data_3ATF
# 
_entry.id   3ATF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ATF         
RCSB  RCSB029672   
WWPDB D_1000029672 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3agw . unspecified 
PDB 2e4f . unspecified 
PDB 3AT8 . unspecified 
PDB 3AT9 . unspecified 
PDB 3ATA . unspecified 
PDB 3ATB . unspecified 
PDB 3ATD . unspecified 
PDB 3ATE . unspecified 
# 
_pdbx_database_status.entry_id                        3ATF 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-28 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Inanobe, A.' 1 
'Kurachi, Y.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                41801 
_citation.page_last                 41811 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21982822 
_citation.pdbx_database_id_DOI      10.1074/jbc.M111.278531 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Inanobe, A.'  1 
primary 'Nakagawa, A.' 2 
primary 'Kurachi, Y.'  3 
# 
_cell.length_a           81.732 
_cell.length_b           81.732 
_cell.length_c           172.125 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3ATF 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.entry_id                         3ATF 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                97 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Potassium inwardly-rectifying channel, subfamily J, member 6' 23748.988 1  ? ? 'RESIDUES 53-74, 200-381' 
;CYTOPLASMIC N- AND C-TERMINI (RESIDUES 53-74 AND 200-381, RESPECTIVELY) OF G-PROTEIN-GATED INWARD RECTIFIER POTASSIUM CHANNEL KIR3.2 ARE CONCATENATED DIRECTLY.
;
2 non-polymer syn 'CESIUM ION'                                                   132.905   2  ? ? ?                         ? 
3 non-polymer syn 'MAGNESIUM ION'                                                24.305    1  ? ? ?                         ? 
4 non-polymer syn ETHANOL                                                        46.068    2  ? ? ?                         ? 
5 water       nat water                                                          18.015    13 ? ? ?                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'G protein-activated inward rectifier potassium channel 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ARG n 
1 6   LYS n 
1 7   ILE n 
1 8   GLN n 
1 9   ARG n 
1 10  TYR n 
1 11  VAL n 
1 12  ARG n 
1 13  LYS n 
1 14  ASP n 
1 15  GLY n 
1 16  LYS n 
1 17  CYS n 
1 18  ASN n 
1 19  VAL n 
1 20  HIS n 
1 21  HIS n 
1 22  GLY n 
1 23  ASN n 
1 24  VAL n 
1 25  ARG n 
1 26  GLU n 
1 27  LYS n 
1 28  ARG n 
1 29  ALA n 
1 30  GLU n 
1 31  THR n 
1 32  LEU n 
1 33  VAL n 
1 34  PHE n 
1 35  SER n 
1 36  THR n 
1 37  HIS n 
1 38  ALA n 
1 39  VAL n 
1 40  ILE n 
1 41  SER n 
1 42  MET n 
1 43  ARG n 
1 44  ASP n 
1 45  GLY n 
1 46  LYS n 
1 47  LEU n 
1 48  CYS n 
1 49  LEU n 
1 50  MET n 
1 51  PHE n 
1 52  ARG n 
1 53  VAL n 
1 54  GLY n 
1 55  ASP n 
1 56  LEU n 
1 57  ARG n 
1 58  ASN n 
1 59  SER n 
1 60  HIS n 
1 61  ILE n 
1 62  VAL n 
1 63  GLU n 
1 64  ALA n 
1 65  SER n 
1 66  ILE n 
1 67  ARG n 
1 68  ALA n 
1 69  LYS n 
1 70  LEU n 
1 71  ILE n 
1 72  LYS n 
1 73  SER n 
1 74  LYS n 
1 75  GLN n 
1 76  THR n 
1 77  SER n 
1 78  GLU n 
1 79  GLY n 
1 80  GLU n 
1 81  PHE n 
1 82  ILE n 
1 83  PRO n 
1 84  LEU n 
1 85  ASN n 
1 86  GLN n 
1 87  THR n 
1 88  ASP n 
1 89  ILE n 
1 90  ASN n 
1 91  VAL n 
1 92  GLY n 
1 93  TYR n 
1 94  TYR n 
1 95  THR n 
1 96  GLY n 
1 97  ASP n 
1 98  ASP n 
1 99  ARG n 
1 100 LEU n 
1 101 PHE n 
1 102 LEU n 
1 103 VAL n 
1 104 SER n 
1 105 PRO n 
1 106 LEU n 
1 107 ILE n 
1 108 ILE n 
1 109 SER n 
1 110 HIS n 
1 111 GLU n 
1 112 ILE n 
1 113 ASN n 
1 114 GLN n 
1 115 GLN n 
1 116 SER n 
1 117 PRO n 
1 118 PHE n 
1 119 TRP n 
1 120 GLU n 
1 121 ILE n 
1 122 SER n 
1 123 LYS n 
1 124 ALA n 
1 125 GLN n 
1 126 LEU n 
1 127 PRO n 
1 128 LYS n 
1 129 GLU n 
1 130 GLU n 
1 131 LEU n 
1 132 GLU n 
1 133 ILE n 
1 134 VAL n 
1 135 VAL n 
1 136 ILE n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 MET n 
1 141 VAL n 
1 142 GLU n 
1 143 ALA n 
1 144 THR n 
1 145 GLY n 
1 146 MET n 
1 147 THR n 
1 148 CYS n 
1 149 GLN n 
1 150 ALA n 
1 151 ARG n 
1 152 SER n 
1 153 SER n 
1 154 TYR n 
1 155 ILE n 
1 156 THR n 
1 157 SER n 
1 158 GLU n 
1 159 ILE n 
1 160 LEU n 
1 161 TRP n 
1 162 GLY n 
1 163 TYR n 
1 164 ARG n 
1 165 PHE n 
1 166 THR n 
1 167 PRO n 
1 168 VAL n 
1 169 LEU n 
1 170 THR n 
1 171 LEU n 
1 172 GLU n 
1 173 ASP n 
1 174 GLY n 
1 175 PHE n 
1 176 TYR n 
1 177 GLU n 
1 178 VAL n 
1 179 ASP n 
1 180 TYR n 
1 181 ASN n 
1 182 SER n 
1 183 PHE n 
1 184 HIS n 
1 185 GLU n 
1 186 THR n 
1 187 TYR n 
1 188 GLU n 
1 189 THR n 
1 190 SER n 
1 191 THR n 
1 192 PRO n 
1 193 SER n 
1 194 LEU n 
1 195 SER n 
1 196 ALA n 
1 197 LYS n 
1 198 GLU n 
1 199 LEU n 
1 200 ALA n 
1 201 GLU n 
1 202 LEU n 
1 203 ALA n 
1 204 ASN n 
1 205 ARG n 
1 206 ALA n 
1 207 GLU n 
1 208 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 5  26  mouse ? ? ? Balb/c ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'ROSSETA2 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
1 2 sample ? 27 208 mouse ? ? ? Balb/c ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'ROSSETA2 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q0VB45_MOUSE 
_struct_ref.pdbx_db_accession          Q0VB45 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RKIQRYVRKDGKCNVHHGNVRE 
_struct_ref.pdbx_align_begin           53 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ATF A 5  ? 26  ? Q0VB45 53  ? 74  ? 53  74  
2 1 3ATF A 27 ? 208 ? Q0VB45 200 ? 381 ? 200 381 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ATF GLY A 1 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 49 1 
1 3ATF SER A 2 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 50 2 
1 3ATF HIS A 3 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 51 3 
1 3ATF MET A 4 ? UNP Q0VB45 ? ? 'EXPRESSION TAG' 52 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CS  non-polymer         . 'CESIUM ION'    ? 'Cs 1'           132.905 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
EOH non-polymer         . ETHANOL         ? 'C2 H6 O'        46.068  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3ATF 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.03 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   59.35 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'hanging drop' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    'Ethanol, pH 8.0, hanging drop, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2010-02-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'double crystal' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.6000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44XU' 
_diffrn_source.pdbx_wavelength_list        1.6000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL44XU 
# 
_reflns.entry_id                     3ATF 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            2.95 
_reflns.d_resolution_low             50.00 
_reflns.number_all                   338695 
_reflns.number_obs                   338691 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.118 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        48.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              52.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.95 
_reflns_shell.d_res_low                   3.06 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.percent_possible_all        99.5 
_reflns_shell.Rmerge_I_obs                0.558 
_reflns_shell.meanI_over_sigI_obs         5.88 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_redundancy             31.1 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3ATF 
_refine.ls_d_res_high                            2.9500 
_refine.ls_d_res_low                             47.98 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.8000 
_refine.ls_number_reflns_obs                     6475 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2274 
_refine.ls_R_factor_R_work                       0.2231 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2810 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 7.6000 
_refine.ls_number_reflns_R_free                  490 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               44.7397 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.4100 
_refine.aniso_B[2][2]                            0.4100 
_refine.aniso_B[3][3]                            -0.8200 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.8970 
_refine.correlation_coeff_Fo_to_Fc_free          0.8630 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  0.4370 
_refine.overall_SU_ML                            0.3100 
_refine.overall_SU_B                             16.5860 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                161.760 
_refine.B_iso_min                                10.750 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.250 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1546 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             13 
_refine_hist.number_atoms_total               1568 
_refine_hist.d_res_high                       2.9500 
_refine_hist.d_res_low                        47.98 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       1587 0.012  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    2144 1.310  1.956  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 193  6.316  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 75   34.585 23.867 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 283  18.301 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 11   15.127 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         242  0.080  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   1187 0.006  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            964  0.654  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1565 1.255  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            623  1.471  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           578  2.621  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.9520 
_refine_ls_shell.d_res_low                        3.0290 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               97.8600 
_refine_ls_shell.number_reflns_R_work             413 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3260 
_refine_ls_shell.R_factor_R_free                  0.3500 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             44 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                457 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3ATF 
_struct.title                     
'Crystal Structure of the Kir3.2 Cytoplasmic Domain (Na+-free crystal soaked in 200 mM Cesium chloride)' 
_struct.pdbx_descriptor           'Potassium inwardly-rectifying channel, subfamily J, member 6' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ATF 
_struct_keywords.text            
'Cytoplasmic assembly, beta-barrel, ion transport, G protein beta-gamma subunits, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 125 ? GLU A 129 ? GLN A 298 GLU A 302 5 ? 5  
HELX_P HELX_P2 2 SER A 195 ? ASN A 204 ? SER A 368 ASN A 377 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A SER 65  OG ? ? ? 1_555 C CS  . CS ? ? A SER 238 A CS  2 1_555 ? ? ? ? ? ? ? 2.852 ? 
metalc2 metalc ? ? A GLU 63  O  ? ? ? 1_555 C CS  . CS ? ? A GLU 236 A CS  2 1_555 ? ? ? ? ? ? ? 2.987 ? 
metalc3 metalc ? ? B CS  .   CS ? ? ? 1_555 G HOH . O  ? ? A CS  1   A HOH 8 1_555 ? ? ? ? ? ? ? 3.309 ? 
metalc4 metalc ? ? A GLU 138 O  ? ? ? 1_555 C CS  . CS ? ? A GLU 311 A CS  2 1_555 ? ? ? ? ? ? ? 3.474 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 4 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 106 ? GLU A 111 ? LEU A 279 GLU A 284 
A 2 LYS A 46  ? VAL A 53  ? LYS A 219 VAL A 226 
A 3 ALA A 38  ? ARG A 43  ? ALA A 211 ARG A 216 
A 4 ILE A 159 ? TRP A 161 ? ILE A 332 TRP A 334 
B 1 GLN A 86  ? ILE A 89  ? GLN A 259 ILE A 262 
B 2 ILE A 61  ? ILE A 71  ? ILE A 234 ILE A 244 
B 3 ARG A 99  ? LEU A 100 ? ARG A 272 LEU A 273 
C 1 GLN A 86  ? ILE A 89  ? GLN A 259 ILE A 262 
C 2 ILE A 61  ? ILE A 71  ? ILE A 234 ILE A 244 
C 3 GLU A 132 ? VAL A 141 ? GLU A 305 VAL A 314 
C 4 THR A 147 ? ILE A 155 ? THR A 320 ILE A 328 
D 1 LYS A 74  ? GLN A 75  ? LYS A 247 GLN A 248 
D 2 PHE A 81  ? ILE A 82  ? PHE A 254 ILE A 255 
E 1 TYR A 163 ? PHE A 165 ? TYR A 336 PHE A 338 
E 2 THR A 186 ? GLU A 188 ? THR A 359 GLU A 361 
F 1 LEU A 169 ? GLU A 172 ? LEU A 342 GLU A 345 
F 2 PHE A 175 ? VAL A 178 ? PHE A 348 VAL A 351 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 110 ? O HIS A 283 N LEU A 49  ? N LEU A 222 
A 2 3 O MET A 50  ? O MET A 223 N VAL A 39  ? N VAL A 212 
A 3 4 N ALA A 38  ? N ALA A 211 O LEU A 160 ? O LEU A 333 
B 1 2 O THR A 87  ? O THR A 260 N LEU A 70  ? N LEU A 243 
B 2 3 N ALA A 64  ? N ALA A 237 O LEU A 100 ? O LEU A 273 
C 1 2 O THR A 87  ? O THR A 260 N LEU A 70  ? N LEU A 243 
C 2 3 N ILE A 71  ? N ILE A 244 O GLU A 132 ? O GLU A 305 
C 3 4 N ILE A 133 ? N ILE A 306 O TYR A 154 ? O TYR A 327 
D 1 2 N LYS A 74  ? N LYS A 247 O ILE A 82  ? O ILE A 255 
E 1 2 N ARG A 164 ? N ARG A 337 O TYR A 187 ? O TYR A 360 
F 1 2 N THR A 170 ? N THR A 343 O GLU A 177 ? O GLU A 350 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CS A 1'    
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CS A 2'    
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EOH A 383' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EOH A 384' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 TYR A 93  ? TYR A 266 . ? 1_555  ? 
2  AC1 2 TYR A 93  ? TYR A 266 . ? 3_555  ? 
3  AC2 3 GLU A 63  ? GLU A 236 . ? 1_555  ? 
4  AC2 3 SER A 65  ? SER A 238 . ? 1_555  ? 
5  AC2 3 GLU A 138 ? GLU A 311 . ? 1_555  ? 
6  AC3 5 SER A 190 ? SER A 363 . ? 16_555 ? 
7  AC3 5 SER A 190 ? SER A 363 . ? 1_555  ? 
8  AC3 5 THR A 191 ? THR A 364 . ? 16_555 ? 
9  AC3 5 PRO A 192 ? PRO A 365 . ? 1_555  ? 
10 AC3 5 PRO A 192 ? PRO A 365 . ? 16_555 ? 
11 AC4 3 ILE A 71  ? ILE A 244 . ? 1_555  ? 
12 AC4 3 LEU A 84  ? LEU A 257 . ? 1_555  ? 
13 AC4 3 GLU A 132 ? GLU A 305 . ? 1_555  ? 
# 
_atom_sites.entry_id                    3ATF 
_atom_sites.fract_transf_matrix[1][1]   0.012235 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012235 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005810 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CS 
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 8   ? 13.653 30.797  21.156 1.00 55.03  ? 56  GLN A N   1 
ATOM   2    C  CA  . GLN A 1 8   ? 13.878 30.348  19.747 1.00 55.73  ? 56  GLN A CA  1 
ATOM   3    C  C   . GLN A 1 8   ? 13.299 28.952  19.425 1.00 54.79  ? 56  GLN A C   1 
ATOM   4    O  O   . GLN A 1 8   ? 13.949 27.917  19.647 1.00 54.24  ? 56  GLN A O   1 
ATOM   5    C  CB  . GLN A 1 8   ? 15.368 30.409  19.407 1.00 56.36  ? 56  GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 8   ? 15.657 30.712  17.922 1.00 60.75  ? 56  GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 8   ? 15.378 32.181  17.517 1.00 66.21  ? 56  GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 8   ? 15.277 32.494  16.319 1.00 69.25  ? 56  GLN A OE1 1 
ATOM   9    N  NE2 . GLN A 1 8   ? 15.256 33.077  18.510 1.00 66.40  ? 56  GLN A NE2 1 
ATOM   10   N  N   . ARG A 1 9   ? 12.075 28.963  18.885 1.00 53.77  ? 57  ARG A N   1 
ATOM   11   C  CA  . ARG A 1 9   ? 11.244 27.777  18.650 1.00 52.39  ? 57  ARG A CA  1 
ATOM   12   C  C   . ARG A 1 9   ? 11.951 26.558  18.107 1.00 52.04  ? 57  ARG A C   1 
ATOM   13   O  O   . ARG A 1 9   ? 12.694 26.648  17.132 1.00 52.13  ? 57  ARG A O   1 
ATOM   14   C  CB  . ARG A 1 9   ? 10.165 28.111  17.636 1.00 52.20  ? 57  ARG A CB  1 
ATOM   15   C  CG  . ARG A 1 9   ? 8.936  28.682  18.212 1.00 51.65  ? 57  ARG A CG  1 
ATOM   16   C  CD  . ARG A 1 9   ? 7.806  28.555  17.232 1.00 50.82  ? 57  ARG A CD  1 
ATOM   17   N  NE  . ARG A 1 9   ? 6.650  29.318  17.684 1.00 50.89  ? 57  ARG A NE  1 
ATOM   18   C  CZ  . ARG A 1 9   ? 5.705  28.863  18.502 1.00 49.71  ? 57  ARG A CZ  1 
ATOM   19   N  NH1 . ARG A 1 9   ? 5.732  27.622  18.979 1.00 47.29  ? 57  ARG A NH1 1 
ATOM   20   N  NH2 . ARG A 1 9   ? 4.714  29.669  18.832 1.00 50.26  ? 57  ARG A NH2 1 
ATOM   21   N  N   . TYR A 1 10  ? 11.663 25.404  18.698 1.00 51.26  ? 58  TYR A N   1 
ATOM   22   C  CA  . TYR A 1 10  ? 12.103 24.144  18.131 1.00 50.47  ? 58  TYR A CA  1 
ATOM   23   C  C   . TYR A 1 10  ? 11.155 23.697  17.035 1.00 49.56  ? 58  TYR A C   1 
ATOM   24   O  O   . TYR A 1 10  ? 11.573 23.098  16.047 1.00 49.28  ? 58  TYR A O   1 
ATOM   25   C  CB  . TYR A 1 10  ? 12.146 23.081  19.203 1.00 50.93  ? 58  TYR A CB  1 
ATOM   26   C  CG  . TYR A 1 10  ? 12.896 21.835  18.808 1.00 52.74  ? 58  TYR A CG  1 
ATOM   27   C  CD1 . TYR A 1 10  ? 13.964 21.893  17.919 1.00 53.82  ? 58  TYR A CD1 1 
ATOM   28   C  CD2 . TYR A 1 10  ? 12.568 20.605  19.369 1.00 54.66  ? 58  TYR A CD2 1 
ATOM   29   C  CE1 . TYR A 1 10  ? 14.668 20.765  17.578 1.00 55.84  ? 58  TYR A CE1 1 
ATOM   30   C  CE2 . TYR A 1 10  ? 13.271 19.465  19.045 1.00 56.39  ? 58  TYR A CE2 1 
ATOM   31   C  CZ  . TYR A 1 10  ? 14.319 19.547  18.142 1.00 57.75  ? 58  TYR A CZ  1 
ATOM   32   O  OH  . TYR A 1 10  ? 15.016 18.400  17.799 1.00 60.48  ? 58  TYR A OH  1 
ATOM   33   N  N   . VAL A 1 11  ? 9.873  23.984  17.227 1.00 48.48  ? 59  VAL A N   1 
ATOM   34   C  CA  . VAL A 1 11  ? 8.855  23.602  16.273 1.00 47.59  ? 59  VAL A CA  1 
ATOM   35   C  C   . VAL A 1 11  ? 7.953  24.799  16.002 1.00 47.95  ? 59  VAL A C   1 
ATOM   36   O  O   . VAL A 1 11  ? 7.492  25.455  16.928 1.00 48.06  ? 59  VAL A O   1 
ATOM   37   C  CB  . VAL A 1 11  ? 8.019  22.412  16.789 1.00 46.92  ? 59  VAL A CB  1 
ATOM   38   C  CG1 . VAL A 1 11  ? 6.824  22.200  15.922 1.00 46.20  ? 59  VAL A CG1 1 
ATOM   39   C  CG2 . VAL A 1 11  ? 8.834  21.170  16.825 1.00 45.36  ? 59  VAL A CG2 1 
ATOM   40   N  N   . ARG A 1 12  ? 7.718  25.075  14.725 1.00 48.17  ? 60  ARG A N   1 
ATOM   41   C  CA  . ARG A 1 12  ? 6.855  26.170  14.283 1.00 48.45  ? 60  ARG A CA  1 
ATOM   42   C  C   . ARG A 1 12  ? 5.373  25.862  14.496 1.00 48.02  ? 60  ARG A C   1 
ATOM   43   O  O   . ARG A 1 12  ? 4.990  24.699  14.527 1.00 47.55  ? 60  ARG A O   1 
ATOM   44   C  CB  . ARG A 1 12  ? 7.126  26.461  12.800 1.00 48.83  ? 60  ARG A CB  1 
ATOM   45   C  CG  . ARG A 1 12  ? 8.524  27.016  12.512 1.00 50.52  ? 60  ARG A CG  1 
ATOM   46   C  CD  . ARG A 1 12  ? 8.516  27.914  11.299 1.00 55.06  ? 60  ARG A CD  1 
ATOM   47   N  NE  . ARG A 1 12  ? 8.884  27.189  10.087 1.00 59.65  ? 60  ARG A NE  1 
ATOM   48   C  CZ  . ARG A 1 12  ? 9.885  27.536  9.276  1.00 62.77  ? 60  ARG A CZ  1 
ATOM   49   N  NH1 . ARG A 1 12  ? 10.618 28.626  9.528  1.00 63.47  ? 60  ARG A NH1 1 
ATOM   50   N  NH2 . ARG A 1 12  ? 10.144 26.801  8.191  1.00 63.18  ? 60  ARG A NH2 1 
ATOM   51   N  N   . LYS A 1 13  ? 4.542  26.900  14.617 1.00 47.92  ? 61  LYS A N   1 
ATOM   52   C  CA  . LYS A 1 13  ? 3.096  26.696  14.853 1.00 47.85  ? 61  LYS A CA  1 
ATOM   53   C  C   . LYS A 1 13  ? 2.446  25.748  13.861 1.00 47.89  ? 61  LYS A C   1 
ATOM   54   O  O   . LYS A 1 13  ? 1.466  25.090  14.193 1.00 48.07  ? 61  LYS A O   1 
ATOM   55   C  CB  . LYS A 1 13  ? 2.300  28.011  14.868 1.00 47.56  ? 61  LYS A CB  1 
ATOM   56   C  CG  . LYS A 1 13  ? 2.809  29.059  15.836 1.00 47.47  ? 61  LYS A CG  1 
ATOM   57   C  CD  . LYS A 1 13  ? 2.634  28.635  17.280 1.00 46.77  ? 61  LYS A CD  1 
ATOM   58   C  CE  . LYS A 1 13  ? 1.300  29.018  17.869 1.00 45.00  ? 61  LYS A CE  1 
ATOM   59   N  NZ  . LYS A 1 13  ? 1.340  28.725  19.314 1.00 43.37  ? 61  LYS A NZ  1 
ATOM   60   N  N   . ASP A 1 14  ? 2.983  25.685  12.646 1.00 48.06  ? 62  ASP A N   1 
ATOM   61   C  CA  . ASP A 1 14  ? 2.417  24.822  11.606 1.00 48.27  ? 62  ASP A CA  1 
ATOM   62   C  C   . ASP A 1 14  ? 2.998  23.413  11.578 1.00 48.01  ? 62  ASP A C   1 
ATOM   63   O  O   . ASP A 1 14  ? 2.598  22.602  10.751 1.00 47.72  ? 62  ASP A O   1 
ATOM   64   C  CB  . ASP A 1 14  ? 2.540  25.463  10.220 1.00 48.70  ? 62  ASP A CB  1 
ATOM   65   C  CG  . ASP A 1 14  ? 3.976  25.677  9.794  1.00 49.39  ? 62  ASP A CG  1 
ATOM   66   O  OD1 . ASP A 1 14  ? 4.863  25.634  10.670 1.00 51.76  ? 62  ASP A OD1 1 
ATOM   67   O  OD2 . ASP A 1 14  ? 4.214  25.897  8.588  1.00 49.12  ? 62  ASP A OD2 1 
ATOM   68   N  N   . GLY A 1 15  ? 3.940  23.135  12.473 1.00 47.96  ? 63  GLY A N   1 
