data_3AU5
# 
_entry.id   3AU5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3AU5         
RCSB  RCSB029697   
WWPDB D_1000029697 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3AU4 
_pdbx_database_related.details        'The same protein complexed with DCC' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3AU5 
_pdbx_database_status.recvd_initial_deposition_date   2011-01-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hirano, Y.'    1 
'Takahashi, A.' 2 
'Hakoshima, T.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            30 
_citation.page_first                2734 
_citation.page_last                 2747 
_citation.year                      2011 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21642953 
_citation.pdbx_database_id_DOI      10.1038/emboj.2011.177 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hirano, Y.'    1 
primary 'Hatano, T.'    2 
primary 'Takahashi, A.' 3 
primary 'Toriyama, M.'  4 
primary 'Inagaki, N.'   5 
primary 'Hakoshima, T.' 6 
# 
_cell.entry_id           3AU5 
_cell.length_a           85.565 
_cell.length_b           49.313 
_cell.length_c           158.407 
_cell.angle_alpha        90.00 
_cell.angle_beta         93.58 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3AU5 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Myosin-X 63425.477 2  ? ? 'MyTH4-FERM cassette, UNP residues 1486-2058' ? 
2 water   nat water    18.015    94 ? ? ?                                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Unconventional myosin-10' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPTRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYT
TLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSR
GILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAG
EVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVE
FAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFSFRTGSVVRQKV
EEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVY
KRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPTRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYT
TLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSR
GILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAG
EVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVE
FAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFSFRTGSVVRQKV
EEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVY
KRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   THR n 
1 4   ARG n 
1 5   TRP n 
1 6   SER n 
1 7   SER n 
1 8   ALA n 
1 9   ILE n 
1 10  GLN n 
1 11  ASN n 
1 12  VAL n 
1 13  THR n 
1 14  ASP n 
1 15  THR n 
1 16  LYS n 
1 17  ALA n 
1 18  PRO n 
1 19  ILE n 
1 20  ASP n 
1 21  THR n 
1 22  PRO n 
1 23  THR n 
1 24  GLN n 
1 25  GLN n 
1 26  LEU n 
1 27  ILE n 
1 28  GLN n 
1 29  ASP n 
1 30  ILE n 
1 31  LYS n 
1 32  GLU n 
1 33  ASN n 
1 34  CYS n 
1 35  LEU n 
1 36  ASN n 
1 37  SER n 
1 38  ASP n 
1 39  VAL n 
1 40  VAL n 
1 41  GLU n 
1 42  GLN n 
1 43  ILE n 
1 44  TYR n 
1 45  LYS n 
1 46  ARG n 
1 47  ASN n 
1 48  PRO n 
1 49  ILE n 
1 50  LEU n 
1 51  ARG n 
1 52  TYR n 
1 53  THR n 
1 54  HIS n 
1 55  HIS n 
1 56  PRO n 
1 57  LEU n 
1 58  HIS n 
1 59  SER n 
1 60  PRO n 
1 61  LEU n 
1 62  LEU n 
1 63  PRO n 
1 64  LEU n 
1 65  PRO n 
1 66  TYR n 
1 67  GLY n 
1 68  ASP n 
1 69  ILE n 
1 70  ASN n 
1 71  LEU n 
1 72  ASN n 
1 73  LEU n 
1 74  LEU n 
1 75  LYS n 
1 76  ASP n 
1 77  LYS n 
1 78  GLY n 
1 79  TYR n 
1 80  THR n 
1 81  THR n 
1 82  LEU n 
1 83  GLN n 
1 84  ASP n 
1 85  GLU n 
1 86  ALA n 
1 87  ILE n 
1 88  LYS n 
1 89  ILE n 
1 90  PHE n 
1 91  ASN n 
1 92  SER n 
1 93  LEU n 
1 94  GLN n 
1 95  GLN n 
1 96  LEU n 
1 97  GLU n 
1 98  SER n 
1 99  MET n 
1 100 SER n 
1 101 ASP n 
1 102 PRO n 
1 103 ILE n 
1 104 PRO n 
1 105 ILE n 
1 106 ILE n 
1 107 GLN n 
1 108 GLY n 
1 109 ILE n 
1 110 LEU n 
1 111 GLN n 
1 112 THR n 
1 113 GLY n 
1 114 HIS n 
1 115 ASP n 
1 116 LEU n 
1 117 ARG n 
1 118 PRO n 
1 119 LEU n 
1 120 ARG n 
1 121 ASP n 
1 122 GLU n 
1 123 LEU n 
1 124 TYR n 
1 125 CYS n 
1 126 GLN n 
1 127 LEU n 
1 128 ILE n 
1 129 LYS n 
1 130 GLN n 
1 131 THR n 
1 132 ASN n 
1 133 LYS n 
1 134 VAL n 
1 135 PRO n 
1 136 HIS n 
1 137 PRO n 
1 138 GLY n 
1 139 SER n 
1 140 VAL n 
1 141 GLY n 
1 142 ASN n 
1 143 LEU n 
1 144 TYR n 
1 145 SER n 
1 146 TRP n 
1 147 GLN n 
1 148 ILE n 
1 149 LEU n 
1 150 THR n 
1 151 CYS n 
1 152 LEU n 
1 153 SER n 
1 154 CYS n 
1 155 THR n 
1 156 PHE n 
1 157 LEU n 
1 158 PRO n 
1 159 SER n 
1 160 ARG n 
1 161 GLY n 
1 162 ILE n 
1 163 LEU n 
1 164 LYS n 
1 165 TYR n 
1 166 LEU n 
1 167 LYS n 
1 168 PHE n 
1 169 HIS n 
1 170 LEU n 
1 171 LYS n 
1 172 ARG n 
1 173 ILE n 
1 174 ARG n 
1 175 GLU n 
1 176 GLN n 
1 177 PHE n 
1 178 PRO n 
1 179 GLY n 
1 180 THR n 
1 181 GLU n 
1 182 MET n 
1 183 GLU n 
1 184 LYS n 
1 185 TYR n 
1 186 ALA n 
1 187 LEU n 
1 188 PHE n 
1 189 THR n 
1 190 TYR n 
1 191 GLU n 
1 192 SER n 
1 193 LEU n 
1 194 LYS n 
1 195 LYS n 
1 196 THR n 
1 197 LYS n 
1 198 CYS n 
1 199 ARG n 
1 200 GLU n 
1 201 PHE n 
1 202 VAL n 
1 203 PRO n 
1 204 SER n 
1 205 ARG n 
1 206 ASP n 
1 207 GLU n 
1 208 ILE n 
1 209 GLU n 
1 210 ALA n 
1 211 LEU n 
1 212 ILE n 
1 213 HIS n 
1 214 ARG n 
1 215 GLN n 
1 216 GLU n 
1 217 MET n 
1 218 THR n 
1 219 SER n 
1 220 THR n 
1 221 VAL n 
1 222 TYR n 
1 223 CYS n 
1 224 HIS n 
1 225 GLY n 
1 226 GLY n 
1 227 GLY n 
1 228 SER n 
1 229 CYS n 
1 230 LYS n 
1 231 ILE n 
1 232 THR n 
1 233 ILE n 
1 234 ASN n 
1 235 SER n 
1 236 HIS n 
1 237 THR n 
1 238 THR n 
1 239 ALA n 
1 240 GLY n 
1 241 GLU n 
1 242 VAL n 
1 243 VAL n 
1 244 GLU n 
1 245 LYS n 
1 246 LEU n 
1 247 ILE n 
1 248 ARG n 
1 249 GLY n 
1 250 LEU n 
1 251 ALA n 
1 252 MET n 
1 253 GLU n 
1 254 ASP n 
1 255 SER n 
1 256 ARG n 
1 257 ASN n 
1 258 MET n 
1 259 PHE n 
1 260 ALA n 
1 261 LEU n 
1 262 PHE n 
1 263 GLU n 
1 264 TYR n 
1 265 ASN n 
1 266 GLY n 
1 267 HIS n 
1 268 VAL n 
1 269 ASP n 
1 270 LYS n 
1 271 ALA n 
1 272 ILE n 
1 273 GLU n 
1 274 SER n 
1 275 ARG n 
1 276 THR n 
1 277 VAL n 
1 278 VAL n 
1 279 ALA n 
1 280 ASP n 
1 281 VAL n 
1 282 LEU n 
1 283 ALA n 
1 284 LYS n 
1 285 PHE n 
1 286 GLU n 
1 287 LYS n 
1 288 LEU n 
1 289 ALA n 
1 290 ALA n 
1 291 THR n 
1 292 SER n 
1 293 GLU n 
1 294 VAL n 
1 295 GLY n 
1 296 ASP n 
1 297 LEU n 
1 298 PRO n 
1 299 TRP n 
1 300 LYS n 
1 301 PHE n 
1 302 TYR n 
1 303 PHE n 
1 304 LYS n 
1 305 LEU n 
1 306 TYR n 
1 307 CYS n 
1 308 PHE n 
1 309 LEU n 
1 310 ASP n 
1 311 THR n 
1 312 ASP n 
1 313 ASN n 
1 314 VAL n 
1 315 PRO n 
1 316 LYS n 
1 317 ASP n 
1 318 SER n 
1 319 VAL n 
1 320 GLU n 
1 321 PHE n 
1 322 ALA n 
1 323 PHE n 
1 324 MET n 
1 325 PHE n 
1 326 GLU n 
1 327 GLN n 
1 328 ALA n 
1 329 HIS n 
1 330 GLU n 
1 331 ALA n 
1 332 VAL n 
1 333 ILE n 
1 334 HIS n 
1 335 GLY n 
1 336 HIS n 
1 337 HIS n 
1 338 PRO n 
1 339 ALA n 
1 340 PRO n 
1 341 GLU n 
1 342 GLU n 
1 343 ASN n 
1 344 LEU n 
1 345 GLN n 
1 346 VAL n 
1 347 LEU n 
1 348 ALA n 
1 349 ALA n 
1 350 LEU n 
1 351 ARG n 
1 352 LEU n 
1 353 GLN n 
1 354 TYR n 
1 355 LEU n 
1 356 GLN n 
1 357 GLY n 
1 358 ASP n 
1 359 TYR n 
1 360 THR n 
1 361 LEU n 
1 362 HIS n 
1 363 ALA n 
1 364 ALA n 
1 365 ILE n 
1 366 PRO n 
1 367 PRO n 
1 368 LEU n 
1 369 GLU n 
1 370 GLU n 
1 371 VAL n 
1 372 TYR n 
1 373 SER n 
1 374 LEU n 
1 375 GLN n 
1 376 ARG n 
1 377 LEU n 
1 378 LYS n 
1 379 ALA n 
1 380 ARG n 
1 381 ILE n 
1 382 SER n 
1 383 GLN n 
1 384 SER n 
1 385 THR n 
1 386 LYS n 
1 387 THR n 
1 388 PHE n 
1 389 SER n 
1 390 PHE n 
1 391 ARG n 
1 392 THR n 
1 393 GLY n 
1 394 SER n 
1 395 VAL n 
1 396 VAL n 
1 397 ARG n 
1 398 GLN n 
1 399 LYS n 
1 400 VAL n 
1 401 GLU n 
1 402 GLU n 
1 403 GLU n 
1 404 GLN n 
1 405 MET n 
1 406 LEU n 
1 407 ASP n 
1 408 MET n 
1 409 TRP n 
1 410 ILE n 
1 411 LYS n 
1 412 GLU n 
1 413 GLU n 
1 414 VAL n 
1 415 SER n 
1 416 SER n 
1 417 ALA n 
1 418 ARG n 
1 419 ALA n 
1 420 SER n 
1 421 ILE n 
1 422 ILE n 
1 423 ASP n 
1 424 LYS n 
1 425 TRP n 
1 426 ARG n 
1 427 LYS n 
1 428 PHE n 
1 429 GLN n 
1 430 GLY n 
1 431 MET n 
1 432 ASN n 
1 433 GLN n 
1 434 GLU n 
1 435 GLN n 
1 436 ALA n 
1 437 MET n 
1 438 ALA n 
1 439 LYS n 
1 440 TYR n 
1 441 MET n 
1 442 ALA n 
1 443 LEU n 
1 444 ILE n 
1 445 LYS n 
1 446 GLU n 
1 447 TRP n 
1 448 PRO n 
1 449 GLY n 
1 450 TYR n 
1 451 GLY n 
1 452 SER n 
1 453 THR n 
1 454 LEU n 
1 455 PHE n 
1 456 ASP n 
1 457 VAL n 
1 458 GLU n 
1 459 CYS n 
1 460 LYS n 
1 461 GLU n 
1 462 GLY n 
1 463 GLY n 
1 464 PHE n 
1 465 PRO n 
1 466 GLN n 
1 467 GLU n 
1 468 LEU n 
1 469 TRP n 
1 470 LEU n 
1 471 GLY n 
1 472 VAL n 
1 473 SER n 
1 474 ALA n 
1 475 ASP n 
1 476 ALA n 
1 477 VAL n 
1 478 SER n 
1 479 VAL n 
1 480 TYR n 
1 481 LYS n 
1 482 ARG n 
1 483 GLY n 
1 484 GLU n 
1 485 GLY n 
1 486 ARG n 
1 487 PRO n 
1 488 LEU n 
1 489 GLU n 
1 490 VAL n 
1 491 PHE n 
1 492 GLN n 
1 493 TYR n 
1 494 GLU n 
1 495 HIS n 
1 496 ILE n 
1 497 LEU n 
1 498 SER n 
1 499 PHE n 
1 500 GLY n 
1 501 ALA n 
1 502 PRO n 
1 503 LEU n 
1 504 ALA n 
1 505 ASN n 
1 506 THR n 
1 507 TYR n 
1 508 LYS n 
1 509 ILE n 
1 510 VAL n 
1 511 VAL n 
1 512 ASP n 
1 513 GLU n 
1 514 ARG n 
1 515 GLU n 
1 516 LEU n 
1 517 LEU n 
1 518 PHE n 
1 519 GLU n 
1 520 THR n 
1 521 SER n 
1 522 GLU n 
1 523 VAL n 
1 524 VAL n 
1 525 ASP n 
1 526 VAL n 
1 527 ALA n 
1 528 LYS n 
1 529 LEU n 
1 530 MET n 
1 531 LYS n 
1 532 ALA n 
1 533 TYR n 
1 534 ILE n 
1 535 SER n 
1 536 MET n 
1 537 ILE n 
1 538 VAL n 
1 539 LYS n 
1 540 LYS n 
1 541 ARG n 
1 542 TYR n 
1 543 SER n 
1 544 THR n 
1 545 THR n 
1 546 ARG n 
1 547 SER n 
1 548 ALA n 
1 549 SER n 
1 550 SER n 
1 551 GLN n 
1 552 GLY n 
1 553 SER n 
1 554 SER n 
1 555 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MYO10, KIAA0799' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 star (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET47b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MYO10_HUMAN 
_struct_ref.pdbx_db_accession          Q9HD67 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTL
QDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGI
LKYLKFHLKRIREQFPGSEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEV
VEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFA
FMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFTPCERLEKRRTSFL
EGTLRRSFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEG
GFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRY
STTRSASSQGSSR
;
_struct_ref.pdbx_align_begin           1486 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3AU5 A 3 ? 555 ? Q9HD67 1486 ? 2058 ? 1486 2058 
2 1 3AU5 B 3 ? 555 ? Q9HD67 1486 ? 2058 ? 1486 2058 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3AU5 GLY A 1   ? UNP Q9HD67 ?   ?    'EXPRESSION TAG' 1484 1  
1 3AU5 PRO A 2   ? UNP Q9HD67 ?   ?    'EXPRESSION TAG' 1485 2  
1 3AU5 THR A 180 ? UNP Q9HD67 SER 1663 'SEE REMARK 999' 1663 3  
1 3AU5 ?   A ?   ? UNP Q9HD67 THR 1872 DELETION         ?    4  
1 3AU5 ?   A ?   ? UNP Q9HD67 PRO 1873 DELETION         ?    5  
1 3AU5 ?   A ?   ? UNP Q9HD67 CYS 1874 DELETION         ?    6  
1 3AU5 ?   A ?   ? UNP Q9HD67 GLU 1875 DELETION         ?    7  
1 3AU5 ?   A ?   ? UNP Q9HD67 ARG 1876 DELETION         ?    8  
1 3AU5 ?   A ?   ? UNP Q9HD67 LEU 1877 DELETION         ?    9  
1 3AU5 ?   A ?   ? UNP Q9HD67 GLU 1878 DELETION         ?    10 
1 3AU5 ?   A ?   ? UNP Q9HD67 LYS 1879 DELETION         ?    11 
1 3AU5 ?   A ?   ? UNP Q9HD67 ARG 1880 DELETION         ?    12 
1 3AU5 ?   A ?   ? UNP Q9HD67 ARG 1881 DELETION         ?    13 
1 3AU5 ?   A ?   ? UNP Q9HD67 THR 1882 DELETION         ?    14 
1 3AU5 ?   A ?   ? UNP Q9HD67 SER 1883 DELETION         ?    15 
1 3AU5 ?   A ?   ? UNP Q9HD67 PHE 1884 DELETION         ?    16 
1 3AU5 ?   A ?   ? UNP Q9HD67 LEU 1885 DELETION         ?    17 
1 3AU5 ?   A ?   ? UNP Q9HD67 GLU 1886 DELETION         ?    18 
1 3AU5 ?   A ?   ? UNP Q9HD67 GLY 1887 DELETION         ?    19 
1 3AU5 ?   A ?   ? UNP Q9HD67 THR 1888 DELETION         ?    20 
1 3AU5 ?   A ?   ? UNP Q9HD67 LEU 1889 DELETION         ?    21 
1 3AU5 ?   A ?   ? UNP Q9HD67 ARG 1890 DELETION         ?    22 
1 3AU5 ?   A ?   ? UNP Q9HD67 ARG 1891 DELETION         ?    23 
2 3AU5 GLY B 1   ? UNP Q9HD67 ?   ?    'EXPRESSION TAG' 1484 24 
2 3AU5 PRO B 2   ? UNP Q9HD67 ?   ?    'EXPRESSION TAG' 1485 25 
2 3AU5 THR B 180 ? UNP Q9HD67 SER 1663 'SEE REMARK 999' 1663 26 
2 3AU5 ?   B ?   ? UNP Q9HD67 THR 1872 DELETION         ?    27 
2 3AU5 ?   B ?   ? UNP Q9HD67 PRO 1873 DELETION         ?    28 
2 3AU5 ?   B ?   ? UNP Q9HD67 CYS 1874 DELETION         ?    29 
2 3AU5 ?   B ?   ? UNP Q9HD67 GLU 1875 DELETION         ?    30 
2 3AU5 ?   B ?   ? UNP Q9HD67 ARG 1876 DELETION         ?    31 
2 3AU5 ?   B ?   ? UNP Q9HD67 LEU 1877 DELETION         ?    32 
2 3AU5 ?   B ?   ? UNP Q9HD67 GLU 1878 DELETION         ?    33 
2 3AU5 ?   B ?   ? UNP Q9HD67 LYS 1879 DELETION         ?    34 
2 3AU5 ?   B ?   ? UNP Q9HD67 ARG 1880 DELETION         ?    35 
2 3AU5 ?   B ?   ? UNP Q9HD67 ARG 1881 DELETION         ?    36 
2 3AU5 ?   B ?   ? UNP Q9HD67 THR 1882 DELETION         ?    37 
2 3AU5 ?   B ?   ? UNP Q9HD67 SER 1883 DELETION         ?    38 
2 3AU5 ?   B ?   ? UNP Q9HD67 PHE 1884 DELETION         ?    39 
2 3AU5 ?   B ?   ? UNP Q9HD67 LEU 1885 DELETION         ?    40 
2 3AU5 ?   B ?   ? UNP Q9HD67 GLU 1886 DELETION         ?    41 
2 3AU5 ?   B ?   ? UNP Q9HD67 GLY 1887 DELETION         ?    42 
2 3AU5 ?   B ?   ? UNP Q9HD67 THR 1888 DELETION         ?    43 
2 3AU5 ?   B ?   ? UNP Q9HD67 LEU 1889 DELETION         ?    44 
2 3AU5 ?   B ?   ? UNP Q9HD67 ARG 1890 DELETION         ?    45 
2 3AU5 ?   B ?   ? UNP Q9HD67 ARG 1891 DELETION         ?    46 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3AU5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.density_percent_sol   53.22 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    '10% PEG 8000, 5% MPD, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2010-11-15 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Rotated-inclined double-crystal monochromator , Si (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99458 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.99458 
# 
_reflns.entry_id                     3AU5 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.55 
_reflns.number_obs                   42632 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        24.7 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.55 
_reflns_shell.d_res_low                   2.64 
_reflns_shell.percent_possible_all        92.2 
_reflns_shell.Rmerge_I_obs                0.482 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         3.29 
_reflns_shell.pdbx_redundancy             2.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3AU5 
_refine.ls_number_reflns_obs                     40247 
_refine.ls_number_reflns_all                     40247 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               55512.61 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.68 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    91.9 
_refine.ls_R_factor_obs                          0.236 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.236 
_refine.ls_R_factor_R_free                       0.281 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2021 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               48.2 
_refine.aniso_B[1][1]                            -6.39 
_refine.aniso_B[2][2]                            0.12 
_refine.aniso_B[3][3]                            6.27 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            2.08 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.36 
_refine.solvent_model_param_bsol                 44.8321 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'PDB ENTRY 3AU4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3AU5 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             0.33 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.34 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7688 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             94 
_refine_hist.number_atoms_total               7782 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        32.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.86  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.50  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.59  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.03  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.06  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.55 
_refine_ls_shell.d_res_low                        2.71 
_refine_ls_shell.number_reflns_R_work             5377 
_refine_ls_shell.R_factor_R_work                  0.279 
_refine_ls_shell.percent_reflns_obs               78.8 
_refine_ls_shell.R_factor_R_free                  0.334 
_refine_ls_shell.R_factor_R_free_error            0.019 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             294 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                5377 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 protein_rep.param  protein.top      
'X-RAY DIFFRACTION' 2 dna-rna_rep.param  dna-rna.top      
'X-RAY DIFFRACTION' 3 water_rep.param    water.top        
'X-RAY DIFFRACTION' 4 ion.param          ion.top          
'X-RAY DIFFRACTION' 5 carbohydrate.param carbohydrate.top 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3AU5 
_struct.title                     'Structure of the human myosin-X MyTH4-FERM cassette' 
_struct.pdbx_descriptor           Myosin-X 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3AU5 
_struct_keywords.pdbx_keywords   'MOTOR PROTEIN' 
_struct_keywords.text            'protein-protein interaction, motor protein cargo transportation, MOTOR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 21  ? GLU A 32  ? THR A 1504 GLU A 1515 1 ? 12 
HELX_P HELX_P2  2  ASN A 36  ? ARG A 46  ? ASN A 1519 ARG A 1529 1 ? 11 
HELX_P HELX_P3  3  ASN A 47  ? ARG A 51  ? ASN A 1530 ARG A 1534 5 ? 5  
HELX_P HELX_P4  4  ASN A 70  ? LYS A 77  ? ASN A 1553 LYS A 1560 1 ? 8  
HELX_P HELX_P5  5  THR A 81  ? LEU A 93  ? THR A 1564 LEU A 1576 1 ? 13 
HELX_P HELX_P6  6  PRO A 102 ? LEU A 116 ? PRO A 1585 LEU A 1599 1 ? 15 
HELX_P HELX_P7  7  PRO A 118 ? THR A 131 ? PRO A 1601 THR A 1614 1 ? 14 
HELX_P HELX_P8  8  SER A 139 ? CYS A 154 ? SER A 1622 CYS A 1637 1 ? 16 
HELX_P HELX_P9  9  SER A 159 ? PHE A 177 ? SER A 1642 PHE A 1660 1 ? 19 
HELX_P HELX_P10 10 THR A 180 ? LYS A 194 ? THR A 1663 LYS A 1677 1 ? 15 
HELX_P HELX_P11 11 SER A 204 ? HIS A 213 ? SER A 1687 HIS A 1696 1 ? 10 
HELX_P HELX_P12 12 THR A 238 ? LEU A 250 ? THR A 1721 LEU A 1733 1 ? 13 
HELX_P HELX_P13 13 VAL A 277 ? THR A 291 ? VAL A 1760 THR A 1774 1 ? 15 
HELX_P HELX_P14 14 SER A 318 ? ILE A 333 ? SER A 1801 ILE A 1816 1 ? 16 
HELX_P HELX_P15 15 PRO A 340 ? GLY A 357 ? PRO A 1823 GLY A 1840 1 ? 18 
HELX_P HELX_P16 16 PRO A 367 ? VAL A 371 ? PRO A 1850 VAL A 1854 5 ? 5  
HELX_P HELX_P17 17 LEU A 374 ? ARG A 380 ? LEU A 1857 ARG A 1863 1 ? 7  
HELX_P HELX_P18 18 ILE A 410 ? LYS A 427 ? ILE A 1913 LYS A 1930 1 ? 18 
HELX_P HELX_P19 19 ASN A 432 ? LYS A 445 ? ASN A 1935 LYS A 1948 1 ? 14 
HELX_P HELX_P20 20 GLU A 522 ? THR A 544 ? GLU A 2025 THR A 2047 1 ? 23 
HELX_P HELX_P21 21 THR B 21  ? GLU B 32  ? THR B 1504 GLU B 1515 1 ? 12 
HELX_P HELX_P22 22 ASN B 36  ? ASN B 47  ? ASN B 1519 ASN B 1530 1 ? 12 
HELX_P HELX_P23 23 PRO B 48  ? ARG B 51  ? PRO B 1531 ARG B 1534 5 ? 4  
HELX_P HELX_P24 24 THR B 81  ? GLN B 95  ? THR B 1564 GLN B 1578 1 ? 15 
HELX_P HELX_P25 25 PRO B 102 ? LEU B 116 ? PRO B 1585 LEU B 1599 1 ? 15 
HELX_P HELX_P26 26 PRO B 118 ? THR B 131 ? PRO B 1601 THR B 1614 1 ? 14 
HELX_P HELX_P27 27 SER B 139 ? SER B 153 ? SER B 1622 SER B 1636 1 ? 15 
HELX_P HELX_P28 28 SER B 159 ? PHE B 177 ? SER B 1642 PHE B 1660 1 ? 19 
HELX_P HELX_P29 29 THR B 180 ? THR B 196 ? THR B 1663 THR B 1679 1 ? 17 
HELX_P HELX_P30 30 SER B 204 ? HIS B 213 ? SER B 1687 HIS B 1696 1 ? 10 
HELX_P HELX_P31 31 THR B 238 ? ARG B 248 ? THR B 1721 ARG B 1731 1 ? 11 
HELX_P HELX_P32 32 VAL B 277 ? ALA B 289 ? VAL B 1760 ALA B 1772 1 ? 13 
HELX_P HELX_P33 33 SER B 318 ? HIS B 334 ? SER B 1801 HIS B 1817 1 ? 17 
HELX_P HELX_P34 34 PRO B 340 ? GLY B 357 ? PRO B 1823 GLY B 1840 1 ? 18 
HELX_P HELX_P35 35 PRO B 367 ? VAL B 371 ? PRO B 1850 VAL B 1854 5 ? 5  
HELX_P HELX_P36 36 MET B 408 ? LYS B 427 ? MET B 1911 LYS B 1930 1 ? 20 
HELX_P HELX_P37 37 ASN B 432 ? LYS B 445 ? ASN B 1935 LYS B 1948 1 ? 14 
HELX_P HELX_P38 38 GLU B 494 ? ILE B 496 ? GLU B 1997 ILE B 1999 5 ? 3  
HELX_P HELX_P39 39 GLU B 522 ? SER B 543 ? GLU B 2025 SER B 2046 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 7 ? 
C ? 4 ? 
D ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 227 ? ILE A 233 ? GLY A 1710 ILE A 1716 
A 2 MET A 217 ? CYS A 223 ? MET A 1700 CYS A 1706 
A 3 LYS A 300 ? CYS A 307 ? LYS A 1783 CYS A 1790 
A 4 MET A 258 ? TYR A 264 ? MET A 1741 TYR A 1747 
A 5 ASP A 269 ? ALA A 271 ? ASP A 1752 ALA A 1754 
B 1 GLU A 489 ? GLN A 492 ? GLU A 1992 GLN A 1995 
B 2 ALA A 476 ? LYS A 481 ? ALA A 1979 LYS A 1984 
B 3 GLU A 467 ? SER A 473 ? GLU A 1970 SER A 1976 
B 4 THR A 453 ? GLU A 461 ? THR A 1956 GLU A 1964 
B 5 ARG A 514 ? GLU A 519 ? ARG A 2017 GLU A 2022 
B 6 THR A 506 ? VAL A 511 ? THR A 2009 VAL A 2014 
B 7 ILE A 496 ? LEU A 503 ? ILE A 1999 LEU A 2006 
C 1 GLY B 227 ? ILE B 233 ? GLY B 1710 ILE B 1716 
C 2 MET B 217 ? CYS B 223 ? MET B 1700 CYS B 1706 
C 3 LYS B 300 ? CYS B 307 ? LYS B 1783 CYS B 1790 
C 4 MET B 258 ? TYR B 264 ? MET B 1741 TYR B 1747 
D 1 GLU B 489 ? GLN B 492 ? GLU B 1992 GLN B 1995 
D 2 ALA B 476 ? TYR B 480 ? ALA B 1979 TYR B 1983 
D 3 GLU B 467 ? VAL B 472 ? GLU B 1970 VAL B 1975 
D 4 THR B 453 ? CYS B 459 ? THR B 1956 CYS B 1962 
D 5 LEU B 516 ? GLU B 519 ? LEU B 2019 GLU B 2022 
D 6 THR B 506 ? VAL B 510 ? THR B 2009 VAL B 2013 
D 7 SER B 498 ? LEU B 503 ? SER B 2001 LEU B 2006 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 233 ? O ILE A 1716 N MET A 217 ? N MET A 1700 
A 2 3 N TYR A 222 ? N TYR A 1705 O PHE A 303 ? O PHE A 1786 
A 3 4 O TYR A 306 ? O TYR A 1789 N MET A 258 ? N MET A 1741 
A 4 5 N GLU A 263 ? N GLU A 1746 O LYS A 270 ? O LYS A 1753 
B 1 2 O GLU A 489 ? O GLU A 1992 N VAL A 479 ? N VAL A 1982 
B 2 3 O ALA A 476 ? O ALA A 1979 N SER A 473 ? N SER A 1976 
B 3 4 O LEU A 470 ? O LEU A 1973 N PHE A 455 ? N PHE A 1958 
B 4 5 N GLU A 458 ? N GLU A 1961 O GLU A 519 ? O GLU A 2022 
B 5 6 O PHE A 518 ? O PHE A 2021 N TYR A 507 ? N TYR A 2010 
B 6 7 O LYS A 508 ? O LYS A 2011 N GLY A 500 ? N GLY A 2003 
C 1 2 O CYS B 229 ? O CYS B 1712 N VAL B 221 ? N VAL B 1704 
C 2 3 N TYR B 222 ? N TYR B 1705 O PHE B 301 ? O PHE B 1784 
C 3 4 O TYR B 306 ? O TYR B 1789 N MET B 258 ? N MET B 1741 
D 1 2 O GLU B 489 ? O GLU B 1992 N VAL B 479 ? N VAL B 1982 
D 2 3 O SER B 478 ? O SER B 1981 N GLY B 471 ? N GLY B 1974 
D 3 4 O LEU B 470 ? O LEU B 1973 N PHE B 455 ? N PHE B 1958 
D 4 5 N GLU B 458 ? N GLU B 1961 O GLU B 519 ? O GLU B 2022 
D 5 6 O PHE B 518 ? O PHE B 2021 N TYR B 507 ? N TYR B 2010 
D 6 7 O THR B 506 ? O THR B 2009 N LEU B 503 ? N LEU B 2006 
# 
_database_PDB_matrix.entry_id          3AU5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3AU5 
_atom_sites.fract_transf_matrix[1][1]   0.011687 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000731 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020279 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006325 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 18  ? 9.433   20.055  -18.868 1.00 72.44  ? 1501 PRO A N   1 
ATOM   2    C CA  . PRO A 1 18  ? 10.453  20.432  -19.897 1.00 72.13  ? 1501 PRO A CA  1 
ATOM   3    C C   . PRO A 1 18  ? 10.208  19.721  -21.243 1.00 70.96  ? 1501 PRO A C   1 
ATOM   4    O O   . PRO A 1 18  ? 9.156   19.114  -21.437 1.00 71.51  ? 1501 PRO A O   1 
ATOM   5    C CB  . PRO A 1 18  ? 11.815  20.068  -19.311 1.00 72.27  ? 1501 PRO A CB  1 
ATOM   6    C CG  . PRO A 1 18  ? 11.522  20.170  -17.795 1.00 72.58  ? 1501 PRO A CG  1 
ATOM   7    C CD  . PRO A 1 18  ? 10.098  19.614  -17.626 1.00 71.45  ? 1501 PRO A CD  1 
ATOM   8    N N   . ILE A 1 19  ? 11.161  19.804  -22.173 1.00 68.99  ? 1502 ILE A N   1 
ATOM   9    C CA  . ILE A 1 19  ? 11.004  19.140  -23.473 1.00 66.29  ? 1502 ILE A CA  1 
ATOM   10   C C   . ILE A 1 19  ? 10.637  17.661  -23.274 1.00 64.43  ? 1502 ILE A C   1 
ATOM   11   O O   . ILE A 1 19  ? 9.556   17.211  -23.690 1.00 64.51  ? 1502 ILE A O   1 
ATOM   12   C CB  . ILE A 1 19  ? 12.303  19.230  -24.331 1.00 66.17  ? 1502 ILE A CB  1 
ATOM   13   C CG1 . ILE A 1 19  ? 13.534  19.018  -23.446 1.00 65.93  ? 1502 ILE A CG1 1 
ATOM   14   C CG2 . ILE A 1 19  ? 12.360  20.567  -25.056 1.00 65.71  ? 1502 ILE A CG2 1 
ATOM   15   C CD1 . ILE A 1 19  ? 14.842  19.061  -24.193 1.00 66.43  ? 1502 ILE A CD1 1 
ATOM   16   N N   . ASP A 1 20  ? 11.535  16.908  -22.639 1.00 60.04  ? 1503 ASP A N   1 
ATOM   17   C CA  . ASP A 1 20  ? 11.294  15.494  -22.374 1.00 54.99  ? 1503 ASP A CA  1 
ATOM   18   C C   . ASP A 1 20  ? 11.478  15.263  -20.865 1.00 50.72  ? 1503 ASP A C   1 
ATOM   19   O O   . ASP A 1 20  ? 11.725  16.208  -20.113 1.00 51.56  ? 1503 ASP A O   1 
ATOM   20   C CB  . ASP A 1 20  ? 12.256  14.627  -23.189 1.00 54.80  ? 1503 ASP A CB  1 
ATOM   21   C CG  . ASP A 1 20  ? 13.545  14.358  -22.457 1.00 57.49  ? 1503 ASP A CG  1 
ATOM   22   O OD1 . ASP A 1 20  ? 13.995  15.258  -21.708 1.00 58.84  ? 1503 ASP A OD1 1 
ATOM   23   O OD2 . ASP A 1 20  ? 14.107  13.253  -22.633 1.00 57.85  ? 1503 ASP A OD2 1 
ATOM   24   N N   . THR A 1 21  ? 11.380  14.019  -20.417 1.00 43.52  ? 1504 THR A N   1 
ATOM   25   C CA  . THR A 1 21  ? 11.485  13.744  -18.990 1.00 35.70  ? 1504 THR A CA  1 
ATOM   26   C C   . THR A 1 21  ? 11.939  12.284  -18.808 1.00 31.85  ? 1504 THR A C   1 
ATOM   27   O O   . THR A 1 21  ? 11.721  11.441  -19.676 1.00 31.59  ? 1504 THR A O   1 
ATOM   28   C CB  . THR A 1 21  ? 10.086  13.997  -18.354 1.00 35.01  ? 1504 THR A CB  1 
ATOM   29   O OG1 . THR A 1 21  ? 10.224  14.387  -16.987 1.00 32.86  ? 1504 THR A OG1 1 
ATOM   30   C CG2 . THR A 1 21  ? 9.205   12.760  -18.481 1.00 28.77  ? 1504 THR A CG2 1 
ATOM   31   N N   . PRO A 1 22  ? 12.573  11.965  -17.680 1.00 28.64  ? 1505 PRO A N   1 
ATOM   32   C CA  . PRO A 1 22  ? 13.034  10.580  -17.467 1.00 27.57  ? 1505 PRO A CA  1 
ATOM   33   C C   . PRO A 1 22  ? 11.997  9.507   -17.818 1.00 26.23  ? 1505 PRO A C   1 
ATOM   34   O O   . PRO A 1 22  ? 12.319  8.538   -18.491 1.00 26.14  ? 1505 PRO A O   1 
ATOM   35   C CB  . PRO A 1 22  ? 13.420  10.559  -15.974 1.00 25.40  ? 1505 PRO A CB  1 
ATOM   36   C CG  . PRO A 1 22  ? 13.832  11.979  -15.722 1.00 25.43  ? 1505 PRO A CG  1 
ATOM   37   C CD  . PRO A 1 22  ? 12.774  12.779  -16.471 1.00 25.49  ? 1505 PRO A CD  1 
ATOM   38   N N   . THR A 1 23  ? 10.756  9.691   -17.362 1.00 25.37  ? 1506 THR A N   1 
ATOM   39   C CA  . THR A 1 23  ? 9.695   8.735   -17.632 1.00 23.86  ? 1506 THR A CA  1 
ATOM   40   C C   . THR A 1 23  ? 9.426   8.599   -19.121 1.00 24.90  ? 1506 THR A C   1 
ATOM   41   O O   . THR A 1 23  ? 9.279   7.489   -19.623 1.00 26.78  ? 1506 THR A O   1 
ATOM   42   C CB  . THR A 1 23  ? 8.373   9.111   -16.900 1.00 21.86  ? 1506 THR A CB  1 
ATOM   43   O OG1 . THR A 1 23  ? 8.513   8.846   -15.498 1.00 24.85  ? 1506 THR A OG1 1 
ATOM   44   C CG2 . THR A 1 23  ? 7.217   8.296   -17.417 1.00 17.56  ? 1506 THR A CG2 1 
ATOM   45   N N   . GLN A 1 24  ? 9.379   9.715   -19.836 1.00 25.18  ? 1507 GLN A N   1 
ATOM   46   C CA  . GLN A 1 24  ? 9.122   9.668   -21.277 1.00 25.39  ? 1507 GLN A CA  1 
ATOM   47   C C   . GLN A 1 24  ? 10.176  8.909   -22.066 1.00 26.51  ? 1507 GLN A C   1 
ATOM   48   O O   . GLN A 1 24  ? 9.826   8.101   -22.933 1.00 26.41  ? 1507 GLN A O   1 
ATOM   49   C CB  . GLN A 1 24  ? 8.998   11.065  -21.857 1.00 24.88  ? 1507 GLN A CB  1 
ATOM   50   C CG  . GLN A 1 24  ? 7.801   11.829  -21.392 1.00 25.17  ? 1507 GLN A CG  1 
ATOM   51   C CD  . GLN A 1 24  ? 7.731   13.189  -22.056 1.00 28.25  ? 1507 GLN A CD  1 
ATOM   52   O OE1 . GLN A 1 24  ? 8.712   13.939  -22.033 1.00 27.93  ? 1507 GLN A OE1 1 
ATOM   53   N NE2 . GLN A 1 24  ? 6.574   13.519  -22.656 1.00 27.21  ? 1507 GLN A NE2 1 
ATOM   54   N N   . GLN A 1 25  ? 11.451  9.181   -21.774 1.00 25.20  ? 1508 GLN A N   1 
ATOM   55   C CA  . GLN A 1 25  ? 12.558  8.517   -22.452 0.50 24.72  ? 1508 GLN A CA  1 
ATOM   56   C C   . GLN A 1 25  ? 12.425  7.031   -22.175 1.00 25.76  ? 1508 GLN A C   1 
ATOM   57   O O   . GLN A 1 25  ? 12.453  6.210   -23.086 1.00 27.99  ? 1508 GLN A O   1 
ATOM   58   C CB  . GLN A 1 25  ? 13.920  8.996   -21.918 0.50 22.05  ? 1508 GLN A CB  1 
ATOM   59   C CG  . GLN A 1 25  ? 14.095  10.505  -21.842 0.50 21.61  ? 1508 GLN A CG  1 
ATOM   60   C CD  . GLN A 1 25  ? 15.498  10.933  -21.401 0.50 22.91  ? 1508 GLN A CD  1 
ATOM   61   O OE1 . GLN A 1 25  ? 15.655  11.908  -20.666 0.50 22.62  ? 1508 GLN A OE1 1 
ATOM   62   N NE2 . GLN A 1 25  ? 16.521  10.215  -21.865 0.50 23.21  ? 1508 GLN A NE2 1 
ATOM   63   N N   . LEU A 1 26  ? 12.279  6.691   -20.901 1.00 26.03  ? 1509 LEU A N   1 
ATOM   64   C CA  . LEU A 1 26  ? 12.158  5.299   -20.503 1.00 25.43  ? 1509 LEU A CA  1 
ATOM   65   C C   . LEU A 1 26  ? 10.986  4.584   -21.201 1.00 24.38  ? 1509 LEU A C   1 
ATOM   66   O O   . LEU A 1 26  ? 11.141  3.452   -21.654 1.00 23.71  ? 1509 LEU A O   1 
ATOM   67   C CB  . LEU A 1 26  ? 12.015  5.203   -18.976 1.00 24.22  ? 1509 LEU A CB  1 
ATOM   68   C CG  . LEU A 1 26  ? 13.297  5.590   -18.264 1.00 22.92  ? 1509 LEU A CG  1 
ATOM   69   C CD1 . LEU A 1 26  ? 13.045  5.798   -16.756 1.00 20.74  ? 1509 LEU A CD1 1 
ATOM   70   C CD2 . LEU A 1 26  ? 14.348  4.501   -18.535 1.00 22.26  ? 1509 LEU A CD2 1 
ATOM   71   N N   . ILE A 1 27  ? 9.821   5.225   -21.268 1.00 23.40  ? 1510 ILE A N   1 
ATOM   72   C CA  . ILE A 1 27  ? 8.684   4.606   -21.934 1.00 24.45  ? 1510 ILE A CA  1 
ATOM   73   C C   . ILE A 1 27  ? 9.080   4.302   -23.395 1.00 27.30  ? 1510 ILE A C   1 
ATOM   74   O O   . ILE A 1 27  ? 8.784   3.218   -23.917 1.00 28.84  ? 1510 ILE A O   1 
ATOM   75   C CB  . ILE A 1 27  ? 7.443   5.521   -21.900 1.00 23.41  ? 1510 ILE A CB  1 
ATOM   76   C CG1 . ILE A 1 27  ? 6.788   5.435   -20.513 1.00 24.65  ? 1510 ILE A CG1 1 
ATOM   77   C CG2 . ILE A 1 27  ? 6.407   5.098   -23.007 1.00 19.06  ? 1510 ILE A CG2 1 
ATOM   78   C CD1 . ILE A 1 27  ? 5.784   6.562   -20.216 1.00 21.22  ? 1510 ILE A CD1 1 
ATOM   79   N N   . GLN A 1 28  ? 9.757   5.258   -24.032 1.00 26.82  ? 1511 GLN A N   1 
ATOM   80   C CA  . GLN A 1 28  ? 10.235  5.116   -25.397 1.00 28.70  ? 1511 GLN A CA  1 
ATOM   81   C C   . GLN A 1 28  ? 11.152  3.879   -25.463 1.00 29.66  ? 1511 GLN A C   1 
ATOM   82   O O   . GLN A 1 28  ? 11.096  3.089   -26.414 1.00 27.77  ? 1511 GLN A O   1 
ATOM   83   C CB  . GLN A 1 28  ? 11.009  6.371   -25.795 1.00 31.29  ? 1511 GLN A CB  1 
ATOM   84   C CG  . GLN A 1 28  ? 11.580  6.367   -27.209 1.00 35.92  ? 1511 GLN A CG  1 
ATOM   85   C CD  . GLN A 1 28  ? 10.511  6.125   -28.271 1.00 36.71  ? 1511 GLN A CD  1 
ATOM   86   O OE1 . GLN A 1 28  ? 9.359   6.502   -28.088 1.00 37.55  ? 1511 GLN A OE1 1 
ATOM   87   N NE2 . GLN A 1 28  ? 10.898  5.499   -29.387 1.00 36.58  ? 1511 GLN A NE2 1 
ATOM   88   N N   . ASP A 1 29  ? 11.993  3.723   -24.442 1.00 29.76  ? 1512 ASP A N   1 
ATOM   89   C CA  . ASP A 1 29  ? 12.896  2.574   -24.334 1.00 30.98  ? 1512 ASP A CA  1 
ATOM   90   C C   . ASP A 1 29  ? 12.102  1.271   -24.224 1.00 31.69  ? 1512 ASP A C   1 
ATOM   91   O O   . ASP A 1 29  ? 12.452  0.270   -24.847 1.00 31.21  ? 1512 ASP A O   1 
ATOM   92   C CB  . ASP A 1 29  ? 13.804  2.727   -23.110 1.00 30.91  ? 1512 ASP A CB  1 
ATOM   93   C CG  . ASP A 1 29  ? 14.978  3.647   -23.371 1.00 33.12  ? 1512 ASP A CG  1 
ATOM   94   O OD1 . ASP A 1 29  ? 14.924  4.411   -24.366 1.00 34.74  ? 1512 ASP A OD1 1 
ATOM   95   O OD2 . ASP A 1 29  ? 15.955  3.611   -22.587 1.00 34.44  ? 1512 ASP A OD2 1 
ATOM   96   N N   . ILE A 1 30  ? 11.034  1.276   -23.428 1.00 32.31  ? 1513 ILE A N   1 
ATOM   97   C CA  . ILE A 1 30  ? 10.212  0.085   -23.304 1.00 33.16  ? 1513 ILE A CA  1 
ATOM   98   C C   . ILE A 1 30  ? 9.526   -0.192  -24.634 1.00 34.29  ? 1513 ILE A C   1 
ATOM   99   O O   . ILE A 1 30  ? 9.304   -1.344  -24.998 1.00 33.30  ? 1513 ILE A O   1 
ATOM   100  C CB  . ILE A 1 30  ? 9.133   0.247   -22.253 1.00 31.18  ? 1513 ILE A CB  1 
ATOM   101  C CG1 . ILE A 1 30  ? 9.774   0.412   -20.881 1.00 32.53  ? 1513 ILE A CG1 1 
ATOM   102  C CG2 . ILE A 1 30  ? 8.225   -0.980  -22.252 1.00 29.30  ? 1513 ILE A CG2 1 
ATOM   103  C CD1 . ILE A 1 30  ? 8.776   0.731   -19.785 1.00 29.35  ? 1513 ILE A CD1 1 
ATOM   104  N N   . LYS A 1 31  ? 9.208   0.874   -25.360 1.00 36.10  ? 1514 LYS A N   1 
ATOM   105  C CA  . LYS A 1 31  ? 8.521   0.753   -26.640 1.00 39.84  ? 1514 LYS A CA  1 
ATOM   106  C C   . LYS A 1 31  ? 9.395   0.067   -27.699 1.00 41.21  ? 1514 LYS A C   1 
ATOM   107  O O   . LYS A 1 31  ? 8.902   -0.725  -28.497 1.00 43.04  ? 1514 LYS A O   1 
ATOM   108  C CB  . LYS A 1 31  ? 8.078   2.143   -27.103 1.00 40.73  ? 1514 LYS A CB  1 
ATOM   109  C CG  . LYS A 1 31  ? 7.292   2.188   -28.401 1.00 42.61  ? 1514 LYS A CG  1 
ATOM   110  C CD  . LYS A 1 31  ? 7.021   3.644   -28.814 1.00 44.92  ? 1514 LYS A CD  1 
ATOM   111  C CE  . LYS A 1 31  ? 6.346   3.745   -30.194 1.00 46.97  ? 1514 LYS A CE  1 
ATOM   112  N NZ  . LYS A 1 31  ? 5.912   5.133   -30.543 1.00 46.32  ? 1514 LYS A NZ  1 
ATOM   113  N N   . GLU A 1 32  ? 10.689  0.364   -27.688 1.00 41.87  ? 1515 GLU A N   1 
ATOM   114  C CA  . GLU A 1 32  ? 11.653  -0.215  -28.625 1.00 42.12  ? 1515 GLU A CA  1 
ATOM   115  C C   . GLU A 1 32  ? 12.092  -1.605  -28.170 1.00 41.67  ? 1515 GLU A C   1 
ATOM   116  O O   . GLU A 1 32  ? 13.002  -2.197  -28.746 1.00 42.46  ? 1515 GLU A O   1 
ATOM   117  C CB  . GLU A 1 32  ? 12.889  0.684   -28.725 1.00 41.14  ? 1515 GLU A CB  1 
ATOM   118  C CG  . GLU A 1 32  ? 12.555  2.084   -29.167 1.00 45.56  ? 1515 GLU A CG  1 
ATOM   119  C CD  . GLU A 1 32  ? 13.695  3.059   -28.945 1.00 46.63  ? 1515 GLU A CD  1 
ATOM   120  O OE1 . GLU A 1 32  ? 14.677  2.694   -28.258 1.00 48.52  ? 1515 GLU A OE1 1 
ATOM   121  O OE2 . GLU A 1 32  ? 13.592  4.200   -29.445 1.00 44.85  ? 1515 GLU A OE2 1 
ATOM   122  N N   . ASN A 1 33  ? 11.457  -2.117  -27.129 1.00 39.57  ? 1516 ASN A N   1 
ATOM   123  C CA  . ASN A 1 33  ? 11.809  -3.426  -26.622 1.00 38.55  ? 1516 ASN A CA  1 
ATOM   124  C C   . ASN A 1 33  ? 10.579  -4.134  -26.093 1.00 37.80  ? 1516 ASN A C   1 
ATOM   125  O O   . ASN A 1 33  ? 10.703  -5.150  -25.433 1.00 37.55  ? 1516 ASN A O   1 
ATOM   126  C CB  . ASN A 1 33  ? 12.841  -3.282  -25.499 1.00 38.00  ? 1516 ASN A CB  1 
ATOM   127  C CG  . ASN A 1 33  ? 14.207  -2.831  -26.009 1.00 38.40  ? 1516 ASN A CG  1 
ATOM   128  O OD1 . ASN A 1 33  ? 15.001  -3.641  -26.475 1.00 41.88  ? 1516 ASN A OD1 1 
ATOM   129  N ND2 . ASN A 1 33  ? 14.479  -1.544  -25.927 1.00 34.00  ? 1516 ASN A ND2 1 
ATOM   130  N N   . CYS A 1 34  ? 9.399   -3.610  -26.414 1.00 38.92  ? 1517 CYS A N   1 
ATOM   131  C CA  . CYS A 1 34  ? 8.134   -4.156  -25.911 1.00 40.67  ? 1517 CYS A CA  1 
ATOM   132  C C   . CYS A 1 34  ? 7.882   -5.624  -26.198 1.00 41.67  ? 1517 CYS A C   1 
ATOM   133  O O   . CYS A 1 34  ? 7.047   -6.262  -25.552 1.00 42.32  ? 1517 CYS A O   1 
ATOM   134  C CB  . CYS A 1 34  ? 6.958   -3.333  -26.432 1.00 39.10  ? 1517 CYS A CB  1 
ATOM   135  S SG  . CYS A 1 34  ? 6.771   -3.329  -28.215 1.00 41.80  ? 1517 CYS A SG  1 
ATOM   136  N N   . LEU A 1 35  ? 8.610   -6.161  -27.165 1.00 42.92  ? 1518 LEU A N   1 
ATOM   137  C CA  . LEU A 1 35  ? 8.455   -7.560  -27.537 1.00 42.70  ? 1518 LEU A CA  1 
ATOM   138  C C   . LEU A 1 35  ? 9.426   -8.461  -26.764 1.00 42.09  ? 1518 LEU A C   1 
ATOM   139  O O   . LEU A 1 35  ? 9.258   -9.680  -26.713 1.00 42.75  ? 1518 LEU A O   1 
ATOM   140  C CB  . LEU A 1 35  ? 8.664   -7.707  -29.048 1.00 42.08  ? 1518 LEU A CB  1 
ATOM   141  C CG  . LEU A 1 35  ? 7.450   -7.635  -29.987 1.00 40.59  ? 1518 LEU A CG  1 
ATOM   142  C CD1 . LEU A 1 35  ? 6.335   -6.794  -29.406 1.00 38.97  ? 1518 LEU A CD1 1 
ATOM   143  C CD2 . LEU A 1 35  ? 7.920   -7.089  -31.329 1.00 39.10  ? 1518 LEU A CD2 1 
ATOM   144  N N   . ASN A 1 36  ? 10.442  -7.856  -26.161 1.00 41.27  ? 1519 ASN A N   1 
ATOM   145  C CA  . ASN A 1 36  ? 11.426  -8.609  -25.391 1.00 39.91  ? 1519 ASN A CA  1 
ATOM   146  C C   . ASN A 1 36  ? 11.090  -8.474  -23.905 1.00 40.56  ? 1519 ASN A C   1 
ATOM   147  O O   . ASN A 1 36  ? 11.347  -7.444  -23.284 1.00 41.32  ? 1519 ASN A O   1 
ATOM   148  C CB  . ASN A 1 36  ? 12.828  -8.071  -25.668 1.00 38.58  ? 1519 ASN A CB  1 
ATOM   149  C CG  . ASN A 1 36  ? 13.917  -8.950  -25.090 1.00 39.25  ? 1519 ASN A CG  1 
ATOM   150  O OD1 . ASN A 1 36  ? 13.748  -9.570  -24.039 1.00 41.74  ? 1519 ASN A OD1 1 
ATOM   151  N ND2 . ASN A 1 36  ? 15.047  -9.003  -25.769 1.00 39.98  ? 1519 ASN A ND2 1 
ATOM   152  N N   . SER A 1 37  ? 10.508  -9.518  -23.338 1.00 41.67  ? 1520 SER A N   1 
ATOM   153  C CA  . SER A 1 37  ? 10.119  -9.508  -21.930 1.00 43.38  ? 1520 SER A CA  1 
ATOM   154  C C   . SER A 1 37  ? 11.265  -9.276  -20.934 1.00 43.72  ? 1520 SER A C   1 
ATOM   155  O O   . SER A 1 37  ? 11.110  -8.576  -19.932 1.00 43.73  ? 1520 SER A O   1 
ATOM   156  C CB  . SER A 1 37  ? 9.400   -10.817 -21.596 1.00 41.73  ? 1520 SER A CB  1 
ATOM   157  O OG  . SER A 1 37  ? 9.645   -11.201 -20.257 1.00 42.70  ? 1520 SER A OG  1 
ATOM   158  N N   . ASP A 1 38  ? 12.417  -9.863  -21.212 1.00 45.42  ? 1521 ASP A N   1 
ATOM   159  C CA  . ASP A 1 38  ? 13.559  -9.741  -20.328 1.00 45.98  ? 1521 ASP A CA  1 
ATOM   160  C C   . ASP A 1 38  ? 14.088  -8.318  -20.223 1.00 44.59  ? 1521 ASP A C   1 
ATOM   161  O O   . ASP A 1 38  ? 14.332  -7.829  -19.124 1.00 44.48  ? 1521 ASP A O   1 
ATOM   162  C CB  . ASP A 1 38  ? 14.671  -10.682 -20.792 1.00 50.19  ? 1521 ASP A CB  1 
ATOM   163  C CG  . ASP A 1 38  ? 14.177  -12.106 -20.996 1.00 55.55  ? 1521 ASP A CG  1 
ATOM   164  O OD1 . ASP A 1 38  ? 13.524  -12.373 -22.043 1.00 57.89  ? 1521 ASP A OD1 1 
ATOM   165  O OD2 . ASP A 1 38  ? 14.434  -12.949 -20.101 1.00 57.31  ? 1521 ASP A OD2 1 
ATOM   166  N N   . VAL A 1 39  ? 14.267  -7.652  -21.360 1.00 42.76  ? 1522 VAL A N   1 
ATOM   167  C CA  . VAL A 1 39  ? 14.785  -6.291  -21.351 1.00 41.71  ? 1522 VAL A CA  1 
ATOM   168  C C   . VAL A 1 39  ? 13.777  -5.359  -20.660 1.00 40.27  ? 1522 VAL A C   1 
ATOM   169  O O   . VAL A 1 39  ? 14.163  -4.522  -19.831 1.00 40.05  ? 1522 VAL A O   1 
ATOM   170  C CB  . VAL A 1 39  ? 15.127  -5.805  -22.792 1.00 41.13  ? 1522 VAL A CB  1 
ATOM   171  C CG1 . VAL A 1 39  ? 13.948  -5.974  -23.675 1.00 46.33  ? 1522 VAL A CG1 1 
ATOM   172  C CG2 . VAL A 1 39  ? 15.545  -4.340  -22.783 1.00 40.55  ? 1522 VAL A CG2 1 
ATOM   173  N N   . VAL A 1 40  ? 12.495  -5.520  -20.978 1.00 37.10  ? 1523 VAL A N   1 
ATOM   174  C CA  . VAL A 1 40  ? 11.461  -4.717  -20.346 1.00 35.25  ? 1523 VAL A CA  1 
ATOM   175  C C   . VAL A 1 40  ? 11.561  -4.830  -18.807 1.00 34.24  ? 1523 VAL A C   1 
ATOM   176  O O   . VAL A 1 40  ? 11.513  -3.824  -18.108 1.00 33.75  ? 1523 VAL A O   1 
ATOM   177  C CB  . VAL A 1 40  ? 10.049  -5.148  -20.836 1.00 34.77  ? 1523 VAL A CB  1 
ATOM   178  C CG1 . VAL A 1 40  ? 8.999   -4.717  -19.847 1.00 35.93  ? 1523 VAL A CG1 1 
ATOM   179  C CG2 . VAL A 1 40  ? 9.734   -4.497  -22.178 1.00 31.60  ? 1523 VAL A CG2 1 
ATOM   180  N N   . GLU A 1 41  ? 11.716  -6.045  -18.284 1.00 34.05  ? 1524 GLU A N   1 
ATOM   181  C CA  . GLU A 1 41  ? 11.836  -6.239  -16.837 1.00 32.92  ? 1524 GLU A CA  1 
ATOM   182  C C   . GLU A 1 41  ? 13.086  -5.551  -16.277 1.00 32.82  ? 1524 GLU A C   1 
ATOM   183  O O   . GLU A 1 41  ? 13.089  -5.023  -15.169 1.00 31.32  ? 1524 GLU A O   1 
ATOM   184  C CB  . GLU A 1 41  ? 11.878  -7.733  -16.480 1.00 29.50  ? 1524 GLU A CB  1 
ATOM   185  C CG  . GLU A 1 41  ? 10.532  -8.466  -16.544 1.00 32.60  ? 1524 GLU A CG  1 
ATOM   186  C CD  . GLU A 1 41  ? 9.353   -7.721  -15.876 1.00 33.83  ? 1524 GLU A CD  1 
ATOM   187  O OE1 . GLU A 1 41  ? 9.520   -7.122  -14.796 1.00 33.29  ? 1524 GLU A OE1 1 
ATOM   188  O OE2 . GLU A 1 41  ? 8.233   -7.746  -16.426 1.00 35.02  ? 1524 GLU A OE2 1 
