A 1 114 GLN 114 287 287 GLN GLN A . n 
A 1 115 GLN 115 288 288 GLN GLN A . n 
A 1 116 SER 116 289 289 SER SER A . n 
A 1 117 PRO 117 290 290 PRO PRO A . n 
A 1 118 PHE 118 291 291 PHE PHE A . n 
A 1 119 TRP 119 292 292 TRP TRP A . n 
A 1 120 GLU 120 293 293 GLU GLU A . n 
A 1 121 ILE 121 294 294 ILE ILE A . n 
A 1 122 SER 122 295 295 SER SER A . n 
A 1 123 LYS 123 296 296 LYS LYS A . n 
A 1 124 ALA 124 297 297 ALA ALA A . n 
A 1 125 GLN 125 298 298 GLN GLN A . n 
A 1 126 LEU 126 299 299 LEU LEU A . n 
A 1 127 PRO 127 300 300 PRO PRO A . n 
A 1 128 LYS 128 301 301 LYS LYS A . n 
A 1 129 GLU 129 302 302 GLU GLU A . n 
A 1 130 GLU 130 303 303 GLU GLU A . n 
A 1 131 LEU 131 304 304 LEU LEU A . n 
A 1 132 GLU 132 305 305 GLU GLU A . n 
A 1 133 ILE 133 306 306 ILE ILE A . n 
A 1 134 VAL 134 307 307 VAL VAL A . n 
A 1 135 VAL 135 308 308 VAL VAL A . n 
A 1 136 ILE 136 309 309 ILE ILE A . n 
A 1 137 LEU 137 310 310 LEU LEU A . n 
A 1 138 GLU 138 311 311 GLU GLU A . n 
A 1 139 GLY 139 312 312 GLY GLY A . n 
A 1 140 MET 140 313 313 MET MET A . n 
A 1 141 VAL 141 314 314 VAL VAL A . n 
A 1 142 GLU 142 315 315 GLU GLU A . n 
A 1 143 ALA 143 316 316 ALA ALA A . n 
A 1 144 THR 144 317 317 THR THR A . n 
A 1 145 GLY 145 318 318 GLY GLY A . n 
A 1 146 MET 146 319 319 MET MET A . n 
A 1 147 THR 147 320 320 THR THR A . n 
A 1 148 CYS 148 321 321 CYS CYS A . n 
A 1 149 GLN 149 322 322 GLN GLN A . n 
A 1 150 ALA 150 323 323 ALA ALA A . n 
A 1 151 ARG 151 324 324 ARG ARG A . n 
A 1 152 SER 152 325 325 SER SER A . n 
A 1 153 SER 153 326 326 SER SER A . n 
A 1 154 TYR 154 327 327 TYR TYR A . n 
A 1 155 ILE 155 328 328 ILE ILE A . n 
A 1 156 THR 156 329 329 THR THR A . n 
A 1 157 SER 157 330 330 SER SER A . n 
A 1 158 GLU 158 331 331 GLU GLU A . n 
A 1 159 ILE 159 332 332 ILE ILE A . n 
A 1 160 LEU 160 333 333 LEU LEU A . n 
A 1 161 TRP 161 334 334 TRP TRP A . n 
A 1 162 GLY 162 335 335 GLY GLY A . n 
A 1 163 TYR 163 336 336 TYR TYR A . n 
A 1 164 ARG 164 337 337 ARG ARG A . n 
A 1 165 PHE 165 338 338 PHE PHE A . n 
A 1 166 THR 166 339 339 THR THR A . n 
A 1 167 PRO 167 340 340 PRO PRO A . n 
A 1 168 VAL 168 341 341 VAL VAL A . n 
A 1 169 LEU 169 342 342 LEU LEU A . n 
A 1 170 THR 170 343 343 THR THR A . n 
A 1 171 LEU 171 344 344 LEU LEU A . n 
A 1 172 GLU 172 345 345 GLU GLU A . n 
A 1 173 ASP 173 346 346 ASP ASP A . n 
A 1 174 GLY 174 347 347 GLY GLY A . n 
A 1 175 PHE 175 348 348 PHE PHE A . n 
A 1 176 TYR 176 349 349 TYR TYR A . n 
A 1 177 GLU 177 350 350 GLU GLU A . n 
A 1 178 VAL 178 351 351 VAL VAL A . n 
A 1 179 ASP 179 352 352 ASP ASP A . n 
A 1 180 TYR 180 353 353 TYR TYR A . n 
A 1 181 ASN 181 354 354 ASN ASN A . n 
A 1 182 SER 182 355 355 SER SER A . n 
A 1 183 PHE 183 356 356 PHE PHE A . n 
A 1 184 HIS 184 357 357 HIS HIS A . n 
A 1 185 GLU 185 358 358 GLU GLU A . n 
A 1 186 THR 186 359 359 THR THR A . n 
A 1 187 TYR 187 360 360 TYR TYR A . n 
A 1 188 GLU 188 361 361 GLU GLU A . n 
A 1 189 THR 189 362 362 THR THR A . n 
A 1 190 SER 190 363 363 SER SER A . n 
A 1 191 THR 191 364 364 THR THR A . n 
A 1 192 PRO 192 365 365 PRO PRO A . n 
A 1 193 SER 193 366 366 SER SER A . n 
A 1 194 LEU 194 367 367 LEU LEU A . n 
A 1 195 SER 195 368 368 SER SER A . n 
A 1 196 ALA 196 369 369 ALA ALA A . n 
A 1 197 LYS 197 370 370 LYS LYS A . n 
A 1 198 GLU 198 371 371 GLU GLU A . n 
A 1 199 LEU 199 372 372 LEU LEU A . n 
A 1 200 ALA 200 373 373 ALA ALA A . n 
A 1 201 GLU 201 374 374 GLU GLU A . n 
A 1 202 LEU 202 375 375 LEU LEU A . n 
A 1 203 ALA 203 376 376 ALA ALA A . n 
A 1 204 ASN 204 377 377 ASN ASN A . n 
A 1 205 ARG 205 378 378 ARG ARG A . n 