ATOM   69   C  CA  . GLY A 1 15  ? 4.448  21.782  12.645 1.00 48.24  ? 63  GLY A CA  1 
ATOM   70   C  C   . GLY A 1 15  ? 5.764  21.461  11.959 1.00 48.72  ? 63  GLY A C   1 
ATOM   71   O  O   . GLY A 1 15  ? 6.294  20.358  12.109 1.00 48.70  ? 63  GLY A O   1 
ATOM   72   N  N   . LYS A 1 16  ? 6.293  22.409  11.192 1.00 49.25  ? 64  LYS A N   1 
ATOM   73   C  CA  . LYS A 1 16  ? 7.603  22.241  10.575 1.00 49.59  ? 64  LYS A CA  1 
ATOM   74   C  C   . LYS A 1 16  ? 8.647  22.518  11.646 1.00 49.50  ? 64  LYS A C   1 
ATOM   75   O  O   . LYS A 1 16  ? 8.440  23.365  12.500 1.00 49.24  ? 64  LYS A O   1 
ATOM   76   C  CB  . LYS A 1 16  ? 7.776  23.195  9.393  1.00 49.70  ? 64  LYS A CB  1 
ATOM   77   C  CG  . LYS A 1 16  ? 6.660  23.162  8.349  1.00 51.35  ? 64  LYS A CG  1 
ATOM   78   C  CD  . LYS A 1 16  ? 7.072  23.938  7.069  1.00 54.61  ? 64  LYS A CD  1 
ATOM   79   C  CE  . LYS A 1 16  ? 5.886  24.299  6.121  1.00 55.50  ? 64  LYS A CE  1 
ATOM   80   N  NZ  . LYS A 1 16  ? 5.227  23.120  5.472  1.00 54.20  ? 64  LYS A NZ  1 
ATOM   81   N  N   . CYS A 1 17  ? 9.761  21.801  11.612 1.00 50.19  ? 65  CYS A N   1 
ATOM   82   C  CA  . CYS A 1 17  ? 10.793 21.952  12.645 1.00 51.08  ? 65  CYS A CA  1 
ATOM   83   C  C   . CYS A 1 17  ? 11.957 22.845  12.189 1.00 51.91  ? 65  CYS A C   1 
ATOM   84   O  O   . CYS A 1 17  ? 12.422 22.736  11.061 1.00 52.56  ? 65  CYS A O   1 
ATOM   85   C  CB  . CYS A 1 17  ? 11.342 20.574  13.042 1.00 50.78  ? 65  CYS A CB  1 
ATOM   86   S  SG  . CYS A 1 17  ? 10.048 19.400  13.480 1.00 50.05  ? 65  CYS A SG  1 
ATOM   87   N  N   . ASN A 1 18  ? 12.443 23.714  13.069 1.00 52.68  ? 66  ASN A N   1 
ATOM   88   C  CA  . ASN A 1 18  ? 13.606 24.553  12.753 1.00 53.22  ? 66  ASN A CA  1 
ATOM   89   C  C   . ASN A 1 18  ? 14.892 23.808  13.119 1.00 54.24  ? 66  ASN A C   1 
ATOM   90   O  O   . ASN A 1 18  ? 15.581 24.125  14.131 1.00 54.77  ? 66  ASN A O   1 
ATOM   91   C  CB  . ASN A 1 18  ? 13.527 25.864  13.518 1.00 52.71  ? 66  ASN A CB  1 
ATOM   92   C  CG  . ASN A 1 18  ? 12.162 26.519  13.376 1.00 52.46  ? 66  ASN A CG  1 
ATOM   93   O  OD1 . ASN A 1 18  ? 11.581 26.539  12.278 1.00 51.67  ? 66  ASN A OD1 1 
ATOM   94   N  ND2 . ASN A 1 18  ? 11.632 27.047  14.483 1.00 51.08  ? 66  ASN A ND2 1 
ATOM   95   N  N   . VAL A 1 19  ? 15.144 22.750  12.316 1.00 55.66  ? 67  VAL A N   1 
ATOM   96   C  CA  . VAL A 1 19  ? 16.341 21.903  12.429 1.00 56.84  ? 67  VAL A CA  1 
ATOM   97   C  C   . VAL A 1 19  ? 16.834 21.607  11.020 1.00 57.89  ? 67  VAL A C   1 
ATOM   98   O  O   . VAL A 1 19  ? 16.030 21.355  10.113 1.00 57.97  ? 67  VAL A O   1 
ATOM   99   C  CB  . VAL A 1 19  ? 16.090 20.526  13.111 1.00 56.63  ? 67  VAL A CB  1 
ATOM   100  C  CG1 . VAL A 1 19  ? 17.395 19.973  13.646 1.00 56.60  ? 67  VAL A CG1 1 
ATOM   101  C  CG2 . VAL A 1 19  ? 15.067 20.604  14.222 1.00 56.72  ? 67  VAL A CG2 1 
ATOM   102  N  N   . HIS A 1 20  ? 18.157 21.634  10.853 1.00 59.19  ? 68  HIS A N   1 
ATOM   103  C  CA  . HIS A 1 20  ? 18.819 21.302  9.593  1.00 60.07  ? 68  HIS A CA  1 
ATOM   104  C  C   . HIS A 1 20  ? 18.467 22.271  8.450  1.00 61.35  ? 68  HIS A C   1 
ATOM   105  O  O   . HIS A 1 20  ? 17.807 21.880  7.483  1.00 61.16  ? 68  HIS A O   1 
ATOM   106  C  CB  . HIS A 1 20  ? 18.460 19.873  9.156  1.00 59.84  ? 68  HIS A CB  1 
ATOM   107  C  CG  . HIS A 1 20  ? 18.669 18.818  10.201 1.00 57.97  ? 68  HIS A CG  1 
ATOM   108  N  ND1 . HIS A 1 20  ? 19.867 18.641  10.857 1.00 57.06  ? 68  HIS A ND1 1 
ATOM   109  C  CD2 . HIS A 1 20  ? 17.848 17.838  10.647 1.00 56.06  ? 68  HIS A CD2 1 
ATOM   110  C  CE1 . HIS A 1 20  ? 19.762 17.618  11.687 1.00 55.64  ? 68  HIS A CE1 1 
ATOM   111  N  NE2 . HIS A 1 20  ? 18.548 17.112  11.576 1.00 54.77  ? 68  HIS A NE2 1 
ATOM   112  N  N   . HIS A 1 21  ? 18.909 23.522  8.543  1.00 63.06  ? 69  HIS A N   1 
ATOM   113  C  CA  . HIS A 1 21  ? 18.571 24.510  7.508  1.00 64.99  ? 69  HIS A CA  1 
ATOM   114  C  C   . HIS A 1 21  ? 18.613 23.895  6.103  1.00 65.34  ? 69  HIS A C   1 
ATOM   115  O  O   . HIS A 1 21  ? 19.601 23.252  5.723  1.00 65.62  ? 69  HIS A O   1 
ATOM   116  C  CB  . HIS A 1 21  ? 19.483 25.745  7.583  1.00 65.57  ? 69  HIS A CB  1 
ATOM   117  C  CG  . HIS A 1 21  ? 19.145 26.806  6.575  1.00 68.65  ? 69  HIS A CG  1 
ATOM   118  N  ND1 . HIS A 1 21  ? 18.324 27.879  6.869  1.00 71.36  ? 69  HIS A ND1 1 
ATOM   119  C  CD2 . HIS A 1 21  ? 19.507 26.955  5.273  1.00 70.49  ? 69  HIS A CD2 1 
ATOM   120  C  CE1 . HIS A 1 21  ? 18.197 28.643  5.794  1.00 71.55  ? 69  HIS A CE1 1 
ATOM   121  N  NE2 . HIS A 1 21  ? 18.906 28.105  4.814  1.00 71.24  ? 69  HIS A NE2 1 
ATOM   122  N  N   . GLY A 1 22  ? 17.531 24.078  5.350  1.00 65.81  ? 70  GLY A N   1 
ATOM   123  C  CA  . GLY A 1 22  ? 17.462 23.616  3.963  1.00 66.41  ? 70  GLY A CA  1 
ATOM   124  C  C   . GLY A 1 22  ? 17.389 22.110  3.741  1.00 66.86  ? 70  GLY A C   1 
ATOM   125  O  O   . GLY A 1 22  ? 17.955 21.594  2.776  1.00 67.18  ? 70  GLY A O   1 
ATOM   126  N  N   . ASN A 1 23  ? 16.699 21.400  4.632  1.00 67.27  ? 71  ASN A N   1 
ATOM   127  C  CA  . ASN A 1 23  ? 16.352 19.988  4.416  1.00 67.24  ? 71  ASN A CA  1 
ATOM   128  C  C   . ASN A 1 23  ? 15.023 19.901  3.670  1.00 67.25  ? 71  ASN A C   1 
ATOM   129  O  O   . ASN A 1 23  ? 14.464 20.925  3.285  1.00 67.08  ? 71  ASN A O   1 
ATOM   130  C  CB  . ASN A 1 23  ? 16.265 19.233  5.747  1.00 67.24  ? 71  ASN A CB  1 
ATOM   131  C  CG  . ASN A 1 23  ? 15.115 19.719  6.620  1.00 67.18  ? 71  ASN A CG  1 
ATOM   132  O  OD1 . ASN A 1 23  ? 15.257 20.683  7.370  1.00 68.04  ? 71  ASN A OD1 1 
ATOM   133  N  ND2 . ASN A 1 23  ? 13.973 19.055  6.521  1.00 66.76  ? 71  ASN A ND2 1 
ATOM   134  N  N   . VAL A 1 24  ? 14.502 18.691  3.496  1.00 67.57  ? 72  VAL A N   1 
ATOM   135  C  CA  . VAL A 1 24  ? 13.347 18.481  2.616  1.00 67.91  ? 72  VAL A CA  1 
ATOM   136  C  C   . VAL A 1 24  ? 12.153 17.713  3.243  1.00 67.72  ? 72  VAL A C   1 
ATOM   137  O  O   . VAL A 1 24  ? 11.324 17.154  2.524  1.00 67.70  ? 72  VAL A O   1 
ATOM   138  C  CB  . VAL A 1 24  ? 13.822 17.821  1.274  1.00 68.05  ? 72  VAL A CB  1 
ATOM   139  C  CG1 . VAL A 1 24  ? 14.182 16.336  1.474  1.00 68.40  ? 72  VAL A CG1 1 
ATOM   140  C  CG2 . VAL A 1 24  ? 12.796 18.015  0.147  1.00 68.76  ? 72  VAL A CG2 1 
ATOM   141  N  N   . ARG A 1 25  ? 12.045 17.713  4.573  1.00 67.77  ? 73  ARG A N   1 
ATOM   142  C  CA  . ARG A 1 25  ? 11.002 16.919  5.282  1.00 67.67  ? 73  ARG A CA  1 
ATOM   143  C  C   . ARG A 1 25  ? 9.537  17.223  4.904  1.00 67.56  ? 73  ARG A C   1 
ATOM   144  O  O   . ARG A 1 25  ? 9.078  18.368  4.972  1.00 67.39  ? 73  ARG A O   1 
ATOM   145  C  CB  . ARG A 1 25  ? 11.192 16.996  6.802  1.00 67.40  ? 73  ARG A CB  1 
ATOM   146  C  CG  . ARG A 1 25  ? 12.357 16.157  7.321  1.00 67.02  ? 73  ARG A CG  1 
ATOM   147  C  CD  . ARG A 1 25  ? 12.752 16.567  8.733  1.00 66.17  ? 73  ARG A CD  1 
ATOM   148  N  NE  . ARG A 1 25  ? 13.639 15.591  9.356  1.00 64.89  ? 73  ARG A NE  1 
ATOM   149  C  CZ  . ARG A 1 25  ? 14.208 15.750  10.547 1.00 64.64  ? 73  ARG A CZ  1 
ATOM   150  N  NH1 . ARG A 1 25  ? 13.990 16.856  11.256 1.00 63.70  ? 73  ARG A NH1 1 
ATOM   151  N  NH2 . ARG A 1 25  ? 15.000 14.799  11.027 1.00 64.60  ? 73  ARG A NH2 1 
ATOM   152  N  N   . THR A 1 31  ? 19.262 5.812   5.990  1.00 54.62  ? 204 THR A N   1 
ATOM   153  C  CA  . THR A 1 31  ? 19.973 5.050   7.033  1.00 54.99  ? 204 THR A CA  1 
ATOM   154  C  C   . THR A 1 31  ? 20.094 5.790   8.378  1.00 54.15  ? 204 THR A C   1 
ATOM   155  O  O   . THR A 1 31  ? 20.584 6.920   8.449  1.00 54.28  ? 204 THR A O   1 
ATOM   156  C  CB  . THR A 1 31  ? 21.390 4.571   6.575  1.00 55.71  ? 204 THR A CB  1 
ATOM   157  O  OG1 . THR A 1 31  ? 21.960 3.728   7.594  1.00 57.43  ? 204 THR A OG1 1 
ATOM   158  C  CG2 . THR A 1 31  ? 22.360 5.778   6.287  1.00 55.80  ? 204 THR A CG2 1 
ATOM   159  N  N   . LEU A 1 32  ? 19.658 5.130   9.444  1.00 53.22  ? 205 LEU A N   1 
ATOM   160  C  CA  . LEU A 1 32  ? 19.570 5.741   10.771 1.00 52.05  ? 205 LEU A CA  1 
ATOM   161  C  C   . LEU A 1 32  ? 20.651 5.183   11.699 1.00 51.06  ? 205 LEU A C   1 
ATOM   162  O  O   . LEU A 1 32  ? 20.756 3.965   11.861 1.00 50.97  ? 205 LEU A O   1 
ATOM   163  C  CB  . LEU A 1 32  ? 18.169 5.482   11.346 1.00 52.11  ? 205 LEU A CB  1 
ATOM   164  C  CG  . LEU A 1 32  ? 17.797 6.210   12.637 1.00 52.29  ? 205 LEU A CG  1 
ATOM   165  C  CD1 . LEU A 1 32  ? 16.383 6.733   12.546 1.00 52.40  ? 205 LEU A CD1 1 
ATOM   166  C  CD2 . LEU A 1 32  ? 18.007 5.357   13.867 1.00 51.34  ? 205 LEU A CD2 1 
ATOM   167  N  N   . VAL A 1 33  ? 21.445 6.059   12.317 1.00 49.97  ? 206 VAL A N   1 
ATOM   168  C  CA  . VAL A 1 33  ? 22.600 5.582   13.109 1.00 49.00  ? 206 VAL A CA  1 
ATOM   169  C  C   . VAL A 1 33  ? 22.375 5.529   14.630 1.00 47.84  ? 206 VAL A C   1 
ATOM   170  O  O   . VAL A 1 33  ? 21.752 6.411   15.210 1.00 47.78  ? 206 VAL A O   1 
ATOM   171  C  CB  . VAL A 1 33  ? 23.926 6.364   12.810 1.00 49.11  ? 206 VAL A CB  1 
ATOM   172  C  CG1 . VAL A 1 33  ? 25.121 5.401   12.858 1.00 49.50  ? 206 VAL A CG1 1 
ATOM   173  C  CG2 . VAL A 1 33  ? 23.881 7.086   11.454 1.00 48.98  ? 206 VAL A CG2 1 
ATOM   174  N  N   . PHE A 1 34  ? 22.884 4.480   15.261 1.00 46.53  ? 207 PHE A N   1 
ATOM   175  C  CA  . PHE A 1 34  ? 22.985 4.448   16.707 1.00 45.56  ? 207 PHE A CA  1 
ATOM   176  C  C   . PHE A 1 34  ? 24.411 4.767   17.063 1.00 45.15  ? 207 PHE A C   1 
ATOM   177  O  O   . PHE A 1 34  ? 25.327 4.493   16.280 1.00 45.10  ? 207 PHE A O   1 
ATOM   178  C  CB  . PHE A 1 34  ? 22.639 3.073   17.247 1.00 45.26  ? 207 PHE A CB  1 
ATOM   179  C  CG  . PHE A 1 34  ? 21.240 2.653   16.945 1.00 45.12  ? 207 PHE A CG  1 
ATOM   180  C  CD1 . PHE A 1 34  ? 20.208 2.920   17.840 1.00 44.43  ? 207 PHE A CD1 1 
ATOM   181  C  CD2 . PHE A 1 34  ? 20.942 2.013   15.756 1.00 44.25  ? 207 PHE A CD2 1 
ATOM   182  C  CE1 . PHE A 1 34  ? 18.913 2.538   17.563 1.00 43.26  ? 207 PHE A CE1 1 
ATOM   183  C  CE2 . PHE A 1 34  ? 19.652 1.638   15.472 1.00 43.81  ? 207 PHE A CE2 1 
ATOM   184  C  CZ  . PHE A 1 34  ? 18.632 1.901   16.382 1.00 43.60  ? 207 PHE A CZ  1 
ATOM   185  N  N   . SER A 1 35  ? 24.609 5.348   18.240 1.00 44.47  ? 208 SER A N   1 
ATOM   186  C  CA  . SER A 1 35  ? 25.956 5.587   18.715 1.00 43.56  ? 208 SER A CA  1 
ATOM   187  C  C   . SER A 1 35  ? 26.669 4.252   18.779 1.00 43.35  ? 208 SER A C   1 
ATOM   188  O  O   . SER A 1 35  ? 26.052 3.205   19.014 1.00 42.85  ? 208 SER A O   1 
ATOM   189  C  CB  . SER A 1 35  ? 25.967 6.305   20.069 1.00 43.36  ? 208 SER A CB  1 
ATOM   190  O  OG  . SER A 1 35  ? 25.389 5.529   21.090 1.00 41.97  ? 208 SER A OG  1 
ATOM   191  N  N   . THR A 1 36  ? 27.970 4.297   18.530 1.00 43.23  ? 209 THR A N   1 
ATOM   192  C  CA  . THR A 1 36  ? 28.787 3.097   18.554 1.00 43.09  ? 209 THR A CA  1 
ATOM   193  C  C   . THR A 1 36  ? 28.917 2.542   19.970 1.00 42.69  ? 209 THR A C   1 
ATOM   194  O  O   . THR A 1 36  ? 29.077 1.336   20.155 1.00 43.06  ? 209 THR A O   1 
ATOM   195  C  CB  . THR A 1 36  ? 30.180 3.375   18.002 1.00 43.21  ? 209 THR A CB  1 
ATOM   196  O  OG1 . THR A 1 36  ? 30.732 4.502   18.692 1.00 43.73  ? 209 THR A OG1 1 
ATOM   197  C  CG2 . THR A 1 36  ? 30.105 3.678   16.504 1.00 43.25  ? 209 THR A CG2 1 
ATOM   198  N  N   . HIS A 1 37  ? 28.846 3.411   20.974 1.00 41.86  ? 210 HIS A N   1 
ATOM   199  C  CA  . HIS A 1 37  ? 28.954 2.946   22.353 1.00 40.70  ? 210 HIS A CA  1 
ATOM   200  C  C   . HIS A 1 37  ? 27.747 3.320   23.192 1.00 39.56  ? 210 HIS A C   1 
ATOM   201  O  O   . HIS A 1 37  ? 26.940 4.156   22.809 1.00 39.41  ? 210 HIS A O   1 
ATOM   202  C  CB  . HIS A 1 37  ? 30.232 3.490   22.994 1.00 41.09  ? 210 HIS A CB  1 
ATOM   203  C  CG  . HIS A 1 37  ? 31.491 3.045   22.313 1.00 42.16  ? 210 HIS A CG  1 
ATOM   204  N  ND1 . HIS A 1 37  ? 32.228 1.956   22.740 1.00 44.35  ? 210 HIS A ND1 1 
ATOM   205  C  CD2 . HIS A 1 37  ? 32.141 3.539   21.231 1.00 41.86  ? 210 HIS A CD2 1 
ATOM   206  C  CE1 . HIS A 1 37  ? 33.277 1.799   21.950 1.00 44.08  ? 210 HIS A CE1 1 
ATOM   207  N  NE2 . HIS A 1 37  ? 33.244 2.745   21.025 1.00 43.30  ? 210 HIS A NE2 1 
ATOM   208  N  N   . ALA A 1 38  ? 27.625 2.670   24.336 1.00 38.63  ? 211 ALA A N   1 
ATOM   209  C  CA  . ALA A 1 38  ? 26.673 3.068   25.356 1.00 37.97  ? 211 ALA A CA  1 
ATOM   210  C  C   . ALA A 1 38  ? 27.472 3.577   26.552 1.00 37.59  ? 211 ALA A C   1 
ATOM   211  O  O   . ALA A 1 38  ? 28.624 3.170   26.763 1.00 37.78  ? 211 ALA A O   1 
ATOM   212  C  CB  . ALA A 1 38  ? 25.811 1.894   25.756 1.00 37.73  ? 211 ALA A CB  1 
ATOM   213  N  N   . VAL A 1 39  ? 26.879 4.472   27.331 1.00 36.91  ? 212 VAL A N   1 
ATOM   214  C  CA  . VAL A 1 39  ? 27.543 4.980   28.530 1.00 36.01  ? 212 VAL A CA  1 
ATOM   215  C  C   . VAL A 1 39  ? 26.706 4.663   29.775 1.00 35.85  ? 212 VAL A C   1 
ATOM   216  O  O   . VAL A 1 39  ? 25.488 4.477   29.700 1.00 36.05  ? 212 VAL A O   1 
ATOM   217  C  CB  . VAL A 1 39  ? 27.767 6.496   28.438 1.00 35.74  ? 212 VAL A CB  1 
ATOM   218  C  CG1 . VAL A 1 39  ? 28.481 6.855   27.163 1.00 34.56  ? 212 VAL A CG1 1 
ATOM   219  C  CG2 . VAL A 1 39  ? 26.435 7.227   28.487 1.00 36.31  ? 212 VAL A CG2 1 
ATOM   220  N  N   . ILE A 1 40  ? 27.368 4.585   30.919 1.00 35.72  ? 213 ILE A N   1 
ATOM   221  C  CA  . ILE A 1 40  ? 26.682 4.534   32.212 1.00 35.15  ? 213 ILE A CA  1 
ATOM   222  C  C   . ILE A 1 40  ? 27.169 5.679   33.107 1.00 35.39  ? 213 ILE A C   1 
ATOM   223  O  O   . ILE A 1 40  ? 28.379 5.908   33.224 1.00 35.31  ? 213 ILE A O   1 
ATOM   224  C  CB  . ILE A 1 40  ? 26.982 3.247   32.936 1.00 34.65  ? 213 ILE A CB  1 
ATOM   225  C  CG1 . ILE A 1 40  ? 26.564 2.055   32.087 1.00 33.14  ? 213 ILE A CG1 1 
ATOM   226  C  CG2 . ILE A 1 40  ? 26.261 3.263   34.258 1.00 35.29  ? 213 ILE A CG2 1 
ATOM   227  C  CD1 . ILE A 1 40  ? 26.890 0.742   32.697 1.00 30.54  ? 213 ILE A CD1 1 
ATOM   228  N  N   . SER A 1 41  ? 26.242 6.394   33.735 1.00 35.30  ? 214 SER A N   1 
ATOM   229  C  CA  . SER A 1 41  ? 26.613 7.476   34.643 1.00 35.71  ? 214 SER A CA  1 
ATOM   230  C  C   . SER A 1 41  ? 25.404 8.031   35.381 1.00 36.08  ? 214 SER A C   1 
ATOM   231  O  O   . SER A 1 41  ? 24.272 7.671   35.080 1.00 36.83  ? 214 SER A O   1 
ATOM   232  C  CB  . SER A 1 41  ? 27.309 8.583   33.880 1.00 35.53  ? 214 SER A CB  1 
ATOM   233  O  OG  . SER A 1 41  ? 26.607 8.855   32.687 1.00 37.11  ? 214 SER A OG  1 
ATOM   234  N  N   . MET A 1 42  ? 25.628 8.905   36.353 1.00 36.28  ? 215 MET A N   1 
ATOM   235  C  CA  . MET A 1 42  ? 24.531 9.381   37.178 1.00 36.08  ? 215 MET A CA  1 
ATOM   236  C  C   . MET A 1 42  ? 23.771 10.468  36.469 1.00 36.03  ? 215 MET A C   1 
ATOM   237  O  O   . MET A 1 42  ? 24.349 11.321  35.800 1.00 36.29  ? 215 MET A O   1 
ATOM   238  C  CB  . MET A 1 42  ? 25.041 9.894   38.517 1.00 36.13  ? 215 MET A CB  1 
ATOM   239  C  CG  . MET A 1 42  ? 25.866 8.875   39.294 1.00 37.57  ? 215 MET A CG  1 
ATOM   240  S  SD  . MET A 1 42  ? 24.869 7.672   40.208 1.00 39.39  ? 215 MET A SD  1 
ATOM   241  C  CE  . MET A 1 42  ? 24.285 8.746   41.521 1.00 40.15  ? 215 MET A CE  1 
ATOM   242  N  N   . ARG A 1 43  ? 22.457 10.418  36.610 1.00 36.14  ? 216 ARG A N   1 
ATOM   243  C  CA  . ARG A 1 43  ? 21.604 11.534  36.242 1.00 36.35  ? 216 ARG A CA  1 
ATOM   244  C  C   . ARG A 1 43  ? 20.628 11.724  37.346 1.00 36.24  ? 216 ARG A C   1 
ATOM   245  O  O   . ARG A 1 43  ? 19.866 10.813  37.643 1.00 36.32  ? 216 ARG A O   1 
ATOM   246  C  CB  . ARG A 1 43  ? 20.835 11.244  34.968 1.00 36.37  ? 216 ARG A CB  1 
ATOM   247  C  CG  . ARG A 1 43  ? 21.632 11.523  33.728 1.00 36.74  ? 216 ARG A CG  1 
ATOM   248  C  CD  . ARG A 1 43  ? 20.846 11.161  32.515 1.00 36.13  ? 216 ARG A CD  1 
ATOM   249  N  NE  . ARG A 1 43  ? 21.376 11.846  31.355 1.00 36.75  ? 216 ARG A NE  1 
ATOM   250  C  CZ  . ARG A 1 43  ? 20.741 11.907  30.201 1.00 38.49  ? 216 ARG A CZ  1 
ATOM   251  N  NH1 . ARG A 1 43  ? 19.558 11.317  30.092 1.00 39.23  ? 216 ARG A NH1 1 
ATOM   252  N  NH2 . ARG A 1 43  ? 21.278 12.559  29.171 1.00 39.51  ? 216 ARG A NH2 1 
ATOM   253  N  N   . ASP A 1 44  ? 20.656 12.904  37.950 1.00 36.51  ? 217 ASP A N   1 
ATOM   254  C  CA  . ASP A 1 44  ? 19.797 13.217  39.084 1.00 36.85  ? 217 ASP A CA  1 
ATOM   255  C  C   . ASP A 1 44  ? 19.873 12.112  40.144 1.00 36.93  ? 217 ASP A C   1 
ATOM   256  O  O   . ASP A 1 44  ? 18.848 11.583  40.584 1.00 37.36  ? 217 ASP A O   1 
ATOM   257  C  CB  . ASP A 1 44  ? 18.355 13.450  38.617 1.00 36.42  ? 217 ASP A CB  1 
ATOM   258  C  CG  . ASP A 1 44  ? 18.207 14.726  37.812 1.00 37.22  ? 217 ASP A CG  1 
ATOM   259  O  OD1 . ASP A 1 44  ? 18.828 15.746  38.163 1.00 38.15  ? 217 ASP A OD1 1 
ATOM   260  O  OD2 . ASP A 1 44  ? 17.477 14.716  36.812 1.00 37.87  ? 217 ASP A OD2 1 
ATOM   261  N  N   . GLY A 1 45  ? 21.086 11.728  40.517 1.00 36.55  ? 218 GLY A N   1 
ATOM   262  C  CA  . GLY A 1 45  ? 21.252 10.745  41.568 1.00 36.61  ? 218 GLY A CA  1 
ATOM   263  C  C   . GLY A 1 45  ? 20.912 9.310   41.218 1.00 36.70  ? 218 GLY A C   1 
ATOM   264  O  O   . GLY A 1 45  ? 21.212 8.404   41.991 1.00 36.91  ? 218 GLY A O   1 
ATOM   265  N  N   . LYS A 1 46  ? 20.286 9.085   40.064 1.00 36.99  ? 219 LYS A N   1 
ATOM   266  C  CA  . LYS A 1 46  ? 20.013 7.718   39.582 1.00 36.82  ? 219 LYS A CA  1 
ATOM   267  C  C   . LYS A 1 46  ? 21.060 7.274   38.567 1.00 36.23  ? 219 LYS A C   1 
ATOM   268  O  O   . LYS A 1 46  ? 21.450 8.058   37.693 1.00 36.33  ? 219 LYS A O   1 
ATOM   269  C  CB  . LYS A 1 46  ? 18.640 7.640   38.927 1.00 37.04  ? 219 LYS A CB  1 
ATOM   270  C  CG  . LYS A 1 46  ? 17.473 8.058   39.793 1.00 39.98  ? 219 LYS A CG  1 
ATOM   271  C  CD  . LYS A 1 46  ? 17.440 7.297   41.145 1.00 43.80  ? 219 LYS A CD  1 
ATOM   272  C  CE  . LYS A 1 46  ? 16.240 7.731   41.998 1.00 43.46  ? 219 LYS A CE  1 
ATOM   273  N  NZ  . LYS A 1 46  ? 16.462 7.291   43.381 1.00 44.07  ? 219 LYS A NZ  1 
ATOM   274  N  N   . LEU A 1 47  ? 21.504 6.021   38.663 1.00 35.62  ? 220 LEU A N   1 
ATOM   275  C  CA  . LEU A 1 47  ? 22.464 5.487   37.688 1.00 35.49  ? 220 LEU A CA  1 
ATOM   276  C  C   . LEU A 1 47  ? 21.795 5.079   36.373 1.00 35.30  ? 220 LEU A C   1 
ATOM   277  O  O   . LEU A 1 47  ? 20.830 4.319   36.376 1.00 35.33  ? 220 LEU A O   1 
ATOM   278  C  CB  . LEU A 1 47  ? 23.246 4.312   38.269 1.00 35.55  ? 220 LEU A CB  1 
ATOM   279  C  CG  . LEU A 1 47  ? 24.590 3.996   37.591 1.00 35.74  ? 220 LEU A CG  1 
ATOM   280  C  CD1 . LEU A 1 47  ? 25.577 5.152   37.746 1.00 35.53  ? 220 LEU A CD1 1 
ATOM   281  C  CD2 . LEU A 1 47  ? 25.204 2.695   38.111 1.00 34.68  ? 220 LEU A CD2 1 
ATOM   282  N  N   . CYS A 1 48  ? 22.305 5.579   35.252 1.00 34.97  ? 221 CYS A N   1 
ATOM   283  C  CA  . CYS A 1 48  ? 21.648 5.344   33.972 1.00 35.26  ? 221 CYS A CA  1 
ATOM   284  C  C   . CYS A 1 48  ? 22.521 4.748   32.851 1.00 35.22  ? 221 CYS A C   1 
ATOM   285  O  O   . CYS A 1 48  ? 23.638 5.214   32.597 1.00 35.75  ? 221 CYS A O   1 
ATOM   286  C  CB  . CYS A 1 48  ? 20.941 6.622   33.502 1.00 34.92  ? 221 CYS A CB  1 
ATOM   287  S  SG  . CYS A 1 48  ? 19.715 7.212   34.672 1.00 36.79  ? 221 CYS A SG  1 
ATOM   288  N  N   . LEU A 1 49  ? 22.007 3.722   32.181 1.00 34.88  ? 222 LEU A N   1 
ATOM   289  C  CA  . LEU A 1 49  ? 22.576 3.278   30.922 1.00 34.95  ? 222 LEU A CA  1 
ATOM   290  C  C   . LEU A 1 49  ? 21.972 4.069   29.763 1.00 35.35  ? 222 LEU A C   1 
ATOM   291  O  O   . LEU A 1 49  ? 20.741 4.137   29.610 1.00 35.35  ? 222 LEU A O   1 
ATOM   292  C  CB  . LEU A 1 49  ? 22.302 1.803   30.705 1.00 34.97  ? 222 LEU A CB  1 
ATOM   293  C  CG  . LEU A 1 49  ? 22.689 1.357   29.304 1.00 34.48  ? 222 LEU A CG  1 
ATOM   294  C  CD1 . LEU A 1 49  ? 24.181 1.189   29.263 1.00 34.94  ? 222 LEU A CD1 1 
ATOM   295  C  CD2 . LEU A 1 49  ? 21.997 0.088   28.932 1.00 33.59  ? 222 LEU A CD2 1 
ATOM   296  N  N   . MET A 1 50  ? 22.835 4.657   28.943 1.00 35.57  ? 223 MET A N   1 
ATOM   297  C  CA  . MET A 1 50  ? 22.386 5.542   27.885 1.00 35.74  ? 223 MET A CA  1 
ATOM   298  C  C   . MET A 1 50  ? 23.081 5.252   26.568 1.00 36.19  ? 223 MET A C   1 
ATOM   299  O  O   . MET A 1 50  ? 24.289 4.976   26.546 1.00 36.34  ? 223 MET A O   1 
ATOM   300  C  CB  . MET A 1 50  ? 22.700 6.971   28.270 1.00 35.61  ? 223 MET A CB  1 
ATOM   301  C  CG  . MET A 1 50  ? 21.845 7.539   29.351 1.00 35.01  ? 223 MET A CG  1 