ATOM   189  N N   . GLN A 1 42  ? 14.160  -5.568  -17.043 1.00 34.03  ? 1525 GLN A N   1 
ATOM   190  C CA  . GLN A 1 42  ? 15.384  -4.933  -16.597 1.00 35.54  ? 1525 GLN A CA  1 
ATOM   191  C C   . GLN A 1 42  ? 15.243  -3.411  -16.562 1.00 33.33  ? 1525 GLN A C   1 
ATOM   192  O O   . GLN A 1 42  ? 15.735  -2.760  -15.636 1.00 33.79  ? 1525 GLN A O   1 
ATOM   193  C CB  . GLN A 1 42  ? 16.558  -5.359  -17.488 1.00 38.58  ? 1525 GLN A CB  1 
ATOM   194  C CG  . GLN A 1 42  ? 16.975  -6.805  -17.221 1.00 45.32  ? 1525 GLN A CG  1 
ATOM   195  C CD  . GLN A 1 42  ? 17.092  -7.112  -15.721 1.00 49.56  ? 1525 GLN A CD  1 
ATOM   196  O OE1 . GLN A 1 42  ? 18.078  -6.744  -15.069 1.00 50.50  ? 1525 GLN A OE1 1 
ATOM   197  N NE2 . GLN A 1 42  ? 16.068  -7.774  -15.165 1.00 50.86  ? 1525 GLN A NE2 1 
ATOM   198  N N   . ILE A 1 43  ? 14.569  -2.850  -17.564 1.00 29.93  ? 1526 ILE A N   1 
ATOM   199  C CA  . ILE A 1 43  ? 14.346  -1.414  -17.605 1.00 27.23  ? 1526 ILE A CA  1 
ATOM   200  C C   . ILE A 1 43  ? 13.576  -0.997  -16.341 1.00 26.59  ? 1526 ILE A C   1 
ATOM   201  O O   . ILE A 1 43  ? 13.894  0.016   -15.729 1.00 24.84  ? 1526 ILE A O   1 
ATOM   202  C CB  . ILE A 1 43  ? 13.549  -1.014  -18.848 1.00 25.99  ? 1526 ILE A CB  1 
ATOM   203  C CG1 . ILE A 1 43  ? 14.402  -1.245  -20.094 1.00 25.49  ? 1526 ILE A CG1 1 
ATOM   204  C CG2 . ILE A 1 43  ? 13.113  0.443   -18.747 1.00 23.27  ? 1526 ILE A CG2 1 
ATOM   205  C CD1 . ILE A 1 43  ? 13.649  -0.882  -21.425 1.00 25.50  ? 1526 ILE A CD1 1 
ATOM   206  N N   . TYR A 1 44  ? 12.585  -1.800  -15.957 1.00 24.45  ? 1527 TYR A N   1 
ATOM   207  C CA  . TYR A 1 44  ? 11.798  -1.535  -14.773 1.00 25.10  ? 1527 TYR A CA  1 
ATOM   208  C C   . TYR A 1 44  ? 12.593  -1.721  -13.489 1.00 27.81  ? 1527 TYR A C   1 
ATOM   209  O O   . TYR A 1 44  ? 12.390  -0.998  -12.507 1.00 29.64  ? 1527 TYR A O   1 
ATOM   210  C CB  . TYR A 1 44  ? 10.572  -2.457  -14.706 1.00 22.80  ? 1527 TYR A CB  1 
ATOM   211  C CG  . TYR A 1 44  ? 9.375   -2.013  -15.506 1.00 24.03  ? 1527 TYR A CG  1 
ATOM   212  C CD1 . TYR A 1 44  ? 8.950   -0.673  -15.494 1.00 25.02  ? 1527 TYR A CD1 1 
ATOM   213  C CD2 . TYR A 1 44  ? 8.628   -2.934  -16.249 1.00 23.12  ? 1527 TYR A CD2 1 
ATOM   214  C CE1 . TYR A 1 44  ? 7.800   -0.263  -16.210 1.00 24.44  ? 1527 TYR A CE1 1 
ATOM   215  C CE2 . TYR A 1 44  ? 7.482   -2.540  -16.962 1.00 22.38  ? 1527 TYR A CE2 1 
ATOM   216  C CZ  . TYR A 1 44  ? 7.074   -1.208  -16.939 1.00 24.91  ? 1527 TYR A CZ  1 
ATOM   217  O OH  . TYR A 1 44  ? 5.950   -0.818  -17.643 1.00 26.15  ? 1527 TYR A OH  1 
ATOM   218  N N   . LYS A 1 45  ? 13.497  -2.693  -13.480 1.00 30.89  ? 1528 LYS A N   1 
ATOM   219  C CA  . LYS A 1 45  ? 14.265  -2.981  -12.278 1.00 31.36  ? 1528 LYS A CA  1 
ATOM   220  C C   . LYS A 1 45  ? 15.290  -1.912  -11.993 1.00 30.86  ? 1528 LYS A C   1 
ATOM   221  O O   . LYS A 1 45  ? 15.419  -1.460  -10.857 1.00 31.72  ? 1528 LYS A O   1 
ATOM   222  C CB  . LYS A 1 45  ? 14.963  -4.328  -12.408 1.00 34.35  ? 1528 LYS A CB  1 
ATOM   223  C CG  . LYS A 1 45  ? 15.768  -4.726  -11.191 1.00 36.44  ? 1528 LYS A CG  1 
ATOM   224  C CD  . LYS A 1 45  ? 16.855  -5.724  -11.555 1.00 41.08  ? 1528 LYS A CD  1 
ATOM   225  C CE  . LYS A 1 45  ? 17.666  -6.157  -10.325 1.00 44.55  ? 1528 LYS A CE  1 
ATOM   226  N NZ  . LYS A 1 45  ? 18.730  -7.173  -10.641 1.00 44.01  ? 1528 LYS A NZ  1 
ATOM   227  N N   . ARG A 1 46  ? 16.012  -1.489  -13.021 1.00 29.50  ? 1529 ARG A N   1 
ATOM   228  C CA  . ARG A 1 46  ? 17.038  -0.484  -12.818 1.00 29.84  ? 1529 ARG A CA  1 
ATOM   229  C C   . ARG A 1 46  ? 16.543  0.960   -12.899 1.00 27.00  ? 1529 ARG A C   1 
ATOM   230  O O   . ARG A 1 46  ? 17.334  1.897   -12.853 1.00 25.32  ? 1529 ARG A O   1 
ATOM   231  C CB  . ARG A 1 46  ? 18.190  -0.723  -13.801 1.00 33.84  ? 1529 ARG A CB  1 
ATOM   232  C CG  . ARG A 1 46  ? 17.999  -0.106  -15.162 1.00 42.50  ? 1529 ARG A CG  1 
ATOM   233  C CD  . ARG A 1 46  ? 18.361  -1.107  -16.248 1.00 50.23  ? 1529 ARG A CD  1 
ATOM   234  N NE  . ARG A 1 46  ? 19.456  -1.994  -15.838 1.00 54.97  ? 1529 ARG A NE  1 
ATOM   235  C CZ  . ARG A 1 46  ? 20.694  -1.596  -15.537 1.00 56.82  ? 1529 ARG A CZ  1 
ATOM   236  N NH1 . ARG A 1 46  ? 21.030  -0.312  -15.589 1.00 57.67  ? 1529 ARG A NH1 1 
ATOM   237  N NH2 . ARG A 1 46  ? 21.609  -2.495  -15.192 1.00 59.29  ? 1529 ARG A NH2 1 
ATOM   238  N N   . ASN A 1 47  ? 15.235  1.141   -13.028 1.00 26.28  ? 1530 ASN A N   1 
ATOM   239  C CA  . ASN A 1 47  ? 14.661  2.490   -13.073 1.00 25.29  ? 1530 ASN A CA  1 
ATOM   240  C C   . ASN A 1 47  ? 13.458  2.612   -12.151 1.00 23.12  ? 1530 ASN A C   1 
ATOM   241  O O   . ASN A 1 47  ? 12.310  2.547   -12.582 1.00 25.25  ? 1530 ASN A O   1 
ATOM   242  C CB  . ASN A 1 47  ? 14.287  2.883   -14.502 1.00 26.16  ? 1530 ASN A CB  1 
ATOM   243  C CG  . ASN A 1 47  ? 15.507  3.104   -15.366 1.00 27.77  ? 1530 ASN A CG  1 
ATOM   244  O OD1 . ASN A 1 47  ? 16.249  4.064   -15.169 1.00 30.22  ? 1530 ASN A OD1 1 
ATOM   245  N ND2 . ASN A 1 47  ? 15.730  2.214   -16.317 1.00 28.07  ? 1530 ASN A ND2 1 
ATOM   246  N N   . PRO A 1 48  ? 13.721  2.804   -10.851 1.00 20.61  ? 1531 PRO A N   1 
ATOM   247  C CA  . PRO A 1 48  ? 12.705  2.944   -9.809  1.00 18.98  ? 1531 PRO A CA  1 
ATOM   248  C C   . PRO A 1 48  ? 11.613  3.971   -10.114 1.00 17.26  ? 1531 PRO A C   1 
ATOM   249  O O   . PRO A 1 48  ? 10.505  3.838   -9.628  1.00 20.77  ? 1531 PRO A O   1 
ATOM   250  C CB  . PRO A 1 48  ? 13.527  3.354   -8.585  1.00 18.84  ? 1531 PRO A CB  1 
ATOM   251  C CG  . PRO A 1 48  ? 14.851  2.771   -8.844  1.00 18.14  ? 1531 PRO A CG  1 
ATOM   252  C CD  . PRO A 1 48  ? 15.068  3.018   -10.296 1.00 17.63  ? 1531 PRO A CD  1 
ATOM   253  N N   . ILE A 1 49  ? 11.936  4.988   -10.906 1.00 14.93  ? 1532 ILE A N   1 
ATOM   254  C CA  . ILE A 1 49  ? 11.001  6.055   -11.238 1.00 13.40  ? 1532 ILE A CA  1 
ATOM   255  C C   . ILE A 1 49  ? 9.785   5.481   -11.961 1.00 16.41  ? 1532 ILE A C   1 
ATOM   256  O O   . ILE A 1 49  ? 8.699   6.075   -11.951 1.00 17.02  ? 1532 ILE A O   1 
ATOM   257  C CB  . ILE A 1 49  ? 11.710  7.151   -12.125 1.00 15.07  ? 1532 ILE A CB  1 
ATOM   258  C CG1 . ILE A 1 49  ? 10.844  8.418   -12.263 1.00 14.19  ? 1532 ILE A CG1 1 
ATOM   259  C CG2 . ILE A 1 49  ? 11.964  6.610   -13.549 1.00 12.29  ? 1532 ILE A CG2 1 
ATOM   260  C CD1 . ILE A 1 49  ? 10.577  9.166   -10.994 1.00 7.85   ? 1532 ILE A CD1 1 
ATOM   261  N N   . LEU A 1 50  ? 9.962   4.309   -12.566 1.00 17.11  ? 1533 LEU A N   1 
ATOM   262  C CA  . LEU A 1 50  ? 8.890   3.662   -13.300 1.00 16.10  ? 1533 LEU A CA  1 
ATOM   263  C C   . LEU A 1 50  ? 7.973   2.766   -12.478 1.00 17.40  ? 1533 LEU A C   1 
ATOM   264  O O   . LEU A 1 50  ? 6.881   2.412   -12.942 1.00 15.98  ? 1533 LEU A O   1 
ATOM   265  C CB  . LEU A 1 50  ? 9.466   2.846   -14.425 1.00 16.32  ? 1533 LEU A CB  1 
ATOM   266  C CG  . LEU A 1 50  ? 10.101  3.638   -15.543 1.00 17.63  ? 1533 LEU A CG  1 
ATOM   267  C CD1 . LEU A 1 50  ? 10.829  2.668   -16.473 1.00 19.90  ? 1533 LEU A CD1 1 
ATOM   268  C CD2 . LEU A 1 50  ? 9.028   4.423   -16.284 1.00 20.78  ? 1533 LEU A CD2 1 
ATOM   269  N N   . ARG A 1 51  ? 8.392   2.409   -11.264 1.00 16.38  ? 1534 ARG A N   1 
ATOM   270  C CA  . ARG A 1 51  ? 7.591   1.517   -10.441 1.00 16.55  ? 1534 ARG A CA  1 
ATOM   271  C C   . ARG A 1 51  ? 7.256   2.074   -9.087  1.00 17.76  ? 1534 ARG A C   1 
ATOM   272  O O   . ARG A 1 51  ? 7.672   3.185   -8.737  1.00 18.64  ? 1534 ARG A O   1 
ATOM   273  C CB  . ARG A 1 51  ? 8.289   0.171   -10.267 1.00 16.56  ? 1534 ARG A CB  1 
ATOM   274  C CG  . ARG A 1 51  ? 9.775   0.259   -9.938  1.00 19.11  ? 1534 ARG A CG  1 
ATOM   275  C CD  . ARG A 1 51  ? 10.495  -1.034  -10.344 1.00 20.50  ? 1534 ARG A CD  1 
ATOM   276  N NE  . ARG A 1 51  ? 11.918  -0.984  -10.060 1.00 21.12  ? 1534 ARG A NE  1 
ATOM   277  C CZ  . ARG A 1 51  ? 12.426  -0.996  -8.830  1.00 22.88  ? 1534 ARG A CZ  1 
ATOM   278  N NH1 . ARG A 1 51  ? 11.616  -1.063  -7.780  1.00 21.34  ? 1534 ARG A NH1 1 
ATOM   279  N NH2 . ARG A 1 51  ? 13.736  -0.920  -8.653  1.00 21.34  ? 1534 ARG A NH2 1 
ATOM   280  N N   . TYR A 1 52  ? 6.519   1.265   -8.326  1.00 17.65  ? 1535 TYR A N   1 
ATOM   281  C CA  . TYR A 1 52  ? 6.042   1.608   -6.989  1.00 18.20  ? 1535 TYR A CA  1 
ATOM   282  C C   . TYR A 1 52  ? 7.141   2.161   -6.102  1.00 18.79  ? 1535 TYR A C   1 
ATOM   283  O O   . TYR A 1 52  ? 8.248   1.623   -6.047  1.00 19.03  ? 1535 TYR A O   1 
ATOM   284  C CB  . TYR A 1 52  ? 5.414   0.387   -6.285  1.00 15.35  ? 1535 TYR A CB  1 
ATOM   285  C CG  . TYR A 1 52  ? 4.938   0.724   -4.885  1.00 13.80  ? 1535 TYR A CG  1 
ATOM   286  C CD1 . TYR A 1 52  ? 3.688   1.308   -4.681  1.00 13.73  ? 1535 TYR A CD1 1 
ATOM   287  C CD2 . TYR A 1 52  ? 5.782   0.569   -3.774  1.00 14.73  ? 1535 TYR A CD2 1 
ATOM   288  C CE1 . TYR A 1 52  ? 3.285   1.737   -3.424  1.00 13.72  ? 1535 TYR A CE1 1 
ATOM   289  C CE2 . TYR A 1 52  ? 5.390   1.001   -2.501  1.00 12.33  ? 1535 TYR A CE2 1 
ATOM   290  C CZ  . TYR A 1 52  ? 4.133   1.586   -2.335  1.00 15.04  ? 1535 TYR A CZ  1 
ATOM   291  O OH  . TYR A 1 52  ? 3.704   2.033   -1.107  1.00 16.89  ? 1535 TYR A OH  1 
ATOM   292  N N   . THR A 1 53  ? 6.813   3.215   -5.375  1.00 19.03  ? 1536 THR A N   1 
ATOM   293  C CA  . THR A 1 53  ? 7.781   3.824   -4.479  1.00 21.91  ? 1536 THR A CA  1 
ATOM   294  C C   . THR A 1 53  ? 7.058   4.384   -3.264  1.00 24.13  ? 1536 THR A C   1 
ATOM   295  O O   . THR A 1 53  ? 5.883   4.738   -3.346  1.00 23.46  ? 1536 THR A O   1 
ATOM   296  C CB  . THR A 1 53  ? 8.543   4.985   -5.173  1.00 17.42  ? 1536 THR A CB  1 
ATOM   297  O OG1 . THR A 1 53  ? 9.512   5.522   -4.280  1.00 18.60  ? 1536 THR A OG1 1 
ATOM   298  C CG2 . THR A 1 53  ? 7.611   6.077   -5.505  1.00 18.52  ? 1536 THR A CG2 1 
ATOM   299  N N   . HIS A 1 54  ? 7.748   4.448   -2.133  1.00 27.85  ? 1537 HIS A N   1 
ATOM   300  C CA  . HIS A 1 54  ? 7.136   5.041   -0.946  1.00 31.28  ? 1537 HIS A CA  1 
ATOM   301  C C   . HIS A 1 54  ? 7.820   6.391   -0.707  1.00 29.07  ? 1537 HIS A C   1 
ATOM   302  O O   . HIS A 1 54  ? 7.432   7.141   0.195   1.00 31.31  ? 1537 HIS A O   1 
ATOM   303  C CB  . HIS A 1 54  ? 7.248   4.126   0.286   1.00 35.18  ? 1537 HIS A CB  1 
ATOM   304  C CG  . HIS A 1 54  ? 8.642   3.700   0.592   1.00 42.82  ? 1537 HIS A CG  1 
ATOM   305  N ND1 . HIS A 1 54  ? 9.338   2.821   -0.209  1.00 48.20  ? 1537 HIS A ND1 1 
ATOM   306  C CD2 . HIS A 1 54  ? 9.495   4.073   1.576   1.00 47.09  ? 1537 HIS A CD2 1 
ATOM   307  C CE1 . HIS A 1 54  ? 10.563  2.673   0.266   1.00 51.45  ? 1537 HIS A CE1 1 
ATOM   308  N NE2 . HIS A 1 54  ? 10.685  3.424   1.348   1.00 51.04  ? 1537 HIS A NE2 1 
ATOM   309  N N   . HIS A 1 55  ? 8.824   6.705   -1.527  1.00 25.28  ? 1538 HIS A N   1 
ATOM   310  C CA  . HIS A 1 55  ? 9.506   7.991   -1.412  1.00 24.51  ? 1538 HIS A CA  1 
ATOM   311  C C   . HIS A 1 55  ? 8.691   9.073   -2.127  1.00 22.15  ? 1538 HIS A C   1 
ATOM   312  O O   . HIS A 1 55  ? 7.979   8.820   -3.105  1.00 20.18  ? 1538 HIS A O   1 
ATOM   313  C CB  . HIS A 1 55  ? 10.943  7.937   -1.975  1.00 28.15  ? 1538 HIS A CB  1 
ATOM   314  C CG  . HIS A 1 55  ? 11.836  6.966   -1.258  1.00 34.39  ? 1538 HIS A CG  1 
ATOM   315  N ND1 . HIS A 1 55  ? 11.625  6.581   0.052   1.00 38.61  ? 1538 HIS A ND1 1 
ATOM   316  C CD2 . HIS A 1 55  ? 12.933  6.289   -1.672  1.00 37.36  ? 1538 HIS A CD2 1 
ATOM   317  C CE1 . HIS A 1 55  ? 12.548  5.706   0.412   1.00 38.49  ? 1538 HIS A CE1 1 
ATOM   318  N NE2 . HIS A 1 55  ? 13.356  5.512   -0.616  1.00 39.65  ? 1538 HIS A NE2 1 
ATOM   319  N N   . PRO A 1 56  ? 8.764   10.302  -1.626  1.00 20.91  ? 1539 PRO A N   1 
ATOM   320  C CA  . PRO A 1 56  ? 8.006   11.378  -2.258  1.00 20.63  ? 1539 PRO A CA  1 
ATOM   321  C C   . PRO A 1 56  ? 8.449   11.696  -3.667  1.00 20.03  ? 1539 PRO A C   1 
ATOM   322  O O   . PRO A 1 56  ? 9.564   11.393  -4.055  1.00 20.44  ? 1539 PRO A O   1 
ATOM   323  C CB  . PRO A 1 56  ? 8.230   12.556  -1.313  1.00 19.43  ? 1539 PRO A CB  1 
ATOM   324  C CG  . PRO A 1 56  ? 9.557   12.284  -0.735  1.00 20.41  ? 1539 PRO A CG  1 
ATOM   325  C CD  . PRO A 1 56  ? 9.516   10.799  -0.461  1.00 19.87  ? 1539 PRO A CD  1 
ATOM   326  N N   . LEU A 1 57  ? 7.552   12.300  -4.431  1.00 20.40  ? 1540 LEU A N   1 
ATOM   327  C CA  . LEU A 1 57  ? 7.859   12.731  -5.791  1.00 20.78  ? 1540 LEU A CA  1 
ATOM   328  C C   . LEU A 1 57  ? 8.217   14.246  -5.675  1.00 21.42  ? 1540 LEU A C   1 
ATOM   329  O O   . LEU A 1 57  ? 7.592   14.966  -4.905  1.00 22.76  ? 1540 LEU A O   1 
ATOM   330  C CB  . LEU A 1 57  ? 6.631   12.522  -6.648  1.00 17.33  ? 1540 LEU A CB  1 
ATOM   331  C CG  . LEU A 1 57  ? 6.780   12.251  -8.126  1.00 19.88  ? 1540 LEU A CG  1 
ATOM   332  C CD1 . LEU A 1 57  ? 7.665   11.032  -8.359  1.00 16.81  ? 1540 LEU A CD1 1 
ATOM   333  C CD2 . LEU A 1 57  ? 5.371   12.041  -8.710  1.00 18.46  ? 1540 LEU A CD2 1 
ATOM   334  N N   . HIS A 1 58  ? 9.221   14.724  -6.409  1.00 22.42  ? 1541 HIS A N   1 
ATOM   335  C CA  . HIS A 1 58  ? 9.613   16.126  -6.309  1.00 20.86  ? 1541 HIS A CA  1 
ATOM   336  C C   . HIS A 1 58  ? 9.358   16.884  -7.576  1.00 20.98  ? 1541 HIS A C   1 
ATOM   337  O O   . HIS A 1 58  ? 9.640   18.093  -7.659  1.00 20.20  ? 1541 HIS A O   1 
ATOM   338  C CB  . HIS A 1 58  ? 11.101  16.243  -5.954  1.00 19.69  ? 1541 HIS A CB  1 
ATOM   339  C CG  . HIS A 1 58  ? 11.440  15.648  -4.632  1.00 20.52  ? 1541 HIS A CG  1 
ATOM   340  N ND1 . HIS A 1 58  ? 10.959  16.165  -3.445  1.00 19.10  ? 1541 HIS A ND1 1 
ATOM   341  C CD2 . HIS A 1 58  ? 12.146  14.535  -4.305  1.00 19.79  ? 1541 HIS A CD2 1 
ATOM   342  C CE1 . HIS A 1 58  ? 11.352  15.392  -2.444  1.00 21.22  ? 1541 HIS A CE1 1 
ATOM   343  N NE2 . HIS A 1 58  ? 12.075  14.396  -2.937  1.00 19.80  ? 1541 HIS A NE2 1 
ATOM   344  N N   . SER A 1 59  ? 8.838   16.184  -8.575  1.00 21.58  ? 1542 SER A N   1 
ATOM   345  C CA  . SER A 1 59  ? 8.575   16.817  -9.870  1.00 22.00  ? 1542 SER A CA  1 
ATOM   346  C C   . SER A 1 59  ? 7.646   15.888  -10.621 1.00 22.56  ? 1542 SER A C   1 
ATOM   347  O O   . SER A 1 59  ? 7.668   14.668  -10.414 1.00 23.02  ? 1542 SER A O   1 
ATOM   348  C CB  . SER A 1 59  ? 9.895   16.985  -10.643 1.00 24.75  ? 1542 SER A CB  1 
ATOM   349  O OG  . SER A 1 59  ? 9.788   17.880  -11.741 1.00 27.82  ? 1542 SER A OG  1 
ATOM   350  N N   . PRO A 1 60  ? 6.794   16.447  -11.481 1.00 21.79  ? 1543 PRO A N   1 
ATOM   351  C CA  . PRO A 1 60  ? 5.863   15.619  -12.253 1.00 19.70  ? 1543 PRO A CA  1 
ATOM   352  C C   . PRO A 1 60  ? 6.652   14.612  -13.079 1.00 18.11  ? 1543 PRO A C   1 
ATOM   353  O O   . PRO A 1 60  ? 7.812   14.848  -13.386 1.00 16.86  ? 1543 PRO A O   1 
ATOM   354  C CB  . PRO A 1 60  ? 5.138   16.643  -13.128 1.00 20.49  ? 1543 PRO A CB  1 
ATOM   355  C CG  . PRO A 1 60  ? 5.185   17.896  -12.268 1.00 21.30  ? 1543 PRO A CG  1 
ATOM   356  C CD  . PRO A 1 60  ? 6.602   17.875  -11.765 1.00 19.43  ? 1543 PRO A CD  1 
ATOM   357  N N   . LEU A 1 61  ? 6.022   13.487  -13.402 1.00 18.53  ? 1544 LEU A N   1 
ATOM   358  C CA  . LEU A 1 61  ? 6.620   12.431  -14.217 1.00 18.84  ? 1544 LEU A CA  1 
ATOM   359  C C   . LEU A 1 61  ? 6.673   12.837  -15.684 1.00 19.61  ? 1544 LEU A C   1 
ATOM   360  O O   . LEU A 1 61  ? 7.569   12.452  -16.408 1.00 19.38  ? 1544 LEU A O   1 
ATOM   361  C CB  . LEU A 1 61  ? 5.798   11.147  -14.123 1.00 20.25  ? 1544 LEU A CB  1 
ATOM   362  C CG  . LEU A 1 61  ? 6.163   9.978   -13.207 1.00 22.13  ? 1544 LEU A CG  1 
ATOM   363  C CD1 . LEU A 1 61  ? 7.138   10.422  -12.102 1.00 18.99  ? 1544 LEU A CD1 1 
ATOM   364  C CD2 . LEU A 1 61  ? 4.842   9.378   -12.650 1.00 16.71  ? 1544 LEU A CD2 1 
ATOM   365  N N   . LEU A 1 62  ? 5.698   13.612  -16.130 1.00 21.35  ? 1545 LEU A N   1 
ATOM   366  C CA  . LEU A 1 62  ? 5.665   14.039  -17.522 1.00 22.69  ? 1545 LEU A CA  1 
ATOM   367  C C   . LEU A 1 62  ? 5.737   15.560  -17.604 1.00 25.13  ? 1545 LEU A C   1 
ATOM   368  O O   . LEU A 1 62  ? 5.672   16.251  -16.578 1.00 26.31  ? 1545 LEU A O   1 
ATOM   369  C CB  . LEU A 1 62  ? 4.372   13.548  -18.191 1.00 19.75  ? 1545 LEU A CB  1 
ATOM   370  C CG  . LEU A 1 62  ? 4.138   12.034  -18.223 1.00 20.67  ? 1545 LEU A CG  1 
ATOM   371  C CD1 . LEU A 1 62  ? 2.775   11.779  -18.893 1.00 17.90  ? 1545 LEU A CD1 1 
ATOM   372  C CD2 . LEU A 1 62  ? 5.298   11.293  -18.978 1.00 17.06  ? 1545 LEU A CD2 1 
ATOM   373  N N   . PRO A 1 63  ? 5.928   16.103  -18.818 1.00 26.07  ? 1546 PRO A N   1 
ATOM   374  C CA  . PRO A 1 63  ? 5.989   17.558  -19.003 1.00 27.29  ? 1546 PRO A CA  1 
ATOM   375  C C   . PRO A 1 63  ? 4.553   18.047  -18.884 1.00 29.07  ? 1546 PRO A C   1 
ATOM   376  O O   . PRO A 1 63  ? 3.625   17.363  -19.331 1.00 29.01  ? 1546 PRO A O   1 
ATOM   377  C CB  . PRO A 1 63  ? 6.512   17.697  -20.418 1.00 26.32  ? 1546 PRO A CB  1 
ATOM   378  C CG  . PRO A 1 63  ? 7.349   16.446  -20.578 1.00 25.40  ? 1546 PRO A CG  1 
ATOM   379  C CD  . PRO A 1 63  ? 6.446   15.411  -20.006 1.00 24.89  ? 1546 PRO A CD  1 
ATOM   380  N N   . LEU A 1 64  ? 4.355   19.207  -18.268 1.00 31.77  ? 1547 LEU A N   1 
ATOM   381  C CA  . LEU A 1 64  ? 2.999   19.738  -18.119 1.00 33.79  ? 1547 LEU A CA  1 
ATOM   382  C C   . LEU A 1 64  ? 2.812   21.095  -18.820 1.00 35.95  ? 1547 LEU A C   1 
ATOM   383  O O   . LEU A 1 64  ? 2.760   22.142  -18.174 1.00 36.46  ? 1547 LEU A O   1 
ATOM   384  C CB  . LEU A 1 64  ? 2.663   19.858  -16.637 1.00 33.35  ? 1547 LEU A CB  1 
ATOM   385  C CG  . LEU A 1 64  ? 2.727   18.576  -15.813 1.00 30.47  ? 1547 LEU A CG  1 
ATOM   386  C CD1 . LEU A 1 64  ? 2.497   18.931  -14.359 1.00 28.07  ? 1547 LEU A CD1 1 
ATOM   387  C CD2 . LEU A 1 64  ? 1.700   17.553  -16.336 1.00 27.75  ? 1547 LEU A CD2 1 
ATOM   388  N N   . PRO A 1 65  ? 2.715   21.083  -20.159 1.00 37.73  ? 1548 PRO A N   1 
ATOM   389  C CA  . PRO A 1 65  ? 2.535   22.318  -20.932 1.00 39.45  ? 1548 PRO A CA  1 
ATOM   390  C C   . PRO A 1 65  ? 1.194   23.013  -20.680 1.00 41.04  ? 1548 PRO A C   1 
ATOM   391  O O   . PRO A 1 65  ? 0.136   22.382  -20.735 1.00 39.22  ? 1548 PRO A O   1 
ATOM   392  C CB  . PRO A 1 65  ? 2.674   21.840  -22.378 1.00 39.70  ? 1548 PRO A CB  1 
ATOM   393  C CG  . PRO A 1 65  ? 2.143   20.411  -22.312 1.00 39.82  ? 1548 PRO A CG  1 
ATOM   394  C CD  . PRO A 1 65  ? 2.786   19.903  -21.046 1.00 36.99  ? 1548 PRO A CD  1 
ATOM   395  N N   . TYR A 1 66  ? 1.244   24.317  -20.417 1.00 43.78  ? 1549 TYR A N   1 
ATOM   396  C CA  . TYR A 1 66  ? 0.029   25.088  -20.162 1.00 46.16  ? 1549 TYR A CA  1 
ATOM   397  C C   . TYR A 1 66  ? -0.979  25.063  -21.304 1.00 48.02  ? 1549 TYR A C   1 
ATOM   398  O O   . TYR A 1 66  ? -2.183  25.208  -21.072 1.00 48.34  ? 1549 TYR A O   1 
ATOM   399  C CB  . TYR A 1 66  ? 0.374   26.537  -19.785 1.00 46.46  ? 1549 TYR A CB  1 
ATOM   400  C CG  . TYR A 1 66  ? 0.556   26.708  -18.287 1.00 47.03  ? 1549 TYR A CG  1 
ATOM   401  C CD1 . TYR A 1 66  ? -0.542  26.654  -17.436 1.00 47.84  ? 1549 TYR A CD1 1 
ATOM   402  C CD2 . TYR A 1 66  ? 1.826   26.813  -17.714 1.00 47.62  ? 1549 TYR A CD2 1 
ATOM   403  C CE1 . TYR A 1 66  ? -0.399  26.687  -16.046 1.00 51.25  ? 1549 TYR A CE1 1 
ATOM   404  C CE2 . TYR A 1 66  ? 1.994   26.846  -16.314 1.00 50.88  ? 1549 TYR A CE2 1 
ATOM   405  C CZ  . TYR A 1 66  ? 0.867   26.779  -15.480 1.00 51.70  ? 1549 TYR A CZ  1 
ATOM   406  O OH  . TYR A 1 66  ? 0.975   26.778  -14.096 1.00 50.18  ? 1549 TYR A OH  1 
ATOM   407  N N   . GLY A 1 67  ? -0.502  24.848  -22.529 1.00 49.91  ? 1550 GLY A N   1 
ATOM   408  C CA  . GLY A 1 67  ? -1.407  24.814  -23.670 1.00 50.37  ? 1550 GLY A CA  1 
