data_3ATE
# 
_entry.id   3ATE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ATE         
RCSB  RCSB029671   
WWPDB D_1000029671 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3agw . unspecified 
PDB 2e4f . unspecified 
PDB 3AT8 . unspecified 
PDB 3AT9 . unspecified 
PDB 3ATA . unspecified 
PDB 3ATB . unspecified 
PDB 3ATD . unspecified 
PDB 3ATF . unspecified 
# 
_pdbx_database_status.entry_id                        3ATE 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-28 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Inanobe, A.' 1 
'Kurachi, Y.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                41801 
_citation.page_last                 41811 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21982822 
_citation.pdbx_database_id_DOI      10.1074/jbc.M111.278531 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Inanobe, A.'  1 
primary 'Nakagawa, A.' 2 
primary 'Kurachi, Y.'  3 
# 
_cell.length_a           82.775 
_cell.length_b           82.775 
_cell.length_c           172.894 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3ATE 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.entry_id                         3ATE 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                97 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Potassium inwardly-rectifying channel, subfamily J, member 6' 23748.988 1 ? ? 'RESIDUES 53-74, 200-381' 
;CYTOPLASMIC N- AND C-TERMINI (RESIDUES 53-74 AND 200-381, RESPECTIVELY) OF G-PROTEIN-GATED INWARD RECTIFIER POTASSIUM CHANNEL KIR3.2 ARE CONCATENATED DIRECTLY.
;
2 non-polymer syn 'PRASEODYMIUM ION'                                             140.908   3 ? ? ?                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'G protein-activated inward rectifier potassium channel 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ARG n 
1 6   LYS n 
1 7   ILE n 
1 8   GLN n 
1 9   ARG n 
1 10  TYR n 
1 11  VAL n 
1 12  ARG n 
1 13  LYS n 
1 14  ASP n 
1 15  GLY n 
1 16  LYS n 
1 17  CYS n 
1 18  ASN n 
1 19  VAL n 
1 20  HIS n 
1 21  HIS n 
1 22  GLY n 
1 23  ASN n 
1 24  VAL n 
1 25  ARG n 
1 26  GLU n 
1 27  LYS n 
1 28  ARG n 
1 29  ALA n 
1 30  GLU n 
1 31  THR n 
1 32  LEU n 
1 33  VAL n 
1 34  PHE n 
1 35  SER n 
1 36  THR n 
1 37  HIS n 
1 38  ALA n 
1 39  VAL n 
1 40  ILE n 
1 41  SER n 
1 42  MET n 
1 43  ARG n 
1 44  ASP n 
1 45  GLY n 
1 46  LYS n 
1 47  LEU n 
1 48  CYS n 
1 49  LEU n 
1 50  MET n 
1 51  PHE n 
1 52  ARG n 
1 53  VAL n 
1 54  GLY n 
1 55  ASP n 
1 56  LEU n 
1 57  ARG n 
1 58  ASN n 
1 59  SER n 
1 60  HIS n 
1 61  ILE n 
1 62  VAL n 
1 63  GLU n 
1 64  ALA n 
1 65  SER n 
1 66  ILE n 
1 67  ARG n 
1 68  ALA n 
1 69  LYS n 
1 70  LEU n 
1 71  ILE n 
1 72  LYS n 
1 73  SER n 
1 74  LYS n 
1 75  GLN n 
1 76  THR n 
1 77  SER n 
1 78  GLU n 
1 79  GLY n 
1 80  GLU n 
1 81  PHE n 
1 82  ILE n 
1 83  PRO n 
1 84  LEU n 
1 85  ASN n 
1 86  GLN n 
1 87  THR n 
1 88  ASP n 
1 89  ILE n 
1 90  ASN n 
1 91  VAL n 
1 92  GLY n 
1 93  TYR n 
1 94  TYR n 
1 95  THR n 
1 96  GLY n 
1 97  ASP n 
1 98  ASP n 
1 99  ARG n 
1 100 LEU n 
1 101 PHE n 
1 102 LEU n 
1 103 VAL n 
1 104 SER n 
1 105 PRO n 
1 106 LEU n 
1 107 ILE n 
1 108 ILE n 
1 109 SER n 
1 110 HIS n 
1 111 GLU n 
1 112 ILE n 
1 113 ASN n 
1 114 GLN n 
1 115 GLN n 
1 116 SER n 
1 117 PRO n 
1 118 PHE n 
1 119 TRP n 
1 120 GLU n 
1 121 ILE n 
1 122 SER n 
1 123 LYS n 
1 124 ALA n 
1 125 GLN n 
1 126 LEU n 
1 127 PRO n 
1 128 LYS n 
1 129 GLU n 
1 130 GLU n 
1 131 LEU n 
1 132 GLU n 
1 133 ILE n 
1 134 VAL n 
1 135 VAL n 
1 136 ILE n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 MET n 
1 141 VAL n 
1 142 GLU n 
1 143 ALA n 
1 144 THR n 
1 145 GLY n 
1 146 MET n 
1 147 THR n 
1 148 CYS n 
1 149 GLN n 
1 150 ALA n 
1 151 ARG n 
1 152 SER n 
1 153 SER n 
1 154 TYR n 
1 155 ILE n 
1 156 THR n 
1 157 SER n 
1 158 GLU n 
1 159 ILE n 
1 160 LEU n 
1 161 TRP n 
1 162 GLY n 
1 163 TYR n 
1 164 ARG n 
1 165 PHE n 
1 166 THR n 
1 167 PRO n 
1 168 VAL n 
1 169 LEU n 
1 170 THR n 
1 171 LEU n 
1 172 GLU n 
1 173 ASP n 
1 174 GLY n 
1 175 PHE n 
1 176 TYR n 
1 177 GLU n 
1 178 VAL n 
1 179 ASP n 
1 180 TYR n 
1 181 ASN n 
1 182 SER n 
1 183 PHE n 
1 184 HIS n 
1 185 GLU n 
1 186 THR n 
1 187 TYR n 
1 188 GLU n 
1 189 THR n 
1 190 SER n 
1 191 THR n 
1 192 PRO n 
1 193 SER n 
1 194 LEU n 
1 195 SER n 
1 196 ALA n 
1 197 LYS n 
1 198 GLU n 
1 199 LEU n 
1 200 ALA n 
1 201 GLU n 
1 202 LEU n 
1 203 ALA n 
1 204 ASN n 
1 205 ARG n 
1 206 ALA n 
1 207 GLU n 
1 208 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 5  26  mouse ? ? ? Balb/c ? ? ? ? 'mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'ROSSETA2 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
1 2 sample ? 27 208 mouse ? ? ? Balb/c ? ? ? ? 'mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'ROSSETA2 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q0VB45_MOUSE 
_struct_ref.pdbx_db_accession          Q0VB45 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RKIQRYVRKDGKCNVHHGNVRE 
_struct_ref.pdbx_align_begin           53 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ATE A 5  ? 26  ? Q0VB45 53  ? 74  ? 53  74  
2 1 3ATE A 27 ? 208 ? Q0VB45 200 ? 381 ? 200 381 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ATE GLY A 1 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 49 1 
1 3ATE SER A 2 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 50 2 
1 3ATE HIS A 3 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 51 3 
1 3ATE MET A 4 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 52 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'    ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE          ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE         ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE      ? 'C9 H11 N O2'    165.189 
PR  non-polymer         . 'PRASEODYMIUM ION' ? 'Pr 3'           140.908 
PRO 'L-peptide linking' y PROLINE            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE             ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3ATE 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.12 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   60.55 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'hanging drop' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    'Ethanol, pH 8.0, hanging drop, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2010-06-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'double crystal' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.6000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44XU' 
_diffrn_source.pdbx_wavelength_list        1.6000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL44XU 
# 
_reflns.entry_id                     3ATE 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            3.20 
_reflns.d_resolution_low             50.00 
_reflns.number_all                   137769 
_reflns.number_obs                   137756 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.150 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              26.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  3.20 
_reflns_shell.d_res_low                   3.31 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.percent_possible_all        96.0 
_reflns_shell.Rmerge_I_obs                0.603 
_reflns_shell.meanI_over_sigI_obs         3.00 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_redundancy             10.7 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3ATE 
_refine.ls_d_res_high                            3.2000 
_refine.ls_d_res_low                             48.47 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.4900 
_refine.ls_number_reflns_obs                     5239 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2742 
_refine.ls_R_factor_R_work                       0.2672 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.3245 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 12.7000 
_refine.ls_number_reflns_R_free                  664 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               69.0046 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.0300 
_refine.aniso_B[2][2]                            0.0300 
_refine.aniso_B[3][3]                            -0.0600 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.8760 
_refine.correlation_coeff_Fo_to_Fc_free          0.8470 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  0.6380 
_refine.overall_SU_ML                            0.4630 
_refine.overall_SU_B                             27.4050 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                167.270 
_refine.B_iso_min                                46.880 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1568 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1571 
_refine_hist.d_res_high                       3.2000 
_refine_hist.d_res_low                        48.47 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       1599 0.012  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    2163 1.270  1.955  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 194  6.086  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 76   32.351 23.947 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 284  18.493 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 11   15.899 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         245  0.077  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   1199 0.004  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            974  0.440  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1581 0.830  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            625  0.887  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           582  1.616  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       3.2020 
_refine_ls_shell.d_res_low                        3.2850 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               95.1500 
_refine_ls_shell.number_reflns_R_work             307 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3420 
_refine_ls_shell.R_factor_R_free                  0.3990 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             46 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                353 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3ATE 
_struct.title                     
'Crystal Structure of the Kir3.2 Cytoplasmic Domain (Na+-free crystal soaked in 10 mM praseodymium (III) acetate)' 
_struct.pdbx_descriptor           'Potassium inwardly-rectifying channel, subfamily J, member 6' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ATE 
_struct_keywords.text            
'Cytoplasmic assembly, beta-barrel, ion transport, G protein beta-gamma subunits, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 125 ? GLU A 129 ? GLN A 298 GLU A 302 5 ? 5  
HELX_P HELX_P2 2 TYR A 180 ? PHE A 183 ? TYR A 353 PHE A 356 5 ? 4  
HELX_P HELX_P3 3 SER A 195 ? ASN A 204 ? SER A 368 ASN A 377 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A GLU 185 OE2 ? ? ? 1_555 C PR . PR ? ? A GLU 358 A PR 2 1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc2 metalc ? ? A GLU 63  OE2 ? ? ? 1_555 B PR . PR ? ? A GLU 236 A PR 1 1_555 ? ? ? ? ? ? ? 2.863 ? 
metalc3 metalc ? ? A GLU 185 OE1 ? ? ? 1_555 C PR . PR ? ? A GLU 358 A PR 2 1_555 ? ? ? ? ? ? ? 3.048 ? 
metalc4 metalc ? ? A GLU 63  OE1 ? ? ? 1_555 B PR . PR ? ? A GLU 236 A PR 1 1_555 ? ? ? ? ? ? ? 3.301 ? 
metalc5 metalc ? ? A SER 182 OG  ? ? ? 1_555 C PR . PR ? ? A SER 355 A PR 2 1_555 ? ? ? ? ? ? ? 3.464 ? 
metalc6 metalc ? ? A GLU 172 OE2 ? ? ? 1_555 D PR . PR ? ? A GLU 345 A PR 3 1_555 ? ? ? ? ? ? ? 3.481 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 106 ? GLU A 111 ? LEU A 279 GLU A 284 
A 2 LYS A 46  ? VAL A 53  ? LYS A 219 VAL A 226 
A 3 ALA A 38  ? ARG A 43  ? ALA A 211 ARG A 216 
A 4 ILE A 159 ? TRP A 161 ? ILE A 332 TRP A 334 
B 1 GLN A 86  ? ASP A 88  ? GLN A 259 ASP A 261 
B 2 ILE A 61  ? ILE A 71  ? ILE A 234 ILE A 244 
B 3 GLU A 132 ? VAL A 141 ? GLU A 305 VAL A 314 
B 4 THR A 147 ? ILE A 155 ? THR A 320 ILE A 328 
C 1 LYS A 74  ? GLN A 75  ? LYS A 247 GLN A 248 
C 2 PHE A 81  ? ILE A 82  ? PHE A 254 ILE A 255 
D 1 TYR A 163 ? PHE A 165 ? TYR A 336 PHE A 338 
D 2 THR A 186 ? GLU A 188 ? THR A 359 GLU A 361 
E 1 LEU A 169 ? GLU A 172 ? LEU A 342 GLU A 345 
E 2 PHE A 175 ? VAL A 178 ? PHE A 348 VAL A 351 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 108 ? O ILE A 281 N PHE A 51  ? N PHE A 224 
A 2 3 O MET A 50  ? O MET A 223 N VAL A 39  ? N VAL A 212 
A 3 4 N ALA A 38  ? N ALA A 211 O LEU A 160 ? O LEU A 333 
B 1 2 O THR A 87  ? O THR A 260 N LEU A 70  ? N LEU A 243 
B 2 3 N LYS A 69  ? N LYS A 242 O VAL A 134 ? O VAL A 307 
B 3 4 N GLY A 139 ? N GLY A 312 O CYS A 148 ? O CYS A 321 
C 1 2 N LYS A 74  ? N LYS A 247 O ILE A 82  ? O ILE A 255 
D 1 2 N ARG A 164 ? N ARG A 337 O TYR A 187 ? O TYR A 360 
E 1 2 N THR A 170 ? N THR A 343 O GLU A 177 ? O GLU A 350 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PR A 1' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PR A 2' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PR A 3' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 GLU A 63  ? GLU A 236 . ? 4_565 ? 
2 AC1 4 GLU A 63  ? GLU A 236 . ? 1_555 ? 
3 AC1 4 GLU A 63  ? GLU A 236 . ? 3_655 ? 
4 AC1 4 GLU A 63  ? GLU A 236 . ? 2_665 ? 
5 AC2 2 SER A 182 ? SER A 355 . ? 1_555 ? 
6 AC2 2 GLU A 185 ? GLU A 358 . ? 1_555 ? 
7 AC3 1 GLU A 172 ? GLU A 345 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3ATE 
_atom_sites.fract_transf_matrix[1][1]   0.012081 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012081 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005784 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
PR 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 7   ? 28.899 7.159  23.253 1.00 71.61  ? 55  ILE A N   1 
ATOM   2    C  CA  . ILE A 1 7   ? 28.956 8.658  23.182 1.00 71.79  ? 55  ILE A CA  1 
ATOM   3    C  C   . ILE A 1 7   ? 29.115 9.168  21.744 1.00 71.61  ? 55  ILE A C   1 
ATOM   4    O  O   . ILE A 1 7   ? 30.022 8.736  21.009 1.00 71.75  ? 55  ILE A O   1 
ATOM   5    C  CB  . ILE A 1 7   ? 30.093 9.261  24.077 1.00 71.91  ? 55  ILE A CB  1 
ATOM   6    C  CG1 . ILE A 1 7   ? 30.304 10.751 23.746 1.00 71.73  ? 55  ILE A CG1 1 
ATOM   7    C  CG2 . ILE A 1 7   ? 31.411 8.460  23.929 1.00 72.23  ? 55  ILE A CG2 1 
ATOM   8    C  CD1 . ILE A 1 7   ? 30.945 11.575 24.863 1.00 71.70  ? 55  ILE A CD1 1 
ATOM   9    N  N   . GLN A 1 8   ? 28.247 10.108 21.365 1.00 71.08  ? 56  GLN A N   1 
ATOM   10   C  CA  . GLN A 1 8   ? 28.233 10.628 20.011 1.00 70.64  ? 56  GLN A CA  1 
ATOM   11   C  C   . GLN A 1 8   ? 28.923 12.010 19.872 1.00 69.99  ? 56  GLN A C   1 
ATOM   12   O  O   . GLN A 1 8   ? 28.372 13.030 20.298 1.00 69.98  ? 56  GLN A O   1 
ATOM   13   C  CB  . GLN A 1 8   ? 26.781 10.653 19.529 1.00 70.87  ? 56  GLN A CB  1 
ATOM   14   C  CG  . GLN A 1 8   ? 26.618 10.804 18.027 1.00 72.62  ? 56  GLN A CG  1 
ATOM   15   C  CD  . GLN A 1 8   ? 27.649 10.013 17.235 1.00 74.44  ? 56  GLN A CD  1 
ATOM   16   O  OE1 . GLN A 1 8   ? 28.548 10.602 16.620 1.00 75.81  ? 56  GLN A OE1 1 
ATOM   17   N  NE2 . GLN A 1 8   ? 27.532 8.674  17.257 1.00 73.59  ? 56  GLN A NE2 1 
ATOM   18   N  N   . ARG A 1 9   ? 30.127 12.025 19.284 1.00 69.28  ? 57  ARG A N   1 
ATOM   19   C  CA  . ARG A 1 9   ? 30.884 13.261 18.990 1.00 68.57  ? 57  ARG A CA  1 
ATOM   20   C  C   . ARG A 1 9   ? 30.088 14.406 18.355 1.00 68.44  ? 57  ARG A C   1 
ATOM   21   O  O   . ARG A 1 9   ? 29.189 14.184 17.543 1.00 68.69  ? 57  ARG A O   1 
ATOM   22   C  CB  . ARG A 1 9   ? 32.020 12.949 18.022 1.00 68.48  ? 57  ARG A CB  1 
ATOM   23   C  CG  . ARG A 1 9   ? 33.355 12.763 18.650 1.00 67.84  ? 57  ARG A CG  1 
ATOM   24   C  CD  . ARG A 1 9   ? 34.421 12.691 17.586 1.00 66.80  ? 57  ARG A CD  1 
ATOM   25   N  NE  . ARG A 1 9   ? 35.560 11.930 18.083 1.00 66.39  ? 57  ARG A NE  1 
ATOM   26   C  CZ  . ARG A 1 9   ? 36.626 12.449 18.694 1.00 65.48  ? 57  ARG A CZ  1 
ATOM   27   N  NH1 . ARG A 1 9   ? 36.752 13.760 18.890 1.00 64.27  ? 57  ARG A NH1 1 
ATOM   28   N  NH2 . ARG A 1 9   ? 37.588 11.640 19.101 1.00 65.45  ? 57  ARG A NH2 1 
ATOM   29   N  N   . TYR A 1 10  ? 30.476 15.631 18.691 1.00 68.05  ? 58  TYR A N   1 
ATOM   30   C  CA  . TYR A 1 10  ? 29.890 16.838 18.121 1.00 67.86  ? 58  TYR A CA  1 
ATOM   31   C  C   . TYR A 1 10  ? 30.868 17.457 17.131 1.00 67.31  ? 58  TYR A C   1 
ATOM   32   O  O   . TYR A 1 10  ? 30.470 18.142 16.191 1.00 67.38  ? 58  TYR A O   1 
ATOM   33   C  CB  . TYR A 1 10  ? 29.608 17.803 19.261 1.00 68.31  ? 58  TYR A CB  1 
ATOM   34   C  CG  . TYR A 1 10  ? 28.917 19.103 18.925 1.00 70.20  ? 58  TYR A CG  1 
ATOM   35   C  CD1 . TYR A 1 10  ? 27.912 19.179 17.959 1.00 71.64  ? 58  TYR A CD1 1 
ATOM   36   C  CD2 . TYR A 1 10  ? 29.241 20.256 19.636 1.00 73.20  ? 58  TYR A CD2 1 
ATOM   37   C  CE1 . TYR A 1 10  ? 27.273 20.389 17.684 1.00 74.35  ? 58  TYR A CE1 1 
ATOM   38   C  CE2 . TYR A 1 10  ? 28.613 21.462 19.384 1.00 75.92  ? 58  TYR A CE2 1 
ATOM   39   C  CZ  . TYR A 1 10  ? 27.629 21.532 18.407 1.00 76.96  ? 58  TYR A CZ  1 
ATOM   40   O  OH  . TYR A 1 10  ? 27.022 22.762 18.173 1.00 78.69  ? 58  TYR A OH  1 
ATOM   41   N  N   . VAL A 1 11  ? 32.153 17.199 17.353 1.00 66.72  ? 59  VAL A N   1 
ATOM   42   C  CA  . VAL A 1 11  ? 33.232 17.680 16.494 1.00 65.90  ? 59  VAL A CA  1 
ATOM   43   C  C   . VAL A 1 11  ? 34.230 16.540 16.238 1.00 65.56  ? 59  VAL A C   1 
ATOM   44   O  O   . VAL A 1 11  ? 34.763 15.969 17.184 1.00 65.51  ? 59  VAL A O   1 
ATOM   45   C  CB  . VAL A 1 11  ? 33.982 18.839 17.181 1.00 65.91  ? 59  VAL A CB  1 
ATOM   46   C  CG1 . VAL A 1 11  ? 35.159 19.275 16.339 1.00 66.13  ? 59  VAL A CG1 1 
ATOM   47   C  CG2 . VAL A 1 11  ? 33.047 20.018 17.474 1.00 65.38  ? 59  VAL A CG2 1 
ATOM   48   N  N   . ARG A 1 12  ? 34.488 16.196 14.978 1.00 65.33  ? 60  ARG A N   1 
ATOM   49   C  CA  . ARG A 1 12  ? 35.390 15.054 14.674 1.00 65.25  ? 60  ARG A CA  1 
ATOM   50   C  C   . ARG A 1 12  ? 36.866 15.423 14.755 1.00 64.78  ? 60  ARG A C   1 
ATOM   51   O  O   . ARG A 1 12  ? 37.207 16.604 14.765 1.00 64.61  ? 60  ARG A O   1 
ATOM   52   C  CB  . ARG A 1 12  ? 35.089 14.448 13.297 1.00 65.50  ? 60  ARG A CB  1 
ATOM   53   C  CG  . ARG A 1 12  ? 33.934 13.445 13.308 1.00 66.32  ? 60  ARG A CG  1 
ATOM   54   C  CD  . ARG A 1 12  ? 33.531 13.043 11.897 1.00 67.05  ? 60  ARG A CD  1 
ATOM   55   N  NE  . ARG A 1 12  ? 32.960 14.155 11.128 1.00 67.98  ? 60  ARG A NE  1 
ATOM   56   C  CZ  . ARG A 1 12  ? 32.420 14.028 9.911  1.00 68.08  ? 60  ARG A CZ  1 
ATOM   57   N  NH1 . ARG A 1 12  ? 32.366 12.832 9.325  1.00 67.96  ? 60  ARG A NH1 1 
ATOM   58   N  NH2 . ARG A 1 12  ? 31.920 15.090 9.278  1.00 68.44  ? 60  ARG A NH2 1 
ATOM   59   N  N   . LYS A 1 13  ? 37.739 14.416 14.798 1.00 64.45  ? 61  LYS A N   1 
ATOM   60   C  CA  . LYS A 1 13  ? 39.174 14.684 14.900 1.00 64.20  ? 61  LYS A CA  1 
ATOM   61   C  C   . LYS A 1 13  ? 39.616 15.712 13.879 1.00 64.19  ? 61  LYS A C   1 
ATOM   62   O  O   . LYS A 1 13  ? 40.263 16.689 14.242 1.00 64.05  ? 61  LYS A O   1 
ATOM   63   C  CB  . LYS A 1 13  ? 40.030 13.416 14.765 1.00 64.15  ? 61  LYS A CB  1 
ATOM   64   C  CG  . LYS A 1 13  ? 39.669 12.263 15.745 1.00 63.92  ? 61  LYS A CG  1 
ATOM   65   C  CD  . LYS A 1 13  ? 39.707 12.669 17.237 1.00 61.96  ? 61  LYS A CD  1 
ATOM   66   C  CE  . LYS A 1 13  ? 41.066 12.402 17.901 1.00 61.06  ? 61  LYS A CE  1 
ATOM   67   N  NZ  . LYS A 1 13  ? 41.075 12.832 19.329 1.00 59.09  ? 61  LYS A NZ  1 
ATOM   68   N  N   . ASP A 1 14  ? 39.255 15.518 12.612 1.00 64.35  ? 62  ASP A N   1 
ATOM   69   C  CA  . ASP A 1 14  ? 39.717 16.440 11.561 1.00 64.33  ? 62  ASP A CA  1 
ATOM   70   C  C   . ASP A 1 14  ? 39.138 17.848 11.685 1.00 64.36  ? 62  ASP A C   1 
ATOM   71   O  O   . ASP A 1 14  ? 39.640 18.780 11.056 1.00 64.31  ? 62  ASP A O   1 
ATOM   72   C  CB  . ASP A 1 14  ? 39.494 15.879 10.146 1.00 64.34  ? 62  ASP A CB  1 
ATOM   73   C  CG  . ASP A 1 14  ? 38.033 15.590 9.843  1.00 64.05  ? 62  ASP A CG  1 
ATOM   74   O  OD1 . ASP A 1 14  ? 37.150 15.998 10.639 1.00 63.82  ? 62  ASP A OD1 1 