ATOM   302  S  SD  . MET A 1 50  ? 22.659 9.006   30.010 1.00 35.97  ? 223 MET A SD  1 
ATOM   303  C  CE  . MET A 1 50  ? 23.889 8.249   31.051 1.00 33.82  ? 223 MET A CE  1 
ATOM   304  N  N   . PHE A 1 51  ? 22.320 5.323   25.478 1.00 36.27  ? 224 PHE A N   1 
ATOM   305  C  CA  . PHE A 1 51  ? 22.897 5.300   24.137 1.00 36.76  ? 224 PHE A CA  1 
ATOM   306  C  C   . PHE A 1 51  ? 22.241 6.373   23.284 1.00 37.19  ? 224 PHE A C   1 
ATOM   307  O  O   . PHE A 1 51  ? 21.219 6.932   23.673 1.00 37.62  ? 224 PHE A O   1 
ATOM   308  C  CB  . PHE A 1 51  ? 22.735 3.929   23.494 1.00 36.72  ? 224 PHE A CB  1 
ATOM   309  C  CG  . PHE A 1 51  ? 21.318 3.490   23.372 1.00 36.71  ? 224 PHE A CG  1 
ATOM   310  C  CD1 . PHE A 1 51  ? 20.571 3.822   22.251 1.00 36.47  ? 224 PHE A CD1 1 
ATOM   311  C  CD2 . PHE A 1 51  ? 20.727 2.734   24.379 1.00 36.05  ? 224 PHE A CD2 1 
ATOM   312  C  CE1 . PHE A 1 51  ? 19.232 3.415   22.144 1.00 37.17  ? 224 PHE A CE1 1 
ATOM   313  C  CE2 . PHE A 1 51  ? 19.403 2.318   24.281 1.00 36.19  ? 224 PHE A CE2 1 
ATOM   314  C  CZ  . PHE A 1 51  ? 18.647 2.663   23.164 1.00 36.32  ? 224 PHE A CZ  1 
ATOM   315  N  N   . ARG A 1 52  ? 22.818 6.676   22.129 1.00 37.55  ? 225 ARG A N   1 
ATOM   316  C  CA  . ARG A 1 52  ? 22.327 7.791   21.339 1.00 38.25  ? 225 ARG A CA  1 
ATOM   317  C  C   . ARG A 1 52  ? 21.759 7.301   20.026 1.00 38.91  ? 225 ARG A C   1 
ATOM   318  O  O   . ARG A 1 52  ? 22.221 6.304   19.469 1.00 39.33  ? 225 ARG A O   1 
ATOM   319  C  CB  . ARG A 1 52  ? 23.436 8.819   21.112 1.00 38.16  ? 225 ARG A CB  1 
ATOM   320  C  CG  . ARG A 1 52  ? 23.084 9.893   20.107 1.00 39.49  ? 225 ARG A CG  1 
ATOM   321  C  CD  . ARG A 1 52  ? 23.379 11.290  20.614 1.00 41.90  ? 225 ARG A CD  1 
ATOM   322  N  NE  . ARG A 1 52  ? 24.812 11.554  20.689 1.00 43.80  ? 225 ARG A NE  1 
ATOM   323  C  CZ  . ARG A 1 52  ? 25.353 12.643  21.234 1.00 43.39  ? 225 ARG A CZ  1 
ATOM   324  N  NH1 . ARG A 1 52  ? 24.593 13.594  21.760 1.00 42.38  ? 225 ARG A NH1 1 
ATOM   325  N  NH2 . ARG A 1 52  ? 26.668 12.771  21.254 1.00 44.05  ? 225 ARG A NH2 1 
ATOM   326  N  N   . VAL A 1 53  ? 20.752 8.001   19.531 1.00 39.57  ? 226 VAL A N   1 
ATOM   327  C  CA  . VAL A 1 53  ? 20.074 7.582   18.309 1.00 40.64  ? 226 VAL A CA  1 
ATOM   328  C  C   . VAL A 1 53  ? 19.765 8.801   17.451 1.00 41.31  ? 226 VAL A C   1 
ATOM   329  O  O   . VAL A 1 53  ? 19.107 9.742   17.901 1.00 41.65  ? 226 VAL A O   1 
ATOM   330  C  CB  . VAL A 1 53  ? 18.779 6.759   18.610 1.00 40.70  ? 226 VAL A CB  1 
ATOM   331  C  CG1 . VAL A 1 53  ? 17.915 7.459   19.636 1.00 40.66  ? 226 VAL A CG1 1 
ATOM   332  C  CG2 . VAL A 1 53  ? 17.975 6.520   17.353 1.00 40.57  ? 226 VAL A CG2 1 
ATOM   333  N  N   . GLY A 1 54  ? 20.263 8.779   16.220 1.00 42.04  ? 227 GLY A N   1 
ATOM   334  C  CA  . GLY A 1 54  ? 20.149 9.908   15.323 1.00 42.85  ? 227 GLY A CA  1 
ATOM   335  C  C   . GLY A 1 54  ? 18.818 9.931   14.627 1.00 43.69  ? 227 GLY A C   1 
ATOM   336  O  O   . GLY A 1 54  ? 18.099 8.936   14.602 1.00 43.38  ? 227 GLY A O   1 
ATOM   337  N  N   . ASP A 1 55  ? 18.487 11.091  14.081 1.00 44.80  ? 228 ASP A N   1 
ATOM   338  C  CA  . ASP A 1 55  ? 17.344 11.233  13.199 1.00 45.87  ? 228 ASP A CA  1 
ATOM   339  C  C   . ASP A 1 55  ? 17.759 10.898  11.770 1.00 46.63  ? 228 ASP A C   1 
ATOM   340  O  O   . ASP A 1 55  ? 18.932 10.635  11.487 1.00 46.30  ? 228 ASP A O   1 
ATOM   341  C  CB  . ASP A 1 55  ? 16.790 12.659  13.261 1.00 45.79  ? 228 ASP A CB  1 
ATOM   342  C  CG  . ASP A 1 55  ? 17.846 13.725  12.948 1.00 46.67  ? 228 ASP A CG  1 
ATOM   343  O  OD1 . ASP A 1 55  ? 19.053 13.412  12.817 1.00 49.06  ? 228 ASP A OD1 1 
ATOM   344  O  OD2 . ASP A 1 55  ? 17.470 14.902  12.842 1.00 47.53  ? 228 ASP A OD2 1 
ATOM   345  N  N   . LEU A 1 56  ? 16.776 10.892  10.880 1.00 47.93  ? 229 LEU A N   1 
ATOM   346  C  CA  . LEU A 1 56  ? 17.025 10.849  9.452  1.00 48.83  ? 229 LEU A CA  1 
ATOM   347  C  C   . LEU A 1 56  ? 16.951 12.280  9.005  1.00 49.89  ? 229 LEU A C   1 
ATOM   348  O  O   . LEU A 1 56  ? 15.901 12.924  9.154  1.00 50.24  ? 229 LEU A O   1 
ATOM   349  C  CB  . LEU A 1 56  ? 15.944 10.038  8.738  1.00 48.63  ? 229 LEU A CB  1 
ATOM   350  C  CG  . LEU A 1 56  ? 15.951 8.544   9.004  1.00 47.50  ? 229 LEU A CG  1 
ATOM   351  C  CD1 . LEU A 1 56  ? 14.749 7.954   8.374  1.00 46.46  ? 229 LEU A CD1 1 
ATOM   352  C  CD2 . LEU A 1 56  ? 17.213 7.936   8.431  1.00 48.34  ? 229 LEU A CD2 1 
ATOM   353  N  N   . ARG A 1 57  ? 18.062 12.791  8.483  1.00 51.16  ? 230 ARG A N   1 
ATOM   354  C  CA  . ARG A 1 57  ? 18.112 14.179  8.029  1.00 52.40  ? 230 ARG A CA  1 
ATOM   355  C  C   . ARG A 1 57  ? 16.886 14.535  7.151  1.00 52.44  ? 230 ARG A C   1 
ATOM   356  O  O   . ARG A 1 57  ? 16.246 15.578  7.355  1.00 52.20  ? 230 ARG A O   1 
ATOM   357  C  CB  . ARG A 1 57  ? 19.466 14.492  7.335  1.00 52.96  ? 230 ARG A CB  1 
ATOM   358  C  CG  . ARG A 1 57  ? 19.472 15.766  6.454  1.00 55.50  ? 230 ARG A CG  1 
ATOM   359  C  CD  . ARG A 1 57  ? 20.846 16.445  6.325  1.00 59.47  ? 230 ARG A CD  1 
ATOM   360  N  NE  . ARG A 1 57  ? 20.833 17.472  5.264  1.00 62.80  ? 230 ARG A NE  1 
ATOM   361  C  CZ  . ARG A 1 57  ? 20.728 18.792  5.461  1.00 63.27  ? 230 ARG A CZ  1 
ATOM   362  N  NH1 . ARG A 1 57  ? 20.642 19.281  6.693  1.00 62.91  ? 230 ARG A NH1 1 
ATOM   363  N  NH2 . ARG A 1 57  ? 20.713 19.629  4.420  1.00 62.81  ? 230 ARG A NH2 1 
ATOM   364  N  N   . ASN A 1 58  ? 16.530 13.645  6.225  1.00 52.56  ? 231 ASN A N   1 
ATOM   365  C  CA  . ASN A 1 58  ? 15.548 13.996  5.205  1.00 53.08  ? 231 ASN A CA  1 
ATOM   366  C  C   . ASN A 1 58  ? 14.173 13.328  5.272  1.00 52.64  ? 231 ASN A C   1 
ATOM   367  O  O   . ASN A 1 58  ? 13.504 13.160  4.246  1.00 52.61  ? 231 ASN A O   1 
ATOM   368  C  CB  . ASN A 1 58  ? 16.151 13.819  3.810  1.00 53.83  ? 231 ASN A CB  1 
ATOM   369  C  CG  . ASN A 1 58  ? 17.386 14.669  3.602  1.00 55.51  ? 231 ASN A CG  1 
ATOM   370  O  OD1 . ASN A 1 58  ? 18.464 14.147  3.268  1.00 56.43  ? 231 ASN A OD1 1 
ATOM   371  N  ND2 . ASN A 1 58  ? 17.246 15.987  3.816  1.00 55.99  ? 231 ASN A ND2 1 
ATOM   372  N  N   . SER A 1 59  ? 13.735 12.959  6.467  1.00 51.79  ? 232 SER A N   1 
ATOM   373  C  CA  . SER A 1 59  ? 12.333 12.603  6.633  1.00 51.18  ? 232 SER A CA  1 
ATOM   374  C  C   . SER A 1 59  ? 11.975 12.346  8.082  1.00 50.42  ? 232 SER A C   1 
ATOM   375  O  O   . SER A 1 59  ? 12.808 11.869  8.866  1.00 50.31  ? 232 SER A O   1 
ATOM   376  C  CB  . SER A 1 59  ? 11.919 11.416  5.742  1.00 51.47  ? 232 SER A CB  1 
ATOM   377  O  OG  . SER A 1 59  ? 12.539 10.215  6.148  1.00 51.05  ? 232 SER A OG  1 
ATOM   378  N  N   . HIS A 1 60  ? 10.732 12.697  8.417  1.00 49.08  ? 233 HIS A N   1 
ATOM   379  C  CA  . HIS A 1 60  ? 10.175 12.446  9.725  1.00 47.89  ? 233 HIS A CA  1 
ATOM   380  C  C   . HIS A 1 60  ? 9.919  10.951  9.830  1.00 46.26  ? 233 HIS A C   1 
ATOM   381  O  O   . HIS A 1 60  ? 9.817  10.267  8.807  1.00 45.85  ? 233 HIS A O   1 
ATOM   382  C  CB  . HIS A 1 60  ? 8.871  13.241  9.913  1.00 48.36  ? 233 HIS A CB  1 
ATOM   383  C  CG  . HIS A 1 60  ? 9.085  14.690  10.255 1.00 51.16  ? 233 HIS A CG  1 
ATOM   384  N  ND1 . HIS A 1 60  ? 9.741  15.103  11.405 1.00 54.42  ? 233 HIS A ND1 1 
ATOM   385  C  CD2 . HIS A 1 60  ? 8.711  15.826  9.607  1.00 52.50  ? 233 HIS A CD2 1 
ATOM   386  C  CE1 . HIS A 1 60  ? 9.765  16.427  11.446 1.00 53.93  ? 233 HIS A CE1 1 
ATOM   387  N  NE2 . HIS A 1 60  ? 9.153  16.890  10.363 1.00 53.52  ? 233 HIS A NE2 1 
ATOM   388  N  N   . ILE A 1 61  ? 9.860  10.451  11.065 1.00 44.53  ? 234 ILE A N   1 
ATOM   389  C  CA  . ILE A 1 61  ? 9.448  9.084   11.321 1.00 42.92  ? 234 ILE A CA  1 
ATOM   390  C  C   . ILE A 1 61  ? 8.269  9.070   12.269 1.00 42.17  ? 234 ILE A C   1 
ATOM   391  O  O   . ILE A 1 61  ? 8.416  9.215   13.477 1.00 42.23  ? 234 ILE A O   1 
ATOM   392  C  CB  . ILE A 1 61  ? 10.553 8.263   11.924 1.00 42.75  ? 234 ILE A CB  1 
ATOM   393  C  CG1 . ILE A 1 61  ? 11.736 8.233   10.979 1.00 41.58  ? 234 ILE A CG1 1 
ATOM   394  C  CG2 . ILE A 1 61  ? 10.048 6.862   12.215 1.00 43.14  ? 234 ILE A CG2 1 
ATOM   395  C  CD1 . ILE A 1 61  ? 12.998 8.114   11.707 1.00 42.95  ? 234 ILE A CD1 1 
ATOM   396  N  N   . VAL A 1 62  ? 7.093  8.905   11.686 1.00 40.96  ? 235 VAL A N   1 
ATOM   397  C  CA  . VAL A 1 62  ? 5.848  8.846   12.412 1.00 39.43  ? 235 VAL A CA  1 
ATOM   398  C  C   . VAL A 1 62  ? 5.834  7.630   13.329 1.00 38.67  ? 235 VAL A C   1 
ATOM   399  O  O   . VAL A 1 62  ? 6.490  6.636   13.057 1.00 38.15  ? 235 VAL A O   1 
ATOM   400  C  CB  . VAL A 1 62  ? 4.677  8.776   11.425 1.00 39.31  ? 235 VAL A CB  1 
ATOM   401  C  CG1 . VAL A 1 62  ? 3.353  8.955   12.153 1.00 39.08  ? 235 VAL A CG1 1 
ATOM   402  C  CG2 . VAL A 1 62  ? 4.849  9.848   10.353 1.00 38.45  ? 235 VAL A CG2 1 
ATOM   403  N  N   . GLU A 1 63  ? 5.093  7.748   14.425 1.00 38.03  ? 236 GLU A N   1 
ATOM   404  C  CA  . GLU A 1 63  ? 4.894  6.667   15.375 1.00 37.37  ? 236 GLU A CA  1 
ATOM   405  C  C   . GLU A 1 63  ? 6.207  6.024   15.760 1.00 36.10  ? 236 GLU A C   1 
ATOM   406  O  O   . GLU A 1 63  ? 6.295  4.811   15.806 1.00 35.92  ? 236 GLU A O   1 
ATOM   407  C  CB  . GLU A 1 63  ? 3.967  5.620   14.770 1.00 37.89  ? 236 GLU A CB  1 
ATOM   408  C  CG  . GLU A 1 63  ? 3.122  4.799   15.768 1.00 40.56  ? 236 GLU A CG  1 
ATOM   409  C  CD  . GLU A 1 63  ? 1.850  4.244   15.107 1.00 44.47  ? 236 GLU A CD  1 
ATOM   410  O  OE1 . GLU A 1 63  ? 1.111  5.062   14.470 1.00 44.98  ? 236 GLU A OE1 1 
ATOM   411  O  OE2 . GLU A 1 63  ? 1.601  3.013   15.210 1.00 44.46  ? 236 GLU A OE2 1 
ATOM   412  N  N   . ALA A 1 64  ? 7.230  6.823   16.029 1.00 34.78  ? 237 ALA A N   1 
ATOM   413  C  CA  . ALA A 1 64  ? 8.519  6.260   16.363 1.00 33.82  ? 237 ALA A CA  1 
ATOM   414  C  C   . ALA A 1 64  ? 8.490  5.675   17.767 1.00 33.47  ? 237 ALA A C   1 
ATOM   415  O  O   . ALA A 1 64  ? 7.824  6.196   18.651 1.00 33.77  ? 237 ALA A O   1 
ATOM   416  C  CB  . ALA A 1 64  ? 9.607  7.313   16.218 1.00 33.35  ? 237 ALA A CB  1 
ATOM   417  N  N   . SER A 1 65  ? 9.200  4.575   17.962 1.00 33.41  ? 238 SER A N   1 
ATOM   418  C  CA  . SER A 1 65  ? 9.389  3.997   19.294 1.00 33.69  ? 238 SER A CA  1 
ATOM   419  C  C   . SER A 1 65  ? 10.647 3.202   19.374 1.00 33.73  ? 238 SER A C   1 
ATOM   420  O  O   . SER A 1 65  ? 11.081 2.601   18.405 1.00 34.28  ? 238 SER A O   1 
ATOM   421  C  CB  . SER A 1 65  ? 8.303  3.037   19.656 1.00 33.44  ? 238 SER A CB  1 
ATOM   422  O  OG  . SER A 1 65  ? 8.071  2.197   18.531 1.00 35.68  ? 238 SER A OG  1 
ATOM   423  N  N   . ILE A 1 66  ? 11.197 3.185   20.575 1.00 33.78  ? 239 ILE A N   1 
ATOM   424  C  CA  . ILE A 1 66  ? 12.426 2.504   20.873 1.00 33.47  ? 239 ILE A CA  1 
ATOM   425  C  C   . ILE A 1 66  ? 12.181 1.404   21.919 1.00 33.82  ? 239 ILE A C   1 
ATOM   426  O  O   . ILE A 1 66  ? 11.399 1.555   22.867 1.00 33.08  ? 239 ILE A O   1 
ATOM   427  C  CB  . ILE A 1 66  ? 13.505 3.529   21.329 1.00 33.37  ? 239 ILE A CB  1 
ATOM   428  C  CG1 . ILE A 1 66  ? 14.838 2.851   21.629 1.00 33.10  ? 239 ILE A CG1 1 
ATOM   429  C  CG2 . ILE A 1 66  ? 13.029 4.367   22.502 1.00 32.89  ? 239 ILE A CG2 1 
ATOM   430  C  CD1 . ILE A 1 66  ? 15.779 2.849   20.461 1.00 33.63  ? 239 ILE A CD1 1 
ATOM   431  N  N   . ARG A 1 67  ? 12.830 0.275   21.708 1.00 34.50  ? 240 ARG A N   1 
ATOM   432  C  CA  . ARG A 1 67  ? 12.884 -0.764  22.724 1.00 35.47  ? 240 ARG A CA  1 
ATOM   433  C  C   . ARG A 1 67  ? 14.274 -1.330  22.700 1.00 34.85  ? 240 ARG A C   1 
ATOM   434  O  O   . ARG A 1 67  ? 15.030 -1.029  21.793 1.00 35.48  ? 240 ARG A O   1 
ATOM   435  C  CB  . ARG A 1 67  ? 11.849 -1.863  22.479 1.00 35.88  ? 240 ARG A CB  1 
ATOM   436  C  CG  . ARG A 1 67  ? 11.535 -2.128  21.034 1.00 37.59  ? 240 ARG A CG  1 
ATOM   437  C  CD  . ARG A 1 67  ? 10.169 -2.836  20.899 1.00 40.72  ? 240 ARG A CD  1 
ATOM   438  N  NE  . ARG A 1 67  ? 10.272 -4.255  20.518 1.00 42.88  ? 240 ARG A NE  1 
ATOM   439  C  CZ  . ARG A 1 67  ? 10.105 -4.713  19.275 1.00 43.88  ? 240 ARG A CZ  1 
ATOM   440  N  NH1 . ARG A 1 67  ? 9.834  -3.865  18.280 1.00 44.10  ? 240 ARG A NH1 1 
ATOM   441  N  NH2 . ARG A 1 67  ? 10.204 -6.017  19.023 1.00 43.82  ? 240 ARG A NH2 1 
ATOM   442  N  N   . ALA A 1 68  ? 14.604 -2.130  23.705 1.00 34.25  ? 241 ALA A N   1 
ATOM   443  C  CA  . ALA A 1 68  ? 15.914 -2.732  23.831 1.00 33.52  ? 241 ALA A CA  1 
ATOM   444  C  C   . ALA A 1 68  ? 15.764 -4.092  24.488 1.00 33.42  ? 241 ALA A C   1 
ATOM   445  O  O   . ALA A 1 68  ? 14.978 -4.262  25.397 1.00 33.13  ? 241 ALA A O   1 
ATOM   446  C  CB  . ALA A 1 68  ? 16.813 -1.849  24.642 1.00 33.01  ? 241 ALA A CB  1 
ATOM   447  N  N   . LYS A 1 69  ? 16.508 -5.069  24.004 1.00 33.83  ? 242 LYS A N   1 
ATOM   448  C  CA  . LYS A 1 69  ? 16.514 -6.380  24.624 1.00 34.23  ? 242 LYS A CA  1 
ATOM   449  C  C   . LYS A 1 69  ? 17.892 -6.662  25.201 1.00 34.25  ? 242 LYS A C   1 
ATOM   450  O  O   . LYS A 1 69  ? 18.899 -6.144  24.735 1.00 34.02  ? 242 LYS A O   1 
ATOM   451  C  CB  . LYS A 1 69  ? 16.130 -7.481  23.622 1.00 34.48  ? 242 LYS A CB  1 
ATOM   452  C  CG  . LYS A 1 69  ? 14.759 -7.329  22.953 1.00 35.72  ? 242 LYS A CG  1 
ATOM   453  C  CD  . LYS A 1 69  ? 13.665 -7.415  23.984 1.00 38.57  ? 242 LYS A CD  1 
ATOM   454  C  CE  . LYS A 1 69  ? 12.302 -7.672  23.382 1.00 39.31  ? 242 LYS A CE  1 
ATOM   455  N  NZ  . LYS A 1 69  ? 11.429 -8.311  24.422 1.00 40.70  ? 242 LYS A NZ  1 
ATOM   456  N  N   . LEU A 1 70  ? 17.915 -7.484  26.232 1.00 34.82  ? 243 LEU A N   1 
ATOM   457  C  CA  . LEU A 1 70  ? 19.134 -7.975  26.781 1.00 35.67  ? 243 LEU A CA  1 
ATOM   458  C  C   . LEU A 1 70  ? 19.283 -9.413  26.351 1.00 36.35  ? 243 LEU A C   1 
ATOM   459  O  O   . LEU A 1 70  ? 18.501 -10.282 26.729 1.00 36.36  ? 243 LEU A O   1 
ATOM   460  C  CB  . LEU A 1 70  ? 19.099 -7.894  28.305 1.00 35.79  ? 243 LEU A CB  1 
ATOM   461  C  CG  . LEU A 1 70  ? 20.272 -8.578  29.022 1.00 36.68  ? 243 LEU A CG  1 
ATOM   462  C  CD1 . LEU A 1 70  ? 21.579 -7.838  28.805 1.00 37.08  ? 243 LEU A CD1 1 
ATOM   463  C  CD2 . LEU A 1 70  ? 19.981 -8.727  30.502 1.00 37.54  ? 243 LEU A CD2 1 
ATOM   464  N  N   . ILE A 1 71  ? 20.300 -9.662  25.548 1.00 37.39  ? 244 ILE A N   1 
ATOM   465  C  CA  . ILE A 1 71  ? 20.671 -11.022 25.208 1.00 38.31  ? 244 ILE A CA  1 
ATOM   466  C  C   . ILE A 1 71  ? 21.682 -11.533 26.236 1.00 38.88  ? 244 ILE A C   1 
ATOM   467  O  O   . ILE A 1 71  ? 22.768 -10.965 26.381 1.00 38.93  ? 244 ILE A O   1 
ATOM   468  C  CB  . ILE A 1 71  ? 21.256 -11.072 23.790 1.00 38.22  ? 244 ILE A CB  1 
ATOM   469  C  CG1 . ILE A 1 71  ? 20.333 -10.336 22.830 1.00 38.09  ? 244 ILE A CG1 1 
ATOM   470  C  CG2 . ILE A 1 71  ? 21.460 -12.512 23.324 1.00 38.22  ? 244 ILE A CG2 1 
ATOM   471  C  CD1 . ILE A 1 71  ? 18.957 -10.928 22.772 1.00 39.83  ? 244 ILE A CD1 1 
ATOM   472  N  N   . LYS A 1 72  ? 21.320 -12.585 26.958 1.00 39.60  ? 245 LYS A N   1 
ATOM   473  C  CA  . LYS A 1 72  ? 22.214 -13.138 27.959 1.00 41.14  ? 245 LYS A CA  1 
ATOM   474  C  C   . LYS A 1 72  ? 21.802 -14.539 28.346 1.00 41.99  ? 245 LYS A C   1 
ATOM   475  O  O   . LYS A 1 72  ? 20.750 -14.731 28.971 1.00 42.20  ? 245 LYS A O   1 
ATOM   476  C  CB  . LYS A 1 72  ? 22.229 -12.272 29.209 1.00 41.04  ? 245 LYS A CB  1 
ATOM   477  C  CG  . LYS A 1 72  ? 23.397 -12.575 30.117 1.00 43.88  ? 245 LYS A CG  1 
ATOM   478  C  CD  . LYS A 1 72  ? 23.009 -12.497 31.605 1.00 48.36  ? 245 LYS A CD  1 
ATOM   479  C  CE  . LYS A 1 72  ? 24.194 -12.823 32.549 1.00 50.52  ? 245 LYS A CE  1 
ATOM   480  N  NZ  . LYS A 1 72  ? 24.848 -14.169 32.269 1.00 51.80  ? 245 LYS A NZ  1 
ATOM   481  N  N   . SER A 1 73  ? 22.633 -15.518 27.977 1.00 43.10  ? 246 SER A N   1 
ATOM   482  C  CA  . SER A 1 73  ? 22.396 -16.917 28.354 1.00 43.73  ? 246 SER A CA  1 
ATOM   483  C  C   . SER A 1 73  ? 22.312 -17.028 29.860 1.00 43.65  ? 246 SER A C   1 
ATOM   484  O  O   . SER A 1 73  ? 23.046 -16.356 30.578 1.00 43.84  ? 246 SER A O   1 
ATOM   485  C  CB  . SER A 1 73  ? 23.483 -17.846 27.815 1.00 43.78  ? 246 SER A CB  1 
ATOM   486  O  OG  . SER A 1 73  ? 24.602 -17.100 27.347 1.00 45.90  ? 246 SER A OG  1 
ATOM   487  N  N   . LYS A 1 74  ? 21.393 -17.854 30.334 1.00 43.76  ? 247 LYS A N   1 
ATOM   488  C  CA  . LYS A 1 74  ? 21.212 -18.002 31.754 1.00 44.16  ? 247 LYS A CA  1 
ATOM   489  C  C   . LYS A 1 74  ? 20.839 -19.435 32.197 1.00 44.83  ? 247 LYS A C   1 
ATOM   490  O  O   . LYS A 1 74  ? 20.424 -20.271 31.378 1.00 44.88  ? 247 LYS A O   1 
ATOM   491  C  CB  . LYS A 1 74  ? 20.193 -16.966 32.223 1.00 44.02  ? 247 LYS A CB  1 
ATOM   492  C  CG  . LYS A 1 74  ? 18.737 -17.375 32.111 1.00 43.03  ? 247 LYS A CG  1 
ATOM   493  C  CD  . LYS A 1 74  ? 17.917 -16.540 33.064 1.00 42.71  ? 247 LYS A CD  1 
ATOM   494  C  CE  . LYS A 1 74  ? 17.015 -17.419 33.887 1.00 43.38  ? 247 LYS A CE  1 
ATOM   495  N  NZ  . LYS A 1 74  ? 16.723 -16.832 35.223 1.00 42.88  ? 247 LYS A NZ  1 
ATOM   496  N  N   . GLN A 1 75  ? 21.003 -19.722 33.488 1.00 45.25  ? 248 GLN A N   1 
ATOM   497  C  CA  . GLN A 1 75  ? 20.557 -20.989 34.039 1.00 45.82  ? 248 GLN A CA  1 
ATOM   498  C  C   . GLN A 1 75  ? 19.543 -20.768 35.158 1.00 45.46  ? 248 GLN A C   1 
ATOM   499  O  O   . GLN A 1 75  ? 19.823 -20.084 36.132 1.00 45.51  ? 248 GLN A O   1 
ATOM   500  C  CB  . GLN A 1 75  ? 21.748 -21.817 34.531 1.00 46.14  ? 248 GLN A CB  1 
ATOM   501  C  CG  . GLN A 1 75  ? 21.493 -23.336 34.530 1.00 49.32  ? 248 GLN A CG  1 
ATOM   502  C  CD  . GLN A 1 75  ? 22.751 -24.175 34.808 1.00 52.61  ? 248 GLN A CD  1 
ATOM   503  O  OE1 . GLN A 1 75  ? 23.039 -25.153 34.097 1.00 53.74  ? 248 GLN A OE1 1 
ATOM   504  N  NE2 . GLN A 1 75  ? 23.499 -23.794 35.840 1.00 53.14  ? 248 GLN A NE2 1 
ATOM   505  N  N   . THR A 1 76  ? 18.360 -21.352 35.019 1.00 45.37  ? 249 THR A N   1 
ATOM   506  C  CA  . THR A 1 76  ? 17.361 -21.275 36.075 1.00 45.36  ? 249 THR A CA  1 
ATOM   507  C  C   . THR A 1 76  ? 17.804 -22.035 37.329 1.00 45.27  ? 249 THR A C   1 
ATOM   508  O  O   . THR A 1 76  ? 18.673 -22.889 37.276 1.00 45.01  ? 249 THR A O   1 
ATOM   509  C  CB  . THR A 1 76  ? 15.968 -21.769 35.598 1.00 45.49  ? 249 THR A CB  1 
ATOM   510  O  OG1 . THR A 1 76  ? 15.919 -23.205 35.601 1.00 45.56  ? 249 THR A OG1 1 
ATOM   511  C  CG2 . THR A 1 76  ? 15.660 -21.238 34.204 1.00 45.13  ? 249 THR A CG2 1 
ATOM   512  N  N   . SER A 1 77  ? 17.194 -21.709 38.460 1.00 45.55  ? 250 SER A N   1 
ATOM   513  C  CA  . SER A 1 77  ? 17.488 -22.389 39.708 1.00 45.82  ? 250 SER A CA  1 
ATOM   514  C  C   . SER A 1 77  ? 17.213 -23.897 39.630 1.00 45.77  ? 250 SER A C   1 
ATOM   515  O  O   . SER A 1 77  ? 17.499 -24.636 40.585 1.00 46.25  ? 250 SER A O   1 
ATOM   516  C  CB  . SER A 1 77  ? 16.677 -21.759 40.845 1.00 46.27  ? 250 SER A CB  1 
ATOM   517  O  OG  . SER A 1 77  ? 15.291 -21.699 40.541 1.00 46.88  ? 250 SER A OG  1 
ATOM   518  N  N   . GLU A 1 78  ? 16.662 -24.345 38.495 1.00 45.05  ? 251 GLU A N   1 
ATOM   519  C  CA  . GLU A 1 78  ? 16.372 -25.760 38.269 1.00 43.96  ? 251 GLU A CA  1 
ATOM   520  C  C   . GLU A 1 78  ? 17.265 -26.330 37.185 1.00 43.56  ? 251 GLU A C   1 
ATOM   521  O  O   . GLU A 1 78  ? 17.037 -27.440 36.725 1.00 43.77  ? 251 GLU A O   1 
ATOM   522  C  CB  . GLU A 1 78  ? 14.902 -25.979 37.894 1.00 43.70  ? 251 GLU A CB  1 
ATOM   523  C  CG  . GLU A 1 78  ? 13.894 -25.498 38.930 1.00 43.61  ? 251 GLU A CG  1 
ATOM   524  C  CD  . GLU A 1 78  ? 13.579 -24.013 38.807 1.00 43.91  ? 251 GLU A CD  1 
ATOM   525  O  OE1 . GLU A 1 78  ? 14.174 -23.347 37.930 1.00 43.77  ? 251 GLU A OE1 1 
ATOM   526  O  OE2 . GLU A 1 78  ? 12.731 -23.514 39.583 1.00 44.17  ? 251 GLU A OE2 1 
ATOM   527  N  N   . GLY A 1 79  ? 18.261 -25.561 36.759 1.00 43.20  ? 252 GLY A N   1 
ATOM   528  C  CA  . GLY A 1 79  ? 19.298 -26.060 35.858 1.00 43.22  ? 252 GLY A CA  1 
ATOM   529  C  C   . GLY A 1 79  ? 18.963 -26.089 34.377 1.00 43.40  ? 252 GLY A C   1 
ATOM   530  O  O   . GLY A 1 79  ? 19.700 -26.681 33.586 1.00 43.59  ? 252 GLY A O   1 
ATOM   531  N  N   . GLU A 1 80  ? 17.845 -25.477 33.994 1.00 43.36  ? 253 GLU A N   1 
ATOM   532  C  CA  . GLU A 1 80  ? 17.513 -25.302 32.581 1.00 43.05  ? 253 GLU A CA  1 
ATOM   533  C  C   . GLU A 1 80  ? 18.441 -24.224 32.053 1.00 43.14  ? 253 GLU A C   1 
ATOM   534  O  O   . GLU A 1 80  ? 18.494 -23.129 32.601 1.00 43.29  ? 253 GLU A O   1 