ATOM   409  C C   . GLY A 1 67  ? -2.311  26.038  -23.664 1.00 51.32  ? 1550 GLY A C   1 
ATOM   410  O O   . GLY A 1 67  ? -1.833  27.171  -23.514 1.00 50.09  ? 1550 GLY A O   1 
ATOM   411  N N   . ASP A 1 68  ? -3.615  25.819  -23.817 1.00 51.43  ? 1551 ASP A N   1 
ATOM   412  C CA  . ASP A 1 68  ? -4.568  26.921  -23.809 1.00 52.30  ? 1551 ASP A CA  1 
ATOM   413  C C   . ASP A 1 68  ? -5.476  26.815  -22.578 1.00 52.10  ? 1551 ASP A C   1 
ATOM   414  O O   . ASP A 1 68  ? -6.706  26.764  -22.690 1.00 53.42  ? 1551 ASP A O   1 
ATOM   415  C CB  . ASP A 1 68  ? -5.405  26.910  -25.098 1.00 53.54  ? 1551 ASP A CB  1 
ATOM   416  N N   . ILE A 1 69  ? -4.856  26.783  -21.403 1.00 50.44  ? 1552 ILE A N   1 
ATOM   417  C CA  . ILE A 1 69  ? -5.590  26.682  -20.151 1.00 48.14  ? 1552 ILE A CA  1 
ATOM   418  C C   . ILE A 1 69  ? -5.888  28.071  -19.615 1.00 47.65  ? 1552 ILE A C   1 
ATOM   419  O O   . ILE A 1 69  ? -5.093  29.001  -19.770 1.00 48.32  ? 1552 ILE A O   1 
ATOM   420  C CB  . ILE A 1 69  ? -4.786  25.924  -19.072 1.00 48.04  ? 1552 ILE A CB  1 
ATOM   421  C CG1 . ILE A 1 69  ? -5.631  25.763  -17.815 1.00 47.96  ? 1552 ILE A CG1 1 
ATOM   422  C CG2 . ILE A 1 69  ? -3.528  26.701  -18.707 1.00 46.71  ? 1552 ILE A CG2 1 
ATOM   423  C CD1 . ILE A 1 69  ? -4.870  25.155  -16.652 1.00 50.80  ? 1552 ILE A CD1 1 
ATOM   424  N N   . ASN A 1 70  ? -7.040  28.194  -18.974 1.00 45.41  ? 1553 ASN A N   1 
ATOM   425  C CA  . ASN A 1 70  ? -7.466  29.449  -18.392 1.00 43.63  ? 1553 ASN A CA  1 
ATOM   426  C C   . ASN A 1 70  ? -6.856  29.537  -16.995 1.00 41.85  ? 1553 ASN A C   1 
ATOM   427  O O   . ASN A 1 70  ? -7.333  28.863  -16.081 1.00 42.89  ? 1553 ASN A O   1 
ATOM   428  C CB  . ASN A 1 70  ? -8.994  29.462  -18.278 1.00 43.28  ? 1553 ASN A CB  1 
ATOM   429  C CG  . ASN A 1 70  ? -9.571  30.849  -17.995 1.00 43.82  ? 1553 ASN A CG  1 
ATOM   430  O OD1 . ASN A 1 70  ? -9.051  31.624  -17.168 1.00 38.74  ? 1553 ASN A OD1 1 
ATOM   431  N ND2 . ASN A 1 70  ? -10.686 31.155  -18.669 1.00 44.23  ? 1553 ASN A ND2 1 
ATOM   432  N N   . LEU A 1 71  ? -5.818  30.356  -16.822 1.00 40.20  ? 1554 LEU A N   1 
ATOM   433  C CA  . LEU A 1 71  ? -5.198  30.516  -15.505 1.00 38.50  ? 1554 LEU A CA  1 
ATOM   434  C C   . LEU A 1 71  ? -6.159  31.141  -14.506 1.00 37.53  ? 1554 LEU A C   1 
ATOM   435  O O   . LEU A 1 71  ? -6.107  30.802  -13.327 1.00 38.27  ? 1554 LEU A O   1 
ATOM   436  C CB  . LEU A 1 71  ? -3.917  31.350  -15.571 1.00 36.85  ? 1554 LEU A CB  1 
ATOM   437  C CG  . LEU A 1 71  ? -2.719  30.568  -16.098 1.00 37.60  ? 1554 LEU A CG  1 
ATOM   438  C CD1 . LEU A 1 71  ? -2.864  30.439  -17.585 1.00 39.13  ? 1554 LEU A CD1 1 
ATOM   439  C CD2 . LEU A 1 71  ? -1.420  31.270  -15.756 1.00 37.37  ? 1554 LEU A CD2 1 
ATOM   440  N N   . ASN A 1 72  ? -7.028  32.050  -14.953 1.00 36.02  ? 1555 ASN A N   1 
ATOM   441  C CA  . ASN A 1 72  ? -7.996  32.652  -14.029 1.00 35.89  ? 1555 ASN A CA  1 
ATOM   442  C C   . ASN A 1 72  ? -8.862  31.543  -13.451 1.00 36.52  ? 1555 ASN A C   1 
ATOM   443  O O   . ASN A 1 72  ? -9.043  31.466  -12.234 1.00 37.54  ? 1555 ASN A O   1 
ATOM   444  C CB  . ASN A 1 72  ? -8.918  33.663  -14.725 1.00 35.14  ? 1555 ASN A CB  1 
ATOM   445  C CG  . ASN A 1 72  ? -8.241  34.989  -15.011 1.00 33.03  ? 1555 ASN A CG  1 
ATOM   446  O OD1 . ASN A 1 72  ? -7.170  35.289  -14.481 1.00 28.46  ? 1555 ASN A OD1 1 
ATOM   447  N ND2 . ASN A 1 72  ? -8.884  35.803  -15.850 1.00 33.12  ? 1555 ASN A ND2 1 
ATOM   448  N N   . LEU A 1 73  ? -9.394  30.700  -14.340 1.00 37.06  ? 1556 LEU A N   1 
ATOM   449  C CA  . LEU A 1 73  ? -10.245 29.551  -13.982 1.00 36.88  ? 1556 LEU A CA  1 
ATOM   450  C C   . LEU A 1 73  ? -9.538  28.568  -13.055 1.00 35.85  ? 1556 LEU A C   1 
ATOM   451  O O   . LEU A 1 73  ? -10.131 28.036  -12.109 1.00 33.50  ? 1556 LEU A O   1 
ATOM   452  C CB  . LEU A 1 73  ? -10.658 28.803  -15.246 1.00 37.93  ? 1556 LEU A CB  1 
ATOM   453  C CG  . LEU A 1 73  ? -11.822 29.394  -16.021 1.00 38.10  ? 1556 LEU A CG  1 
ATOM   454  C CD1 . LEU A 1 73  ? -12.003 28.620  -17.324 1.00 37.50  ? 1556 LEU A CD1 1 
ATOM   455  C CD2 . LEU A 1 73  ? -13.072 29.328  -15.143 1.00 39.70  ? 1556 LEU A CD2 1 
ATOM   456  N N   . LEU A 1 74  ? -8.273  28.310  -13.371 1.00 35.42  ? 1557 LEU A N   1 
ATOM   457  C CA  . LEU A 1 74  ? -7.445  27.421  -12.580 1.00 35.36  ? 1557 LEU A CA  1 
ATOM   458  C C   . LEU A 1 74  ? -7.349  27.979  -11.150 1.00 35.79  ? 1557 LEU A C   1 
ATOM   459  O O   . LEU A 1 74  ? -7.605  27.263  -10.179 1.00 36.96  ? 1557 LEU A O   1 
ATOM   460  C CB  . LEU A 1 74  ? -6.063  27.286  -13.244 1.00 33.11  ? 1557 LEU A CB  1 
ATOM   461  C CG  . LEU A 1 74  ? -4.940  26.551  -12.508 1.00 33.09  ? 1557 LEU A CG  1 
ATOM   462  C CD1 . LEU A 1 74  ? -3.854  26.181  -13.501 1.00 32.48  ? 1557 LEU A CD1 1 
ATOM   463  C CD2 . LEU A 1 74  ? -4.375  27.424  -11.395 1.00 31.83  ? 1557 LEU A CD2 1 
ATOM   464  N N   . LYS A 1 75  ? -7.010  29.258  -11.013 1.00 36.71  ? 1558 LYS A N   1 
ATOM   465  C CA  . LYS A 1 75  ? -6.898  29.857  -9.678  1.00 36.54  ? 1558 LYS A CA  1 
ATOM   466  C C   . LYS A 1 75  ? -8.278  29.987  -9.040  1.00 36.74  ? 1558 LYS A C   1 
ATOM   467  O O   . LYS A 1 75  ? -8.465  29.641  -7.873  1.00 34.23  ? 1558 LYS A O   1 
ATOM   468  C CB  . LYS A 1 75  ? -6.240  31.235  -9.750  1.00 33.20  ? 1558 LYS A CB  1 
ATOM   469  C CG  . LYS A 1 75  ? -4.826  31.232  -10.289 1.00 32.26  ? 1558 LYS A CG  1 
ATOM   470  C CD  . LYS A 1 75  ? -3.859  30.668  -9.293  1.00 29.34  ? 1558 LYS A CD  1 
ATOM   471  C CE  . LYS A 1 75  ? -2.467  30.773  -9.809  1.00 28.31  ? 1558 LYS A CE  1 
ATOM   472  N NZ  . LYS A 1 75  ? -1.490  30.308  -8.793  1.00 30.75  ? 1558 LYS A NZ  1 
ATOM   473  N N   . ASP A 1 76  ? -9.248  30.476  -9.809  1.00 39.42  ? 1559 ASP A N   1 
ATOM   474  C CA  . ASP A 1 76  ? -10.603 30.640  -9.278  1.00 43.45  ? 1559 ASP A CA  1 
ATOM   475  C C   . ASP A 1 76  ? -11.144 29.334  -8.695  1.00 44.77  ? 1559 ASP A C   1 
ATOM   476  O O   . ASP A 1 76  ? -12.071 29.358  -7.877  1.00 45.40  ? 1559 ASP A O   1 
ATOM   477  C CB  . ASP A 1 76  ? -11.572 31.182  -10.352 1.00 45.03  ? 1559 ASP A CB  1 
ATOM   478  C CG  . ASP A 1 76  ? -11.426 32.697  -10.581 1.00 48.91  ? 1559 ASP A CG  1 
ATOM   479  O OD1 . ASP A 1 76  ? -10.987 33.422  -9.658  1.00 51.53  ? 1559 ASP A OD1 1 
ATOM   480  O OD2 . ASP A 1 76  ? -11.767 33.175  -11.683 1.00 50.84  ? 1559 ASP A OD2 1 
ATOM   481  N N   . LYS A 1 77  ? -10.544 28.205  -9.092  1.00 45.10  ? 1560 LYS A N   1 
ATOM   482  C CA  . LYS A 1 77  ? -10.958 26.886  -8.603  1.00 43.40  ? 1560 LYS A CA  1 
ATOM   483  C C   . LYS A 1 77  ? -10.166 26.404  -7.393  1.00 41.63  ? 1560 LYS A C   1 
ATOM   484  O O   . LYS A 1 77  ? -10.449 25.342  -6.840  1.00 42.76  ? 1560 LYS A O   1 
ATOM   485  C CB  . LYS A 1 77  ? -10.884 25.845  -9.732  1.00 44.49  ? 1560 LYS A CB  1 
ATOM   486  C CG  . LYS A 1 77  ? -11.995 26.004  -10.754 1.00 44.27  ? 1560 LYS A CG  1 
ATOM   487  C CD  . LYS A 1 77  ? -11.799 25.143  -11.984 1.00 44.74  ? 1560 LYS A CD  1 
ATOM   488  C CE  . LYS A 1 77  ? -12.884 25.476  -13.013 1.00 44.29  ? 1560 LYS A CE  1 
ATOM   489  N NZ  . LYS A 1 77  ? -12.810 24.647  -14.234 1.00 42.74  ? 1560 LYS A NZ  1 
ATOM   490  N N   . GLY A 1 78  ? -9.173  27.177  -6.980  1.00 39.38  ? 1561 GLY A N   1 
ATOM   491  C CA  . GLY A 1 78  ? -8.410  26.790  -5.807  1.00 36.64  ? 1561 GLY A CA  1 
ATOM   492  C C   . GLY A 1 78  ? -7.048  26.177  -6.052  1.00 35.94  ? 1561 GLY A C   1 
ATOM   493  O O   . GLY A 1 78  ? -6.345  25.892  -5.090  1.00 36.27  ? 1561 GLY A O   1 
ATOM   494  N N   . TYR A 1 79  ? -6.661  25.997  -7.317  1.00 33.49  ? 1562 TYR A N   1 
ATOM   495  C CA  . TYR A 1 79  ? -5.368  25.394  -7.661  1.00 32.57  ? 1562 TYR A CA  1 
ATOM   496  C C   . TYR A 1 79  ? -4.158  26.338  -7.593  1.00 31.84  ? 1562 TYR A C   1 
ATOM   497  O O   . TYR A 1 79  ? -4.299  27.549  -7.682  1.00 34.25  ? 1562 TYR A O   1 
ATOM   498  C CB  . TYR A 1 79  ? -5.440  24.783  -9.069  1.00 30.73  ? 1562 TYR A CB  1 
ATOM   499  C CG  . TYR A 1 79  ? -6.562  23.791  -9.248  1.00 30.68  ? 1562 TYR A CG  1 
ATOM   500  C CD1 . TYR A 1 79  ? -6.571  22.590  -8.544  1.00 30.61  ? 1562 TYR A CD1 1 
ATOM   501  C CD2 . TYR A 1 79  ? -7.620  24.051  -10.125 1.00 29.02  ? 1562 TYR A CD2 1 
ATOM   502  C CE1 . TYR A 1 79  ? -7.600  21.666  -8.709  1.00 30.77  ? 1562 TYR A CE1 1 
ATOM   503  C CE2 . TYR A 1 79  ? -8.655  23.136  -10.293 1.00 30.00  ? 1562 TYR A CE2 1 
ATOM   504  C CZ  . TYR A 1 79  ? -8.633  21.942  -9.581  1.00 30.25  ? 1562 TYR A CZ  1 
ATOM   505  O OH  . TYR A 1 79  ? -9.631  21.021  -9.756  1.00 29.66  ? 1562 TYR A OH  1 
ATOM   506  N N   . THR A 1 80  ? -2.969  25.766  -7.458  1.00 29.80  ? 1563 THR A N   1 
ATOM   507  C CA  . THR A 1 80  ? -1.727  26.528  -7.410  1.00 29.32  ? 1563 THR A CA  1 
ATOM   508  C C   . THR A 1 80  ? -1.130  26.578  -8.822  1.00 27.84  ? 1563 THR A C   1 
ATOM   509  O O   . THR A 1 80  ? -1.373  27.518  -9.575  1.00 29.97  ? 1563 THR A O   1 
ATOM   510  C CB  . THR A 1 80  ? -0.728  25.858  -6.472  1.00 31.15  ? 1563 THR A CB  1 
ATOM   511  O OG1 . THR A 1 80  ? -0.605  24.474  -6.827  1.00 33.97  ? 1563 THR A OG1 1 
ATOM   512  C CG2 . THR A 1 80  ? -1.201  25.968  -5.015  1.00 30.14  ? 1563 THR A CG2 1 
ATOM   513  N N   . THR A 1 81  ? -0.318  25.584  -9.159  1.00 25.05  ? 1564 THR A N   1 
ATOM   514  C CA  . THR A 1 81  ? 0.246   25.459  -10.502 1.00 23.39  ? 1564 THR A CA  1 
ATOM   515  C C   . THR A 1 81  ? 0.142   24.001  -10.947 1.00 22.77  ? 1564 THR A C   1 
ATOM   516  O O   . THR A 1 81  ? -0.064  23.117  -10.123 1.00 25.51  ? 1564 THR A O   1 
ATOM   517  C CB  . THR A 1 81  ? 1.696   25.877  -10.549 1.00 22.46  ? 1564 THR A CB  1 
ATOM   518  O OG1 . THR A 1 81  ? 2.502   24.883  -9.918  1.00 21.28  ? 1564 THR A OG1 1 
ATOM   519  C CG2 . THR A 1 81  ? 1.865   27.198  -9.841  1.00 23.54  ? 1564 THR A CG2 1 
ATOM   520  N N   . LEU A 1 82  ? 0.284   23.744  -12.242 1.00 21.54  ? 1565 LEU A N   1 
ATOM   521  C CA  . LEU A 1 82  ? 0.192   22.386  -12.763 1.00 19.52  ? 1565 LEU A CA  1 
ATOM   522  C C   . LEU A 1 82  ? 1.171   21.432  -12.074 1.00 21.67  ? 1565 LEU A C   1 
ATOM   523  O O   . LEU A 1 82  ? 0.776   20.377  -11.563 1.00 20.13  ? 1565 LEU A O   1 
ATOM   524  C CB  . LEU A 1 82  ? 0.433   22.381  -14.275 1.00 16.60  ? 1565 LEU A CB  1 
ATOM   525  C CG  . LEU A 1 82  ? -0.639  23.106  -15.101 1.00 17.49  ? 1565 LEU A CG  1 
ATOM   526  C CD1 . LEU A 1 82  ? -0.280  23.058  -16.576 1.00 16.14  ? 1565 LEU A CD1 1 
ATOM   527  C CD2 . LEU A 1 82  ? -1.989  22.470  -14.868 1.00 13.62  ? 1565 LEU A CD2 1 
ATOM   528  N N   . GLN A 1 83  ? 2.447   21.802  -12.060 1.00 23.07  ? 1566 GLN A N   1 
ATOM   529  C CA  . GLN A 1 83  ? 3.464   20.975  -11.447 0.50 24.47  ? 1566 GLN A CA  1 
ATOM   530  C C   . GLN A 1 83  ? 3.128   20.697  -9.995  1.00 24.42  ? 1566 GLN A C   1 
ATOM   531  O O   . GLN A 1 83  ? 3.215   19.565  -9.523  1.00 22.93  ? 1566 GLN A O   1 
ATOM   532  C CB  . GLN A 1 83  ? 4.813   21.667  -11.537 1.00 29.58  ? 1566 GLN A CB  1 
ATOM   533  C CG  . GLN A 1 83  ? 5.530   21.469  -12.877 1.00 37.19  ? 1566 GLN A CG  1 
ATOM   534  C CD  . GLN A 1 83  ? 5.472   22.680  -13.814 1.00 44.71  ? 1566 GLN A CD  1 
ATOM   535  O OE1 . GLN A 1 83  ? 4.401   23.059  -14.335 1.00 45.34  ? 1566 GLN A OE1 1 
ATOM   536  N NE2 . GLN A 1 83  ? 6.639   23.292  -14.040 1.00 46.22  ? 1566 GLN A NE2 1 
ATOM   537  N N   . ASP A 1 84  ? 2.734   21.738  -9.275  1.00 24.94  ? 1567 ASP A N   1 
ATOM   538  C CA  . ASP A 1 84  ? 2.394   21.585  -7.872  1.00 23.48  ? 1567 ASP A CA  1 
ATOM   539  C C   . ASP A 1 84  ? 1.220   20.637  -7.661  1.00 23.68  ? 1567 ASP A C   1 
ATOM   540  O O   . ASP A 1 84  ? 1.305   19.750  -6.818  1.00 24.35  ? 1567 ASP A O   1 
ATOM   541  C CB  . ASP A 1 84  ? 2.095   22.950  -7.226  1.00 24.11  ? 1567 ASP A CB  1 
ATOM   542  C CG  . ASP A 1 84  ? 1.921   22.847  -5.711  1.00 22.81  ? 1567 ASP A CG  1 
ATOM   543  O OD1 . ASP A 1 84  ? 2.799   22.236  -5.084  1.00 23.87  ? 1567 ASP A OD1 1 
ATOM   544  O OD2 . ASP A 1 84  ? 0.932   23.368  -5.155  1.00 19.96  ? 1567 ASP A OD2 1 
ATOM   545  N N   . GLU A 1 85  ? 0.129   20.815  -8.410  1.00 23.04  ? 1568 GLU A N   1 
ATOM   546  C CA  . GLU A 1 85  ? -1.034  19.933  -8.264  1.00 23.49  ? 1568 GLU A CA  1 
ATOM   547  C C   . GLU A 1 85  ? -0.627  18.486  -8.539  1.00 22.65  ? 1568 GLU A C   1 
ATOM   548  O O   . GLU A 1 85  ? -1.032  17.557  -7.824  1.00 25.21  ? 1568 GLU A O   1 
ATOM   549  C CB  . GLU A 1 85  ? -2.174  20.320  -9.226  1.00 23.72  ? 1568 GLU A CB  1 
ATOM   550  C CG  . GLU A 1 85  ? -2.873  21.616  -8.893  1.00 27.31  ? 1568 GLU A CG  1 
ATOM   551  C CD  . GLU A 1 85  ? -3.341  21.708  -7.455  1.00 29.58  ? 1568 GLU A CD  1 
ATOM   552  O OE1 . GLU A 1 85  ? -3.983  20.752  -6.957  1.00 29.85  ? 1568 GLU A OE1 1 
ATOM   553  O OE2 . GLU A 1 85  ? -3.067  22.755  -6.825  1.00 32.34  ? 1568 GLU A OE2 1 
ATOM   554  N N   . ALA A 1 86  ? 0.169   18.308  -9.583  1.00 19.58  ? 1569 ALA A N   1 
ATOM   555  C CA  . ALA A 1 86  ? 0.647   16.999  -9.966  1.00 18.81  ? 1569 ALA A CA  1 
ATOM   556  C C   . ALA A 1 86  ? 1.358   16.275  -8.825  1.00 18.49  ? 1569 ALA A C   1 
ATOM   557  O O   . ALA A 1 86  ? 1.026   15.122  -8.546  1.00 18.63  ? 1569 ALA A O   1 
ATOM   558  C CB  . ALA A 1 86  ? 1.572   17.106  -11.179 1.00 19.39  ? 1569 ALA A CB  1 
ATOM   559  N N   . ILE A 1 87  ? 2.316   16.920  -8.159  1.00 17.39  ? 1570 ILE A N   1 
ATOM   560  C CA  . ILE A 1 87  ? 2.993   16.211  -7.098  1.00 20.99  ? 1570 ILE A CA  1 
ATOM   561  C C   . ILE A 1 87  ? 2.187   16.133  -5.810  1.00 22.35  ? 1570 ILE A C   1 
ATOM   562  O O   . ILE A 1 87  ? 2.370   15.225  -5.008  1.00 23.39  ? 1570 ILE A O   1 
ATOM   563  C CB  . ILE A 1 87  ? 4.421   16.749  -6.813  1.00 22.85  ? 1570 ILE A CB  1 
ATOM   564  C CG1 . ILE A 1 87  ? 4.370   17.918  -5.844  1.00 24.44  ? 1570 ILE A CG1 1 
ATOM   565  C CG2 . ILE A 1 87  ? 5.130   17.099  -8.116  1.00 21.95  ? 1570 ILE A CG2 1 
ATOM   566  C CD1 . ILE A 1 87  ? 5.769   18.342  -5.390  1.00 23.93  ? 1570 ILE A CD1 1 
ATOM   567  N N   . LYS A 1 88  ? 1.259   17.056  -5.627  1.00 25.43  ? 1571 LYS A N   1 
ATOM   568  C CA  . LYS A 1 88  ? 0.414   17.040  -4.444  1.00 25.16  ? 1571 LYS A CA  1 
ATOM   569  C C   . LYS A 1 88  ? -0.478  15.780  -4.429  1.00 26.23  ? 1571 LYS A C   1 
ATOM   570  O O   . LYS A 1 88  ? -0.604  15.130  -3.402  1.00 26.98  ? 1571 LYS A O   1 
ATOM   571  C CB  . LYS A 1 88  ? -0.485  18.270  -4.421  1.00 27.73  ? 1571 LYS A CB  1 
ATOM   572  C CG  . LYS A 1 88  ? 0.025   19.524  -3.737  1.00 29.16  ? 1571 LYS A CG  1 
ATOM   573  C CD  . LYS A 1 88  ? -1.178  20.490  -3.719  1.00 29.83  ? 1571 LYS A CD  1 
ATOM   574  C CE  . LYS A 1 88  ? -0.773  21.914  -3.559  1.00 30.68  ? 1571 LYS A CE  1 
ATOM   575  N NZ  . LYS A 1 88  ? -1.990  22.783  -3.499  1.00 35.73  ? 1571 LYS A NZ  1 
ATOM   576  N N   . ILE A 1 89  ? -1.127  15.465  -5.549  1.00 25.24  ? 1572 ILE A N   1 
ATOM   577  C CA  . ILE A 1 89  ? -1.990  14.282  -5.639  1.00 27.51  ? 1572 ILE A CA  1 
ATOM   578  C C   . ILE A 1 89  ? -1.173  13.009  -5.372  1.00 27.44  ? 1572 ILE A C   1 
ATOM   579  O O   . ILE A 1 89  ? -1.604  12.099  -4.667  1.00 26.80  ? 1572 ILE A O   1 
ATOM   580  C CB  . ILE A 1 89  ? -2.606  14.143  -7.049  1.00 30.47  ? 1572 ILE A CB  1 
ATOM   581  C CG1 . ILE A 1 89  ? -3.861  14.990  -7.168  1.00 30.51  ? 1572 ILE A CG1 1 
ATOM   582  C CG2 . ILE A 1 89  ? -2.922  12.676  -7.347  1.00 32.05  ? 1572 ILE A CG2 1 
ATOM   583  C CD1 . ILE A 1 89  ? -4.228  15.262  -8.623  1.00 30.52  ? 1572 ILE A CD1 1 
ATOM   584  N N   . PHE A 1 90  ? 0.007   12.945  -5.966  1.00 26.07  ? 1573 PHE A N   1 
ATOM   585  C CA  . PHE A 1 90  ? 0.862   11.806  -5.752  1.00 26.12  ? 1573 PHE A CA  1 
ATOM   586  C C   . PHE A 1 90  ? 1.255   11.695  -4.272  1.00 27.29  ? 1573 PHE A C   1 
ATOM   587  O O   . PHE A 1 90  ? 1.013   10.683  -3.624  1.00 27.91  ? 1573 PHE A O   1 
ATOM   588  C CB  . PHE A 1 90  ? 2.150   11.904  -6.615  1.00 19.34  ? 1573 PHE A CB  1 
ATOM   589  C CG  . PHE A 1 90  ? 2.979   10.637  -6.608  1.00 15.95  ? 1573 PHE A CG  1 
ATOM   590  C CD1 . PHE A 1 90  ? 2.772   9.647   -7.571  1.00 13.95  ? 1573 PHE A CD1 1 
ATOM   591  C CD2 . PHE A 1 90  ? 3.908   10.387  -5.579  1.00 12.13  ? 1573 PHE A CD2 1 
ATOM   592  C CE1 . PHE A 1 90  ? 3.471   8.408   -7.512  1.00 13.12  ? 1573 PHE A CE1 1 
ATOM   593  C CE2 . PHE A 1 90  ? 4.611   9.156   -5.511  1.00 12.05  ? 1573 PHE A CE2 1 
ATOM   594  C CZ  . PHE A 1 90  ? 4.395   8.163   -6.472  1.00 10.57  ? 1573 PHE A CZ  1 
ATOM   595  N N   . ASN A 1 91  ? 1.869   12.748  -3.750  1.00 30.98  ? 1574 ASN A N   1 
ATOM   596  C CA  . ASN A 1 91  ? 2.375   12.732  -2.388  1.00 35.23  ? 1574 ASN A CA  1 
ATOM   597  C C   . ASN A 1 91  ? 1.304   12.590  -1.348  1.00 39.37  ? 1574 ASN A C   1 
ATOM   598  O O   . ASN A 1 91  ? 1.448   11.800  -0.428  1.00 43.45  ? 1574 ASN A O   1 
ATOM   599  C CB  . ASN A 1 91  ? 3.241   13.969  -2.125  1.00 31.22  ? 1574 ASN A CB  1 
ATOM   600  C CG  . ASN A 1 91  ? 4.597   13.864  -2.785  1.00 35.82  ? 1574 ASN A CG  1 
ATOM   601  O OD1 . ASN A 1 91  ? 5.353   14.833  -2.848  1.00 41.69  ? 1574 ASN A OD1 1 
ATOM   602  N ND2 . ASN A 1 91  ? 4.923   12.673  -3.284  1.00 37.00  ? 1574 ASN A ND2 1 
ATOM   603  N N   . SER A 1 92  ? 0.226   13.340  -1.485  1.00 42.77  ? 1575 SER A N   1 
ATOM   604  C CA  . SER A 1 92  ? -0.843  13.243  -0.511  1.00 46.84  ? 1575 SER A CA  1 
ATOM   605  C C   . SER A 1 92  ? -1.446  11.847  -0.594  1.00 48.90  ? 1575 SER A C   1 
ATOM   606  O O   . SER A 1 92  ? -1.516  11.138  0.422   1.00 50.41  ? 1575 SER A O   1 
ATOM   607  C CB  . SER A 1 92  ? -1.918  14.316  -0.762  1.00 47.76  ? 1575 SER A CB  1 
ATOM   608  O OG  . SER A 1 92  ? -1.459  15.618  -0.409  1.00 46.39  ? 1575 SER A OG  1 
ATOM   609  N N   . LEU A 1 93  ? -1.870  11.444  -1.794  1.00 49.83  ? 1576 LEU A N   1 
ATOM   610  C CA  . LEU A 1 93  ? -2.467  10.117  -1.972  1.00 50.41  ? 1576 LEU A CA  1 
ATOM   611  C C   . LEU A 1 93  ? -1.425  9.012   -1.887  1.00 52.09  ? 1576 LEU A C   1 
ATOM   612  O O   . LEU A 1 93  ? -1.579  7.963   -2.502  1.00 52.80  ? 1576 LEU A O   1 
ATOM   613  C CB  . LEU A 1 93  ? -3.187  10.019  -3.311  1.00 49.01  ? 1576 LEU A CB  1 
ATOM   614  N N   . GLN A 1 94  ? -0.351  9.263   -1.144  1.00 52.94  ? 1577 GLN A N   1 
ATOM   615  C CA  . GLN A 1 94  ? 0.708   8.281   -0.954  1.00 52.92  ? 1577 GLN A CA  1 
ATOM   616  C C   . GLN A 1 94  ? 0.676   7.983   0.539   1.00 57.46  ? 1577 GLN A C   1 
ATOM   617  O O   . GLN A 1 94  ? 1.265   7.011   1.015   1.00 58.49  ? 1577 GLN A O   1 
ATOM   618  C CB  . GLN A 1 94  ? 2.067   8.865   -1.347  1.00 47.94  ? 1577 GLN A CB  1 
ATOM   619  C CG  . GLN A 1 94  ? 3.178   7.848   -1.459  1.00 41.55  ? 1577 GLN A CG  1 
ATOM   620  C CD  . GLN A 1 94  ? 4.522   8.464   -1.831  1.00 40.82  ? 1577 GLN A CD  1 
ATOM   621  O OE1 . GLN A 1 94  ? 4.720   9.672   -1.720  1.00 40.73  ? 1577 GLN A OE1 1 
ATOM   622  N NE2 . GLN A 1 94  ? 5.463   7.625   -2.251  1.00 39.44  ? 1577 GLN A NE2 1 
ATOM   623  N N   . GLN A 1 95  ? -0.028  8.844   1.271   1.00 61.28  ? 1578 GLN A N   1 
ATOM   624  C CA  . GLN A 1 95  ? -0.171  8.708   2.717   1.00 64.89  ? 1578 GLN A CA  1 
ATOM   625  C C   . GLN A 1 95  ? -1.657  8.601   3.080   1.00 65.65  ? 1578 GLN A C   1 
ATOM   626  O O   . GLN A 1 95  ? -2.099  9.121   4.106   1.00 66.42  ? 1578 GLN A O   1 
ATOM   627  C CB  . GLN A 1 95  ? 0.465   9.907   3.426   1.00 66.02  ? 1578 GLN A CB  1 