ATOM   75   O  OD2 . ASP A 1 14  ? 37.775 14.936 8.806  1.00 63.62  ? 62  ASP A OD2 1 
ATOM   76   N  N   . GLY A 1 15  ? 38.090 18.000 12.494 1.00 64.63  ? 63  GLY A N   1 
ATOM   77   C  CA  . GLY A 1 15  ? 37.537 19.327 12.773 1.00 65.15  ? 63  GLY A CA  1 
ATOM   78   C  C   . GLY A 1 15  ? 36.164 19.655 12.189 1.00 65.62  ? 63  GLY A C   1 
ATOM   79   O  O   . GLY A 1 15  ? 35.627 20.736 12.442 1.00 65.51  ? 63  GLY A O   1 
ATOM   80   N  N   . LYS A 1 16  ? 35.594 18.736 11.410 1.00 66.36  ? 64  LYS A N   1 
ATOM   81   C  CA  . LYS A 1 16  ? 34.256 18.924 10.849 1.00 67.05  ? 64  LYS A CA  1 
ATOM   82   C  C   . LYS A 1 16  ? 33.212 18.516 11.872 1.00 67.55  ? 64  LYS A C   1 
ATOM   83   O  O   . LYS A 1 16  ? 33.287 17.422 12.447 1.00 67.39  ? 64  LYS A O   1 
ATOM   84   C  CB  . LYS A 1 16  ? 34.058 18.098 9.573  1.00 67.12  ? 64  LYS A CB  1 
ATOM   85   C  CG  . LYS A 1 16  ? 35.264 18.028 8.626  1.00 67.50  ? 64  LYS A CG  1 
ATOM   86   C  CD  . LYS A 1 16  ? 34.891 17.290 7.326  1.00 67.92  ? 64  LYS A CD  1 
ATOM   87   C  CE  . LYS A 1 16  ? 36.120 16.717 6.614  1.00 68.29  ? 64  LYS A CE  1 
ATOM   88   N  NZ  . LYS A 1 16  ? 37.108 17.772 6.207  1.00 68.47  ? 64  LYS A NZ  1 
ATOM   89   N  N   . CYS A 1 17  ? 32.232 19.393 12.077 1.00 68.51  ? 65  CYS A N   1 
ATOM   90   C  CA  . CYS A 1 17  ? 31.175 19.186 13.082 1.00 69.62  ? 65  CYS A CA  1 
ATOM   91   C  C   . CYS A 1 17  ? 30.104 18.209 12.599 1.00 70.59  ? 65  CYS A C   1 
ATOM   92   O  O   . CYS A 1 17  ? 29.873 18.077 11.400 1.00 71.08  ? 65  CYS A O   1 
ATOM   93   C  CB  . CYS A 1 17  ? 30.534 20.524 13.452 1.00 69.42  ? 65  CYS A CB  1 
ATOM   94   S  SG  . CYS A 1 17  ? 31.764 21.824 13.701 1.00 69.55  ? 65  CYS A SG  1 
ATOM   95   N  N   . ASN A 1 18  ? 29.451 17.519 13.526 1.00 71.63  ? 66  ASN A N   1 
ATOM   96   C  CA  . ASN A 1 18  ? 28.414 16.568 13.143 1.00 72.63  ? 66  ASN A CA  1 
ATOM   97   C  C   . ASN A 1 18  ? 27.020 17.135 13.373 1.00 73.78  ? 66  ASN A C   1 
ATOM   98   O  O   . ASN A 1 18  ? 26.258 16.640 14.209 1.00 73.79  ? 66  ASN A O   1 
ATOM   99   C  CB  . ASN A 1 18  ? 28.624 15.216 13.833 1.00 72.22  ? 66  ASN A CB  1 
ATOM   100  C  CG  . ASN A 1 18  ? 29.932 14.544 13.410 1.00 71.93  ? 66  ASN A CG  1 
ATOM   101  O  OD1 . ASN A 1 18  ? 30.327 14.598 12.237 1.00 71.58  ? 66  ASN A OD1 1 
ATOM   102  N  ND2 . ASN A 1 18  ? 30.612 13.914 14.368 1.00 71.37  ? 66  ASN A ND2 1 
ATOM   103  N  N   . VAL A 1 19  ? 26.716 18.193 12.615 1.00 75.38  ? 67  VAL A N   1 
ATOM   104  C  CA  . VAL A 1 19  ? 25.407 18.863 12.621 1.00 76.94  ? 67  VAL A CA  1 
ATOM   105  C  C   . VAL A 1 19  ? 24.866 19.009 11.177 1.00 78.16  ? 67  VAL A C   1 
ATOM   106  O  O   . VAL A 1 19  ? 25.659 19.055 10.230 1.00 78.40  ? 67  VAL A O   1 
ATOM   107  C  CB  . VAL A 1 19  ? 25.496 20.268 13.287 1.00 76.83  ? 67  VAL A CB  1 
ATOM   108  C  CG1 . VAL A 1 19  ? 24.105 20.826 13.563 1.00 77.18  ? 67  VAL A CG1 1 
ATOM   109  C  CG2 . VAL A 1 19  ? 26.303 20.226 14.588 1.00 77.17  ? 67  VAL A CG2 1 
ATOM   110  N  N   . HIS A 1 20  ? 23.531 19.078 11.025 1.00 79.68  ? 68  HIS A N   1 
ATOM   111  C  CA  . HIS A 1 20  ? 22.814 19.267 9.721  1.00 81.01  ? 68  HIS A CA  1 
ATOM   112  C  C   . HIS A 1 20  ? 23.284 18.370 8.559  1.00 81.73  ? 68  HIS A C   1 
ATOM   113  O  O   . HIS A 1 20  ? 23.690 18.898 7.511  1.00 81.68  ? 68  HIS A O   1 
ATOM   114  C  CB  . HIS A 1 20  ? 22.907 20.722 9.193  1.00 81.16  ? 68  HIS A CB  1 
ATOM   115  C  CG  . HIS A 1 20  ? 22.486 21.789 10.160 1.00 82.13  ? 68  HIS A CG  1 
ATOM   116  N  ND1 . HIS A 1 20  ? 21.161 22.103 10.403 1.00 82.81  ? 68  HIS A ND1 1 
ATOM   117  C  CD2 . HIS A 1 20  ? 23.221 22.672 10.881 1.00 82.72  ? 68  HIS A CD2 1 
ATOM   118  C  CE1 . HIS A 1 20  ? 21.101 23.104 11.265 1.00 83.61  ? 68  HIS A CE1 1 
ATOM   119  N  NE2 . HIS A 1 20  ? 22.336 23.468 11.573 1.00 83.01  ? 68  HIS A NE2 1 
ATOM   120  N  N   . HIS A 1 21  ? 23.226 17.047 8.698  1.00 82.83  ? 69  HIS A N   1 
ATOM   121  C  CA  . HIS A 1 21  ? 23.915 16.196 7.707  1.00 83.99  ? 69  HIS A CA  1 
ATOM   122  C  C   . HIS A 1 21  ? 23.867 16.676 6.227  1.00 84.63  ? 69  HIS A C   1 
ATOM   123  O  O   . HIS A 1 21  ? 22.789 16.794 5.633  1.00 84.77  ? 69  HIS A O   1 
ATOM   124  C  CB  . HIS A 1 21  ? 23.488 14.724 7.789  1.00 83.98  ? 69  HIS A CB  1 
ATOM   125  C  CG  . HIS A 1 21  ? 24.068 13.885 6.686  1.00 84.64  ? 69  HIS A CG  1 
ATOM   126  N  ND1 . HIS A 1 21  ? 25.434 13.586 6.605  1.00 84.77  ? 69  HIS A ND1 1 
ATOM   127  C  CD2 . HIS A 1 21  ? 23.476 13.325 5.591  1.00 85.28  ? 69  HIS A CD2 1 
ATOM   128  C  CE1 . HIS A 1 21  ? 25.652 12.853 5.525  1.00 85.29  ? 69  HIS A CE1 1 
ATOM   129  N  NE2 . HIS A 1 21  ? 24.481 12.681 4.891  1.00 85.45  ? 69  HIS A NE2 1 
ATOM   130  N  N   . GLY A 1 22  ? 25.047 16.939 5.656  1.00 85.38  ? 70  GLY A N   1 
ATOM   131  C  CA  . GLY A 1 22  ? 25.197 17.160 4.215  1.00 86.28  ? 70  GLY A CA  1 
ATOM   132  C  C   . GLY A 1 22  ? 25.138 18.589 3.683  1.00 86.98  ? 70  GLY A C   1 
ATOM   133  O  O   . GLY A 1 22  ? 24.724 18.800 2.538  1.00 87.00  ? 70  GLY A O   1 
ATOM   134  N  N   . ASN A 1 23  ? 25.555 19.570 4.490  1.00 87.75  ? 71  ASN A N   1 
ATOM   135  C  CA  . ASN A 1 23  ? 25.618 20.986 4.046  1.00 88.50  ? 71  ASN A CA  1 
ATOM   136  C  C   . ASN A 1 23  ? 26.965 21.371 3.385  1.00 88.95  ? 71  ASN A C   1 
ATOM   137  O  O   . ASN A 1 23  ? 27.823 20.498 3.151  1.00 89.22  ? 71  ASN A O   1 
ATOM   138  C  CB  . ASN A 1 23  ? 25.290 21.942 5.210  1.00 88.53  ? 71  ASN A CB  1 
ATOM   139  C  CG  . ASN A 1 23  ? 26.418 22.032 6.229  1.00 88.63  ? 71  ASN A CG  1 
ATOM   140  O  OD1 . ASN A 1 23  ? 26.932 21.011 6.702  1.00 88.62  ? 71  ASN A OD1 1 
ATOM   141  N  ND2 . ASN A 1 23  ? 26.816 23.256 6.563  1.00 88.75  ? 71  ASN A ND2 1 
ATOM   142  N  N   . VAL A 1 24  ? 27.168 22.656 3.088  1.00 89.41  ? 72  VAL A N   1 
ATOM   143  C  CA  . VAL A 1 24  ? 28.350 23.073 2.304  1.00 89.82  ? 72  VAL A CA  1 
ATOM   144  C  C   . VAL A 1 24  ? 29.513 23.735 3.107  1.00 90.04  ? 72  VAL A C   1 
ATOM   145  O  O   . VAL A 1 24  ? 30.262 24.577 2.580  1.00 89.89  ? 72  VAL A O   1 
ATOM   146  C  CB  . VAL A 1 24  ? 27.925 23.898 1.019  1.00 89.88  ? 72  VAL A CB  1 
ATOM   147  C  CG1 . VAL A 1 24  ? 27.684 25.409 1.346  1.00 89.88  ? 72  VAL A CG1 1 
ATOM   148  C  CG2 . VAL A 1 24  ? 28.956 23.697 -0.129 1.00 89.73  ? 72  VAL A CG2 1 
ATOM   149  N  N   . ARG A 1 25  ? 29.670 23.331 4.371  1.00 90.41  ? 73  ARG A N   1 
ATOM   150  C  CA  . ARG A 1 25  ? 30.730 23.879 5.239  1.00 90.75  ? 73  ARG A CA  1 
ATOM   151  C  C   . ARG A 1 25  ? 32.122 23.363 4.856  1.00 90.56  ? 73  ARG A C   1 
ATOM   152  O  O   . ARG A 1 25  ? 32.915 22.966 5.722  1.00 90.37  ? 73  ARG A O   1 
ATOM   153  C  CB  . ARG A 1 25  ? 30.436 23.608 6.729  1.00 90.93  ? 73  ARG A CB  1 
ATOM   154  C  CG  . ARG A 1 25  ? 29.696 24.744 7.476  1.00 92.03  ? 73  ARG A CG  1 
ATOM   155  C  CD  . ARG A 1 25  ? 29.439 24.369 8.952  1.00 93.80  ? 73  ARG A CD  1 
ATOM   156  N  NE  . ARG A 1 25  ? 28.554 25.313 9.647  1.00 95.10  ? 73  ARG A NE  1 
ATOM   157  C  CZ  . ARG A 1 25  ? 28.033 25.120 10.866 1.00 95.81  ? 73  ARG A CZ  1 
ATOM   158  N  NH1 . ARG A 1 25  ? 28.298 24.006 11.555 1.00 95.82  ? 73  ARG A NH1 1 
ATOM   159  N  NH2 . ARG A 1 25  ? 27.240 26.047 11.401 1.00 96.14  ? 73  ARG A NH2 1 
ATOM   160  N  N   . ALA A 1 29  ? 22.161 34.981 -0.041 1.00 87.69  ? 202 ALA A N   1 
ATOM   161  C  CA  . ALA A 1 29  ? 22.852 35.378 1.198  1.00 87.72  ? 202 ALA A CA  1 
ATOM   162  C  C   . ALA A 1 29  ? 21.925 35.244 2.428  1.00 87.81  ? 202 ALA A C   1 
ATOM   163  O  O   . ALA A 1 29  ? 21.187 36.192 2.763  1.00 87.85  ? 202 ALA A O   1 
ATOM   164  C  CB  . ALA A 1 29  ? 23.423 36.826 1.077  1.00 87.65  ? 202 ALA A CB  1 
ATOM   165  N  N   . GLU A 1 30  ? 21.962 34.058 3.076  1.00 87.80  ? 203 GLU A N   1 
ATOM   166  C  CA  . GLU A 1 30  ? 21.240 33.815 4.353  1.00 87.54  ? 203 GLU A CA  1 
ATOM   167  C  C   . GLU A 1 30  ? 21.815 34.604 5.550  1.00 87.00  ? 203 GLU A C   1 
ATOM   168  O  O   . GLU A 1 30  ? 22.988 34.456 5.935  1.00 86.90  ? 203 GLU A O   1 
ATOM   169  C  CB  . GLU A 1 30  ? 21.157 32.312 4.696  1.00 87.63  ? 203 GLU A CB  1 
ATOM   170  C  CG  . GLU A 1 30  ? 22.511 31.579 4.689  1.00 88.81  ? 203 GLU A CG  1 
ATOM   171  C  CD  . GLU A 1 30  ? 22.677 30.600 5.854  1.00 90.42  ? 203 GLU A CD  1 
ATOM   172  O  OE1 . GLU A 1 30  ? 23.711 29.878 5.886  1.00 91.07  ? 203 GLU A OE1 1 
ATOM   173  O  OE2 . GLU A 1 30  ? 21.785 30.563 6.740  1.00 90.80  ? 203 GLU A OE2 1 
ATOM   174  N  N   . THR A 1 31  ? 20.963 35.450 6.125  1.00 86.44  ? 204 THR A N   1 
ATOM   175  C  CA  . THR A 1 31  ? 21.342 36.275 7.268  1.00 85.71  ? 204 THR A CA  1 
ATOM   176  C  C   . THR A 1 31  ? 21.256 35.445 8.563  1.00 84.88  ? 204 THR A C   1 
ATOM   177  O  O   . THR A 1 31  ? 20.595 34.399 8.602  1.00 84.92  ? 204 THR A O   1 
ATOM   178  C  CB  . THR A 1 31  ? 20.439 37.562 7.349  1.00 85.92  ? 204 THR A CB  1 
ATOM   179  O  OG1 . THR A 1 31  ? 20.778 38.335 8.524  1.00 85.85  ? 204 THR A OG1 1 
ATOM   180  C  CG2 . THR A 1 31  ? 18.929 37.192 7.378  1.00 86.02  ? 204 THR A CG2 1 
ATOM   181  N  N   . LEU A 1 32  ? 21.936 35.918 9.606  1.00 83.78  ? 205 LEU A N   1 
ATOM   182  C  CA  . LEU A 1 32  ? 21.916 35.289 10.933 1.00 82.56  ? 205 LEU A CA  1 
ATOM   183  C  C   . LEU A 1 32  ? 20.714 35.760 11.777 1.00 81.45  ? 205 LEU A C   1 
ATOM   184  O  O   . LEU A 1 32  ? 20.274 36.909 11.662 1.00 81.73  ? 205 LEU A O   1 
ATOM   185  C  CB  . LEU A 1 32  ? 23.207 35.636 11.670 1.00 82.62  ? 205 LEU A CB  1 
ATOM   186  C  CG  . LEU A 1 32  ? 23.629 34.612 12.715 1.00 83.09  ? 205 LEU A CG  1 
ATOM   187  C  CD1 . LEU A 1 32  ? 24.836 33.868 12.189 1.00 83.11  ? 205 LEU A CD1 1 
ATOM   188  C  CD2 . LEU A 1 32  ? 23.942 35.305 14.040 1.00 83.09  ? 205 LEU A CD2 1 
ATOM   189  N  N   . VAL A 1 33  ? 20.200 34.883 12.641 1.00 79.80  ? 206 VAL A N   1 
ATOM   190  C  CA  . VAL A 1 33  ? 19.022 35.228 13.441 1.00 78.09  ? 206 VAL A CA  1 
ATOM   191  C  C   . VAL A 1 33  ? 19.302 35.293 14.946 1.00 76.79  ? 206 VAL A C   1 
ATOM   192  O  O   . VAL A 1 33  ? 20.001 34.450 15.502 1.00 76.49  ? 206 VAL A O   1 
ATOM   193  C  CB  . VAL A 1 33  ? 17.833 34.239 13.205 1.00 78.24  ? 206 VAL A CB  1 
ATOM   194  C  CG1 . VAL A 1 33  ? 16.552 35.016 12.930 1.00 77.87  ? 206 VAL A CG1 1 
ATOM   195  C  CG2 . VAL A 1 33  ? 18.118 33.260 12.069 1.00 77.74  ? 206 VAL A CG2 1 
ATOM   196  N  N   . PHE A 1 34  ? 18.753 36.305 15.599 1.00 75.18  ? 207 PHE A N   1 
ATOM   197  C  CA  . PHE A 1 34  ? 18.625 36.281 17.036 1.00 73.57  ? 207 PHE A CA  1 
ATOM   198  C  C   . PHE A 1 34  ? 17.200 35.882 17.326 1.00 73.14  ? 207 PHE A C   1 
ATOM   199  O  O   . PHE A 1 34  ? 16.317 36.088 16.496 1.00 73.15  ? 207 PHE A O   1 
ATOM   200  C  CB  . PHE A 1 34  ? 18.836 37.663 17.605 1.00 73.15  ? 207 PHE A CB  1 
ATOM   201  C  CG  . PHE A 1 34  ? 20.188 38.225 17.342 1.00 71.93  ? 207 PHE A CG  1 
ATOM   202  C  CD1 . PHE A 1 34  ? 21.210 38.064 18.268 1.00 70.61  ? 207 PHE A CD1 1 
ATOM   203  C  CD2 . PHE A 1 34  ? 20.441 38.938 16.179 1.00 70.57  ? 207 PHE A CD2 1 
ATOM   204  C  CE1 . PHE A 1 34  ? 22.454 38.600 18.039 1.00 69.58  ? 207 PHE A CE1 1 
ATOM   205  C  CE2 . PHE A 1 34  ? 21.689 39.479 15.940 1.00 69.31  ? 207 PHE A CE2 1 
ATOM   206  C  CZ  . PHE A 1 34  ? 22.696 39.310 16.870 1.00 69.86  ? 207 PHE A CZ  1 
ATOM   207  N  N   . SER A 1 35  ? 16.960 35.330 18.507 1.00 72.54  ? 208 SER A N   1 
ATOM   208  C  CA  . SER A 1 35  ? 15.597 35.088 18.941 1.00 71.70  ? 208 SER A CA  1 
ATOM   209  C  C   . SER A 1 35  ? 14.896 36.420 18.950 1.00 71.47  ? 208 SER A C   1 
ATOM   210  O  O   . SER A 1 35  ? 15.511 37.460 19.171 1.00 71.32  ? 208 SER A O   1 
ATOM   211  C  CB  . SER A 1 35  ? 15.550 34.462 20.334 1.00 71.73  ? 208 SER A CB  1 
ATOM   212  O  OG  . SER A 1 35  ? 16.160 35.300 21.299 1.00 70.92  ? 208 SER A OG  1 
ATOM   213  N  N   . THR A 1 36  ? 13.604 36.380 18.688 1.00 71.31  ? 209 THR A N   1 
ATOM   214  C  CA  . THR A 1 36  ? 12.787 37.572 18.720 1.00 71.16  ? 209 THR A CA  1 
ATOM   215  C  C   . THR A 1 36  ? 12.676 38.077 20.148 1.00 71.13  ? 209 THR A C   1 
ATOM   216  O  O   . THR A 1 36  ? 12.558 39.279 20.383 1.00 71.53  ? 209 THR A O   1 
ATOM   217  C  CB  . THR A 1 36  ? 11.392 37.261 18.206 1.00 70.98  ? 209 THR A CB  1 
ATOM   218  O  OG1 . THR A 1 36  ? 10.822 36.226 19.012 1.00 71.17  ? 209 THR A OG1 1 
ATOM   219  C  CG2 . THR A 1 36  ? 11.459 36.780 16.761 1.00 71.06  ? 209 THR A CG2 1 
ATOM   220  N  N   . HIS A 1 37  ? 12.729 37.157 21.105 1.00 70.84  ? 210 HIS A N   1 
ATOM   221  C  CA  . HIS A 1 37  ? 12.519 37.525 22.495 1.00 70.64  ? 210 HIS A CA  1 
ATOM   222  C  C   . HIS A 1 37  ? 13.694 37.196 23.414 1.00 70.42  ? 210 HIS A C   1 
ATOM   223  O  O   . HIS A 1 37  ? 14.496 36.308 23.140 1.00 70.52  ? 210 HIS A O   1 
ATOM   224  C  CB  . HIS A 1 37  ? 11.234 36.883 23.024 1.00 70.86  ? 210 HIS A CB  1 
ATOM   225  C  CG  . HIS A 1 37  ? 9.981  37.386 22.363 1.00 71.38  ? 210 HIS A CG  1 
ATOM   226  N  ND1 . HIS A 1 37  ? 9.332  38.538 22.770 1.00 71.83  ? 210 HIS A ND1 1 
ATOM   227  C  CD2 . HIS A 1 37  ? 9.246  36.879 21.340 1.00 70.89  ? 210 HIS A CD2 1 
ATOM   228  C  CE1 . HIS A 1 37  ? 8.261  38.725 22.018 1.00 70.98  ? 210 HIS A CE1 1 
ATOM   229  N  NE2 . HIS A 1 37  ? 8.188  37.735 21.142 1.00 70.60  ? 210 HIS A NE2 1 
ATOM   230  N  N   . ALA A 1 38  ? 13.784 37.943 24.505 1.00 70.06  ? 211 ALA A N   1 
ATOM   231  C  CA  . ALA A 1 38  ? 14.752 37.685 25.545 1.00 69.79  ? 211 ALA A CA  1 
ATOM   232  C  C   . ALA A 1 38  ? 13.970 37.164 26.735 1.00 69.86  ? 211 ALA A C   1 
ATOM   233  O  O   . ALA A 1 38  ? 12.773 37.436 26.866 1.00 70.28  ? 211 ALA A O   1 
ATOM   234  C  CB  . ALA A 1 38  ? 15.487 38.962 25.909 1.00 69.68  ? 211 ALA A CB  1 
ATOM   235  N  N   . VAL A 1 39  ? 14.632 36.411 27.604 1.00 69.30  ? 212 VAL A N   1 
ATOM   236  C  CA  . VAL A 1 39  ? 13.971 35.905 28.795 1.00 68.51  ? 212 VAL A CA  1 
ATOM   237  C  C   . VAL A 1 39  ? 14.792 36.189 30.030 1.00 68.30  ? 212 VAL A C   1 
ATOM   238  O  O   . VAL A 1 39  ? 15.987 36.459 29.959 1.00 68.74  ? 212 VAL A O   1 
ATOM   239  C  CB  . VAL A 1 39  ? 13.703 34.396 28.711 1.00 68.28  ? 212 VAL A CB  1 
ATOM   240  C  CG1 . VAL A 1 39  ? 12.788 34.095 27.553 1.00 68.39  ? 212 VAL A CG1 1 
ATOM   241  C  CG2 . VAL A 1 39  ? 15.007 33.628 28.574 1.00 68.16  ? 212 VAL A CG2 1 
ATOM   242  N  N   . ILE A 1 40  ? 14.126 36.127 31.166 1.00 67.60  ? 213 ILE A N   1 
ATOM   243  C  CA  . ILE A 1 40  ? 14.768 36.288 32.434 1.00 66.39  ? 213 ILE A CA  1 
ATOM   244  C  C   . ILE A 1 40  ? 14.260 35.151 33.275 1.00 66.54  ? 213 ILE A C   1 
ATOM   245  O  O   . ILE A 1 40  ? 13.061 34.954 33.377 1.00 66.64  ? 213 ILE A O   1 
ATOM   246  C  CB  . ILE A 1 40  ? 14.375 37.607 33.048 1.00 65.91  ? 213 ILE A CB  1 
ATOM   247  C  CG1 . ILE A 1 40  ? 15.243 38.708 32.448 1.00 65.47  ? 213 ILE A CG1 1 
ATOM   248  C  CG2 . ILE A 1 40  ? 14.488 37.556 34.559 1.00 65.24  ? 213 ILE A CG2 1 
ATOM   249  C  CD1 . ILE A 1 40  ? 14.635 40.076 32.548 1.00 65.05  ? 213 ILE A CD1 1 
ATOM   250  N  N   . SER A 1 41  ? 15.177 34.378 33.839 1.00 66.56  ? 214 SER A N   1 
ATOM   251  C  CA  . SER A 1 41  ? 14.827 33.289 34.723 1.00 66.54  ? 214 SER A CA  1 
ATOM   252  C  C   . SER A 1 41  ? 16.072 32.775 35.400 1.00 66.45  ? 214 SER A C   1 
ATOM   253  O  O   . SER A 1 41  ? 17.187 33.159 35.047 1.00 66.27  ? 214 SER A O   1 
ATOM   254  C  CB  . SER A 1 41  ? 14.165 32.158 33.949 1.00 66.54  ? 214 SER A CB  1 
ATOM   255  O  OG  . SER A 1 41  ? 15.061 31.632 32.995 1.00 66.53  ? 214 SER A OG  1 
ATOM   256  N  N   . MET A 1 42  ? 15.867 31.876 36.356 1.00 66.39  ? 215 MET A N   1 
ATOM   257  C  CA  . MET A 1 42  ? 16.931 31.392 37.210 1.00 66.15  ? 215 MET A CA  1 
ATOM   258  C  C   . MET A 1 42  ? 17.780 30.281 36.612 1.00 65.72  ? 215 MET A C   1 
ATOM   259  O  O   . MET A 1 42  ? 17.287 29.394 35.908 1.00 65.72  ? 215 MET A O   1 
ATOM   260  C  CB  . MET A 1 42  ? 16.347 30.947 38.540 1.00 66.60  ? 215 MET A CB  1 
ATOM   261  C  CG  . MET A 1 42  ? 15.811 32.104 39.362 1.00 68.01  ? 215 MET A CG  1 
ATOM   262  S  SD  . MET A 1 42  ? 17.131 33.127 40.062 1.00 70.22  ? 215 MET A SD  1 
ATOM   263  C  CE  . MET A 1 42  ? 17.588 32.137 41.485 1.00 70.07  ? 215 MET A CE  1 
ATOM   264  N  N   . ARG A 1 43  ? 19.072 30.364 36.910 1.00 65.43  ? 216 ARG A N   1 
ATOM   265  C  CA  . ARG A 1 43  ? 20.065 29.383 36.508 1.00 65.11  ? 216 ARG A CA  1 
ATOM   266  C  C   . ARG A 1 43  ? 21.076 29.221 37.609 1.00 65.27  ? 216 ARG A C   1 
ATOM   267  O  O   . ARG A 1 43  ? 21.848 30.140 37.886 1.00 65.45  ? 216 ARG A O   1 
ATOM   268  C  CB  . ARG A 1 43  ? 20.773 29.820 35.240 1.00 64.82  ? 216 ARG A CB  1 
ATOM   269  C  CG  . ARG A 1 43  ? 20.265 29.100 34.057 1.00 63.89  ? 216 ARG A CG  1 
ATOM   270  C  CD  . ARG A 1 43  ? 20.819 29.637 32.792 1.00 62.79  ? 216 ARG A CD  1 
ATOM   271  N  NE  . ARG A 1 43  ? 20.237 28.895 31.691 1.00 62.55  ? 216 ARG A NE  1 
ATOM   272  C  CZ  . ARG A 1 43  ? 20.708 28.881 30.457 1.00 62.69  ? 216 ARG A CZ  1 
ATOM   273  N  NH1 . ARG A 1 43  ? 21.781 29.585 30.134 1.00 63.78  ? 216 ARG A NH1 1 
ATOM   274  N  NH2 . ARG A 1 43  ? 20.094 28.155 29.544 1.00 63.33  ? 216 ARG A NH2 1 
ATOM   275  N  N   . ASP A 1 44  ? 21.063 28.046 38.231 1.00 65.44  ? 217 ASP A N   1 
ATOM   276  C  CA  . ASP A 1 44  ? 21.886 27.766 39.402 1.00 65.54  ? 217 ASP A CA  1 
ATOM   277  C  C   . ASP A 1 44  ? 21.837 28.922 40.402 1.00 65.62  ? 217 ASP A C   1 
ATOM   278  O  O   . ASP A 1 44  ? 22.868 29.495 40.752 1.00 65.83  ? 217 ASP A O   1 
ATOM   279  C  CB  . ASP A 1 44  ? 23.323 27.453 38.987 1.00 65.43  ? 217 ASP A CB  1 
ATOM   280  C  CG  . ASP A 1 44  ? 23.418 26.236 38.101 1.00 65.64  ? 217 ASP A CG  1 
ATOM   281  O  OD1 . ASP A 1 44  ? 22.781 25.213 38.419 1.00 66.73  ? 217 ASP A OD1 1 
ATOM   282  O  OD2 . ASP A 1 44  ? 24.134 26.296 37.083 1.00 65.90  ? 217 ASP A OD2 1 
ATOM   283  N  N   . GLY A 1 45  ? 20.629 29.279 40.825 1.00 65.61  ? 218 GLY A N   1 
ATOM   284  C  CA  . GLY A 1 45  ? 20.430 30.302 41.837 1.00 65.83  ? 218 GLY A CA  1 
ATOM   285  C  C   . GLY A 1 45  ? 20.758 31.733 41.449 1.00 66.09  ? 218 GLY A C   1 
ATOM   286  O  O   . GLY A 1 45  ? 20.631 32.638 42.276 1.00 66.20  ? 218 GLY A O   1 
ATOM   287  N  N   . LYS A 1 46  ? 21.185 31.955 40.207 1.00 66.26  ? 219 LYS A N   1 
ATOM   288  C  CA  . LYS A 1 46  ? 21.434 33.314 39.733 1.00 66.35  ? 219 LYS A CA  1 
ATOM   289  C  C   . LYS A 1 46  ? 20.339 33.720 38.771 1.00 65.84  ? 219 LYS A C   1 
ATOM   290  O  O   . LYS A 1 46  ? 19.880 32.906 37.977 1.00 66.03  ? 219 LYS A O   1 
ATOM   291  C  CB  . LYS A 1 46  ? 22.782 33.428 39.006 1.00 66.76  ? 219 LYS A CB  1 
ATOM   292  C  CG  . LYS A 1 46  ? 23.999 32.882 39.726 1.00 68.32  ? 219 LYS A CG  1 
ATOM   293  C  CD  . LYS A 1 46  ? 24.214 33.528 41.090 1.00 70.84  ? 219 LYS A CD  1 
ATOM   294  C  CE  . LYS A 1 46  ? 25.343 32.799 41.843 1.00 71.86  ? 219 LYS A CE  1 
ATOM   295  N  NZ  . LYS A 1 46  ? 25.204 32.961 43.307 1.00 72.07  ? 219 LYS A NZ  1 
ATOM   296  N  N   . LEU A 1 47  ? 19.937 34.984 38.824 1.00 65.30  ? 220 LEU A N   1 
ATOM   297  C  CA  . LEU A 1 47  ? 18.986 35.503 37.859 1.00 64.66  ? 220 LEU A CA  1 
ATOM   298  C  C   . LEU A 1 47  ? 19.719 35.838 36.566 1.00 64.40  ? 220 LEU A C   1 
ATOM   299  O  O   . LEU A 1 47  ? 20.770 36.472 36.596 1.00 64.29  ? 220 LEU A O   1 
ATOM   300  C  CB  . LEU A 1 47  ? 18.295 36.737 38.432 1.00 64.44  ? 220 LEU A CB  1 
ATOM   301  C  CG  . LEU A 1 47  ? 16.926 37.072 37.871 1.00 64.17  ? 220 LEU A CG  1 
ATOM   302  C  CD1 . LEU A 1 47  ? 16.025 35.879 37.991 1.00 65.52  ? 220 LEU A CD1 1 
ATOM   303  C  CD2 . LEU A 1 47  ? 16.350 38.222 38.632 1.00 64.93  ? 220 LEU A CD2 1 
ATOM   304  N  N   . CYS A 1 48  ? 19.179 35.400 35.432 1.00 64.22  ? 221 CYS A N   1 
ATOM   305  C  CA  . CYS A 1 48  ? 19.830 35.663 34.150 1.00 64.33  ? 221 CYS A CA  1 
ATOM   306  C  C   . CYS A 1 48  ? 18.910 36.216 33.071 1.00 64.23  ? 221 CYS A C   1 
ATOM   307  O  O   . CYS A 1 48  ? 17.726 35.890 33.017 1.00 64.48  ? 221 CYS A O   1 
ATOM   308  C  CB  . CYS A 1 48  ? 20.519 34.413 33.615 1.00 64.31  ? 221 CYS A CB  1 