ATOM   535  C  CB  . GLU A 1 80  ? 16.052 -24.877 32.399 1.00 42.78  ? 253 GLU A CB  1 
ATOM   536  C  CG  . GLU A 1 80  ? 15.616 -24.719 30.944 1.00 42.24  ? 253 GLU A CG  1 
ATOM   537  C  CD  . GLU A 1 80  ? 14.167 -24.232 30.785 1.00 42.98  ? 253 GLU A CD  1 
ATOM   538  O  OE1 . GLU A 1 80  ? 13.496 -23.951 31.805 1.00 43.13  ? 253 GLU A OE1 1 
ATOM   539  O  OE2 . GLU A 1 80  ? 13.691 -24.121 29.630 1.00 42.83  ? 253 GLU A OE2 1 
ATOM   540  N  N   . PHE A 1 81  ? 19.201 -24.553 31.015 1.00 43.33  ? 254 PHE A N   1 
ATOM   541  C  CA  . PHE A 1 81  ? 20.100 -23.596 30.392 1.00 43.21  ? 254 PHE A CA  1 
ATOM   542  C  C   . PHE A 1 81  ? 19.391 -22.973 29.216 1.00 43.42  ? 254 PHE A C   1 
ATOM   543  O  O   . PHE A 1 81  ? 18.943 -23.692 28.315 1.00 43.51  ? 254 PHE A O   1 
ATOM   544  C  CB  . PHE A 1 81  ? 21.368 -24.273 29.905 1.00 43.01  ? 254 PHE A CB  1 
ATOM   545  C  CG  . PHE A 1 81  ? 22.309 -23.338 29.223 1.00 43.34  ? 254 PHE A CG  1 
ATOM   546  C  CD1 . PHE A 1 81  ? 23.103 -22.457 29.968 1.00 43.95  ? 254 PHE A CD1 1 
ATOM   547  C  CD2 . PHE A 1 81  ? 22.408 -23.322 27.829 1.00 43.66  ? 254 PHE A CD2 1 
ATOM   548  C  CE1 . PHE A 1 81  ? 23.985 -21.563 29.328 1.00 43.60  ? 254 PHE A CE1 1 
ATOM   549  C  CE2 . PHE A 1 81  ? 23.287 -22.433 27.172 1.00 43.34  ? 254 PHE A CE2 1 
ATOM   550  C  CZ  . PHE A 1 81  ? 24.073 -21.552 27.923 1.00 43.19  ? 254 PHE A CZ  1 
ATOM   551  N  N   . ILE A 1 82  ? 19.285 -21.636 29.231 1.00 43.65  ? 255 ILE A N   1 
ATOM   552  C  CA  . ILE A 1 82  ? 18.626 -20.862 28.153 1.00 43.18  ? 255 ILE A CA  1 
ATOM   553  C  C   . ILE A 1 82  ? 19.651 -20.010 27.417 1.00 42.93  ? 255 ILE A C   1 
ATOM   554  O  O   . ILE A 1 82  ? 20.043 -18.953 27.902 1.00 42.90  ? 255 ILE A O   1 
ATOM   555  C  CB  . ILE A 1 82  ? 17.487 -19.939 28.685 1.00 42.96  ? 255 ILE A CB  1 
ATOM   556  C  CG1 . ILE A 1 82  ? 16.535 -20.724 29.584 1.00 42.24  ? 255 ILE A CG1 1 
ATOM   557  C  CG2 . ILE A 1 82  ? 16.736 -19.304 27.523 1.00 42.58  ? 255 ILE A CG2 1 
ATOM   558  C  CD1 . ILE A 1 82  ? 15.657 -19.879 30.471 1.00 42.49  ? 255 ILE A CD1 1 
ATOM   559  N  N   . PRO A 1 83  ? 20.098 -20.474 26.246 1.00 42.89  ? 256 PRO A N   1 
ATOM   560  C  CA  . PRO A 1 83  ? 21.137 -19.734 25.549 1.00 43.17  ? 256 PRO A CA  1 
ATOM   561  C  C   . PRO A 1 83  ? 20.586 -18.438 24.978 1.00 43.34  ? 256 PRO A C   1 
ATOM   562  O  O   . PRO A 1 83  ? 19.424 -18.394 24.549 1.00 43.58  ? 256 PRO A O   1 
ATOM   563  C  CB  . PRO A 1 83  ? 21.559 -20.696 24.426 1.00 42.93  ? 256 PRO A CB  1 
ATOM   564  C  CG  . PRO A 1 83  ? 20.415 -21.542 24.201 1.00 42.50  ? 256 PRO A CG  1 
ATOM   565  C  CD  . PRO A 1 83  ? 19.732 -21.705 25.531 1.00 42.76  ? 256 PRO A CD  1 
ATOM   566  N  N   . LEU A 1 84  ? 21.392 -17.382 25.001 1.00 43.18  ? 257 LEU A N   1 
ATOM   567  C  CA  . LEU A 1 84  ? 20.994 -16.144 24.343 1.00 43.03  ? 257 LEU A CA  1 
ATOM   568  C  C   . LEU A 1 84  ? 19.533 -15.766 24.633 1.00 42.68  ? 257 LEU A C   1 
ATOM   569  O  O   . LEU A 1 84  ? 18.787 -15.331 23.754 1.00 42.42  ? 257 LEU A O   1 
ATOM   570  C  CB  . LEU A 1 84  ? 21.248 -16.266 22.845 1.00 43.17  ? 257 LEU A CB  1 
ATOM   571  C  CG  . LEU A 1 84  ? 22.628 -15.753 22.408 1.00 43.87  ? 257 LEU A CG  1 
ATOM   572  C  CD1 . LEU A 1 84  ? 23.766 -16.681 22.797 1.00 43.16  ? 257 LEU A CD1 1 
ATOM   573  C  CD2 . LEU A 1 84  ? 22.627 -15.497 20.914 1.00 44.63  ? 257 LEU A CD2 1 
ATOM   574  N  N   . ASN A 1 85  ? 19.159 -15.954 25.897 1.00 42.27  ? 258 ASN A N   1 
ATOM   575  C  CA  . ASN A 1 85  ? 17.874 -15.579 26.455 1.00 41.37  ? 258 ASN A CA  1 
ATOM   576  C  C   . ASN A 1 85  ? 17.625 -14.060 26.411 1.00 40.70  ? 258 ASN A C   1 
ATOM   577  O  O   . ASN A 1 85  ? 18.537 -13.250 26.611 1.00 40.09  ? 258 ASN A O   1 
ATOM   578  C  CB  . ASN A 1 85  ? 17.831 -16.147 27.872 1.00 41.76  ? 258 ASN A CB  1 
ATOM   579  C  CG  . ASN A 1 85  ? 16.810 -15.485 28.757 1.00 42.39  ? 258 ASN A CG  1 
ATOM   580  O  OD1 . ASN A 1 85  ? 15.630 -15.825 28.718 1.00 40.67  ? 258 ASN A OD1 1 
ATOM   581  N  ND2 . ASN A 1 85  ? 17.277 -14.557 29.613 1.00 44.54  ? 258 ASN A ND2 1 
ATOM   582  N  N   . GLN A 1 86  ? 16.381 -13.696 26.112 1.00 40.40  ? 259 GLN A N   1 
ATOM   583  C  CA  . GLN A 1 86  ? 15.978 -12.305 25.913 1.00 40.43  ? 259 GLN A CA  1 
ATOM   584  C  C   . GLN A 1 86  ? 15.220 -11.764 27.112 1.00 40.08  ? 259 GLN A C   1 
ATOM   585  O  O   . GLN A 1 86  ? 14.375 -12.449 27.667 1.00 40.16  ? 259 GLN A O   1 
ATOM   586  C  CB  . GLN A 1 86  ? 15.064 -12.185 24.697 1.00 40.31  ? 259 GLN A CB  1 
ATOM   587  C  CG  . GLN A 1 86  ? 15.689 -12.578 23.388 1.00 42.50  ? 259 GLN A CG  1 
ATOM   588  C  CD  . GLN A 1 86  ? 14.979 -11.980 22.177 1.00 45.65  ? 259 GLN A CD  1 
ATOM   589  O  OE1 . GLN A 1 86  ? 15.331 -12.293 21.036 1.00 47.80  ? 259 GLN A OE1 1 
ATOM   590  N  NE2 . GLN A 1 86  ? 13.975 -11.124 22.414 1.00 45.76  ? 259 GLN A NE2 1 
ATOM   591  N  N   . THR A 1 87  ? 15.521 -10.534 27.509 1.00 39.79  ? 260 THR A N   1 
ATOM   592  C  CA  . THR A 1 87  ? 14.701 -9.813  28.491 1.00 39.81  ? 260 THR A CA  1 
ATOM   593  C  C   . THR A 1 87  ? 14.652 -8.322  28.152 1.00 39.12  ? 260 THR A C   1 
ATOM   594  O  O   . THR A 1 87  ? 15.599 -7.762  27.619 1.00 38.90  ? 260 THR A O   1 
ATOM   595  C  CB  . THR A 1 87  ? 15.140 -10.059 29.951 1.00 39.88  ? 260 THR A CB  1 
ATOM   596  O  OG1 . THR A 1 87  ? 16.564 -9.925  30.057 1.00 42.41  ? 260 THR A OG1 1 
ATOM   597  C  CG2 . THR A 1 87  ? 14.744 -11.492 30.410 1.00 40.49  ? 260 THR A CG2 1 
ATOM   598  N  N   . ASP A 1 88  ? 13.523 -7.694  28.436 1.00 38.70  ? 261 ASP A N   1 
ATOM   599  C  CA  . ASP A 1 88  ? 13.238 -6.375  27.910 1.00 38.05  ? 261 ASP A CA  1 
ATOM   600  C  C   . ASP A 1 88  ? 13.747 -5.308  28.855 1.00 37.41  ? 261 ASP A C   1 
ATOM   601  O  O   . ASP A 1 88  ? 13.284 -5.221  29.967 1.00 37.34  ? 261 ASP A O   1 
ATOM   602  C  CB  . ASP A 1 88  ? 11.726 -6.225  27.668 1.00 38.23  ? 261 ASP A CB  1 
ATOM   603  C  CG  . ASP A 1 88  ? 11.411 -5.344  26.478 1.00 38.58  ? 261 ASP A CG  1 
ATOM   604  O  OD1 . ASP A 1 88  ? 10.953 -5.865  25.430 1.00 38.63  ? 261 ASP A OD1 1 
ATOM   605  O  OD2 . ASP A 1 88  ? 11.649 -4.124  26.582 1.00 40.15  ? 261 ASP A OD2 1 
ATOM   606  N  N   . ILE A 1 89  ? 14.713 -4.519  28.390 1.00 36.94  ? 262 ILE A N   1 
ATOM   607  C  CA  . ILE A 1 89  ? 15.281 -3.392  29.112 1.00 36.25  ? 262 ILE A CA  1 
ATOM   608  C  C   . ILE A 1 89  ? 14.363 -2.180  29.013 1.00 36.36  ? 262 ILE A C   1 
ATOM   609  O  O   . ILE A 1 89  ? 13.932 -1.806  27.932 1.00 36.24  ? 262 ILE A O   1 
ATOM   610  C  CB  . ILE A 1 89  ? 16.652 -3.027  28.541 1.00 36.31  ? 262 ILE A CB  1 
ATOM   611  C  CG1 . ILE A 1 89  ? 17.619 -4.194  28.730 1.00 36.84  ? 262 ILE A CG1 1 
ATOM   612  C  CG2 . ILE A 1 89  ? 17.211 -1.755  29.193 1.00 35.78  ? 262 ILE A CG2 1 
ATOM   613  C  CD1 . ILE A 1 89  ? 18.982 -4.039  28.026 1.00 37.29  ? 262 ILE A CD1 1 
ATOM   614  N  N   . ASN A 1 90  ? 14.086 -1.563  30.156 1.00 36.60  ? 263 ASN A N   1 
ATOM   615  C  CA  . ASN A 1 90  ? 13.089 -0.519  30.254 1.00 36.87  ? 263 ASN A CA  1 
ATOM   616  C  C   . ASN A 1 90  ? 13.615 0.808   29.782 1.00 36.90  ? 263 ASN A C   1 
ATOM   617  O  O   . ASN A 1 90  ? 14.493 1.364   30.408 1.00 37.42  ? 263 ASN A O   1 
ATOM   618  C  CB  . ASN A 1 90  ? 12.617 -0.391  31.702 1.00 36.83  ? 263 ASN A CB  1 
ATOM   619  C  CG  . ASN A 1 90  ? 11.483 0.617   31.869 1.00 37.46  ? 263 ASN A CG  1 
ATOM   620  O  OD1 . ASN A 1 90  ? 11.314 1.544   31.075 1.00 38.49  ? 263 ASN A OD1 1 
ATOM   621  N  ND2 . ASN A 1 90  ? 10.706 0.440   32.918 1.00 39.95  ? 263 ASN A ND2 1 
ATOM   622  N  N   . VAL A 1 91  ? 13.056 1.335   28.698 1.00 37.39  ? 264 VAL A N   1 
ATOM   623  C  CA  . VAL A 1 91  ? 13.516 2.624   28.150 1.00 37.63  ? 264 VAL A CA  1 
ATOM   624  C  C   . VAL A 1 91  ? 12.369 3.611   27.955 1.00 38.25  ? 264 VAL A C   1 
ATOM   625  O  O   . VAL A 1 91  ? 12.366 4.380   26.987 1.00 38.52  ? 264 VAL A O   1 
ATOM   626  C  CB  . VAL A 1 91  ? 14.321 2.460   26.819 1.00 37.33  ? 264 VAL A CB  1 
ATOM   627  C  CG1 . VAL A 1 91  ? 15.638 1.705   27.061 1.00 37.07  ? 264 VAL A CG1 1 
ATOM   628  C  CG2 . VAL A 1 91  ? 13.486 1.740   25.747 1.00 37.51  ? 264 VAL A CG2 1 
ATOM   629  N  N   . GLY A 1 92  ? 11.396 3.562   28.873 1.00 38.99  ? 265 GLY A N   1 
ATOM   630  C  CA  . GLY A 1 92  ? 10.265 4.516   28.936 1.00 39.73  ? 265 GLY A CA  1 
ATOM   631  C  C   . GLY A 1 92  ? 8.944  3.913   28.485 1.00 40.84  ? 265 GLY A C   1 
ATOM   632  O  O   . GLY A 1 92  ? 8.159  4.558   27.789 1.00 41.75  ? 265 GLY A O   1 
ATOM   633  N  N   . TYR A 1 93  ? 8.709  2.649   28.839 1.00 41.11  ? 266 TYR A N   1 
ATOM   634  C  CA  . TYR A 1 93  ? 7.550  1.915   28.347 1.00 41.14  ? 266 TYR A CA  1 
ATOM   635  C  C   . TYR A 1 93  ? 6.371  2.458   29.100 1.00 41.03  ? 266 TYR A C   1 
ATOM   636  O  O   . TYR A 1 93  ? 5.346  2.798   28.531 1.00 41.31  ? 266 TYR A O   1 
ATOM   637  C  CB  . TYR A 1 93  ? 7.758  0.415   28.614 1.00 41.76  ? 266 TYR A CB  1 
ATOM   638  C  CG  . TYR A 1 93  ? 6.674  -0.554  28.135 1.00 43.47  ? 266 TYR A CG  1 
ATOM   639  C  CD1 . TYR A 1 93  ? 6.321  -0.646  26.788 1.00 45.16  ? 266 TYR A CD1 1 
ATOM   640  C  CD2 . TYR A 1 93  ? 6.040  -1.418  29.035 1.00 45.06  ? 266 TYR A CD2 1 
ATOM   641  C  CE1 . TYR A 1 93  ? 5.341  -1.547  26.359 1.00 45.71  ? 266 TYR A CE1 1 
ATOM   642  C  CE2 . TYR A 1 93  ? 5.064  -2.319  28.619 1.00 44.89  ? 266 TYR A CE2 1 
ATOM   643  C  CZ  . TYR A 1 93  ? 4.722  -2.380  27.288 1.00 46.16  ? 266 TYR A CZ  1 
ATOM   644  O  OH  . TYR A 1 93  ? 3.753  -3.275  26.884 1.00 47.24  ? 266 TYR A OH  1 
ATOM   645  N  N   . TYR A 1 94  ? 6.550  2.589   30.401 1.00 41.27  ? 267 TYR A N   1 
ATOM   646  C  CA  . TYR A 1 94  ? 5.465  2.885   31.311 1.00 40.95  ? 267 TYR A CA  1 
ATOM   647  C  C   . TYR A 1 94  ? 4.940  4.306   31.194 1.00 40.82  ? 267 TYR A C   1 
ATOM   648  O  O   . TYR A 1 94  ? 3.728  4.533   31.285 1.00 41.06  ? 267 TYR A O   1 
ATOM   649  C  CB  . TYR A 1 94  ? 5.915  2.606   32.732 1.00 40.82  ? 267 TYR A CB  1 
ATOM   650  C  CG  . TYR A 1 94  ? 6.218  1.145   33.007 1.00 41.79  ? 267 TYR A CG  1 
ATOM   651  C  CD1 . TYR A 1 94  ? 5.223  0.158   32.869 1.00 42.37  ? 267 TYR A CD1 1 
ATOM   652  C  CD2 . TYR A 1 94  ? 7.491  0.744   33.439 1.00 41.09  ? 267 TYR A CD2 1 
ATOM   653  C  CE1 . TYR A 1 94  ? 5.503  -1.183  33.133 1.00 42.49  ? 267 TYR A CE1 1 
ATOM   654  C  CE2 . TYR A 1 94  ? 7.772  -0.597  33.706 1.00 40.25  ? 267 TYR A CE2 1 
ATOM   655  C  CZ  . TYR A 1 94  ? 6.781  -1.542  33.550 1.00 41.64  ? 267 TYR A CZ  1 
ATOM   656  O  OH  . TYR A 1 94  ? 7.050  -2.852  33.824 1.00 43.29  ? 267 TYR A OH  1 
ATOM   657  N  N   . THR A 1 95  ? 5.840  5.261   31.000 1.00 40.33  ? 268 THR A N   1 
ATOM   658  C  CA  . THR A 1 95  ? 5.418  6.645   30.858 1.00 40.23  ? 268 THR A CA  1 
ATOM   659  C  C   . THR A 1 95  ? 5.279  7.069   29.402 1.00 40.65  ? 268 THR A C   1 
ATOM   660  O  O   . THR A 1 95  ? 4.941  8.214   29.138 1.00 41.31  ? 268 THR A O   1 
ATOM   661  C  CB  . THR A 1 95  ? 6.380  7.616   31.520 1.00 39.89  ? 268 THR A CB  1 
ATOM   662  O  OG1 . THR A 1 95  ? 7.685  7.448   30.959 1.00 40.02  ? 268 THR A OG1 1 
ATOM   663  C  CG2 . THR A 1 95  ? 6.425  7.388   33.017 1.00 40.47  ? 268 THR A CG2 1 
ATOM   664  N  N   . GLY A 1 96  ? 5.537  6.166   28.453 1.00 40.63  ? 269 GLY A N   1 
ATOM   665  C  CA  . GLY A 1 96  ? 5.401  6.505   27.037 1.00 39.87  ? 269 GLY A CA  1 
ATOM   666  C  C   . GLY A 1 96  ? 6.498  7.437   26.565 1.00 39.80  ? 269 GLY A C   1 
ATOM   667  O  O   . GLY A 1 96  ? 6.366  8.082   25.534 1.00 40.05  ? 269 GLY A O   1 
ATOM   668  N  N   . ASP A 1 97  ? 7.587  7.508   27.323 1.00 39.64  ? 270 ASP A N   1 
ATOM   669  C  CA  . ASP A 1 97  ? 8.817  8.157   26.859 1.00 39.60  ? 270 ASP A CA  1 
ATOM   670  C  C   . ASP A 1 97  ? 9.623  7.318   25.854 1.00 39.13  ? 270 ASP A C   1 
ATOM   671  O  O   . ASP A 1 97  ? 10.752 7.679   25.511 1.00 39.52  ? 270 ASP A O   1 
ATOM   672  C  CB  . ASP A 1 97  ? 9.715  8.512   28.056 1.00 39.87  ? 270 ASP A CB  1 
ATOM   673  C  CG  . ASP A 1 97  ? 9.400  9.873   28.632 1.00 41.05  ? 270 ASP A CG  1 
ATOM   674  O  OD1 . ASP A 1 97  ? 9.520  10.895  27.897 1.00 42.47  ? 270 ASP A OD1 1 
ATOM   675  O  OD2 . ASP A 1 97  ? 9.015  9.915   29.817 1.00 41.86  ? 270 ASP A OD2 1 
ATOM   676  N  N   . ASP A 1 98  ? 9.075  6.178   25.430 1.00 38.37  ? 271 ASP A N   1 
ATOM   677  C  CA  . ASP A 1 98  ? 9.721  5.325   24.433 1.00 37.61  ? 271 ASP A CA  1 
ATOM   678  C  C   . ASP A 1 98  ? 9.151  5.740   23.100 1.00 37.16  ? 271 ASP A C   1 
ATOM   679  O  O   . ASP A 1 98  ? 9.663  5.394   22.050 1.00 36.91  ? 271 ASP A O   1 
ATOM   680  C  CB  . ASP A 1 98  ? 9.488  3.830   24.697 1.00 37.01  ? 271 ASP A CB  1 
ATOM   681  C  CG  . ASP A 1 98  ? 8.010  3.466   24.811 1.00 37.24  ? 271 ASP A CG  1 
ATOM   682  O  OD1 . ASP A 1 98  ? 7.143  4.370   24.811 1.00 38.89  ? 271 ASP A OD1 1 
ATOM   683  O  OD2 . ASP A 1 98  ? 7.701  2.264   24.929 1.00 36.28  ? 271 ASP A OD2 1 
ATOM   684  N  N   . ARG A 1 99  ? 8.070  6.502   23.171 1.00 36.93  ? 272 ARG A N   1 
ATOM   685  C  CA  . ARG A 1 99  ? 7.443  7.047   21.989 1.00 36.65  ? 272 ARG A CA  1 
ATOM   686  C  C   . ARG A 1 99  ? 8.222  8.289   21.632 1.00 36.40  ? 272 ARG A C   1 
ATOM   687  O  O   . ARG A 1 99  ? 8.062  9.342   22.250 1.00 35.73  ? 272 ARG A O   1 
ATOM   688  C  CB  . ARG A 1 99  ? 5.971  7.361   22.248 1.00 36.46  ? 272 ARG A CB  1 
ATOM   689  C  CG  . ARG A 1 99  ? 5.089  6.143   22.427 1.00 36.53  ? 272 ARG A CG  1 
ATOM   690  C  CD  . ARG A 1 99  ? 3.687  6.603   22.743 1.00 38.56  ? 272 ARG A CD  1 
ATOM   691  N  NE  . ARG A 1 99  ? 3.702  7.609   23.812 1.00 40.09  ? 272 ARG A NE  1 
ATOM   692  C  CZ  . ARG A 1 99  ? 2.621  8.203   24.318 1.00 38.91  ? 272 ARG A CZ  1 
ATOM   693  N  NH1 . ARG A 1 99  ? 1.427  7.902   23.857 1.00 39.76  ? 272 ARG A NH1 1 
ATOM   694  N  NH2 . ARG A 1 99  ? 2.730  9.097   25.285 1.00 37.63  ? 272 ARG A NH2 1 
ATOM   695  N  N   . LEU A 1 100 ? 9.091  8.136   20.641 1.00 36.57  ? 273 LEU A N   1 
ATOM   696  C  CA  . LEU A 1 100 ? 10.064 9.168   20.301 1.00 36.69  ? 273 LEU A CA  1 
ATOM   697  C  C   . LEU A 1 100 ? 9.498  10.240  19.381 1.00 37.37  ? 273 LEU A C   1 
ATOM   698  O  O   . LEU A 1 100 ? 8.584  9.990   18.595 1.00 37.96  ? 273 LEU A O   1 
ATOM   699  C  CB  . LEU A 1 100 ? 11.300 8.542   19.676 1.00 35.87  ? 273 LEU A CB  1 
ATOM   700  C  CG  . LEU A 1 100 ? 11.979 7.509   20.561 1.00 35.49  ? 273 LEU A CG  1 
ATOM   701  C  CD1 . LEU A 1 100 ? 13.217 6.981   19.886 1.00 35.18  ? 273 LEU A CD1 1 
ATOM   702  C  CD2 . LEU A 1 100 ? 12.338 8.101   21.911 1.00 35.51  ? 273 LEU A CD2 1 
ATOM   703  N  N   . PHE A 1 101 ? 10.030 11.446  19.507 1.00 37.84  ? 274 PHE A N   1 
ATOM   704  C  CA  . PHE A 1 101 ? 9.722  12.501  18.567 1.00 38.12  ? 274 PHE A CA  1 
ATOM   705  C  C   . PHE A 1 101 ? 11.044 12.868  17.897 1.00 38.87  ? 274 PHE A C   1 
ATOM   706  O  O   . PHE A 1 101 ? 11.611 13.974  18.110 1.00 39.84  ? 274 PHE A O   1 
ATOM   707  C  CB  . PHE A 1 101 ? 9.124  13.710  19.296 1.00 38.11  ? 274 PHE A CB  1 
ATOM   708  C  CG  . PHE A 1 101 ? 9.020  14.937  18.428 1.00 36.57  ? 274 PHE A CG  1 
ATOM   709  C  CD1 . PHE A 1 101 ? 8.350  14.881  17.223 1.00 35.64  ? 274 PHE A CD1 1 
ATOM   710  C  CD2 . PHE A 1 101 ? 9.608  16.142  18.808 1.00 35.53  ? 274 PHE A CD2 1 
ATOM   711  C  CE1 . PHE A 1 101 ? 8.259  16.017  16.408 1.00 35.72  ? 274 PHE A CE1 1 
ATOM   712  C  CE2 . PHE A 1 101 ? 9.506  17.277  18.010 1.00 34.11  ? 274 PHE A CE2 1 
ATOM   713  C  CZ  . PHE A 1 101 ? 8.833  17.213  16.811 1.00 34.09  ? 274 PHE A CZ  1 
ATOM   714  N  N   . LEU A 1 102 ? 11.518 11.929  17.068 1.00 38.73  ? 275 LEU A N   1 
ATOM   715  C  CA  . LEU A 1 102 ? 12.875 12.007  16.470 1.00 38.56  ? 275 LEU A CA  1 
ATOM   716  C  C   . LEU A 1 102 ? 13.078 13.106  15.421 1.00 38.24  ? 275 LEU A C   1 
ATOM   717  O  O   . LEU A 1 102 ? 12.728 12.927  14.256 1.00 39.20  ? 275 LEU A O   1 
ATOM   718  C  CB  . LEU A 1 102 ? 13.231 10.646  15.852 1.00 38.30  ? 275 LEU A CB  1 
ATOM   719  C  CG  . LEU A 1 102 ? 14.713 10.250  15.848 1.00 38.15  ? 275 LEU A CG  1 
ATOM   720  C  CD1 . LEU A 1 102 ? 15.481 10.723  17.087 1.00 37.65  ? 275 LEU A CD1 1 
ATOM   721  C  CD2 . LEU A 1 102 ? 14.803 8.749   15.712 1.00 35.75  ? 275 LEU A CD2 1 
ATOM   722  N  N   . VAL A 1 103 ? 13.605 14.251  15.839 1.00 37.81  ? 276 VAL A N   1 
ATOM   723  C  CA  . VAL A 1 103 ? 13.891 15.334  14.894 1.00 37.66  ? 276 VAL A CA  1 
ATOM   724  C  C   . VAL A 1 103 ? 15.300 15.878  15.149 1.00 37.68  ? 276 VAL A C   1 
ATOM   725  O  O   . VAL A 1 103 ? 15.692 16.931  14.626 1.00 37.66  ? 276 VAL A O   1 
ATOM   726  C  CB  . VAL A 1 103 ? 12.863 16.480  14.977 1.00 37.42  ? 276 VAL A CB  1 
ATOM   727  C  CG1 . VAL A 1 103 ? 11.503 16.019  14.504 1.00 37.29  ? 276 VAL A CG1 1 
ATOM   728  C  CG2 . VAL A 1 103 ? 12.786 16.996  16.376 1.00 37.30  ? 276 VAL A CG2 1 
ATOM   729  N  N   . SER A 1 104 ? 16.037 15.147  15.978 1.00 37.18  ? 277 SER A N   1 
ATOM   730  C  CA  . SER A 1 104 ? 17.468 15.316  16.126 1.00 36.98  ? 277 SER A CA  1 
ATOM   731  C  C   . SER A 1 104 ? 17.943 14.216  17.074 1.00 36.29  ? 277 SER A C   1 
ATOM   732  O  O   . SER A 1 104 ? 17.130 13.533  17.703 1.00 36.28  ? 277 SER A O   1 
ATOM   733  C  CB  . SER A 1 104 ? 17.792 16.696  16.666 1.00 37.24  ? 277 SER A CB  1 
ATOM   734  O  OG  . SER A 1 104 ? 17.064 16.873  17.856 1.00 38.95  ? 277 SER A OG  1 
ATOM   735  N  N   . PRO A 1 105 ? 19.258 14.000  17.141 1.00 35.53  ? 278 PRO A N   1 
ATOM   736  C  CA  . PRO A 1 105 ? 19.722 12.843  17.895 1.00 35.14  ? 278 PRO A CA  1 
ATOM   737  C  C   . PRO A 1 105 ? 19.281 12.906  19.358 1.00 34.66  ? 278 PRO A C   1 
ATOM   738  O  O   . PRO A 1 105 ? 19.325 13.968  19.976 1.00 34.85  ? 278 PRO A O   1 
ATOM   739  C  CB  . PRO A 1 105 ? 21.249 12.924  17.763 1.00 35.05  ? 278 PRO A CB  1 
ATOM   740  C  CG  . PRO A 1 105 ? 21.470 13.709  16.529 1.00 35.26  ? 278 PRO A CG  1 
ATOM   741  C  CD  . PRO A 1 105 ? 20.347 14.682  16.428 1.00 35.31  ? 278 PRO A CD  1 
ATOM   742  N  N   . LEU A 1 106 ? 18.865 11.773  19.902 1.00 33.56  ? 279 LEU A N   1 
ATOM   743  C  CA  . LEU A 1 106 ? 18.383 11.736  21.256 1.00 32.46  ? 279 LEU A CA  1 
ATOM   744  C  C   . LEU A 1 106 ? 19.195 10.752  22.052 1.00 32.63  ? 279 LEU A C   1 
ATOM   745  O  O   . LEU A 1 106 ? 19.558 9.689   21.532 1.00 32.78  ? 279 LEU A O   1 
ATOM   746  C  CB  . LEU A 1 106 ? 16.941 11.264  21.257 1.00 32.21  ? 279 LEU A CB  1 
ATOM   747  C  CG  . LEU A 1 106 ? 15.919 12.074  20.487 1.00 29.60  ? 279 LEU A CG  1 
ATOM   748  C  CD1 . LEU A 1 106 ? 14.595 11.444  20.707 1.00 27.74  ? 279 LEU A CD1 1 
ATOM   749  C  CD2 . LEU A 1 106 ? 15.923 13.506  20.951 1.00 27.61  ? 279 LEU A CD2 1 
ATOM   750  N  N   . ILE A 1 107 ? 19.487 11.101  23.307 1.00 32.28  ? 280 ILE A N   1 
ATOM   751  C  CA  . ILE A 1 107 ? 20.083 10.138  24.233 1.00 32.16  ? 280 ILE A CA  1 
ATOM   752  C  C   . ILE A 1 107 ? 18.961 9.334   24.890 1.00 31.87  ? 280 ILE A C   1 
ATOM   753  O  O   . ILE A 1 107 ? 18.135 9.870   25.612 1.00 31.88  ? 280 ILE A O   1 
ATOM   754  C  CB  . ILE A 1 107 ? 21.002 10.814  25.300 1.00 32.23  ? 280 ILE A CB  1 
ATOM   755  C  CG1 . ILE A 1 107 ? 22.121 11.585  24.619 1.00 32.66  ? 280 ILE A CG1 1 
ATOM   756  C  CG2 . ILE A 1 107 ? 21.638 9.782   26.230 1.00 31.08  ? 280 ILE A CG2 1 
ATOM   757  C  CD1 . ILE A 1 107 ? 22.787 12.567  25.534 1.00 33.49  ? 280 ILE A CD1 1 
ATOM   758  N  N   . ILE A 1 108 ? 18.916 8.043   24.626 1.00 31.57  ? 281 ILE A N   1 
ATOM   759  C  CA  . ILE A 1 108 ? 17.893 7.239   25.249 1.00 31.66  ? 281 ILE A CA  1 
ATOM   760  C  C   . ILE A 1 108 ? 18.461 6.773   26.566 1.00 32.17  ? 281 ILE A C   1 
ATOM   761  O  O   . ILE A 1 108 ? 19.624 6.355   26.612 1.00 33.08  ? 281 ILE A O   1 
ATOM   762  C  CB  . ILE A 1 108 ? 17.474 6.069   24.348 1.00 31.18  ? 281 ILE A CB  1 
ATOM   763  C  CG1 . ILE A 1 108 ? 16.916 6.612   23.018 1.00 30.54  ? 281 ILE A CG1 1 
ATOM   764  C  CG2 . ILE A 1 108 ? 16.470 5.170   25.057 1.00 30.45  ? 281 ILE A CG2 1 
ATOM   765  C  CD1 . ILE A 1 108 ? 15.912 7.776   23.116 1.00 24.57  ? 281 ILE A CD1 1 
ATOM   766  N  N   . SER A 1 109 ? 17.671 6.866   27.634 1.00 32.13  ? 282 SER A N   1 
ATOM   767  C  CA  . SER A 1 109 ? 18.164 6.489   28.953 1.00 32.36  ? 282 SER A CA  1 