ATOM   628  C CG  . GLN A 1 95  ? -0.015  11.242  2.894   1.00 69.36  ? 1578 GLN A CG  1 
ATOM   629  C CD  . GLN A 1 95  ? 0.987   12.359  3.139   1.00 72.69  ? 1578 GLN A CD  1 
ATOM   630  O OE1 . GLN A 1 95  ? 0.834   13.468  2.619   1.00 74.18  ? 1578 GLN A OE1 1 
ATOM   631  N NE2 . GLN A 1 95  ? 2.017   12.072  3.936   1.00 73.04  ? 1578 GLN A NE2 1 
ATOM   632  N N   . LEU A 1 96  ? -2.415  7.916   2.228   1.00 65.06  ? 1579 LEU A N   1 
ATOM   633  C CA  . LEU A 1 96  ? -3.833  7.722   2.453   1.00 64.56  ? 1579 LEU A CA  1 
ATOM   634  C C   . LEU A 1 96  ? -4.427  6.860   1.328   1.00 65.34  ? 1579 LEU A C   1 
ATOM   635  O O   . LEU A 1 96  ? -4.211  5.641   1.281   1.00 65.02  ? 1579 LEU A O   1 
ATOM   636  C CB  . LEU A 1 96  ? -4.532  9.085   2.527   1.00 63.00  ? 1579 LEU A CB  1 
ATOM   637  C CG  . LEU A 1 96  ? -5.920  9.139   3.169   1.00 62.05  ? 1579 LEU A CG  1 
ATOM   638  C CD1 . LEU A 1 96  ? -5.952  8.336   4.480   1.00 63.54  ? 1579 LEU A CD1 1 
ATOM   639  C CD2 . LEU A 1 96  ? -6.277  10.585  3.418   1.00 61.28  ? 1579 LEU A CD2 1 
ATOM   640  N N   . MET A 1 99  ? -8.888  5.214   4.926   1.00 64.81  ? 1582 MET A N   1 
ATOM   641  C CA  . MET A 1 99  ? -10.107 5.263   5.734   1.00 65.70  ? 1582 MET A CA  1 
ATOM   642  C C   . MET A 1 99  ? -11.301 4.552   5.088   1.00 63.86  ? 1582 MET A C   1 
ATOM   643  O O   . MET A 1 99  ? -11.289 4.250   3.897   1.00 61.99  ? 1582 MET A O   1 
ATOM   644  C CB  . MET A 1 99  ? -10.503 6.715   6.019   1.00 69.52  ? 1582 MET A CB  1 
ATOM   645  C CG  . MET A 1 99  ? -10.936 7.512   4.789   1.00 72.20  ? 1582 MET A CG  1 
ATOM   646  S SD  . MET A 1 99  ? -9.608  8.561   4.162   1.00 77.06  ? 1582 MET A SD  1 
ATOM   647  C CE  . MET A 1 99  ? -8.940  7.547   2.791   1.00 75.31  ? 1582 MET A CE  1 
ATOM   648  N N   . SER A 1 100 ? -12.344 4.313   5.882   1.00 63.00  ? 1583 SER A N   1 
ATOM   649  C CA  . SER A 1 100 ? -13.553 3.632   5.400   1.00 62.06  ? 1583 SER A CA  1 
ATOM   650  C C   . SER A 1 100 ? -14.393 4.411   4.374   1.00 60.67  ? 1583 SER A C   1 
ATOM   651  O O   . SER A 1 100 ? -15.468 3.954   3.984   1.00 59.65  ? 1583 SER A O   1 
ATOM   652  C CB  . SER A 1 100 ? -14.439 3.219   6.586   1.00 61.30  ? 1583 SER A CB  1 
ATOM   653  O OG  . SER A 1 100 ? -14.762 4.323   7.405   1.00 61.17  ? 1583 SER A OG  1 
ATOM   654  N N   . ASP A 1 101 ? -13.897 5.578   3.949   1.00 59.76  ? 1584 ASP A N   1 
ATOM   655  C CA  . ASP A 1 101 ? -14.569 6.418   2.940   1.00 57.47  ? 1584 ASP A CA  1 
ATOM   656  C C   . ASP A 1 101 ? -13.482 7.011   2.034   1.00 54.23  ? 1584 ASP A C   1 
ATOM   657  O O   . ASP A 1 101 ? -13.005 8.123   2.260   1.00 54.69  ? 1584 ASP A O   1 
ATOM   658  C CB  . ASP A 1 101 ? -15.375 7.547   3.611   1.00 58.43  ? 1584 ASP A CB  1 
ATOM   659  C CG  . ASP A 1 101 ? -16.450 8.141   2.687   1.00 59.29  ? 1584 ASP A CG  1 
ATOM   660  O OD1 . ASP A 1 101 ? -16.616 7.636   1.554   1.00 57.91  ? 1584 ASP A OD1 1 
ATOM   661  O OD2 . ASP A 1 101 ? -17.140 9.104   3.101   1.00 59.51  ? 1584 ASP A OD2 1 
ATOM   662  N N   . PRO A 1 102 ? -13.050 6.249   1.012   1.00 51.52  ? 1585 PRO A N   1 
ATOM   663  C CA  . PRO A 1 102 ? -12.011 6.722   0.083   1.00 47.66  ? 1585 PRO A CA  1 
ATOM   664  C C   . PRO A 1 102 ? -12.615 7.492   -1.113  1.00 43.75  ? 1585 PRO A C   1 
ATOM   665  O O   . PRO A 1 102 ? -11.890 8.145   -1.868  1.00 43.73  ? 1585 PRO A O   1 
ATOM   666  C CB  . PRO A 1 102 ? -11.339 5.424   -0.342  1.00 47.45  ? 1585 PRO A CB  1 
ATOM   667  C CG  . PRO A 1 102 ? -12.524 4.499   -0.470  1.00 47.76  ? 1585 PRO A CG  1 
ATOM   668  C CD  . PRO A 1 102 ? -13.386 4.832   0.750   1.00 48.91  ? 1585 PRO A CD  1 
ATOM   669  N N   . ILE A 1 103 ? -13.937 7.414   -1.256  1.00 37.80  ? 1586 ILE A N   1 
ATOM   670  C CA  . ILE A 1 103 ? -14.654 8.073   -2.339  1.00 36.85  ? 1586 ILE A CA  1 
ATOM   671  C C   . ILE A 1 103 ? -14.355 9.580   -2.541  1.00 37.03  ? 1586 ILE A C   1 
ATOM   672  O O   . ILE A 1 103 ? -14.047 10.007  -3.658  1.00 34.89  ? 1586 ILE A O   1 
ATOM   673  C CB  . ILE A 1 103 ? -16.177 7.833   -2.183  1.00 36.06  ? 1586 ILE A CB  1 
ATOM   674  C CG1 . ILE A 1 103 ? -16.449 6.315   -2.234  1.00 35.94  ? 1586 ILE A CG1 1 
ATOM   675  C CG2 . ILE A 1 103 ? -16.964 8.559   -3.283  1.00 33.12  ? 1586 ILE A CG2 1 
ATOM   676  C CD1 . ILE A 1 103 ? -17.911 5.936   -2.394  1.00 34.61  ? 1586 ILE A CD1 1 
ATOM   677  N N   . PRO A 1 104 ? -14.434 10.398  -1.469  1.00 35.85  ? 1587 PRO A N   1 
ATOM   678  C CA  . PRO A 1 104 ? -14.160 11.836  -1.584  1.00 33.57  ? 1587 PRO A CA  1 
ATOM   679  C C   . PRO A 1 104 ? -12.795 12.125  -2.215  1.00 30.65  ? 1587 PRO A C   1 
ATOM   680  O O   . PRO A 1 104 ? -12.698 12.948  -3.120  1.00 30.10  ? 1587 PRO A O   1 
ATOM   681  C CB  . PRO A 1 104 ? -14.251 12.321  -0.134  1.00 33.83  ? 1587 PRO A CB  1 
ATOM   682  C CG  . PRO A 1 104 ? -15.285 11.388  0.455   1.00 34.35  ? 1587 PRO A CG  1 
ATOM   683  C CD  . PRO A 1 104 ? -14.828 10.059  -0.090  1.00 36.78  ? 1587 PRO A CD  1 
ATOM   684  N N   . ILE A 1 105 ? -11.748 11.458  -1.735  1.00 27.49  ? 1588 ILE A N   1 
ATOM   685  C CA  . ILE A 1 105 ? -10.414 11.645  -2.284  1.00 26.66  ? 1588 ILE A CA  1 
ATOM   686  C C   . ILE A 1 105 ? -10.365 11.228  -3.774  1.00 26.38  ? 1588 ILE A C   1 
ATOM   687  O O   . ILE A 1 105 ? -9.763  11.927  -4.589  1.00 26.78  ? 1588 ILE A O   1 
ATOM   688  C CB  . ILE A 1 105 ? -9.356  10.842  -1.474  1.00 27.76  ? 1588 ILE A CB  1 
ATOM   689  C CG1 . ILE A 1 105 ? -9.350  11.343  -0.038  1.00 29.25  ? 1588 ILE A CG1 1 
ATOM   690  C CG2 . ILE A 1 105 ? -7.932  11.056  -2.043  1.00 23.16  ? 1588 ILE A CG2 1 
ATOM   691  C CD1 . ILE A 1 105 ? -8.430  10.534  0.886   1.00 32.62  ? 1588 ILE A CD1 1 
ATOM   692  N N   . ILE A 1 106 ? -10.994 10.104  -4.129  1.00 24.26  ? 1589 ILE A N   1 
ATOM   693  C CA  . ILE A 1 106 ? -11.025 9.661   -5.521  1.00 20.85  ? 1589 ILE A CA  1 
ATOM   694  C C   . ILE A 1 106 ? -11.706 10.705  -6.403  1.00 20.21  ? 1589 ILE A C   1 
ATOM   695  O O   . ILE A 1 106 ? -11.260 10.974  -7.518  1.00 21.09  ? 1589 ILE A O   1 
ATOM   696  C CB  . ILE A 1 106 ? -11.804 8.328   -5.695  1.00 20.32  ? 1589 ILE A CB  1 
ATOM   697  C CG1 . ILE A 1 106 ? -11.097 7.196   -4.922  1.00 18.02  ? 1589 ILE A CG1 1 
ATOM   698  C CG2 . ILE A 1 106 ? -11.925 7.993   -7.179  1.00 10.86  ? 1589 ILE A CG2 1 
ATOM   699  C CD1 . ILE A 1 106 ? -11.832 5.850   -4.957  1.00 10.08  ? 1589 ILE A CD1 1 
ATOM   700  N N   . GLN A 1 107 ? -12.790 11.294  -5.908  1.00 20.13  ? 1590 GLN A N   1 
ATOM   701  C CA  . GLN A 1 107 ? -13.511 12.310  -6.678  1.00 20.08  ? 1590 GLN A CA  1 
ATOM   702  C C   . GLN A 1 107 ? -12.652 13.565  -6.869  1.00 20.02  ? 1590 GLN A C   1 
ATOM   703  O O   . GLN A 1 107 ? -12.601 14.125  -7.979  1.00 19.87  ? 1590 GLN A O   1 
ATOM   704  C CB  . GLN A 1 107 ? -14.820 12.680  -5.992  1.00 19.35  ? 1590 GLN A CB  1 
ATOM   705  C CG  . GLN A 1 107 ? -15.810 13.359  -6.929  1.00 23.00  ? 1590 GLN A CG  1 
ATOM   706  C CD  . GLN A 1 107 ? -17.168 13.589  -6.285  1.00 22.65  ? 1590 GLN A CD  1 
ATOM   707  O OE1 . GLN A 1 107 ? -17.263 14.144  -5.194  1.00 26.27  ? 1590 GLN A OE1 1 
ATOM   708  N NE2 . GLN A 1 107 ? -18.217 13.173  -6.959  1.00 21.27  ? 1590 GLN A NE2 1 
ATOM   709  N N   . GLY A 1 108 ? -11.962 13.978  -5.797  1.00 16.22  ? 1591 GLY A N   1 
ATOM   710  C CA  . GLY A 1 108 ? -11.107 15.143  -5.860  1.00 14.00  ? 1591 GLY A CA  1 
ATOM   711  C C   . GLY A 1 108 ? -10.021 14.973  -6.896  1.00 16.30  ? 1591 GLY A C   1 
ATOM   712  O O   . GLY A 1 108 ? -9.641  15.924  -7.599  1.00 17.37  ? 1591 GLY A O   1 
ATOM   713  N N   . ILE A 1 109 ? -9.513  13.750  -6.982  1.00 16.25  ? 1592 ILE A N   1 
ATOM   714  C CA  . ILE A 1 109 ? -8.479  13.386  -7.943  1.00 17.46  ? 1592 ILE A CA  1 
ATOM   715  C C   . ILE A 1 109 ? -9.059  13.458  -9.371  1.00 17.68  ? 1592 ILE A C   1 
ATOM   716  O O   . ILE A 1 109 ? -8.429  13.983  -10.294 1.00 18.78  ? 1592 ILE A O   1 
ATOM   717  C CB  . ILE A 1 109 ? -7.965  11.943  -7.630  1.00 19.00  ? 1592 ILE A CB  1 
ATOM   718  C CG1 . ILE A 1 109 ? -7.148  11.966  -6.331  1.00 16.90  ? 1592 ILE A CG1 1 
ATOM   719  C CG2 . ILE A 1 109 ? -7.144  11.382  -8.795  1.00 15.97  ? 1592 ILE A CG2 1 
ATOM   720  C CD1 . ILE A 1 109 ? -6.711  10.580  -5.850  1.00 19.20  ? 1592 ILE A CD1 1 
ATOM   721  N N   . LEU A 1 110 ? -10.271 12.940  -9.536  1.00 17.15  ? 1593 LEU A N   1 
ATOM   722  C CA  . LEU A 1 110 ? -10.951 12.953  -10.838 1.00 17.92  ? 1593 LEU A CA  1 
ATOM   723  C C   . LEU A 1 110 ? -11.205 14.397  -11.275 1.00 17.75  ? 1593 LEU A C   1 
ATOM   724  O O   . LEU A 1 110 ? -10.973 14.768  -12.425 1.00 13.70  ? 1593 LEU A O   1 
ATOM   725  C CB  . LEU A 1 110 ? -12.283 12.218  -10.729 1.00 15.73  ? 1593 LEU A CB  1 
ATOM   726  C CG  . LEU A 1 110 ? -12.447 10.758  -11.168 1.00 17.29  ? 1593 LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 110 ? -11.150 9.969   -11.134 1.00 13.13  ? 1593 LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 110 ? -13.538 10.133  -10.306 1.00 13.24  ? 1593 LEU A CD2 1 
ATOM   729  N N   . GLN A 1 111 ? -11.648 15.210  -10.317 1.00 18.67  ? 1594 GLN A N   1 
ATOM   730  C CA  . GLN A 1 111 ? -11.947 16.608  -10.567 1.00 19.80  ? 1594 GLN A CA  1 
ATOM   731  C C   . GLN A 1 111 ? -10.688 17.368  -11.000 1.00 19.44  ? 1594 GLN A C   1 
ATOM   732  O O   . GLN A 1 111 ? -10.702 18.101  -11.989 1.00 18.57  ? 1594 GLN A O   1 
ATOM   733  C CB  . GLN A 1 111 ? -12.567 17.236  -9.310  1.00 20.52  ? 1594 GLN A CB  1 
ATOM   734  C CG  . GLN A 1 111 ? -13.081 18.649  -9.516  1.00 21.21  ? 1594 GLN A CG  1 
ATOM   735  C CD  . GLN A 1 111 ? -14.278 18.725  -10.450 1.00 17.99  ? 1594 GLN A CD  1 
ATOM   736  O OE1 . GLN A 1 111 ? -15.341 18.203  -10.149 1.00 19.95  ? 1594 GLN A OE1 1 
ATOM   737  N NE2 . GLN A 1 111 ? -14.103 19.381  -11.580 1.00 15.59  ? 1594 GLN A NE2 1 
ATOM   738  N N   . THR A 1 112 ? -9.594  17.182  -10.270 1.00 18.82  ? 1595 THR A N   1 
ATOM   739  C CA  . THR A 1 112 ? -8.350  17.853  -10.619 1.00 19.18  ? 1595 THR A CA  1 
ATOM   740  C C   . THR A 1 112 ? -7.926  17.522  -12.057 1.00 20.25  ? 1595 THR A C   1 
ATOM   741  O O   . THR A 1 112 ? -7.582  18.416  -12.834 1.00 19.87  ? 1595 THR A O   1 
ATOM   742  C CB  . THR A 1 112 ? -7.229  17.427  -9.675  1.00 20.33  ? 1595 THR A CB  1 
ATOM   743  O OG1 . THR A 1 112 ? -7.624  17.664  -8.322  1.00 21.29  ? 1595 THR A OG1 1 
ATOM   744  C CG2 . THR A 1 112 ? -5.971  18.179  -9.981  1.00 17.24  ? 1595 THR A CG2 1 
ATOM   745  N N   . GLY A 1 113 ? -7.927  16.237  -12.409 1.00 19.41  ? 1596 GLY A N   1 
ATOM   746  C CA  . GLY A 1 113 ? -7.554  15.877  -13.766 1.00 17.79  ? 1596 GLY A CA  1 
ATOM   747  C C   . GLY A 1 113 ? -8.563  16.403  -14.777 1.00 17.58  ? 1596 GLY A C   1 
ATOM   748  O O   . GLY A 1 113 ? -8.224  16.736  -15.908 1.00 18.43  ? 1596 GLY A O   1 
ATOM   749  N N   . HIS A 1 114 ? -9.824  16.467  -14.380 1.00 17.01  ? 1597 HIS A N   1 
ATOM   750  C CA  . HIS A 1 114 ? -10.848 16.984  -15.269 1.00 19.81  ? 1597 HIS A CA  1 
ATOM   751  C C   . HIS A 1 114 ? -10.614 18.479  -15.526 1.00 19.62  ? 1597 HIS A C   1 
ATOM   752  O O   . HIS A 1 114 ? -10.604 18.930  -16.673 1.00 19.96  ? 1597 HIS A O   1 
ATOM   753  C CB  . HIS A 1 114 ? -12.240 16.768  -14.664 1.00 22.66  ? 1597 HIS A CB  1 
ATOM   754  C CG  . HIS A 1 114 ? -13.355 17.229  -15.545 1.00 25.18  ? 1597 HIS A CG  1 
ATOM   755  N ND1 . HIS A 1 114 ? -13.547 16.734  -16.816 1.00 27.27  ? 1597 HIS A ND1 1 
ATOM   756  C CD2 . HIS A 1 114 ? -14.356 18.115  -15.331 1.00 28.13  ? 1597 HIS A CD2 1 
ATOM   757  C CE1 . HIS A 1 114 ? -14.623 17.288  -17.346 1.00 27.88  ? 1597 HIS A CE1 1 
ATOM   758  N NE2 . HIS A 1 114 ? -15.133 18.131  -16.466 1.00 27.86  ? 1597 HIS A NE2 1 
ATOM   759  N N   . ASP A 1 115 ? -10.424 19.240  -14.457 1.00 18.70  ? 1598 ASP A N   1 
ATOM   760  C CA  . ASP A 1 115 ? -10.178 20.663  -14.584 1.00 20.37  ? 1598 ASP A CA  1 
ATOM   761  C C   . ASP A 1 115 ? -8.866  20.969  -15.286 1.00 22.78  ? 1598 ASP A C   1 
ATOM   762  O O   . ASP A 1 115 ? -8.820  21.911  -16.087 1.00 23.42  ? 1598 ASP A O   1 
ATOM   763  C CB  . ASP A 1 115 ? -10.152 21.354  -13.215 1.00 22.10  ? 1598 ASP A CB  1 
ATOM   764  C CG  . ASP A 1 115 ? -11.511 21.407  -12.563 1.00 24.28  ? 1598 ASP A CG  1 
ATOM   765  O OD1 . ASP A 1 115 ? -12.524 21.430  -13.304 1.00 20.83  ? 1598 ASP A OD1 1 
ATOM   766  O OD2 . ASP A 1 115 ? -11.556 21.430  -11.310 1.00 26.96  ? 1598 ASP A OD2 1 
ATOM   767  N N   . LEU A 1 116 ? -7.824  20.168  -15.007 1.00 20.78  ? 1599 LEU A N   1 
ATOM   768  C CA  . LEU A 1 116 ? -6.500  20.391  -15.577 1.00 22.51  ? 1599 LEU A CA  1 
ATOM   769  C C   . LEU A 1 116 ? -6.085  19.353  -16.601 1.00 24.97  ? 1599 LEU A C   1 
ATOM   770  O O   . LEU A 1 116 ? -5.357  18.418  -16.272 1.00 28.45  ? 1599 LEU A O   1 
ATOM   771  C CB  . LEU A 1 116 ? -5.444  20.462  -14.443 1.00 22.28  ? 1599 LEU A CB  1 
ATOM   772  C CG  . LEU A 1 116 ? -5.928  21.197  -13.158 1.00 24.11  ? 1599 LEU A CG  1 
ATOM   773  C CD1 . LEU A 1 116 ? -4.829  21.301  -12.141 1.00 20.14  ? 1599 LEU A CD1 1 
ATOM   774  C CD2 . LEU A 1 116 ? -6.454  22.595  -13.504 1.00 21.70  ? 1599 LEU A CD2 1 
ATOM   775  N N   . ARG A 1 117 ? -6.519  19.528  -17.845 1.00 26.01  ? 1600 ARG A N   1 
ATOM   776  C CA  . ARG A 1 117 ? -6.196  18.587  -18.918 1.00 28.71  ? 1600 ARG A CA  1 
ATOM   777  C C   . ARG A 1 117 ? -4.758  18.092  -18.932 1.00 27.44  ? 1600 ARG A C   1 
ATOM   778  O O   . ARG A 1 117 ? -4.520  16.895  -19.079 1.00 27.62  ? 1600 ARG A O   1 
ATOM   779  C CB  . ARG A 1 117 ? -6.523  19.180  -20.299 1.00 30.25  ? 1600 ARG A CB  1 
ATOM   780  C CG  . ARG A 1 117 ? -7.998  19.171  -20.647 1.00 39.11  ? 1600 ARG A CG  1 
ATOM   781  C CD  . ARG A 1 117 ? -8.300  19.774  -22.034 1.00 44.85  ? 1600 ARG A CD  1 
ATOM   782  N NE  . ARG A 1 117 ? -9.752  19.875  -22.270 1.00 50.21  ? 1600 ARG A NE  1 
ATOM   783  C CZ  . ARG A 1 117 ? -10.548 18.855  -22.613 1.00 51.90  ? 1600 ARG A CZ  1 
ATOM   784  N NH1 . ARG A 1 117 ? -10.051 17.631  -22.788 1.00 51.05  ? 1600 ARG A NH1 1 
ATOM   785  N NH2 . ARG A 1 117 ? -11.857 19.050  -22.750 1.00 52.98  ? 1600 ARG A NH2 1 
ATOM   786  N N   . PRO A 1 118 ? -3.778  19.004  -18.785 1.00 26.80  ? 1601 PRO A N   1 
ATOM   787  C CA  . PRO A 1 118 ? -2.362  18.595  -18.796 1.00 25.98  ? 1601 PRO A CA  1 
ATOM   788  C C   . PRO A 1 118 ? -2.000  17.535  -17.745 1.00 26.06  ? 1601 PRO A C   1 
ATOM   789  O O   . PRO A 1 118 ? -1.030  16.816  -17.903 1.00 27.57  ? 1601 PRO A O   1 
ATOM   790  C CB  . PRO A 1 118 ? -1.621  19.914  -18.580 1.00 24.61  ? 1601 PRO A CB  1 
ATOM   791  C CG  . PRO A 1 118 ? -2.549  20.910  -19.246 1.00 24.40  ? 1601 PRO A CG  1 
ATOM   792  C CD  . PRO A 1 118 ? -3.897  20.472  -18.717 1.00 24.40  ? 1601 PRO A CD  1 
ATOM   793  N N   . LEU A 1 119 ? -2.783  17.435  -16.681 1.00 25.47  ? 1602 LEU A N   1 
ATOM   794  C CA  . LEU A 1 119 ? -2.501  16.453  -15.647 1.00 26.50  ? 1602 LEU A CA  1 
ATOM   795  C C   . LEU A 1 119 ? -3.147  15.107  -15.937 1.00 26.68  ? 1602 LEU A C   1 
ATOM   796  O O   . LEU A 1 119 ? -2.962  14.172  -15.168 1.00 29.08  ? 1602 LEU A O   1 
ATOM   797  C CB  . LEU A 1 119 ? -2.985  16.948  -14.266 1.00 26.15  ? 1602 LEU A CB  1 
ATOM   798  C CG  . LEU A 1 119 ? -2.143  17.995  -13.529 1.00 24.93  ? 1602 LEU A CG  1 
ATOM   799  C CD1 . LEU A 1 119 ? -2.504  17.945  -12.069 1.00 21.46  ? 1602 LEU A CD1 1 
ATOM   800  C CD2 . LEU A 1 119 ? -0.658  17.703  -13.685 1.00 26.25  ? 1602 LEU A CD2 1 
ATOM   801  N N   . ARG A 1 120 ? -3.918  15.008  -17.021 1.00 26.03  ? 1603 ARG A N   1 
ATOM   802  C CA  . ARG A 1 120 ? -4.581  13.750  -17.366 1.00 24.48  ? 1603 ARG A CA  1 
ATOM   803  C C   . ARG A 1 120 ? -3.594  12.635  -17.690 1.00 22.72  ? 1603 ARG A C   1 
ATOM   804  O O   . ARG A 1 120 ? -3.721  11.519  -17.181 1.00 23.01  ? 1603 ARG A O   1 
ATOM   805  C CB  . ARG A 1 120 ? -5.565  13.953  -18.518 1.00 23.18  ? 1603 ARG A CB  1 
ATOM   806  C CG  . ARG A 1 120 ? -6.829  14.616  -18.052 1.00 22.93  ? 1603 ARG A CG  1 
ATOM   807  C CD  . ARG A 1 120 ? -7.714  15.016  -19.186 1.00 21.95  ? 1603 ARG A CD  1 
ATOM   808  N NE  . ARG A 1 120 ? -8.767  15.905  -18.730 1.00 20.37  ? 1603 ARG A NE  1 
ATOM   809  C CZ  . ARG A 1 120 ? -9.793  16.265  -19.490 1.00 22.88  ? 1603 ARG A CZ  1 
ATOM   810  N NH1 . ARG A 1 120 ? -9.871  15.799  -20.735 1.00 21.67  ? 1603 ARG A NH1 1 
ATOM   811  N NH2 . ARG A 1 120 ? -10.751 17.050  -19.002 1.00 21.39  ? 1603 ARG A NH2 1 
ATOM   812  N N   . ASP A 1 121 ? -2.610  12.932  -18.524 1.00 21.60  ? 1604 ASP A N   1 
ATOM   813  C CA  . ASP A 1 121 ? -1.592  11.940  -18.852 1.00 20.45  ? 1604 ASP A CA  1 
ATOM   814  C C   . ASP A 1 121 ? -0.733  11.672  -17.614 1.00 19.67  ? 1604 ASP A C   1 
ATOM   815  O O   . ASP A 1 121 ? -0.376  10.521  -17.366 1.00 19.31  ? 1604 ASP A O   1 
ATOM   816  C CB  . ASP A 1 121 ? -0.687  12.420  -19.996 1.00 17.66  ? 1604 ASP A CB  1 
ATOM   817  C CG  . ASP A 1 121 ? -1.302  12.199  -21.352 1.00 21.84  ? 1604 ASP A CG  1 
ATOM   818  O OD1 . ASP A 1 121 ? -2.394  11.569  -21.418 1.00 22.01  ? 1604 ASP A OD1 1 
ATOM   819  O OD2 . ASP A 1 121 ? -0.696  12.644  -22.356 1.00 23.51  ? 1604 ASP A OD2 1 
ATOM   820  N N   . GLU A 1 122 ? -0.424  12.737  -16.857 1.00 18.71  ? 1605 GLU A N   1 
ATOM   821  C CA  . GLU A 1 122 ? 0.401   12.650  -15.642 1.00 19.81  ? 1605 GLU A CA  1 
ATOM   822  C C   . GLU A 1 122 ? -0.221  11.711  -14.612 1.00 19.70  ? 1605 GLU A C   1 
ATOM   823  O O   . GLU A 1 122 ? 0.472   10.841  -14.077 1.00 20.49  ? 1605 GLU A O   1 
ATOM   824  C CB  . GLU A 1 122 ? 0.607   14.041  -15.011 1.00 18.83  ? 1605 GLU A CB  1 
ATOM   825  C CG  . GLU A 1 122 ? 1.281   14.073  -13.618 1.00 19.28  ? 1605 GLU A CG  1 
ATOM   826  C CD  . GLU A 1 122 ? 2.782   13.720  -13.633 1.00 22.41  ? 1605 GLU A CD  1 
ATOM   827  O OE1 . GLU A 1 122 ? 3.412   13.797  -14.697 1.00 22.49  ? 1605 GLU A OE1 1 
ATOM   828  O OE2 . GLU A 1 122 ? 3.354   13.368  -12.575 1.00 24.34  ? 1605 GLU A OE2 1 
ATOM   829  N N   . LEU A 1 123 ? -1.514  11.883  -14.357 1.00 16.91  ? 1606 LEU A N   1 
ATOM   830  C CA  . LEU A 1 123 ? -2.226  11.034  -13.420 1.00 19.13  ? 1606 LEU A CA  1 
ATOM   831  C C   . LEU A 1 123 ? -2.211  9.570   -13.873 1.00 19.69  ? 1606 LEU A C   1 
ATOM   832  O O   . LEU A 1 123 ? -2.089  8.661   -13.061 1.00 21.04  ? 1606 LEU A O   1 
ATOM   833  C CB  . LEU A 1 123 ? -3.685  11.489  -13.271 1.00 21.61  ? 1606 LEU A CB  1 
ATOM   834  C CG  . LEU A 1 123 ? -3.961  12.744  -12.428 1.00 24.03  ? 1606 LEU A CG  1 
ATOM   835  C CD1 . LEU A 1 123 ? -5.471  13.011  -12.409 1.00 24.93  ? 1606 LEU A CD1 1 
ATOM   836  C CD2 . LEU A 1 123 ? -3.437  12.541  -10.991 1.00 24.13  ? 1606 LEU A CD2 1 
ATOM   837  N N   . TYR A 1 124 ? -2.343  9.333   -15.166 1.00 17.65  ? 1607 TYR A N   1 
ATOM   838  C CA  . TYR A 1 124 ? -2.346  7.964   -15.642 1.00 17.94  ? 1607 TYR A CA  1 
ATOM   839  C C   . TYR A 1 124 ? -0.993  7.331   -15.417 1.00 17.65  ? 1607 TYR A C   1 
ATOM   840  O O   . TYR A 1 124 ? -0.911  6.179   -14.969 1.00 17.64  ? 1607 TYR A O   1 
ATOM   841  C CB  . TYR A 1 124 ? -2.709  7.900   -17.139 1.00 18.30  ? 1607 TYR A CB  1 
ATOM   842  C CG  . TYR A 1 124 ? -4.170  7.709   -17.394 1.00 15.13  ? 1607 TYR A CG  1 
ATOM   843  C CD1 . TYR A 1 124 ? -4.807  6.520   -17.052 1.00 16.46  ? 1607 TYR A CD1 1 
ATOM   844  C CD2 . TYR A 1 124 ? -4.931  8.720   -17.945 1.00 14.10  ? 1607 TYR A CD2 1 
ATOM   845  C CE1 . TYR A 1 124 ? -6.190  6.345   -17.258 1.00 12.86  ? 1607 TYR A CE1 1 
ATOM   846  C CE2 . TYR A 1 124 ? -6.299  8.561   -18.142 1.00 11.88  ? 1607 TYR A CE2 1 