ATOM   309  S  SG  . CYS A 1 48  ? 21.534 33.566 34.802 1.00 64.88  ? 221 CYS A SG  1 
ATOM   310  N  N   . LEU A 1 49  ? 19.478 37.051 32.206 1.00 64.04  ? 222 LEU A N   1 
ATOM   311  C  CA  . LEU A 1 49  ? 18.797 37.533 31.024 1.00 63.67  ? 222 LEU A CA  1 
ATOM   312  C  C   . LEU A 1 49  ? 19.410 36.814 29.856 1.00 63.67  ? 222 LEU A C   1 
ATOM   313  O  O   . LEU A 1 49  ? 20.611 36.841 29.673 1.00 63.49  ? 222 LEU A O   1 
ATOM   314  C  CB  . LEU A 1 49  ? 18.995 39.032 30.873 1.00 63.63  ? 222 LEU A CB  1 
ATOM   315  C  CG  . LEU A 1 49  ? 18.737 39.645 29.502 1.00 63.30  ? 222 LEU A CG  1 
ATOM   316  C  CD1 . LEU A 1 49  ? 17.258 39.781 29.240 1.00 63.44  ? 222 LEU A CD1 1 
ATOM   317  C  CD2 . LEU A 1 49  ? 19.408 40.986 29.444 1.00 62.66  ? 222 LEU A CD2 1 
ATOM   318  N  N   . MET A 1 50  ? 18.581 36.156 29.067 1.00 64.11  ? 223 MET A N   1 
ATOM   319  C  CA  . MET A 1 50  ? 19.078 35.267 28.039 1.00 64.45  ? 223 MET A CA  1 
ATOM   320  C  C   . MET A 1 50  ? 18.391 35.524 26.729 1.00 64.80  ? 223 MET A C   1 
ATOM   321  O  O   . MET A 1 50  ? 17.181 35.707 26.686 1.00 64.98  ? 223 MET A O   1 
ATOM   322  C  CB  . MET A 1 50  ? 18.805 33.825 28.436 1.00 64.47  ? 223 MET A CB  1 
ATOM   323  C  CG  . MET A 1 50  ? 19.529 33.377 29.668 1.00 64.52  ? 223 MET A CG  1 
ATOM   324  S  SD  . MET A 1 50  ? 18.865 31.854 30.305 1.00 63.83  ? 223 MET A SD  1 
ATOM   325  C  CE  . MET A 1 50  ? 17.477 32.504 31.216 1.00 64.34  ? 223 MET A CE  1 
ATOM   326  N  N   . PHE A 1 51  ? 19.171 35.544 25.661 1.00 65.20  ? 224 PHE A N   1 
ATOM   327  C  CA  . PHE A 1 51  ? 18.626 35.575 24.321 1.00 65.52  ? 224 PHE A CA  1 
ATOM   328  C  C   . PHE A 1 51  ? 19.360 34.496 23.571 1.00 65.98  ? 224 PHE A C   1 
ATOM   329  O  O   . PHE A 1 51  ? 20.432 34.084 23.999 1.00 66.11  ? 224 PHE A O   1 
ATOM   330  C  CB  . PHE A 1 51  ? 18.805 36.954 23.659 1.00 65.36  ? 224 PHE A CB  1 
ATOM   331  C  CG  . PHE A 1 51  ? 20.229 37.412 23.569 1.00 64.55  ? 224 PHE A CG  1 
ATOM   332  C  CD1 . PHE A 1 51  ? 20.980 37.156 22.433 1.00 63.53  ? 224 PHE A CD1 1 
ATOM   333  C  CD2 . PHE A 1 51  ? 20.823 38.100 24.626 1.00 63.72  ? 224 PHE A CD2 1 
ATOM   334  C  CE1 . PHE A 1 51  ? 22.301 37.567 22.357 1.00 63.35  ? 224 PHE A CE1 1 
ATOM   335  C  CE2 . PHE A 1 51  ? 22.139 38.516 24.559 1.00 62.64  ? 224 PHE A CE2 1 
ATOM   336  C  CZ  . PHE A 1 51  ? 22.880 38.252 23.424 1.00 63.00  ? 224 PHE A CZ  1 
ATOM   337  N  N   . ARG A 1 52  ? 18.779 34.017 22.472 1.00 66.57  ? 225 ARG A N   1 
ATOM   338  C  CA  . ARG A 1 52  ? 19.427 32.997 21.645 1.00 67.04  ? 225 ARG A CA  1 
ATOM   339  C  C   . ARG A 1 52  ? 19.966 33.587 20.341 1.00 67.78  ? 225 ARG A C   1 
ATOM   340  O  O   . ARG A 1 52  ? 19.325 34.419 19.701 1.00 67.66  ? 225 ARG A O   1 
ATOM   341  C  CB  . ARG A 1 52  ? 18.473 31.826 21.379 1.00 66.67  ? 225 ARG A CB  1 
ATOM   342  C  CG  . ARG A 1 52  ? 18.926 30.872 20.266 1.00 66.67  ? 225 ARG A CG  1 
ATOM   343  C  CD  . ARG A 1 52  ? 18.708 29.395 20.615 1.00 66.49  ? 225 ARG A CD  1 
ATOM   344  N  NE  . ARG A 1 52  ? 17.287 29.063 20.773 1.00 66.93  ? 225 ARG A NE  1 
ATOM   345  C  CZ  . ARG A 1 52  ? 16.822 28.057 21.516 1.00 66.82  ? 225 ARG A CZ  1 
ATOM   346  N  NH1 . ARG A 1 52  ? 17.659 27.263 22.193 1.00 66.32  ? 225 ARG A NH1 1 
ATOM   347  N  NH2 . ARG A 1 52  ? 15.508 27.853 21.591 1.00 66.51  ? 225 ARG A NH2 1 
ATOM   348  N  N   . VAL A 1 53  ? 21.164 33.172 19.962 1.00 69.09  ? 226 VAL A N   1 
ATOM   349  C  CA  . VAL A 1 53  ? 21.731 33.641 18.714 1.00 70.55  ? 226 VAL A CA  1 
ATOM   350  C  C   . VAL A 1 53  ? 21.990 32.452 17.790 1.00 71.60  ? 226 VAL A C   1 
ATOM   351  O  O   . VAL A 1 53  ? 22.539 31.432 18.211 1.00 71.67  ? 226 VAL A O   1 
ATOM   352  C  CB  . VAL A 1 53  ? 22.976 34.566 18.938 1.00 70.45  ? 226 VAL A CB  1 
ATOM   353  C  CG1 . VAL A 1 53  ? 24.144 33.813 19.582 1.00 70.26  ? 226 VAL A CG1 1 
ATOM   354  C  CG2 . VAL A 1 53  ? 23.399 35.246 17.640 1.00 70.84  ? 226 VAL A CG2 1 
ATOM   355  N  N   . GLY A 1 54  ? 21.548 32.583 16.540 1.00 72.89  ? 227 GLY A N   1 
ATOM   356  C  CA  . GLY A 1 54  ? 21.551 31.480 15.578 1.00 74.82  ? 227 GLY A CA  1 
ATOM   357  C  C   . GLY A 1 54  ? 22.887 31.228 14.908 1.00 76.28  ? 227 GLY A C   1 
ATOM   358  O  O   . GLY A 1 54  ? 23.855 31.962 15.130 1.00 76.42  ? 227 GLY A O   1 
ATOM   359  N  N   . ASP A 1 55  ? 22.946 30.183 14.088 1.00 77.74  ? 228 ASP A N   1 
ATOM   360  C  CA  . ASP A 1 55  ? 24.166 29.869 13.342 1.00 79.06  ? 228 ASP A CA  1 
ATOM   361  C  C   . ASP A 1 55  ? 24.004 30.121 11.836 1.00 79.51  ? 228 ASP A C   1 
ATOM   362  O  O   . ASP A 1 55  ? 22.887 30.314 11.337 1.00 79.33  ? 228 ASP A O   1 
ATOM   363  C  CB  . ASP A 1 55  ? 24.664 28.439 13.637 1.00 79.35  ? 228 ASP A CB  1 
ATOM   364  C  CG  . ASP A 1 55  ? 23.728 27.349 13.102 1.00 80.72  ? 228 ASP A CG  1 
ATOM   365  O  OD1 . ASP A 1 55  ? 22.501 27.577 12.995 1.00 81.80  ? 228 ASP A OD1 1 
ATOM   366  O  OD2 . ASP A 1 55  ? 24.228 26.242 12.800 1.00 82.59  ? 228 ASP A OD2 1 
ATOM   367  N  N   . LEU A 1 56  ? 25.128 30.164 11.123 1.00 80.36  ? 229 LEU A N   1 
ATOM   368  C  CA  . LEU A 1 56  ? 25.076 30.311 9.680  1.00 81.23  ? 229 LEU A CA  1 
ATOM   369  C  C   . LEU A 1 56  ? 25.059 28.937 9.089  1.00 81.84  ? 229 LEU A C   1 
ATOM   370  O  O   . LEU A 1 56  ? 26.079 28.227 9.046  1.00 82.10  ? 229 LEU A O   1 
ATOM   371  C  CB  . LEU A 1 56  ? 26.215 31.170 9.122  1.00 81.15  ? 229 LEU A CB  1 
ATOM   372  C  CG  . LEU A 1 56  ? 25.811 32.649 9.131  1.00 81.32  ? 229 LEU A CG  1 
ATOM   373  C  CD1 . LEU A 1 56  ? 26.900 33.546 8.544  1.00 81.53  ? 229 LEU A CD1 1 
ATOM   374  C  CD2 . LEU A 1 56  ? 24.442 32.891 8.451  1.00 81.10  ? 229 LEU A CD2 1 
ATOM   375  N  N   . ARG A 1 57  ? 23.861 28.554 8.680  1.00 82.41  ? 230 ARG A N   1 
ATOM   376  C  CA  . ARG A 1 57  ? 23.655 27.278 8.059  1.00 82.97  ? 230 ARG A CA  1 
ATOM   377  C  C   . ARG A 1 57  ? 24.867 26.906 7.177  1.00 82.93  ? 230 ARG A C   1 
ATOM   378  O  O   . ARG A 1 57  ? 25.562 25.924 7.458  1.00 82.99  ? 230 ARG A O   1 
ATOM   379  C  CB  . ARG A 1 57  ? 22.327 27.299 7.288  1.00 83.23  ? 230 ARG A CB  1 
ATOM   380  C  CG  . ARG A 1 57  ? 21.906 25.959 6.726  1.00 84.22  ? 230 ARG A CG  1 
ATOM   381  C  CD  . ARG A 1 57  ? 20.403 25.876 6.517  1.00 86.30  ? 230 ARG A CD  1 
ATOM   382  N  NE  . ARG A 1 57  ? 20.118 24.817 5.550  1.00 88.51  ? 230 ARG A NE  1 
ATOM   383  C  CZ  . ARG A 1 57  ? 20.253 23.508 5.798  1.00 89.31  ? 230 ARG A CZ  1 
ATOM   384  N  NH1 . ARG A 1 57  ? 20.655 23.086 6.999  1.00 89.19  ? 230 ARG A NH1 1 
ATOM   385  N  NH2 . ARG A 1 57  ? 19.984 22.620 4.839  1.00 89.46  ? 230 ARG A NH2 1 
ATOM   386  N  N   . ASN A 1 58  ? 25.158 27.716 6.160  1.00 82.90  ? 231 ASN A N   1 
ATOM   387  C  CA  . ASN A 1 58  ? 26.096 27.275 5.121  1.00 82.91  ? 231 ASN A CA  1 
ATOM   388  C  C   . ASN A 1 58  ? 27.588 27.571 5.284  1.00 82.63  ? 231 ASN A C   1 
ATOM   389  O  O   . ASN A 1 58  ? 28.372 27.339 4.354  1.00 82.67  ? 231 ASN A O   1 
ATOM   390  C  CB  . ASN A 1 58  ? 25.606 27.672 3.720  1.00 82.97  ? 231 ASN A CB  1 
ATOM   391  C  CG  . ASN A 1 58  ? 24.741 26.585 3.084  1.00 83.53  ? 231 ASN A CG  1 
ATOM   392  O  OD1 . ASN A 1 58  ? 23.913 26.871 2.212  1.00 84.69  ? 231 ASN A OD1 1 
ATOM   393  N  ND2 . ASN A 1 58  ? 24.920 25.326 3.530  1.00 83.23  ? 231 ASN A ND2 1 
ATOM   394  N  N   . SER A 1 59  ? 27.992 28.062 6.452  1.00 82.17  ? 232 SER A N   1 
ATOM   395  C  CA  . SER A 1 59  ? 29.387 28.454 6.623  1.00 81.82  ? 232 SER A CA  1 
ATOM   396  C  C   . SER A 1 59  ? 29.759 28.661 8.077  1.00 81.37  ? 232 SER A C   1 
ATOM   397  O  O   . SER A 1 59  ? 28.894 28.812 8.944  1.00 81.39  ? 232 SER A O   1 
ATOM   398  C  CB  . SER A 1 59  ? 29.694 29.739 5.835  1.00 81.98  ? 232 SER A CB  1 
ATOM   399  O  OG  . SER A 1 59  ? 29.378 30.897 6.599  1.00 82.25  ? 232 SER A OG  1 
ATOM   400  N  N   . HIS A 1 60  ? 31.063 28.675 8.326  1.00 80.79  ? 233 HIS A N   1 
ATOM   401  C  CA  . HIS A 1 60  ? 31.585 28.973 9.640  1.00 80.30  ? 233 HIS A CA  1 
ATOM   402  C  C   . HIS A 1 60  ? 31.715 30.470 9.848  1.00 79.56  ? 233 HIS A C   1 
ATOM   403  O  O   . HIS A 1 60  ? 31.827 31.240 8.886  1.00 79.56  ? 233 HIS A O   1 
ATOM   404  C  CB  . HIS A 1 60  ? 32.949 28.317 9.836  1.00 80.59  ? 233 HIS A CB  1 
ATOM   405  C  CG  . HIS A 1 60  ? 32.870 26.931 10.388 1.00 81.67  ? 233 HIS A CG  1 
ATOM   406  N  ND1 . HIS A 1 60  ? 32.408 26.665 11.661 1.00 82.60  ? 233 HIS A ND1 1 
ATOM   407  C  CD2 . HIS A 1 60  ? 33.191 25.732 9.844  1.00 82.34  ? 233 HIS A CD2 1 
ATOM   408  C  CE1 . HIS A 1 60  ? 32.446 25.361 11.877 1.00 83.34  ? 233 HIS A CE1 1 
ATOM   409  N  NE2 . HIS A 1 60  ? 32.918 24.773 10.790 1.00 82.98  ? 233 HIS A NE2 1 
ATOM   410  N  N   . ILE A 1 61  ? 31.692 30.867 11.117 1.00 78.52  ? 234 ILE A N   1 
ATOM   411  C  CA  . ILE A 1 61  ? 31.965 32.232 11.521 1.00 77.45  ? 234 ILE A CA  1 
ATOM   412  C  C   . ILE A 1 61  ? 33.117 32.153 12.505 1.00 76.92  ? 234 ILE A C   1 
ATOM   413  O  O   . ILE A 1 61  ? 33.138 31.287 13.368 1.00 76.93  ? 234 ILE A O   1 
ATOM   414  C  CB  . ILE A 1 61  ? 30.740 32.868 12.166 1.00 77.38  ? 234 ILE A CB  1 
ATOM   415  C  CG1 . ILE A 1 61  ? 29.519 32.646 11.274 1.00 77.51  ? 234 ILE A CG1 1 
ATOM   416  C  CG2 . ILE A 1 61  ? 30.962 34.359 12.365 1.00 77.34  ? 234 ILE A CG2 1 
ATOM   417  C  CD1 . ILE A 1 61  ? 28.206 32.654 12.005 1.00 77.73  ? 234 ILE A CD1 1 
ATOM   418  N  N   . VAL A 1 62  ? 34.083 33.052 12.366 1.00 76.28  ? 235 VAL A N   1 
ATOM   419  C  CA  . VAL A 1 62  ? 35.381 32.888 13.023 1.00 75.74  ? 235 VAL A CA  1 
ATOM   420  C  C   . VAL A 1 62  ? 35.738 34.174 13.779 1.00 75.18  ? 235 VAL A C   1 
ATOM   421  O  O   . VAL A 1 62  ? 35.048 35.178 13.584 1.00 75.47  ? 235 VAL A O   1 
ATOM   422  C  CB  . VAL A 1 62  ? 36.448 32.450 11.964 1.00 75.76  ? 235 VAL A CB  1 
ATOM   423  C  CG1 . VAL A 1 62  ? 37.870 32.485 12.517 1.00 76.08  ? 235 VAL A CG1 1 
ATOM   424  C  CG2 . VAL A 1 62  ? 36.109 31.041 11.431 1.00 75.70  ? 235 VAL A CG2 1 
ATOM   425  N  N   . GLU A 1 63  ? 36.789 34.150 14.623 1.00 74.27  ? 236 GLU A N   1 
ATOM   426  C  CA  . GLU A 1 63  ? 37.046 35.214 15.620 1.00 73.46  ? 236 GLU A CA  1 
ATOM   427  C  C   . GLU A 1 63  ? 35.643 35.643 16.074 1.00 72.45  ? 236 GLU A C   1 
ATOM   428  O  O   . GLU A 1 63  ? 35.392 36.818 16.328 1.00 72.86  ? 236 GLU A O   1 
ATOM   429  C  CB  . GLU A 1 63  ? 37.937 36.403 15.078 1.00 73.63  ? 236 GLU A CB  1 
ATOM   430  C  CG  . GLU A 1 63  ? 38.856 37.186 16.153 1.00 74.62  ? 236 GLU A CG  1 
ATOM   431  C  CD  . GLU A 1 63  ? 39.742 38.391 15.608 1.00 76.65  ? 236 GLU A CD  1 
ATOM   432  O  OE1 . GLU A 1 63  ? 40.743 38.151 14.886 1.00 76.96  ? 236 GLU A OE1 1 
ATOM   433  O  OE2 . GLU A 1 63  ? 39.485 39.581 15.956 1.00 76.53  ? 236 GLU A OE2 1 
ATOM   434  N  N   . ALA A 1 64  ? 34.729 34.670 16.144 1.00 70.94  ? 237 ALA A N   1 
ATOM   435  C  CA  . ALA A 1 64  ? 33.316 34.931 16.428 1.00 69.64  ? 237 ALA A CA  1 
ATOM   436  C  C   . ALA A 1 64  ? 33.132 35.391 17.869 1.00 69.02  ? 237 ALA A C   1 
ATOM   437  O  O   . ALA A 1 64  ? 33.717 34.805 18.785 1.00 69.23  ? 237 ALA A O   1 
ATOM   438  C  CB  . ALA A 1 64  ? 32.490 33.706 16.159 1.00 69.32  ? 237 ALA A CB  1 
ATOM   439  N  N   . SER A 1 65  ? 32.334 36.447 18.065 1.00 68.02  ? 238 SER A N   1 
ATOM   440  C  CA  . SER A 1 65  ? 32.153 37.061 19.384 1.00 66.96  ? 238 SER A CA  1 
ATOM   441  C  C   . SER A 1 65  ? 30.832 37.798 19.560 1.00 66.23  ? 238 SER A C   1 
ATOM   442  O  O   . SER A 1 65  ? 30.279 38.352 18.619 1.00 65.81  ? 238 SER A O   1 
ATOM   443  C  CB  . SER A 1 65  ? 33.310 38.011 19.700 1.00 67.22  ? 238 SER A CB  1 
ATOM   444  O  OG  . SER A 1 65  ? 33.066 39.297 19.173 1.00 67.45  ? 238 SER A OG  1 
ATOM   445  N  N   . ILE A 1 66  ? 30.353 37.816 20.796 1.00 65.77  ? 239 ILE A N   1 
ATOM   446  C  CA  . ILE A 1 66  ? 29.099 38.457 21.133 1.00 65.44  ? 239 ILE A CA  1 
ATOM   447  C  C   . ILE A 1 66  ? 29.298 39.570 22.179 1.00 65.74  ? 239 ILE A C   1 
ATOM   448  O  O   . ILE A 1 66  ? 30.153 39.487 23.065 1.00 65.19  ? 239 ILE A O   1 
ATOM   449  C  CB  . ILE A 1 66  ? 28.018 37.392 21.555 1.00 65.15  ? 239 ILE A CB  1 
ATOM   450  C  CG1 . ILE A 1 66  ? 26.656 38.023 21.855 1.00 64.53  ? 239 ILE A CG1 1 
ATOM   451  C  CG2 . ILE A 1 66  ? 28.481 36.551 22.731 1.00 64.75  ? 239 ILE A CG2 1 
ATOM   452  C  CD1 . ILE A 1 66  ? 25.930 38.520 20.643 1.00 64.87  ? 239 ILE A CD1 1 
ATOM   453  N  N   . ARG A 1 67  ? 28.518 40.634 22.030 1.00 66.30  ? 240 ARG A N   1 
ATOM   454  C  CA  . ARG A 1 67  ? 28.465 41.717 23.001 1.00 66.44  ? 240 ARG A CA  1 
ATOM   455  C  C   . ARG A 1 67  ? 27.054 42.247 23.012 1.00 66.28  ? 240 ARG A C   1 
ATOM   456  O  O   . ARG A 1 67  ? 26.256 41.869 22.163 1.00 66.27  ? 240 ARG A O   1 
ATOM   457  C  CB  . ARG A 1 67  ? 29.460 42.824 22.663 1.00 66.51  ? 240 ARG A CB  1 
ATOM   458  C  CG  . ARG A 1 67  ? 29.641 43.096 21.180 1.00 66.99  ? 240 ARG A CG  1 
ATOM   459  C  CD  . ARG A 1 67  ? 30.988 43.773 20.900 1.00 68.20  ? 240 ARG A CD  1 
ATOM   460  N  NE  . ARG A 1 67  ? 30.889 45.230 20.725 1.00 68.94  ? 240 ARG A NE  1 
ATOM   461  C  CZ  . ARG A 1 67  ? 31.126 45.872 19.577 1.00 68.94  ? 240 ARG A CZ  1 
ATOM   462  N  NH1 . ARG A 1 67  ? 31.482 45.196 18.493 1.00 69.19  ? 240 ARG A NH1 1 
ATOM   463  N  NH2 . ARG A 1 67  ? 31.013 47.193 19.506 1.00 68.23  ? 240 ARG A NH2 1 
ATOM   464  N  N   . ALA A 1 68  ? 26.740 43.098 23.985 1.00 66.36  ? 241 ALA A N   1 
ATOM   465  C  CA  . ALA A 1 68  ? 25.394 43.647 24.121 1.00 66.58  ? 241 ALA A CA  1 
ATOM   466  C  C   . ALA A 1 68  ? 25.437 45.019 24.742 1.00 66.68  ? 241 ALA A C   1 
ATOM   467  O  O   . ALA A 1 68  ? 26.191 45.250 25.672 1.00 66.56  ? 241 ALA A O   1 
ATOM   468  C  CB  . ALA A 1 68  ? 24.530 42.736 24.955 1.00 66.72  ? 241 ALA A CB  1 
ATOM   469  N  N   . LYS A 1 69  ? 24.619 45.929 24.228 1.00 67.10  ? 242 LYS A N   1 
ATOM   470  C  CA  . LYS A 1 69  ? 24.618 47.296 24.725 1.00 67.61  ? 242 LYS A CA  1 
ATOM   471  C  C   . LYS A 1 69  ? 23.261 47.674 25.250 1.00 67.74  ? 242 LYS A C   1 
ATOM   472  O  O   . LYS A 1 69  ? 22.245 47.349 24.642 1.00 68.00  ? 242 LYS A O   1 
ATOM   473  C  CB  . LYS A 1 69  ? 24.997 48.289 23.626 1.00 67.67  ? 242 LYS A CB  1 
ATOM   474  C  CG  . LYS A 1 69  ? 26.431 48.215 23.163 1.00 68.07  ? 242 LYS A CG  1 
ATOM   475  C  CD  . LYS A 1 69  ? 27.420 48.651 24.224 1.00 68.61  ? 242 LYS A CD  1 
ATOM   476  C  CE  . LYS A 1 69  ? 28.682 49.133 23.523 1.00 69.42  ? 242 LYS A CE  1 
ATOM   477  N  NZ  . LYS A 1 69  ? 29.911 48.746 24.240 1.00 70.33  ? 242 LYS A NZ  1 
ATOM   478  N  N   . LEU A 1 70  ? 23.252 48.378 26.373 1.00 67.81  ? 243 LEU A N   1 
ATOM   479  C  CA  . LEU A 1 70  ? 22.024 48.923 26.889 1.00 67.97  ? 243 LEU A CA  1 
ATOM   480  C  C   . LEU A 1 70  ? 21.869 50.371 26.462 1.00 68.11  ? 243 LEU A C   1 
ATOM   481  O  O   . LEU A 1 70  ? 22.623 51.246 26.892 1.00 68.15  ? 243 LEU A O   1 
ATOM   482  C  CB  . LEU A 1 70  ? 21.985 48.820 28.407 1.00 68.15  ? 243 LEU A CB  1 
ATOM   483  C  CG  . LEU A 1 70  ? 20.779 49.488 29.081 1.00 68.28  ? 243 LEU A CG  1 
ATOM   484  C  CD1 . LEU A 1 70  ? 19.597 48.533 29.253 1.00 67.75  ? 243 LEU A CD1 1 
ATOM   485  C  CD2 . LEU A 1 70  ? 21.218 50.056 30.414 1.00 69.12  ? 243 LEU A CD2 1 
ATOM   486  N  N   . ILE A 1 71  ? 20.876 50.609 25.614 1.00 68.19  ? 244 ILE A N   1 
ATOM   487  C  CA  . ILE A 1 71  ? 20.446 51.954 25.279 1.00 67.97  ? 244 ILE A CA  1 
ATOM   488  C  C   . ILE A 1 71  ? 19.403 52.395 26.296 1.00 67.78  ? 244 ILE A C   1 
ATOM   489  O  O   . ILE A 1 71  ? 18.288 51.901 26.292 1.00 67.29  ? 244 ILE A O   1 
ATOM   490  C  CB  . ILE A 1 71  ? 19.806 51.991 23.892 1.00 68.00  ? 244 ILE A CB  1 
ATOM   491  C  CG1 . ILE A 1 71  ? 20.520 51.032 22.945 1.00 67.93  ? 244 ILE A CG1 1 
ATOM   492  C  CG2 . ILE A 1 71  ? 19.826 53.391 23.337 1.00 67.86  ? 244 ILE A CG2 1 
ATOM   493  C  CD1 . ILE A 1 71  ? 21.849 51.526 22.463 1.00 68.41  ? 244 ILE A CD1 1 
ATOM   494  N  N   . LYS A 1 72  ? 19.789 53.301 27.185 1.00 68.14  ? 245 LYS A N   1 
ATOM   495  C  CA  . LYS A 1 72  ? 18.869 53.877 28.167 1.00 68.63  ? 245 LYS A CA  1 
ATOM   496  C  C   . LYS A 1 72  ? 19.273 55.299 28.552 1.00 68.84  ? 245 LYS A C   1 
ATOM   497  O  O   . LYS A 1 72  ? 20.359 55.534 29.100 1.00 69.23  ? 245 LYS A O   1 
ATOM   498  C  CB  . LYS A 1 72  ? 18.775 53.011 29.427 1.00 68.71  ? 245 LYS A CB  1 
ATOM   499  C  CG  . LYS A 1 72  ? 17.982 53.664 30.566 1.00 68.98  ? 245 LYS A CG  1 
ATOM   500  C  CD  . LYS A 1 72  ? 17.924 52.791 31.822 1.00 70.05  ? 245 LYS A CD  1 
ATOM   501  C  CE  . LYS A 1 72  ? 17.623 53.646 33.063 1.00 72.08  ? 245 LYS A CE  1 
ATOM   502  N  NZ  . LYS A 1 72  ? 17.194 52.843 34.256 1.00 73.05  ? 245 LYS A NZ  1 
ATOM   503  N  N   . SER A 1 73  ? 18.381 56.242 28.263 1.00 68.71  ? 246 SER A N   1 
ATOM   504  C  CA  . SER A 1 73  ? 18.593 57.624 28.633 1.00 68.03  ? 246 SER A CA  1 
ATOM   505  C  C   . SER A 1 73  ? 18.765 57.699 30.144 1.00 67.79  ? 246 SER A C   1 
ATOM   506  O  O   . SER A 1 73  ? 18.212 56.871 30.872 1.00 67.66  ? 246 SER A O   1 
ATOM   507  C  CB  . SER A 1 73  ? 17.412 58.473 28.167 1.00 67.96  ? 246 SER A CB  1 
ATOM   508  O  OG  . SER A 1 73  ? 17.199 58.280 26.776 1.00 67.36  ? 246 SER A OG  1 
ATOM   509  N  N   . LYS A 1 74  ? 19.550 58.663 30.619 1.00 67.43  ? 247 LYS A N   1 
ATOM   510  C  CA  . LYS A 1 74  ? 19.717 58.826 32.053 1.00 67.05  ? 247 LYS A CA  1 
ATOM   511  C  C   . LYS A 1 74  ? 20.114 60.225 32.444 1.00 66.70  ? 247 LYS A C   1 
ATOM   512  O  O   . LYS A 1 74  ? 20.541 61.016 31.608 1.00 66.62  ? 247 LYS A O   1 
ATOM   513  C  CB  . LYS A 1 74  ? 20.737 57.825 32.596 1.00 67.41  ? 247 LYS A CB  1 
ATOM   514  C  CG  . LYS A 1 74  ? 22.185 58.273 32.529 1.00 67.30  ? 247 LYS A CG  1 
ATOM   515  C  CD  . LYS A 1 74  ? 23.015 57.434 33.462 1.00 68.12  ? 247 LYS A CD  1 
ATOM   516  C  CE  . LYS A 1 74  ? 24.066 58.282 34.141 1.00 68.67  ? 247 LYS A CE  1 
ATOM   517  N  NZ  . LYS A 1 74  ? 24.298 57.810 35.540 1.00 70.34  ? 247 LYS A NZ  1 
ATOM   518  N  N   . GLN A 1 75  ? 19.978 60.509 33.736 1.00 66.31  ? 248 GLN A N   1 
ATOM   519  C  CA  . GLN A 1 75  ? 20.347 61.796 34.291 1.00 65.72  ? 248 GLN A CA  1 
ATOM   520  C  C   . GLN A 1 75  ? 21.384 61.592 35.384 1.00 65.07  ? 248 GLN A C   1 
ATOM   521  O  O   . GLN A 1 75  ? 21.145 60.872 36.341 1.00 64.69  ? 248 GLN A O   1 
ATOM   522  C  CB  . GLN A 1 75  ? 19.105 62.503 34.843 1.00 65.76  ? 248 GLN A CB  1 
ATOM   523  C  CG  . GLN A 1 75  ? 19.294 63.997 35.116 1.00 66.52  ? 248 GLN A CG  1 
ATOM   524  C  CD  . GLN A 1 75  ? 17.990 64.782 35.071 1.00 67.15  ? 248 GLN A CD  1 
ATOM   525  O  OE1 . GLN A 1 75  ? 17.892 65.796 34.378 1.00 67.38  ? 248 GLN A OE1 1 
ATOM   526  N  NE2 . GLN A 1 75  ? 16.980 64.307 35.796 1.00 67.79  ? 248 GLN A NE2 1 
ATOM   527  N  N   . THR A 1 76  ? 22.543 62.220 35.224 1.00 64.73  ? 249 THR A N   1 
ATOM   528  C  CA  . THR A 1 76  ? 23.584 62.172 36.237 1.00 64.28  ? 249 THR A CA  1 
ATOM   529  C  C   . THR A 1 76  ? 23.158 62.996 37.455 1.00 64.65  ? 249 THR A C   1 
ATOM   530  O  O   . THR A 1 76  ? 22.483 64.024 37.326 1.00 64.59  ? 249 THR A O   1 
ATOM   531  C  CB  . THR A 1 76  ? 24.941 62.688 35.693 1.00 64.02  ? 249 THR A CB  1 
ATOM   532  O  OG1 . THR A 1 76  ? 24.996 64.116 35.754 1.00 63.06  ? 249 THR A OG1 1 
ATOM   533  C  CG2 . THR A 1 76  ? 25.139 62.264 34.266 1.00 63.33  ? 249 THR A CG2 1 
ATOM   534  N  N   . SER A 1 77  ? 23.558 62.543 38.640 1.00 64.71  ? 250 SER A N   1 
ATOM   535  C  CA  . SER A 1 77  ? 23.252 63.255 39.879 1.00 64.53  ? 250 SER A CA  1 
ATOM   536  C  C   . SER A 1 77  ? 23.520 64.758 39.803 1.00 64.21  ? 250 SER A C   1 
ATOM   537  O  O   . SER A 1 77  ? 22.873 65.524 40.505 1.00 64.19  ? 250 SER A O   1 
ATOM   538  C  CB  . SER A 1 77  ? 24.020 62.645 41.059 1.00 64.78  ? 250 SER A CB  1 
ATOM   539  O  OG  . SER A 1 77  ? 25.417 62.794 40.891 1.00 64.80  ? 250 SER A OG  1 
ATOM   540  N  N   . GLU A 1 78  ? 24.467 65.173 38.960 1.00 64.03  ? 251 GLU A N   1 
ATOM   541  C  CA  . GLU A 1 78  ? 24.804 66.593 38.815 1.00 63.95  ? 251 GLU A CA  1 