ATOM   768  C  C   . SER A 1 109 ? 17.382 5.375   29.621 1.00 32.47  ? 282 SER A C   1 
ATOM   769  O  O   . SER A 1 109 ? 16.156 5.416   29.726 1.00 32.41  ? 282 SER A O   1 
ATOM   770  C  CB  . SER A 1 109 ? 18.226 7.702   29.882 1.00 32.60  ? 282 SER A CB  1 
ATOM   771  O  OG  . SER A 1 109 ? 18.464 7.307   31.234 1.00 33.28  ? 282 SER A OG  1 
ATOM   772  N  N   . HIS A 1 110 ? 18.112 4.381   30.108 1.00 32.85  ? 283 HIS A N   1 
ATOM   773  C  CA  . HIS A 1 110 ? 17.506 3.318   30.894 1.00 33.07  ? 283 HIS A CA  1 
ATOM   774  C  C   . HIS A 1 110 ? 17.968 3.533   32.312 1.00 33.91  ? 283 HIS A C   1 
ATOM   775  O  O   . HIS A 1 110 ? 19.164 3.455   32.581 1.00 33.84  ? 283 HIS A O   1 
ATOM   776  C  CB  . HIS A 1 110 ? 17.969 1.963   30.388 1.00 32.63  ? 283 HIS A CB  1 
ATOM   777  C  CG  . HIS A 1 110 ? 17.800 0.855   31.372 1.00 31.63  ? 283 HIS A CG  1 
ATOM   778  N  ND1 . HIS A 1 110 ? 16.573 0.318   31.684 1.00 31.49  ? 283 HIS A ND1 1 
ATOM   779  C  CD2 . HIS A 1 110 ? 18.708 0.168   32.101 1.00 31.27  ? 283 HIS A CD2 1 
ATOM   780  C  CE1 . HIS A 1 110 ? 16.729 -0.654  32.563 1.00 31.27  ? 283 HIS A CE1 1 
ATOM   781  N  NE2 . HIS A 1 110 ? 18.016 -0.767  32.833 1.00 30.52  ? 283 HIS A NE2 1 
ATOM   782  N  N   . GLU A 1 111 ? 17.036 3.843   33.212 1.00 34.75  ? 284 GLU A N   1 
ATOM   783  C  CA  . GLU A 1 111 ? 17.397 4.024   34.603 1.00 35.98  ? 284 GLU A CA  1 
ATOM   784  C  C   . GLU A 1 111 ? 17.669 2.653   35.228 1.00 36.24  ? 284 GLU A C   1 
ATOM   785  O  O   . GLU A 1 111 ? 16.791 1.777   35.209 1.00 37.16  ? 284 GLU A O   1 
ATOM   786  C  CB  . GLU A 1 111 ? 16.283 4.745   35.346 1.00 36.40  ? 284 GLU A CB  1 
ATOM   787  C  CG  . GLU A 1 111 ? 16.662 5.131   36.780 1.00 39.37  ? 284 GLU A CG  1 
ATOM   788  C  CD  . GLU A 1 111 ? 15.456 5.531   37.639 1.00 42.74  ? 284 GLU A CD  1 
ATOM   789  O  OE1 . GLU A 1 111 ? 14.600 6.311   37.147 1.00 42.87  ? 284 GLU A OE1 1 
ATOM   790  O  OE2 . GLU A 1 111 ? 15.375 5.069   38.810 1.00 44.66  ? 284 GLU A OE2 1 
ATOM   791  N  N   . ILE A 1 112 ? 18.874 2.454   35.763 1.00 36.03  ? 285 ILE A N   1 
ATOM   792  C  CA  . ILE A 1 112 ? 19.261 1.147   36.310 1.00 35.78  ? 285 ILE A CA  1 
ATOM   793  C  C   . ILE A 1 112 ? 18.720 1.017   37.716 1.00 36.48  ? 285 ILE A C   1 
ATOM   794  O  O   . ILE A 1 112 ? 19.360 1.479   38.665 1.00 36.51  ? 285 ILE A O   1 
ATOM   795  C  CB  . ILE A 1 112 ? 20.804 0.955   36.336 1.00 35.58  ? 285 ILE A CB  1 
ATOM   796  C  CG1 . ILE A 1 112 ? 21.379 1.070   34.934 1.00 34.87  ? 285 ILE A CG1 1 
ATOM   797  C  CG2 . ILE A 1 112 ? 21.199 -0.392  36.929 1.00 34.80  ? 285 ILE A CG2 1 
ATOM   798  C  CD1 . ILE A 1 112 ? 22.849 1.010   34.911 1.00 34.10  ? 285 ILE A CD1 1 
ATOM   799  N  N   . ASN A 1 113 ? 17.540 0.403   37.849 1.00 37.00  ? 286 ASN A N   1 
ATOM   800  C  CA  . ASN A 1 113 ? 16.870 0.246   39.149 1.00 37.10  ? 286 ASN A CA  1 
ATOM   801  C  C   . ASN A 1 113 ? 16.680 -1.234  39.512 1.00 37.68  ? 286 ASN A C   1 
ATOM   802  O  O   . ASN A 1 113 ? 17.098 -2.133  38.767 1.00 37.99  ? 286 ASN A O   1 
ATOM   803  C  CB  . ASN A 1 113 ? 15.515 0.983   39.147 1.00 36.78  ? 286 ASN A CB  1 
ATOM   804  C  CG  . ASN A 1 113 ? 14.505 0.406   38.148 1.00 36.05  ? 286 ASN A CG  1 
ATOM   805  O  OD1 . ASN A 1 113 ? 14.565 -0.757  37.749 1.00 36.79  ? 286 ASN A OD1 1 
ATOM   806  N  ND2 . ASN A 1 113 ? 13.543 1.227   37.774 1.00 35.66  ? 286 ASN A ND2 1 
ATOM   807  N  N   . GLN A 1 114 ? 15.973 -1.469  40.620 1.00 38.48  ? 287 GLN A N   1 
ATOM   808  C  CA  . GLN A 1 114 ? 15.686 -2.834  41.119 1.00 38.97  ? 287 GLN A CA  1 
ATOM   809  C  C   . GLN A 1 114 ? 15.168 -3.831  40.073 1.00 38.67  ? 287 GLN A C   1 
ATOM   810  O  O   . GLN A 1 114 ? 15.437 -5.039  40.196 1.00 38.39  ? 287 GLN A O   1 
ATOM   811  C  CB  . GLN A 1 114 ? 14.718 -2.795  42.304 1.00 39.21  ? 287 GLN A CB  1 
ATOM   812  C  CG  . GLN A 1 114 ? 14.444 -4.174  42.911 1.00 41.73  ? 287 GLN A CG  1 
ATOM   813  C  CD  . GLN A 1 114 ? 14.347 -4.119  44.438 1.00 45.95  ? 287 GLN A CD  1 
ATOM   814  O  OE1 . GLN A 1 114 ? 13.666 -3.248  45.010 1.00 44.58  ? 287 GLN A OE1 1 
ATOM   815  N  NE2 . GLN A 1 114 ? 15.062 -5.038  45.110 1.00 47.26  ? 287 GLN A NE2 1 
ATOM   816  N  N   . GLN A 1 115 ? 14.434 -3.335  39.066 1.00 38.21  ? 288 GLN A N   1 
ATOM   817  C  CA  . GLN A 1 115 ? 13.939 -4.193  37.977 1.00 37.91  ? 288 GLN A CA  1 
ATOM   818  C  C   . GLN A 1 115 ? 14.921 -4.357  36.825 1.00 37.06  ? 288 GLN A C   1 
ATOM   819  O  O   . GLN A 1 115 ? 14.813 -5.293  36.049 1.00 36.97  ? 288 GLN A O   1 
ATOM   820  C  CB  . GLN A 1 115 ? 12.570 -3.741  37.451 1.00 38.20  ? 288 GLN A CB  1 
ATOM   821  C  CG  . GLN A 1 115 ? 11.435 -3.995  38.418 1.00 38.98  ? 288 GLN A CG  1 
ATOM   822  C  CD  . GLN A 1 115 ? 11.504 -3.038  39.597 1.00 42.46  ? 288 GLN A CD  1 
ATOM   823  O  OE1 . GLN A 1 115 ? 11.678 -1.816  39.415 1.00 43.33  ? 288 GLN A OE1 1 
ATOM   824  N  NE2 . GLN A 1 115 ? 11.404 -3.582  40.818 1.00 42.35  ? 288 GLN A NE2 1 
ATOM   825  N  N   . SER A 1 116 ? 15.875 -3.449  36.719 1.00 36.53  ? 289 SER A N   1 
ATOM   826  C  CA  . SER A 1 116 ? 16.879 -3.518  35.673 1.00 36.37  ? 289 SER A CA  1 
ATOM   827  C  C   . SER A 1 116 ? 17.863 -4.677  35.877 1.00 36.71  ? 289 SER A C   1 
ATOM   828  O  O   . SER A 1 116 ? 18.291 -4.969  36.999 1.00 36.85  ? 289 SER A O   1 
ATOM   829  C  CB  . SER A 1 116 ? 17.634 -2.194  35.572 1.00 36.04  ? 289 SER A CB  1 
ATOM   830  O  OG  . SER A 1 116 ? 18.778 -2.335  34.760 1.00 35.41  ? 289 SER A OG  1 
ATOM   831  N  N   . PRO A 1 117 ? 18.226 -5.350  34.779 1.00 37.01  ? 290 PRO A N   1 
ATOM   832  C  CA  . PRO A 1 117 ? 19.219 -6.420  34.817 1.00 37.18  ? 290 PRO A CA  1 
ATOM   833  C  C   . PRO A 1 117 ? 20.614 -5.969  35.260 1.00 37.40  ? 290 PRO A C   1 
ATOM   834  O  O   . PRO A 1 117 ? 21.448 -6.820  35.594 1.00 37.26  ? 290 PRO A O   1 
ATOM   835  C  CB  . PRO A 1 117 ? 19.248 -6.913  33.371 1.00 36.88  ? 290 PRO A CB  1 
ATOM   836  C  CG  . PRO A 1 117 ? 18.709 -5.781  32.585 1.00 36.73  ? 290 PRO A CG  1 
ATOM   837  C  CD  . PRO A 1 117 ? 17.644 -5.211  33.437 1.00 36.80  ? 290 PRO A CD  1 
ATOM   838  N  N   . PHE A 1 118 ? 20.862 -4.659  35.283 1.00 37.58  ? 291 PHE A N   1 
ATOM   839  C  CA  . PHE A 1 118 ? 22.186 -4.140  35.684 1.00 38.02  ? 291 PHE A CA  1 
ATOM   840  C  C   . PHE A 1 118 ? 22.264 -3.738  37.158 1.00 38.23  ? 291 PHE A C   1 
ATOM   841  O  O   . PHE A 1 118 ? 23.300 -3.285  37.645 1.00 37.66  ? 291 PHE A O   1 
ATOM   842  C  CB  . PHE A 1 118 ? 22.588 -2.977  34.806 1.00 37.63  ? 291 PHE A CB  1 
ATOM   843  C  CG  . PHE A 1 118 ? 22.544 -3.289  33.365 1.00 37.97  ? 291 PHE A CG  1 
ATOM   844  C  CD1 . PHE A 1 118 ? 23.694 -3.633  32.687 1.00 37.47  ? 291 PHE A CD1 1 
ATOM   845  C  CD2 . PHE A 1 118 ? 21.349 -3.233  32.671 1.00 39.53  ? 291 PHE A CD2 1 
ATOM   846  C  CE1 . PHE A 1 118 ? 23.659 -3.916  31.344 1.00 37.59  ? 291 PHE A CE1 1 
ATOM   847  C  CE2 . PHE A 1 118 ? 21.306 -3.521  31.318 1.00 39.72  ? 291 PHE A CE2 1 
ATOM   848  C  CZ  . PHE A 1 118 ? 22.470 -3.866  30.656 1.00 38.57  ? 291 PHE A CZ  1 
ATOM   849  N  N   . TRP A 1 119 ? 21.149 -3.928  37.852 1.00 38.72  ? 292 TRP A N   1 
ATOM   850  C  CA  . TRP A 1 119 ? 21.038 -3.626  39.261 1.00 39.49  ? 292 TRP A CA  1 
ATOM   851  C  C   . TRP A 1 119 ? 22.261 -4.068  40.050 1.00 40.20  ? 292 TRP A C   1 
ATOM   852  O  O   . TRP A 1 119 ? 22.806 -3.302  40.831 1.00 40.50  ? 292 TRP A O   1 
ATOM   853  C  CB  . TRP A 1 119 ? 19.787 -4.301  39.810 1.00 39.51  ? 292 TRP A CB  1 
ATOM   854  C  CG  . TRP A 1 119 ? 19.453 -3.962  41.204 1.00 38.53  ? 292 TRP A CG  1 
ATOM   855  C  CD1 . TRP A 1 119 ? 19.292 -4.831  42.218 1.00 37.74  ? 292 TRP A CD1 1 
ATOM   856  C  CD2 . TRP A 1 119 ? 19.216 -2.656  41.743 1.00 39.10  ? 292 TRP A CD2 1 
ATOM   857  N  NE1 . TRP A 1 119 ? 18.964 -4.161  43.367 1.00 39.10  ? 292 TRP A NE1 1 
ATOM   858  C  CE2 . TRP A 1 119 ? 18.920 -2.820  43.109 1.00 38.15  ? 292 TRP A CE2 1 
ATOM   859  C  CE3 . TRP A 1 119 ? 19.231 -1.359  41.204 1.00 40.25  ? 292 TRP A CE3 1 
ATOM   860  C  CZ2 . TRP A 1 119 ? 18.638 -1.744  43.958 1.00 37.65  ? 292 TRP A CZ2 1 
ATOM   861  C  CZ3 . TRP A 1 119 ? 18.953 -0.274  42.058 1.00 38.74  ? 292 TRP A CZ3 1 
ATOM   862  C  CH2 . TRP A 1 119 ? 18.660 -0.481  43.417 1.00 38.15  ? 292 TRP A CH2 1 
ATOM   863  N  N   . GLU A 1 120 ? 22.701 -5.297  39.836 1.00 40.99  ? 293 GLU A N   1 
ATOM   864  C  CA  . GLU A 1 120 ? 23.777 -5.844  40.631 1.00 42.03  ? 293 GLU A CA  1 
ATOM   865  C  C   . GLU A 1 120 ? 25.124 -5.752  39.926 1.00 41.98  ? 293 GLU A C   1 
ATOM   866  O  O   . GLU A 1 120 ? 26.073 -6.398  40.355 1.00 42.66  ? 293 GLU A O   1 
ATOM   867  C  CB  . GLU A 1 120 ? 23.471 -7.296  41.042 1.00 42.13  ? 293 GLU A CB  1 
ATOM   868  C  CG  . GLU A 1 120 ? 22.215 -7.435  41.924 1.00 46.43  ? 293 GLU A CG  1 
ATOM   869  C  CD  . GLU A 1 120 ? 21.912 -8.891  42.377 1.00 51.79  ? 293 GLU A CD  1 
ATOM   870  O  OE1 . GLU A 1 120 ? 22.182 -9.830  41.596 1.00 54.07  ? 293 GLU A OE1 1 
ATOM   871  O  OE2 . GLU A 1 120 ? 21.383 -9.100  43.505 1.00 52.00  ? 293 GLU A OE2 1 
ATOM   872  N  N   . ILE A 1 121 ? 25.237 -4.935  38.883 1.00 41.95  ? 294 ILE A N   1 
ATOM   873  C  CA  . ILE A 1 121 ? 26.502 -4.874  38.107 1.00 42.23  ? 294 ILE A CA  1 
ATOM   874  C  C   . ILE A 1 121 ? 27.400 -3.623  38.318 1.00 42.49  ? 294 ILE A C   1 
ATOM   875  O  O   . ILE A 1 121 ? 27.049 -2.502  37.932 1.00 42.27  ? 294 ILE A O   1 
ATOM   876  C  CB  . ILE A 1 121 ? 26.252 -5.156  36.590 1.00 42.18  ? 294 ILE A CB  1 
ATOM   877  C  CG1 . ILE A 1 121 ? 25.808 -6.612  36.398 1.00 42.66  ? 294 ILE A CG1 1 
ATOM   878  C  CG2 . ILE A 1 121 ? 27.491 -4.860  35.761 1.00 41.17  ? 294 ILE A CG2 1 
ATOM   879  C  CD1 . ILE A 1 121 ? 25.057 -6.902  35.092 1.00 42.74  ? 294 ILE A CD1 1 
ATOM   880  N  N   . SER A 1 122 ? 28.568 -3.844  38.917 1.00 43.09  ? 295 SER A N   1 
ATOM   881  C  CA  . SER A 1 122 ? 29.513 -2.768  39.242 1.00 43.55  ? 295 SER A CA  1 
ATOM   882  C  C   . SER A 1 122 ? 30.433 -2.477  38.080 1.00 43.90  ? 295 SER A C   1 
ATOM   883  O  O   . SER A 1 122 ? 30.384 -3.160  37.069 1.00 43.72  ? 295 SER A O   1 
ATOM   884  C  CB  . SER A 1 122 ? 30.382 -3.182  40.421 1.00 43.83  ? 295 SER A CB  1 
ATOM   885  O  OG  . SER A 1 122 ? 31.235 -4.260  40.046 1.00 42.81  ? 295 SER A OG  1 
ATOM   886  N  N   . LYS A 1 123 ? 31.300 -1.482  38.247 1.00 44.59  ? 296 LYS A N   1 
ATOM   887  C  CA  . LYS A 1 123 ? 32.267 -1.136  37.210 1.00 45.43  ? 296 LYS A CA  1 
ATOM   888  C  C   . LYS A 1 123 ? 33.223 -2.293  36.965 1.00 45.99  ? 296 LYS A C   1 
ATOM   889  O  O   . LYS A 1 123 ? 33.620 -2.562  35.831 1.00 46.34  ? 296 LYS A O   1 
ATOM   890  C  CB  . LYS A 1 123 ? 33.064 0.109   37.593 1.00 45.31  ? 296 LYS A CB  1 
ATOM   891  C  CG  . LYS A 1 123 ? 34.054 0.563   36.512 1.00 45.82  ? 296 LYS A CG  1 
ATOM   892  C  CD  . LYS A 1 123 ? 34.699 1.906   36.844 1.00 46.52  ? 296 LYS A CD  1 
ATOM   893  C  CE  . LYS A 1 123 ? 35.975 2.105   36.050 1.00 46.17  ? 296 LYS A CE  1 
ATOM   894  N  NZ  . LYS A 1 123 ? 36.610 3.409   36.405 1.00 47.29  ? 296 LYS A NZ  1 
ATOM   895  N  N   . ALA A 1 124 ? 33.596 -2.973  38.036 1.00 46.65  ? 297 ALA A N   1 
ATOM   896  C  CA  . ALA A 1 124 ? 34.507 -4.093  37.924 1.00 47.49  ? 297 ALA A CA  1 
ATOM   897  C  C   . ALA A 1 124 ? 33.800 -5.332  37.402 1.00 48.15  ? 297 ALA A C   1 
ATOM   898  O  O   . ALA A 1 124 ? 34.393 -6.070  36.628 1.00 48.22  ? 297 ALA A O   1 
ATOM   899  C  CB  . ALA A 1 124 ? 35.181 -4.386  39.267 1.00 47.32  ? 297 ALA A CB  1 
ATOM   900  N  N   . GLN A 1 125 ? 32.549 -5.555  37.829 1.00 49.12  ? 298 GLN A N   1 
ATOM   901  C  CA  . GLN A 1 125 ? 31.793 -6.762  37.457 1.00 50.19  ? 298 GLN A CA  1 
ATOM   902  C  C   . GLN A 1 125 ? 31.511 -6.742  35.977 1.00 50.39  ? 298 GLN A C   1 
ATOM   903  O  O   . GLN A 1 125 ? 31.294 -7.785  35.369 1.00 50.97  ? 298 GLN A O   1 
ATOM   904  C  CB  . GLN A 1 125 ? 30.438 -6.820  38.159 1.00 50.32  ? 298 GLN A CB  1 
ATOM   905  C  CG  . GLN A 1 125 ? 30.415 -7.466  39.549 1.00 53.29  ? 298 GLN A CG  1 
ATOM   906  C  CD  . GLN A 1 125 ? 29.221 -6.953  40.429 1.00 55.63  ? 298 GLN A CD  1 
ATOM   907  O  OE1 . GLN A 1 125 ? 29.392 -6.125  41.330 1.00 56.33  ? 298 GLN A OE1 1 
ATOM   908  N  NE2 . GLN A 1 125 ? 28.024 -7.445  40.145 1.00 55.59  ? 298 GLN A NE2 1 
ATOM   909  N  N   . LEU A 1 126 ? 31.480 -5.533  35.423 1.00 50.63  ? 299 LEU A N   1 
ATOM   910  C  CA  . LEU A 1 126 ? 30.975 -5.280  34.092 1.00 50.56  ? 299 LEU A CA  1 
ATOM   911  C  C   . LEU A 1 126 ? 31.690 -5.999  32.962 1.00 50.83  ? 299 LEU A C   1 
ATOM   912  O  O   . LEU A 1 126 ? 31.030 -6.555  32.050 1.00 52.21  ? 299 LEU A O   1 
ATOM   913  C  CB  . LEU A 1 126 ? 30.893 -3.761  33.780 1.00 50.60  ? 299 LEU A CB  1 
ATOM   914  C  CG  . LEU A 1 126 ? 30.540 -3.333  32.331 1.00 50.19  ? 299 LEU A CG  1 
ATOM   915  C  CD1 . LEU A 1 126 ? 29.055 -3.559  32.051 1.00 48.55  ? 299 LEU A CD1 1 
ATOM   916  C  CD2 . LEU A 1 126 ? 30.965 -1.904  31.972 1.00 49.43  ? 299 LEU A CD2 1 
ATOM   917  N  N   . PRO A 1 127 ? 33.034 -5.922  32.963 1.00 50.32  ? 300 PRO A N   1 
ATOM   918  C  CA  . PRO A 1 127 ? 33.736 -6.531  31.830 1.00 49.86  ? 300 PRO A CA  1 
ATOM   919  C  C   . PRO A 1 127 ? 33.772 -8.044  31.925 1.00 49.51  ? 300 PRO A C   1 
ATOM   920  O  O   . PRO A 1 127 ? 34.118 -8.715  30.967 1.00 49.32  ? 300 PRO A O   1 
ATOM   921  C  CB  . PRO A 1 127 ? 35.140 -5.941  31.940 1.00 49.93  ? 300 PRO A CB  1 
ATOM   922  C  CG  . PRO A 1 127 ? 34.932 -4.622  32.659 1.00 50.21  ? 300 PRO A CG  1 
ATOM   923  C  CD  . PRO A 1 127 ? 33.871 -4.929  33.662 1.00 50.26  ? 300 PRO A CD  1 
ATOM   924  N  N   . LYS A 1 128 ? 33.413 -8.573  33.082 1.00 49.51  ? 301 LYS A N   1 
ATOM   925  C  CA  . LYS A 1 128 ? 33.363 -10.022 33.288 1.00 49.67  ? 301 LYS A CA  1 
ATOM   926  C  C   . LYS A 1 128 ? 31.984 -10.613 32.898 1.00 49.48  ? 301 LYS A C   1 
ATOM   927  O  O   . LYS A 1 128 ? 31.802 -11.845 32.862 1.00 49.40  ? 301 LYS A O   1 
ATOM   928  C  CB  . LYS A 1 128 ? 33.670 -10.367 34.760 1.00 49.96  ? 301 LYS A CB  1 
ATOM   929  C  CG  . LYS A 1 128 ? 35.028 -9.868  35.313 1.00 50.93  ? 301 LYS A CG  1 
ATOM   930  C  CD  . LYS A 1 128 ? 35.154 -10.200 36.812 1.00 52.24  ? 301 LYS A CD  1 
ATOM   931  C  CE  . LYS A 1 128 ? 36.079 -9.230  37.557 1.00 52.93  ? 301 LYS A CE  1 
ATOM   932  N  NZ  . LYS A 1 128 ? 35.797 -9.264  39.052 1.00 52.31  ? 301 LYS A NZ  1 
ATOM   933  N  N   . GLU A 1 129 ? 31.012 -9.732  32.627 1.00 48.83  ? 302 GLU A N   1 
ATOM   934  C  CA  . GLU A 1 129 ? 29.681 -10.161 32.216 1.00 47.78  ? 302 GLU A CA  1 
ATOM   935  C  C   . GLU A 1 129 ? 29.713 -10.428 30.739 1.00 47.52  ? 302 GLU A C   1 
ATOM   936  O  O   . GLU A 1 129 ? 30.373 -9.704  29.984 1.00 47.68  ? 302 GLU A O   1 
ATOM   937  C  CB  . GLU A 1 129 ? 28.635 -9.088  32.493 1.00 47.57  ? 302 GLU A CB  1 
ATOM   938  C  CG  . GLU A 1 129 ? 28.371 -8.828  33.958 1.00 47.22  ? 302 GLU A CG  1 
ATOM   939  C  CD  . GLU A 1 129 ? 27.753 -10.009 34.669 1.00 47.78  ? 302 GLU A CD  1 
ATOM   940  O  OE1 . GLU A 1 129 ? 27.084 -10.832 34.006 1.00 48.60  ? 302 GLU A OE1 1 
ATOM   941  O  OE2 . GLU A 1 129 ? 27.935 -10.110 35.901 1.00 47.85  ? 302 GLU A OE2 1 
ATOM   942  N  N   . GLU A 1 130 ? 28.990 -11.463 30.332 1.00 46.75  ? 303 GLU A N   1 
ATOM   943  C  CA  . GLU A 1 130 ? 28.885 -11.849 28.939 1.00 46.17  ? 303 GLU A CA  1 
ATOM   944  C  C   . GLU A 1 130 ? 27.451 -11.602 28.458 1.00 45.13  ? 303 GLU A C   1 
ATOM   945  O  O   . GLU A 1 130 ? 26.575 -12.482 28.562 1.00 45.11  ? 303 GLU A O   1 
ATOM   946  C  CB  . GLU A 1 130 ? 29.227 -13.316 28.853 1.00 46.76  ? 303 GLU A CB  1 
ATOM   947  C  CG  . GLU A 1 130 ? 29.441 -13.855 27.485 1.00 49.66  ? 303 GLU A CG  1 
ATOM   948  C  CD  . GLU A 1 130 ? 29.851 -15.323 27.565 1.00 55.03  ? 303 GLU A CD  1 
ATOM   949  O  OE1 . GLU A 1 130 ? 30.509 -15.704 28.578 1.00 54.73  ? 303 GLU A OE1 1 
ATOM   950  O  OE2 . GLU A 1 130 ? 29.493 -16.094 26.631 1.00 57.18  ? 303 GLU A OE2 1 
ATOM   951  N  N   . LEU A 1 131 ? 27.216 -10.387 27.955 1.00 43.49  ? 304 LEU A N   1 
ATOM   952  C  CA  . LEU A 1 131 ? 25.876 -9.934  27.604 1.00 41.96  ? 304 LEU A CA  1 
ATOM   953  C  C   . LEU A 1 131 ? 25.923 -8.926  26.478 1.00 41.22  ? 304 LEU A C   1 
ATOM   954  O  O   . LEU A 1 131 ? 26.982 -8.390  26.176 1.00 41.45  ? 304 LEU A O   1 
ATOM   955  C  CB  . LEU A 1 131 ? 25.201 -9.300  28.814 1.00 42.06  ? 304 LEU A CB  1 
ATOM   956  C  CG  . LEU A 1 131 ? 25.962 -8.194  29.553 1.00 41.39  ? 304 LEU A CG  1 
ATOM   957  C  CD1 . LEU A 1 131 ? 26.056 -6.919  28.736 1.00 41.43  ? 304 LEU A CD1 1 
ATOM   958  C  CD2 . LEU A 1 131 ? 25.265 -7.927  30.858 1.00 40.61  ? 304 LEU A CD2 1 
ATOM   959  N  N   . GLU A 1 132 ? 24.766 -8.648  25.883 1.00 39.95  ? 305 GLU A N   1 
ATOM   960  C  CA  . GLU A 1 132 ? 24.684 -7.854  24.668 1.00 38.63  ? 305 GLU A CA  1 
ATOM   961  C  C   . GLU A 1 132 ? 23.351 -7.143  24.659 1.00 38.20  ? 305 GLU A C   1 
ATOM   962  O  O   . GLU A 1 132 ? 22.328 -7.743  24.968 1.00 38.76  ? 305 GLU A O   1 
ATOM   963  C  CB  . GLU A 1 132 ? 24.791 -8.772  23.453 1.00 38.31  ? 305 GLU A CB  1 
ATOM   964  C  CG  . GLU A 1 132 ? 24.503 -8.098  22.129 1.00 37.38  ? 305 GLU A CG  1 
ATOM   965  C  CD  . GLU A 1 132 ? 24.590 -9.056  20.958 1.00 35.29  ? 305 GLU A CD  1 
ATOM   966  O  OE1 . GLU A 1 132 ? 24.600 -10.269 21.225 1.00 34.59  ? 305 GLU A OE1 1 
ATOM   967  O  OE2 . GLU A 1 132 ? 24.648 -8.605  19.783 1.00 33.44  ? 305 GLU A OE2 1 
ATOM   968  N  N   . ILE A 1 133 ? 23.359 -5.861  24.321 1.00 37.15  ? 306 ILE A N   1 
ATOM   969  C  CA  . ILE A 1 133 ? 22.147 -5.053  24.334 1.00 36.16  ? 306 ILE A CA  1 
ATOM   970  C  C   . ILE A 1 133 ? 21.752 -4.805  22.911 1.00 35.71  ? 306 ILE A C   1 
ATOM   971  O  O   . ILE A 1 133 ? 22.549 -4.273  22.128 1.00 35.54  ? 306 ILE A O   1 
ATOM   972  C  CB  . ILE A 1 133 ? 22.369 -3.681  25.011 1.00 36.36  ? 306 ILE A CB  1 
ATOM   973  C  CG1 . ILE A 1 133 ? 22.545 -3.864  26.510 1.00 36.66  ? 306 ILE A CG1 1 
ATOM   974  C  CG2 . ILE A 1 133 ? 21.203 -2.735  24.756 1.00 35.38  ? 306 ILE A CG2 1 
ATOM   975  C  CD1 . ILE A 1 133 ? 23.441 -2.827  27.086 1.00 38.84  ? 306 ILE A CD1 1 
ATOM   976  N  N   . VAL A 1 134 ? 20.524 -5.193  22.565 1.00 34.97  ? 307 VAL A N   1 
ATOM   977  C  CA  . VAL A 1 134 ? 20.028 -4.954  21.220 1.00 33.93  ? 307 VAL A CA  1 
ATOM   978  C  C   . VAL A 1 134 ? 19.017 -3.835  21.290 1.00 33.44  ? 307 VAL A C   1 
ATOM   979  O  O   . VAL A 1 134 ? 18.074 -3.876  22.078 1.00 32.53  ? 307 VAL A O   1 
ATOM   980  C  CB  . VAL A 1 134 ? 19.429 -6.226  20.583 1.00 34.16  ? 307 VAL A CB  1 
ATOM   981  C  CG1 . VAL A 1 134 ? 18.903 -5.941  19.164 1.00 32.99  ? 307 VAL A CG1 1 
ATOM   982  C  CG2 . VAL A 1 134 ? 20.467 -7.342  20.571 1.00 33.72  ? 307 VAL A CG2 1 
ATOM   983  N  N   . VAL A 1 135 ? 19.264 -2.817  20.481 1.00 33.10  ? 308 VAL A N   1 
ATOM   984  C  CA  . VAL A 1 135 ? 18.399 -1.666  20.415 1.00 32.92  ? 308 VAL A CA  1 
ATOM   985  C  C   . VAL A 1 135 ? 17.657 -1.650  19.088 1.00 33.09  ? 308 VAL A C   1 
ATOM   986  O  O   . VAL A 1 135 ? 18.232 -1.928  18.030 1.00 33.01  ? 308 VAL A O   1 
ATOM   987  C  CB  . VAL A 1 135 ? 19.199 -0.405  20.592 1.00 32.84  ? 308 VAL A CB  1 
ATOM   988  C  CG1 . VAL A 1 135 ? 19.993 -0.518  21.862 1.00 32.91  ? 308 VAL A CG1 1 
ATOM   989  C  CG2 . VAL A 1 135 ? 20.137 -0.203  19.422 1.00 32.46  ? 308 VAL A CG2 1 
ATOM   990  N  N   . ILE A 1 136 ? 16.374 -1.323  19.148 1.00 32.91  ? 309 ILE A N   1 
ATOM   991  C  CA  . ILE A 1 136 ? 15.521 -1.462  17.998 1.00 32.87  ? 309 ILE A CA  1 
ATOM   992  C  C   . ILE A 1 136 ? 14.587 -0.279  17.928 1.00 33.39  ? 309 ILE A C   1 
ATOM   993  O  O   . ILE A 1 136 ? 13.744 -0.110  18.799 1.00 33.75  ? 309 ILE A O   1 
ATOM   994  C  CB  . ILE A 1 136 ? 14.685 -2.737  18.127 1.00 32.89  ? 309 ILE A CB  1 
ATOM   995  C  CG1 . ILE A 1 136 ? 15.573 -3.915  18.533 1.00 32.86  ? 309 ILE A CG1 1 
ATOM   996  C  CG2 . ILE A 1 136 ? 13.879 -3.008  16.854 1.00 31.53  ? 309 ILE A CG2 1 
ATOM   997  C  CD1 . ILE A 1 136 ? 14.780 -5.109  19.014 1.00 33.67  ? 309 ILE A CD1 1 
ATOM   998  N  N   . LEU A 1 137 ? 14.728 0.537   16.890 1.00 34.11  ? 310 LEU A N   1 
ATOM   999  C  CA  . LEU A 1 137 ? 13.789 1.630   16.638 1.00 34.69  ? 310 LEU A CA  1 
ATOM   1000 C  C   . LEU A 1 137 ? 12.824 1.168   15.595 1.00 35.46  ? 310 LEU A C   1 
ATOM   1001 O  O   . LEU A 1 137 ? 13.189 0.401   14.721 1.00 34.97  ? 310 LEU A O   1 