ATOM   847  C CZ  . TYR A 1 124 ? -6.923  7.377   -17.795 1.00 9.80   ? 1607 TYR A CZ  1 
ATOM   848  O OH  . TYR A 1 124 ? -8.284  7.245   -17.974 1.00 9.82   ? 1607 TYR A OH  1 
ATOM   849  N N   . CYS A 1 125 ? 0.067   8.071   -15.737 1.00 15.88  ? 1608 CYS A N   1 
ATOM   850  C CA  . CYS A 1 125 ? 1.423   7.558   -15.557 1.00 17.34  ? 1608 CYS A CA  1 
ATOM   851  C C   . CYS A 1 125 ? 1.706   7.312   -14.097 1.00 15.32  ? 1608 CYS A C   1 
ATOM   852  O O   . CYS A 1 125 ? 2.410   6.378   -13.746 1.00 18.10  ? 1608 CYS A O   1 
ATOM   853  C CB  . CYS A 1 125 ? 2.467   8.521   -16.139 1.00 17.89  ? 1608 CYS A CB  1 
ATOM   854  S SG  . CYS A 1 125 ? 2.576   8.451   -17.935 1.00 25.63  ? 1608 CYS A SG  1 
ATOM   855  N N   . GLN A 1 126 ? 1.153   8.161   -13.246 1.00 14.27  ? 1609 GLN A N   1 
ATOM   856  C CA  . GLN A 1 126 ? 1.338   8.007   -11.820 1.00 13.61  ? 1609 GLN A CA  1 
ATOM   857  C C   . GLN A 1 126 ? 0.697   6.707   -11.298 1.00 13.49  ? 1609 GLN A C   1 
ATOM   858  O O   . GLN A 1 126 ? 1.318   5.984   -10.523 1.00 14.82  ? 1609 GLN A O   1 
ATOM   859  C CB  . GLN A 1 126 ? 0.785   9.226   -11.095 1.00 11.55  ? 1609 GLN A CB  1 
ATOM   860  C CG  . GLN A 1 126 ? 1.822   10.336  -10.857 1.00 11.73  ? 1609 GLN A CG  1 
ATOM   861  C CD  . GLN A 1 126 ? 1.219   11.557  -10.141 1.00 15.97  ? 1609 GLN A CD  1 
ATOM   862  O OE1 . GLN A 1 126 ? 0.343   11.411  -9.284  1.00 16.74  ? 1609 GLN A OE1 1 
ATOM   863  N NE2 . GLN A 1 126 ? 1.694   12.756  -10.483 1.00 13.45  ? 1609 GLN A NE2 1 
ATOM   864  N N   . LEU A 1 127 ? -0.529  6.403   -11.711 1.00 13.13  ? 1610 LEU A N   1 
ATOM   865  C CA  . LEU A 1 127 ? -1.166  5.155   -11.279 1.00 15.21  ? 1610 LEU A CA  1 
ATOM   866  C C   . LEU A 1 127 ? -0.436  3.913   -11.808 1.00 15.80  ? 1610 LEU A C   1 
ATOM   867  O O   . LEU A 1 127 ? -0.311  2.908   -11.122 1.00 15.58  ? 1610 LEU A O   1 
ATOM   868  C CB  . LEU A 1 127 ? -2.619  5.071   -11.735 1.00 10.17  ? 1610 LEU A CB  1 
ATOM   869  C CG  . LEU A 1 127 ? -3.706  5.668   -10.850 1.00 11.40  ? 1610 LEU A CG  1 
ATOM   870  C CD1 . LEU A 1 127 ? -3.392  5.512   -9.372  1.00 9.62   ? 1610 LEU A CD1 1 
ATOM   871  C CD2 . LEU A 1 127 ? -3.866  7.091   -11.222 1.00 14.02  ? 1610 LEU A CD2 1 
ATOM   872  N N   . ILE A 1 128 ? 0.027   3.984   -13.045 1.00 17.92  ? 1611 ILE A N   1 
ATOM   873  C CA  . ILE A 1 128 ? 0.734   2.862   -13.638 1.00 19.40  ? 1611 ILE A CA  1 
ATOM   874  C C   . ILE A 1 128 ? 1.975   2.605   -12.767 1.00 19.11  ? 1611 ILE A C   1 
ATOM   875  O O   . ILE A 1 128 ? 2.251   1.467   -12.364 1.00 17.62  ? 1611 ILE A O   1 
ATOM   876  C CB  . ILE A 1 128 ? 1.137   3.198   -15.080 1.00 20.17  ? 1611 ILE A CB  1 
ATOM   877  C CG1 . ILE A 1 128 ? -0.105  3.160   -15.966 1.00 22.05  ? 1611 ILE A CG1 1 
ATOM   878  C CG2 . ILE A 1 128 ? 2.269   2.287   -15.537 1.00 17.50  ? 1611 ILE A CG2 1 
ATOM   879  C CD1 . ILE A 1 128 ? 0.172   3.602   -17.411 1.00 25.12  ? 1611 ILE A CD1 1 
ATOM   880  N N   . LYS A 1 129 ? 2.700   3.679   -12.470 1.00 16.66  ? 1612 LYS A N   1 
ATOM   881  C CA  . LYS A 1 129 ? 3.870   3.574   -11.625 1.00 17.69  ? 1612 LYS A CA  1 
ATOM   882  C C   . LYS A 1 129 ? 3.517   2.929   -10.257 1.00 17.22  ? 1612 LYS A C   1 
ATOM   883  O O   . LYS A 1 129 ? 4.163   1.959   -9.858  1.00 14.53  ? 1612 LYS A O   1 
ATOM   884  C CB  . LYS A 1 129 ? 4.492   4.968   -11.423 1.00 17.14  ? 1612 LYS A CB  1 
ATOM   885  C CG  . LYS A 1 129 ? 5.501   5.075   -10.293 1.00 16.86  ? 1612 LYS A CG  1 
ATOM   886  C CD  . LYS A 1 129 ? 5.787   6.532   -9.989  1.00 21.37  ? 1612 LYS A CD  1 
ATOM   887  C CE  . LYS A 1 129 ? 6.663   6.716   -8.751  1.00 19.60  ? 1612 LYS A CE  1 
ATOM   888  N NZ  . LYS A 1 129 ? 8.071   6.365   -9.011  1.00 20.61  ? 1612 LYS A NZ  1 
ATOM   889  N N   . GLN A 1 130 ? 2.496   3.442   -9.556  1.00 14.50  ? 1613 GLN A N   1 
ATOM   890  C CA  . GLN A 1 130 ? 2.157   2.882   -8.236  1.00 16.32  ? 1613 GLN A CA  1 
ATOM   891  C C   . GLN A 1 130 ? 1.473   1.522   -8.247  1.00 14.81  ? 1613 GLN A C   1 
ATOM   892  O O   . GLN A 1 130 ? 1.267   0.939   -7.195  1.00 16.36  ? 1613 GLN A O   1 
ATOM   893  C CB  . GLN A 1 130 ? 1.317   3.863   -7.385  1.00 12.84  ? 1613 GLN A CB  1 
ATOM   894  C CG  . GLN A 1 130 ? 2.039   5.127   -6.941  1.00 10.62  ? 1613 GLN A CG  1 
ATOM   895  C CD  . GLN A 1 130 ? 3.354   4.846   -6.218  1.00 14.76  ? 1613 GLN A CD  1 
ATOM   896  O OE1 . GLN A 1 130 ? 4.398   4.677   -6.850  1.00 16.04  ? 1613 GLN A OE1 1 
ATOM   897  N NE2 . GLN A 1 130 ? 3.304   4.784   -4.886  1.00 15.22  ? 1613 GLN A NE2 1 
ATOM   898  N N   . THR A 1 131 ? 1.085   1.039   -9.418  1.00 13.65  ? 1614 THR A N   1 
ATOM   899  C CA  . THR A 1 131 ? 0.491   -0.280  -9.510  1.00 14.42  ? 1614 THR A CA  1 
ATOM   900  C C   . THR A 1 131 ? 1.534   -1.227  -10.146 1.00 16.15  ? 1614 THR A C   1 
ATOM   901  O O   . THR A 1 131 ? 1.233   -2.378  -10.408 1.00 18.12  ? 1614 THR A O   1 
ATOM   902  C CB  . THR A 1 131 ? -0.775  -0.311  -10.387 1.00 11.74  ? 1614 THR A CB  1 
ATOM   903  O OG1 . THR A 1 131 ? -0.461  0.218   -11.684 1.00 16.56  ? 1614 THR A OG1 1 
ATOM   904  C CG2 . THR A 1 131 ? -1.889  0.498   -9.751  1.00 8.09   ? 1614 THR A CG2 1 
ATOM   905  N N   . ASN A 1 132 ? 2.742   -0.733  -10.392 1.00 15.23  ? 1615 ASN A N   1 
ATOM   906  C CA  . ASN A 1 132 ? 3.803   -1.531  -10.991 1.00 16.59  ? 1615 ASN A CA  1 
ATOM   907  C C   . ASN A 1 132 ? 4.872   -1.995  -9.983  1.00 16.39  ? 1615 ASN A C   1 
ATOM   908  O O   . ASN A 1 132 ? 5.559   -1.171  -9.384  1.00 16.16  ? 1615 ASN A O   1 
ATOM   909  C CB  . ASN A 1 132 ? 4.461   -0.725  -12.118 1.00 18.46  ? 1615 ASN A CB  1 
ATOM   910  C CG  . ASN A 1 132 ? 5.479   -1.535  -12.905 1.00 20.31  ? 1615 ASN A CG  1 
ATOM   911  O OD1 . ASN A 1 132 ? 5.400   -2.788  -12.961 1.00 20.43  ? 1615 ASN A OD1 1 
ATOM   912  N ND2 . ASN A 1 132 ? 6.434   -0.830  -13.543 1.00 11.89  ? 1615 ASN A ND2 1 
ATOM   913  N N   . LYS A 1 133 ? 5.004   -3.317  -9.815  1.00 16.98  ? 1616 LYS A N   1 
ATOM   914  C CA  . LYS A 1 133 ? 5.957   -3.945  -8.886  1.00 14.88  ? 1616 LYS A CA  1 
ATOM   915  C C   . LYS A 1 133 ? 5.744   -3.534  -7.430  1.00 17.47  ? 1616 LYS A C   1 
ATOM   916  O O   . LYS A 1 133 ? 6.706   -3.201  -6.727  1.00 20.54  ? 1616 LYS A O   1 
ATOM   917  C CB  . LYS A 1 133 ? 7.388   -3.610  -9.276  1.00 13.87  ? 1616 LYS A CB  1 
ATOM   918  C CG  . LYS A 1 133 ? 7.660   -3.710  -10.753 1.00 19.21  ? 1616 LYS A CG  1 
ATOM   919  C CD  . LYS A 1 133 ? 7.367   -5.115  -11.276 1.00 23.18  ? 1616 LYS A CD  1 
ATOM   920  C CE  . LYS A 1 133 ? 7.658   -5.208  -12.761 1.00 21.84  ? 1616 LYS A CE  1 
ATOM   921  N NZ  . LYS A 1 133 ? 7.134   -6.483  -13.276 1.00 28.57  ? 1616 LYS A NZ  1 
ATOM   922  N N   . VAL A 1 134 ? 4.495   -3.549  -6.979  1.00 19.15  ? 1617 VAL A N   1 
ATOM   923  C CA  . VAL A 1 134 ? 4.149   -3.173  -5.606  1.00 19.89  ? 1617 VAL A CA  1 
ATOM   924  C C   . VAL A 1 134 ? 4.663   -4.266  -4.691  1.00 22.56  ? 1617 VAL A C   1 
ATOM   925  O O   . VAL A 1 134 ? 4.652   -5.439  -5.049  1.00 22.08  ? 1617 VAL A O   1 
ATOM   926  C CB  . VAL A 1 134 ? 2.572   -3.035  -5.387  1.00 19.97  ? 1617 VAL A CB  1 
ATOM   927  C CG1 . VAL A 1 134 ? 1.971   -2.124  -6.447  1.00 16.66  ? 1617 VAL A CG1 1 
ATOM   928  C CG2 . VAL A 1 134 ? 1.865   -4.441  -5.392  1.00 12.94  ? 1617 VAL A CG2 1 
ATOM   929  N N   . PRO A 1 135 ? 5.115   -3.898  -3.493  1.00 25.99  ? 1618 PRO A N   1 
ATOM   930  C CA  . PRO A 1 135 ? 5.626   -4.917  -2.563  1.00 26.92  ? 1618 PRO A CA  1 
ATOM   931  C C   . PRO A 1 135 ? 4.548   -5.808  -1.935  1.00 26.78  ? 1618 PRO A C   1 
ATOM   932  O O   . PRO A 1 135 ? 4.850   -6.918  -1.488  1.00 27.57  ? 1618 PRO A O   1 
ATOM   933  C CB  . PRO A 1 135 ? 6.382   -4.088  -1.525  1.00 26.43  ? 1618 PRO A CB  1 
ATOM   934  C CG  . PRO A 1 135 ? 5.575   -2.781  -1.494  1.00 27.63  ? 1618 PRO A CG  1 
ATOM   935  C CD  . PRO A 1 135 ? 5.371   -2.537  -2.986  1.00 27.72  ? 1618 PRO A CD  1 
ATOM   936  N N   . HIS A 1 136 ? 3.304   -5.329  -1.914  1.00 24.74  ? 1619 HIS A N   1 
ATOM   937  C CA  . HIS A 1 136 ? 2.193   -6.070  -1.322  1.00 23.18  ? 1619 HIS A CA  1 
ATOM   938  C C   . HIS A 1 136 ? 0.957   -6.171  -2.221  1.00 22.13  ? 1619 HIS A C   1 
ATOM   939  O O   . HIS A 1 136 ? -0.030  -5.457  -2.046  1.00 20.71  ? 1619 HIS A O   1 
ATOM   940  C CB  . HIS A 1 136 ? 1.812   -5.425  0.019   1.00 23.54  ? 1619 HIS A CB  1 
ATOM   941  C CG  . HIS A 1 136 ? 2.844   -5.617  1.087   1.00 31.95  ? 1619 HIS A CG  1 
ATOM   942  N ND1 . HIS A 1 136 ? 3.030   -6.823  1.740   1.00 33.55  ? 1619 HIS A ND1 1 
ATOM   943  C CD2 . HIS A 1 136 ? 3.767   -4.765  1.598   1.00 31.63  ? 1619 HIS A CD2 1 
ATOM   944  C CE1 . HIS A 1 136 ? 4.019   -6.698  2.608   1.00 35.64  ? 1619 HIS A CE1 1 
ATOM   945  N NE2 . HIS A 1 136 ? 4.483   -5.461  2.541   1.00 33.26  ? 1619 HIS A NE2 1 
ATOM   946  N N   . PRO A 1 137 ? 0.986   -7.081  -3.191  1.00 23.01  ? 1620 PRO A N   1 
ATOM   947  C CA  . PRO A 1 137 ? -0.170  -7.222  -4.087  1.00 22.15  ? 1620 PRO A CA  1 
ATOM   948  C C   . PRO A 1 137 ? -1.456  -7.550  -3.345  1.00 21.88  ? 1620 PRO A C   1 
ATOM   949  O O   . PRO A 1 137 ? -1.465  -8.399  -2.454  1.00 24.87  ? 1620 PRO A O   1 
ATOM   950  C CB  . PRO A 1 137 ? 0.264   -8.340  -5.032  1.00 21.81  ? 1620 PRO A CB  1 
ATOM   951  C CG  . PRO A 1 137 ? 1.785   -8.204  -5.059  1.00 19.26  ? 1620 PRO A CG  1 
ATOM   952  C CD  . PRO A 1 137 ? 2.099   -7.954  -3.610  1.00 22.17  ? 1620 PRO A CD  1 
ATOM   953  N N   . GLY A 1 138 ? -2.538  -6.860  -3.686  1.00 21.35  ? 1621 GLY A N   1 
ATOM   954  C CA  . GLY A 1 138 ? -3.807  -7.129  -3.034  1.00 21.16  ? 1621 GLY A CA  1 
ATOM   955  C C   . GLY A 1 138 ? -4.018  -6.409  -1.720  1.00 20.87  ? 1621 GLY A C   1 
ATOM   956  O O   . GLY A 1 138 ? -5.064  -6.538  -1.089  1.00 21.73  ? 1621 GLY A O   1 
ATOM   957  N N   . SER A 1 139 ? -3.017  -5.656  -1.283  1.00 22.16  ? 1622 SER A N   1 
ATOM   958  C CA  . SER A 1 139 ? -3.152  -4.909  -0.037  1.00 19.97  ? 1622 SER A CA  1 
ATOM   959  C C   . SER A 1 139 ? -4.253  -3.863  -0.240  1.00 18.52  ? 1622 SER A C   1 
ATOM   960  O O   . SER A 1 139 ? -4.727  -3.659  -1.373  1.00 15.41  ? 1622 SER A O   1 
ATOM   961  C CB  . SER A 1 139 ? -1.849  -4.212  0.288   1.00 21.36  ? 1622 SER A CB  1 
ATOM   962  O OG  . SER A 1 139 ? -1.622  -3.197  -0.664  1.00 25.70  ? 1622 SER A OG  1 
ATOM   963  N N   . VAL A 1 140 ? -4.669  -3.214  0.849   1.00 17.81  ? 1623 VAL A N   1 
ATOM   964  C CA  . VAL A 1 140 ? -5.709  -2.192  0.743   1.00 18.65  ? 1623 VAL A CA  1 
ATOM   965  C C   . VAL A 1 140 ? -5.252  -1.059  -0.172  1.00 18.73  ? 1623 VAL A C   1 
ATOM   966  O O   . VAL A 1 140 ? -6.007  -0.638  -1.058  1.00 19.52  ? 1623 VAL A O   1 
ATOM   967  C CB  . VAL A 1 140 ? -6.094  -1.605  2.111   1.00 19.51  ? 1623 VAL A CB  1 
ATOM   968  C CG1 . VAL A 1 140 ? -6.785  -0.262  1.928   1.00 16.55  ? 1623 VAL A CG1 1 
ATOM   969  C CG2 . VAL A 1 140 ? -7.060  -2.570  2.822   1.00 22.94  ? 1623 VAL A CG2 1 
ATOM   970  N N   . GLY A 1 141 ? -4.005  -0.616  0.023   1.00 16.99  ? 1624 GLY A N   1 
ATOM   971  C CA  . GLY A 1 141 ? -3.441  0.443   -0.784  1.00 16.04  ? 1624 GLY A CA  1 
ATOM   972  C C   . GLY A 1 141 ? -3.399  0.091   -2.260  1.00 17.37  ? 1624 GLY A C   1 
ATOM   973  O O   . GLY A 1 141 ? -3.855  0.865   -3.129  1.00 13.01  ? 1624 GLY A O   1 
ATOM   974  N N   . ASN A 1 142 ? -2.858  -1.089  -2.560  1.00 18.81  ? 1625 ASN A N   1 
ATOM   975  C CA  . ASN A 1 142 ? -2.779  -1.530  -3.952  1.00 17.13  ? 1625 ASN A CA  1 
ATOM   976  C C   . ASN A 1 142 ? -4.217  -1.518  -4.538  1.00 16.61  ? 1625 ASN A C   1 
ATOM   977  O O   . ASN A 1 142 ? -4.428  -1.118  -5.688  1.00 15.81  ? 1625 ASN A O   1 
ATOM   978  C CB  . ASN A 1 142 ? -2.125  -2.914  -4.017  1.00 12.95  ? 1625 ASN A CB  1 
ATOM   979  C CG  . ASN A 1 142 ? -1.917  -3.411  -5.447  1.00 14.61  ? 1625 ASN A CG  1 
ATOM   980  O OD1 . ASN A 1 142 ? -2.423  -4.463  -5.809  1.00 11.83  ? 1625 ASN A OD1 1 
ATOM   981  N ND2 . ASN A 1 142 ? -1.163  -2.658  -6.264  1.00 13.71  ? 1625 ASN A ND2 1 
ATOM   982  N N   . LEU A 1 143 ? -5.209  -1.915  -3.746  1.00 16.02  ? 1626 LEU A N   1 
ATOM   983  C CA  . LEU A 1 143 ? -6.591  -1.871  -4.245  1.00 17.50  ? 1626 LEU A CA  1 
ATOM   984  C C   . LEU A 1 143 ? -7.106  -0.432  -4.463  1.00 18.51  ? 1626 LEU A C   1 
ATOM   985  O O   . LEU A 1 143 ? -7.877  -0.209  -5.375  1.00 19.19  ? 1626 LEU A O   1 
ATOM   986  C CB  . LEU A 1 143 ? -7.536  -2.579  -3.287  1.00 19.38  ? 1626 LEU A CB  1 
ATOM   987  C CG  . LEU A 1 143 ? -7.328  -4.079  -3.092  1.00 23.61  ? 1626 LEU A CG  1 
ATOM   988  C CD1 . LEU A 1 143 ? -8.157  -4.565  -1.910  1.00 24.30  ? 1626 LEU A CD1 1 
ATOM   989  C CD2 . LEU A 1 143 ? -7.674  -4.809  -4.373  1.00 22.27  ? 1626 LEU A CD2 1 
ATOM   990  N N   . TYR A 1 144 ? -6.715  0.545   -3.636  1.00 17.92  ? 1627 TYR A N   1 
ATOM   991  C CA  . TYR A 1 144 ? -7.205  1.892   -3.879  1.00 19.31  ? 1627 TYR A CA  1 
ATOM   992  C C   . TYR A 1 144 ? -6.650  2.399   -5.211  1.00 16.88  ? 1627 TYR A C   1 
ATOM   993  O O   . TYR A 1 144 ? -7.344  3.069   -5.968  1.00 17.51  ? 1627 TYR A O   1 
ATOM   994  C CB  . TYR A 1 144 ? -6.796  2.879   -2.780  1.00 25.01  ? 1627 TYR A CB  1 
ATOM   995  C CG  . TYR A 1 144 ? -7.453  2.715   -1.436  1.00 34.44  ? 1627 TYR A CG  1 
ATOM   996  C CD1 . TYR A 1 144 ? -8.709  2.085   -1.297  1.00 37.53  ? 1627 TYR A CD1 1 
ATOM   997  C CD2 . TYR A 1 144 ? -6.845  3.244   -0.280  1.00 36.78  ? 1627 TYR A CD2 1 
ATOM   998  C CE1 . TYR A 1 144 ? -9.336  1.990   -0.034  1.00 37.99  ? 1627 TYR A CE1 1 
ATOM   999  C CE2 . TYR A 1 144 ? -7.464  3.161   0.968   1.00 37.96  ? 1627 TYR A CE2 1 
ATOM   1000 C CZ  . TYR A 1 144 ? -8.698  2.536   1.082   1.00 38.78  ? 1627 TYR A CZ  1 
ATOM   1001 O OH  . TYR A 1 144 ? -9.271  2.468   2.323   1.00 41.58  ? 1627 TYR A OH  1 
ATOM   1002 N N   . SER A 1 145 ? -5.393  2.085   -5.488  1.00 14.45  ? 1628 SER A N   1 
ATOM   1003 C CA  . SER A 1 145 ? -4.774  2.522   -6.714  1.00 11.74  ? 1628 SER A CA  1 
ATOM   1004 C C   . SER A 1 145 ? -5.583  2.026   -7.894  1.00 12.16  ? 1628 SER A C   1 
ATOM   1005 O O   . SER A 1 145 ? -5.876  2.770   -8.818  1.00 12.03  ? 1628 SER A O   1 
ATOM   1006 C CB  . SER A 1 145 ? -3.378  1.950   -6.840  1.00 9.33   ? 1628 SER A CB  1 
ATOM   1007 O OG  . SER A 1 145 ? -2.570  2.301   -5.760  1.00 13.95  ? 1628 SER A OG  1 
ATOM   1008 N N   . TRP A 1 146 ? -5.915  0.748   -7.867  1.00 13.34  ? 1629 TRP A N   1 
ATOM   1009 C CA  . TRP A 1 146 ? -6.649  0.157   -8.963  1.00 16.08  ? 1629 TRP A CA  1 
ATOM   1010 C C   . TRP A 1 146 ? -8.061  0.729   -9.088  1.00 17.20  ? 1629 TRP A C   1 
ATOM   1011 O O   . TRP A 1 146 ? -8.598  0.846   -10.187 1.00 18.12  ? 1629 TRP A O   1 
ATOM   1012 C CB  . TRP A 1 146 ? -6.661  -1.368  -8.815  1.00 14.96  ? 1629 TRP A CB  1 
ATOM   1013 C CG  . TRP A 1 146 ? -5.398  -1.969  -9.311  1.00 12.19  ? 1629 TRP A CG  1 
ATOM   1014 C CD1 . TRP A 1 146 ? -4.373  -2.472  -8.557  1.00 16.19  ? 1629 TRP A CD1 1 
ATOM   1015 C CD2 . TRP A 1 146 ? -4.970  -2.062  -10.677 1.00 11.73  ? 1629 TRP A CD2 1 
ATOM   1016 N NE1 . TRP A 1 146 ? -3.330  -2.870  -9.367  1.00 13.72  ? 1629 TRP A NE1 1 
ATOM   1017 C CE2 . TRP A 1 146 ? -3.673  -2.627  -10.674 1.00 11.77  ? 1629 TRP A CE2 1 
ATOM   1018 C CE3 . TRP A 1 146 ? -5.551  -1.718  -11.901 1.00 11.54  ? 1629 TRP A CE3 1 
ATOM   1019 C CZ2 . TRP A 1 146 ? -2.954  -2.849  -11.846 1.00 8.97   ? 1629 TRP A CZ2 1 
ATOM   1020 C CZ3 . TRP A 1 146 ? -4.840  -1.940  -13.054 1.00 11.00  ? 1629 TRP A CZ3 1 
ATOM   1021 C CH2 . TRP A 1 146 ? -3.549  -2.499  -13.021 1.00 10.10  ? 1629 TRP A CH2 1 
ATOM   1022 N N   . GLN A 1 147 ? -8.638  1.118   -7.961  1.00 17.54  ? 1630 GLN A N   1 
ATOM   1023 C CA  . GLN A 1 147 ? -9.959  1.711   -7.949  1.00 17.51  ? 1630 GLN A CA  1 
ATOM   1024 C C   . GLN A 1 147 ? -9.897  3.113   -8.546  1.00 17.35  ? 1630 GLN A C   1 
ATOM   1025 O O   . GLN A 1 147 ? -10.809 3.548   -9.267  1.00 16.92  ? 1630 GLN A O   1 
ATOM   1026 C CB  . GLN A 1 147 ? -10.471 1.762   -6.514  1.00 20.05  ? 1630 GLN A CB  1 
ATOM   1027 C CG  . GLN A 1 147 ? -11.166 0.490   -6.080  1.00 22.82  ? 1630 GLN A CG  1 
ATOM   1028 C CD  . GLN A 1 147 ? -11.052 0.257   -4.597  1.00 23.06  ? 1630 GLN A CD  1 
ATOM   1029 O OE1 . GLN A 1 147 ? -10.780 1.185   -3.835  1.00 23.89  ? 1630 GLN A OE1 1 
ATOM   1030 N NE2 . GLN A 1 147 ? -11.259 -0.984  -4.174  1.00 20.93  ? 1630 GLN A NE2 1 
ATOM   1031 N N   . ILE A 1 148 ? -8.822  3.832   -8.246  1.00 15.40  ? 1631 ILE A N   1 
ATOM   1032 C CA  . ILE A 1 148 ? -8.688  5.165   -8.798  1.00 17.11  ? 1631 ILE A CA  1 
ATOM   1033 C C   . ILE A 1 148 ? -8.537  5.084   -10.325 1.00 17.35  ? 1631 ILE A C   1 
ATOM   1034 O O   . ILE A 1 148 ? -9.174  5.843   -11.053 1.00 16.31  ? 1631 ILE A O   1 
ATOM   1035 C CB  . ILE A 1 148 ? -7.485  5.889   -8.193  1.00 17.72  ? 1631 ILE A CB  1 
ATOM   1036 C CG1 . ILE A 1 148 ? -7.728  6.104   -6.691  1.00 17.94  ? 1631 ILE A CG1 1 
ATOM   1037 C CG2 . ILE A 1 148 ? -7.248  7.233   -8.931  1.00 19.03  ? 1631 ILE A CG2 1 
ATOM   1038 C CD1 . ILE A 1 148 ? -6.459  6.427   -5.905  1.00 12.92  ? 1631 ILE A CD1 1 
ATOM   1039 N N   . LEU A 1 149 ? -7.697  4.157   -10.796 1.00 17.38  ? 1632 LEU A N   1 
ATOM   1040 C CA  . LEU A 1 149 ? -7.478  3.949   -12.225 1.00 17.63  ? 1632 LEU A CA  1 
ATOM   1041 C C   . LEU A 1 149 ? -8.799  3.564   -12.916 1.00 18.86  ? 1632 LEU A C   1 
ATOM   1042 O O   . LEU A 1 149 ? -9.128  4.061   -14.005 1.00 16.09  ? 1632 LEU A O   1 
ATOM   1043 C CB  . LEU A 1 149 ? -6.443  2.854   -12.418 1.00 18.56  ? 1632 LEU A CB  1 
ATOM   1044 C CG  . LEU A 1 149 ? -5.841  2.604   -13.794 1.00 19.89  ? 1632 LEU A CG  1 
ATOM   1045 C CD1 . LEU A 1 149 ? -5.367  3.890   -14.421 1.00 17.86  ? 1632 LEU A CD1 1 
ATOM   1046 C CD2 . LEU A 1 149 ? -4.655  1.647   -13.599 1.00 23.06  ? 1632 LEU A CD2 1 
ATOM   1047 N N   . THR A 1 150 ? -9.566  2.689   -12.268 1.00 16.84  ? 1633 THR A N   1 
ATOM   1048 C CA  . THR A 1 150 ? -10.833 2.288   -12.831 1.00 15.92  ? 1633 THR A CA  1 
ATOM   1049 C C   . THR A 1 150 ? -11.768 3.508   -13.019 1.00 17.19  ? 1633 THR A C   1 
ATOM   1050 O O   . THR A 1 150 ? -12.375 3.676   -14.089 1.00 17.54  ? 1633 THR A O   1 
ATOM   1051 C CB  . THR A 1 150 ? -11.482 1.197   -11.972 1.00 15.38  ? 1633 THR A CB  1 
ATOM   1052 O OG1 . THR A 1 150 ? -10.713 -0.009  -12.111 1.00 15.40  ? 1633 THR A OG1 1 
ATOM   1053 C CG2 . THR A 1 150 ? -12.942 0.952   -12.403 1.00 9.26   ? 1633 THR A CG2 1 
ATOM   1054 N N   . CYS A 1 151 ? -11.889 4.349   -12.002 1.00 14.65  ? 1634 CYS A N   1 
ATOM   1055 C CA  . CYS A 1 151 ? -12.714 5.548   -12.126 1.00 14.43  ? 1634 CYS A CA  1 
ATOM   1056 C C   . CYS A 1 151 ? -12.126 6.488   -13.227 1.00 15.87  ? 1634 CYS A C   1 
ATOM   1057 O O   . CYS A 1 151 ? -12.862 7.079   -14.040 1.00 13.76  ? 1634 CYS A O   1 
ATOM   1058 C CB  . CYS A 1 151 ? -12.780 6.272   -10.777 1.00 8.65   ? 1634 CYS A CB  1 
ATOM   1059 S SG  . CYS A 1 151 ? -13.619 5.285   -9.547  1.00 13.55  ? 1634 CYS A SG  1 
ATOM   1060 N N   . LEU A 1 152 ? -10.802 6.608   -13.248 1.00 14.36  ? 1635 LEU A N   1 
ATOM   1061 C CA  . LEU A 1 152 ? -10.140 7.425   -14.242 1.00 17.13  ? 1635 LEU A CA  1 
ATOM   1062 C C   . LEU A 1 152 ? -10.534 6.940   -15.662 1.00 20.10  ? 1635 LEU A C   1 
ATOM   1063 O O   . LEU A 1 152 ? -10.971 7.732   -16.496 1.00 24.66  ? 1635 LEU A O   1 
ATOM   1064 C CB  . LEU A 1 152 ? -8.631  7.317   -14.057 1.00 17.02  ? 1635 LEU A CB  1 
ATOM   1065 C CG  . LEU A 1 152 ? -7.890  8.625   -13.807 1.00 19.94  ? 1635 LEU A CG  1 