ATOM   542  C  C   . GLU A 1 78  ? 23.820 67.336 37.921 1.00 64.06  ? 251 GLU A C   1 
ATOM   543  O  O   . GLU A 1 78  ? 23.904 68.558 37.788 1.00 63.70  ? 251 GLU A O   1 
ATOM   544  C  CB  . GLU A 1 78  ? 26.213 66.777 38.258 1.00 63.74  ? 251 GLU A CB  1 
ATOM   545  C  CG  . GLU A 1 78  ? 27.293 66.235 39.140 1.00 63.67  ? 251 GLU A CG  1 
ATOM   546  C  CD  . GLU A 1 78  ? 27.502 64.752 38.942 1.00 64.11  ? 251 GLU A CD  1 
ATOM   547  O  OE1 . GLU A 1 78  ? 26.793 64.151 38.092 1.00 63.28  ? 251 GLU A OE1 1 
ATOM   548  O  OE2 . GLU A 1 78  ? 28.388 64.197 39.645 1.00 64.83  ? 251 GLU A OE2 1 
ATOM   549  N  N   . GLY A 1 79  ? 22.907 66.594 37.297 1.00 64.41  ? 252 GLY A N   1 
ATOM   550  C  CA  . GLY A 1 79  ? 21.852 67.187 36.481 1.00 64.94  ? 252 GLY A CA  1 
ATOM   551  C  C   . GLY A 1 79  ? 21.896 66.859 34.994 1.00 65.30  ? 252 GLY A C   1 
ATOM   552  O  O   . GLY A 1 79  ? 20.952 67.174 34.263 1.00 65.39  ? 252 GLY A O   1 
ATOM   553  N  N   . GLU A 1 80  ? 22.975 66.216 34.543 1.00 65.51  ? 253 GLU A N   1 
ATOM   554  C  CA  . GLU A 1 80  ? 23.231 66.033 33.104 1.00 65.67  ? 253 GLU A CA  1 
ATOM   555  C  C   . GLU A 1 80  ? 22.373 64.928 32.473 1.00 66.12  ? 253 GLU A C   1 
ATOM   556  O  O   . GLU A 1 80  ? 22.435 63.768 32.895 1.00 66.33  ? 253 GLU A O   1 
ATOM   557  C  CB  . GLU A 1 80  ? 24.720 65.756 32.873 1.00 65.35  ? 253 GLU A CB  1 
ATOM   558  C  CG  . GLU A 1 80  ? 25.142 65.709 31.390 1.00 65.29  ? 253 GLU A CG  1 
ATOM   559  C  CD  . GLU A 1 80  ? 26.588 65.247 31.221 1.00 65.84  ? 253 GLU A CD  1 
ATOM   560  O  OE1 . GLU A 1 80  ? 27.201 64.847 32.247 1.00 67.00  ? 253 GLU A OE1 1 
ATOM   561  O  OE2 . GLU A 1 80  ? 27.114 65.304 30.072 1.00 65.51  ? 253 GLU A OE2 1 
ATOM   562  N  N   . PHE A 1 81  ? 21.584 65.291 31.460 1.00 66.49  ? 254 PHE A N   1 
ATOM   563  C  CA  . PHE A 1 81  ? 20.689 64.334 30.789 1.00 66.54  ? 254 PHE A CA  1 
ATOM   564  C  C   . PHE A 1 81  ? 21.408 63.727 29.605 1.00 66.12  ? 254 PHE A C   1 
ATOM   565  O  O   . PHE A 1 81  ? 21.770 64.438 28.673 1.00 66.27  ? 254 PHE A O   1 
ATOM   566  C  CB  . PHE A 1 81  ? 19.367 65.016 30.351 1.00 66.71  ? 254 PHE A CB  1 
ATOM   567  C  CG  . PHE A 1 81  ? 18.355 64.073 29.701 1.00 67.94  ? 254 PHE A CG  1 
ATOM   568  C  CD1 . PHE A 1 81  ? 17.582 63.167 30.468 1.00 69.46  ? 254 PHE A CD1 1 
ATOM   569  C  CD2 . PHE A 1 81  ? 18.148 64.106 28.330 1.00 69.14  ? 254 PHE A CD2 1 
ATOM   570  C  CE1 . PHE A 1 81  ? 16.681 62.298 29.861 1.00 69.29  ? 254 PHE A CE1 1 
ATOM   571  C  CE2 . PHE A 1 81  ? 17.219 63.246 27.723 1.00 69.02  ? 254 PHE A CE2 1 
ATOM   572  C  CZ  . PHE A 1 81  ? 16.465 62.352 28.495 1.00 68.73  ? 254 PHE A CZ  1 
ATOM   573  N  N   . ILE A 1 82  ? 21.636 62.416 29.655 1.00 65.58  ? 255 ILE A N   1 
ATOM   574  C  CA  . ILE A 1 82  ? 22.269 61.703 28.553 1.00 65.14  ? 255 ILE A CA  1 
ATOM   575  C  C   . ILE A 1 82  ? 21.203 60.953 27.799 1.00 65.00  ? 255 ILE A C   1 
ATOM   576  O  O   . ILE A 1 82  ? 20.818 59.871 28.209 1.00 65.28  ? 255 ILE A O   1 
ATOM   577  C  CB  . ILE A 1 82  ? 23.290 60.635 29.028 1.00 65.28  ? 255 ILE A CB  1 
ATOM   578  C  CG1 . ILE A 1 82  ? 24.088 61.097 30.251 1.00 65.71  ? 255 ILE A CG1 1 
ATOM   579  C  CG2 . ILE A 1 82  ? 24.195 60.229 27.891 1.00 65.01  ? 255 ILE A CG2 1 
ATOM   580  C  CD1 . ILE A 1 82  ? 24.773 62.435 30.099 1.00 66.80  ? 255 ILE A CD1 1 
ATOM   581  N  N   . PRO A 1 83  ? 20.717 61.519 26.696 1.00 64.78  ? 256 PRO A N   1 
ATOM   582  C  CA  . PRO A 1 83  ? 19.737 60.757 25.946 1.00 64.97  ? 256 PRO A CA  1 
ATOM   583  C  C   . PRO A 1 83  ? 20.360 59.477 25.372 1.00 65.31  ? 256 PRO A C   1 
ATOM   584  O  O   . PRO A 1 83  ? 21.507 59.502 24.896 1.00 65.22  ? 256 PRO A O   1 
ATOM   585  C  CB  . PRO A 1 83  ? 19.337 61.717 24.826 1.00 64.83  ? 256 PRO A CB  1 
ATOM   586  C  CG  . PRO A 1 83  ? 20.505 62.632 24.670 1.00 64.73  ? 256 PRO A CG  1 
ATOM   587  C  CD  . PRO A 1 83  ? 21.077 62.801 26.044 1.00 64.71  ? 256 PRO A CD  1 
ATOM   588  N  N   . LEU A 1 84  ? 19.620 58.365 25.449 1.00 65.61  ? 257 LEU A N   1 
ATOM   589  C  CA  . LEU A 1 84  ? 20.033 57.086 24.839 1.00 66.00  ? 257 LEU A CA  1 
ATOM   590  C  C   . LEU A 1 84  ? 21.492 56.646 25.130 1.00 66.38  ? 257 LEU A C   1 
ATOM   591  O  O   . LEU A 1 84  ? 22.261 56.268 24.225 1.00 66.17  ? 257 LEU A O   1 
ATOM   592  C  CB  . LEU A 1 84  ? 19.688 57.074 23.339 1.00 65.92  ? 257 LEU A CB  1 
ATOM   593  C  CG  . LEU A 1 84  ? 18.228 56.683 23.019 1.00 66.26  ? 257 LEU A CG  1 
ATOM   594  C  CD1 . LEU A 1 84  ? 17.199 57.716 23.479 1.00 66.19  ? 257 LEU A CD1 1 
ATOM   595  C  CD2 . LEU A 1 84  ? 18.061 56.404 21.531 1.00 66.78  ? 257 LEU A CD2 1 
ATOM   596  N  N   . ASN A 1 85  ? 21.838 56.694 26.416 1.00 66.90  ? 258 ASN A N   1 
ATOM   597  C  CA  . ASN A 1 85  ? 23.151 56.323 26.903 1.00 67.49  ? 258 ASN A CA  1 
ATOM   598  C  C   . ASN A 1 85  ? 23.446 54.839 26.700 1.00 68.02  ? 258 ASN A C   1 
ATOM   599  O  O   . ASN A 1 85  ? 22.575 53.988 26.891 1.00 67.82  ? 258 ASN A O   1 
ATOM   600  C  CB  . ASN A 1 85  ? 23.244 56.675 28.385 1.00 67.52  ? 258 ASN A CB  1 
ATOM   601  C  CG  . ASN A 1 85  ? 24.662 56.664 28.907 1.00 67.88  ? 258 ASN A CG  1 
ATOM   602  O  OD1 . ASN A 1 85  ? 25.599 57.085 28.212 1.00 65.97  ? 258 ASN A OD1 1 
ATOM   603  N  ND2 . ASN A 1 85  ? 24.828 56.194 30.156 1.00 68.16  ? 258 ASN A ND2 1 
ATOM   604  N  N   . GLN A 1 86  ? 24.683 54.543 26.305 1.00 69.01  ? 259 GLN A N   1 
ATOM   605  C  CA  . GLN A 1 86  ? 25.151 53.167 26.119 1.00 69.15  ? 259 GLN A CA  1 
ATOM   606  C  C   . GLN A 1 86  ? 26.028 52.719 27.280 1.00 69.04  ? 259 GLN A C   1 
ATOM   607  O  O   . GLN A 1 86  ? 26.907 53.454 27.717 1.00 69.10  ? 259 GLN A O   1 
ATOM   608  C  CB  . GLN A 1 86  ? 25.966 53.037 24.838 1.00 69.15  ? 259 GLN A CB  1 
ATOM   609  C  CG  . GLN A 1 86  ? 25.201 53.218 23.554 1.00 70.38  ? 259 GLN A CG  1 
ATOM   610  C  CD  . GLN A 1 86  ? 26.068 52.965 22.330 1.00 72.32  ? 259 GLN A CD  1 
ATOM   611  O  OE1 . GLN A 1 86  ? 25.804 53.494 21.248 1.00 73.18  ? 259 GLN A OE1 1 
ATOM   612  N  NE2 . GLN A 1 86  ? 27.112 52.153 22.496 1.00 73.69  ? 259 GLN A NE2 1 
ATOM   613  N  N   . THR A 1 87  ? 25.782 51.506 27.769 1.00 69.14  ? 260 THR A N   1 
ATOM   614  C  CA  . THR A 1 87  ? 26.621 50.862 28.778 1.00 69.07  ? 260 THR A CA  1 
ATOM   615  C  C   . THR A 1 87  ? 26.640 49.358 28.487 1.00 68.99  ? 260 THR A C   1 
ATOM   616  O  O   . THR A 1 87  ? 25.585 48.764 28.255 1.00 69.29  ? 260 THR A O   1 
ATOM   617  C  CB  . THR A 1 87  ? 26.129 51.140 30.233 1.00 69.08  ? 260 THR A CB  1 
ATOM   618  O  OG1 . THR A 1 87  ? 24.747 50.783 30.368 1.00 69.71  ? 260 THR A OG1 1 
ATOM   619  C  CG2 . THR A 1 87  ? 26.316 52.615 30.620 1.00 68.78  ? 260 THR A CG2 1 
ATOM   620  N  N   . ASP A 1 88  ? 27.836 48.757 28.483 1.00 68.71  ? 261 ASP A N   1 
ATOM   621  C  CA  . ASP A 1 88  ? 28.035 47.323 28.151 1.00 68.03  ? 261 ASP A CA  1 
ATOM   622  C  C   . ASP A 1 88  ? 27.300 46.377 29.111 1.00 67.44  ? 261 ASP A C   1 
ATOM   623  O  O   . ASP A 1 88  ? 27.261 46.614 30.305 1.00 67.50  ? 261 ASP A O   1 
ATOM   624  C  CB  . ASP A 1 88  ? 29.538 46.985 28.129 1.00 67.95  ? 261 ASP A CB  1 
ATOM   625  C  CG  . ASP A 1 88  ? 29.934 46.103 26.953 1.00 68.06  ? 261 ASP A CG  1 
ATOM   626  O  OD1 . ASP A 1 88  ? 30.390 46.645 25.929 1.00 68.54  ? 261 ASP A OD1 1 
ATOM   627  O  OD2 . ASP A 1 88  ? 29.794 44.867 27.036 1.00 69.04  ? 261 ASP A OD2 1 
ATOM   628  N  N   . ILE A 1 89  ? 26.707 45.320 28.567 1.00 66.95  ? 262 ILE A N   1 
ATOM   629  C  CA  . ILE A 1 89  ? 26.090 44.247 29.345 1.00 66.46  ? 262 ILE A CA  1 
ATOM   630  C  C   . ILE A 1 89  ? 27.042 43.053 29.371 1.00 66.47  ? 262 ILE A C   1 
ATOM   631  O  O   . ILE A 1 89  ? 27.511 42.605 28.323 1.00 66.61  ? 262 ILE A O   1 
ATOM   632  C  CB  . ILE A 1 89  ? 24.772 43.785 28.692 1.00 66.28  ? 262 ILE A CB  1 
ATOM   633  C  CG1 . ILE A 1 89  ? 23.687 44.835 28.867 1.00 66.17  ? 262 ILE A CG1 1 
ATOM   634  C  CG2 . ILE A 1 89  ? 24.297 42.480 29.270 1.00 65.75  ? 262 ILE A CG2 1 
ATOM   635  C  CD1 . ILE A 1 89  ? 22.508 44.582 27.991 1.00 65.89  ? 262 ILE A CD1 1 
ATOM   636  N  N   . ASN A 1 90  ? 27.334 42.529 30.555 1.00 66.35  ? 263 ASN A N   1 
ATOM   637  C  CA  . ASN A 1 90  ? 28.229 41.383 30.644 1.00 66.19  ? 263 ASN A CA  1 
ATOM   638  C  C   . ASN A 1 90  ? 27.621 40.107 30.068 1.00 66.09  ? 263 ASN A C   1 
ATOM   639  O  O   . ASN A 1 90  ? 26.612 39.617 30.556 1.00 65.98  ? 263 ASN A O   1 
ATOM   640  C  CB  . ASN A 1 90  ? 28.678 41.150 32.087 1.00 66.25  ? 263 ASN A CB  1 
ATOM   641  C  CG  . ASN A 1 90  ? 29.962 40.338 32.179 1.00 66.06  ? 263 ASN A CG  1 
ATOM   642  O  OD1 . ASN A 1 90  ? 30.271 39.524 31.311 1.00 67.29  ? 263 ASN A OD1 1 
ATOM   643  N  ND2 . ASN A 1 90  ? 30.710 40.557 33.237 1.00 65.57  ? 263 ASN A ND2 1 
ATOM   644  N  N   . VAL A 1 91  ? 28.237 39.582 29.016 1.00 66.22  ? 264 VAL A N   1 
ATOM   645  C  CA  . VAL A 1 91  ? 27.813 38.310 28.439 1.00 66.33  ? 264 VAL A CA  1 
ATOM   646  C  C   . VAL A 1 91  ? 29.023 37.451 28.107 1.00 66.69  ? 264 VAL A C   1 
ATOM   647  O  O   . VAL A 1 91  ? 29.061 36.766 27.074 1.00 66.77  ? 264 VAL A O   1 
ATOM   648  C  CB  . VAL A 1 91  ? 26.926 38.472 27.164 1.00 66.24  ? 264 VAL A CB  1 
ATOM   649  C  CG1 . VAL A 1 91  ? 25.637 39.215 27.472 1.00 65.81  ? 264 VAL A CG1 1 
ATOM   650  C  CG2 . VAL A 1 91  ? 27.690 39.149 26.040 1.00 65.97  ? 264 VAL A CG2 1 
ATOM   651  N  N   . GLY A 1 92  ? 30.022 37.507 28.982 1.00 67.08  ? 265 GLY A N   1 
ATOM   652  C  CA  . GLY A 1 92  ? 31.170 36.612 28.887 1.00 67.71  ? 265 GLY A CA  1 
ATOM   653  C  C   . GLY A 1 92  ? 32.518 37.268 28.719 1.00 68.06  ? 265 GLY A C   1 
ATOM   654  O  O   . GLY A 1 92  ? 33.526 36.586 28.687 1.00 68.06  ? 265 GLY A O   1 
ATOM   655  N  N   . TYR A 1 93  ? 32.539 38.592 28.615 1.00 68.61  ? 266 TYR A N   1 
ATOM   656  C  CA  . TYR A 1 93  ? 33.784 39.326 28.439 1.00 69.14  ? 266 TYR A CA  1 
ATOM   657  C  C   . TYR A 1 93  ? 34.943 38.796 29.296 1.00 69.03  ? 266 TYR A C   1 
ATOM   658  O  O   . TYR A 1 93  ? 35.945 38.334 28.763 1.00 69.11  ? 266 TYR A O   1 
ATOM   659  C  CB  . TYR A 1 93  ? 33.563 40.829 28.667 1.00 69.40  ? 266 TYR A CB  1 
ATOM   660  C  CG  . TYR A 1 93  ? 34.728 41.736 28.242 1.00 71.24  ? 266 TYR A CG  1 
ATOM   661  C  CD1 . TYR A 1 93  ? 35.441 41.510 27.049 1.00 72.55  ? 266 TYR A CD1 1 
ATOM   662  C  CD2 . TYR A 1 93  ? 35.094 42.841 29.019 1.00 72.86  ? 266 TYR A CD2 1 
ATOM   663  C  CE1 . TYR A 1 93  ? 36.499 42.351 26.661 1.00 72.59  ? 266 TYR A CE1 1 
ATOM   664  C  CE2 . TYR A 1 93  ? 36.149 43.684 28.634 1.00 73.06  ? 266 TYR A CE2 1 
ATOM   665  C  CZ  . TYR A 1 93  ? 36.841 43.435 27.461 1.00 72.96  ? 266 TYR A CZ  1 
ATOM   666  O  OH  . TYR A 1 93  ? 37.864 44.281 27.099 1.00 72.94  ? 266 TYR A OH  1 
ATOM   667  N  N   . TYR A 1 94  ? 34.793 38.834 30.615 1.00 69.32  ? 267 TYR A N   1 
ATOM   668  C  CA  . TYR A 1 94  ? 35.909 38.564 31.533 1.00 69.59  ? 267 TYR A CA  1 
ATOM   669  C  C   . TYR A 1 94  ? 36.486 37.151 31.533 1.00 69.58  ? 267 TYR A C   1 
ATOM   670  O  O   . TYR A 1 94  ? 37.555 36.937 32.092 1.00 69.92  ? 267 TYR A O   1 
ATOM   671  C  CB  . TYR A 1 94  ? 35.524 38.899 32.972 1.00 69.81  ? 267 TYR A CB  1 
ATOM   672  C  CG  . TYR A 1 94  ? 35.109 40.326 33.224 1.00 70.58  ? 267 TYR A CG  1 
ATOM   673  C  CD1 . TYR A 1 94  ? 36.049 41.358 33.271 1.00 71.31  ? 267 TYR A CD1 1 
ATOM   674  C  CD2 . TYR A 1 94  ? 33.781 40.639 33.454 1.00 70.80  ? 267 TYR A CD2 1 
ATOM   675  C  CE1 . TYR A 1 94  ? 35.660 42.661 33.520 1.00 71.34  ? 267 TYR A CE1 1 
ATOM   676  C  CE2 . TYR A 1 94  ? 33.389 41.932 33.703 1.00 71.38  ? 267 TYR A CE2 1 
ATOM   677  C  CZ  . TYR A 1 94  ? 34.325 42.934 33.735 1.00 71.18  ? 267 TYR A CZ  1 
ATOM   678  O  OH  . TYR A 1 94  ? 33.904 44.208 33.987 1.00 71.53  ? 267 TYR A OH  1 
ATOM   679  N  N   . THR A 1 95  ? 35.779 36.188 30.945 1.00 69.55  ? 268 THR A N   1 
ATOM   680  C  CA  . THR A 1 95  ? 36.222 34.792 30.954 1.00 69.18  ? 268 THR A CA  1 
ATOM   681  C  C   . THR A 1 95  ? 36.492 34.247 29.551 1.00 69.18  ? 268 THR A C   1 
ATOM   682  O  O   . THR A 1 95  ? 37.156 33.223 29.392 1.00 69.48  ? 268 THR A O   1 
ATOM   683  C  CB  . THR A 1 95  ? 35.209 33.870 31.665 1.00 69.05  ? 268 THR A CB  1 
ATOM   684  O  OG1 . THR A 1 95  ? 34.007 33.786 30.895 1.00 69.29  ? 268 THR A OG1 1 
ATOM   685  C  CG2 . THR A 1 95  ? 34.873 34.394 33.040 1.00 68.89  ? 268 THR A CG2 1 
ATOM   686  N  N   . GLY A 1 96  ? 35.983 34.938 28.537 1.00 69.16  ? 269 GLY A N   1 
ATOM   687  C  CA  . GLY A 1 96  ? 36.098 34.481 27.162 1.00 69.06  ? 269 GLY A CA  1 
ATOM   688  C  C   . GLY A 1 96  ? 34.864 33.759 26.639 1.00 69.08  ? 269 GLY A C   1 
ATOM   689  O  O   . GLY A 1 96  ? 34.835 33.357 25.487 1.00 69.30  ? 269 GLY A O   1 
ATOM   690  N  N   . ASP A 1 97  ? 33.842 33.591 27.474 1.00 69.04  ? 270 ASP A N   1 
ATOM   691  C  CA  . ASP A 1 97  ? 32.597 32.949 27.048 1.00 69.04  ? 270 ASP A CA  1 
ATOM   692  C  C   . ASP A 1 97  ? 31.818 33.783 26.024 1.00 68.75  ? 270 ASP A C   1 
ATOM   693  O  O   . ASP A 1 97  ? 30.813 33.337 25.469 1.00 68.79  ? 270 ASP A O   1 
ATOM   694  C  CB  . ASP A 1 97  ? 31.711 32.623 28.258 1.00 69.36  ? 270 ASP A CB  1 
ATOM   695  C  CG  . ASP A 1 97  ? 31.933 31.212 28.791 1.00 70.02  ? 270 ASP A CG  1 
ATOM   696  O  OD1 . ASP A 1 97  ? 31.412 30.251 28.184 1.00 70.27  ? 270 ASP A OD1 1 
ATOM   697  O  OD2 . ASP A 1 97  ? 32.618 31.069 29.828 1.00 71.23  ? 270 ASP A OD2 1 
ATOM   698  N  N   . ASP A 1 98  ? 32.281 34.997 25.777 1.00 68.43  ? 271 ASP A N   1 
ATOM   699  C  CA  . ASP A 1 98  ? 31.683 35.822 24.754 1.00 68.09  ? 271 ASP A CA  1 
ATOM   700  C  C   . ASP A 1 98  ? 32.314 35.541 23.404 1.00 67.95  ? 271 ASP A C   1 
ATOM   701  O  O   . ASP A 1 98  ? 31.829 36.018 22.390 1.00 67.97  ? 271 ASP A O   1 
ATOM   702  C  CB  . ASP A 1 98  ? 31.839 37.292 25.106 1.00 68.20  ? 271 ASP A CB  1 
ATOM   703  C  CG  . ASP A 1 98  ? 33.269 37.756 25.040 1.00 68.31  ? 271 ASP A CG  1 
ATOM   704  O  OD1 . ASP A 1 98  ? 34.188 36.923 25.135 1.00 69.78  ? 271 ASP A OD1 1 
ATOM   705  O  OD2 . ASP A 1 98  ? 33.481 38.966 24.891 1.00 68.67  ? 271 ASP A OD2 1 
ATOM   706  N  N   . ARG A 1 99  ? 33.418 34.791 23.402 1.00 68.01  ? 272 ARG A N   1 
ATOM   707  C  CA  . ARG A 1 99  ? 34.042 34.290 22.165 1.00 67.79  ? 272 ARG A CA  1 
ATOM   708  C  C   . ARG A 1 99  ? 33.386 32.957 21.799 1.00 67.44  ? 272 ARG A C   1 
ATOM   709  O  O   . ARG A 1 99  ? 33.624 31.931 22.441 1.00 67.48  ? 272 ARG A O   1 
ATOM   710  C  CB  . ARG A 1 99  ? 35.557 34.082 22.329 1.00 67.84  ? 272 ARG A CB  1 
ATOM   711  C  CG  . ARG A 1 99  ? 36.371 35.297 22.724 1.00 67.83  ? 272 ARG A CG  1 
ATOM   712  C  CD  . ARG A 1 99  ? 37.788 34.866 23.083 1.00 68.80  ? 272 ARG A CD  1 
ATOM   713  N  NE  . ARG A 1 99  ? 37.778 33.845 24.132 1.00 70.27  ? 272 ARG A NE  1 
ATOM   714  C  CZ  . ARG A 1 99  ? 38.851 33.225 24.628 1.00 70.45  ? 272 ARG A CZ  1 
ATOM   715  N  NH1 . ARG A 1 99  ? 40.068 33.496 24.181 1.00 69.62  ? 272 ARG A NH1 1 
ATOM   716  N  NH2 . ARG A 1 99  ? 38.703 32.312 25.583 1.00 70.58  ? 272 ARG A NH2 1 
ATOM   717  N  N   . LEU A 1 100 ? 32.580 32.976 20.751 1.00 66.91  ? 273 LEU A N   1 
ATOM   718  C  CA  . LEU A 1 100 ? 31.659 31.887 20.491 1.00 66.11  ? 273 LEU A CA  1 
ATOM   719  C  C   . LEU A 1 100 ? 32.183 30.777 19.566 1.00 65.77  ? 273 LEU A C   1 
ATOM   720  O  O   . LEU A 1 100 ? 32.939 31.028 18.625 1.00 66.03  ? 273 LEU A O   1 
ATOM   721  C  CB  . LEU A 1 100 ? 30.333 32.458 19.972 1.00 65.90  ? 273 LEU A CB  1 
ATOM   722  C  CG  . LEU A 1 100 ? 29.583 33.418 20.903 1.00 65.03  ? 273 LEU A CG  1 
ATOM   723  C  CD1 . LEU A 1 100 ? 28.404 33.995 20.191 1.00 64.99  ? 273 LEU A CD1 1 
ATOM   724  C  CD2 . LEU A 1 100 ? 29.121 32.724 22.162 1.00 64.62  ? 273 LEU A CD2 1 
ATOM   725  N  N   . PHE A 1 101 ? 31.790 29.542 19.866 1.00 65.10  ? 274 PHE A N   1 
ATOM   726  C  CA  . PHE A 1 101 ? 31.950 28.447 18.922 1.00 64.53  ? 274 PHE A CA  1 
ATOM   727  C  C   . PHE A 1 101 ? 30.584 28.121 18.336 1.00 64.55  ? 274 PHE A C   1 
ATOM   728  O  O   . PHE A 1 101 ? 29.843 27.271 18.839 1.00 64.37  ? 274 PHE A O   1 
ATOM   729  C  CB  . PHE A 1 101 ? 32.570 27.223 19.579 1.00 64.33  ? 274 PHE A CB  1 
ATOM   730  C  CG  . PHE A 1 101 ? 32.714 26.054 18.655 1.00 62.86  ? 274 PHE A CG  1 
ATOM   731  C  CD1 . PHE A 1 101 ? 33.380 26.188 17.451 1.00 62.59  ? 274 PHE A CD1 1 
ATOM   732  C  CD2 . PHE A 1 101 ? 32.199 24.822 19.000 1.00 61.80  ? 274 PHE A CD2 1 
ATOM   733  C  CE1 . PHE A 1 101 ? 33.521 25.121 16.605 1.00 63.06  ? 274 PHE A CE1 1 
ATOM   734  C  CE2 . PHE A 1 101 ? 32.338 23.748 18.162 1.00 62.29  ? 274 PHE A CE2 1 
ATOM   735  C  CZ  . PHE A 1 101 ? 33.001 23.894 16.960 1.00 63.13  ? 274 PHE A CZ  1 
ATOM   736  N  N   . LEU A 1 102 ? 30.272 28.824 17.258 1.00 64.36  ? 275 LEU A N   1 
ATOM   737  C  CA  . LEU A 1 102 ? 28.935 28.850 16.709 1.00 64.13  ? 275 LEU A CA  1 
ATOM   738  C  C   . LEU A 1 102 ? 28.692 27.695 15.731 1.00 64.34  ? 275 LEU A C   1 
ATOM   739  O  O   . LEU A 1 102 ? 28.797 27.846 14.514 1.00 64.38  ? 275 LEU A O   1 
ATOM   740  C  CB  . LEU A 1 102 ? 28.701 30.208 16.054 1.00 63.73  ? 275 LEU A CB  1 
ATOM   741  C  CG  . LEU A 1 102 ? 27.274 30.733 16.048 1.00 63.76  ? 275 LEU A CG  1 
ATOM   742  C  CD1 . LEU A 1 102 ? 26.595 30.583 17.402 1.00 62.58  ? 275 LEU A CD1 1 
ATOM   743  C  CD2 . LEU A 1 102 ? 27.308 32.175 15.618 1.00 64.38  ? 275 LEU A CD2 1 
ATOM   744  N  N   . VAL A 1 103 ? 28.361 26.537 16.282 1.00 64.66  ? 276 VAL A N   1 
ATOM   745  C  CA  . VAL A 1 103 ? 28.092 25.357 15.472 1.00 65.28  ? 276 VAL A CA  1 
ATOM   746  C  C   . VAL A 1 103 ? 26.666 24.856 15.653 1.00 65.53  ? 276 VAL A C   1 
ATOM   747  O  O   . VAL A 1 103 ? 26.262 23.855 15.042 1.00 65.82  ? 276 VAL A O   1 
ATOM   748  C  CB  . VAL A 1 103 ? 29.064 24.242 15.808 1.00 65.38  ? 276 VAL A CB  1 
ATOM   749  C  CG1 . VAL A 1 103 ? 30.277 24.351 14.915 1.00 65.64  ? 276 VAL A CG1 1 
ATOM   750  C  CG2 . VAL A 1 103 ? 29.455 24.335 17.263 1.00 65.46  ? 276 VAL A CG2 1 
ATOM   751  N  N   . SER A 1 104 ? 25.923 25.551 16.512 1.00 65.37  ? 277 SER A N   1 
ATOM   752  C  CA  . SER A 1 104 ? 24.503 25.336 16.670 1.00 65.46  ? 277 SER A CA  1 
ATOM   753  C  C   . SER A 1 104 ? 23.964 26.492 17.484 1.00 65.15  ? 277 SER A C   1 
ATOM   754  O  O   . SER A 1 104 ? 24.676 27.053 18.307 1.00 65.25  ? 277 SER A O   1 
ATOM   755  C  CB  . SER A 1 104 ? 24.230 24.020 17.387 1.00 65.62  ? 277 SER A CB  1 
ATOM   756  O  OG  . SER A 1 104 ? 24.615 24.116 18.753 1.00 66.99  ? 277 SER A OG  1 
ATOM   757  N  N   . PRO A 1 105 ? 22.698 26.851 17.263 1.00 64.85  ? 278 PRO A N   1 
ATOM   758  C  CA  . PRO A 1 105 ? 22.074 27.961 17.968 1.00 64.77  ? 278 PRO A CA  1 
ATOM   759  C  C   . PRO A 1 105 ? 22.408 27.945 19.465 1.00 64.47  ? 278 PRO A C   1 
ATOM   760  O  O   . PRO A 1 105 ? 22.260 26.904 20.126 1.00 63.92  ? 278 PRO A O   1 
ATOM   761  C  CB  . PRO A 1 105 ? 20.584 27.703 17.745 1.00 64.91  ? 278 PRO A CB  1 
ATOM   762  C  CG  . PRO A 1 105 ? 20.527 26.997 16.445 1.00 64.58  ? 278 PRO A CG  1 
ATOM   763  C  CD  . PRO A 1 105 ? 21.766 26.181 16.343 1.00 64.66  ? 278 PRO A CD  1 
ATOM   764  N  N   . LEU A 1 106 ? 22.849 29.094 19.982 1.00 64.28  ? 279 LEU A N   1 
ATOM   765  C  CA  . LEU A 1 106 ? 23.321 29.183 21.364 1.00 64.36  ? 279 LEU A CA  1 
ATOM   766  C  C   . LEU A 1 106 ? 22.510 30.125 22.230 1.00 63.84  ? 279 LEU A C   1 
ATOM   767  O  O   . LEU A 1 106 ? 22.101 31.192 21.785 1.00 63.64  ? 279 LEU A O   1 
ATOM   768  C  CB  . LEU A 1 106 ? 24.796 29.598 21.408 1.00 64.33  ? 279 LEU A CB  1 
ATOM   769  C  CG  . LEU A 1 106 ? 25.844 28.602 20.897 1.00 63.96  ? 279 LEU A CG  1 
ATOM   770  C  CD1 . LEU A 1 106 ? 27.195 29.266 20.760 1.00 64.44  ? 279 LEU A CD1 1 
ATOM   771  C  CD2 . LEU A 1 106 ? 25.955 27.390 21.798 1.00 63.53  ? 279 LEU A CD2 1 
ATOM   772  N  N   . ILE A 1 107 ? 22.287 29.725 23.474 1.00 63.46  ? 280 ILE A N   1 
ATOM   773  C  CA  . ILE A 1 107 ? 21.688 30.626 24.438 1.00 63.37  ? 280 ILE A CA  1 
ATOM   774  C  C   . ILE A 1 107 ? 22.798 31.453 25.063 1.00 63.30  ? 280 ILE A C   1 