A 1 206 ALA 206 379 ?   ?   ?   A . n 
A 1 207 GLU 207 380 ?   ?   ?   A . n 
A 1 208 LEU 208 381 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GD 1 1 1 GD GD A . 
C 2 GD 1 2 2 GD GD A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12030 ? 
1 MORE         -12   ? 
1 'SSA (A^2)'  34480 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  1.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000  0.0000000000 82.3730000000 0.0000000000  
-1.0000000000 0.0000000000 82.3730000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_655 -y+1,x,z    0.0000000000  -1.0000000000 0.0000000000 82.3730000000 1.0000000000  0.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_565 y,-x+1,z    0.0000000000  1.0000000000  0.0000000000 0.0000000000  -1.0000000000 0.0000000000 
0.0000000000 82.3730000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    GD 
_pdbx_struct_special_symmetry.auth_seq_id     1 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   B 
_pdbx_struct_special_symmetry.label_comp_id   GD 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   OE2 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   GLU 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    185 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    GLU 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     358 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   GD 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   C 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   GD 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    GD 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     2 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   OE1 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   GLU 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    185 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    GLU 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     358 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 39.3 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-10-19 
2 'Structure model' 1 1 2013-06-05 
3 'Structure model' 1 2 2017-08-16 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
3 3 'Structure model' 'Source and taxonomy'    
4 4 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen 
2 3 'Structure model' software       
3 4 'Structure model' software       
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .        ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 MOLREP      .        ?               program 'Alexei Vaguine'     alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html  Fortran_77 ? 
3 REFMAC      5.5.0109 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.10     'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 DENZO       .        ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 57  ? ? -46.33  151.09 
2 1 ASN A 66  ? ? -113.90 52.87  
3 1 HIS A 69  ? ? -31.67  122.81 
4 1 SER A 277 ? ? 178.63  151.49 
5 1 ALA A 316 ? ? -55.79  -71.27 
6 1 SER A 330 ? ? -57.06  -5.33  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 49  ? A GLY 1   
2  1 Y 1 A SER 50  ? A SER 2   
3  1 Y 1 A HIS 51  ? A HIS 3   
4  1 Y 1 A MET 52  ? A MET 4   
5  1 Y 1 A ARG 53  ? A ARG 5   
6  1 Y 1 A LYS 54  ? A LYS 6   
7  1 Y 1 A GLU 74  ? A GLU 26  
8  1 Y 1 A LYS 200 ? A LYS 27  
9  1 Y 1 A ARG 201 ? A ARG 28  
10 1 Y 1 A ALA 379 ? A ALA 206 
11 1 Y 1 A GLU 380 ? A GLU 207 
12 1 Y 1 A LEU 381 ? A LEU 208 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'GADOLINIUM ATOM' 
_pdbx_entity_nonpoly.comp_id     GD 
#