ATOM   1002 C  CB  . LEU A 1 137 ? 14.505 2.864   16.113 1.00 34.57  ? 310 LEU A CB  1 
ATOM   1003 C  CG  . LEU A 1 137 ? 13.648 4.043   15.664 1.00 33.73  ? 310 LEU A CG  1 
ATOM   1004 C  CD1 . LEU A 1 137 ? 13.505 5.057   16.742 1.00 33.10  ? 310 LEU A CD1 1 
ATOM   1005 C  CD2 . LEU A 1 137 ? 14.314 4.693   14.514 1.00 35.13  ? 310 LEU A CD2 1 
ATOM   1006 N  N   . GLU A 1 138 ? 11.585 1.631   15.684 1.00 36.99  ? 311 GLU A N   1 
ATOM   1007 C  CA  . GLU A 1 138 ? 10.595 1.262   14.692 1.00 38.41  ? 311 GLU A CA  1 
ATOM   1008 C  C   . GLU A 1 138 ? 9.628  2.442   14.483 1.00 39.57  ? 311 GLU A C   1 
ATOM   1009 O  O   . GLU A 1 138 ? 9.100  3.013   15.445 1.00 41.44  ? 311 GLU A O   1 
ATOM   1010 C  CB  . GLU A 1 138 ? 9.761  0.068   15.156 1.00 37.62  ? 311 GLU A CB  1 
ATOM   1011 C  CG  . GLU A 1 138 ? 10.500 -1.180  15.475 1.00 37.99  ? 311 GLU A CG  1 
ATOM   1012 C  CD  . GLU A 1 138 ? 9.564  -2.358  15.717 1.00 39.45  ? 311 GLU A CD  1 
ATOM   1013 O  OE1 . GLU A 1 138 ? 8.383  -2.161  16.059 1.00 40.47  ? 311 GLU A OE1 1 
ATOM   1014 O  OE2 . GLU A 1 138 ? 9.998  -3.507  15.561 1.00 39.68  ? 311 GLU A OE2 1 
ATOM   1015 N  N   . GLY A 1 139 ? 9.319  2.736   13.238 1.00 40.23  ? 312 GLY A N   1 
ATOM   1016 C  CA  . GLY A 1 139 ? 8.332  3.760   12.946 1.00 41.12  ? 312 GLY A CA  1 
ATOM   1017 C  C   . GLY A 1 139 ? 7.985  3.709   11.482 1.00 42.39  ? 312 GLY A C   1 
ATOM   1018 O  O   . GLY A 1 139 ? 8.502  2.894   10.716 1.00 41.93  ? 312 GLY A O   1 
ATOM   1019 N  N   . MET A 1 140 ? 7.093  4.595   11.095 1.00 43.75  ? 313 MET A N   1 
ATOM   1020 C  CA  A MET A 1 140 ? 6.722  4.736   9.665  0.50 44.92  ? 313 MET A CA  1 
ATOM   1021 C  CA  B MET A 1 140 ? 6.793  4.697   9.662  0.50 44.70  ? 313 MET A CA  1 
ATOM   1022 C  C   . MET A 1 140 ? 7.475  5.929   9.045  1.00 46.00  ? 313 MET A C   1 
ATOM   1023 O  O   . MET A 1 140 ? 7.602  6.976   9.685  1.00 45.90  ? 313 MET A O   1 
ATOM   1024 C  CB  A MET A 1 140 ? 5.217  5.008   9.612  0.50 44.53  ? 313 MET A CB  1 
ATOM   1025 C  CB  B MET A 1 140 ? 5.274  4.674   9.463  0.50 44.20  ? 313 MET A CB  1 
ATOM   1026 C  CG  A MET A 1 140 ? 4.536  4.588   8.314  0.50 44.64  ? 313 MET A CG  1 
ATOM   1027 C  CG  B MET A 1 140 ? 4.668  3.258   9.704  0.50 43.06  ? 313 MET A CG  1 
ATOM   1028 S  SD  A MET A 1 140 ? 4.759  5.796   6.981  0.50 44.44  ? 313 MET A SD  1 
ATOM   1029 S  SD  B MET A 1 140 ? 2.858  3.241   9.848  0.50 41.12  ? 313 MET A SD  1 
ATOM   1030 C  CE  A MET A 1 140 ? 3.509  7.044   7.345  0.50 43.64  ? 313 MET A CE  1 
ATOM   1031 C  CE  B MET A 1 140 ? 2.645  2.885   11.626 0.50 41.20  ? 313 MET A CE  1 
ATOM   1032 N  N   . VAL A 1 141 ? 7.976  5.771   7.822  1.00 48.17  ? 314 VAL A N   1 
ATOM   1033 C  CA  . VAL A 1 141 ? 8.736  6.848   7.193  1.00 51.11  ? 314 VAL A CA  1 
ATOM   1034 C  C   . VAL A 1 141 ? 7.789  7.896   6.611  1.00 53.11  ? 314 VAL A C   1 
ATOM   1035 O  O   . VAL A 1 141 ? 6.940  7.588   5.771  1.00 53.36  ? 314 VAL A O   1 
ATOM   1036 C  CB  . VAL A 1 141 ? 9.737  6.334   6.133  1.00 50.88  ? 314 VAL A CB  1 
ATOM   1037 C  CG1 . VAL A 1 141 ? 10.421 7.499   5.458  1.00 51.47  ? 314 VAL A CG1 1 
ATOM   1038 C  CG2 . VAL A 1 141 ? 10.771 5.412   6.774  1.00 50.57  ? 314 VAL A CG2 1 
ATOM   1039 N  N   . GLU A 1 142 ? 7.950  9.132   7.086  1.00 55.63  ? 315 GLU A N   1 
ATOM   1040 C  CA  . GLU A 1 142 ? 7.007  10.225  6.833  1.00 57.89  ? 315 GLU A CA  1 
ATOM   1041 C  C   . GLU A 1 142 ? 6.516  10.252  5.353  1.00 59.78  ? 315 GLU A C   1 
ATOM   1042 O  O   . GLU A 1 142 ? 5.286  10.512  5.014  1.00 60.45  ? 315 GLU A O   1 
ATOM   1043 C  CB  . GLU A 1 142 ? 7.665  11.582  7.171  1.00 57.72  ? 315 GLU A CB  1 
ATOM   1044 C  CG  . GLU A 1 142 ? 6.906  12.849  6.722  1.00 56.29  ? 315 GLU A CG  1 
ATOM   1045 C  CD  . GLU A 1 142 ? 5.647  13.105  7.527  1.00 54.79  ? 315 GLU A CD  1 
ATOM   1046 O  OE1 . GLU A 1 142 ? 5.603  14.133  8.239  1.00 56.70  ? 315 GLU A OE1 1 
ATOM   1047 O  OE2 . GLU A 1 142 ? 4.700  12.298  7.468  1.00 53.60  ? 315 GLU A OE2 1 
ATOM   1048 N  N   . ALA A 1 143 ? 7.532  10.185  4.494  1.00 61.33  ? 316 ALA A N   1 
ATOM   1049 C  CA  . ALA A 1 143 ? 7.367  10.332  3.060  1.00 62.64  ? 316 ALA A CA  1 
ATOM   1050 C  C   . ALA A 1 143 ? 6.926  8.977   2.439  1.00 63.40  ? 316 ALA A C   1 
ATOM   1051 O  O   . ALA A 1 143 ? 5.946  8.888   1.626  1.00 64.71  ? 316 ALA A O   1 
ATOM   1052 C  CB  . ALA A 1 143 ? 8.726  10.828  2.398  1.00 62.70  ? 316 ALA A CB  1 
ATOM   1053 N  N   . THR A 1 144 ? 7.727  7.945   2.813  1.00 63.04  ? 317 THR A N   1 
ATOM   1054 C  CA  . THR A 1 144 ? 7.715  6.626   2.151  1.00 61.93  ? 317 THR A CA  1 
ATOM   1055 C  C   . THR A 1 144 ? 6.490  5.769   2.466  1.00 61.47  ? 317 THR A C   1 
ATOM   1056 O  O   . THR A 1 144 ? 6.280  4.748   1.823  1.00 61.27  ? 317 THR A O   1 
ATOM   1057 C  CB  . THR A 1 144 ? 9.033  5.891   2.466  1.00 62.11  ? 317 THR A CB  1 
ATOM   1058 O  OG1 . THR A 1 144 ? 10.080 6.470   1.671  1.00 61.42  ? 317 THR A OG1 1 
ATOM   1059 C  CG2 . THR A 1 144 ? 8.944  4.396   2.218  1.00 61.66  ? 317 THR A CG2 1 
ATOM   1060 N  N   . GLY A 1 145 ? 5.677  6.206   3.436  1.00 61.19  ? 318 GLY A N   1 
ATOM   1061 C  CA  . GLY A 1 145 ? 4.506  5.443   3.924  1.00 60.33  ? 318 GLY A CA  1 
ATOM   1062 C  C   . GLY A 1 145 ? 4.781  3.968   4.264  1.00 59.71  ? 318 GLY A C   1 
ATOM   1063 O  O   . GLY A 1 145 ? 3.912  3.099   4.043  1.00 60.13  ? 318 GLY A O   1 
ATOM   1064 N  N   . MET A 1 146 ? 5.991  3.678   4.772  1.00 58.50  ? 319 MET A N   1 
ATOM   1065 C  CA  . MET A 1 146 ? 6.424  2.287   5.020  1.00 57.42  ? 319 MET A CA  1 
ATOM   1066 C  C   . MET A 1 146 ? 7.054  2.044   6.395  1.00 55.78  ? 319 MET A C   1 
ATOM   1067 O  O   . MET A 1 146 ? 7.785  2.885   6.915  1.00 55.51  ? 319 MET A O   1 
ATOM   1068 C  CB  . MET A 1 146 ? 7.395  1.822   3.941  1.00 57.94  ? 319 MET A CB  1 
ATOM   1069 C  CG  . MET A 1 146 ? 6.803  0.835   2.923  1.00 60.29  ? 319 MET A CG  1 
ATOM   1070 S  SD  . MET A 1 146 ? 7.845  -0.660  2.805  1.00 66.64  ? 319 MET A SD  1 
ATOM   1071 C  CE  . MET A 1 146 ? 9.460  0.018   2.315  1.00 65.43  ? 319 MET A CE  1 
ATOM   1072 N  N   . THR A 1 147 ? 6.770  0.887   6.976  1.00 53.74  ? 320 THR A N   1 
ATOM   1073 C  CA  . THR A 1 147 ? 7.257  0.588   8.310  1.00 52.27  ? 320 THR A CA  1 
ATOM   1074 C  C   . THR A 1 147 ? 8.730  0.180   8.280  1.00 51.00  ? 320 THR A C   1 
ATOM   1075 O  O   . THR A 1 147 ? 9.099  -0.771  7.596  1.00 51.01  ? 320 THR A O   1 
ATOM   1076 C  CB  . THR A 1 147 ? 6.407  -0.503  8.972  1.00 52.35  ? 320 THR A CB  1 
ATOM   1077 O  OG1 . THR A 1 147 ? 5.079  -0.007  9.148  1.00 53.53  ? 320 THR A OG1 1 
ATOM   1078 C  CG2 . THR A 1 147 ? 6.949  -0.879  10.321 1.00 52.02  ? 320 THR A CG2 1 
ATOM   1079 N  N   . CYS A 1 148 ? 9.565  0.912   9.014  1.00 49.09  ? 321 CYS A N   1 
ATOM   1080 C  CA  . CYS A 1 148 ? 10.979 0.599   9.107  1.00 47.36  ? 321 CYS A CA  1 
ATOM   1081 C  C   . CYS A 1 148 ? 11.313 0.039   10.490 1.00 45.56  ? 321 CYS A C   1 
ATOM   1082 O  O   . CYS A 1 148 ? 10.676 0.371   11.491 1.00 45.32  ? 321 CYS A O   1 
ATOM   1083 C  CB  . CYS A 1 148 ? 11.832 1.838   8.807  1.00 47.41  ? 321 CYS A CB  1 
ATOM   1084 S  SG  . CYS A 1 148 ? 12.078 3.004   10.233 1.00 51.58  ? 321 CYS A SG  1 
ATOM   1085 N  N   . GLN A 1 149 ? 12.311 -0.828  10.526 1.00 43.67  ? 322 GLN A N   1 
ATOM   1086 C  CA  . GLN A 1 149 ? 12.934 -1.256  11.764 1.00 42.17  ? 322 GLN A CA  1 
ATOM   1087 C  C   . GLN A 1 149 ? 14.435 -1.012  11.619 1.00 41.25  ? 322 GLN A C   1 
ATOM   1088 O  O   . GLN A 1 149 ? 15.029 -1.421  10.623 1.00 41.96  ? 322 GLN A O   1 
ATOM   1089 C  CB  . GLN A 1 149 ? 12.640 -2.730  12.027 1.00 41.93  ? 322 GLN A CB  1 
ATOM   1090 C  CG  . GLN A 1 149 ? 13.581 -3.404  13.006 1.00 42.36  ? 322 GLN A CG  1 
ATOM   1091 C  CD  . GLN A 1 149 ? 12.953 -4.619  13.672 1.00 44.06  ? 322 GLN A CD  1 
ATOM   1092 O  OE1 . GLN A 1 149 ? 13.512 -5.728  13.671 1.00 44.41  ? 322 GLN A OE1 1 
ATOM   1093 N  NE2 . GLN A 1 149 ? 11.776 -4.419  14.240 1.00 45.26  ? 322 GLN A NE2 1 
ATOM   1094 N  N   . ALA A 1 150 ? 15.042 -0.314  12.578 1.00 39.80  ? 323 ALA A N   1 
ATOM   1095 C  CA  . ALA A 1 150 ? 16.498 -0.115  12.592 1.00 38.16  ? 323 ALA A CA  1 
ATOM   1096 C  C   . ALA A 1 150 ? 17.037 -0.733  13.863 1.00 37.28  ? 323 ALA A C   1 
ATOM   1097 O  O   . ALA A 1 150 ? 16.433 -0.620  14.925 1.00 36.95  ? 323 ALA A O   1 
ATOM   1098 C  CB  . ALA A 1 150 ? 16.868 1.355   12.488 1.00 37.55  ? 323 ALA A CB  1 
ATOM   1099 N  N   . ARG A 1 151 ? 18.155 -1.428  13.744 1.00 36.56  ? 324 ARG A N   1 
ATOM   1100 C  CA  . ARG A 1 151 ? 18.680 -2.178  14.864 1.00 36.00  ? 324 ARG A CA  1 
ATOM   1101 C  C   . ARG A 1 151 ? 20.146 -1.897  15.062 1.00 35.74  ? 324 ARG A C   1 
ATOM   1102 O  O   . ARG A 1 151 ? 20.839 -1.501  14.136 1.00 35.78  ? 324 ARG A O   1 
ATOM   1103 C  CB  . ARG A 1 151 ? 18.477 -3.667  14.625 1.00 35.85  ? 324 ARG A CB  1 
ATOM   1104 C  CG  . ARG A 1 151 ? 17.038 -4.022  14.361 1.00 36.41  ? 324 ARG A CG  1 
ATOM   1105 C  CD  . ARG A 1 151 ? 16.862 -5.490  14.218 1.00 37.99  ? 324 ARG A CD  1 
ATOM   1106 N  NE  . ARG A 1 151 ? 17.590 -5.918  13.048 1.00 41.50  ? 324 ARG A NE  1 
ATOM   1107 C  CZ  . ARG A 1 151 ? 17.216 -5.661  11.802 1.00 43.20  ? 324 ARG A CZ  1 
ATOM   1108 N  NH1 . ARG A 1 151 ? 16.092 -4.995  11.541 1.00 44.21  ? 324 ARG A NH1 1 
ATOM   1109 N  NH2 . ARG A 1 151 ? 17.974 -6.090  10.807 1.00 45.16  ? 324 ARG A NH2 1 
ATOM   1110 N  N   . SER A 1 152 ? 20.617 -2.090  16.284 1.00 35.52  ? 325 SER A N   1 
ATOM   1111 C  CA  . SER A 1 152 ? 22.051 -2.083  16.557 1.00 34.92  ? 325 SER A CA  1 
ATOM   1112 C  C   . SER A 1 152 ? 22.318 -2.870  17.824 1.00 34.87  ? 325 SER A C   1 
ATOM   1113 O  O   . SER A 1 152 ? 21.384 -3.391  18.472 1.00 35.05  ? 325 SER A O   1 
ATOM   1114 C  CB  . SER A 1 152 ? 22.609 -0.663  16.661 1.00 34.70  ? 325 SER A CB  1 
ATOM   1115 O  OG  . SER A 1 152 ? 24.023 -0.685  16.639 1.00 33.75  ? 325 SER A OG  1 
ATOM   1116 N  N   . SER A 1 153 ? 23.593 -2.933  18.192 1.00 34.75  ? 326 SER A N   1 
ATOM   1117 C  CA  . SER A 1 153 ? 24.012 -3.830  19.245 1.00 34.77  ? 326 SER A CA  1 
ATOM   1118 C  C   . SER A 1 153 ? 25.140 -3.251  20.064 1.00 34.59  ? 326 SER A C   1 
ATOM   1119 O  O   . SER A 1 153 ? 26.044 -2.619  19.526 1.00 34.56  ? 326 SER A O   1 
ATOM   1120 C  CB  . SER A 1 153 ? 24.463 -5.146  18.613 1.00 35.07  ? 326 SER A CB  1 
ATOM   1121 O  OG  . SER A 1 153 ? 24.983 -6.055  19.569 1.00 35.93  ? 326 SER A OG  1 
ATOM   1122 N  N   . TYR A 1 154 ? 25.090 -3.497  21.371 1.00 34.82  ? 327 TYR A N   1 
ATOM   1123 C  CA  . TYR A 1 154 ? 26.213 -3.203  22.279 1.00 34.80  ? 327 TYR A CA  1 
ATOM   1124 C  C   . TYR A 1 154 ? 26.648 -4.437  23.086 1.00 36.11  ? 327 TYR A C   1 
ATOM   1125 O  O   . TYR A 1 154 ? 25.814 -5.122  23.692 1.00 36.86  ? 327 TYR A O   1 
ATOM   1126 C  CB  . TYR A 1 154 ? 25.840 -2.076  23.222 1.00 33.55  ? 327 TYR A CB  1 
ATOM   1127 C  CG  . TYR A 1 154 ? 25.361 -0.850  22.514 1.00 29.83  ? 327 TYR A CG  1 
ATOM   1128 C  CD1 . TYR A 1 154 ? 26.256 0.024   21.940 1.00 27.97  ? 327 TYR A CD1 1 
ATOM   1129 C  CD2 . TYR A 1 154 ? 24.010 -0.555  22.438 1.00 27.66  ? 327 TYR A CD2 1 
ATOM   1130 C  CE1 . TYR A 1 154 ? 25.818 1.154   21.282 1.00 28.42  ? 327 TYR A CE1 1 
ATOM   1131 C  CE2 . TYR A 1 154 ? 23.554 0.577   21.794 1.00 26.31  ? 327 TYR A CE2 1 
ATOM   1132 C  CZ  . TYR A 1 154 ? 24.463 1.427   21.215 1.00 27.17  ? 327 TYR A CZ  1 
ATOM   1133 O  OH  . TYR A 1 154 ? 24.037 2.552   20.557 1.00 27.10  ? 327 TYR A OH  1 
ATOM   1134 N  N   . ILE A 1 155 ? 27.942 -4.744  23.078 1.00 37.16  ? 328 ILE A N   1 
ATOM   1135 C  CA  . ILE A 1 155 ? 28.452 -5.816  23.938 1.00 38.15  ? 328 ILE A CA  1 
ATOM   1136 C  C   . ILE A 1 155 ? 29.279 -5.236  25.084 1.00 38.93  ? 328 ILE A C   1 
ATOM   1137 O  O   . ILE A 1 155 ? 29.594 -4.036  25.109 1.00 40.14  ? 328 ILE A O   1 
ATOM   1138 C  CB  . ILE A 1 155 ? 29.246 -6.864  23.162 1.00 38.22  ? 328 ILE A CB  1 
ATOM   1139 C  CG1 . ILE A 1 155 ? 30.288 -6.180  22.265 1.00 38.92  ? 328 ILE A CG1 1 
ATOM   1140 C  CG2 . ILE A 1 155 ? 28.299 -7.724  22.329 1.00 37.58  ? 328 ILE A CG2 1 
ATOM   1141 C  CD1 . ILE A 1 155 ? 31.472 -7.073  21.887 1.00 38.68  ? 328 ILE A CD1 1 
ATOM   1142 N  N   . THR A 1 156 ? 29.628 -6.076  26.042 1.00 39.28  ? 329 THR A N   1 
ATOM   1143 C  CA  . THR A 1 156 ? 30.231 -5.602  27.278 1.00 39.60  ? 329 THR A CA  1 
ATOM   1144 C  C   . THR A 1 156 ? 31.343 -4.568  27.069 1.00 39.85  ? 329 THR A C   1 
ATOM   1145 O  O   . THR A 1 156 ? 31.511 -3.648  27.880 1.00 41.38  ? 329 THR A O   1 
ATOM   1146 C  CB  . THR A 1 156 ? 30.858 -6.773  28.011 1.00 39.76  ? 329 THR A CB  1 
ATOM   1147 O  OG1 . THR A 1 156 ? 29.983 -7.908  27.929 1.00 41.41  ? 329 THR A OG1 1 
ATOM   1148 C  CG2 . THR A 1 156 ? 31.079 -6.424  29.444 1.00 39.61  ? 329 THR A CG2 1 
ATOM   1149 N  N   . SER A 1 157 ? 32.123 -4.712  26.011 1.00 39.60  ? 330 SER A N   1 
ATOM   1150 C  CA  . SER A 1 157 ? 33.263 -3.828  25.830 1.00 39.22  ? 330 SER A CA  1 
ATOM   1151 C  C   . SER A 1 157 ? 32.851 -2.508  25.184 1.00 39.24  ? 330 SER A C   1 
ATOM   1152 O  O   . SER A 1 157 ? 33.696 -1.635  24.925 1.00 39.66  ? 330 SER A O   1 
ATOM   1153 C  CB  . SER A 1 157 ? 34.339 -4.520  25.004 1.00 39.09  ? 330 SER A CB  1 
ATOM   1154 O  OG  . SER A 1 157 ? 33.813 -5.004  23.786 1.00 39.16  ? 330 SER A OG  1 
ATOM   1155 N  N   . GLU A 1 158 ? 31.560 -2.355  24.913 1.00 38.61  ? 331 GLU A N   1 
ATOM   1156 C  CA  . GLU A 1 158 ? 31.107 -1.172  24.190 1.00 38.46  ? 331 GLU A CA  1 
ATOM   1157 C  C   . GLU A 1 158 ? 30.232 -0.308  25.067 1.00 38.39  ? 331 GLU A C   1 
ATOM   1158 O  O   . GLU A 1 158 ? 29.726 0.725   24.642 1.00 38.41  ? 331 GLU A O   1 
ATOM   1159 C  CB  . GLU A 1 158 ? 30.390 -1.565  22.920 1.00 38.17  ? 331 GLU A CB  1 
ATOM   1160 C  CG  . GLU A 1 158 ? 31.270 -2.415  22.041 1.00 39.70  ? 331 GLU A CG  1 
ATOM   1161 C  CD  . GLU A 1 158 ? 30.550 -3.007  20.858 1.00 40.22  ? 331 GLU A CD  1 
ATOM   1162 O  OE1 . GLU A 1 158 ? 31.217 -3.141  19.814 1.00 39.72  ? 331 GLU A OE1 1 
ATOM   1163 O  OE2 . GLU A 1 158 ? 29.336 -3.330  20.966 1.00 40.04  ? 331 GLU A OE2 1 
ATOM   1164 N  N   . ILE A 1 159 ? 30.072 -0.734  26.311 1.00 38.20  ? 332 ILE A N   1 
ATOM   1165 C  CA  . ILE A 1 159 ? 29.466 0.110   27.313 1.00 37.84  ? 332 ILE A CA  1 
ATOM   1166 C  C   . ILE A 1 159 ? 30.567 0.764   28.162 1.00 38.21  ? 332 ILE A C   1 
ATOM   1167 O  O   . ILE A 1 159 ? 31.171 0.117   29.029 1.00 38.48  ? 332 ILE A O   1 
ATOM   1168 C  CB  . ILE A 1 159 ? 28.545 -0.695  28.212 1.00 37.60  ? 332 ILE A CB  1 
ATOM   1169 C  CG1 . ILE A 1 159 ? 27.521 -1.445  27.361 1.00 36.63  ? 332 ILE A CG1 1 
ATOM   1170 C  CG2 . ILE A 1 159 ? 27.898 0.223   29.227 1.00 36.65  ? 332 ILE A CG2 1 
ATOM   1171 C  CD1 . ILE A 1 159 ? 26.927 -2.669  28.040 1.00 34.92  ? 332 ILE A CD1 1 
ATOM   1172 N  N   . LEU A 1 160 ? 30.825 2.041   27.896 1.00 37.99  ? 333 LEU A N   1 
ATOM   1173 C  CA  . LEU A 1 160 ? 31.815 2.802   28.632 1.00 37.59  ? 333 LEU A CA  1 
ATOM   1174 C  C   . LEU A 1 160 ? 31.260 3.267   29.975 1.00 37.54  ? 333 LEU A C   1 
ATOM   1175 O  O   . LEU A 1 160 ? 30.359 4.113   30.027 1.00 37.78  ? 333 LEU A O   1 
ATOM   1176 C  CB  . LEU A 1 160 ? 32.222 4.008   27.811 1.00 37.61  ? 333 LEU A CB  1 
ATOM   1177 C  CG  . LEU A 1 160 ? 32.702 3.726   26.390 1.00 37.88  ? 333 LEU A CG  1 
ATOM   1178 C  CD1 . LEU A 1 160 ? 32.816 5.034   25.660 1.00 39.65  ? 333 LEU A CD1 1 
ATOM   1179 C  CD2 . LEU A 1 160 ? 34.033 2.991   26.356 1.00 37.83  ? 333 LEU A CD2 1 
ATOM   1180 N  N   . TRP A 1 161 ? 31.797 2.710   31.059 1.00 37.35  ? 334 TRP A N   1 
ATOM   1181 C  CA  . TRP A 1 161 ? 31.350 3.053   32.407 1.00 36.95  ? 334 TRP A CA  1 
ATOM   1182 C  C   . TRP A 1 161 ? 31.949 4.397   32.831 1.00 37.27  ? 334 TRP A C   1 
ATOM   1183 O  O   . TRP A 1 161 ? 33.144 4.594   32.723 1.00 37.76  ? 334 TRP A O   1 
ATOM   1184 C  CB  . TRP A 1 161 ? 31.729 1.947   33.410 1.00 36.48  ? 334 TRP A CB  1 
ATOM   1185 C  CG  . TRP A 1 161 ? 31.230 2.209   34.815 1.00 34.30  ? 334 TRP A CG  1 
ATOM   1186 C  CD1 . TRP A 1 161 ? 31.638 3.203   35.647 1.00 32.68  ? 334 TRP A CD1 1 
ATOM   1187 C  CD2 . TRP A 1 161 ? 30.233 1.472   35.532 1.00 32.60  ? 334 TRP A CD2 1 
ATOM   1188 N  NE1 . TRP A 1 161 ? 30.957 3.143   36.828 1.00 32.55  ? 334 TRP A NE1 1 
ATOM   1189 C  CE2 . TRP A 1 161 ? 30.091 2.083   36.791 1.00 32.89  ? 334 TRP A CE2 1 
ATOM   1190 C  CE3 . TRP A 1 161 ? 29.443 0.356   35.234 1.00 32.38  ? 334 TRP A CE3 1 
ATOM   1191 C  CZ2 . TRP A 1 161 ? 29.187 1.615   37.759 1.00 32.64  ? 334 TRP A CZ2 1 
ATOM   1192 C  CZ3 . TRP A 1 161 ? 28.547 -0.113  36.197 1.00 32.08  ? 334 TRP A CZ3 1 
ATOM   1193 C  CH2 . TRP A 1 161 ? 28.422 0.521   37.438 1.00 32.16  ? 334 TRP A CH2 1 
ATOM   1194 N  N   . GLY A 1 162 ? 31.117 5.316   33.302 1.00 37.36  ? 335 GLY A N   1 
ATOM   1195 C  CA  . GLY A 1 162 ? 31.609 6.573   33.845 1.00 37.65  ? 335 GLY A CA  1 
ATOM   1196 C  C   . GLY A 1 162 ? 31.773 7.650   32.798 1.00 38.04  ? 335 GLY A C   1 
ATOM   1197 O  O   . GLY A 1 162 ? 32.654 8.494   32.919 1.00 38.15  ? 335 GLY A O   1 
ATOM   1198 N  N   . TYR A 1 163 ? 30.914 7.631   31.776 1.00 38.24  ? 336 TYR A N   1 
ATOM   1199 C  CA  . TYR A 1 163 ? 31.008 8.579   30.666 1.00 38.06  ? 336 TYR A CA  1 
ATOM   1200 C  C   . TYR A 1 163 ? 29.682 9.235   30.392 1.00 38.07  ? 336 TYR A C   1 
ATOM   1201 O  O   . TYR A 1 163 ? 28.666 8.851   30.966 1.00 38.33  ? 336 TYR A O   1 
ATOM   1202 C  CB  . TYR A 1 163 ? 31.447 7.851   29.414 1.00 38.13  ? 336 TYR A CB  1 
ATOM   1203 C  CG  . TYR A 1 163 ? 32.916 7.531   29.379 1.00 39.09  ? 336 TYR A CG  1 
ATOM   1204 C  CD1 . TYR A 1 163 ? 33.785 8.288   28.606 1.00 39.87  ? 336 TYR A CD1 1 
ATOM   1205 C  CD2 . TYR A 1 163 ? 33.445 6.482   30.125 1.00 39.21  ? 336 TYR A CD2 1 
ATOM   1206 C  CE1 . TYR A 1 163 ? 35.138 8.005   28.566 1.00 40.62  ? 336 TYR A CE1 1 
ATOM   1207 C  CE2 . TYR A 1 163 ? 34.804 6.192   30.089 1.00 40.04  ? 336 TYR A CE2 1 
ATOM   1208 C  CZ  . TYR A 1 163 ? 35.639 6.956   29.300 1.00 40.98  ? 336 TYR A CZ  1 
ATOM   1209 O  OH  . TYR A 1 163 ? 36.984 6.682   29.236 1.00 43.13  ? 336 TYR A OH  1 
ATOM   1210 N  N   . ARG A 1 164 ? 29.693 10.227  29.509 1.00 38.03  ? 337 ARG A N   1 
ATOM   1211 C  CA  . ARG A 1 164 ? 28.469 10.905  29.071 1.00 38.16  ? 337 ARG A CA  1 
ATOM   1212 C  C   . ARG A 1 164 ? 28.603 11.196  27.588 1.00 38.49  ? 337 ARG A C   1 
ATOM   1213 O  O   . ARG A 1 164 ? 29.708 11.146  27.057 1.00 38.72  ? 337 ARG A O   1 
ATOM   1214 C  CB  . ARG A 1 164 ? 28.253 12.220  29.828 1.00 37.97  ? 337 ARG A CB  1 
ATOM   1215 C  CG  . ARG A 1 164 ? 28.295 12.102  31.341 1.00 38.63  ? 337 ARG A CG  1 
ATOM   1216 C  CD  . ARG A 1 164 ? 27.282 13.038  32.028 1.00 41.34  ? 337 ARG A CD  1 
ATOM   1217 N  NE  . ARG A 1 164 ? 27.727 14.434  32.257 1.00 41.08  ? 337 ARG A NE  1 
ATOM   1218 C  CZ  . ARG A 1 164 ? 27.930 14.987  33.456 1.00 38.36  ? 337 ARG A CZ  1 
ATOM   1219 N  NH1 . ARG A 1 164 ? 27.754 14.299  34.567 1.00 38.46  ? 337 ARG A NH1 1 
ATOM   1220 N  NH2 . ARG A 1 164 ? 28.297 16.241  33.541 1.00 38.64  ? 337 ARG A NH2 1 
ATOM   1221 N  N   . PHE A 1 165 ? 27.498 11.493  26.913 1.00 38.94  ? 338 PHE A N   1 
ATOM   1222 C  CA  . PHE A 1 165 ? 27.569 11.848  25.501 1.00 39.77  ? 338 PHE A CA  1 
ATOM   1223 C  C   . PHE A 1 165 ? 27.882 13.326  25.333 1.00 41.08  ? 338 PHE A C   1 
ATOM   1224 O  O   . PHE A 1 165 ? 27.289 14.181  25.997 1.00 41.68  ? 338 PHE A O   1 
ATOM   1225 C  CB  . PHE A 1 165 ? 26.267 11.493  24.755 1.00 39.59  ? 338 PHE A CB  1 
ATOM   1226 C  CG  . PHE A 1 165 ? 26.136 10.023  24.418 1.00 38.40  ? 338 PHE A CG  1 
ATOM   1227 C  CD1 . PHE A 1 165 ? 25.251 9.214   25.115 1.00 36.67  ? 338 PHE A CD1 1 
ATOM   1228 C  CD2 . PHE A 1 165 ? 26.915 9.447   23.415 1.00 36.29  ? 338 PHE A CD2 1 
ATOM   1229 C  CE1 . PHE A 1 165 ? 25.147 7.858   24.826 1.00 35.90  ? 338 PHE A CE1 1 
ATOM   1230 C  CE2 . PHE A 1 165 ? 26.816 8.096   23.131 1.00 35.75  ? 338 PHE A CE2 1 
ATOM   1231 C  CZ  . PHE A 1 165 ? 25.928 7.300   23.837 1.00 35.42  ? 338 PHE A CZ  1 
ATOM   1232 N  N   . THR A 1 166 ? 28.824 13.633  24.452 1.00 42.28  ? 339 THR A N   1 
ATOM   1233 C  CA  . THR A 1 166 ? 29.048 15.009  24.042 1.00 43.62  ? 339 THR A CA  1 
ATOM   1234 C  C   . THR A 1 166 ? 27.725 15.556  23.488 1.00 44.69  ? 339 THR A C   1 