ATOM   775  O  O   . ILE A 1 107 ? 23.671 30.913 25.724 1.00 63.58  ? 280 ILE A O   1 
ATOM   776  C  CB  . ILE A 1 107 ? 20.914 29.875 25.537 1.00 63.33  ? 280 ILE A CB  1 
ATOM   777  C  CG1 . ILE A 1 107 ? 19.863 28.959 24.912 1.00 63.78  ? 280 ILE A CG1 1 
ATOM   778  C  CG2 . ILE A 1 107 ? 20.226 30.861 26.468 1.00 62.64  ? 280 ILE A CG2 1 
ATOM   779  C  CD1 . ILE A 1 107 ? 19.622 27.657 25.677 1.00 64.75  ? 280 ILE A CD1 1 
ATOM   780  N  N   . ILE A 1 108 ? 22.782 32.758 24.828 1.00 63.20  ? 281 ILE A N   1 
ATOM   781  C  CA  . ILE A 1 108 ? 23.712 33.656 25.500 1.00 63.06  ? 281 ILE A CA  1 
ATOM   782  C  C   . ILE A 1 108 ? 23.086 34.064 26.821 1.00 63.26  ? 281 ILE A C   1 
ATOM   783  O  O   . ILE A 1 108 ? 21.875 34.296 26.899 1.00 63.56  ? 281 ILE A O   1 
ATOM   784  C  CB  . ILE A 1 108 ? 24.026 34.916 24.672 1.00 62.86  ? 281 ILE A CB  1 
ATOM   785  C  CG1 . ILE A 1 108 ? 24.633 34.550 23.313 1.00 62.96  ? 281 ILE A CG1 1 
ATOM   786  C  CG2 . ILE A 1 108 ? 24.931 35.840 25.439 1.00 62.29  ? 281 ILE A CG2 1 
ATOM   787  C  CD1 . ILE A 1 108 ? 25.589 33.361 23.326 1.00 63.13  ? 281 ILE A CD1 1 
ATOM   788  N  N   . SER A 1 109 ? 23.910 34.153 27.859 1.00 63.21  ? 282 SER A N   1 
ATOM   789  C  CA  . SER A 1 109 ? 23.406 34.373 29.198 1.00 63.07  ? 282 SER A CA  1 
ATOM   790  C  C   . SER A 1 109 ? 24.160 35.491 29.858 1.00 63.11  ? 282 SER A C   1 
ATOM   791  O  O   . SER A 1 109 ? 25.385 35.511 29.867 1.00 63.44  ? 282 SER A O   1 
ATOM   792  C  CB  . SER A 1 109 ? 23.537 33.095 30.027 1.00 63.14  ? 282 SER A CB  1 
ATOM   793  O  OG  . SER A 1 109 ? 23.164 33.306 31.379 1.00 63.24  ? 282 SER A OG  1 
ATOM   794  N  N   . HIS A 1 110 ? 23.407 36.432 30.403 1.00 63.29  ? 283 HIS A N   1 
ATOM   795  C  CA  . HIS A 1 110 ? 23.977 37.506 31.171 1.00 63.27  ? 283 HIS A CA  1 
ATOM   796  C  C   . HIS A 1 110 ? 23.502 37.372 32.599 1.00 63.58  ? 283 HIS A C   1 
ATOM   797  O  O   . HIS A 1 110 ? 22.330 37.601 32.895 1.00 63.61  ? 283 HIS A O   1 
ATOM   798  C  CB  . HIS A 1 110 ? 23.543 38.849 30.602 1.00 63.18  ? 283 HIS A CB  1 
ATOM   799  C  CG  . HIS A 1 110 ? 23.615 39.966 31.588 1.00 62.18  ? 283 HIS A CG  1 
ATOM   800  N  ND1 . HIS A 1 110 ? 24.798 40.586 31.923 1.00 61.49  ? 283 HIS A ND1 1 
ATOM   801  C  CD2 . HIS A 1 110 ? 22.651 40.567 32.321 1.00 61.73  ? 283 HIS A CD2 1 
ATOM   802  C  CE1 . HIS A 1 110 ? 24.559 41.526 32.818 1.00 61.38  ? 283 HIS A CE1 1 
ATOM   803  N  NE2 . HIS A 1 110 ? 23.264 41.536 33.075 1.00 61.37  ? 283 HIS A NE2 1 
ATOM   804  N  N   . GLU A 1 111 ? 24.426 37.002 33.477 1.00 63.98  ? 284 GLU A N   1 
ATOM   805  C  CA  . GLU A 1 111 ? 24.144 36.882 34.896 1.00 64.55  ? 284 GLU A CA  1 
ATOM   806  C  C   . GLU A 1 111 ? 23.903 38.248 35.507 1.00 64.45  ? 284 GLU A C   1 
ATOM   807  O  O   . GLU A 1 111 ? 24.798 39.081 35.539 1.00 64.48  ? 284 GLU A O   1 
ATOM   808  C  CB  . GLU A 1 111 ? 25.303 36.186 35.604 1.00 64.83  ? 284 GLU A CB  1 
ATOM   809  C  CG  . GLU A 1 111 ? 25.195 36.150 37.126 1.00 66.41  ? 284 GLU A CG  1 
ATOM   810  C  CD  . GLU A 1 111 ? 26.450 35.592 37.780 1.00 68.22  ? 284 GLU A CD  1 
ATOM   811  O  OE1 . GLU A 1 111 ? 27.017 34.618 37.236 1.00 69.15  ? 284 GLU A OE1 1 
ATOM   812  O  OE2 . GLU A 1 111 ? 26.867 36.128 38.832 1.00 68.86  ? 284 GLU A OE2 1 
ATOM   813  N  N   . ILE A 1 112 ? 22.680 38.467 35.983 1.00 64.65  ? 285 ILE A N   1 
ATOM   814  C  CA  . ILE A 1 112 ? 22.285 39.740 36.556 1.00 64.57  ? 285 ILE A CA  1 
ATOM   815  C  C   . ILE A 1 112 ? 22.860 39.852 37.959 1.00 65.23  ? 285 ILE A C   1 
ATOM   816  O  O   . ILE A 1 112 ? 22.358 39.220 38.884 1.00 65.80  ? 285 ILE A O   1 
ATOM   817  C  CB  . ILE A 1 112 ? 20.760 39.879 36.583 1.00 64.07  ? 285 ILE A CB  1 
ATOM   818  C  CG1 . ILE A 1 112 ? 20.219 39.864 35.160 1.00 63.32  ? 285 ILE A CG1 1 
ATOM   819  C  CG2 . ILE A 1 112 ? 20.354 41.160 37.262 1.00 63.88  ? 285 ILE A CG2 1 
ATOM   820  C  CD1 . ILE A 1 112 ? 18.744 39.692 35.076 1.00 62.52  ? 285 ILE A CD1 1 
ATOM   821  N  N   . ASN A 1 113 ? 23.928 40.638 38.103 1.00 65.63  ? 286 ASN A N   1 
ATOM   822  C  CA  . ASN A 1 113 ? 24.606 40.820 39.383 1.00 65.97  ? 286 ASN A CA  1 
ATOM   823  C  C   . ASN A 1 113 ? 24.781 42.279 39.730 1.00 66.26  ? 286 ASN A C   1 
ATOM   824  O  O   . ASN A 1 113 ? 24.303 43.137 39.011 1.00 66.45  ? 286 ASN A O   1 
ATOM   825  C  CB  . ASN A 1 113 ? 25.960 40.107 39.396 1.00 66.08  ? 286 ASN A CB  1 
ATOM   826  C  CG  . ASN A 1 113 ? 26.882 40.555 38.276 1.00 66.15  ? 286 ASN A CG  1 
ATOM   827  O  OD1 . ASN A 1 113 ? 26.758 41.653 37.730 1.00 67.12  ? 286 ASN A OD1 1 
ATOM   828  N  ND2 . ASN A 1 113 ? 27.825 39.695 37.932 1.00 65.93  ? 286 ASN A ND2 1 
ATOM   829  N  N   . GLN A 1 114 ? 25.477 42.563 40.825 1.00 66.82  ? 287 GLN A N   1 
ATOM   830  C  CA  . GLN A 1 114 ? 25.628 43.937 41.301 1.00 67.35  ? 287 GLN A CA  1 
ATOM   831  C  C   . GLN A 1 114 ? 26.067 44.918 40.208 1.00 67.54  ? 287 GLN A C   1 
ATOM   832  O  O   . GLN A 1 114 ? 25.731 46.093 40.261 1.00 67.78  ? 287 GLN A O   1 
ATOM   833  C  CB  . GLN A 1 114 ? 26.576 43.996 42.503 1.00 67.52  ? 287 GLN A CB  1 
ATOM   834  C  CG  . GLN A 1 114 ? 26.644 45.358 43.188 1.00 68.13  ? 287 GLN A CG  1 
ATOM   835  C  CD  . GLN A 1 114 ? 26.817 45.255 44.688 1.00 69.15  ? 287 GLN A CD  1 
ATOM   836  O  OE1 . GLN A 1 114 ? 27.356 44.270 45.208 1.00 70.14  ? 287 GLN A OE1 1 
ATOM   837  N  NE2 . GLN A 1 114 ? 26.346 46.271 45.398 1.00 69.03  ? 287 GLN A NE2 1 
ATOM   838  N  N   . GLN A 1 115 ? 26.798 44.437 39.212 1.00 67.79  ? 288 GLN A N   1 
ATOM   839  C  CA  . GLN A 1 115 ? 27.288 45.317 38.163 1.00 68.05  ? 288 GLN A CA  1 
ATOM   840  C  C   . GLN A 1 115 ? 26.363 45.369 36.965 1.00 67.83  ? 288 GLN A C   1 
ATOM   841  O  O   . GLN A 1 115 ? 26.547 46.200 36.078 1.00 67.98  ? 288 GLN A O   1 
ATOM   842  C  CB  . GLN A 1 115 ? 28.684 44.904 37.713 1.00 68.40  ? 288 GLN A CB  1 
ATOM   843  C  CG  . GLN A 1 115 ? 29.733 45.014 38.793 1.00 69.98  ? 288 GLN A CG  1 
ATOM   844  C  CD  . GLN A 1 115 ? 29.627 43.895 39.812 1.00 72.19  ? 288 GLN A CD  1 
ATOM   845  O  OE1 . GLN A 1 115 ? 29.617 42.707 39.454 1.00 72.64  ? 288 GLN A OE1 1 
ATOM   846  N  NE2 . GLN A 1 115 ? 29.549 44.266 41.094 1.00 72.73  ? 288 GLN A NE2 1 
ATOM   847  N  N   . SER A 1 116 ? 25.377 44.476 36.937 1.00 67.58  ? 289 SER A N   1 
ATOM   848  C  CA  . SER A 1 116 ? 24.402 44.438 35.853 1.00 67.25  ? 289 SER A CA  1 
ATOM   849  C  C   . SER A 1 116 ? 23.376 45.550 35.995 1.00 67.22  ? 289 SER A C   1 
ATOM   850  O  O   . SER A 1 116 ? 22.851 45.760 37.084 1.00 67.54  ? 289 SER A O   1 
ATOM   851  C  CB  . SER A 1 116 ? 23.683 43.099 35.838 1.00 67.06  ? 289 SER A CB  1 
ATOM   852  O  OG  . SER A 1 116 ? 22.541 43.158 35.011 1.00 66.87  ? 289 SER A OG  1 
ATOM   853  N  N   . PRO A 1 117 ? 23.084 46.266 34.893 1.00 67.09  ? 290 PRO A N   1 
ATOM   854  C  CA  . PRO A 1 117 ? 22.044 47.298 34.852 1.00 67.06  ? 290 PRO A CA  1 
ATOM   855  C  C   . PRO A 1 117 ? 20.658 46.830 35.313 1.00 67.20  ? 290 PRO A C   1 
ATOM   856  O  O   . PRO A 1 117 ? 19.760 47.656 35.502 1.00 67.35  ? 290 PRO A O   1 
ATOM   857  C  CB  . PRO A 1 117 ? 21.986 47.698 33.368 1.00 66.97  ? 290 PRO A CB  1 
ATOM   858  C  CG  . PRO A 1 117 ? 22.902 46.771 32.647 1.00 67.01  ? 290 PRO A CG  1 
ATOM   859  C  CD  . PRO A 1 117 ? 23.868 46.246 33.650 1.00 67.09  ? 290 PRO A CD  1 
ATOM   860  N  N   . PHE A 1 118 ? 20.500 45.521 35.505 1.00 67.27  ? 291 PHE A N   1 
ATOM   861  C  CA  . PHE A 1 118 ? 19.217 44.925 35.869 1.00 66.88  ? 291 PHE A CA  1 
ATOM   862  C  C   . PHE A 1 118 ? 19.169 44.528 37.336 1.00 67.07  ? 291 PHE A C   1 
ATOM   863  O  O   . PHE A 1 118 ? 18.154 44.046 37.827 1.00 67.32  ? 291 PHE A O   1 
ATOM   864  C  CB  . PHE A 1 118 ? 18.927 43.734 34.966 1.00 66.46  ? 291 PHE A CB  1 
ATOM   865  C  CG  . PHE A 1 118 ? 18.863 44.093 33.523 1.00 65.68  ? 291 PHE A CG  1 
ATOM   866  C  CD1 . PHE A 1 118 ? 17.658 44.435 32.935 1.00 65.73  ? 291 PHE A CD1 1 
ATOM   867  C  CD2 . PHE A 1 118 ? 20.011 44.117 32.751 1.00 64.87  ? 291 PHE A CD2 1 
ATOM   868  C  CE1 . PHE A 1 118 ? 17.597 44.786 31.590 1.00 65.66  ? 291 PHE A CE1 1 
ATOM   869  C  CE2 . PHE A 1 118 ? 19.961 44.469 31.412 1.00 64.71  ? 291 PHE A CE2 1 
ATOM   870  C  CZ  . PHE A 1 118 ? 18.754 44.804 30.830 1.00 65.08  ? 291 PHE A CZ  1 
ATOM   871  N  N   . TRP A 1 119 ? 20.267 44.764 38.038 1.00 67.19  ? 292 TRP A N   1 
ATOM   872  C  CA  . TRP A 1 119 ? 20.358 44.457 39.451 1.00 67.43  ? 292 TRP A CA  1 
ATOM   873  C  C   . TRP A 1 119 ? 19.068 44.831 40.179 1.00 68.06  ? 292 TRP A C   1 
ATOM   874  O  O   . TRP A 1 119 ? 18.490 43.991 40.863 1.00 68.43  ? 292 TRP A O   1 
ATOM   875  C  CB  . TRP A 1 119 ? 21.577 45.163 40.040 1.00 67.11  ? 292 TRP A CB  1 
ATOM   876  C  CG  . TRP A 1 119 ? 21.869 44.950 41.496 1.00 66.63  ? 292 TRP A CG  1 
ATOM   877  C  CD1 . TRP A 1 119 ? 21.941 45.914 42.449 1.00 66.68  ? 292 TRP A CD1 1 
ATOM   878  C  CD2 . TRP A 1 119 ? 22.183 43.716 42.155 1.00 66.30  ? 292 TRP A CD2 1 
ATOM   879  N  NE1 . TRP A 1 119 ? 22.263 45.364 43.662 1.00 66.88  ? 292 TRP A NE1 1 
ATOM   880  C  CE2 . TRP A 1 119 ? 22.416 44.015 43.511 1.00 66.00  ? 292 TRP A CE2 1 
ATOM   881  C  CE3 . TRP A 1 119 ? 22.279 42.390 41.735 1.00 66.47  ? 292 TRP A CE3 1 
ATOM   882  C  CZ2 . TRP A 1 119 ? 22.735 43.041 44.450 1.00 65.55  ? 292 TRP A CZ2 1 
ATOM   883  C  CZ3 . TRP A 1 119 ? 22.601 41.424 42.669 1.00 66.32  ? 292 TRP A CZ3 1 
ATOM   884  C  CH2 . TRP A 1 119 ? 22.824 41.756 44.013 1.00 65.73  ? 292 TRP A CH2 1 
ATOM   885  N  N   . GLU A 1 120 ? 18.586 46.058 39.989 1.00 68.61  ? 293 GLU A N   1 
ATOM   886  C  CA  . GLU A 1 120 ? 17.466 46.566 40.788 1.00 69.22  ? 293 GLU A CA  1 
ATOM   887  C  C   . GLU A 1 120 ? 16.055 46.356 40.195 1.00 69.38  ? 293 GLU A C   1 
ATOM   888  O  O   . GLU A 1 120 ? 15.052 46.778 40.786 1.00 69.67  ? 293 GLU A O   1 
ATOM   889  C  CB  . GLU A 1 120 ? 17.688 48.040 41.136 1.00 69.21  ? 293 GLU A CB  1 
ATOM   890  C  CG  . GLU A 1 120 ? 19.039 48.332 41.759 1.00 71.07  ? 293 GLU A CG  1 
ATOM   891  C  CD  . GLU A 1 120 ? 18.998 49.471 42.775 1.00 74.13  ? 293 GLU A CD  1 
ATOM   892  O  OE1 . GLU A 1 120 ? 18.234 50.446 42.575 1.00 75.79  ? 293 GLU A OE1 1 
ATOM   893  O  OE2 . GLU A 1 120 ? 19.739 49.394 43.783 1.00 75.03  ? 293 GLU A OE2 1 
ATOM   894  N  N   . ILE A 1 121 ? 15.961 45.687 39.052 1.00 69.30  ? 294 ILE A N   1 
ATOM   895  C  CA  . ILE A 1 121 ? 14.673 45.575 38.379 1.00 69.20  ? 294 ILE A CA  1 
ATOM   896  C  C   . ILE A 1 121 ? 13.917 44.287 38.682 1.00 69.16  ? 294 ILE A C   1 
ATOM   897  O  O   . ILE A 1 121 ? 14.408 43.183 38.452 1.00 69.28  ? 294 ILE A O   1 
ATOM   898  C  CB  . ILE A 1 121 ? 14.816 45.743 36.879 1.00 69.05  ? 294 ILE A CB  1 
ATOM   899  C  CG1 . ILE A 1 121 ? 15.365 47.145 36.573 1.00 69.04  ? 294 ILE A CG1 1 
ATOM   900  C  CG2 . ILE A 1 121 ? 13.485 45.472 36.201 1.00 68.19  ? 294 ILE A CG2 1 
ATOM   901  C  CD1 . ILE A 1 121 ? 15.919 47.339 35.166 1.00 68.22  ? 294 ILE A CD1 1 
ATOM   902  N  N   . SER A 1 122 ? 12.709 44.452 39.205 1.00 68.86  ? 295 SER A N   1 
ATOM   903  C  CA  . SER A 1 122 ? 11.833 43.338 39.523 1.00 68.40  ? 295 SER A CA  1 
ATOM   904  C  C   . SER A 1 122 ? 10.907 43.078 38.362 1.00 67.99  ? 295 SER A C   1 
ATOM   905  O  O   . SER A 1 122 ? 10.944 43.780 37.356 1.00 67.91  ? 295 SER A O   1 
ATOM   906  C  CB  . SER A 1 122 ? 10.991 43.680 40.743 1.00 68.69  ? 295 SER A CB  1 
ATOM   907  O  OG  . SER A 1 122 ? 10.076 44.720 40.431 1.00 68.75  ? 295 SER A OG  1 
ATOM   908  N  N   . LYS A 1 123 ? 10.051 42.083 38.523 1.00 67.46  ? 296 LYS A N   1 
ATOM   909  C  CA  . LYS A 1 123 ? 9.131  41.733 37.474 1.00 66.99  ? 296 LYS A CA  1 
ATOM   910  C  C   . LYS A 1 123 ? 8.172  42.884 37.223 1.00 67.10  ? 296 LYS A C   1 
ATOM   911  O  O   . LYS A 1 123 ? 8.040  43.346 36.097 1.00 67.14  ? 296 LYS A O   1 
ATOM   912  C  CB  . LYS A 1 123 ? 8.369  40.470 37.835 1.00 66.63  ? 296 LYS A CB  1 
ATOM   913  C  CG  . LYS A 1 123 ? 7.540  39.953 36.698 1.00 65.62  ? 296 LYS A CG  1 
ATOM   914  C  CD  . LYS A 1 123 ? 6.656  38.845 37.180 1.00 65.53  ? 296 LYS A CD  1 
ATOM   915  C  CE  . LYS A 1 123 ? 6.019  38.135 36.012 1.00 65.74  ? 296 LYS A CE  1 
ATOM   916  N  NZ  . LYS A 1 123 ? 5.548  36.784 36.423 1.00 65.76  ? 296 LYS A NZ  1 
ATOM   917  N  N   . ALA A 1 124 ? 7.514  43.358 38.273 1.00 67.22  ? 297 ALA A N   1 
ATOM   918  C  CA  . ALA A 1 124 ? 6.554  44.449 38.129 1.00 67.47  ? 297 ALA A CA  1 
ATOM   919  C  C   . ALA A 1 124 ? 7.232  45.736 37.625 1.00 67.86  ? 297 ALA A C   1 
ATOM   920  O  O   . ALA A 1 124 ? 6.644  46.525 36.881 1.00 67.70  ? 297 ALA A O   1 
ATOM   921  C  CB  . ALA A 1 124 ? 5.840  44.698 39.455 1.00 67.40  ? 297 ALA A CB  1 
ATOM   922  N  N   . GLN A 1 125 ? 8.486  45.920 38.025 1.00 68.55  ? 298 GLN A N   1 
ATOM   923  C  CA  . GLN A 1 125 ? 9.241  47.129 37.727 1.00 69.01  ? 298 GLN A CA  1 
ATOM   924  C  C   . GLN A 1 125 ? 9.756  47.106 36.290 1.00 68.98  ? 298 GLN A C   1 
ATOM   925  O  O   . GLN A 1 125 ? 10.057 48.149 35.708 1.00 68.89  ? 298 GLN A O   1 
ATOM   926  C  CB  . GLN A 1 125 ? 10.382 47.262 38.747 1.00 69.20  ? 298 GLN A CB  1 
ATOM   927  C  CG  . GLN A 1 125 ? 11.207 48.546 38.710 1.00 70.04  ? 298 GLN A CG  1 
ATOM   928  C  CD  . GLN A 1 125 ? 10.393 49.809 38.519 1.00 71.52  ? 298 GLN A CD  1 
ATOM   929  O  OE1 . GLN A 1 125 ? 10.698 50.600 37.634 1.00 73.31  ? 298 GLN A OE1 1 
ATOM   930  N  NE2 . GLN A 1 125 ? 9.364  50.009 39.343 1.00 70.59  ? 298 GLN A NE2 1 
ATOM   931  N  N   . LEU A 1 126 ? 9.832  45.909 35.718 1.00 68.95  ? 299 LEU A N   1 
ATOM   932  C  CA  . LEU A 1 126 ? 10.329 45.748 34.368 1.00 68.79  ? 299 LEU A CA  1 
ATOM   933  C  C   . LEU A 1 126 ? 9.551  46.589 33.368 1.00 68.87  ? 299 LEU A C   1 
ATOM   934  O  O   . LEU A 1 126 ? 10.143 47.408 32.677 1.00 68.51  ? 299 LEU A O   1 
ATOM   935  C  CB  . LEU A 1 126 ? 10.366 44.271 33.954 1.00 68.70  ? 299 LEU A CB  1 
ATOM   936  C  CG  . LEU A 1 126 ? 10.908 43.936 32.562 1.00 68.56  ? 299 LEU A CG  1 
ATOM   937  C  CD1 . LEU A 1 126 ? 12.346 44.420 32.412 1.00 68.50  ? 299 LEU A CD1 1 
ATOM   938  C  CD2 . LEU A 1 126 ? 10.824 42.440 32.306 1.00 68.93  ? 299 LEU A CD2 1 
ATOM   939  N  N   . PRO A 1 127 ? 8.218  46.408 33.293 1.00 69.43  ? 300 PRO A N   1 
ATOM   940  C  CA  . PRO A 1 127 ? 7.513  47.036 32.155 1.00 69.74  ? 300 PRO A CA  1 
ATOM   941  C  C   . PRO A 1 127 ? 7.359  48.563 32.265 1.00 69.84  ? 300 PRO A C   1 
ATOM   942  O  O   . PRO A 1 127 ? 6.795  49.199 31.375 1.00 69.81  ? 300 PRO A O   1 
ATOM   943  C  CB  . PRO A 1 127 ? 6.141  46.309 32.127 1.00 69.76  ? 300 PRO A CB  1 
ATOM   944  C  CG  . PRO A 1 127 ? 6.331  45.062 33.013 1.00 69.43  ? 300 PRO A CG  1 
ATOM   945  C  CD  . PRO A 1 127 ? 7.312  45.538 34.070 1.00 69.46  ? 300 PRO A CD  1 
ATOM   946  N  N   . LYS A 1 128 ? 7.883  49.140 33.338 1.00 70.27  ? 301 LYS A N   1 
ATOM   947  C  CA  . LYS A 1 128 ? 7.885  50.587 33.499 1.00 70.68  ? 301 LYS A CA  1 
ATOM   948  C  C   . LYS A 1 128 ? 9.137  51.214 32.880 1.00 70.95  ? 301 LYS A C   1 
ATOM   949  O  O   . LYS A 1 128 ? 9.169  52.408 32.574 1.00 70.84  ? 301 LYS A O   1 
ATOM   950  C  CB  . LYS A 1 128 ? 7.808  50.942 34.990 1.00 70.79  ? 301 LYS A CB  1 
ATOM   951  C  CG  . LYS A 1 128 ? 6.448  50.674 35.630 1.00 70.28  ? 301 LYS A CG  1 
ATOM   952  C  CD  . LYS A 1 128 ? 6.558  50.584 37.130 1.00 70.68  ? 301 LYS A CD  1 
ATOM   953  C  CE  . LYS A 1 128 ? 5.247  50.094 37.715 1.00 71.81  ? 301 LYS A CE  1 
ATOM   954  N  NZ  . LYS A 1 128 ? 5.470  49.264 38.946 1.00 72.88  ? 301 LYS A NZ  1 
ATOM   955  N  N   . GLU A 1 129 ? 10.166 50.389 32.699 1.00 71.39  ? 302 GLU A N   1 
ATOM   956  C  CA  . GLU A 1 129 ? 11.487 50.862 32.287 1.00 71.89  ? 302 GLU A CA  1 
ATOM   957  C  C   . GLU A 1 129 ? 11.547 51.271 30.821 1.00 71.73  ? 302 GLU A C   1 
ATOM   958  O  O   . GLU A 1 129 ? 11.053 50.558 29.945 1.00 71.60  ? 302 GLU A O   1 
ATOM   959  C  CB  . GLU A 1 129 ? 12.560 49.803 32.586 1.00 72.01  ? 302 GLU A CB  1 
ATOM   960  C  CG  . GLU A 1 129 ? 12.872 49.606 34.074 1.00 73.60  ? 302 GLU A CG  1 
ATOM   961  C  CD  . GLU A 1 129 ? 13.364 50.875 34.763 1.00 76.28  ? 302 GLU A CD  1 
ATOM   962  O  OE1 . GLU A 1 129 ? 14.140 51.648 34.144 1.00 77.02  ? 302 GLU A OE1 1 
ATOM   963  O  OE2 . GLU A 1 129 ? 12.979 51.099 35.938 1.00 77.53  ? 302 GLU A OE2 1 
ATOM   964  N  N   . GLU A 1 130 ? 12.157 52.428 30.571 1.00 71.61  ? 303 GLU A N   1 
ATOM   965  C  CA  . GLU A 1 130 ? 12.371 52.894 29.217 1.00 71.33  ? 303 GLU A CA  1 
ATOM   966  C  C   . GLU A 1 130 ? 13.764 52.469 28.791 1.00 70.65  ? 303 GLU A C   1 
ATOM   967  O  O   . GLU A 1 130 ? 14.719 53.234 28.950 1.00 70.81  ? 303 GLU A O   1 
ATOM   968  C  CB  . GLU A 1 130 ? 12.222 54.417 29.150 1.00 71.78  ? 303 GLU A CB  1 
ATOM   969  C  CG  . GLU A 1 130 ? 12.342 54.998 27.732 1.00 73.66  ? 303 GLU A CG  1 
ATOM   970  C  CD  . GLU A 1 130 ? 11.274 56.040 27.403 1.00 75.96  ? 303 GLU A CD  1 
ATOM   971  O  OE1 . GLU A 1 130 ? 10.452 56.375 28.293 1.00 76.29  ? 303 GLU A OE1 1 
ATOM   972  O  OE2 . GLU A 1 130 ? 11.250 56.518 26.242 1.00 77.30  ? 303 GLU A OE2 1 
ATOM   973  N  N   . LEU A 1 131 ? 13.876 51.251 28.255 1.00 69.76  ? 304 LEU A N   1 
ATOM   974  C  CA  . LEU A 1 131 ? 15.180 50.681 27.925 1.00 68.98  ? 304 LEU A CA  1 
ATOM   975  C  C   . LEU A 1 131 ? 15.205 49.771 26.686 1.00 68.68  ? 304 LEU A C   1 
ATOM   976  O  O   . LEU A 1 131 ? 14.164 49.316 26.217 1.00 69.11  ? 304 LEU A O   1 
ATOM   977  C  CB  . LEU A 1 131 ? 15.749 49.950 29.141 1.00 68.85  ? 304 LEU A CB  1 
ATOM   978  C  CG  . LEU A 1 131 ? 15.186 48.576 29.504 1.00 68.84  ? 304 LEU A CG  1 
ATOM   979  C  CD1 . LEU A 1 131 ? 15.670 47.506 28.538 1.00 69.44  ? 304 LEU A CD1 1 
ATOM   980  C  CD2 . LEU A 1 131 ? 15.572 48.201 30.920 1.00 68.65  ? 304 LEU A CD2 1 
ATOM   981  N  N   . GLU A 1 132 ? 16.412 49.504 26.182 1.00 67.91  ? 305 GLU A N   1 
ATOM   982  C  CA  . GLU A 1 132 ? 16.620 48.715 24.974 1.00 66.92  ? 305 GLU A CA  1 
ATOM   983  C  C   . GLU A 1 132 ? 17.982 48.034 25.009 1.00 66.41  ? 305 GLU A C   1 
ATOM   984  O  O   . GLU A 1 132 ? 19.003 48.680 25.227 1.00 66.45  ? 305 GLU A O   1 
ATOM   985  C  CB  . GLU A 1 132 ? 16.521 49.616 23.743 1.00 66.85  ? 305 GLU A CB  1 
ATOM   986  C  CG  . GLU A 1 132 ? 16.893 48.941 22.423 1.00 67.09  ? 305 GLU A CG  1 
ATOM   987  C  CD  . GLU A 1 132 ? 16.718 49.856 21.209 1.00 66.91  ? 305 GLU A CD  1 
ATOM   988  O  OE1 . GLU A 1 132 ? 16.497 51.077 21.402 1.00 67.33  ? 305 GLU A OE1 1 
ATOM   989  O  OE2 . GLU A 1 132 ? 16.798 49.351 20.065 1.00 66.17  ? 305 GLU A OE2 1 
ATOM   990  N  N   . ILE A 1 133 ? 17.972 46.722 24.792 1.00 65.92  ? 306 ILE A N   1 
ATOM   991  C  CA  . ILE A 1 133 ? 19.173 45.894 24.714 1.00 65.05  ? 306 ILE A CA  1 
ATOM   992  C  C   . ILE A 1 133 ? 19.542 45.722 23.259 1.00 64.72  ? 306 ILE A C   1 
ATOM   993  O  O   . ILE A 1 133 ? 18.702 45.318 22.462 1.00 64.77  ? 306 ILE A O   1 
ATOM   994  C  CB  . ILE A 1 133 ? 18.899 44.480 25.271 1.00 64.82  ? 306 ILE A CB  1 
ATOM   995  C  CG1 . ILE A 1 133 ? 18.450 44.554 26.727 1.00 64.83  ? 306 ILE A CG1 1 
ATOM   996  C  CG2 . ILE A 1 133 ? 20.129 43.585 25.162 1.00 64.57  ? 306 ILE A CG2 1 
ATOM   997  C  CD1 . ILE A 1 133 ? 17.660 43.342 27.119 1.00 65.71  ? 306 ILE A CD1 1 
ATOM   998  N  N   . VAL A 1 134 ? 20.792 46.007 22.909 1.00 64.28  ? 307 VAL A N   1 
ATOM   999  C  CA  . VAL A 1 134 ? 21.250 45.808 21.535 1.00 63.81  ? 307 VAL A CA  1 
ATOM   1000 C  C   . VAL A 1 134 ? 22.296 44.702 21.440 1.00 63.42  ? 307 VAL A C   1 
ATOM   1001 O  O   . VAL A 1 134 ? 23.408 44.812 21.953 1.00 63.14  ? 307 VAL A O   1 
ATOM   1002 C  CB  . VAL A 1 134 ? 21.772 47.111 20.872 1.00 63.82  ? 307 VAL A CB  1 
ATOM   1003 C  CG1 . VAL A 1 134 ? 22.107 46.866 19.419 1.00 63.35  ? 307 VAL A CG1 1 
ATOM   1004 C  CG2 . VAL A 1 134 ? 20.741 48.211 20.969 1.00 63.70  ? 307 VAL A CG2 1 
ATOM   1005 N  N   . VAL A 1 135 ? 21.919 43.632 20.765 1.00 63.26  ? 308 VAL A N   1 
ATOM   1006 C  CA  . VAL A 1 135 ? 22.789 42.490 20.618 1.00 63.27  ? 308 VAL A CA  1 
ATOM   1007 C  C   . VAL A 1 135 ? 23.543 42.539 19.303 1.00 63.28  ? 308 VAL A C   1 