ATOM   1066 C CD1 . LEU A 1 152 ? -8.319  9.221   -12.495 1.00 19.23  ? 1635 LEU A CD1 1 
ATOM   1067 C CD2 . LEU A 1 152 ? -6.407  8.370   -13.796 1.00 20.34  ? 1635 LEU A CD2 1 
ATOM   1068 N N   . SER A 1 153 ? -10.407 5.640   -15.931 1.00 18.55  ? 1636 SER A N   1 
ATOM   1069 C CA  . SER A 1 153 ? -10.745 5.126   -17.247 1.00 18.81  ? 1636 SER A CA  1 
ATOM   1070 C C   . SER A 1 153 ? -12.186 5.440   -17.632 1.00 19.79  ? 1636 SER A C   1 
ATOM   1071 O O   . SER A 1 153 ? -12.553 5.338   -18.810 1.00 19.43  ? 1636 SER A O   1 
ATOM   1072 C CB  . SER A 1 153 ? -10.502 3.606   -17.334 1.00 19.79  ? 1636 SER A CB  1 
ATOM   1073 O OG  . SER A 1 153 ? -11.480 2.838   -16.639 1.00 20.48  ? 1636 SER A OG  1 
ATOM   1074 N N   . CYS A 1 154 ? -12.997 5.842   -16.658 1.00 17.37  ? 1637 CYS A N   1 
ATOM   1075 C CA  . CYS A 1 154 ? -14.388 6.137   -16.947 1.00 17.02  ? 1637 CYS A CA  1 
ATOM   1076 C C   . CYS A 1 154 ? -14.711 7.607   -16.983 1.00 15.94  ? 1637 CYS A C   1 
ATOM   1077 O O   . CYS A 1 154 ? -15.861 7.972   -17.198 1.00 15.96  ? 1637 CYS A O   1 
ATOM   1078 C CB  . CYS A 1 154 ? -15.307 5.485   -15.919 1.00 18.05  ? 1637 CYS A CB  1 
ATOM   1079 S SG  . CYS A 1 154 ? -15.579 3.724   -16.154 1.00 20.34  ? 1637 CYS A SG  1 
ATOM   1080 N N   . THR A 1 155 ? -13.708 8.446   -16.779 1.00 15.32  ? 1638 THR A N   1 
ATOM   1081 C CA  . THR A 1 155 ? -13.929 9.894   -16.736 1.00 18.19  ? 1638 THR A CA  1 
ATOM   1082 C C   . THR A 1 155 ? -13.341 10.618  -17.942 1.00 19.27  ? 1638 THR A C   1 
ATOM   1083 O O   . THR A 1 155 ? -13.968 11.476  -18.527 1.00 20.08  ? 1638 THR A O   1 
ATOM   1084 C CB  . THR A 1 155 ? -13.306 10.487  -15.468 1.00 18.41  ? 1638 THR A CB  1 
ATOM   1085 O OG1 . THR A 1 155 ? -13.686 9.675   -14.348 1.00 18.42  ? 1638 THR A OG1 1 
ATOM   1086 C CG2 . THR A 1 155 ? -13.773 11.944  -15.261 1.00 17.23  ? 1638 THR A CG2 1 
ATOM   1087 N N   . PHE A 1 156 ? -12.115 10.270  -18.283 1.00 20.18  ? 1639 PHE A N   1 
ATOM   1088 C CA  . PHE A 1 156 ? -11.440 10.839  -19.428 1.00 21.06  ? 1639 PHE A CA  1 
ATOM   1089 C C   . PHE A 1 156 ? -10.340 9.892   -19.896 1.00 21.60  ? 1639 PHE A C   1 
ATOM   1090 O O   . PHE A 1 156 ? -9.953  8.958   -19.193 1.00 22.22  ? 1639 PHE A O   1 
ATOM   1091 C CB  . PHE A 1 156 ? -10.862 12.233  -19.107 1.00 20.94  ? 1639 PHE A CB  1 
ATOM   1092 C CG  . PHE A 1 156 ? -10.064 12.295  -17.844 1.00 22.55  ? 1639 PHE A CG  1 
ATOM   1093 C CD1 . PHE A 1 156 ? -10.606 12.875  -16.691 1.00 24.26  ? 1639 PHE A CD1 1 
ATOM   1094 C CD2 . PHE A 1 156 ? -8.758  11.809  -17.801 1.00 23.17  ? 1639 PHE A CD2 1 
ATOM   1095 C CE1 . PHE A 1 156 ? -9.853  12.978  -15.508 1.00 20.27  ? 1639 PHE A CE1 1 
ATOM   1096 C CE2 . PHE A 1 156 ? -7.990  11.906  -16.616 1.00 24.53  ? 1639 PHE A CE2 1 
ATOM   1097 C CZ  . PHE A 1 156 ? -8.546  12.495  -15.471 1.00 22.02  ? 1639 PHE A CZ  1 
ATOM   1098 N N   . LEU A 1 157 ? -9.851  10.133  -21.101 1.00 22.60  ? 1640 LEU A N   1 
ATOM   1099 C CA  . LEU A 1 157 ? -8.807  9.307   -21.666 1.00 23.32  ? 1640 LEU A CA  1 
ATOM   1100 C C   . LEU A 1 157 ? -7.485  10.026  -21.718 1.00 23.44  ? 1640 LEU A C   1 
ATOM   1101 O O   . LEU A 1 157 ? -7.423  11.254  -21.720 1.00 20.44  ? 1640 LEU A O   1 
ATOM   1102 C CB  . LEU A 1 157 ? -9.145  8.903   -23.099 1.00 23.53  ? 1640 LEU A CB  1 
ATOM   1103 C CG  . LEU A 1 157 ? -10.415 8.121   -23.410 1.00 23.77  ? 1640 LEU A CG  1 
ATOM   1104 C CD1 . LEU A 1 157 ? -10.454 7.879   -24.923 1.00 20.91  ? 1640 LEU A CD1 1 
ATOM   1105 C CD2 . LEU A 1 157 ? -10.441 6.817   -22.645 1.00 21.04  ? 1640 LEU A CD2 1 
ATOM   1106 N N   . PRO A 1 158 ? -6.399  9.254   -21.748 1.00 24.14  ? 1641 PRO A N   1 
ATOM   1107 C CA  . PRO A 1 158 ? -5.074  9.852   -21.821 1.00 25.84  ? 1641 PRO A CA  1 
ATOM   1108 C C   . PRO A 1 158 ? -4.819  10.036  -23.312 1.00 27.03  ? 1641 PRO A C   1 
ATOM   1109 O O   . PRO A 1 158 ? -5.645  9.637   -24.127 1.00 26.55  ? 1641 PRO A O   1 
ATOM   1110 C CB  . PRO A 1 158 ? -4.190  8.777   -21.216 1.00 23.86  ? 1641 PRO A CB  1 
ATOM   1111 C CG  . PRO A 1 158 ? -4.862  7.532   -21.664 1.00 23.94  ? 1641 PRO A CG  1 
ATOM   1112 C CD  . PRO A 1 158 ? -6.312  7.817   -21.435 1.00 22.78  ? 1641 PRO A CD  1 
ATOM   1113 N N   . SER A 1 159 ? -3.693  10.641  -23.665 1.00 29.15  ? 1642 SER A N   1 
ATOM   1114 C CA  . SER A 1 159 ? -3.327  10.830  -25.068 1.00 27.89  ? 1642 SER A CA  1 
ATOM   1115 C C   . SER A 1 159 ? -2.987  9.462   -25.616 1.00 26.70  ? 1642 SER A C   1 
ATOM   1116 O O   . SER A 1 159 ? -2.833  8.525   -24.850 1.00 28.12  ? 1642 SER A O   1 
ATOM   1117 C CB  . SER A 1 159 ? -2.116  11.774  -25.159 1.00 27.10  ? 1642 SER A CB  1 
ATOM   1118 O OG  . SER A 1 159 ? -0.945  11.192  -24.607 1.00 27.31  ? 1642 SER A OG  1 
ATOM   1119 N N   . ARG A 1 160 ? -2.856  9.363   -26.932 1.00 26.87  ? 1643 ARG A N   1 
ATOM   1120 C CA  . ARG A 1 160 ? -2.550  8.100   -27.613 1.00 26.63  ? 1643 ARG A CA  1 
ATOM   1121 C C   . ARG A 1 160 ? -1.294  7.379   -27.133 1.00 23.74  ? 1643 ARG A C   1 
ATOM   1122 O O   . ARG A 1 160 ? -1.302  6.169   -26.962 1.00 26.34  ? 1643 ARG A O   1 
ATOM   1123 C CB  . ARG A 1 160 ? -2.468  8.341   -29.131 1.00 29.33  ? 1643 ARG A CB  1 
ATOM   1124 C CG  . ARG A 1 160 ? -3.816  8.629   -29.744 1.00 30.27  ? 1643 ARG A CG  1 
ATOM   1125 C CD  . ARG A 1 160 ? -3.694  9.074   -31.151 1.00 35.12  ? 1643 ARG A CD  1 
ATOM   1126 N NE  . ARG A 1 160 ? -4.994  9.390   -31.749 1.00 39.11  ? 1643 ARG A NE  1 
ATOM   1127 C CZ  . ARG A 1 160 ? -5.122  10.025  -32.912 1.00 41.49  ? 1643 ARG A CZ  1 
ATOM   1128 N NH1 . ARG A 1 160 ? -4.036  10.399  -33.578 1.00 42.73  ? 1643 ARG A NH1 1 
ATOM   1129 N NH2 . ARG A 1 160 ? -6.322  10.289  -33.415 1.00 44.87  ? 1643 ARG A NH2 1 
ATOM   1130 N N   . GLY A 1 161 ? -0.222  8.119   -26.910 1.00 21.22  ? 1644 GLY A N   1 
ATOM   1131 C CA  . GLY A 1 161 ? 0.999   7.502   -26.446 1.00 18.35  ? 1644 GLY A CA  1 
ATOM   1132 C C   . GLY A 1 161 ? 0.824   6.845   -25.088 1.00 21.75  ? 1644 GLY A C   1 
ATOM   1133 O O   . GLY A 1 161 ? 1.184   5.674   -24.909 1.00 22.41  ? 1644 GLY A O   1 
ATOM   1134 N N   . ILE A 1 162 ? 0.259   7.576   -24.129 1.00 20.45  ? 1645 ILE A N   1 
ATOM   1135 C CA  . ILE A 1 162 ? 0.075   7.036   -22.788 1.00 23.03  ? 1645 ILE A CA  1 
ATOM   1136 C C   . ILE A 1 162 ? -1.012  5.969   -22.764 1.00 23.81  ? 1645 ILE A C   1 
ATOM   1137 O O   . ILE A 1 162 ? -0.931  5.027   -21.963 1.00 23.91  ? 1645 ILE A O   1 
ATOM   1138 C CB  . ILE A 1 162 ? -0.237  8.171   -21.762 1.00 22.01  ? 1645 ILE A CB  1 
ATOM   1139 C CG1 . ILE A 1 162 ? 0.984   9.048   -21.621 1.00 23.16  ? 1645 ILE A CG1 1 
ATOM   1140 C CG2 . ILE A 1 162 ? -0.592  7.633   -20.426 1.00 15.54  ? 1645 ILE A CG2 1 
ATOM   1141 C CD1 . ILE A 1 162 ? 1.128   9.970   -22.769 1.00 26.43  ? 1645 ILE A CD1 1 
ATOM   1142 N N   . LEU A 1 163 ? -2.008  6.112   -23.643 1.00 23.68  ? 1646 LEU A N   1 
ATOM   1143 C CA  . LEU A 1 163 ? -3.098  5.141   -23.735 1.00 26.11  ? 1646 LEU A CA  1 
ATOM   1144 C C   . LEU A 1 163 ? -2.485  3.810   -24.170 1.00 27.63  ? 1646 LEU A C   1 
ATOM   1145 O O   . LEU A 1 163 ? -2.939  2.737   -23.774 1.00 29.42  ? 1646 LEU A O   1 
ATOM   1146 C CB  . LEU A 1 163 ? -4.152  5.586   -24.756 1.00 23.72  ? 1646 LEU A CB  1 
ATOM   1147 C CG  . LEU A 1 163 ? -5.304  4.580   -24.952 1.00 26.25  ? 1646 LEU A CG  1 
ATOM   1148 C CD1 . LEU A 1 163 ? -6.042  4.324   -23.625 1.00 22.05  ? 1646 LEU A CD1 1 
ATOM   1149 C CD2 . LEU A 1 163 ? -6.274  5.110   -26.024 1.00 20.99  ? 1646 LEU A CD2 1 
ATOM   1150 N N   . LYS A 1 164 ? -1.441  3.890   -24.987 1.00 28.41  ? 1647 LYS A N   1 
ATOM   1151 C CA  . LYS A 1 164 ? -0.736  2.696   -25.447 1.00 29.65  ? 1647 LYS A CA  1 
ATOM   1152 C C   . LYS A 1 164 ? 0.042   2.050   -24.315 1.00 28.98  ? 1647 LYS A C   1 
ATOM   1153 O O   . LYS A 1 164 ? 0.030   0.817   -24.141 1.00 28.02  ? 1647 LYS A O   1 
ATOM   1154 C CB  . LYS A 1 164 ? 0.271   3.054   -26.509 1.00 31.70  ? 1647 LYS A CB  1 
ATOM   1155 C CG  . LYS A 1 164 ? -0.066  2.589   -27.868 1.00 37.15  ? 1647 LYS A CG  1 
ATOM   1156 C CD  . LYS A 1 164 ? 1.100   2.952   -28.763 1.00 46.22  ? 1647 LYS A CD  1 
ATOM   1157 C CE  . LYS A 1 164 ? 2.287   1.943   -28.614 1.00 48.12  ? 1647 LYS A CE  1 
ATOM   1158 N NZ  . LYS A 1 164 ? 2.643   1.661   -27.176 1.00 52.66  ? 1647 LYS A NZ  1 
ATOM   1159 N N   . TYR A 1 165 ? 0.752   2.903   -23.576 1.00 25.44  ? 1648 TYR A N   1 
ATOM   1160 C CA  . TYR A 1 165 ? 1.550   2.451   -22.464 1.00 23.47  ? 1648 TYR A CA  1 
ATOM   1161 C C   . TYR A 1 165 ? 0.626   1.792   -21.435 1.00 21.32  ? 1648 TYR A C   1 
ATOM   1162 O O   . TYR A 1 165 ? 0.938   0.719   -20.916 1.00 20.29  ? 1648 TYR A O   1 
ATOM   1163 C CB  . TYR A 1 165 ? 2.317   3.635   -21.846 1.00 23.18  ? 1648 TYR A CB  1 
ATOM   1164 C CG  . TYR A 1 165 ? 3.272   3.228   -20.750 1.00 22.74  ? 1648 TYR A CG  1 
ATOM   1165 C CD1 . TYR A 1 165 ? 4.191   2.190   -20.953 1.00 23.61  ? 1648 TYR A CD1 1 
ATOM   1166 C CD2 . TYR A 1 165 ? 3.237   3.838   -19.497 1.00 21.49  ? 1648 TYR A CD2 1 
ATOM   1167 C CE1 . TYR A 1 165 ? 5.040   1.759   -19.936 1.00 21.11  ? 1648 TYR A CE1 1 
ATOM   1168 C CE2 . TYR A 1 165 ? 4.092   3.416   -18.471 1.00 20.46  ? 1648 TYR A CE2 1 
ATOM   1169 C CZ  . TYR A 1 165 ? 4.982   2.367   -18.702 1.00 19.14  ? 1648 TYR A CZ  1 
ATOM   1170 O OH  . TYR A 1 165 ? 5.755   1.859   -17.693 1.00 17.24  ? 1648 TYR A OH  1 
ATOM   1171 N N   . LEU A 1 166 ? -0.502  2.440   -21.155 1.00 19.39  ? 1649 LEU A N   1 
ATOM   1172 C CA  . LEU A 1 166 ? -1.479  1.926   -20.193 1.00 21.17  ? 1649 LEU A CA  1 
ATOM   1173 C C   . LEU A 1 166 ? -1.986  0.527   -20.586 1.00 21.67  ? 1649 LEU A C   1 
ATOM   1174 O O   . LEU A 1 166 ? -2.017  -0.391  -19.750 1.00 20.26  ? 1649 LEU A O   1 
ATOM   1175 C CB  . LEU A 1 166 ? -2.689  2.879   -20.072 1.00 20.55  ? 1649 LEU A CB  1 
ATOM   1176 C CG  . LEU A 1 166 ? -3.915  2.421   -19.241 1.00 20.64  ? 1649 LEU A CG  1 
ATOM   1177 C CD1 . LEU A 1 166 ? -3.505  2.176   -17.792 1.00 18.37  ? 1649 LEU A CD1 1 
ATOM   1178 C CD2 . LEU A 1 166 ? -5.029  3.478   -19.312 1.00 18.26  ? 1649 LEU A CD2 1 
ATOM   1179 N N   . LYS A 1 167 ? -2.403  0.374   -21.841 1.00 19.97  ? 1650 LYS A N   1 
ATOM   1180 C CA  . LYS A 1 167 ? -2.899  -0.911  -22.293 1.00 20.82  ? 1650 LYS A CA  1 
ATOM   1181 C C   . LYS A 1 167 ? -1.777  -1.950  -22.200 1.00 20.08  ? 1650 LYS A C   1 
ATOM   1182 O O   . LYS A 1 167 ? -2.019  -3.106  -21.902 1.00 19.17  ? 1650 LYS A O   1 
ATOM   1183 C CB  . LYS A 1 167 ? -3.435  -0.792  -23.722 1.00 22.50  ? 1650 LYS A CB  1 
ATOM   1184 C CG  . LYS A 1 167 ? -4.756  -0.024  -23.851 1.00 22.59  ? 1650 LYS A CG  1 
ATOM   1185 C CD  . LYS A 1 167 ? -5.092  0.216   -25.324 1.00 26.23  ? 1650 LYS A CD  1 
ATOM   1186 C CE  . LYS A 1 167 ? -6.513  0.750   -25.539 1.00 31.23  ? 1650 LYS A CE  1 
ATOM   1187 N NZ  . LYS A 1 167 ? -6.818  0.984   -27.004 1.00 35.57  ? 1650 LYS A NZ  1 
ATOM   1188 N N   . PHE A 1 168 ? -0.543  -1.515  -22.426 1.00 20.24  ? 1651 PHE A N   1 
ATOM   1189 C CA  . PHE A 1 168 ? 0.604   -2.401  -22.352 1.00 19.85  ? 1651 PHE A CA  1 
ATOM   1190 C C   . PHE A 1 168 ? 0.687   -2.944  -20.931 1.00 21.57  ? 1651 PHE A C   1 
ATOM   1191 O O   . PHE A 1 168 ? 0.892   -4.143  -20.715 1.00 22.32  ? 1651 PHE A O   1 
ATOM   1192 C CB  . PHE A 1 168 ? 1.856   -1.610  -22.693 1.00 18.28  ? 1651 PHE A CB  1 
ATOM   1193 C CG  . PHE A 1 168 ? 3.143   -2.338  -22.414 1.00 18.02  ? 1651 PHE A CG  1 
ATOM   1194 C CD1 . PHE A 1 168 ? 3.639   -3.281  -23.318 1.00 16.54  ? 1651 PHE A CD1 1 
ATOM   1195 C CD2 . PHE A 1 168 ? 3.911   -2.006  -21.297 1.00 17.25  ? 1651 PHE A CD2 1 
ATOM   1196 C CE1 . PHE A 1 168 ? 4.883   -3.867  -23.123 1.00 17.63  ? 1651 PHE A CE1 1 
ATOM   1197 C CE2 . PHE A 1 168 ? 5.160   -2.583  -21.082 1.00 18.70  ? 1651 PHE A CE2 1 
ATOM   1198 C CZ  . PHE A 1 168 ? 5.656   -3.511  -21.991 1.00 20.69  ? 1651 PHE A CZ  1 
ATOM   1199 N N   . HIS A 1 169 ? 0.517   -2.026  -19.976 1.00 22.15  ? 1652 HIS A N   1 
ATOM   1200 C CA  . HIS A 1 169 ? 0.537   -2.299  -18.528 1.00 20.67  ? 1652 HIS A CA  1 
ATOM   1201 C C   . HIS A 1 169 ? -0.618  -3.188  -18.046 1.00 19.20  ? 1652 HIS A C   1 
ATOM   1202 O O   . HIS A 1 169 ? -0.422  -4.119  -17.264 1.00 18.25  ? 1652 HIS A O   1 
ATOM   1203 C CB  . HIS A 1 169 ? 0.463   -0.983  -17.748 1.00 18.84  ? 1652 HIS A CB  1 
ATOM   1204 C CG  . HIS A 1 169 ? 0.661   -1.141  -16.275 1.00 15.94  ? 1652 HIS A CG  1 
ATOM   1205 N ND1 . HIS A 1 169 ? 1.828   -1.637  -15.732 1.00 15.13  ? 1652 HIS A ND1 1 
ATOM   1206 C CD2 . HIS A 1 169 ? -0.145  -0.851  -15.229 1.00 13.81  ? 1652 HIS A CD2 1 
ATOM   1207 C CE1 . HIS A 1 169 ? 1.733   -1.644  -14.415 1.00 12.36  ? 1652 HIS A CE1 1 
ATOM   1208 N NE2 . HIS A 1 169 ? 0.548   -1.170  -14.083 1.00 10.80  ? 1652 HIS A NE2 1 
ATOM   1209 N N   . LEU A 1 170 ? -1.828  -2.879  -18.489 1.00 18.15  ? 1653 LEU A N   1 
ATOM   1210 C CA  . LEU A 1 170 ? -2.998  -3.650  -18.091 1.00 18.08  ? 1653 LEU A CA  1 
ATOM   1211 C C   . LEU A 1 170 ? -2.861  -5.097  -18.546 1.00 20.25  ? 1653 LEU A C   1 
ATOM   1212 O O   . LEU A 1 170 ? -3.089  -6.029  -17.777 1.00 22.16  ? 1653 LEU A O   1 
ATOM   1213 C CB  . LEU A 1 170 ? -4.262  -3.035  -18.689 1.00 15.70  ? 1653 LEU A CB  1 
ATOM   1214 C CG  . LEU A 1 170 ? -4.512  -1.609  -18.224 1.00 13.13  ? 1653 LEU A CG  1 
ATOM   1215 C CD1 . LEU A 1 170 ? -5.709  -1.058  -18.954 1.00 11.08  ? 1653 LEU A CD1 1 
ATOM   1216 C CD2 . LEU A 1 170 ? -4.703  -1.596  -16.702 1.00 10.17  ? 1653 LEU A CD2 1 
ATOM   1217 N N   . LYS A 1 171 ? -2.479  -5.294  -19.797 1.00 21.22  ? 1654 LYS A N   1 
ATOM   1218 C CA  . LYS A 1 171 ? -2.314  -6.641  -20.286 1.00 23.15  ? 1654 LYS A CA  1 
ATOM   1219 C C   . LYS A 1 171 ? -1.265  -7.410  -19.444 1.00 22.84  ? 1654 LYS A C   1 
ATOM   1220 O O   . LYS A 1 171 ? -1.475  -8.585  -19.096 1.00 22.09  ? 1654 LYS A O   1 
ATOM   1221 C CB  . LYS A 1 171 ? -1.919  -6.611  -21.765 1.00 25.51  ? 1654 LYS A CB  1 
ATOM   1222 C CG  . LYS A 1 171 ? -1.569  -7.986  -22.314 1.00 32.00  ? 1654 LYS A CG  1 
ATOM   1223 C CD  . LYS A 1 171 ? -1.337  -7.947  -23.815 1.00 37.79  ? 1654 LYS A CD  1 
ATOM   1224 C CE  . LYS A 1 171 ? -1.358  -9.365  -24.403 1.00 40.86  ? 1654 LYS A CE  1 
ATOM   1225 N NZ  . LYS A 1 171 ? -1.535  -9.359  -25.881 1.00 41.14  ? 1654 LYS A NZ  1 
ATOM   1226 N N   . ARG A 1 172 ? -0.145  -6.758  -19.122 1.00 20.45  ? 1655 ARG A N   1 
ATOM   1227 C CA  . ARG A 1 172 ? 0.901   -7.391  -18.315 1.00 19.17  ? 1655 ARG A CA  1 
ATOM   1228 C C   . ARG A 1 172 ? 0.425   -7.725  -16.880 1.00 18.77  ? 1655 ARG A C   1 
ATOM   1229 O O   . ARG A 1 172 ? 0.864   -8.697  -16.265 1.00 18.64  ? 1655 ARG A O   1 
ATOM   1230 C CB  . ARG A 1 172 ? 2.133   -6.488  -18.246 1.00 18.86  ? 1655 ARG A CB  1 
ATOM   1231 C CG  . ARG A 1 172 ? 2.930   -6.407  -19.541 1.00 19.05  ? 1655 ARG A CG  1 
ATOM   1232 C CD  . ARG A 1 172 ? 3.908   -5.222  -19.555 1.00 22.13  ? 1655 ARG A CD  1 
ATOM   1233 N NE  . ARG A 1 172 ? 4.739   -5.157  -18.353 1.00 22.27  ? 1655 ARG A NE  1 
ATOM   1234 C CZ  . ARG A 1 172 ? 5.768   -5.958  -18.101 1.00 25.66  ? 1655 ARG A CZ  1 
ATOM   1235 N NH1 . ARG A 1 172 ? 6.111   -6.894  -18.981 1.00 25.69  ? 1655 ARG A NH1 1 
ATOM   1236 N NH2 . ARG A 1 172 ? 6.434   -5.843  -16.955 1.00 24.44  ? 1655 ARG A NH2 1 
ATOM   1237 N N   . ILE A 1 173 ? -0.488  -6.923  -16.356 1.00 18.15  ? 1656 ILE A N   1 
ATOM   1238 C CA  . ILE A 1 173 ? -0.981  -7.132  -15.013 1.00 15.93  ? 1656 ILE A CA  1 
ATOM   1239 C C   . ILE A 1 173 ? -1.873  -8.347  -15.016 1.00 20.02  ? 1656 ILE A C   1 
ATOM   1240 O O   . ILE A 1 173 ? -1.800  -9.204  -14.124 1.00 21.29  ? 1656 ILE A O   1 
ATOM   1241 C CB  . ILE A 1 173 ? -1.749  -5.849  -14.510 1.00 14.51  ? 1656 ILE A CB  1 
ATOM   1242 C CG1 . ILE A 1 173 ? -0.728  -4.726  -14.245 1.00 12.49  ? 1656 ILE A CG1 1 
ATOM   1243 C CG2 . ILE A 1 173 ? -2.585  -6.141  -13.234 1.00 5.46   ? 1656 ILE A CG2 1 
ATOM   1244 C CD1 . ILE A 1 173 ? 0.155   -4.952  -12.979 1.00 9.38   ? 1656 ILE A CD1 1 
ATOM   1245 N N   . ARG A 1 174 ? -2.714  -8.447  -16.030 1.00 22.33  ? 1657 ARG A N   1 
ATOM   1246 C CA  . ARG A 1 174 ? -3.603  -9.586  -16.110 1.00 27.17  ? 1657 ARG A CA  1 
ATOM   1247 C C   . ARG A 1 174 ? -2.838  -10.896 -16.247 1.00 27.84  ? 1657 ARG A C   1 
ATOM   1248 O O   . ARG A 1 174 ? -3.239  -11.912 -15.709 1.00 30.44  ? 1657 ARG A O   1 
ATOM   1249 C CB  . ARG A 1 174 ? -4.574  -9.414  -17.277 1.00 28.41  ? 1657 ARG A CB  1 
ATOM   1250 C CG  . ARG A 1 174 ? -5.488  -8.220  -17.119 1.00 27.88  ? 1657 ARG A CG  1 
ATOM   1251 C CD  . ARG A 1 174 ? -6.577  -8.253  -18.144 1.00 27.98  ? 1657 ARG A CD  1 
ATOM   1252 N NE  . ARG A 1 174 ? -7.495  -9.359  -17.903 1.00 30.05  ? 1657 ARG A NE  1 
ATOM   1253 C CZ  . ARG A 1 174 ? -8.203  -9.956  -18.864 1.00 30.71  ? 1657 ARG A CZ  1 
ATOM   1254 N NH1 . ARG A 1 174 ? -8.091  -9.544  -20.124 1.00 31.07  ? 1657 ARG A NH1 1 
ATOM   1255 N NH2 . ARG A 1 174 ? -8.990  -10.981 -18.573 1.00 28.69  ? 1657 ARG A NH2 1 
ATOM   1256 N N   . GLU A 1 175 ? -1.725  -10.869 -16.961 1.00 30.00  ? 1658 GLU A N   1 
ATOM   1257 C CA  . GLU A 1 175 ? -0.930  -12.076 -17.149 1.00 30.85  ? 1658 GLU A CA  1 
ATOM   1258 C C   . GLU A 1 175 ? -0.180  -12.500 -15.899 1.00 31.83  ? 1658 GLU A C   1 
ATOM   1259 O O   . GLU A 1 175 ? -0.116  -13.684 -15.587 1.00 33.11  ? 1658 GLU A O   1 
ATOM   1260 C CB  . GLU A 1 175 ? 0.054   -11.873 -18.302 1.00 30.98  ? 1658 GLU A CB  1 
ATOM   1261 C CG  . GLU A 1 175 ? -0.640  -11.593 -19.620 1.00 33.14  ? 1658 GLU A CG  1 
ATOM   1262 C CD  . GLU A 1 175 ? 0.316   -11.219 -20.733 1.00 35.91  ? 1658 GLU A CD  1 
ATOM   1263 O OE1 . GLU A 1 175 ? 1.395   -10.639 -20.446 1.00 38.08  ? 1658 GLU A OE1 1 
ATOM   1264 O OE2 . GLU A 1 175 ? -0.029  -11.486 -21.905 1.00 36.58  ? 1658 GLU A OE2 1 
ATOM   1265 N N   . GLN A 1 176 ? 0.378   -11.525 -15.180 1.00 31.78  ? 1659 GLN A N   1 
ATOM   1266 C CA  . GLN A 1 176 ? 1.147   -11.801 -13.976 1.00 30.52  ? 1659 GLN A CA  1 
ATOM   1267 C C   . GLN A 1 176 ? 0.323   -11.964 -12.696 1.00 28.21  ? 1659 GLN A C   1 
ATOM   1268 O O   . GLN A 1 176 ? 0.771   -12.601 -11.756 1.00 25.42  ? 1659 GLN A O   1 
ATOM   1269 C CB  . GLN A 1 176 ? 2.204   -10.710 -13.786 1.00 33.89  ? 1659 GLN A CB  1 
ATOM   1270 C CG  . GLN A 1 176 ? 3.476   -10.901 -14.612 1.00 41.62  ? 1659 GLN A CG  1 
ATOM   1271 C CD  . GLN A 1 176 ? 4.365   -9.639  -14.674 1.00 46.90  ? 1659 GLN A CD  1 
ATOM   1272 O OE1 . GLN A 1 176 ? 4.580   -8.940  -13.662 1.00 47.11  ? 1659 GLN A OE1 1 
ATOM   1273 N NE2 . GLN A 1 176 ? 4.886   -9.349  -15.871 1.00 45.93  ? 1659 GLN A NE2 1 
ATOM   1274 N N   . PHE A 1 177 ? -0.879  -11.386 -12.651 1.00 26.40  ? 1660 PHE A N   1 
ATOM   1275 C CA  . PHE A 1 177 ? -1.705  -11.495 -11.455 1.00 22.57  ? 1660 PHE A CA  1 
ATOM   1276 C C   . PHE A 1 177 ? -3.082  -12.060 -11.741 1.00 24.15  ? 1660 PHE A C   1 
ATOM   1277 O O   . PHE A 1 177 ? -4.097  -11.449 -11.398 1.00 26.87  ? 1660 PHE A O   1 
ATOM   1278 C CB  . PHE A 1 177 ? -1.836  -10.125 -10.760 1.00 20.06  ? 1660 PHE A CB  1 
ATOM   1279 C CG  . PHE A 1 177 ? -0.523  -9.579  -10.250 1.00 14.98  ? 1660 PHE A CG  1 
ATOM   1280 C CD1 . PHE A 1 177 ? 0.002   -10.029 -9.054  1.00 10.57  ? 1660 PHE A CD1 1 
ATOM   1281 C CD2 . PHE A 1 177 ? 0.241   -8.717  -11.041 1.00 11.91  ? 1660 PHE A CD2 1 
ATOM   1282 C CE1 . PHE A 1 177 ? 1.300   -9.637  -8.638  1.00 11.06  ? 1660 PHE A CE1 1 
ATOM   1283 C CE2 . PHE A 1 177 ? 1.539   -8.324  -10.635 1.00 14.72  ? 1660 PHE A CE2 1 
ATOM   1284 C CZ  . PHE A 1 177 ? 2.066   -8.797  -9.427  1.00 9.71   ? 1660 PHE A CZ  1 