ATOM   1235 O  O   . THR A 1 166 ? 27.007 14.836  22.800 1.00 45.14  ? 339 THR A O   1 
ATOM   1236 C  CB  . THR A 1 166 ? 30.122 15.037  22.947 1.00 43.58  ? 339 THR A CB  1 
ATOM   1237 O  OG1 . THR A 1 166 ? 31.243 14.245  23.367 1.00 44.27  ? 339 THR A OG1 1 
ATOM   1238 C  CG2 . THR A 1 166 ? 30.590 16.461  22.635 1.00 43.55  ? 339 THR A CG2 1 
ATOM   1239 N  N   . PRO A 1 167 ? 27.368 16.818  23.801 1.00 45.71  ? 340 PRO A N   1 
ATOM   1240 C  CA  . PRO A 1 167 ? 26.203 17.363  23.065 1.00 46.18  ? 340 PRO A CA  1 
ATOM   1241 C  C   . PRO A 1 167 ? 26.558 17.676  21.613 1.00 46.67  ? 340 PRO A C   1 
ATOM   1242 O  O   . PRO A 1 167 ? 27.730 17.859  21.281 1.00 46.48  ? 340 PRO A O   1 
ATOM   1243 C  CB  . PRO A 1 167 ? 25.836 18.653  23.828 1.00 46.02  ? 340 PRO A CB  1 
ATOM   1244 C  CG  . PRO A 1 167 ? 26.646 18.613  25.106 1.00 46.36  ? 340 PRO A CG  1 
ATOM   1245 C  CD  . PRO A 1 167 ? 27.857 17.737  24.844 1.00 45.73  ? 340 PRO A CD  1 
ATOM   1246 N  N   . VAL A 1 168 ? 25.548 17.735  20.758 1.00 47.75  ? 341 VAL A N   1 
ATOM   1247 C  CA  . VAL A 1 168 ? 25.776 17.937  19.336 1.00 48.86  ? 341 VAL A CA  1 
ATOM   1248 C  C   . VAL A 1 168 ? 24.938 19.085  18.772 1.00 49.97  ? 341 VAL A C   1 
ATOM   1249 O  O   . VAL A 1 168 ? 25.113 19.480  17.610 1.00 50.33  ? 341 VAL A O   1 
ATOM   1250 C  CB  . VAL A 1 168 ? 25.485 16.647  18.532 1.00 48.68  ? 341 VAL A CB  1 
ATOM   1251 C  CG1 . VAL A 1 168 ? 26.255 15.480  19.105 1.00 48.78  ? 341 VAL A CG1 1 
ATOM   1252 C  CG2 . VAL A 1 168 ? 23.994 16.340  18.510 1.00 48.13  ? 341 VAL A CG2 1 
ATOM   1253 N  N   . LEU A 1 169 ? 24.040 19.626  19.593 1.00 50.89  ? 342 LEU A N   1 
ATOM   1254 C  CA  . LEU A 1 169 ? 23.020 20.523  19.084 1.00 51.84  ? 342 LEU A CA  1 
ATOM   1255 C  C   . LEU A 1 169 ? 23.329 21.974  19.387 1.00 52.97  ? 342 LEU A C   1 
ATOM   1256 O  O   . LEU A 1 169 ? 23.463 22.344  20.543 1.00 53.29  ? 342 LEU A O   1 
ATOM   1257 C  CB  . LEU A 1 169 ? 21.667 20.126  19.660 1.00 51.55  ? 342 LEU A CB  1 
ATOM   1258 C  CG  . LEU A 1 169 ? 20.379 20.716  19.088 1.00 51.32  ? 342 LEU A CG  1 
ATOM   1259 C  CD1 . LEU A 1 169 ? 20.345 20.649  17.577 1.00 51.09  ? 342 LEU A CD1 1 
ATOM   1260 C  CD2 . LEU A 1 169 ? 19.184 19.977  19.671 1.00 51.38  ? 342 LEU A CD2 1 
ATOM   1261 N  N   . THR A 1 170 ? 23.452 22.794  18.346 1.00 54.52  ? 343 THR A N   1 
ATOM   1262 C  CA  . THR A 1 170 ? 23.651 24.238  18.517 1.00 56.10  ? 343 THR A CA  1 
ATOM   1263 C  C   . THR A 1 170 ? 22.614 25.035  17.739 1.00 57.07  ? 343 THR A C   1 
ATOM   1264 O  O   . THR A 1 170 ? 22.106 24.577  16.718 1.00 56.97  ? 343 THR A O   1 
ATOM   1265 C  CB  . THR A 1 170 ? 25.067 24.712  18.083 1.00 56.11  ? 343 THR A CB  1 
ATOM   1266 O  OG1 . THR A 1 170 ? 25.319 24.287  16.740 1.00 56.14  ? 343 THR A OG1 1 
ATOM   1267 C  CG2 . THR A 1 170 ? 26.160 24.168  19.028 1.00 56.33  ? 343 THR A CG2 1 
ATOM   1268 N  N   . LEU A 1 171 ? 22.311 26.230  18.238 1.00 58.59  ? 344 LEU A N   1 
ATOM   1269 C  CA  . LEU A 1 171 ? 21.373 27.127  17.588 1.00 60.16  ? 344 LEU A CA  1 
ATOM   1270 C  C   . LEU A 1 171 ? 22.142 28.150  16.774 1.00 61.83  ? 344 LEU A C   1 
ATOM   1271 O  O   . LEU A 1 171 ? 22.990 28.872  17.316 1.00 62.05  ? 344 LEU A O   1 
ATOM   1272 C  CB  . LEU A 1 171 ? 20.473 27.820  18.616 1.00 59.62  ? 344 LEU A CB  1 
ATOM   1273 C  CG  . LEU A 1 171 ? 19.675 29.050  18.169 1.00 58.65  ? 344 LEU A CG  1 
ATOM   1274 C  CD1 . LEU A 1 171 ? 18.803 28.746  16.989 1.00 57.77  ? 344 LEU A CD1 1 
ATOM   1275 C  CD2 . LEU A 1 171 ? 18.841 29.552  19.312 1.00 58.38  ? 344 LEU A CD2 1 
ATOM   1276 N  N   . GLU A 1 172 ? 21.833 28.209  15.476 1.00 63.85  ? 345 GLU A N   1 
ATOM   1277 C  CA  . GLU A 1 172 ? 22.487 29.140  14.548 1.00 65.66  ? 345 GLU A CA  1 
ATOM   1278 C  C   . GLU A 1 172 ? 21.545 29.832  13.549 1.00 66.04  ? 345 GLU A C   1 
ATOM   1279 O  O   . GLU A 1 172 ? 20.965 29.186  12.664 1.00 65.94  ? 345 GLU A O   1 
ATOM   1280 C  CB  . GLU A 1 172 ? 23.649 28.446  13.828 1.00 66.19  ? 345 GLU A CB  1 
ATOM   1281 C  CG  . GLU A 1 172 ? 24.982 28.551  14.602 1.00 69.29  ? 345 GLU A CG  1 
ATOM   1282 C  CD  . GLU A 1 172 ? 26.196 28.579  13.674 1.00 72.75  ? 345 GLU A CD  1 
ATOM   1283 O  OE1 . GLU A 1 172 ? 26.578 27.484  13.175 1.00 73.14  ? 345 GLU A OE1 1 
ATOM   1284 O  OE2 . GLU A 1 172 ? 26.756 29.693  13.446 1.00 73.09  ? 345 GLU A OE2 1 
ATOM   1285 N  N   . ASP A 1 173 ? 21.411 31.151  13.707 1.00 66.72  ? 346 ASP A N   1 
ATOM   1286 C  CA  . ASP A 1 173 ? 20.520 31.985  12.870 1.00 67.50  ? 346 ASP A CA  1 
ATOM   1287 C  C   . ASP A 1 173 ? 19.063 31.471  12.744 1.00 67.23  ? 346 ASP A C   1 
ATOM   1288 O  O   . ASP A 1 173 ? 18.505 31.436  11.642 1.00 67.54  ? 346 ASP A O   1 
ATOM   1289 C  CB  . ASP A 1 173 ? 21.139 32.250  11.473 1.00 67.81  ? 346 ASP A CB  1 
ATOM   1290 C  CG  . ASP A 1 173 ? 22.168 33.404  11.473 1.00 69.66  ? 346 ASP A CG  1 
ATOM   1291 O  OD1 . ASP A 1 173 ? 22.864 33.558  10.444 1.00 70.90  ? 346 ASP A OD1 1 
ATOM   1292 O  OD2 . ASP A 1 173 ? 22.293 34.158  12.476 1.00 70.72  ? 346 ASP A OD2 1 
ATOM   1293 N  N   . GLY A 1 174 ? 18.457 31.080  13.869 1.00 66.77  ? 347 GLY A N   1 
ATOM   1294 C  CA  . GLY A 1 174 ? 17.038 30.662  13.901 1.00 66.21  ? 347 GLY A CA  1 
ATOM   1295 C  C   . GLY A 1 174 ? 16.695 29.235  13.450 1.00 65.67  ? 347 GLY A C   1 
ATOM   1296 O  O   . GLY A 1 174 ? 15.514 28.867  13.400 1.00 66.00  ? 347 GLY A O   1 
ATOM   1297 N  N   . PHE A 1 175 ? 17.713 28.458  13.073 1.00 64.44  ? 348 PHE A N   1 
ATOM   1298 C  CA  . PHE A 1 175 ? 17.574 27.011  12.875 1.00 63.32  ? 348 PHE A CA  1 
ATOM   1299 C  C   . PHE A 1 175 ? 18.498 26.299  13.875 1.00 62.37  ? 348 PHE A C   1 
ATOM   1300 O  O   . PHE A 1 175 ? 19.459 26.895  14.377 1.00 62.50  ? 348 PHE A O   1 
ATOM   1301 C  CB  . PHE A 1 175 ? 17.911 26.613  11.423 1.00 63.46  ? 348 PHE A CB  1 
ATOM   1302 C  CG  . PHE A 1 175 ? 16.702 26.536  10.507 1.00 64.28  ? 348 PHE A CG  1 
ATOM   1303 C  CD1 . PHE A 1 175 ? 16.060 25.306  10.270 1.00 64.81  ? 348 PHE A CD1 1 
ATOM   1304 C  CD2 . PHE A 1 175 ? 16.208 27.681  9.876  1.00 64.78  ? 348 PHE A CD2 1 
ATOM   1305 C  CE1 . PHE A 1 175 ? 14.933 25.218  9.422  1.00 64.86  ? 348 PHE A CE1 1 
ATOM   1306 C  CE2 . PHE A 1 175 ? 15.089 27.607  9.019  1.00 65.61  ? 348 PHE A CE2 1 
ATOM   1307 C  CZ  . PHE A 1 175 ? 14.448 26.369  8.796  1.00 65.26  ? 348 PHE A CZ  1 
ATOM   1308 N  N   . TYR A 1 176 ? 18.210 25.041  14.187 1.00 60.74  ? 349 TYR A N   1 
ATOM   1309 C  CA  . TYR A 1 176 ? 19.103 24.280  15.049 1.00 59.17  ? 349 TYR A CA  1 
ATOM   1310 C  C   . TYR A 1 176 ? 19.953 23.335  14.209 1.00 58.91  ? 349 TYR A C   1 
ATOM   1311 O  O   . TYR A 1 176 ? 19.422 22.562  13.410 1.00 58.89  ? 349 TYR A O   1 
ATOM   1312 C  CB  . TYR A 1 176 ? 18.311 23.478  16.083 1.00 58.75  ? 349 TYR A CB  1 
ATOM   1313 C  CG  . TYR A 1 176 ? 17.758 24.295  17.221 1.00 56.29  ? 349 TYR A CG  1 
ATOM   1314 C  CD1 . TYR A 1 176 ? 18.419 24.364  18.438 1.00 53.83  ? 349 TYR A CD1 1 
ATOM   1315 C  CD2 . TYR A 1 176 ? 16.565 24.988  17.080 1.00 53.98  ? 349 TYR A CD2 1 
ATOM   1316 C  CE1 . TYR A 1 176 ? 17.908 25.108  19.472 1.00 52.94  ? 349 TYR A CE1 1 
ATOM   1317 C  CE2 . TYR A 1 176 ? 16.051 25.732  18.099 1.00 52.67  ? 349 TYR A CE2 1 
ATOM   1318 C  CZ  . TYR A 1 176 ? 16.722 25.796  19.293 1.00 52.83  ? 349 TYR A CZ  1 
ATOM   1319 O  OH  . TYR A 1 176 ? 16.187 26.556  20.307 1.00 53.18  ? 349 TYR A OH  1 
ATOM   1320 N  N   . GLU A 1 177 ? 21.268 23.381  14.402 1.00 58.22  ? 350 GLU A N   1 
ATOM   1321 C  CA  . GLU A 1 177 ? 22.175 22.520  13.645 1.00 57.47  ? 350 GLU A CA  1 
ATOM   1322 C  C   . GLU A 1 177 ? 22.783 21.394  14.469 1.00 56.58  ? 350 GLU A C   1 
ATOM   1323 O  O   . GLU A 1 177 ? 22.983 21.519  15.672 1.00 56.34  ? 350 GLU A O   1 
ATOM   1324 C  CB  . GLU A 1 177 ? 23.281 23.347  12.971 1.00 57.78  ? 350 GLU A CB  1 
ATOM   1325 C  CG  . GLU A 1 177 ? 22.831 24.116  11.733 1.00 58.39  ? 350 GLU A CG  1 
ATOM   1326 C  CD  . GLU A 1 177 ? 22.086 23.245  10.734 1.00 60.63  ? 350 GLU A CD  1 
ATOM   1327 O  OE1 . GLU A 1 177 ? 21.249 23.802  9.977  1.00 61.15  ? 350 GLU A OE1 1 
ATOM   1328 O  OE2 . GLU A 1 177 ? 22.323 22.004  10.719 1.00 61.83  ? 350 GLU A OE2 1 
ATOM   1329 N  N   . VAL A 1 178 ? 23.101 20.303  13.790 1.00 55.76  ? 351 VAL A N   1 
ATOM   1330 C  CA  . VAL A 1 178 ? 23.643 19.119  14.437 1.00 55.07  ? 351 VAL A CA  1 
ATOM   1331 C  C   . VAL A 1 178 ? 25.085 18.867  13.973 1.00 54.73  ? 351 VAL A C   1 
ATOM   1332 O  O   . VAL A 1 178 ? 25.338 18.672  12.787 1.00 54.61  ? 351 VAL A O   1 
ATOM   1333 C  CB  . VAL A 1 178 ? 22.751 17.876  14.126 1.00 54.90  ? 351 VAL A CB  1 
ATOM   1334 C  CG1 . VAL A 1 178 ? 23.242 16.647  14.853 1.00 54.74  ? 351 VAL A CG1 1 
ATOM   1335 C  CG2 . VAL A 1 178 ? 21.303 18.148  14.482 1.00 54.54  ? 351 VAL A CG2 1 
ATOM   1336 N  N   . ASP A 1 179 ? 26.033 18.889  14.899 1.00 54.51  ? 352 ASP A N   1 
ATOM   1337 C  CA  . ASP A 1 179 ? 27.389 18.500  14.556 1.00 54.69  ? 352 ASP A CA  1 
ATOM   1338 C  C   . ASP A 1 179 ? 27.510 16.978  14.573 1.00 54.36  ? 352 ASP A C   1 
ATOM   1339 O  O   . ASP A 1 179 ? 27.792 16.379  15.615 1.00 54.34  ? 352 ASP A O   1 
ATOM   1340 C  CB  . ASP A 1 179 ? 28.431 19.124  15.495 1.00 54.87  ? 352 ASP A CB  1 
ATOM   1341 C  CG  . ASP A 1 179 ? 29.866 18.721  15.125 1.00 56.42  ? 352 ASP A CG  1 
ATOM   1342 O  OD1 . ASP A 1 179 ? 30.060 17.935  14.165 1.00 57.99  ? 352 ASP A OD1 1 
ATOM   1343 O  OD2 . ASP A 1 179 ? 30.815 19.185  15.786 1.00 58.20  ? 352 ASP A OD2 1 
ATOM   1344 N  N   . TYR A 1 180 ? 27.329 16.357  13.413 1.00 53.98  ? 353 TYR A N   1 
ATOM   1345 C  CA  . TYR A 1 180 ? 27.332 14.900  13.337 1.00 53.71  ? 353 TYR A CA  1 
ATOM   1346 C  C   . TYR A 1 180 ? 28.708 14.256  13.610 1.00 53.50  ? 353 TYR A C   1 
ATOM   1347 O  O   . TYR A 1 180 ? 28.814 13.044  13.794 1.00 53.34  ? 353 TYR A O   1 
ATOM   1348 C  CB  . TYR A 1 180 ? 26.703 14.435  12.020 1.00 53.72  ? 353 TYR A CB  1 
ATOM   1349 C  CG  . TYR A 1 180 ? 25.176 14.593  11.971 1.00 54.32  ? 353 TYR A CG  1 
ATOM   1350 C  CD1 . TYR A 1 180 ? 24.341 13.633  12.556 1.00 54.87  ? 353 TYR A CD1 1 
ATOM   1351 C  CD2 . TYR A 1 180 ? 24.569 15.686  11.334 1.00 54.50  ? 353 TYR A CD2 1 
ATOM   1352 C  CE1 . TYR A 1 180 ? 22.947 13.743  12.522 1.00 54.85  ? 353 TYR A CE1 1 
ATOM   1353 C  CE2 . TYR A 1 180 ? 23.162 15.812  11.295 1.00 54.87  ? 353 TYR A CE2 1 
ATOM   1354 C  CZ  . TYR A 1 180 ? 22.362 14.827  11.901 1.00 55.59  ? 353 TYR A CZ  1 
ATOM   1355 O  OH  . TYR A 1 180 ? 20.981 14.895  11.896 1.00 55.35  ? 353 TYR A OH  1 
ATOM   1356 N  N   . ASN A 1 181 ? 29.755 15.073  13.678 1.00 53.46  ? 354 ASN A N   1 
ATOM   1357 C  CA  . ASN A 1 181 ? 31.095 14.569  14.021 1.00 53.40  ? 354 ASN A CA  1 
ATOM   1358 C  C   . ASN A 1 181 ? 31.276 14.377  15.507 1.00 52.89  ? 354 ASN A C   1 
ATOM   1359 O  O   . ASN A 1 181 ? 32.337 13.946  15.960 1.00 53.04  ? 354 ASN A O   1 
ATOM   1360 C  CB  . ASN A 1 181 ? 32.202 15.497  13.503 1.00 53.73  ? 354 ASN A CB  1 
ATOM   1361 C  CG  . ASN A 1 181 ? 32.296 15.502  11.990 1.00 54.76  ? 354 ASN A CG  1 
ATOM   1362 O  OD1 . ASN A 1 181 ? 32.021 14.497  11.323 1.00 56.40  ? 354 ASN A OD1 1 
ATOM   1363 N  ND2 . ASN A 1 181 ? 32.693 16.637  11.435 1.00 55.25  ? 354 ASN A ND2 1 
ATOM   1364 N  N   . SER A 1 182 ? 30.248 14.727  16.270 1.00 52.12  ? 355 SER A N   1 
ATOM   1365 C  CA  . SER A 1 182 ? 30.286 14.543  17.713 1.00 51.19  ? 355 SER A CA  1 
ATOM   1366 C  C   . SER A 1 182 ? 29.289 13.486  18.095 1.00 49.81  ? 355 SER A C   1 
ATOM   1367 O  O   . SER A 1 182 ? 29.233 13.085  19.251 1.00 49.99  ? 355 SER A O   1 
ATOM   1368 C  CB  . SER A 1 182 ? 29.935 15.837  18.434 1.00 51.69  ? 355 SER A CB  1 
ATOM   1369 O  OG  . SER A 1 182 ? 30.395 16.963  17.699 1.00 53.62  ? 355 SER A OG  1 
ATOM   1370 N  N   . PHE A 1 183 ? 28.507 13.039  17.113 1.00 48.11  ? 356 PHE A N   1 
ATOM   1371 C  CA  . PHE A 1 183 ? 27.440 12.066  17.346 1.00 46.25  ? 356 PHE A CA  1 
ATOM   1372 C  C   . PHE A 1 183 ? 27.899 10.950  18.270 1.00 45.44  ? 356 PHE A C   1 
ATOM   1373 O  O   . PHE A 1 183 ? 27.233 10.695  19.246 1.00 45.37  ? 356 PHE A O   1 
ATOM   1374 C  CB  . PHE A 1 183 ? 26.880 11.492  16.030 1.00 45.89  ? 356 PHE A CB  1 
ATOM   1375 C  CG  . PHE A 1 183 ? 25.768 10.494  16.225 1.00 44.76  ? 356 PHE A CG  1 
ATOM   1376 C  CD1 . PHE A 1 183 ? 24.436 10.869  16.050 1.00 43.51  ? 356 PHE A CD1 1 
ATOM   1377 C  CD2 . PHE A 1 183 ? 26.041 9.173   16.600 1.00 44.51  ? 356 PHE A CD2 1 
ATOM   1378 C  CE1 . PHE A 1 183 ? 23.387 9.948   16.245 1.00 41.74  ? 356 PHE A CE1 1 
ATOM   1379 C  CE2 . PHE A 1 183 ? 24.992 8.248   16.801 1.00 43.30  ? 356 PHE A CE2 1 
ATOM   1380 C  CZ  . PHE A 1 183 ? 23.666 8.644   16.617 1.00 41.68  ? 356 PHE A CZ  1 
ATOM   1381 N  N   . HIS A 1 184 ? 29.037 10.316  17.969 1.00 44.72  ? 357 HIS A N   1 
ATOM   1382 C  CA  . HIS A 1 184 ? 29.513 9.135   18.694 1.00 44.13  ? 357 HIS A CA  1 
ATOM   1383 C  C   . HIS A 1 184 ? 30.440 9.518   19.811 1.00 44.18  ? 357 HIS A C   1 
ATOM   1384 O  O   . HIS A 1 184 ? 30.896 8.655   20.557 1.00 43.92  ? 357 HIS A O   1 
ATOM   1385 C  CB  . HIS A 1 184 ? 30.277 8.186   17.767 1.00 44.18  ? 357 HIS A CB  1 
ATOM   1386 C  CG  . HIS A 1 184 ? 29.498 7.756   16.568 1.00 44.28  ? 357 HIS A CG  1 
ATOM   1387 N  ND1 . HIS A 1 184 ? 28.656 6.664   16.584 1.00 44.37  ? 357 HIS A ND1 1 
ATOM   1388 C  CD2 . HIS A 1 184 ? 29.402 8.292   15.328 1.00 43.32  ? 357 HIS A CD2 1 
ATOM   1389 C  CE1 . HIS A 1 184 ? 28.083 6.544   15.398 1.00 44.93  ? 357 HIS A CE1 1 
ATOM   1390 N  NE2 . HIS A 1 184 ? 28.520 7.518   14.618 1.00 43.46  ? 357 HIS A NE2 1 
ATOM   1391 N  N   . GLU A 1 185 ? 30.740 10.808  19.927 1.00 44.45  ? 358 GLU A N   1 
ATOM   1392 C  CA  . GLU A 1 185 ? 31.706 11.248  20.920 1.00 44.85  ? 358 GLU A CA  1 
ATOM   1393 C  C   . GLU A 1 185 ? 31.126 11.324  22.320 1.00 44.14  ? 358 GLU A C   1 
ATOM   1394 O  O   . GLU A 1 185 ? 29.966 11.687  22.507 1.00 44.04  ? 358 GLU A O   1 
ATOM   1395 C  CB  . GLU A 1 185 ? 32.409 12.539  20.499 1.00 45.17  ? 358 GLU A CB  1 
ATOM   1396 C  CG  . GLU A 1 185 ? 33.876 12.281  20.078 1.00 49.46  ? 358 GLU A CG  1 
ATOM   1397 C  CD  . GLU A 1 185 ? 34.337 13.097  18.841 1.00 54.23  ? 358 GLU A CD  1 
ATOM   1398 O  OE1 . GLU A 1 185 ? 34.305 14.360  18.869 1.00 56.11  ? 358 GLU A OE1 1 
ATOM   1399 O  OE2 . GLU A 1 185 ? 34.751 12.460  17.840 1.00 54.88  ? 358 GLU A OE2 1 
ATOM   1400 N  N   . THR A 1 186 ? 31.956 10.935  23.288 1.00 43.43  ? 359 THR A N   1 
ATOM   1401 C  CA  . THR A 1 186 ? 31.606 10.917  24.699 1.00 42.56  ? 359 THR A CA  1 
ATOM   1402 C  C   . THR A 1 186 ? 32.775 11.450  25.514 1.00 41.88  ? 359 THR A C   1 
ATOM   1403 O  O   . THR A 1 186 ? 33.897 11.477  25.028 1.00 41.85  ? 359 THR A O   1 
ATOM   1404 C  CB  . THR A 1 186 ? 31.343 9.495   25.181 1.00 42.64  ? 359 THR A CB  1 
ATOM   1405 O  OG1 . THR A 1 186 ? 32.528 8.717   25.008 1.00 43.40  ? 359 THR A OG1 1 
ATOM   1406 C  CG2 . THR A 1 186 ? 30.221 8.858   24.400 1.00 42.63  ? 359 THR A CG2 1 
ATOM   1407 N  N   . TYR A 1 187 ? 32.512 11.858  26.757 1.00 41.22  ? 360 TYR A N   1 
ATOM   1408 C  CA  . TYR A 1 187 ? 33.559 12.373  27.653 1.00 39.94  ? 360 TYR A CA  1 
ATOM   1409 C  C   . TYR A 1 187 ? 33.446 11.764  29.029 1.00 39.72  ? 360 TYR A C   1 
ATOM   1410 O  O   . TYR A 1 187 ? 32.373 11.299  29.416 1.00 39.54  ? 360 TYR A O   1 
ATOM   1411 C  CB  . TYR A 1 187 ? 33.533 13.903  27.732 1.00 39.29  ? 360 TYR A CB  1 
ATOM   1412 C  CG  . TYR A 1 187 ? 32.297 14.489  28.339 1.00 37.41  ? 360 TYR A CG  1 
ATOM   1413 C  CD1 . TYR A 1 187 ? 32.277 14.869  29.676 1.00 36.77  ? 360 TYR A CD1 1 
ATOM   1414 C  CD2 . TYR A 1 187 ? 31.150 14.691  27.578 1.00 35.50  ? 360 TYR A CD2 1 
ATOM   1415 C  CE1 . TYR A 1 187 ? 31.138 15.433  30.254 1.00 34.89  ? 360 TYR A CE1 1 
ATOM   1416 C  CE2 . TYR A 1 187 ? 30.010 15.248  28.137 1.00 34.65  ? 360 TYR A CE2 1 
ATOM   1417 C  CZ  . TYR A 1 187 ? 30.009 15.621  29.479 1.00 34.64  ? 360 TYR A CZ  1 
ATOM   1418 O  OH  . TYR A 1 187 ? 28.876 16.165  30.048 1.00 33.42  ? 360 TYR A OH  1 
ATOM   1419 N  N   . GLU A 1 188 ? 34.559 11.754  29.761 1.00 39.51  ? 361 GLU A N   1 
ATOM   1420 C  CA  . GLU A 1 188 ? 34.590 11.139  31.093 1.00 39.40  ? 361 GLU A CA  1 
ATOM   1421 C  C   . GLU A 1 188 ? 33.996 12.044  32.173 1.00 38.83  ? 361 GLU A C   1 
ATOM   1422 O  O   . GLU A 1 188 ? 34.043 13.265  32.055 1.00 38.83  ? 361 GLU A O   1 
ATOM   1423 C  CB  . GLU A 1 188 ? 36.009 10.727  31.464 1.00 39.41  ? 361 GLU A CB  1 
ATOM   1424 C  CG  . GLU A 1 188 ? 36.076 9.777   32.654 1.00 41.58  ? 361 GLU A CG  1 
ATOM   1425 C  CD  . GLU A 1 188 ? 37.497 9.344   32.970 1.00 44.44  ? 361 GLU A CD  1 
ATOM   1426 O  OE1 . GLU A 1 188 ? 38.443 10.032  32.512 1.00 46.37  ? 361 GLU A OE1 1 
ATOM   1427 O  OE2 . GLU A 1 188 ? 37.669 8.323   33.673 1.00 44.08  ? 361 GLU A OE2 1 
ATOM   1428 N  N   . THR A 1 189 ? 33.418 11.447  33.209 1.00 38.25  ? 362 THR A N   1 
ATOM   1429 C  CA  . THR A 1 189 ? 32.844 12.219  34.297 1.00 38.27  ? 362 THR A CA  1 
ATOM   1430 C  C   . THR A 1 189 ? 32.843 11.437  35.603 1.00 38.70  ? 362 THR A C   1 
ATOM   1431 O  O   . THR A 1 189 ? 32.555 10.232  35.623 1.00 39.12  ? 362 THR A O   1 
ATOM   1432 C  CB  . THR A 1 189 ? 31.419 12.625  33.998 1.00 38.27  ? 362 THR A CB  1 
ATOM   1433 O  OG1 . THR A 1 189 ? 31.069 13.759  34.798 1.00 39.08  ? 362 THR A OG1 1 
ATOM   1434 C  CG2 . THR A 1 189 ? 30.467 11.487  34.308 1.00 38.34  ? 362 THR A CG2 1 
ATOM   1435 N  N   . SER A 1 190 ? 33.169 12.125  36.699 1.00 38.73  ? 363 SER A N   1 
ATOM   1436 C  CA  . SER A 1 190 ? 33.202 11.504  38.026 1.00 38.21  ? 363 SER A CA  1 
ATOM   1437 C  C   . SER A 1 190 ? 31.920 10.693  38.208 1.00 37.63  ? 363 SER A C   1 
ATOM   1438 O  O   . SER A 1 190 ? 30.830 11.202  37.962 1.00 37.83  ? 363 SER A O   1 
ATOM   1439 C  CB  . SER A 1 190 ? 33.357 12.575  39.111 1.00 38.11  ? 363 SER A CB  1 
ATOM   1440 O  OG  . SER A 1 190 ? 33.393 12.007  40.403 1.00 38.68  ? 363 SER A OG  1 
ATOM   1441 N  N   . THR A 1 191 ? 32.067 9.433   38.606 1.00 37.07  ? 364 THR A N   1 
ATOM   1442 C  CA  . THR A 1 191 ? 30.977 8.456   38.638 1.00 36.69  ? 364 THR A CA  1 
ATOM   1443 C  C   . THR A 1 191 ? 31.395 7.325   39.561 1.00 36.74  ? 364 THR A C   1 
ATOM   1444 O  O   . THR A 1 191 ? 32.457 6.743   39.359 1.00 36.90  ? 364 THR A O   1 
ATOM   1445 C  CB  . THR A 1 191 ? 30.741 7.851   37.238 1.00 36.67  ? 364 THR A CB  1 
ATOM   1446 O  OG1 . THR A 1 191 ? 30.242 8.854   36.348 1.00 36.91  ? 364 THR A OG1 1 
ATOM   1447 C  CG2 . THR A 1 191 ? 29.763 6.705   37.280 1.00 35.87  ? 364 THR A CG2 1 
ATOM   1448 N  N   . PRO A 1 192 ? 30.566 6.990   40.568 1.00 36.79  ? 365 PRO A N   1 
ATOM   1449 C  CA  . PRO A 1 192 ? 30.957 5.977   41.543 1.00 37.11  ? 365 PRO A CA  1 
ATOM   1450 C  C   . PRO A 1 192 ? 31.164 4.629   40.876 1.00 37.61  ? 365 PRO A C   1 
ATOM   1451 O  O   . PRO A 1 192 ? 30.566 4.353   39.849 1.00 37.97  ? 365 PRO A O   1 
ATOM   1452 C  CB  . PRO A 1 192 ? 29.766 5.926   42.494 1.00 37.02  ? 365 PRO A CB  1 
ATOM   1453 C  CG  . PRO A 1 192 ? 28.629 6.420   41.712 1.00 36.72  ? 365 PRO A CG  1 
ATOM   1454 C  CD  . PRO A 1 192 ? 29.170 7.415   40.750 1.00 36.96  ? 365 PRO A CD  1 
ATOM   1455 N  N   . SER A 1 193 ? 32.013 3.791   41.431 1.00 38.11  ? 366 SER A N   1 
ATOM   1456 C  CA  . SER A 1 193 ? 32.271 2.542   40.771 1.00 39.17  ? 366 SER A CA  1 
ATOM   1457 C  C   . SER A 1 193 ? 31.402 1.424   41.369 1.00 39.84  ? 366 SER A C   1 
ATOM   1458 O  O   . SER A 1 193 ? 31.544 0.242   41.017 1.00 40.44  ? 366 SER A O   1 
ATOM   1459 C  CB  . SER A 1 193 ? 33.753 2.229   40.848 1.00 39.12  ? 366 SER A CB  1 
ATOM   1460 O  OG  . SER A 1 193 ? 34.193 2.407   42.181 1.00 40.42  ? 366 SER A OG  1 
ATOM   1461 N  N   . LEU A 1 194 ? 30.482 1.802   42.249 1.00 40.29  ? 367 LEU A N   1 
ATOM   1462 C  CA  . LEU A 1 194 ? 29.605 0.838   42.898 1.00 41.10  ? 367 LEU A CA  1 
ATOM   1463 C  C   . LEU A 1 194 ? 28.429 0.469   42.020 1.00 41.76  ? 367 LEU A C   1 
ATOM   1464 O  O   . LEU A 1 194 ? 27.988 1.269   41.199 1.00 41.96  ? 367 LEU A O   1 
ATOM   1465 C  CB  . LEU A 1 194 ? 29.082 1.398   44.215 1.00 41.22  ? 367 LEU A CB  1 
ATOM   1466 C  CG  . LEU A 1 194 ? 29.671 0.958   45.563 1.00 41.54  ? 367 LEU A CG  1 
ATOM   1467 C  CD1 . LEU A 1 194 ? 31.205 0.820   45.576 1.00 41.14  ? 367 LEU A CD1 1 