ATOM   1008 O  O   . VAL A 1 135 ? 22.970 42.777 18.239 1.00 63.11  ? 308 VAL A O   1 
ATOM   1009 C  CB  . VAL A 1 135 ? 22.017 41.176 20.772 1.00 63.20  ? 308 VAL A CB  1 
ATOM   1010 C  CG1 . VAL A 1 135 ? 21.291 41.180 22.115 1.00 63.39  ? 308 VAL A CG1 1 
ATOM   1011 C  CG2 . VAL A 1 135 ? 21.022 40.976 19.637 1.00 63.14  ? 308 VAL A CG2 1 
ATOM   1012 N  N   . ILE A 1 136 ? 24.845 42.314 19.396 1.00 63.33  ? 309 ILE A N   1 
ATOM   1013 C  CA  . ILE A 1 136 ? 25.744 42.525 18.283 1.00 63.34  ? 309 ILE A CA  1 
ATOM   1014 C  C   . ILE A 1 136 ? 26.691 41.358 18.178 1.00 63.42  ? 309 ILE A C   1 
ATOM   1015 O  O   . ILE A 1 136 ? 27.476 41.108 19.083 1.00 63.37  ? 309 ILE A O   1 
ATOM   1016 C  CB  . ILE A 1 136 ? 26.560 43.794 18.497 1.00 63.31  ? 309 ILE A CB  1 
ATOM   1017 C  CG1 . ILE A 1 136 ? 25.631 44.926 18.924 1.00 63.06  ? 309 ILE A CG1 1 
ATOM   1018 C  CG2 . ILE A 1 136 ? 27.362 44.138 17.246 1.00 63.12  ? 309 ILE A CG2 1 
ATOM   1019 C  CD1 . ILE A 1 136 ? 26.327 46.016 19.640 1.00 63.65  ? 309 ILE A CD1 1 
ATOM   1020 N  N   . LEU A 1 137 ? 26.593 40.641 17.066 1.00 63.63  ? 310 LEU A N   1 
ATOM   1021 C  CA  . LEU A 1 137 ? 27.468 39.529 16.782 1.00 63.99  ? 310 LEU A CA  1 
ATOM   1022 C  C   . LEU A 1 137 ? 28.467 39.983 15.760 1.00 64.30  ? 310 LEU A C   1 
ATOM   1023 O  O   . LEU A 1 137 ? 28.091 40.515 14.732 1.00 64.56  ? 310 LEU A O   1 
ATOM   1024 C  CB  . LEU A 1 137 ? 26.683 38.363 16.199 1.00 63.84  ? 310 LEU A CB  1 
ATOM   1025 C  CG  . LEU A 1 137 ? 27.529 37.097 16.073 1.00 64.22  ? 310 LEU A CG  1 
ATOM   1026 C  CD1 . LEU A 1 137 ? 27.585 36.377 17.416 1.00 64.73  ? 310 LEU A CD1 1 
ATOM   1027 C  CD2 . LEU A 1 137 ? 26.972 36.187 15.012 1.00 64.07  ? 310 LEU A CD2 1 
ATOM   1028 N  N   . GLU A 1 138 ? 29.743 39.776 16.033 1.00 64.99  ? 311 GLU A N   1 
ATOM   1029 C  CA  . GLU A 1 138 ? 30.766 40.095 15.053 1.00 65.85  ? 311 GLU A CA  1 
ATOM   1030 C  C   . GLU A 1 138 ? 31.606 38.862 14.785 1.00 65.64  ? 311 GLU A C   1 
ATOM   1031 O  O   . GLU A 1 138 ? 31.886 38.087 15.692 1.00 65.60  ? 311 GLU A O   1 
ATOM   1032 C  CB  . GLU A 1 138 ? 31.636 41.256 15.530 1.00 66.27  ? 311 GLU A CB  1 
ATOM   1033 C  CG  . GLU A 1 138 ? 30.845 42.510 15.908 1.00 69.31  ? 311 GLU A CG  1 
ATOM   1034 C  CD  . GLU A 1 138 ? 31.729 43.762 16.030 1.00 73.16  ? 311 GLU A CD  1 
ATOM   1035 O  OE1 . GLU A 1 138 ? 32.961 43.615 16.184 1.00 75.86  ? 311 GLU A OE1 1 
ATOM   1036 O  OE2 . GLU A 1 138 ? 31.192 44.896 15.977 1.00 73.62  ? 311 GLU A OE2 1 
ATOM   1037 N  N   . GLY A 1 139 ? 31.991 38.674 13.529 1.00 65.70  ? 312 GLY A N   1 
ATOM   1038 C  CA  . GLY A 1 139 ? 32.806 37.529 13.141 1.00 66.03  ? 312 GLY A CA  1 
ATOM   1039 C  C   . GLY A 1 139 ? 33.227 37.607 11.687 1.00 66.36  ? 312 GLY A C   1 
ATOM   1040 O  O   . GLY A 1 139 ? 32.645 38.384 10.909 1.00 66.66  ? 312 GLY A O   1 
ATOM   1041 N  N   . MET A 1 140 ? 34.256 36.821 11.329 1.00 66.60  ? 313 MET A N   1 
ATOM   1042 C  CA  A MET A 1 140 ? 34.664 36.787 9.966  0.00 46.98  ? 313 MET A CA  1 
ATOM   1043 C  CA  B MET A 1 140 ? 34.699 36.758 9.929  0.50 66.98  ? 313 MET A CA  1 
ATOM   1044 C  C   . MET A 1 140 ? 34.101 35.503 9.340  1.00 67.34  ? 313 MET A C   1 
ATOM   1045 O  O   . MET A 1 140 ? 34.205 34.433 9.939  1.00 67.59  ? 313 MET A O   1 
ATOM   1046 C  CB  A MET A 1 140 ? 36.189 36.821 10.018 0.00 46.88  ? 313 MET A CB  1 
ATOM   1047 C  CB  B MET A 1 140 ? 36.228 36.685 9.838  0.50 66.88  ? 313 MET A CB  1 
ATOM   1048 C  CG  A MET A 1 140 ? 36.869 37.160 8.720  0.00 47.26  ? 313 MET A CG  1 
ATOM   1049 C  CG  B MET A 1 140 ? 36.900 38.056 9.984  0.50 67.26  ? 313 MET A CG  1 
ATOM   1050 S  SD  A MET A 1 140 ? 36.725 35.825 7.522  0.00 48.46  ? 313 MET A SD  1 
ATOM   1051 S  SD  B MET A 1 140 ? 38.710 37.952 9.983  0.50 68.46  ? 313 MET A SD  1 
ATOM   1052 C  CE  A MET A 1 140 ? 38.143 34.818 7.951  0.00 48.39  ? 313 MET A CE  1 
ATOM   1053 C  CE  B MET A 1 140 ? 39.071 37.910 11.774 0.50 68.39  ? 313 MET A CE  1 
ATOM   1054 N  N   . VAL A 1 141 ? 33.456 35.627 8.185  1.00 67.79  ? 314 VAL A N   1 
ATOM   1055 C  CA  . VAL A 1 141 ? 32.840 34.470 7.529  1.00 68.25  ? 314 VAL A CA  1 
ATOM   1056 C  C   . VAL A 1 141 ? 33.892 33.652 6.756  1.00 68.66  ? 314 VAL A C   1 
ATOM   1057 O  O   . VAL A 1 141 ? 34.459 34.129 5.765  1.00 68.82  ? 314 VAL A O   1 
ATOM   1058 C  CB  . VAL A 1 141 ? 31.676 34.898 6.602  1.00 68.27  ? 314 VAL A CB  1 
ATOM   1059 C  CG1 . VAL A 1 141 ? 31.065 33.680 5.901  1.00 68.29  ? 314 VAL A CG1 1 
ATOM   1060 C  CG2 . VAL A 1 141 ? 30.617 35.659 7.402  1.00 68.23  ? 314 VAL A CG2 1 
ATOM   1061 N  N   . GLU A 1 142 ? 34.131 32.422 7.219  1.00 69.09  ? 315 GLU A N   1 
ATOM   1062 C  CA  . GLU A 1 142 ? 35.234 31.559 6.741  1.00 69.56  ? 315 GLU A CA  1 
ATOM   1063 C  C   . GLU A 1 142 ? 35.433 31.490 5.215  1.00 69.61  ? 315 GLU A C   1 
ATOM   1064 O  O   . GLU A 1 142 ? 36.522 31.784 4.711  1.00 69.37  ? 315 GLU A O   1 
ATOM   1065 C  CB  . GLU A 1 142 ? 35.060 30.137 7.303  1.00 69.74  ? 315 GLU A CB  1 
ATOM   1066 C  CG  . GLU A 1 142 ? 36.147 29.135 6.879  1.00 70.28  ? 315 GLU A CG  1 
ATOM   1067 C  CD  . GLU A 1 142 ? 36.112 27.900 7.737  1.00 70.87  ? 315 GLU A CD  1 
ATOM   1068 O  OE1 . GLU A 1 142 ? 35.067 27.201 7.731  1.00 71.13  ? 315 GLU A OE1 1 
ATOM   1069 O  OE2 . GLU A 1 142 ? 37.122 27.642 8.429  1.00 71.17  ? 315 GLU A OE2 1 
ATOM   1070 N  N   . ALA A 1 143 ? 34.389 31.062 4.498  1.00 69.88  ? 316 ALA A N   1 
ATOM   1071 C  CA  . ALA A 1 143 ? 34.422 31.026 3.041  1.00 70.16  ? 316 ALA A CA  1 
ATOM   1072 C  C   . ALA A 1 143 ? 34.827 32.417 2.536  1.00 70.37  ? 316 ALA A C   1 
ATOM   1073 O  O   . ALA A 1 143 ? 35.983 32.617 2.070  1.00 70.44  ? 316 ALA A O   1 
ATOM   1074 C  CB  . ALA A 1 143 ? 33.046 30.621 2.488  1.00 70.09  ? 316 ALA A CB  1 
ATOM   1075 N  N   . THR A 1 144 ? 33.873 33.368 2.689  1.00 70.44  ? 317 THR A N   1 
ATOM   1076 C  CA  . THR A 1 144 ? 34.000 34.747 2.201  1.00 70.59  ? 317 THR A CA  1 
ATOM   1077 C  C   . THR A 1 144 ? 35.361 35.391 2.457  1.00 70.32  ? 317 THR A C   1 
ATOM   1078 O  O   . THR A 1 144 ? 35.964 35.944 1.541  1.00 70.23  ? 317 THR A O   1 
ATOM   1079 C  CB  . THR A 1 144 ? 32.860 35.637 2.784  1.00 70.72  ? 317 THR A CB  1 
ATOM   1080 O  OG1 . THR A 1 144 ? 31.635 35.339 2.101  1.00 71.52  ? 317 THR A OG1 1 
ATOM   1081 C  CG2 . THR A 1 144 ? 33.161 37.154 2.660  1.00 71.22  ? 317 THR A CG2 1 
ATOM   1082 N  N   . GLY A 1 145 ? 35.836 35.322 3.698  1.00 70.13  ? 318 GLY A N   1 
ATOM   1083 C  CA  . GLY A 1 145 ? 37.037 36.061 4.092  1.00 69.98  ? 318 GLY A CA  1 
ATOM   1084 C  C   . GLY A 1 145 ? 36.751 37.385 4.800  1.00 69.80  ? 318 GLY A C   1 
ATOM   1085 O  O   . GLY A 1 145 ? 37.515 37.785 5.676  1.00 69.88  ? 318 GLY A O   1 
ATOM   1086 N  N   . MET A 1 146 ? 35.660 38.067 4.439  1.00 69.48  ? 319 MET A N   1 
ATOM   1087 C  CA  . MET A 1 146 ? 35.360 39.382 5.020  1.00 69.17  ? 319 MET A CA  1 
ATOM   1088 C  C   . MET A 1 146 ? 34.618 39.322 6.363  1.00 68.56  ? 319 MET A C   1 
ATOM   1089 O  O   . MET A 1 146 ? 33.921 38.346 6.654  1.00 68.61  ? 319 MET A O   1 
ATOM   1090 C  CB  . MET A 1 146 ? 34.548 40.229 4.044  1.00 69.48  ? 319 MET A CB  1 
ATOM   1091 C  CG  . MET A 1 146 ? 35.079 40.282 2.628  1.00 70.91  ? 319 MET A CG  1 
ATOM   1092 S  SD  . MET A 1 146 ? 34.060 41.377 1.598  1.00 74.19  ? 319 MET A SD  1 
ATOM   1093 C  CE  . MET A 1 146 ? 32.329 40.975 2.118  1.00 74.12  ? 319 MET A CE  1 
ATOM   1094 N  N   . THR A 1 147 ? 34.745 40.386 7.156  1.00 67.76  ? 320 THR A N   1 
ATOM   1095 C  CA  . THR A 1 147 ? 34.059 40.498 8.447  1.00 66.92  ? 320 THR A CA  1 
ATOM   1096 C  C   . THR A 1 147 ? 32.551 40.754 8.308  1.00 66.46  ? 320 THR A C   1 
ATOM   1097 O  O   . THR A 1 147 ? 32.135 41.608 7.525  1.00 66.56  ? 320 THR A O   1 
ATOM   1098 C  CB  . THR A 1 147 ? 34.630 41.656 9.285  1.00 66.87  ? 320 THR A CB  1 
ATOM   1099 O  OG1 . THR A 1 147 ? 35.912 42.039 8.779  1.00 66.74  ? 320 THR A OG1 1 
ATOM   1100 C  CG2 . THR A 1 147 ? 34.768 41.243 10.747 1.00 66.99  ? 320 THR A CG2 1 
ATOM   1101 N  N   . CYS A 1 148 ? 31.743 40.023 9.080  1.00 65.87  ? 321 CYS A N   1 
ATOM   1102 C  CA  . CYS A 1 148 ? 30.307 40.287 9.201  1.00 65.27  ? 321 CYS A CA  1 
ATOM   1103 C  C   . CYS A 1 148 ? 30.020 41.123 10.463 1.00 64.59  ? 321 CYS A C   1 
ATOM   1104 O  O   . CYS A 1 148 ? 30.890 41.269 11.318 1.00 64.51  ? 321 CYS A O   1 
ATOM   1105 C  CB  . CYS A 1 148 ? 29.527 38.957 9.246  1.00 65.41  ? 321 CYS A CB  1 
ATOM   1106 S  SG  . CYS A 1 148 ? 29.227 38.232 10.921 1.00 66.49  ? 321 CYS A SG  1 
ATOM   1107 N  N   . GLN A 1 149 ? 28.816 41.690 10.552 1.00 63.95  ? 322 GLN A N   1 
ATOM   1108 C  CA  . GLN A 1 149 ? 28.240 42.171 11.825 1.00 63.23  ? 322 GLN A CA  1 
ATOM   1109 C  C   . GLN A 1 149 ? 26.723 42.050 11.773 1.00 62.71  ? 322 GLN A C   1 
ATOM   1110 O  O   . GLN A 1 149 ? 26.093 42.634 10.895 1.00 63.21  ? 322 GLN A O   1 
ATOM   1111 C  CB  . GLN A 1 149 ? 28.617 43.622 12.162 1.00 63.17  ? 322 GLN A CB  1 
ATOM   1112 C  CG  . GLN A 1 149 ? 28.208 44.021 13.590 1.00 62.96  ? 322 GLN A CG  1 
ATOM   1113 C  CD  . GLN A 1 149 ? 28.460 45.493 13.932 1.00 63.01  ? 322 GLN A CD  1 
ATOM   1114 O  OE1 . GLN A 1 149 ? 27.590 46.343 13.748 1.00 63.47  ? 322 GLN A OE1 1 
ATOM   1115 N  NE2 . GLN A 1 149 ? 29.636 45.788 14.471 1.00 62.18  ? 322 GLN A NE2 1 
ATOM   1116 N  N   . ALA A 1 150 ? 26.138 41.300 12.704 1.00 62.00  ? 323 ALA A N   1 
ATOM   1117 C  CA  . ALA A 1 150 ? 24.692 41.143 12.754 1.00 61.51  ? 323 ALA A CA  1 
ATOM   1118 C  C   . ALA A 1 150 ? 24.127 41.728 14.046 1.00 61.49  ? 323 ALA A C   1 
ATOM   1119 O  O   . ALA A 1 150 ? 24.540 41.353 15.137 1.00 61.60  ? 323 ALA A O   1 
ATOM   1120 C  CB  . ALA A 1 150 ? 24.315 39.691 12.607 1.00 61.37  ? 323 ALA A CB  1 
ATOM   1121 N  N   . ARG A 1 151 ? 23.187 42.658 13.918 1.00 61.38  ? 324 ARG A N   1 
ATOM   1122 C  CA  . ARG A 1 151 ? 22.600 43.312 15.077 1.00 60.98  ? 324 ARG A CA  1 
ATOM   1123 C  C   . ARG A 1 151 ? 21.149 42.900 15.261 1.00 60.88  ? 324 ARG A C   1 
ATOM   1124 O  O   . ARG A 1 151 ? 20.475 42.555 14.286 1.00 61.28  ? 324 ARG A O   1 
ATOM   1125 C  CB  . ARG A 1 151 ? 22.650 44.825 14.903 1.00 60.93  ? 324 ARG A CB  1 
ATOM   1126 C  CG  . ARG A 1 151 ? 24.036 45.410 14.759 1.00 60.51  ? 324 ARG A CG  1 
ATOM   1127 C  CD  . ARG A 1 151 ? 23.981 46.813 14.157 1.00 59.79  ? 324 ARG A CD  1 
ATOM   1128 N  NE  . ARG A 1 151 ? 23.736 46.792 12.716 1.00 60.12  ? 324 ARG A NE  1 
ATOM   1129 C  CZ  . ARG A 1 151 ? 24.637 46.412 11.810 1.00 61.53  ? 324 ARG A CZ  1 
ATOM   1130 N  NH1 . ARG A 1 151 ? 25.840 46.011 12.190 1.00 61.70  ? 324 ARG A NH1 1 
ATOM   1131 N  NH2 . ARG A 1 151 ? 24.342 46.422 10.517 1.00 62.52  ? 324 ARG A NH2 1 
ATOM   1132 N  N   . SER A 1 152 ? 20.664 42.935 16.505 1.00 60.31  ? 325 SER A N   1 
ATOM   1133 C  CA  . SER A 1 152 ? 19.226 42.934 16.731 1.00 59.98  ? 325 SER A CA  1 
ATOM   1134 C  C   . SER A 1 152 ? 18.920 43.673 18.013 1.00 59.64  ? 325 SER A C   1 
ATOM   1135 O  O   . SER A 1 152 ? 19.829 44.136 18.695 1.00 59.08  ? 325 SER A O   1 
ATOM   1136 C  CB  . SER A 1 152 ? 18.641 41.524 16.734 1.00 59.92  ? 325 SER A CB  1 
ATOM   1137 O  OG  . SER A 1 152 ? 17.242 41.570 16.974 1.00 60.32  ? 325 SER A OG  1 
ATOM   1138 N  N   . SER A 1 153 ? 17.641 43.800 18.337 1.00 59.82  ? 326 SER A N   1 
ATOM   1139 C  CA  . SER A 1 153 ? 17.245 44.592 19.488 1.00 60.24  ? 326 SER A CA  1 
ATOM   1140 C  C   . SER A 1 153 ? 16.078 44.015 20.268 1.00 60.93  ? 326 SER A C   1 
ATOM   1141 O  O   . SER A 1 153 ? 15.161 43.434 19.692 1.00 61.30  ? 326 SER A O   1 
ATOM   1142 C  CB  . SER A 1 153 ? 16.913 46.016 19.058 1.00 60.11  ? 326 SER A CB  1 
ATOM   1143 O  OG  . SER A 1 153 ? 16.028 46.639 19.978 1.00 59.28  ? 326 SER A OG  1 
ATOM   1144 N  N   . TYR A 1 154 ? 16.140 44.177 21.589 1.00 61.67  ? 327 TYR A N   1 
ATOM   1145 C  CA  . TYR A 1 154 ? 15.045 43.837 22.483 1.00 62.21  ? 327 TYR A CA  1 
ATOM   1146 C  C   . TYR A 1 154 ? 14.655 45.070 23.296 1.00 63.02  ? 327 TYR A C   1 
ATOM   1147 O  O   . TYR A 1 154 ? 15.465 45.619 24.048 1.00 63.18  ? 327 TYR A O   1 
ATOM   1148 C  CB  . TYR A 1 154 ? 15.429 42.693 23.424 1.00 61.78  ? 327 TYR A CB  1 
ATOM   1149 C  CG  . TYR A 1 154 ? 15.984 41.480 22.727 1.00 60.85  ? 327 TYR A CG  1 
ATOM   1150 C  CD1 . TYR A 1 154 ? 15.142 40.545 22.138 1.00 60.14  ? 327 TYR A CD1 1 
ATOM   1151 C  CD2 . TYR A 1 154 ? 17.355 41.264 22.660 1.00 59.91  ? 327 TYR A CD2 1 
ATOM   1152 C  CE1 . TYR A 1 154 ? 15.651 39.431 21.497 1.00 59.32  ? 327 TYR A CE1 1 
ATOM   1153 C  CE2 . TYR A 1 154 ? 17.871 40.157 22.021 1.00 59.49  ? 327 TYR A CE2 1 
ATOM   1154 C  CZ  . TYR A 1 154 ? 17.014 39.247 21.440 1.00 59.17  ? 327 TYR A CZ  1 
ATOM   1155 O  OH  . TYR A 1 154 ? 17.521 38.148 20.803 1.00 59.28  ? 327 TYR A OH  1 
ATOM   1156 N  N   . ILE A 1 155 ? 13.420 45.524 23.119 1.00 63.68  ? 328 ILE A N   1 
ATOM   1157 C  CA  . ILE A 1 155 ? 12.873 46.542 24.000 1.00 64.30  ? 328 ILE A CA  1 
ATOM   1158 C  C   . ILE A 1 155 ? 12.191 45.836 25.148 1.00 64.96  ? 328 ILE A C   1 
ATOM   1159 O  O   . ILE A 1 155 ? 12.073 44.607 25.154 1.00 65.20  ? 328 ILE A O   1 
ATOM   1160 C  CB  . ILE A 1 155 ? 11.870 47.493 23.301 1.00 64.11  ? 328 ILE A CB  1 
ATOM   1161 C  CG1 . ILE A 1 155 ? 10.874 46.716 22.426 1.00 64.10  ? 328 ILE A CG1 1 
ATOM   1162 C  CG2 . ILE A 1 155 ? 12.615 48.522 22.481 1.00 64.41  ? 328 ILE A CG2 1 
ATOM   1163 C  CD1 . ILE A 1 155 ? 9.542  47.414 22.291 1.00 63.87  ? 328 ILE A CD1 1 
ATOM   1164 N  N   . THR A 1 156 ? 11.737 46.625 26.112 1.00 65.35  ? 329 THR A N   1 
ATOM   1165 C  CA  . THR A 1 156 ? 11.175 46.106 27.342 1.00 65.65  ? 329 THR A CA  1 
ATOM   1166 C  C   . THR A 1 156 ? 10.127 45.051 27.076 1.00 65.53  ? 329 THR A C   1 
ATOM   1167 O  O   . THR A 1 156 ? 10.229 43.924 27.561 1.00 65.56  ? 329 THR A O   1 
ATOM   1168 C  CB  . THR A 1 156 ? 10.539 47.224 28.138 1.00 65.73  ? 329 THR A CB  1 
ATOM   1169 O  OG1 . THR A 1 156 ? 11.474 48.305 28.255 1.00 66.48  ? 329 THR A OG1 1 
ATOM   1170 C  CG2 . THR A 1 156 ? 10.150 46.733 29.516 1.00 65.89  ? 329 THR A CG2 1 
ATOM   1171 N  N   . SER A 1 157 ? 9.126  45.417 26.285 1.00 65.36  ? 330 SER A N   1 
ATOM   1172 C  CA  . SER A 1 157 ? 8.001  44.527 26.017 1.00 65.42  ? 330 SER A CA  1 
ATOM   1173 C  C   . SER A 1 157 ? 8.399  43.264 25.230 1.00 65.50  ? 330 SER A C   1 
ATOM   1174 O  O   . SER A 1 157 ? 7.544  42.458 24.860 1.00 65.80  ? 330 SER A O   1 
ATOM   1175 C  CB  . SER A 1 157 ? 6.895  45.286 25.289 1.00 65.15  ? 330 SER A CB  1 
ATOM   1176 O  OG  . SER A 1 157 ? 7.260  45.516 23.941 1.00 64.92  ? 330 SER A OG  1 
ATOM   1177 N  N   . GLU A 1 158 ? 9.691  43.087 24.981 1.00 65.25  ? 331 GLU A N   1 
ATOM   1178 C  CA  . GLU A 1 158 ? 10.142 41.890 24.306 1.00 65.23  ? 331 GLU A CA  1 
ATOM   1179 C  C   . GLU A 1 158 ? 10.999 41.006 25.182 1.00 65.21  ? 331 GLU A C   1 
ATOM   1180 O  O   . GLU A 1 158 ? 11.445 39.938 24.748 1.00 65.18  ? 331 GLU A O   1 
ATOM   1181 C  CB  . GLU A 1 158 ? 10.883 42.249 23.044 1.00 65.38  ? 331 GLU A CB  1 
ATOM   1182 C  CG  . GLU A 1 158 ? 9.960  42.584 21.922 1.00 66.08  ? 331 GLU A CG  1 
ATOM   1183 C  CD  . GLU A 1 158 ? 10.621 43.463 20.901 1.00 67.28  ? 331 GLU A CD  1 
ATOM   1184 O  OE1 . GLU A 1 158 ? 9.959  43.792 19.904 1.00 67.50  ? 331 GLU A OE1 1 
ATOM   1185 O  OE2 . GLU A 1 158 ? 11.796 43.843 21.093 1.00 68.47  ? 331 GLU A OE2 1 
ATOM   1186 N  N   . ILE A 1 159 ? 11.227 41.463 26.409 1.00 65.10  ? 332 ILE A N   1 
ATOM   1187 C  CA  . ILE A 1 159 ? 11.893 40.667 27.426 1.00 64.86  ? 332 ILE A CA  1 
ATOM   1188 C  C   . ILE A 1 159 ? 10.829 39.987 28.285 1.00 65.14  ? 332 ILE A C   1 
ATOM   1189 O  O   . ILE A 1 159 ? 10.039 40.665 28.937 1.00 65.39  ? 332 ILE A O   1 
ATOM   1190 C  CB  . ILE A 1 159 ? 12.787 41.553 28.302 1.00 64.45  ? 332 ILE A CB  1 
ATOM   1191 C  CG1 . ILE A 1 159 ? 13.764 42.323 27.413 1.00 64.86  ? 332 ILE A CG1 1 
ATOM   1192 C  CG2 . ILE A 1 159 ? 13.512 40.710 29.340 1.00 64.01  ? 332 ILE A CG2 1 
ATOM   1193 C  CD1 . ILE A 1 159 ? 14.382 43.526 28.067 1.00 64.27  ? 332 ILE A CD1 1 
ATOM   1194 N  N   . LEU A 1 160 ? 10.804 38.657 28.286 1.00 65.17  ? 333 LEU A N   1 
ATOM   1195 C  CA  . LEU A 1 160 ? 9.803  37.935 29.060 1.00 65.51  ? 333 LEU A CA  1 
ATOM   1196 C  C   . LEU A 1 160 ? 10.344 37.437 30.393 1.00 65.71  ? 333 LEU A C   1 
ATOM   1197 O  O   . LEU A 1 160 ? 11.268 36.611 30.435 1.00 65.77  ? 333 LEU A O   1 
ATOM   1198 C  CB  . LEU A 1 160 ? 9.252  36.752 28.274 1.00 65.65  ? 333 LEU A CB  1 
ATOM   1199 C  CG  . LEU A 1 160 ? 8.974  36.888 26.780 1.00 66.25  ? 333 LEU A CG  1 
ATOM   1200 C  CD1 . LEU A 1 160 ? 8.557  35.535 26.227 1.00 65.74  ? 333 LEU A CD1 1 
ATOM   1201 C  CD2 . LEU A 1 160 ? 7.916  37.954 26.498 1.00 66.36  ? 333 LEU A CD2 1 
ATOM   1202 N  N   . TRP A 1 161 ? 9.749  37.927 31.478 1.00 65.68  ? 334 TRP A N   1 
ATOM   1203 C  CA  . TRP A 1 161 ? 10.136 37.512 32.815 1.00 65.55  ? 334 TRP A CA  1 
ATOM   1204 C  C   . TRP A 1 161 ? 9.629  36.112 33.118 1.00 65.68  ? 334 TRP A C   1 
ATOM   1205 O  O   . TRP A 1 161 ? 8.456  35.819 32.927 1.00 65.62  ? 334 TRP A O   1 
ATOM   1206 C  CB  . TRP A 1 161 ? 9.588  38.479 33.862 1.00 65.54  ? 334 TRP A CB  1 
ATOM   1207 C  CG  . TRP A 1 161 ? 10.203 38.284 35.216 1.00 64.79  ? 334 TRP A CG  1 
ATOM   1208 C  CD1 . TRP A 1 161 ? 9.943  37.278 36.096 1.00 64.25  ? 334 TRP A CD1 1 
ATOM   1209 C  CD2 . TRP A 1 161 ? 11.183 39.121 35.842 1.00 64.47  ? 334 TRP A CD2 1 
ATOM   1210 N  NE1 . TRP A 1 161 ? 10.695 37.433 37.232 1.00 64.22  ? 334 TRP A NE1 1 
ATOM   1211 C  CE2 . TRP A 1 161 ? 11.467 38.557 37.102 1.00 64.47  ? 334 TRP A CE2 1 
ATOM   1212 C  CE3 . TRP A 1 161 ? 11.850 40.295 35.459 1.00 64.35  ? 334 TRP A CE3 1 
ATOM   1213 C  CZ2 . TRP A 1 161 ? 12.396 39.122 37.982 1.00 64.15  ? 334 TRP A CZ2 1 
ATOM   1214 C  CZ3 . TRP A 1 161 ? 12.766 40.859 36.339 1.00 62.96  ? 334 TRP A CZ3 1 
ATOM   1215 C  CH2 . TRP A 1 161 ? 13.029 40.271 37.583 1.00 63.19  ? 334 TRP A CH2 1 
ATOM   1216 N  N   . GLY A 1 162 ? 10.522 35.252 33.594 1.00 65.70  ? 335 GLY A N   1 
ATOM   1217 C  CA  . GLY A 1 162 ? 10.140 33.937 34.103 1.00 65.53  ? 335 GLY A CA  1 
ATOM   1218 C  C   . GLY A 1 162 ? 9.947  32.889 33.033 1.00 65.51  ? 335 GLY A C   1 
ATOM   1219 O  O   . GLY A 1 162 ? 9.140  31.975 33.190 1.00 65.75  ? 335 GLY A O   1 
ATOM   1220 N  N   . TYR A 1 163 ? 10.692 33.021 31.944 1.00 65.25  ? 336 TYR A N   1 
ATOM   1221 C  CA  . TYR A 1 163 ? 10.622 32.065 30.860 1.00 64.91  ? 336 TYR A CA  1 
ATOM   1222 C  C   . TYR A 1 163 ? 11.948 31.392 30.641 1.00 64.96  ? 336 TYR A C   1 
ATOM   1223 O  O   . TYR A 1 163 ? 12.962 31.834 31.171 1.00 64.81  ? 336 TYR A O   1 
ATOM   1224 C  CB  . TYR A 1 163 ? 10.168 32.760 29.585 1.00 64.61  ? 336 TYR A CB  1 
ATOM   1225 C  CG  . TYR A 1 163 ? 8.692  33.000 29.608 1.00 64.54  ? 336 TYR A CG  1 
ATOM   1226 C  CD1 . TYR A 1 163 ? 7.820  32.092 29.028 1.00 63.93  ? 336 TYR A CD1 1 
ATOM   1227 C  CD2 . TYR A 1 163 ? 8.158  34.106 30.248 1.00 64.77  ? 336 TYR A CD2 1 
ATOM   1228 C  CE1 . TYR A 1 163 ? 6.459  32.290 29.062 1.00 63.50  ? 336 TYR A CE1 1 
ATOM   1229 C  CE2 . TYR A 1 163 ? 6.794  34.314 30.285 1.00 64.03  ? 336 TYR A CE2 1 
ATOM   1230 C  CZ  . TYR A 1 163 ? 5.951  33.398 29.691 1.00 63.44  ? 336 TYR A CZ  1 
ATOM   1231 O  OH  . TYR A 1 163 ? 4.592  33.584 29.717 1.00 64.27  ? 336 TYR A OH  1 
ATOM   1232 N  N   . ARG A 1 164 ? 11.929 30.313 29.867 1.00 65.20  ? 337 ARG A N   1 
ATOM   1233 C  CA  . ARG A 1 164 ? 13.161 29.664 29.421 1.00 65.69  ? 337 ARG A CA  1 
ATOM   1234 C  C   . ARG A 1 164 ? 13.089 29.377 27.921 1.00 65.83  ? 337 ARG A C   1 
ATOM   1235 O  O   . ARG A 1 164 ? 12.037 29.527 27.322 1.00 65.87  ? 337 ARG A O   1 
ATOM   1236 C  CB  . ARG A 1 164 ? 13.467 28.395 30.234 1.00 65.71  ? 337 ARG A CB  1 
ATOM   1237 C  CG  . ARG A 1 164 ? 13.473 28.611 31.754 1.00 65.91  ? 337 ARG A CG  1 
ATOM   1238 C  CD  . ARG A 1 164 ? 14.498 27.768 32.462 1.00 66.42  ? 337 ARG A CD  1 
ATOM   1239 N  NE  . ARG A 1 164 ? 14.047 26.411 32.761 1.00 66.49  ? 337 ARG A NE  1 
ATOM   1240 C  CZ  . ARG A 1 164 ? 13.829 25.955 33.993 1.00 66.58  ? 337 ARG A CZ  1 
ATOM   1241 N  NH1 . ARG A 1 164 ? 14.005 26.752 35.043 1.00 66.80  ? 337 ARG A NH1 1 
ATOM   1242 N  NH2 . ARG A 1 164 ? 13.438 24.701 34.183 1.00 65.94  ? 337 ARG A NH2 1 
ATOM   1243 N  N   . PHE A 1 165 ? 14.217 29.015 27.314 1.00 66.02  ? 338 PHE A N   1 
ATOM   1244 C  CA  . PHE A 1 165 ? 14.252 28.721 25.890 1.00 65.82  ? 338 PHE A CA  1 
ATOM   1245 C  C   . PHE A 1 165 ? 14.030 27.248 25.680 1.00 66.21  ? 338 PHE A C   1 
ATOM   1246 O  O   . PHE A 1 165 ? 14.598 26.421 26.391 1.00 66.32  ? 338 PHE A O   1 
ATOM   1247 C  CB  . PHE A 1 165 ? 15.588 29.130 25.262 1.00 65.43  ? 338 PHE A CB  1 
ATOM   1248 C  CG  . PHE A 1 165 ? 15.671 30.585 24.907 1.00 64.57  ? 338 PHE A CG  1 
ATOM   1249 C  CD1 . PHE A 1 165 ? 16.428 31.457 25.672 1.00 63.27  ? 338 PHE A CD1 1 
ATOM   1250 C  CD2 . PHE A 1 165 ? 14.983 31.085 23.808 1.00 63.46  ? 338 PHE A CD2 1 
ATOM   1251 C  CE1 . PHE A 1 165 ? 16.504 32.795 25.351 1.00 62.58  ? 338 PHE A CE1 1 
ATOM   1252 C  CE2 . PHE A 1 165 ? 15.048 32.427 23.486 1.00 62.87  ? 338 PHE A CE2 1 
ATOM   1253 C  CZ  . PHE A 1 165 ? 15.814 33.281 24.262 1.00 63.21  ? 338 PHE A CZ  1 
ATOM   1254 N  N   . THR A 1 166 ? 13.191 26.930 24.703 1.00 66.68  ? 339 THR A N   1 
ATOM   1255 C  CA  . THR A 1 166 ? 12.937 25.557 24.319 1.00 67.53  ? 339 THR A CA  1 
ATOM   1256 C  C   . THR A 1 166 ? 14.178 25.025 23.632 1.00 67.98  ? 339 THR A C   1 
ATOM   1257 O  O   . THR A 1 166 ? 14.659 25.642 22.686 1.00 68.00  ? 339 THR A O   1 
ATOM   1258 C  CB  . THR A 1 166 ? 11.774 25.490 23.327 1.00 67.62  ? 339 THR A CB  1 
ATOM   1259 O  OG1 . THR A 1 166 ? 10.674 26.270 23.823 1.00 69.01  ? 339 THR A OG1 1 
ATOM   1260 C  CG2 . THR A 1 166 ? 11.333 24.053 23.108 1.00 67.64  ? 339 THR A CG2 1 
ATOM   1261 N  N   . PRO A 1 167 ? 14.702 23.872 24.098 1.00 68.68  ? 340 PRO A N   1 
ATOM   1262 C  CA  . PRO A 1 167 ? 15.910 23.324 23.476 1.00 69.28  ? 340 PRO A CA  1 
ATOM   1263 C  C   . PRO A 1 167 ? 15.632 22.948 22.029 1.00 69.96  ? 340 PRO A C   1 
ATOM   1264 O  O   . PRO A 1 167 ? 14.613 22.316 21.734 1.00 69.86  ? 340 PRO A O   1 
ATOM   1265 C  CB  . PRO A 1 167 ? 16.206 22.062 24.293 1.00 69.22  ? 340 PRO A CB  1 
ATOM   1266 C  CG  . PRO A 1 167 ? 15.196 22.010 25.389 1.00 69.01  ? 340 PRO A CG  1 
ATOM   1267 C  CD  . PRO A 1 167 ? 14.081 22.928 25.044 1.00 68.67  ? 340 PRO A CD  1 
ATOM   1268 N  N   . VAL A 1 168 ? 16.520 23.349 21.131 1.00 70.67  ? 341 VAL A N   1 
ATOM   1269 C  CA  . VAL A 1 168 ? 16.330 23.065 19.713 1.00 71.14  ? 341 VAL A CA  1 
ATOM   1270 C  C   . VAL A 1 168 ? 17.095 21.822 19.283 1.00 71.41  ? 341 VAL A C   1 
ATOM   1271 O  O   . VAL A 1 168 ? 16.879 21.297 18.182 1.00 71.65  ? 341 VAL A O   1 
ATOM   1272 C  CB  . VAL A 1 168 ? 16.754 24.258 18.818 1.00 71.14  ? 341 VAL A CB  1 
ATOM   1273 C  CG1 . VAL A 1 168 ? 15.918 25.485 19.133 1.00 71.61  ? 341 VAL A CG1 1 
ATOM   1274 C  CG2 . VAL A 1 168 ? 18.228 24.571 18.981 1.00 71.22  ? 341 VAL A CG2 1 
ATOM   1275 N  N   . LEU A 1 169 ? 17.981 21.351 20.156 1.00 71.67  ? 342 LEU A N   1 
ATOM   1276 C  CA  . LEU A 1 169 ? 18.930 20.316 19.781 1.00 71.99  ? 342 LEU A CA  1 
ATOM   1277 C  C   . LEU A 1 169 ? 18.428 18.880 19.998 1.00 72.53  ? 342 LEU A C   1 
ATOM   1278 O  O   . LEU A 1 169 ? 17.982 18.531 21.090 1.00 72.53  ? 342 LEU A O   1 
ATOM   1279 C  CB  . LEU A 1 169 ? 20.246 20.542 20.516 1.00 71.75  ? 342 LEU A CB  1 
ATOM   1280 C  CG  . LEU A 1 169 ? 21.485 19.953 19.846 1.00 71.17  ? 342 LEU A CG  1 
ATOM   1281 C  CD1 . LEU A 1 169 ? 21.727 20.602 18.488 1.00 69.88  ? 342 LEU A CD1 1 
ATOM   1282 C  CD2 . LEU A 1 169 ? 22.685 20.131 20.756 1.00 70.54  ? 342 LEU A CD2 1 
ATOM   1283 N  N   . THR A 1 170 ? 18.499 18.064 18.942 1.00 73.24  ? 343 THR A N   1 
ATOM   1284 C  CA  . THR A 1 170 ? 18.220 16.627 19.016 1.00 74.03  ? 343 THR A CA  1 
ATOM   1285 C  C   . THR A 1 170 ? 19.234 15.829 18.193 1.00 74.84  ? 343 THR A C   1 
ATOM   1286 O  O   . THR A 1 170 ? 19.727 16.301 17.156 1.00 74.90  ? 343 THR A O   1 
ATOM   1287 C  CB  . THR A 1 170 ? 16.824 16.271 18.486 1.00 73.89  ? 343 THR A CB  1 
ATOM   1288 O  OG1 . THR A 1 170 ? 16.651 16.880 17.196 1.00 73.27  ? 343 THR A OG1 1 
ATOM   1289 C  CG2 . THR A 1 170 ? 15.723 16.737 19.454 1.00 73.66  ? 343 THR A CG2 1 
ATOM   1290 N  N   . LEU A 1 171 ? 19.524 14.613 18.664 1.00 75.63  ? 344 LEU A N   1 
ATOM   1291 C  CA  . LEU A 1 171 ? 20.459 13.690 18.010 1.00 76.27  ? 344 LEU A CA  1 
ATOM   1292 C  C   . LEU A 1 171 ? 19.699 12.485 17.466 1.00 77.08  ? 344 LEU A C   1 
ATOM   1293 O  O   . LEU A 1 171 ? 19.077 11.734 18.232 1.00 77.43  ? 344 LEU A O   1 
ATOM   1294 C  CB  . LEU A 1 171 ? 21.547 13.225 19.000 1.00 76.01  ? 344 LEU A CB  1 
ATOM   1295 C  CG  . LEU A 1 171 ? 22.308 11.892 18.813 1.00 75.87  ? 344 LEU A CG  1 
ATOM   1296 C  CD1 . LEU A 1 171 ? 23.198 11.883 17.565 1.00 75.75  ? 344 LEU A CD1 1 
ATOM   1297 C  CD2 . LEU A 1 171 ? 23.135 11.597 20.041 1.00 74.94  ? 344 LEU A CD2 1 
ATOM   1298 N  N   . GLU A 1 172 ? 19.745 12.316 16.144 1.00 77.82  ? 345 GLU A N   1 
ATOM   1299 C  CA  . GLU A 1 172 ? 19.139 11.162 15.479 1.00 78.56  ? 345 GLU A CA  1 
ATOM   1300 C  C   . GLU A 1 172 ? 20.101 10.697 14.371 1.00 78.94  ? 345 GLU A C   1 
ATOM   1301 O  O   . GLU A 1 172 ? 20.685 11.530 13.649 1.00 78.88  ? 345 GLU A O   1 
ATOM   1302 C  CB  . GLU A 1 172 ? 17.750 11.533 14.915 1.00 78.68  ? 345 GLU A CB  1 
ATOM   1303 C  CG  . GLU A 1 172 ? 16.758 10.344 14.703 1.00 79.23  ? 345 GLU A CG  1 
ATOM   1304 C  CD  . GLU A 1 172 ? 15.489 10.791 13.925 1.00 80.06  ? 345 GLU A CD  1 
ATOM   1305 O  OE1 . GLU A 1 172 ? 14.975 9.982  13.066 1.00 80.11  ? 345 GLU A OE1 1 
ATOM   1306 O  OE2 . GLU A 1 172 ? 15.014 11.943 14.148 1.00 79.82  ? 345 GLU A OE2 1 
ATOM   1307 N  N   . ASP A 1 173 ? 20.278 9.373  14.266 1.00 79.42  ? 346 ASP A N   1 
ATOM   1308 C  CA  . ASP A 1 173 ? 21.096 8.746  13.204 1.00 79.80  ? 346 ASP A CA  1 
ATOM   1309 C  C   . ASP A 1 173 ? 22.516 9.343  13.078 1.00 80.02  ? 346 ASP A C   1 
ATOM   1310 O  O   . ASP A 1 173 ? 22.923 9.793  11.998 1.00 80.14  ? 346 ASP A O   1 
ATOM   1311 C  CB  . ASP A 1 173 ? 20.354 8.744  11.830 1.00 79.81  ? 346 ASP A CB  1 
ATOM   1312 C  CG  . ASP A 1 173 ? 19.514 7.456  11.579 1.00 79.76  ? 346 ASP A CG  1 
ATOM   1313 O  OD1 . ASP A 1 173 ? 18.383 7.577  11.032 1.00 79.23  ? 346 ASP A OD1 1 
ATOM   1314 O  OD2 . ASP A 1 173 ? 19.983 6.332  11.912 1.00 79.45  ? 346 ASP A OD2 1 
ATOM   1315 N  N   . GLY A 1 174 ? 23.264 9.352  14.182 1.00 80.17  ? 347 GLY A N   1 
ATOM   1316 C  CA  . GLY A 1 174 ? 24.653 9.841  14.157 1.00 80.34  ? 347 GLY A CA  1 
ATOM   1317 C  C   . GLY A 1 174 ? 24.861 11.356 14.233 1.00 80.51  ? 347 GLY A C   1 
ATOM   1318 O  O   . GLY A 1 174 ? 25.665 11.839 15.058 1.00 80.61  ? 347 GLY A O   1 
ATOM   1319 N  N   . PHE A 1 175 ? 24.154 12.104 13.370 1.00 80.53  ? 348 PHE A N   1 
ATOM   1320 C  CA  . PHE A 1 175 ? 24.272 13.577 13.314 1.00 80.41  ? 348 PHE A CA  1 
ATOM   1321 C  C   . PHE A 1 175 ? 23.356 14.288 14.321 1.00 79.71  ? 348 PHE A C   1 
ATOM   1322 O  O   . PHE A 1 175 ? 22.393 13.697 14.840 1.00 79.80  ? 348 PHE A O   1 
ATOM   1323 C  CB  . PHE A 1 175 ? 24.005 14.108 11.884 1.00 80.79  ? 348 PHE A CB  1 
ATOM   1324 C  CG  . PHE A 1 175 ? 25.145 13.865 10.916 1.00 82.01  ? 348 PHE A CG  1 
ATOM   1325 C  CD1 . PHE A 1 175 ? 26.091 14.877 10.659 1.00 82.67  ? 348 PHE A CD1 1 
ATOM   1326 C  CD2 . PHE A 1 175 ? 25.279 12.615 10.264 1.00 82.95  ? 348 PHE A CD2 1 
ATOM   1327 C  CE1 . PHE A 1 175 ? 27.161 14.652 9.763  1.00 83.54  ? 348 PHE A CE1 1 
ATOM   1328 C  CE2 . PHE A 1 175 ? 26.345 12.369 9.367  1.00 83.23  ? 348 PHE A CE2 1 
ATOM   1329 C  CZ  . PHE A 1 175 ? 27.285 13.389 9.115  1.00 83.85  ? 348 PHE A CZ  1 
ATOM   1330 N  N   . TYR A 1 176 ? 23.661 15.556 14.593 1.00 78.93  ? 349 TYR A N   1 
ATOM   1331 C  CA  . TYR A 1 176 ? 22.794 16.374 15.436 1.00 78.39  ? 349 TYR A CA  1 
ATOM   1332 C  C   . TYR A 1 176 ? 21.950 17.281 14.553 1.00 77.48  ? 349 TYR A C   1 
ATOM   1333 O  O   . TYR A 1 176 ? 22.487 17.983 13.697 1.00 77.56  ? 349 TYR A O   1 
ATOM   1334 C  CB  . TYR A 1 176 ? 23.619 17.186 16.457 1.00 78.84  ? 349 TYR A CB  1 
ATOM   1335 C  CG  . TYR A 1 176 ? 24.239 16.321 17.555 1.00 79.74  ? 349 TYR A CG  1 
ATOM   1336 C  CD1 . TYR A 1 176 ? 23.552 16.062 18.747 1.00 79.94  ? 349 TYR A CD1 1 
ATOM   1337 C  CD2 . TYR A 1 176 ? 25.501 15.749 17.385 1.00 80.49  ? 349 TYR A CD2 1 
ATOM   1338 C  CE1 . TYR A 1 176 ? 24.113 15.305 19.750 1.00 79.60  ? 349 TYR A CE1 1 
ATOM   1339 C  CE2 . TYR A 1 176 ? 26.070 14.954 18.373 1.00 80.08  ? 349 TYR A CE2 1 
ATOM   1340 C  CZ  . TYR A 1 176 ? 25.373 14.716 19.547 1.00 79.54  ? 349 TYR A CZ  1 
ATOM   1341 O  OH  . TYR A 1 176 ? 25.944 13.929 20.515 1.00 79.25  ? 349 TYR A OH  1 
ATOM   1342 N  N   . GLU A 1 177 ? 20.632 17.248 14.748 1.00 76.37  ? 350 GLU A N   1 
ATOM   1343 C  CA  . GLU A 1 177 ? 19.729 18.056 13.925 1.00 75.29  ? 350 GLU A CA  1 
ATOM   1344 C  C   . GLU A 1 177 ? 18.982 19.113 14.761 1.00 74.07  ? 350 GLU A C   1 
ATOM   1345 O  O   . GLU A 1 177 ? 18.717 18.926 15.955 1.00 73.72  ? 350 GLU A O   1 
ATOM   1346 C  CB  . GLU A 1 177 ? 18.760 17.171 13.106 1.00 75.54  ? 350 GLU A CB  1 
ATOM   1347 C  CG  . GLU A 1 177 ? 19.366 15.843 12.529 1.00 77.00  ? 350 GLU A CG  1 
ATOM   1348 C  CD  . GLU A 1 177 ? 20.226 16.008 11.236 1.00 78.99  ? 350 GLU A CD  1 
ATOM   1349 O  OE1 . GLU A 1 177 ? 20.551 14.957 10.576 1.00 78.47  ? 350 GLU A OE1 1 
ATOM   1350 O  OE2 . GLU A 1 177 ? 20.582 17.173 10.874 1.00 80.05  ? 350 GLU A OE2 1 
ATOM   1351 N  N   . VAL A 1 178 ? 18.646 20.221 14.116 1.00 72.79  ? 351 VAL A N   1 
ATOM   1352 C  CA  . VAL A 1 178 ? 18.168 21.397 14.805 1.00 71.70  ? 351 VAL A CA  1 
ATOM   1353 C  C   . VAL A 1 178 ? 16.706 21.650 14.460 1.00 71.18  ? 351 VAL A C   1 
ATOM   1354 O  O   . VAL A 1 178 ? 16.393 22.027 13.339 1.00 71.18  ? 351 VAL A O   1 
ATOM   1355 C  CB  . VAL A 1 178 ? 19.027 22.630 14.374 1.00 71.59  ? 351 VAL A CB  1 
ATOM   1356 C  CG1 . VAL A 1 178 ? 18.519 23.923 14.988 1.00 71.40  ? 351 VAL A CG1 1 
ATOM   1357 C  CG2 . VAL A 1 178 ? 20.491 22.424 14.727 1.00 71.54  ? 351 VAL A CG2 1 
ATOM   1358 N  N   . ASP A 1 179 ? 15.808 21.459 15.416 1.00 70.65  ? 352 ASP A N   1 
ATOM   1359 C  CA  . ASP A 1 179 ? 14.424 21.881 15.220 1.00 70.21  ? 352 ASP A CA  1 
ATOM   1360 C  C   . ASP A 1 179 ? 14.321 23.417 15.180 1.00 69.76  ? 352 ASP A C   1 
ATOM   1361 O  O   . ASP A 1 179 ? 14.102 24.055 16.208 1.00 69.69  ? 352 ASP A O   1 
ATOM   1362 C  CB  . ASP A 1 179 ? 13.518 21.294 16.317 1.00 70.41  ? 352 ASP A CB  1 
ATOM   1363 C  CG  . ASP A 1 179 ? 12.067 21.802 16.240 1.00 70.59  ? 352 ASP A CG  1 
ATOM   1364 O  OD1 . ASP A 1 179 ? 11.639 22.310 15.174 1.00 70.83  ? 352 ASP A OD1 1 
ATOM   1365 O  OD2 . ASP A 1 179 ? 11.344 21.684 17.254 1.00 71.43  ? 352 ASP A OD2 1 
ATOM   1366 N  N   . TYR A 1 180 ? 14.456 24.001 13.991 1.00 69.16  ? 353 TYR A N   1 
ATOM   1367 C  CA  . TYR A 1 180 ? 14.437 25.461 13.835 1.00 68.82  ? 353 TYR A CA  1 
ATOM   1368 C  C   . TYR A 1 180 ? 13.085 26.170 14.072 1.00 68.40  ? 353 TYR A C   1 
ATOM   1369 O  O   . TYR A 1 180 ? 13.028 27.414 14.128 1.00 68.37  ? 353 TYR A O   1 
ATOM   1370 C  CB  . TYR A 1 180 ? 14.963 25.836 12.456 1.00 68.90  ? 353 TYR A CB  1 
ATOM   1371 C  CG  . TYR A 1 180 ? 16.466 25.874 12.370 1.00 69.32  ? 353 TYR A CG  1 
ATOM   1372 C  CD1 . TYR A 1 180 ? 17.174 27.002 12.787 1.00 70.02  ? 353 TYR A CD1 1 
ATOM   1373 C  CD2 . TYR A 1 180 ? 17.185 24.796 11.855 1.00 69.53  ? 353 TYR A CD2 1 
ATOM   1374 C  CE1 . TYR A 1 180 ? 18.563 27.059 12.703 1.00 70.58  ? 353 TYR A CE1 1 
ATOM   1375 C  CE2 . TYR A 1 180 ? 18.579 24.837 11.765 1.00 70.06  ? 353 TYR A CE2 1 
ATOM   1376 C  CZ  . TYR A 1 180 ? 19.266 25.972 12.197 1.00 70.52  ? 353 TYR A CZ  1 
ATOM   1377 O  OH  . TYR A 1 180 ? 20.650 26.036 12.117 1.00 70.23  ? 353 TYR A OH  1 
ATOM   1378 N  N   . ASN A 1 181 ? 12.005 25.399 14.191 1.00 67.75  ? 354 ASN A N   1 
ATOM   1379 C  CA  . ASN A 1 181 ? 10.689 25.991 14.440 1.00 67.33  ? 354 ASN A CA  1 
ATOM   1380 C  C   . ASN A 1 181 ? 10.509 26.261 15.924 1.00 66.88  ? 354 ASN A C   1 
ATOM   1381 O  O   . ASN A 1 181 ? 9.499  26.832 16.353 1.00 66.94  ? 354 ASN A O   1 
ATOM   1382 C  CB  . ASN A 1 181 ? 9.551  25.082 13.937 1.00 67.62  ? 354 ASN A CB  1 
ATOM   1383 C  CG  . ASN A 1 181 ? 9.655  24.766 12.436 1.00 68.36  ? 354 ASN A CG  1 
ATOM   1384 O  OD1 . ASN A 1 181 ? 10.081 25.614 11.632 1.00 68.89  ? 354 ASN A OD1 1 
ATOM   1385 N  ND2 . ASN A 1 181 ? 9.262  23.532 12.055 1.00 68.36  ? 354 ASN A ND2 1 
ATOM   1386 N  N   . SER A 1 182 ? 11.481 25.818 16.716 1.00 66.38  ? 355 SER A N   1 
ATOM   1387 C  CA  . SER A 1 182 ? 11.451 26.060 18.157 1.00 65.76  ? 355 SER A CA  1 
ATOM   1388 C  C   . SER A 1 182 ? 12.513 27.078 18.568 1.00 65.13  ? 355 SER A C   1 
ATOM   1389 O  O   . SER A 1 182 ? 12.653 27.394 19.747 1.00 65.32  ? 355 SER A O   1 
ATOM   1390 C  CB  . SER A 1 182 ? 11.598 24.745 18.945 1.00 65.91  ? 355 SER A CB  1 
ATOM   1391 O  OG  . SER A 1 182 ? 10.420 23.929 18.850 1.00 66.61  ? 355 SER A OG  1 
ATOM   1392 N  N   . PHE A 1 183 ? 13.245 27.597 17.583 1.00 64.36  ? 356 PHE A N   1 
ATOM   1393 C  CA  . PHE A 1 183 ? 14.275 28.595 17.829 1.00 63.51  ? 356 PHE A CA  1 
ATOM   1394 C  C   . PHE A 1 183 ? 13.759 29.688 18.751 1.00 62.96  ? 356 PHE A C   1 
ATOM   1395 O  O   . PHE A 1 183 ? 14.318 29.869 19.822 1.00 63.07  ? 356 PHE A O   1 
ATOM   1396 C  CB  . PHE A 1 183 ? 14.754 29.192 16.511 1.00 63.62  ? 356 PHE A CB  1 
ATOM   1397 C  CG  . PHE A 1 183 ? 15.809 30.260 16.655 1.00 64.57  ? 356 PHE A CG  1 
ATOM   1398 C  CD1 . PHE A 1 183 ? 17.147 29.966 16.415 1.00 65.71  ? 356 PHE A CD1 1 
ATOM   1399 C  CD2 . PHE A 1 183 ? 15.463 31.573 16.974 1.00 65.28  ? 356 PHE A CD2 1 
ATOM   1400 C  CE1 . PHE A 1 183 ? 18.122 30.953 16.522 1.00 66.01  ? 356 PHE A CE1 1 
ATOM   1401 C  CE2 . PHE A 1 183 ? 16.438 32.567 17.083 1.00 65.18  ? 356 PHE A CE2 1 
ATOM   1402 C  CZ  . PHE A 1 183 ? 17.763 32.259 16.857 1.00 65.69  ? 356 PHE A CZ  1 
ATOM   1403 N  N   . HIS A 1 184 ? 12.697 30.401 18.352 1.00 62.36  ? 357 HIS A N   1 
ATOM   1404 C  CA  . HIS A 1 184 ? 12.179 31.535 19.139 1.00 61.90  ? 357 HIS A CA  1 
ATOM   1405 C  C   . HIS A 1 184 ? 11.197 31.080 20.208 1.00 61.83  ? 357 HIS A C   1 
ATOM   1406 O  O   . HIS A 1 184 ? 10.553 31.903 20.859 1.00 62.04  ? 357 HIS A O   1 
ATOM   1407 C  CB  . HIS A 1 184 ? 11.467 32.555 18.253 1.00 61.68  ? 357 HIS A CB  1 
ATOM   1408 C  CG  . HIS A 1 184 ? 12.230 32.938 17.023 1.00 61.51  ? 357 HIS A CG  1 
ATOM   1409 N  ND1 . HIS A 1 184 ? 13.082 34.024 16.990 1.00 62.00  ? 357 HIS A ND1 1 
ATOM   1410 C  CD2 . HIS A 1 184 ? 12.240 32.401 15.772 1.00 60.34  ? 357 HIS A CD2 1 
ATOM   1411 C  CE1 . HIS A 1 184 ? 13.600 34.131 15.776 1.00 61.17  ? 357 HIS A CE1 1 
ATOM   1412 N  NE2 . HIS A 1 184 ? 13.105 33.159 15.018 1.00 59.59  ? 357 HIS A NE2 1 
ATOM   1413 N  N   . GLU A 1 185 ? 11.055 29.773 20.379 1.00 61.50  ? 358 GLU A N   1 
ATOM   1414 C  CA  . GLU A 1 185 ? 10.063 29.272 21.309 1.00 61.28  ? 358 GLU A CA  1 
ATOM   1415 C  C   . GLU A 1 185 ? 10.565 29.385 22.711 1.00 60.83  ? 358 GLU A C   1 
ATOM   1416 O  O   . GLU A 1 185 ? 11.688 29.007 23.021 1.00 60.77  ? 358 GLU A O   1 
ATOM   1417 C  CB  . GLU A 1 185 ? 9.723  27.818 21.030 1.00 61.36  ? 358 GLU A CB  1 
ATOM   1418 C  CG  . GLU A 1 185 ? 8.632  27.616 20.005 1.00 64.10  ? 358 GLU A CG  1 
ATOM   1419 C  CD  . GLU A 1 185 ? 7.924  26.289 20.222 1.00 67.86  ? 358 GLU A CD  1 
ATOM   1420 O  OE1 . GLU A 1 185 ? 8.167  25.682 21.306 1.00 68.44  ? 358 GLU A OE1 1 
ATOM   1421 O  OE2 . GLU A 1 185 ? 7.133  25.856 19.327 1.00 68.14  ? 358 GLU A OE2 1 
ATOM   1422 N  N   . THR A 1 186 ? 9.715  29.907 23.567 1.00 60.37  ? 359 THR A N   1 
ATOM   1423 C  CA  . THR A 1 186 ? 9.999  29.903 24.976 1.00 59.81  ? 359 THR A CA  1 
ATOM   1424 C  C   . THR A 1 186 ? 8.881  29.172 25.696 1.00 59.68  ? 359 THR A C   1 
ATOM   1425 O  O   . THR A 1 186 ? 7.895  28.780 25.085 1.00 59.77  ? 359 THR A O   1 
ATOM   1426 C  CB  . THR A 1 186 ? 10.073 31.316 25.497 1.00 59.48  ? 359 THR A CB  1 
ATOM   1427 O  OG1 . THR A 1 186 ? 8.842  31.974 25.182 1.00 59.90  ? 359 THR A OG1 1 
ATOM   1428 C  CG2 . THR A 1 186 ? 11.212 32.042 24.824 1.00 59.23  ? 359 THR A CG2 1 
ATOM   1429 N  N   . TYR A 1 187 ? 9.049  28.995 26.999 1.00 59.60  ? 360 TYR A N   1 
ATOM   1430 C  CA  . TYR A 1 187 ? 8.027  28.420 27.852 1.00 59.25  ? 360 TYR A CA  1 
ATOM   1431 C  C   . TYR A 1 187 ? 8.152  28.984 29.259 1.00 59.10  ? 360 TYR A C   1 
ATOM   1432 O  O   . TYR A 1 187 ? 9.226  29.414 29.662 1.00 58.92  ? 360 TYR A O   1 
ATOM   1433 C  CB  . TYR A 1 187 ? 8.119  26.891 27.862 1.00 59.16  ? 360 TYR A CB  1 
ATOM   1434 C  CG  . TYR A 1 187 ? 9.344  26.310 28.526 1.00 58.28  ? 360 TYR A CG  1 
ATOM   1435 C  CD1 . TYR A 1 187 ? 9.320  25.950 29.872 1.00 57.84  ? 360 TYR A CD1 1 
ATOM   1436 C  CD2 . TYR A 1 187 ? 10.515 26.078 27.797 1.00 58.35  ? 360 TYR A CD2 1 
ATOM   1437 C  CE1 . TYR A 1 187 ? 10.444 25.381 30.489 1.00 58.32  ? 360 TYR A CE1 1 
ATOM   1438 C  CE2 . TYR A 1 187 ? 11.644 25.515 28.399 1.00 59.05  ? 360 TYR A CE2 1 
ATOM   1439 C  CZ  . TYR A 1 187 ? 11.600 25.164 29.747 1.00 58.63  ? 360 TYR A CZ  1 
ATOM   1440 O  OH  . TYR A 1 187 ? 12.705 24.611 30.356 1.00 57.60  ? 360 TYR A OH  1 
ATOM   1441 N  N   . GLU A 1 188 ? 7.049  28.989 29.996 1.00 58.99  ? 361 GLU A N   1 
ATOM   1442 C  CA  . GLU A 1 188 ? 7.042  29.502 31.358 1.00 58.97  ? 361 GLU A CA  1 
ATOM   1443 C  C   . GLU A 1 188 ? 7.636  28.537 32.381 1.00 58.52  ? 361 GLU A C   1 
ATOM   1444 O  O   . GLU A 1 188 ? 7.470  27.325 32.291 1.00 58.19  ? 361 GLU A O   1 
ATOM   1445 C  CB  . GLU A 1 188 ? 5.629  29.898 31.766 1.00 59.43  ? 361 GLU A CB  1 
ATOM   1446 C  CG  . GLU A 1 188 ? 5.576  30.832 32.965 1.00 60.65  ? 361 GLU A CG  1 
ATOM   1447 C  CD  . GLU A 1 188 ? 4.208  31.457 33.126 1.00 62.14  ? 361 GLU A CD  1 
ATOM   1448 O  OE1 . GLU A 1 188 ? 3.233  30.920 32.520 1.00 61.88  ? 361 GLU A OE1 1 
ATOM   1449 O  OE2 . GLU A 1 188 ? 4.112  32.482 33.856 1.00 63.26  ? 361 GLU A OE2 1 
ATOM   1450 N  N   . THR A 1 189 ? 8.335  29.101 33.356 1.00 58.17  ? 362 THR A N   1 
ATOM   1451 C  CA  . THR A 1 189 ? 8.977  28.335 34.401 1.00 57.76  ? 362 THR A CA  1 
ATOM   1452 C  C   . THR A 1 189 ? 8.823  29.157 35.660 1.00 57.65  ? 362 THR A C   1 
ATOM   1453 O  O   . THR A 1 189 ? 8.834  30.390 35.601 1.00 57.45  ? 362 THR A O   1 
ATOM   1454 C  CB  . THR A 1 189 ? 10.463 28.096 34.088 1.00 57.60  ? 362 THR A CB  1 
ATOM   1455 O  OG1 . THR A 1 189 ? 11.029 27.226 35.072 1.00 57.82  ? 362 THR A OG1 1 
ATOM   1456 C  CG2 . THR A 1 189 ? 11.226 29.406 34.081 1.00 57.79  ? 362 THR A CG2 1 
ATOM   1457 N  N   . SER A 1 190 ? 8.648  28.477 36.791 1.00 57.52  ? 363 SER A N   1 
ATOM   1458 C  CA  . SER A 1 190 ? 8.406  29.163 38.051 1.00 57.10  ? 363 SER A CA  1 
ATOM   1459 C  C   . SER A 1 190 ? 9.633  29.964 38.416 1.00 57.09  ? 363 SER A C   1 
ATOM   1460 O  O   . SER A 1 190 ? 10.747 29.440 38.422 1.00 57.07  ? 363 SER A O   1 
ATOM   1461 C  CB  . SER A 1 190 ? 8.077  28.186 39.171 1.00 56.97  ? 363 SER A CB  1 
ATOM   1462 O  OG  . SER A 1 190 ? 7.686  28.892 40.339 1.00 56.49  ? 363 SER A OG  1 
ATOM   1463 N  N   . THR A 1 191 ? 9.409  31.238 38.719 1.00 56.96  ? 364 THR A N   1 
ATOM   1464 C  CA  . THR A 1 191 ? 10.479 32.204 38.861 1.00 56.76  ? 364 THR A CA  1 
ATOM   1465 C  C   . THR A 1 191 ? 10.062 33.321 39.840 1.00 56.69  ? 364 THR A C   1 
ATOM   1466 O  O   . THR A 1 191 ? 8.920  33.773 39.811 1.00 56.61  ? 364 THR A O   1 
ATOM   1467 C  CB  . THR A 1 191 ? 10.835 32.761 37.460 1.00 56.77  ? 364 THR A CB  1 
ATOM   1468 O  OG1 . THR A 1 191 ? 11.404 31.710 36.656 1.00 56.99  ? 364 THR A OG1 1 
ATOM   1469 C  CG2 . THR A 1 191 ? 11.816 33.932 37.549 1.00 56.88  ? 364 THR A CG2 1 
ATOM   1470 N  N   . PRO A 1 192 ? 10.980 33.763 40.725 1.00 56.61  ? 365 PRO A N   1 
ATOM   1471 C  CA  . PRO A 1 192 ? 10.582 34.825 41.648 1.00 56.61  ? 365 PRO A CA  1 
ATOM   1472 C  C   . PRO A 1 192 ? 10.333 36.153 40.938 1.00 56.86  ? 365 PRO A C   1 
ATOM   1473 O  O   . PRO A 1 192 ? 10.955 36.443 39.923 1.00 56.90  ? 365 PRO A O   1 