ATOM   1468 C  CD2 . LEU A 1 194 ? 29.203 1.965   46.605 1.00 41.23  ? 367 LEU A CD2 1 
ATOM   1469 N  N   . SER A 1 195 ? 27.914 -0.748  42.195 1.00 42.52  ? 368 SER A N   1 
ATOM   1470 C  CA  . SER A 1 195 ? 26.697 -1.169  41.502 1.00 42.82  ? 368 SER A CA  1 
ATOM   1471 C  C   . SER A 1 195 ? 25.484 -0.371  42.006 1.00 43.13  ? 368 SER A C   1 
ATOM   1472 O  O   . SER A 1 195 ? 25.494 0.195   43.103 1.00 42.89  ? 368 SER A O   1 
ATOM   1473 C  CB  . SER A 1 195 ? 26.470 -2.672  41.672 1.00 42.66  ? 368 SER A CB  1 
ATOM   1474 O  OG  . SER A 1 195 ? 25.875 -2.968  42.930 1.00 43.02  ? 368 SER A OG  1 
ATOM   1475 N  N   . ALA A 1 196 ? 24.439 -0.321  41.197 1.00 43.56  ? 369 ALA A N   1 
ATOM   1476 C  CA  . ALA A 1 196 ? 23.255 0.424   41.583 1.00 44.13  ? 369 ALA A CA  1 
ATOM   1477 C  C   . ALA A 1 196 ? 22.690 -0.090  42.904 1.00 44.53  ? 369 ALA A C   1 
ATOM   1478 O  O   . ALA A 1 196 ? 22.282 0.695   43.747 1.00 44.50  ? 369 ALA A O   1 
ATOM   1479 C  CB  . ALA A 1 196 ? 22.213 0.348   40.502 1.00 44.29  ? 369 ALA A CB  1 
ATOM   1480 N  N   . LYS A 1 197 ? 22.663 -1.410  43.076 1.00 45.15  ? 370 LYS A N   1 
ATOM   1481 C  CA  . LYS A 1 197 ? 22.138 -2.003  44.298 1.00 45.67  ? 370 LYS A CA  1 
ATOM   1482 C  C   . LYS A 1 197 ? 22.965 -1.492  45.467 1.00 46.34  ? 370 LYS A C   1 
ATOM   1483 O  O   . LYS A 1 197 ? 22.434 -0.935  46.438 1.00 46.10  ? 370 LYS A O   1 
ATOM   1484 C  CB  . LYS A 1 197 ? 22.157 -3.540  44.228 1.00 45.43  ? 370 LYS A CB  1 
ATOM   1485 C  CG  . LYS A 1 197 ? 21.957 -4.219  45.583 1.00 45.30  ? 370 LYS A CG  1 
ATOM   1486 C  CD  . LYS A 1 197 ? 20.869 -5.292  45.580 1.00 44.18  ? 370 LYS A CD  1 
ATOM   1487 C  CE  . LYS A 1 197 ? 21.440 -6.673  45.432 1.00 43.10  ? 370 LYS A CE  1 
ATOM   1488 N  NZ  . LYS A 1 197 ? 22.024 -7.127  46.718 1.00 43.55  ? 370 LYS A NZ  1 
ATOM   1489 N  N   . GLU A 1 198 ? 24.276 -1.667  45.350 1.00 47.21  ? 371 GLU A N   1 
ATOM   1490 C  CA  . GLU A 1 198 ? 25.191 -1.203  46.370 1.00 48.15  ? 371 GLU A CA  1 
ATOM   1491 C  C   . GLU A 1 198 ? 24.955 0.275   46.675 1.00 48.19  ? 371 GLU A C   1 
ATOM   1492 O  O   . GLU A 1 198 ? 24.795 0.621   47.836 1.00 48.83  ? 371 GLU A O   1 
ATOM   1493 C  CB  . GLU A 1 198 ? 26.640 -1.465  45.961 1.00 48.50  ? 371 GLU A CB  1 
ATOM   1494 C  CG  . GLU A 1 198 ? 27.133 -2.880  46.270 1.00 50.66  ? 371 GLU A CG  1 
ATOM   1495 C  CD  . GLU A 1 198 ? 28.520 -3.179  45.659 1.00 54.66  ? 371 GLU A CD  1 
ATOM   1496 O  OE1 . GLU A 1 198 ? 28.849 -2.656  44.558 1.00 54.56  ? 371 GLU A OE1 1 
ATOM   1497 O  OE2 . GLU A 1 198 ? 29.281 -3.957  46.286 1.00 56.25  ? 371 GLU A OE2 1 
ATOM   1498 N  N   . LEU A 1 199 ? 24.890 1.131   45.652 1.00 48.10  ? 372 LEU A N   1 
ATOM   1499 C  CA  . LEU A 1 199 ? 24.662 2.560   45.878 1.00 48.15  ? 372 LEU A CA  1 
ATOM   1500 C  C   . LEU A 1 199 ? 23.422 2.777   46.715 1.00 48.94  ? 372 LEU A C   1 
ATOM   1501 O  O   . LEU A 1 199 ? 23.438 3.574   47.647 1.00 48.89  ? 372 LEU A O   1 
ATOM   1502 C  CB  . LEU A 1 199 ? 24.540 3.347   44.571 1.00 47.62  ? 372 LEU A CB  1 
ATOM   1503 C  CG  . LEU A 1 199 ? 25.715 3.538   43.609 1.00 45.70  ? 372 LEU A CG  1 
ATOM   1504 C  CD1 . LEU A 1 199 ? 25.293 4.516   42.567 1.00 44.60  ? 372 LEU A CD1 1 
ATOM   1505 C  CD2 . LEU A 1 199 ? 26.942 4.059   44.278 1.00 44.56  ? 372 LEU A CD2 1 
ATOM   1506 N  N   . ALA A 1 200 ? 22.360 2.050   46.380 1.00 50.26  ? 373 ALA A N   1 
ATOM   1507 C  CA  . ALA A 1 200 ? 21.091 2.133   47.094 1.00 51.79  ? 373 ALA A CA  1 
ATOM   1508 C  C   . ALA A 1 200 ? 21.288 1.788   48.554 1.00 53.14  ? 373 ALA A C   1 
ATOM   1509 O  O   . ALA A 1 200 ? 20.898 2.551   49.444 1.00 53.48  ? 373 ALA A O   1 
ATOM   1510 C  CB  . ALA A 1 200 ? 20.060 1.201   46.469 1.00 51.50  ? 373 ALA A CB  1 
ATOM   1511 N  N   . GLU A 1 201 ? 21.890 0.629   48.797 1.00 54.65  ? 374 GLU A N   1 
ATOM   1512 C  CA  . GLU A 1 201 ? 22.187 0.213   50.157 1.00 56.45  ? 374 GLU A CA  1 
ATOM   1513 C  C   . GLU A 1 201 ? 22.915 1.321   50.909 1.00 56.96  ? 374 GLU A C   1 
ATOM   1514 O  O   . GLU A 1 201 ? 22.390 1.875   51.894 1.00 56.98  ? 374 GLU A O   1 
ATOM   1515 C  CB  . GLU A 1 201 ? 23.024 -1.065  50.143 1.00 56.74  ? 374 GLU A CB  1 
ATOM   1516 C  CG  . GLU A 1 201 ? 22.152 -2.315  50.081 1.00 59.25  ? 374 GLU A CG  1 
ATOM   1517 C  CD  . GLU A 1 201 ? 22.835 -3.471  49.364 1.00 62.56  ? 374 GLU A CD  1 
ATOM   1518 O  OE1 . GLU A 1 201 ? 24.081 -3.400  49.138 1.00 63.10  ? 374 GLU A OE1 1 
ATOM   1519 O  OE2 . GLU A 1 201 ? 22.110 -4.443  49.023 1.00 63.19  ? 374 GLU A OE2 1 
ATOM   1520 N  N   . LEU A 1 202 ? 24.114 1.640   50.419 1.00 57.54  ? 375 LEU A N   1 
ATOM   1521 C  CA  . LEU A 1 202 ? 24.942 2.696   50.983 1.00 58.13  ? 375 LEU A CA  1 
ATOM   1522 C  C   . LEU A 1 202 ? 24.132 3.953   51.284 1.00 59.07  ? 375 LEU A C   1 
ATOM   1523 O  O   . LEU A 1 202 ? 24.117 4.422   52.417 1.00 59.44  ? 375 LEU A O   1 
ATOM   1524 C  CB  . LEU A 1 202 ? 26.119 3.014   50.061 1.00 57.41  ? 375 LEU A CB  1 
ATOM   1525 C  CG  . LEU A 1 202 ? 27.172 3.961   50.614 1.00 55.94  ? 375 LEU A CG  1 
ATOM   1526 C  CD1 . LEU A 1 202 ? 27.505 3.594   52.047 1.00 56.38  ? 375 LEU A CD1 1 
ATOM   1527 C  CD2 . LEU A 1 202 ? 28.408 3.924   49.756 1.00 54.29  ? 375 LEU A CD2 1 
ATOM   1528 N  N   . ALA A 1 203 ? 23.438 4.480   50.285 1.00 60.21  ? 376 ALA A N   1 
ATOM   1529 C  CA  . ALA A 1 203 ? 22.687 5.712   50.485 1.00 61.56  ? 376 ALA A CA  1 
ATOM   1530 C  C   . ALA A 1 203 ? 21.634 5.565   51.563 1.00 62.68  ? 376 ALA A C   1 
ATOM   1531 O  O   . ALA A 1 203 ? 21.473 6.456   52.366 1.00 63.06  ? 376 ALA A O   1 
ATOM   1532 C  CB  . ALA A 1 203 ? 22.057 6.197   49.192 1.00 61.36  ? 376 ALA A CB  1 
ATOM   1533 N  N   . ASN A 1 204 ? 20.927 4.442   51.599 1.00 64.35  ? 377 ASN A N   1 
ATOM   1534 C  CA  . ASN A 1 204 ? 19.819 4.303   52.549 1.00 65.96  ? 377 ASN A CA  1 
ATOM   1535 C  C   . ASN A 1 204 ? 20.298 3.909   53.972 1.00 66.66  ? 377 ASN A C   1 
ATOM   1536 O  O   . ASN A 1 204 ? 20.356 2.721   54.350 1.00 66.88  ? 377 ASN A O   1 
ATOM   1537 C  CB  . ASN A 1 204 ? 18.691 3.414   51.976 1.00 66.18  ? 377 ASN A CB  1 
ATOM   1538 C  CG  . ASN A 1 204 ? 18.574 2.065   52.682 1.00 67.14  ? 377 ASN A CG  1 
ATOM   1539 O  OD1 . ASN A 1 204 ? 19.416 1.167   52.510 1.00 67.56  ? 377 ASN A OD1 1 
ATOM   1540 N  ND2 . ASN A 1 204 ? 17.517 1.920   53.484 1.00 67.31  ? 377 ASN A ND2 1 
ATOM   1541 N  N   . ARG A 1 205 ? 20.667 4.949   54.727 1.00 67.44  ? 378 ARG A N   1 
ATOM   1542 C  CA  . ARG A 1 205 ? 21.221 4.886   56.105 1.00 67.93  ? 378 ARG A CA  1 
ATOM   1543 C  C   . ARG A 1 205 ? 22.212 6.062   56.307 1.00 67.81  ? 378 ARG A C   1 
ATOM   1544 O  O   . ARG A 1 205 ? 21.859 7.223   56.064 1.00 67.39  ? 378 ARG A O   1 
ATOM   1545 C  CB  . ARG A 1 205 ? 21.864 3.511   56.444 1.00 68.11  ? 378 ARG A CB  1 
ATOM   1546 C  CG  . ARG A 1 205 ? 23.107 3.135   55.622 1.00 67.97  ? 378 ARG A CG  1 
ATOM   1547 C  CD  . ARG A 1 205 ? 23.671 1.823   56.108 1.00 69.65  ? 378 ARG A CD  1 
ATOM   1548 N  NE  . ARG A 1 205 ? 24.473 1.158   55.084 1.00 72.03  ? 378 ARG A NE  1 
ATOM   1549 C  CZ  . ARG A 1 205 ? 25.781 1.345   54.899 1.00 73.04  ? 378 ARG A CZ  1 
ATOM   1550 N  NH1 . ARG A 1 205 ? 26.458 2.184   55.677 1.00 73.43  ? 378 ARG A NH1 1 
ATOM   1551 N  NH2 . ARG A 1 205 ? 26.419 0.688   53.931 1.00 72.83  ? 378 ARG A NH2 1 
HETATM 1552 CS CS  . CS  B 2 .   ? 2.614  0.765   27.475 1.00 161.76 ? 1   CS  A CS  1 
HETATM 1553 CS CS  . CS  C 2 .   ? 5.998  1.944   16.588 1.00 144.29 ? 2   CS  A CS  1 
HETATM 1554 MG MG  . MG  D 3 .   ? 0.000  0.000   13.226 0.25 33.15  ? 382 MG  A MG  1 
HETATM 1555 C  C1  . EOH E 4 .   ? 30.982 9.272   43.625 0.50 11.16  ? 383 EOH A C1  1 
HETATM 1556 C  C2  . EOH E 4 .   ? 31.194 10.337  42.548 0.50 11.04  ? 383 EOH A C2  1 
HETATM 1557 O  O   . EOH E 4 .   ? 31.972 8.259   43.593 0.50 11.16  ? 383 EOH A O   1 
HETATM 1558 C  C1  . EOH F 4 .   ? 25.741 -13.615 23.096 1.00 44.62  ? 384 EOH A C1  1 
HETATM 1559 C  C2  . EOH F 4 .   ? 25.860 -14.092 24.541 1.00 45.02  ? 384 EOH A C2  1 
HETATM 1560 O  O   . EOH F 4 .   ? 25.090 -12.364 23.029 1.00 44.67  ? 384 EOH A O   1 
HETATM 1561 O  O   . HOH G 5 .   ? 28.042 10.022  36.859 1.00 24.98  ? 3   HOH A O   1 
HETATM 1562 O  O   . HOH G 5 .   ? 14.078 4.405   31.975 1.00 24.80  ? 4   HOH A O   1 
HETATM 1563 O  O   . HOH G 5 .   ? 25.015 19.871  9.886  1.00 32.89  ? 6   HOH A O   1 
HETATM 1564 O  O   . HOH G 5 .   ? 10.195 19.532  9.884  1.00 33.55  ? 7   HOH A O   1 
HETATM 1565 O  O   . HOH G 5 .   ? 0.000  0.000   25.595 0.25 10.75  ? 8   HOH A O   1 
HETATM 1566 O  O   . HOH G 5 .   ? 26.519 0.700   17.471 1.00 52.31  ? 9   HOH A O   1 
HETATM 1567 O  O   . HOH G 5 .   ? 9.867  0.318   25.075 1.00 28.69  ? 10  HOH A O   1 
HETATM 1568 O  O   . HOH G 5 .   ? 14.763 3.377   10.187 1.00 25.49  ? 11  HOH A O   1 
HETATM 1569 O  O   . HOH G 5 .   ? 10.418 -0.351  18.651 1.00 63.74  ? 13  HOH A O   1 
HETATM 1570 O  O   . HOH G 5 .   ? 9.103  2.778   31.793 1.00 32.17  ? 14  HOH A O   1 
HETATM 1571 O  O   . HOH G 5 .   ? 5.614  1.773   23.563 1.00 36.60  ? 15  HOH A O   1 
HETATM 1572 O  O   . HOH G 5 .   ? 8.817  13.098  12.331 1.00 38.90  ? 385 HOH A O   1 
HETATM 1573 O  O   . HOH G 5 .   ? 22.440 0.054   12.756 1.00 24.10  ? 386 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   49  ?   ?   ?   A . n 
A 1 2   SER 2   50  ?   ?   ?   A . n 
A 1 3   HIS 3   51  ?   ?   ?   A . n 
A 1 4   MET 4   52  ?   ?   ?   A . n 
A 1 5   ARG 5   53  ?   ?   ?   A . n 
A 1 6   LYS 6   54  ?   ?   ?   A . n 
A 1 7   ILE 7   55  ?   ?   ?   A . n 
A 1 8   GLN 8   56  56  GLN GLN A . n 
A 1 9   ARG 9   57  57  ARG ARG A . n 
A 1 10  TYR 10  58  58  TYR TYR A . n 
A 1 11  VAL 11  59  59  VAL VAL A . n 
A 1 12  ARG 12  60  60  ARG ARG A . n 
A 1 13  LYS 13  61  61  LYS LYS A . n 
A 1 14  ASP 14  62  62  ASP ASP A . n 
A 1 15  GLY 15  63  63  GLY GLY A . n 
A 1 16  LYS 16  64  64  LYS LYS A . n 
A 1 17  CYS 17  65  65  CYS CYS A . n 
A 1 18  ASN 18  66  66  ASN ASN A . n 
A 1 19  VAL 19  67  67  VAL VAL A . n 
A 1 20  HIS 20  68  68  HIS HIS A . n 
A 1 21  HIS 21  69  69  HIS HIS A . n 
A 1 22  GLY 22  70  70  GLY GLY A . n 
A 1 23  ASN 23  71  71  ASN ASN A . n 
A 1 24  VAL 24  72  72  VAL VAL A . n 
A 1 25  ARG 25  73  73  ARG ARG A . n 
A 1 26  GLU 26  74  ?   ?   ?   A . n 
A 1 27  LYS 27  200 ?   ?   ?   A . n 
A 1 28  ARG 28  201 ?   ?   ?   A . n 
A 1 29  ALA 29  202 ?   ?   ?   A . n 
A 1 30  GLU 30  203 ?   ?   ?   A . n 
A 1 31  THR 31  204 204 THR THR A . n 
A 1 32  LEU 32  205 205 LEU LEU A . n 
A 1 33  VAL 33  206 206 VAL VAL A . n 
A 1 34  PHE 34  207 207 PHE PHE A . n 
A 1 35  SER 35  208 208 SER SER A . n 
A 1 36  THR 36  209 209 THR THR A . n 
A 1 37  HIS 37  210 210 HIS HIS A . n 
A 1 38  ALA 38  211 211 ALA ALA A . n 
A 1 39  VAL 39  212 212 VAL VAL A . n 
A 1 40  ILE 40  213 213 ILE ILE A . n 
A 1 41  SER 41  214 214 SER SER A . n 
A 1 42  MET 42  215 215 MET MET A . n 
A 1 43  ARG 43  216 216 ARG ARG A . n 
A 1 44  ASP 44  217 217 ASP ASP A . n 
A 1 45  GLY 45  218 218 GLY GLY A . n 
A 1 46  LYS 46  219 219 LYS LYS A . n 
A 1 47  LEU 47  220 220 LEU LEU A . n 
A 1 48  CYS 48  221 221 CYS CYS A . n 
A 1 49  LEU 49  222 222 LEU LEU A . n 
A 1 50  MET 50  223 223 MET MET A . n 
A 1 51  PHE 51  224 224 PHE PHE A . n 
A 1 52  ARG 52  225 225 ARG ARG A . n 
A 1 53  VAL 53  226 226 VAL VAL A . n 
A 1 54  GLY 54  227 227 GLY GLY A . n 
A 1 55  ASP 55  228 228 ASP ASP A . n 
A 1 56  LEU 56  229 229 LEU LEU A . n 
A 1 57  ARG 57  230 230 ARG ARG A . n 
A 1 58  ASN 58  231 231 ASN ASN A . n 
A 1 59  SER 59  232 232 SER SER A . n 
A 1 60  HIS 60  233 233 HIS HIS A . n 
A 1 61  ILE 61  234 234 ILE ILE A . n 
A 1 62  VAL 62  235 235 VAL VAL A . n 
A 1 63  GLU 63  236 236 GLU GLU A . n 
A 1 64  ALA 64  237 237 ALA ALA A . n 
A 1 65  SER 65  238 238 SER SER A . n 
A 1 66  ILE 66  239 239 ILE ILE A . n 
A 1 67  ARG 67  240 240 ARG ARG A . n 
A 1 68  ALA 68  241 241 ALA ALA A . n 
A 1 69  LYS 69  242 242 LYS LYS A . n 
A 1 70  LEU 70  243 243 LEU LEU A . n 
A 1 71  ILE 71  244 244 ILE ILE A . n 
A 1 72  LYS 72  245 245 LYS LYS A . n 
A 1 73  SER 73  246 246 SER SER A . n 
A 1 74  LYS 74  247 247 LYS LYS A . n 
A 1 75  GLN 75  248 248 GLN GLN A . n 
A 1 76  THR 76  249 249 THR THR A . n 
A 1 77  SER 77  250 250 SER SER A . n 
A 1 78  GLU 78  251 251 GLU GLU A . n 
A 1 79  GLY 79  252 252 GLY GLY A . n 
A 1 80  GLU 80  253 253 GLU GLU A . n 
A 1 81  PHE 81  254 254 PHE PHE A . n 
A 1 82  ILE 82  255 255 ILE ILE A . n 
A 1 83  PRO 83  256 256 PRO PRO A . n 
A 1 84  LEU 84  257 257 LEU LEU A . n 
A 1 85  ASN 85  258 258 ASN ASN A . n 
A 1 86  GLN 86  259 259 GLN GLN A . n 
A 1 87  THR 87  260 260 THR THR A . n 
A 1 88  ASP 88  261 261 ASP ASP A . n 
A 1 89  ILE 89  262 262 ILE ILE A . n 
A 1 90  ASN 90  263 263 ASN ASN A . n 
A 1 91  VAL 91  264 264 VAL VAL A . n 
A 1 92  GLY 92  265 265 GLY GLY A . n 
A 1 93  TYR 93  266 266 TYR TYR A . n 
A 1 94  TYR 94  267 267 TYR TYR A . n 
A 1 95  THR 95  268 268 THR THR A . n 
A 1 96  GLY 96  269 269 GLY GLY A . n 
A 1 97  ASP 97  270 270 ASP ASP A . n 
A 1 98  ASP 98  271 271 ASP ASP A . n 
A 1 99  ARG 99  272 272 ARG ARG A . n 
A 1 100 LEU 100 273 273 LEU LEU A . n 
A 1 101 PHE 101 274 274 PHE PHE A . n 
A 1 102 LEU 102 275 275 LEU LEU A . n 
A 1 103 VAL 103 276 276 VAL VAL A . n 
A 1 104 SER 104 277 277 SER SER A . n 
A 1 105 PRO 105 278 278 PRO PRO A . n 
A 1 106 LEU 106 279 279 LEU LEU A . n 
A 1 107 ILE 107 280 280 ILE ILE A . n 
A 1 108 ILE 108 281 281 ILE ILE A . n 
A 1 109 SER 109 282 282 SER SER A . n 
A 1 110 HIS 110 283 283 HIS HIS A . n 
A 1 111 GLU 111 284 284 GLU GLU A . n 
A 1 112 ILE 112 285 285 ILE ILE A . n 
A 1 113 ASN 113 286 286 ASN ASN A . n 
A 1 114 GLN 114 287 287 GLN GLN A . n 
A 1 115 GLN 115 288 288 GLN GLN A . n 
A 1 116 SER 116 289 289 SER SER A . n 
A 1 117 PRO 117 290 290 PRO PRO A . n 
A 1 118 PHE 118 291 291 PHE PHE A . n 
A 1 119 TRP 119 292 292 TRP TRP A . n 
A 1 120 GLU 120 293 293 GLU GLU A . n 
A 1 121 ILE 121 294 294 ILE ILE A . n 
A 1 122 SER 122 295 295 SER SER A . n 
A 1 123 LYS 123 296 296 LYS LYS A . n 
A 1 124 ALA 124 297 297 ALA ALA A . n 
A 1 125 GLN 125 298 298 GLN GLN A . n 
A 1 126 LEU 126 299 299 LEU LEU A . n 
A 1 127 PRO 127 300 300 PRO PRO A . n 
A 1 128 LYS 128 301 301 LYS LYS A . n 
A 1 129 GLU 129 302 302 GLU GLU A . n 
A 1 130 GLU 130 303 303 GLU GLU A . n 
A 1 131 LEU 131 304 304 LEU LEU A . n 
A 1 132 GLU 132 305 305 GLU GLU A . n 
A 1 133 ILE 133 306 306 ILE ILE A . n 
A 1 134 VAL 134 307 307 VAL VAL A . n 
A 1 135 VAL 135 308 308 VAL VAL A . n 
A 1 136 ILE 136 309 309 ILE ILE A . n 
A 1 137 LEU 137 310 310 LEU LEU A . n 
A 1 138 GLU 138 311 311 GLU GLU A . n 
A 1 139 GLY 139 312 312 GLY GLY A . n 
A 1 140 MET 140 313 313 MET MET A . n 
A 1 141 VAL 141 314 314 VAL VAL A . n 
A 1 142 GLU 142 315 315 GLU GLU A . n 
A 1 143 ALA 143 316 316 ALA ALA A . n 
A 1 144 THR 144 317 317 THR THR A . n 
A 1 145 GLY 145 318 318 GLY GLY A . n 
A 1 146 MET 146 319 319 MET MET A . n 
A 1 147 THR 147 320 320 THR THR A . n 
A 1 148 CYS 148 321 321 CYS CYS A . n 
A 1 149 GLN 149 322 322 GLN GLN A . n 
A 1 150 ALA 150 323 323 ALA ALA A . n 
A 1 151 ARG 151 324 324 ARG ARG A . n 
A 1 152 SER 152 325 325 SER SER A . n 
A 1 153 SER 153 326 326 SER SER A . n 
A 1 154 TYR 154 327 327 TYR TYR A . n 
A 1 155 ILE 155 328 328 ILE ILE A . n 
A 1 156 THR 156 329 329 THR THR A . n 
A 1 157 SER 157 330 330 SER SER A . n 
A 1 158 GLU 158 331 331 GLU GLU A . n 
A 1 159 ILE 159 332 332 ILE ILE A . n 
A 1 160 LEU 160 333 333 LEU LEU A . n 
A 1 161 TRP 161 334 334 TRP TRP A . n 
A 1 162 GLY 162 335 335 GLY GLY A . n 
A 1 163 TYR 163 336 336 TYR TYR A . n 
A 1 164 ARG 164 337 337 ARG ARG A . n 
A 1 165 PHE 165 338 338 PHE PHE A . n 
A 1 166 THR 166 339 339 THR THR A . n 
A 1 167 PRO 167 340 340 PRO PRO A . n 
A 1 168 VAL 168 341 341 VAL VAL A . n 
A 1 169 LEU 169 342 342 LEU LEU A . n 
A 1 170 THR 170 343 343 THR THR A . n 
A 1 171 LEU 171 344 344 LEU LEU A . n 
A 1 172 GLU 172 345 345 GLU GLU A . n 
A 1 173 ASP 173 346 346 ASP ASP A . n 
A 1 174 GLY 174 347 347 GLY GLY A . n 
A 1 175 PHE 175 348 348 PHE PHE A . n 
A 1 176 TYR 176 349 349 TYR TYR A . n 
A 1 177 GLU 177 350 350 GLU GLU A . n 
A 1 178 VAL 178 351 351 VAL VAL A . n 
A 1 179 ASP 179 352 352 ASP ASP A . n 
A 1 180 TYR 180 353 353 TYR TYR A . n 
A 1 181 ASN 181 354 354 ASN ASN A . n 
A 1 182 SER 182 355 355 SER SER A . n 
A 1 183 PHE 183 356 356 PHE PHE A . n 
A 1 184 HIS 184 357 357 HIS HIS A . n 
A 1 185 GLU 185 358 358 GLU GLU A . n 
A 1 186 THR 186 359 359 THR THR A . n 
A 1 187 TYR 187 360 360 TYR TYR A . n 
A 1 188 GLU 188 361 361 GLU GLU A . n 
A 1 189 THR 189 362 362 THR THR A . n 
A 1 190 SER 190 363 363 SER SER A . n 
A 1 191 THR 191 364 364 THR THR A . n 
A 1 192 PRO 192 365 365 PRO PRO A . n 
A 1 193 SER 193 366 366 SER SER A . n 
A 1 194 LEU 194 367 367 LEU LEU A . n 
A 1 195 SER 195 368 368 SER SER A . n 
A 1 196 ALA 196 369 369 ALA ALA A . n 
A 1 197 LYS 197 370 370 LYS LYS A . n 
A 1 198 GLU 198 371 371 GLU GLU A . n 
A 1 199 LEU 199 372 372 LEU LEU A . n 
A 1 200 ALA 200 373 373 ALA ALA A . n 
A 1 201 GLU 201 374 374 GLU GLU A . n 
A 1 202 LEU 202 375 375 LEU LEU A . n 
A 1 203 ALA 203 376 376 ALA ALA A . n 
A 1 204 ASN 204 377 377 ASN ASN A . n 
A 1 205 ARG 205 378 378 ARG ARG A . n 
A 1 206 ALA 206 379 ?   ?   ?   A . n 
A 1 207 GLU 207 380 ?   ?   ?   A . n 
A 1 208 LEU 208 381 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CS  1  1   1  CS  CS  A . 
C 2 CS  1  2   2  CS  CS  A . 
D 3 MG  1  382 1  MG  MG  A . 
E 4 EOH 1  383 1  EOH EOH A . 
F 4 EOH 1  384 2  EOH EOH A . 
G 5 HOH 1  3   3  HOH HOH A . 
G 5 HOH 2  4   4  HOH HOH A . 
G 5 HOH 3  6   6  HOH HOH A . 
G 5 HOH 4  7   7  HOH HOH A . 
G 5 HOH 5  8   8  HOH HOH A . 
G 5 HOH 6  9   9  HOH HOH A . 
G 5 HOH 7  10  10 HOH HOH A . 
G 5 HOH 8  11  11 HOH HOH A . 
G 5 HOH 9  13  13 HOH HOH A . 
G 5 HOH 10 14  14 HOH HOH A . 
G 5 HOH 11 15  15 HOH HOH A . 
G 5 HOH 12 385 1  HOH HOH A . 
G 5 HOH 13 386 2  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 11480 ? 
1 MORE         -10   ? 
1 'SSA (A^2)'  34430 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -y,x,z  0.0000000000  -1.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_555 y,-x,z  0.0000000000  1.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A MG  382 ? D MG  . 
2 1 A HOH 8   ? G HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OG ? A SER 65 ? A SER 238 ? 1_555 CS ? C CS . ? A CS 2 ? 1_555 O ? A GLU 63  ? A GLU 236 ? 1_555 91.2 ? 
2 OG ? A SER 65 ? A SER 238 ? 1_555 CS ? C CS . ? A CS 2 ? 1_555 O ? A GLU 138 ? A GLU 311 ? 1_555 63.1 ? 
3 O  ? A GLU 63 ? A GLU 236 ? 1_555 CS ? C CS . ? A CS 2 ? 1_555 O ? A GLU 138 ? A GLU 311 ? 1_555 61.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-10-19 
2 'Structure model' 1 1 2013-06-05 
3 'Structure model' 1 2 2017-08-16 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
3 3 'Structure model' 'Source and taxonomy'    
4 4 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen 
2 3 'Structure model' software       
3 4 'Structure model' software       
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .        ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 MOLREP      .        ?               program 'Alexei Vaguine'     alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html  Fortran_77 ? 
3 REFMAC      5.5.0109 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.10     'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 DENZO       .        ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 68  ? ? 63.77   67.92  
2 1 HIS A 69  ? ? -39.45  128.12 
3 1 SER A 232 ? ? -174.11 146.75 
4 1 LYS A 245 ? ? -162.51 111.93 
5 1 SER A 250 ? ? -59.26  -4.81  
6 1 PHE A 274 ? ? -117.69 70.16  
7 1 LEU A 275 ? ? -69.61  95.97  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 49  ? A GLY 1   
2  1 Y 1 A SER 50  ? A SER 2   
3  1 Y 1 A HIS 51  ? A HIS 3   
4  1 Y 1 A MET 52  ? A MET 4   
5  1 Y 1 A ARG 53  ? A ARG 5   
6  1 Y 1 A LYS 54  ? A LYS 6   
7  1 Y 1 A ILE 55  ? A ILE 7   
8  1 Y 1 A GLU 74  ? A GLU 26  
9  1 Y 1 A LYS 200 ? A LYS 27  
10 1 Y 1 A ARG 201 ? A ARG 28  
11 1 Y 1 A ALA 202 ? A ALA 29  
12 1 Y 1 A GLU 203 ? A GLU 30  
13 1 Y 1 A ALA 379 ? A ALA 206 
14 1 Y 1 A GLU 380 ? A GLU 207 
15 1 Y 1 A LEU 381 ? A LEU 208 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CESIUM ION'    CS  
3 'MAGNESIUM ION' MG  
4 ETHANOL         EOH 
5 water           HOH 
#