ATOM   1474 C  CB  . PRO A 1 192 ? 11.777 34.938 42.594 1.00 56.54  ? 365 PRO A CB  1 
ATOM   1475 C  CG  . PRO A 1 192 ? 12.905 34.370 41.862 1.00 55.79  ? 365 PRO A CG  1 
ATOM   1476 C  CD  . PRO A 1 192 ? 12.385 33.341 40.929 1.00 56.14  ? 365 PRO A CD  1 
ATOM   1477 N  N   . SER A 1 193 ? 9.420  36.952 41.465 1.00 56.96  ? 366 SER A N   1 
ATOM   1478 C  CA  . SER A 1 193 ? 9.100  38.219 40.845 1.00 57.23  ? 366 SER A CA  1 
ATOM   1479 C  C   . SER A 1 193 ? 9.951  39.319 41.458 1.00 57.38  ? 366 SER A C   1 
ATOM   1480 O  O   . SER A 1 193 ? 9.930  40.471 41.004 1.00 57.75  ? 366 SER A O   1 
ATOM   1481 C  CB  . SER A 1 193 ? 7.639  38.541 41.080 1.00 57.20  ? 366 SER A CB  1 
ATOM   1482 O  OG  . SER A 1 193 ? 7.412  38.567 42.477 1.00 57.48  ? 366 SER A OG  1 
ATOM   1483 N  N   . LEU A 1 194 ? 10.677 38.969 42.511 1.00 57.38  ? 367 LEU A N   1 
ATOM   1484 C  CA  . LEU A 1 194 ? 11.592 39.906 43.147 1.00 57.56  ? 367 LEU A CA  1 
ATOM   1485 C  C   . LEU A 1 194 ? 12.710 40.278 42.189 1.00 58.04  ? 367 LEU A C   1 
ATOM   1486 O  O   . LEU A 1 194 ? 13.047 39.493 41.303 1.00 58.10  ? 367 LEU A O   1 
ATOM   1487 C  CB  . LEU A 1 194 ? 12.194 39.287 44.413 1.00 57.23  ? 367 LEU A CB  1 
ATOM   1488 C  CG  . LEU A 1 194 ? 11.679 39.725 45.778 1.00 56.01  ? 367 LEU A CG  1 
ATOM   1489 C  CD1 . LEU A 1 194 ? 10.216 39.379 45.956 1.00 55.91  ? 367 LEU A CD1 1 
ATOM   1490 C  CD2 . LEU A 1 194 ? 12.490 39.050 46.823 1.00 54.46  ? 367 LEU A CD2 1 
ATOM   1491 N  N   . SER A 1 195 ? 13.285 41.468 42.373 1.00 58.90  ? 368 SER A N   1 
ATOM   1492 C  CA  . SER A 1 195 ? 14.498 41.872 41.655 1.00 59.91  ? 368 SER A CA  1 
ATOM   1493 C  C   . SER A 1 195 ? 15.728 41.119 42.167 1.00 60.69  ? 368 SER A C   1 
ATOM   1494 O  O   . SER A 1 195 ? 15.725 40.565 43.274 1.00 60.59  ? 368 SER A O   1 
ATOM   1495 C  CB  . SER A 1 195 ? 14.738 43.364 41.813 1.00 59.75  ? 368 SER A CB  1 
ATOM   1496 O  OG  . SER A 1 195 ? 15.295 43.638 43.083 1.00 59.32  ? 368 SER A OG  1 
ATOM   1497 N  N   . ALA A 1 196 ? 16.777 41.120 41.348 1.00 61.69  ? 369 ALA A N   1 
ATOM   1498 C  CA  . ALA A 1 196 ? 18.030 40.442 41.664 1.00 62.72  ? 369 ALA A CA  1 
ATOM   1499 C  C   . ALA A 1 196 ? 18.609 40.888 43.005 1.00 63.26  ? 369 ALA A C   1 
ATOM   1500 O  O   . ALA A 1 196 ? 18.978 40.054 43.849 1.00 63.13  ? 369 ALA A O   1 
ATOM   1501 C  CB  . ALA A 1 196 ? 19.026 40.675 40.560 1.00 63.04  ? 369 ALA A CB  1 
ATOM   1502 N  N   . LYS A 1 197 ? 18.691 42.208 43.178 1.00 63.97  ? 370 LYS A N   1 
ATOM   1503 C  CA  . LYS A 1 197 ? 19.104 42.807 44.441 1.00 64.79  ? 370 LYS A CA  1 
ATOM   1504 C  C   . LYS A 1 197 ? 18.194 42.300 45.546 1.00 65.28  ? 370 LYS A C   1 
ATOM   1505 O  O   . LYS A 1 197 ? 18.673 41.827 46.586 1.00 65.35  ? 370 LYS A O   1 
ATOM   1506 C  CB  . LYS A 1 197 ? 19.040 44.340 44.358 1.00 64.80  ? 370 LYS A CB  1 
ATOM   1507 C  CG  . LYS A 1 197 ? 19.246 45.100 45.682 1.00 65.70  ? 370 LYS A CG  1 
ATOM   1508 C  CD  . LYS A 1 197 ? 19.517 46.578 45.394 1.00 66.95  ? 370 LYS A CD  1 
ATOM   1509 C  CE  . LYS A 1 197 ? 18.818 47.523 46.371 1.00 67.51  ? 370 LYS A CE  1 
ATOM   1510 N  NZ  . LYS A 1 197 ? 19.732 48.030 47.439 1.00 68.67  ? 370 LYS A NZ  1 
ATOM   1511 N  N   . GLU A 1 198 ? 16.885 42.381 45.302 1.00 65.88  ? 371 GLU A N   1 
ATOM   1512 C  CA  . GLU A 1 198 ? 15.892 41.998 46.298 1.00 66.65  ? 371 GLU A CA  1 
ATOM   1513 C  C   . GLU A 1 198 ? 16.102 40.562 46.741 1.00 66.77  ? 371 GLU A C   1 
ATOM   1514 O  O   . GLU A 1 198 ? 15.947 40.251 47.923 1.00 66.80  ? 371 GLU A O   1 
ATOM   1515 C  CB  . GLU A 1 198 ? 14.471 42.216 45.774 1.00 66.87  ? 371 GLU A CB  1 
ATOM   1516 C  CG  . GLU A 1 198 ? 13.983 43.654 45.922 1.00 68.17  ? 371 GLU A CG  1 
ATOM   1517 C  CD  . GLU A 1 198 ? 12.674 43.930 45.188 1.00 69.76  ? 371 GLU A CD  1 
ATOM   1518 O  OE1 . GLU A 1 198 ? 12.309 43.153 44.272 1.00 70.10  ? 371 GLU A OE1 1 
ATOM   1519 O  OE2 . GLU A 1 198 ? 12.008 44.940 45.529 1.00 70.33  ? 371 GLU A OE2 1 
ATOM   1520 N  N   . LEU A 1 199 ? 16.485 39.707 45.794 1.00 66.92  ? 372 LEU A N   1 
ATOM   1521 C  CA  . LEU A 1 199 ? 16.723 38.287 46.064 1.00 67.02  ? 372 LEU A CA  1 
ATOM   1522 C  C   . LEU A 1 199 ? 17.971 38.024 46.897 1.00 67.30  ? 372 LEU A C   1 
ATOM   1523 O  O   . LEU A 1 199 ? 18.005 37.069 47.678 1.00 67.16  ? 372 LEU A O   1 
ATOM   1524 C  CB  . LEU A 1 199 ? 16.816 37.496 44.762 1.00 66.77  ? 372 LEU A CB  1 
ATOM   1525 C  CG  . LEU A 1 199 ? 15.487 37.201 44.072 1.00 65.61  ? 372 LEU A CG  1 
ATOM   1526 C  CD1 . LEU A 1 199 ? 15.702 36.777 42.635 1.00 64.53  ? 372 LEU A CD1 1 
ATOM   1527 C  CD2 . LEU A 1 199 ? 14.732 36.138 44.840 1.00 64.86  ? 372 LEU A CD2 1 
ATOM   1528 N  N   . ALA A 1 200 ? 18.994 38.858 46.716 1.00 67.64  ? 373 ALA A N   1 
ATOM   1529 C  CA  . ALA A 1 200 ? 20.235 38.715 47.461 1.00 67.89  ? 373 ALA A CA  1 
ATOM   1530 C  C   . ALA A 1 200 ? 20.074 39.281 48.859 1.00 68.18  ? 373 ALA A C   1 
ATOM   1531 O  O   . ALA A 1 200 ? 20.648 38.749 49.811 1.00 68.20  ? 373 ALA A O   1 
ATOM   1532 C  CB  . ALA A 1 200 ? 21.374 39.400 46.734 1.00 67.98  ? 373 ALA A CB  1 
ATOM   1533 N  N   . GLU A 1 201 ? 19.301 40.363 48.981 1.00 68.66  ? 374 GLU A N   1 
ATOM   1534 C  CA  . GLU A 1 201 ? 19.002 40.947 50.292 1.00 69.45  ? 374 GLU A CA  1 
ATOM   1535 C  C   . GLU A 1 201 ? 18.326 39.889 51.154 1.00 69.42  ? 374 GLU A C   1 
ATOM   1536 O  O   . GLU A 1 201 ? 18.800 39.583 52.261 1.00 69.58  ? 374 GLU A O   1 
ATOM   1537 C  CB  . GLU A 1 201 ? 18.117 42.202 50.174 1.00 69.86  ? 374 GLU A CB  1 
ATOM   1538 C  CG  . GLU A 1 201 ? 18.890 43.540 50.225 1.00 72.46  ? 374 GLU A CG  1 
ATOM   1539 C  CD  . GLU A 1 201 ? 18.050 44.783 49.824 1.00 74.59  ? 374 GLU A CD  1 
ATOM   1540 O  OE1 . GLU A 1 201 ? 16.842 44.836 50.148 1.00 75.58  ? 374 GLU A OE1 1 
ATOM   1541 O  OE2 . GLU A 1 201 ? 18.613 45.720 49.197 1.00 73.96  ? 374 GLU A OE2 1 
ATOM   1542 N  N   . LEU A 1 202 ? 17.249 39.312 50.614 1.00 69.38  ? 375 LEU A N   1 
ATOM   1543 C  CA  . LEU A 1 202 ? 16.481 38.271 51.289 1.00 69.17  ? 375 LEU A CA  1 
ATOM   1544 C  C   . LEU A 1 202 ? 17.311 37.033 51.628 1.00 69.46  ? 375 LEU A C   1 
ATOM   1545 O  O   . LEU A 1 202 ? 17.152 36.446 52.695 1.00 69.68  ? 375 LEU A O   1 
ATOM   1546 C  CB  . LEU A 1 202 ? 15.298 37.858 50.429 1.00 69.02  ? 375 LEU A CB  1 
ATOM   1547 C  CG  . LEU A 1 202 ? 14.255 36.978 51.111 1.00 68.57  ? 375 LEU A CG  1 
ATOM   1548 C  CD1 . LEU A 1 202 ? 13.202 37.832 51.791 1.00 68.91  ? 375 LEU A CD1 1 
ATOM   1549 C  CD2 . LEU A 1 202 ? 13.609 36.057 50.098 1.00 67.35  ? 375 LEU A CD2 1 
ATOM   1550 N  N   . ALA A 1 203 ? 18.190 36.625 50.727 1.00 69.77  ? 376 ALA A N   1 
ATOM   1551 C  CA  . ALA A 1 203 ? 19.029 35.480 51.011 1.00 70.39  ? 376 ALA A CA  1 
ATOM   1552 C  C   . ALA A 1 203 ? 19.985 35.782 52.162 1.00 71.17  ? 376 ALA A C   1 
ATOM   1553 O  O   . ALA A 1 203 ? 20.138 34.955 53.064 1.00 71.45  ? 376 ALA A O   1 
ATOM   1554 C  CB  . ALA A 1 203 ? 19.786 35.041 49.779 1.00 70.22  ? 376 ALA A CB  1 
ATOM   1555 N  N   . ASN A 1 204 ? 20.608 36.963 52.154 1.00 72.20  ? 377 ASN A N   1 
ATOM   1556 C  CA  . ASN A 1 204 ? 21.630 37.278 53.167 1.00 73.23  ? 377 ASN A CA  1 
ATOM   1557 C  C   . ASN A 1 204 ? 21.043 37.593 54.550 1.00 73.38  ? 377 ASN A C   1 
ATOM   1558 O  O   . ASN A 1 204 ? 21.306 38.653 55.133 1.00 73.53  ? 377 ASN A O   1 
ATOM   1559 C  CB  . ASN A 1 204 ? 22.591 38.379 52.689 1.00 73.54  ? 377 ASN A CB  1 
ATOM   1560 C  CG  . ASN A 1 204 ? 23.547 37.890 51.599 1.00 75.26  ? 377 ASN A CG  1 
ATOM   1561 O  OD1 . ASN A 1 204 ? 24.297 36.920 51.787 1.00 77.23  ? 377 ASN A OD1 1 
ATOM   1562 N  ND2 . ASN A 1 204 ? 23.521 38.564 50.449 1.00 76.37  ? 377 ASN A ND2 1 
ATOM   1563 N  N   . ARG A 1 205 ? 20.231 36.652 55.039 1.00 73.64  ? 378 ARG A N   1 
ATOM   1564 C  CA  . ARG A 1 205 ? 19.680 36.641 56.399 1.00 73.93  ? 378 ARG A CA  1 
ATOM   1565 C  C   . ARG A 1 205 ? 18.876 35.343 56.661 1.00 73.94  ? 378 ARG A C   1 
ATOM   1566 O  O   . ARG A 1 205 ? 19.206 34.276 56.129 1.00 73.79  ? 378 ARG A O   1 
ATOM   1567 C  CB  . ARG A 1 205 ? 18.862 37.916 56.711 1.00 74.06  ? 378 ARG A CB  1 
ATOM   1568 C  CG  . ARG A 1 205 ? 17.877 38.386 55.634 1.00 74.66  ? 378 ARG A CG  1 
ATOM   1569 C  CD  . ARG A 1 205 ? 17.057 39.592 56.138 1.00 76.65  ? 378 ARG A CD  1 
ATOM   1570 N  NE  . ARG A 1 205 ? 16.387 40.344 55.068 1.00 77.30  ? 378 ARG A NE  1 
ATOM   1571 C  CZ  . ARG A 1 205 ? 15.138 40.115 54.637 1.00 77.27  ? 378 ARG A CZ  1 
ATOM   1572 N  NH1 . ARG A 1 205 ? 14.394 39.141 55.179 1.00 76.39  ? 378 ARG A NH1 1 
ATOM   1573 N  NH2 . ARG A 1 205 ? 14.634 40.860 53.653 1.00 77.09  ? 378 ARG A NH2 1 
HETATM 1574 PR PR  . PR  B 2 .   ? 41.388 41.388 14.811 0.25 113.91 ? 1   PR  A PR  1 
HETATM 1575 PR PR  . PR  C 2 .   ? 7.224  23.134 19.925 1.00 136.20 ? 2   PR  A PR  1 
HETATM 1576 PR PR  . PR  D 2 .   ? 14.792 13.926 11.296 1.00 167.27 ? 3   PR  A PR  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   49  ?   ?   ?   A . n 
A 1 2   SER 2   50  ?   ?   ?   A . n 
A 1 3   HIS 3   51  ?   ?   ?   A . n 
A 1 4   MET 4   52  ?   ?   ?   A . n 
A 1 5   ARG 5   53  ?   ?   ?   A . n 
A 1 6   LYS 6   54  ?   ?   ?   A . n 
A 1 7   ILE 7   55  55  ILE ILE A . n 
A 1 8   GLN 8   56  56  GLN GLN A . n 
A 1 9   ARG 9   57  57  ARG ARG A . n 
A 1 10  TYR 10  58  58  TYR TYR A . n 
A 1 11  VAL 11  59  59  VAL VAL A . n 
A 1 12  ARG 12  60  60  ARG ARG A . n 
A 1 13  LYS 13  61  61  LYS LYS A . n 
A 1 14  ASP 14  62  62  ASP ASP A . n 
A 1 15  GLY 15  63  63  GLY GLY A . n 
A 1 16  LYS 16  64  64  LYS LYS A . n 
A 1 17  CYS 17  65  65  CYS CYS A . n 
A 1 18  ASN 18  66  66  ASN ASN A . n 
A 1 19  VAL 19  67  67  VAL VAL A . n 
A 1 20  HIS 20  68  68  HIS HIS A . n 
A 1 21  HIS 21  69  69  HIS HIS A . n 
A 1 22  GLY 22  70  70  GLY GLY A . n 
A 1 23  ASN 23  71  71  ASN ASN A . n 
A 1 24  VAL 24  72  72  VAL VAL A . n 
A 1 25  ARG 25  73  73  ARG ARG A . n 
A 1 26  GLU 26  74  ?   ?   ?   A . n 
A 1 27  LYS 27  200 ?   ?   ?   A . n 
A 1 28  ARG 28  201 ?   ?   ?   A . n 
A 1 29  ALA 29  202 202 ALA ALA A . n 
A 1 30  GLU 30  203 203 GLU GLU A . n 
A 1 31  THR 31  204 204 THR THR A . n 
A 1 32  LEU 32  205 205 LEU LEU A . n 
A 1 33  VAL 33  206 206 VAL VAL A . n 
A 1 34  PHE 34  207 207 PHE PHE A . n 
A 1 35  SER 35  208 208 SER SER A . n 
A 1 36  THR 36  209 209 THR THR A . n 
A 1 37  HIS 37  210 210 HIS HIS A . n 
A 1 38  ALA 38  211 211 ALA ALA A . n 
A 1 39  VAL 39  212 212 VAL VAL A . n 
A 1 40  ILE 40  213 213 ILE ILE A . n 
A 1 41  SER 41  214 214 SER SER A . n 
A 1 42  MET 42  215 215 MET MET A . n 
A 1 43  ARG 43  216 216 ARG ARG A . n 
A 1 44  ASP 44  217 217 ASP ASP A . n 
A 1 45  GLY 45  218 218 GLY GLY A . n 
A 1 46  LYS 46  219 219 LYS LYS A . n 
A 1 47  LEU 47  220 220 LEU LEU A . n 
A 1 48  CYS 48  221 221 CYS CYS A . n 
A 1 49  LEU 49  222 222 LEU LEU A . n 
A 1 50  MET 50  223 223 MET MET A . n 
A 1 51  PHE 51  224 224 PHE PHE A . n 
A 1 52  ARG 52  225 225 ARG ARG A . n 
A 1 53  VAL 53  226 226 VAL VAL A . n 
A 1 54  GLY 54  227 227 GLY GLY A . n 
A 1 55  ASP 55  228 228 ASP ASP A . n 
A 1 56  LEU 56  229 229 LEU LEU A . n 
A 1 57  ARG 57  230 230 ARG ARG A . n 
A 1 58  ASN 58  231 231 ASN ASN A . n 
A 1 59  SER 59  232 232 SER SER A . n 
A 1 60  HIS 60  233 233 HIS HIS A . n 
A 1 61  ILE 61  234 234 ILE ILE A . n 
A 1 62  VAL 62  235 235 VAL VAL A . n 
A 1 63  GLU 63  236 236 GLU GLU A . n 
A 1 64  ALA 64  237 237 ALA ALA A . n 
A 1 65  SER 65  238 238 SER SER A . n 
A 1 66  ILE 66  239 239 ILE ILE A . n 
A 1 67  ARG 67  240 240 ARG ARG A . n 
A 1 68  ALA 68  241 241 ALA ALA A . n 
A 1 69  LYS 69  242 242 LYS LYS A . n 
A 1 70  LEU 70  243 243 LEU LEU A . n 
A 1 71  ILE 71  244 244 ILE ILE A . n 
A 1 72  LYS 72  245 245 LYS LYS A . n 
A 1 73  SER 73  246 246 SER SER A . n 
A 1 74  LYS 74  247 247 LYS LYS A . n 
A 1 75  GLN 75  248 248 GLN GLN A . n 
A 1 76  THR 76  249 249 THR THR A . n 
A 1 77  SER 77  250 250 SER SER A . n 
A 1 78  GLU 78  251 251 GLU GLU A . n 
A 1 79  GLY 79  252 252 GLY GLY A . n 
A 1 80  GLU 80  253 253 GLU GLU A . n 
A 1 81  PHE 81  254 254 PHE PHE A . n 
A 1 82  ILE 82  255 255 ILE ILE A . n 
A 1 83  PRO 83  256 256 PRO PRO A . n 
A 1 84  LEU 84  257 257 LEU LEU A . n 
A 1 85  ASN 85  258 258 ASN ASN A . n 
A 1 86  GLN 86  259 259 GLN GLN A . n 
A 1 87  THR 87  260 260 THR THR A . n 
A 1 88  ASP 88  261 261 ASP ASP A . n 
A 1 89  ILE 89  262 262 ILE ILE A . n 
A 1 90  ASN 90  263 263 ASN ASN A . n 
A 1 91  VAL 91  264 264 VAL VAL A . n 
A 1 92  GLY 92  265 265 GLY GLY A . n 
A 1 93  TYR 93  266 266 TYR TYR A . n 
A 1 94  TYR 94  267 267 TYR TYR A . n 
A 1 95  THR 95  268 268 THR THR A . n 
A 1 96  GLY 96  269 269 GLY GLY A . n 
A 1 97  ASP 97  270 270 ASP ASP A . n 
A 1 98  ASP 98  271 271 ASP ASP A . n 
A 1 99  ARG 99  272 272 ARG ARG A . n 
A 1 100 LEU 100 273 273 LEU LEU A . n 
A 1 101 PHE 101 274 274 PHE PHE A . n 
A 1 102 LEU 102 275 275 LEU LEU A . n 
A 1 103 VAL 103 276 276 VAL VAL A . n 
A 1 104 SER 104 277 277 SER SER A . n 
A 1 105 PRO 105 278 278 PRO PRO A . n 
A 1 106 LEU 106 279 279 LEU LEU A . n 
A 1 107 ILE 107 280 280 ILE ILE A . n 
A 1 108 ILE 108 281 281 ILE ILE A . n 
A 1 109 SER 109 282 282 SER SER A . n 
A 1 110 HIS 110 283 283 HIS HIS A . n 
A 1 111 GLU 111 284 284 GLU GLU A . n 
A 1 112 ILE 112 285 285 ILE ILE A . n 
A 1 113 ASN 113 286 286 ASN ASN A . n 
A 1 114 GLN 114 287 287 GLN GLN A . n 
A 1 115 GLN 115 288 288 GLN GLN A . n 
A 1 116 SER 116 289 289 SER SER A . n 
A 1 117 PRO 117 290 290 PRO PRO A . n 
A 1 118 PHE 118 291 291 PHE PHE A . n 
A 1 119 TRP 119 292 292 TRP TRP A . n 
A 1 120 GLU 120 293 293 GLU GLU A . n 
A 1 121 ILE 121 294 294 ILE ILE A . n 
A 1 122 SER 122 295 295 SER SER A . n 
A 1 123 LYS 123 296 296 LYS LYS A . n 
A 1 124 ALA 124 297 297 ALA ALA A . n 
A 1 125 GLN 125 298 298 GLN GLN A . n 
A 1 126 LEU 126 299 299 LEU LEU A . n 
A 1 127 PRO 127 300 300 PRO PRO A . n 
A 1 128 LYS 128 301 301 LYS LYS A . n 
A 1 129 GLU 129 302 302 GLU GLU A . n 
A 1 130 GLU 130 303 303 GLU GLU A . n 
A 1 131 LEU 131 304 304 LEU LEU A . n 
A 1 132 GLU 132 305 305 GLU GLU A . n 
A 1 133 ILE 133 306 306 ILE ILE A . n 
A 1 134 VAL 134 307 307 VAL VAL A . n 
A 1 135 VAL 135 308 308 VAL VAL A . n 
A 1 136 ILE 136 309 309 ILE ILE A . n 
A 1 137 LEU 137 310 310 LEU LEU A . n 
A 1 138 GLU 138 311 311 GLU GLU A . n 
A 1 139 GLY 139 312 312 GLY GLY A . n 
A 1 140 MET 140 313 313 MET MET A . n 
A 1 141 VAL 141 314 314 VAL VAL A . n 
A 1 142 GLU 142 315 315 GLU GLU A . n 
A 1 143 ALA 143 316 316 ALA ALA A . n 
A 1 144 THR 144 317 317 THR THR A . n 
A 1 145 GLY 145 318 318 GLY GLY A . n 
A 1 146 MET 146 319 319 MET MET A . n 
A 1 147 THR 147 320 320 THR THR A . n 
A 1 148 CYS 148 321 321 CYS CYS A . n 
A 1 149 GLN 149 322 322 GLN GLN A . n 
A 1 150 ALA 150 323 323 ALA ALA A . n 
A 1 151 ARG 151 324 324 ARG ARG A . n 
A 1 152 SER 152 325 325 SER SER A . n 
A 1 153 SER 153 326 326 SER SER A . n 
A 1 154 TYR 154 327 327 TYR TYR A . n 
A 1 155 ILE 155 328 328 ILE ILE A . n 
A 1 156 THR 156 329 329 THR THR A . n 
A 1 157 SER 157 330 330 SER SER A . n 
A 1 158 GLU 158 331 331 GLU GLU A . n 
A 1 159 ILE 159 332 332 ILE ILE A . n 
A 1 160 LEU 160 333 333 LEU LEU A . n 
A 1 161 TRP 161 334 334 TRP TRP A . n 
A 1 162 GLY 162 335 335 GLY GLY A . n 
A 1 163 TYR 163 336 336 TYR TYR A . n 
A 1 164 ARG 164 337 337 ARG ARG A . n 
A 1 165 PHE 165 338 338 PHE PHE A . n 
A 1 166 THR 166 339 339 THR THR A . n 
A 1 167 PRO 167 340 340 PRO PRO A . n 
A 1 168 VAL 168 341 341 VAL VAL A . n 
A 1 169 LEU 169 342 342 LEU LEU A . n 
A 1 170 THR 170 343 343 THR THR A . n 
A 1 171 LEU 171 344 344 LEU LEU A . n 
A 1 172 GLU 172 345 345 GLU GLU A . n 
A 1 173 ASP 173 346 346 ASP ASP A . n 
A 1 174 GLY 174 347 347 GLY GLY A . n 
A 1 175 PHE 175 348 348 PHE PHE A . n 
A 1 176 TYR 176 349 349 TYR TYR A . n 
A 1 177 GLU 177 350 350 GLU GLU A . n 
A 1 178 VAL 178 351 351 VAL VAL A . n 
A 1 179 ASP 179 352 352 ASP ASP A . n 
A 1 180 TYR 180 353 353 TYR TYR A . n 
A 1 181 ASN 181 354 354 ASN ASN A . n 
A 1 182 SER 182 355 355 SER SER A . n 
A 1 183 PHE 183 356 356 PHE PHE A . n 
A 1 184 HIS 184 357 357 HIS HIS A . n 
A 1 185 GLU 185 358 358 GLU GLU A . n 
A 1 186 THR 186 359 359 THR THR A . n 
A 1 187 TYR 187 360 360 TYR TYR A . n 
A 1 188 GLU 188 361 361 GLU GLU A . n 
A 1 189 THR 189 362 362 THR THR A . n 
A 1 190 SER 190 363 363 SER SER A . n 
A 1 191 THR 191 364 364 THR THR A . n 
A 1 192 PRO 192 365 365 PRO PRO A . n 
A 1 193 SER 193 366 366 SER SER A . n 
A 1 194 LEU 194 367 367 LEU LEU A . n 
A 1 195 SER 195 368 368 SER SER A . n 
A 1 196 ALA 196 369 369 ALA ALA A . n 
A 1 197 LYS 197 370 370 LYS LYS A . n 
A 1 198 GLU 198 371 371 GLU GLU A . n 
A 1 199 LEU 199 372 372 LEU LEU A . n 
A 1 200 ALA 200 373 373 ALA ALA A . n 
A 1 201 GLU 201 374 374 GLU GLU A . n 
A 1 202 LEU 202 375 375 LEU LEU A . n 
A 1 203 ALA 203 376 376 ALA ALA A . n 
A 1 204 ASN 204 377 377 ASN ASN A . n 
A 1 205 ARG 205 378 378 ARG ARG A . n 
A 1 206 ALA 206 379 ?   ?   ?   A . n 
A 1 207 GLU 207 380 ?   ?   ?   A . n 
A 1 208 LEU 208 381 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PR 1 1 1 PR PR A . 
C 2 PR 1 2 2 PR PR A . 
D 2 PR 1 3 3 PR PR A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12270 ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  34900 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  1.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000  0.0000000000 82.7750000000 0.0000000000  
-1.0000000000 0.0000000000 82.7750000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_655 -y+1,x,z    0.0000000000  -1.0000000000 0.0000000000 82.7750000000 1.0000000000  0.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_565 y,-x+1,z    0.0000000000  1.0000000000  0.0000000000 0.0000000000  -1.0000000000 0.0000000000 
0.0000000000 82.7750000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    PR 
_pdbx_struct_special_symmetry.auth_seq_id     1 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   B 
_pdbx_struct_special_symmetry.label_comp_id   PR 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OE2 ? A GLU 185 ? A GLU 358 ? 1_555 PR ? C PR . ? A PR 2 ? 1_555 OE1 ? A GLU 185 ? A GLU 358 ? 1_555 44.9 ? 
2 OE2 ? A GLU 185 ? A GLU 358 ? 1_555 PR ? C PR . ? A PR 2 ? 1_555 OG  ? A SER 182 ? A SER 355 ? 1_555 74.9 ? 
3 OE1 ? A GLU 185 ? A GLU 358 ? 1_555 PR ? C PR . ? A PR 2 ? 1_555 OG  ? A SER 182 ? A SER 355 ? 1_555 70.3 ? 
4 OE2 ? A GLU 63  ? A GLU 236 ? 1_555 PR ? B PR . ? A PR 1 ? 1_555 OE1 ? A GLU 63  ? A GLU 236 ? 1_555 40.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-10-19 
2 'Structure model' 1 1 2013-06-05 
3 'Structure model' 1 2 2017-08-16 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' Advisory                 
3 3 'Structure model' 'Refinement description' 
4 3 'Structure model' 'Source and taxonomy'    
5 4 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen               
2 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 
3 3 'Structure model' software                     
4 4 'Structure model' software                     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .        ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 MOLREP      .        ?               program 'Alexei Vaguine'     alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html  Fortran_77 ? 
3 REFMAC      5.5.0109 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.10     'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 DENZO       .        ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 66  ? ? -102.68 64.82  
2 1 HIS A 69  ? ? -37.84  118.94 
3 1 GLU A 236 ? ? 35.44   35.37  
4 1 PRO A 290 ? ? -54.26  -9.62  
5 1 ALA A 316 ? ? -53.16  -71.45 
6 1 SER A 330 ? ? -65.67  4.73   
7 1 ASP A 352 ? ? -68.49  89.27  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 49  ? A GLY 1   
2  1 Y 1 A SER 50  ? A SER 2   
3  1 Y 1 A HIS 51  ? A HIS 3   
4  1 Y 1 A MET 52  ? A MET 4   
5  1 Y 1 A ARG 53  ? A ARG 5   
6  1 Y 1 A LYS 54  ? A LYS 6   
7  1 Y 1 A GLU 74  ? A GLU 26  
8  1 Y 1 A LYS 200 ? A LYS 27  
9  1 Y 1 A ARG 201 ? A ARG 28  
10 1 Y 1 A ALA 379 ? A ALA 206 
11 1 Y 1 A GLU 380 ? A GLU 207 
12 1 Y 1 A LEU 381 ? A LEU 208 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'PRASEODYMIUM ION' 
_pdbx_entity_nonpoly.comp_id     PR 
#