ATOM   1285 N N   . PRO A 1 178 ? -3.149  -13.248 -12.354 1.00 24.97  ? 1661 PRO A N   1 
ATOM   1286 C CA  . PRO A 1 178 ? -4.489  -13.792 -12.628 1.00 25.31  ? 1661 PRO A CA  1 
ATOM   1287 C C   . PRO A 1 178 ? -5.286  -14.168 -11.370 1.00 26.11  ? 1661 PRO A C   1 
ATOM   1288 O O   . PRO A 1 178 ? -4.716  -14.486 -10.317 1.00 27.96  ? 1661 PRO A O   1 
ATOM   1289 C CB  . PRO A 1 178 ? -4.205  -14.982 -13.542 1.00 25.11  ? 1661 PRO A CB  1 
ATOM   1290 C CG  . PRO A 1 178 ? -2.808  -15.443 -13.079 1.00 25.99  ? 1661 PRO A CG  1 
ATOM   1291 C CD  . PRO A 1 178 ? -2.072  -14.150 -12.817 1.00 24.47  ? 1661 PRO A CD  1 
ATOM   1292 N N   . GLY A 1 179 ? -6.605  -14.106 -11.482 1.00 26.41  ? 1662 GLY A N   1 
ATOM   1293 C CA  . GLY A 1 179 ? -7.455  -14.443 -10.357 1.00 28.47  ? 1662 GLY A CA  1 
ATOM   1294 C C   . GLY A 1 179 ? -7.450  -13.441 -9.206  1.00 29.08  ? 1662 GLY A C   1 
ATOM   1295 O O   . GLY A 1 179 ? -7.899  -13.742 -8.105  1.00 33.22  ? 1662 GLY A O   1 
ATOM   1296 N N   . THR A 1 180 ? -6.964  -12.234 -9.447  1.00 27.77  ? 1663 THR A N   1 
ATOM   1297 C CA  . THR A 1 180 ? -6.924  -11.229 -8.389  1.00 23.68  ? 1663 THR A CA  1 
ATOM   1298 C C   . THR A 1 180 ? -7.837  -10.036 -8.663  1.00 22.10  ? 1663 THR A C   1 
ATOM   1299 O O   . THR A 1 180 ? -8.315  -9.830  -9.783  1.00 19.85  ? 1663 THR A O   1 
ATOM   1300 C CB  . THR A 1 180 ? -5.529  -10.654 -8.229  1.00 22.29  ? 1663 THR A CB  1 
ATOM   1301 O OG1 . THR A 1 180 ? -5.214  -9.914  -9.417  1.00 21.41  ? 1663 THR A OG1 1 
ATOM   1302 C CG2 . THR A 1 180 ? -4.493  -11.762 -7.983  1.00 18.72  ? 1663 THR A CG2 1 
ATOM   1303 N N   . GLU A 1 181 ? -8.071  -9.247  -7.618  1.00 21.21  ? 1664 GLU A N   1 
ATOM   1304 C CA  . GLU A 1 181 ? -8.873  -8.041  -7.753  1.00 18.63  ? 1664 GLU A CA  1 
ATOM   1305 C C   . GLU A 1 181 ? -8.210  -7.118  -8.791  1.00 18.11  ? 1664 GLU A C   1 
ATOM   1306 O O   . GLU A 1 181 ? -8.915  -6.537  -9.630  1.00 15.92  ? 1664 GLU A O   1 
ATOM   1307 C CB  . GLU A 1 181 ? -8.992  -7.310  -6.412  1.00 16.63  ? 1664 GLU A CB  1 
ATOM   1308 C CG  . GLU A 1 181 ? -10.048 -7.904  -5.506  1.00 18.45  ? 1664 GLU A CG  1 
ATOM   1309 C CD  . GLU A 1 181 ? -11.472 -7.791  -6.079  1.00 21.83  ? 1664 GLU A CD  1 
ATOM   1310 O OE1 . GLU A 1 181 ? -12.052 -6.685  -6.101  1.00 19.12  ? 1664 GLU A OE1 1 
ATOM   1311 O OE2 . GLU A 1 181 ? -12.012 -8.825  -6.517  1.00 26.43  ? 1664 GLU A OE2 1 
ATOM   1312 N N   . MET A 1 182 ? -6.871  -7.014  -8.754  1.00 14.61  ? 1665 MET A N   1 
ATOM   1313 C CA  . MET A 1 182 ? -6.173  -6.158  -9.692  1.00 16.49  ? 1665 MET A CA  1 
ATOM   1314 C C   . MET A 1 182 ? -6.455  -6.581  -11.156 1.00 19.25  ? 1665 MET A C   1 
ATOM   1315 O O   . MET A 1 182 ? -6.768  -5.747  -12.015 1.00 19.77  ? 1665 MET A O   1 
ATOM   1316 C CB  . MET A 1 182 ? -4.666  -6.163  -9.417  1.00 14.96  ? 1665 MET A CB  1 
ATOM   1317 C CG  . MET A 1 182 ? -4.272  -5.850  -7.995  1.00 16.82  ? 1665 MET A CG  1 
ATOM   1318 S SD  . MET A 1 182 ? -4.569  -7.201  -6.786  1.00 20.21  ? 1665 MET A SD  1 
ATOM   1319 C CE  . MET A 1 182 ? -3.098  -8.178  -7.153  1.00 11.03  ? 1665 MET A CE  1 
ATOM   1320 N N   . GLU A 1 183 ? -6.356  -7.876  -11.438 1.00 21.05  ? 1666 GLU A N   1 
ATOM   1321 C CA  . GLU A 1 183 ? -6.599  -8.363  -12.786 1.00 20.68  ? 1666 GLU A CA  1 
ATOM   1322 C C   . GLU A 1 183 ? -7.992  -7.956  -13.221 1.00 20.06  ? 1666 GLU A C   1 
ATOM   1323 O O   . GLU A 1 183 ? -8.182  -7.489  -14.338 1.00 20.85  ? 1666 GLU A O   1 
ATOM   1324 C CB  . GLU A 1 183 ? -6.438  -9.888  -12.831 1.00 23.07  ? 1666 GLU A CB  1 
ATOM   1325 C CG  . GLU A 1 183 ? -6.664  -10.564 -14.203 1.00 25.96  ? 1666 GLU A CG  1 
ATOM   1326 C CD  . GLU A 1 183 ? -8.152  -10.767 -14.564 1.00 27.65  ? 1666 GLU A CD  1 
ATOM   1327 O OE1 . GLU A 1 183 ? -8.966  -11.061 -13.653 1.00 29.65  ? 1666 GLU A OE1 1 
ATOM   1328 O OE2 . GLU A 1 183 ? -8.489  -10.660 -15.771 1.00 23.72  ? 1666 GLU A OE2 1 
ATOM   1329 N N   . LYS A 1 184 ? -8.962  -8.106  -12.327 1.00 19.80  ? 1667 LYS A N   1 
ATOM   1330 C CA  . LYS A 1 184 ? -10.341 -7.761  -12.641 1.00 20.02  ? 1667 LYS A CA  1 
ATOM   1331 C C   . LYS A 1 184 ? -10.554 -6.264  -12.887 1.00 18.39  ? 1667 LYS A C   1 
ATOM   1332 O O   . LYS A 1 184 ? -11.274 -5.884  -13.830 1.00 18.71  ? 1667 LYS A O   1 
ATOM   1333 C CB  . LYS A 1 184 ? -11.260 -8.286  -11.547 1.00 22.54  ? 1667 LYS A CB  1 
ATOM   1334 C CG  . LYS A 1 184 ? -11.411 -9.800  -11.591 1.00 27.12  ? 1667 LYS A CG  1 
ATOM   1335 C CD  . LYS A 1 184 ? -12.149 -10.368 -10.377 1.00 29.64  ? 1667 LYS A CD  1 
ATOM   1336 C CE  . LYS A 1 184 ? -12.101 -11.875 -10.423 1.00 31.49  ? 1667 LYS A CE  1 
ATOM   1337 N NZ  . LYS A 1 184 ? -10.775 -12.338 -10.988 1.00 36.10  ? 1667 LYS A NZ  1 
ATOM   1338 N N   . TYR A 1 185 ? -9.928  -5.431  -12.052 1.00 16.72  ? 1668 TYR A N   1 
ATOM   1339 C CA  . TYR A 1 185 ? -9.975  -3.981  -12.205 1.00 14.65  ? 1668 TYR A CA  1 
ATOM   1340 C C   . TYR A 1 185 ? -9.292  -3.627  -13.542 1.00 15.07  ? 1668 TYR A C   1 
ATOM   1341 O O   . TYR A 1 185 ? -9.757  -2.751  -14.280 1.00 13.62  ? 1668 TYR A O   1 
ATOM   1342 C CB  . TYR A 1 185 ? -9.238  -3.275  -11.053 1.00 14.10  ? 1668 TYR A CB  1 
ATOM   1343 C CG  . TYR A 1 185 ? -10.067 -3.127  -9.799  1.00 13.97  ? 1668 TYR A CG  1 
ATOM   1344 C CD1 . TYR A 1 185 ? -11.312 -2.479  -9.831  1.00 11.46  ? 1668 TYR A CD1 1 
ATOM   1345 C CD2 . TYR A 1 185 ? -9.599  -3.598  -8.572  1.00 13.09  ? 1668 TYR A CD2 1 
ATOM   1346 C CE1 . TYR A 1 185 ? -12.049 -2.303  -8.693  1.00 11.26  ? 1668 TYR A CE1 1 
ATOM   1347 C CE2 . TYR A 1 185 ? -10.337 -3.437  -7.418  1.00 14.53  ? 1668 TYR A CE2 1 
ATOM   1348 C CZ  . TYR A 1 185 ? -11.569 -2.789  -7.477  1.00 15.41  ? 1668 TYR A CZ  1 
ATOM   1349 O OH  . TYR A 1 185 ? -12.340 -2.685  -6.323  1.00 16.59  ? 1668 TYR A OH  1 
ATOM   1350 N N   . ALA A 1 186 ? -8.190  -4.306  -13.851 1.00 15.06  ? 1669 ALA A N   1 
ATOM   1351 C CA  . ALA A 1 186 ? -7.496  -4.054  -15.115 1.00 17.53  ? 1669 ALA A CA  1 
ATOM   1352 C C   . ALA A 1 186 ? -8.399  -4.359  -16.326 1.00 19.15  ? 1669 ALA A C   1 
ATOM   1353 O O   . ALA A 1 186 ? -8.388  -3.623  -17.326 1.00 20.89  ? 1669 ALA A O   1 
ATOM   1354 C CB  . ALA A 1 186 ? -6.208  -4.871  -15.194 1.00 15.07  ? 1669 ALA A CB  1 
ATOM   1355 N N   . LEU A 1 187 ? -9.200  -5.419  -16.232 1.00 18.30  ? 1670 LEU A N   1 
ATOM   1356 C CA  . LEU A 1 187 ? -10.090 -5.767  -17.331 1.00 18.04  ? 1670 LEU A CA  1 
ATOM   1357 C C   . LEU A 1 187 ? -11.174 -4.710  -17.461 1.00 16.96  ? 1670 LEU A C   1 
ATOM   1358 O O   . LEU A 1 187 ? -11.445 -4.214  -18.550 1.00 13.83  ? 1670 LEU A O   1 
ATOM   1359 C CB  . LEU A 1 187 ? -10.741 -7.129  -17.086 1.00 19.26  ? 1670 LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 187 ? -11.664 -7.566  -18.229 1.00 20.37  ? 1670 LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 187 ? -10.863 -7.736  -19.533 1.00 19.07  ? 1670 LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 187 ? -12.330 -8.850  -17.850 1.00 16.41  ? 1670 LEU A CD2 1 
ATOM   1363 N N   . PHE A 1 188 ? -11.774 -4.356  -16.329 1.00 16.53  ? 1671 PHE A N   1 
ATOM   1364 C CA  . PHE A 1 188 ? -12.834 -3.345  -16.324 1.00 18.18  ? 1671 PHE A CA  1 
ATOM   1365 C C   . PHE A 1 188 ? -12.300 -2.013  -16.909 1.00 19.05  ? 1671 PHE A C   1 
ATOM   1366 O O   . PHE A 1 188 ? -12.921 -1.401  -17.803 1.00 16.55  ? 1671 PHE A O   1 
ATOM   1367 C CB  . PHE A 1 188 ? -13.346 -3.147  -14.886 1.00 15.03  ? 1671 PHE A CB  1 
ATOM   1368 C CG  . PHE A 1 188 ? -14.655 -2.405  -14.797 1.00 14.62  ? 1671 PHE A CG  1 
ATOM   1369 C CD1 . PHE A 1 188 ? -14.692 -1.008  -14.845 1.00 17.44  ? 1671 PHE A CD1 1 
ATOM   1370 C CD2 . PHE A 1 188 ? -15.850 -3.099  -14.634 1.00 14.55  ? 1671 PHE A CD2 1 
ATOM   1371 C CE1 . PHE A 1 188 ? -15.901 -0.302  -14.728 1.00 17.21  ? 1671 PHE A CE1 1 
ATOM   1372 C CE2 . PHE A 1 188 ? -17.067 -2.419  -14.515 1.00 17.01  ? 1671 PHE A CE2 1 
ATOM   1373 C CZ  . PHE A 1 188 ? -17.093 -1.007  -14.562 1.00 18.64  ? 1671 PHE A CZ  1 
ATOM   1374 N N   . THR A 1 189 ? -11.153 -1.573  -16.387 1.00 17.84  ? 1672 THR A N   1 
ATOM   1375 C CA  . THR A 1 189 ? -10.527 -0.355  -16.843 1.00 17.65  ? 1672 THR A CA  1 
ATOM   1376 C C   . THR A 1 189 ? -10.324 -0.468  -18.348 1.00 20.80  ? 1672 THR A C   1 
ATOM   1377 O O   . THR A 1 189 ? -10.672 0.443   -19.103 1.00 22.59  ? 1672 THR A O   1 
ATOM   1378 C CB  . THR A 1 189 ? -9.171  -0.119  -16.097 1.00 15.97  ? 1672 THR A CB  1 
ATOM   1379 O OG1 . THR A 1 189 ? -9.452  0.228   -14.738 1.00 13.46  ? 1672 THR A OG1 1 
ATOM   1380 C CG2 . THR A 1 189 ? -8.340  1.002   -16.736 1.00 9.45   ? 1672 THR A CG2 1 
ATOM   1381 N N   . TYR A 1 190 ? -9.778  -1.596  -18.793 1.00 22.75  ? 1673 TYR A N   1 
ATOM   1382 C CA  . TYR A 1 190 ? -9.537  -1.802  -20.221 1.00 21.43  ? 1673 TYR A CA  1 
ATOM   1383 C C   . TYR A 1 190 ? -10.818 -1.663  -21.067 1.00 20.94  ? 1673 TYR A C   1 
ATOM   1384 O O   . TYR A 1 190 ? -10.827 -1.025  -22.112 1.00 21.92  ? 1673 TYR A O   1 
ATOM   1385 C CB  . TYR A 1 190 ? -8.948  -3.182  -20.432 1.00 23.69  ? 1673 TYR A CB  1 
ATOM   1386 C CG  . TYR A 1 190 ? -8.565  -3.425  -21.854 1.00 26.67  ? 1673 TYR A CG  1 
ATOM   1387 C CD1 . TYR A 1 190 ? -7.342  -2.984  -22.342 1.00 27.38  ? 1673 TYR A CD1 1 
ATOM   1388 C CD2 . TYR A 1 190 ? -9.451  -4.038  -22.739 1.00 26.69  ? 1673 TYR A CD2 1 
ATOM   1389 C CE1 . TYR A 1 190 ? -7.009  -3.142  -23.669 1.00 30.31  ? 1673 TYR A CE1 1 
ATOM   1390 C CE2 . TYR A 1 190 ? -9.118  -4.198  -24.075 1.00 29.47  ? 1673 TYR A CE2 1 
ATOM   1391 C CZ  . TYR A 1 190 ? -7.898  -3.752  -24.524 1.00 28.46  ? 1673 TYR A CZ  1 
ATOM   1392 O OH  . TYR A 1 190 ? -7.529  -3.957  -25.823 1.00 34.63  ? 1673 TYR A OH  1 
ATOM   1393 N N   . GLU A 1 191 ? -11.895 -2.296  -20.627 1.00 20.58  ? 1674 GLU A N   1 
ATOM   1394 C CA  . GLU A 1 191 ? -13.143 -2.212  -21.348 0.50 19.55  ? 1674 GLU A CA  1 
ATOM   1395 C C   . GLU A 1 191 ? -13.669 -0.781  -21.314 1.00 21.66  ? 1674 GLU A C   1 
ATOM   1396 O O   . GLU A 1 191 ? -14.124 -0.273  -22.328 1.00 26.99  ? 1674 GLU A O   1 
ATOM   1397 C CB  . GLU A 1 191 ? -14.161 -3.180  -20.750 0.50 15.48  ? 1674 GLU A CB  1 
ATOM   1398 C CG  . GLU A 1 191 ? -13.922 -4.651  -21.097 0.50 15.11  ? 1674 GLU A CG  1 
ATOM   1399 C CD  . GLU A 1 191 ? -13.910 -4.917  -22.616 0.50 17.51  ? 1674 GLU A CD  1 
ATOM   1400 O OE1 . GLU A 1 191 ? -14.595 -4.178  -23.369 0.50 16.68  ? 1674 GLU A OE1 1 
ATOM   1401 O OE2 . GLU A 1 191 ? -13.232 -5.881  -23.058 0.50 14.14  ? 1674 GLU A OE2 1 
ATOM   1402 N N   . SER A 1 192 ? -13.608 -0.118  -20.162 1.00 22.41  ? 1675 SER A N   1 
ATOM   1403 C CA  . SER A 1 192 ? -14.089 1.269   -20.047 1.00 19.91  ? 1675 SER A CA  1 
ATOM   1404 C C   . SER A 1 192 ? -13.378 2.197   -21.029 1.00 20.15  ? 1675 SER A C   1 
ATOM   1405 O O   . SER A 1 192 ? -13.990 3.048   -21.650 1.00 17.98  ? 1675 SER A O   1 
ATOM   1406 C CB  . SER A 1 192 ? -13.882 1.791   -18.618 1.00 18.29  ? 1675 SER A CB  1 
ATOM   1407 O OG  . SER A 1 192 ? -14.687 1.071   -17.695 1.00 17.95  ? 1675 SER A OG  1 
ATOM   1408 N N   . LEU A 1 193 ? -12.072 2.001   -21.166 1.00 21.63  ? 1676 LEU A N   1 
ATOM   1409 C CA  . LEU A 1 193 ? -11.251 2.797   -22.062 1.00 23.92  ? 1676 LEU A CA  1 
ATOM   1410 C C   . LEU A 1 193 ? -11.785 2.780   -23.501 1.00 25.68  ? 1676 LEU A C   1 
ATOM   1411 O O   . LEU A 1 193 ? -11.522 3.702   -24.276 1.00 27.14  ? 1676 LEU A O   1 
ATOM   1412 C CB  . LEU A 1 193 ? -9.812  2.261   -22.040 1.00 24.35  ? 1676 LEU A CB  1 
ATOM   1413 C CG  . LEU A 1 193 ? -8.645  3.049   -21.418 1.00 24.63  ? 1676 LEU A CG  1 
ATOM   1414 C CD1 . LEU A 1 193 ? -9.041  3.892   -20.230 1.00 19.62  ? 1676 LEU A CD1 1 
ATOM   1415 C CD2 . LEU A 1 193 ? -7.595  2.049   -21.030 1.00 23.97  ? 1676 LEU A CD2 1 
ATOM   1416 N N   . LYS A 1 194 ? -12.536 1.741   -23.856 1.00 25.30  ? 1677 LYS A N   1 
ATOM   1417 C CA  . LYS A 1 194 ? -13.061 1.625   -25.211 1.00 26.92  ? 1677 LYS A CA  1 
ATOM   1418 C C   . LYS A 1 194 ? -14.382 2.363   -25.418 1.00 29.67  ? 1677 LYS A C   1 
ATOM   1419 O O   . LYS A 1 194 ? -14.823 2.545   -26.563 1.00 28.78  ? 1677 LYS A O   1 
ATOM   1420 C CB  . LYS A 1 194 ? -13.254 0.154   -25.574 1.00 27.36  ? 1677 LYS A CB  1 
ATOM   1421 C CG  . LYS A 1 194 ? -11.978 -0.587  -25.936 1.00 30.40  ? 1677 LYS A CG  1 
ATOM   1422 C CD  . LYS A 1 194 ? -12.260 -2.039  -26.325 1.00 32.55  ? 1677 LYS A CD  1 
ATOM   1423 C CE  . LYS A 1 194 ? -12.701 -2.845  -25.117 1.00 37.32  ? 1677 LYS A CE  1 
ATOM   1424 N NZ  . LYS A 1 194 ? -13.021 -4.267  -25.441 1.00 41.06  ? 1677 LYS A NZ  1 
ATOM   1425 N N   . LYS A 1 195 ? -15.001 2.796   -24.320 1.00 28.57  ? 1678 LYS A N   1 
ATOM   1426 C CA  . LYS A 1 195 ? -16.271 3.473   -24.403 1.00 29.56  ? 1678 LYS A CA  1 
ATOM   1427 C C   . LYS A 1 195 ? -16.230 4.905   -23.918 1.00 29.81  ? 1678 LYS A C   1 
ATOM   1428 O O   . LYS A 1 195 ? -17.034 5.736   -24.344 1.00 29.71  ? 1678 LYS A O   1 
ATOM   1429 C CB  . LYS A 1 195 ? -17.323 2.690   -23.609 1.00 32.75  ? 1678 LYS A CB  1 
ATOM   1430 C CG  . LYS A 1 195 ? -17.502 1.240   -24.092 1.00 36.21  ? 1678 LYS A CG  1 
ATOM   1431 C CD  . LYS A 1 195 ? -18.301 0.376   -23.123 1.00 35.59  ? 1678 LYS A CD  1 
ATOM   1432 C CE  . LYS A 1 195 ? -19.789 0.512   -23.312 1.00 38.53  ? 1678 LYS A CE  1 
ATOM   1433 N NZ  . LYS A 1 195 ? -20.485 -0.507  -22.449 1.00 41.35  ? 1678 LYS A NZ  1 
ATOM   1434 N N   . THR A 1 196 ? -15.295 5.203   -23.030 1.00 29.99  ? 1679 THR A N   1 
ATOM   1435 C CA  . THR A 1 196 ? -15.214 6.539   -22.479 1.00 30.54  ? 1679 THR A CA  1 
ATOM   1436 C C   . THR A 1 196 ? -14.997 7.584   -23.557 1.00 33.63  ? 1679 THR A C   1 
ATOM   1437 O O   . THR A 1 196 ? -14.058 7.521   -24.346 1.00 36.18  ? 1679 THR A O   1 
ATOM   1438 C CB  . THR A 1 196 ? -14.129 6.604   -21.399 1.00 28.77  ? 1679 THR A CB  1 
ATOM   1439 O OG1 . THR A 1 196 ? -14.547 5.781   -20.303 1.00 26.39  ? 1679 THR A OG1 1 
ATOM   1440 C CG2 . THR A 1 196 ? -13.906 8.041   -20.910 1.00 24.60  ? 1679 THR A CG2 1 
ATOM   1441 N N   . LYS A 1 197 ? -15.892 8.555   -23.591 1.00 35.79  ? 1680 LYS A N   1 
ATOM   1442 C CA  . LYS A 1 197 ? -15.808 9.593   -24.593 1.00 39.95  ? 1680 LYS A CA  1 
ATOM   1443 C C   . LYS A 1 197 ? -15.316 10.882  -23.983 1.00 41.76  ? 1680 LYS A C   1 
ATOM   1444 O O   . LYS A 1 197 ? -14.107 11.129  -23.901 1.00 44.07  ? 1680 LYS A O   1 
ATOM   1445 C CB  . LYS A 1 197 ? -17.187 9.815   -25.241 1.00 38.91  ? 1680 LYS A CB  1 
ATOM   1446 N N   . CYS A 1 198 ? -16.270 11.693  -23.536 1.00 42.18  ? 1681 CYS A N   1 
ATOM   1447 C CA  . CYS A 1 198 ? -15.981 12.992  -22.945 1.00 42.45  ? 1681 CYS A CA  1 
ATOM   1448 C C   . CYS A 1 198 ? -17.064 13.307  -21.911 1.00 39.64  ? 1681 CYS A C   1 
ATOM   1449 O O   . CYS A 1 198 ? -18.254 13.387  -22.244 1.00 38.52  ? 1681 CYS A O   1 
ATOM   1450 C CB  . CYS A 1 198 ? -15.960 14.060  -24.054 1.00 46.01  ? 1681 CYS A CB  1 
ATOM   1451 S SG  . CYS A 1 198 ? -15.718 15.768  -23.468 1.00 57.58  ? 1681 CYS A SG  1 
ATOM   1452 N N   . ARG A 1 199 ? -16.659 13.464  -20.653 1.00 35.65  ? 1682 ARG A N   1 
ATOM   1453 C CA  . ARG A 1 199 ? -17.617 13.752  -19.598 1.00 31.51  ? 1682 ARG A CA  1 
ATOM   1454 C C   . ARG A 1 199 ? -17.520 15.217  -19.225 1.00 31.57  ? 1682 ARG A C   1 
ATOM   1455 O O   . ARG A 1 199 ? -16.441 15.797  -19.253 1.00 31.38  ? 1682 ARG A O   1 
ATOM   1456 C CB  . ARG A 1 199 ? -17.342 12.874  -18.375 1.00 28.87  ? 1682 ARG A CB  1 
ATOM   1457 C CG  . ARG A 1 199 ? -17.542 11.386  -18.613 1.00 28.07  ? 1682 ARG A CG  1 
ATOM   1458 C CD  . ARG A 1 199 ? -18.997 10.983  -18.426 1.00 27.30  ? 1682 ARG A CD  1 
ATOM   1459 N NE  . ARG A 1 199 ? -19.418 11.234  -17.047 1.00 28.51  ? 1682 ARG A NE  1 
ATOM   1460 C CZ  . ARG A 1 199 ? -19.547 10.308  -16.100 1.00 25.96  ? 1682 ARG A CZ  1 
ATOM   1461 N NH1 . ARG A 1 199 ? -19.296 9.028   -16.374 1.00 23.11  ? 1682 ARG A NH1 1 
ATOM   1462 N NH2 . ARG A 1 199 ? -19.905 10.676  -14.869 1.00 21.85  ? 1682 ARG A NH2 1 
ATOM   1463 N N   . GLU A 1 200 ? -18.655 15.832  -18.916 1.00 32.13  ? 1683 GLU A N   1 
ATOM   1464 C CA  . GLU A 1 200 ? -18.649 17.238  -18.510 1.00 32.25  ? 1683 GLU A CA  1 
ATOM   1465 C C   . GLU A 1 200 ? -18.443 17.325  -17.007 1.00 28.28  ? 1683 GLU A C   1 
ATOM   1466 O O   . GLU A 1 200 ? -17.858 18.275  -16.503 1.00 28.01  ? 1683 GLU A O   1 
ATOM   1467 C CB  . GLU A 1 200 ? -19.964 17.924  -18.874 1.00 35.86  ? 1683 GLU A CB  1 
ATOM   1468 C CG  . GLU A 1 200 ? -20.197 18.058  -20.358 1.00 41.38  ? 1683 GLU A CG  1 
ATOM   1469 C CD  . GLU A 1 200 ? -21.499 18.785  -20.659 1.00 46.58  ? 1683 GLU A CD  1 
ATOM   1470 O OE1 . GLU A 1 200 ? -21.763 19.046  -21.860 1.00 49.61  ? 1683 GLU A OE1 1 
ATOM   1471 O OE2 . GLU A 1 200 ? -22.253 19.092  -19.695 1.00 47.09  ? 1683 GLU A OE2 1 
ATOM   1472 N N   . PHE A 1 201 ? -18.919 16.304  -16.310 1.00 25.87  ? 1684 PHE A N   1 
ATOM   1473 C CA  . PHE A 1 201 ? -18.817 16.212  -14.866 1.00 24.50  ? 1684 PHE A CA  1 
ATOM   1474 C C   . PHE A 1 201 ? -18.165 14.888  -14.459 1.00 24.03  ? 1684 PHE A C   1 
ATOM   1475 O O   . PHE A 1 201 ? -18.455 13.843  -15.028 1.00 27.32  ? 1684 PHE A O   1 
ATOM   1476 C CB  . PHE A 1 201 ? -20.211 16.311  -14.261 1.00 23.28  ? 1684 PHE A CB  1 
ATOM   1477 C CG  . PHE A 1 201 ? -20.891 17.610  -14.549 1.00 27.50  ? 1684 PHE A CG  1 
ATOM   1478 C CD1 . PHE A 1 201 ? -20.644 18.736  -13.764 1.00 27.46  ? 1684 PHE A CD1 1 
ATOM   1479 C CD2 . PHE A 1 201 ? -21.735 17.730  -15.650 1.00 27.78  ? 1684 PHE A CD2 1 
ATOM   1480 C CE1 . PHE A 1 201 ? -21.219 19.951  -14.077 1.00 29.04  ? 1684 PHE A CE1 1 
ATOM   1481 C CE2 . PHE A 1 201 ? -22.312 18.941  -15.969 1.00 30.09  ? 1684 PHE A CE2 1 
ATOM   1482 C CZ  . PHE A 1 201 ? -22.054 20.054  -15.184 1.00 31.08  ? 1684 PHE A CZ  1 
ATOM   1483 N N   . VAL A 1 202 ? -17.274 14.925  -13.482 1.00 21.38  ? 1685 VAL A N   1 
ATOM   1484 C CA  . VAL A 1 202 ? -16.639 13.700  -13.058 1.00 19.56  ? 1685 VAL A CA  1 
ATOM   1485 C C   . VAL A 1 202 ? -17.660 12.838  -12.318 1.00 19.67  ? 1685 VAL A C   1 
ATOM   1486 O O   . VAL A 1 202 ? -18.653 13.347  -11.788 1.00 17.10  ? 1685 VAL A O   1 
ATOM   1487 C CB  . VAL A 1 202 ? -15.409 13.988  -12.152 1.00 17.71  ? 1685 VAL A CB  1 
ATOM   1488 C CG1 . VAL A 1 202 ? -14.551 15.035  -12.811 1.00 17.53  ? 1685 VAL A CG1 1 
ATOM   1489 C CG2 . VAL A 1 202 ? -15.828 14.456  -10.780 1.00 15.69  ? 1685 VAL A CG2 1 
ATOM   1490 N N   . PRO A 1 203 ? -17.435 11.513  -12.295 1.00 19.81  ? 1686 PRO A N   1 
ATOM   1491 C CA  . PRO A 1 203 ? -18.305 10.543  -11.631 1.00 19.54  ? 1686 PRO A CA  1 
ATOM   1492 C C   . PRO A 1 203 ? -18.726 10.966  -10.226 1.00 21.91  ? 1686 PRO A C   1 
ATOM   1493 O O   . PRO A 1 203 ? -17.904 11.345  -9.389  1.00 24.16  ? 1686 PRO A O   1 
ATOM   1494 C CB  . PRO A 1 203 ? -17.456 9.285   -11.617 1.00 18.49  ? 1686 PRO A CB  1 
ATOM   1495 C CG  . PRO A 1 203 ? -16.766 9.375   -12.940 1.00 20.35  ? 1686 PRO A CG  1 
ATOM   1496 C CD  . PRO A 1 203 ? -16.332 10.828  -12.991 1.00 20.33  ? 1686 PRO A CD  1 
ATOM   1497 N N   . SER A 1 204 ? -20.029 10.906  -9.986  1.00 22.11  ? 1687 SER A N   1 
ATOM   1498 C CA  . SER A 1 204 ? -20.619 11.242  -8.709  1.00 19.10  ? 1687 SER A CA  1 
ATOM   1499 C C   . SER A 1 204 ? -20.312 10.101  -7.732  1.00 21.22  ? 1687 SER A C   1 
ATOM   1500 O O   . SER A 1 204 ? -19.863 9.020   -8.137  1.00 22.14  ? 1687 SER A O   1 
ATOM   1501 C CB  . SER A 1 204 ? -22.110 11.334  -8.896  1.00 15.47  ? 1687 SER A CB  1 
ATOM   1502 O OG  . SER A 1 204 ? -22.580 10.040  -9.211  1.00 12.68  ? 1687 SER A OG  1 
ATOM   1503 N N   . ARG A 1 205 ? -20.599 10.321  -6.457  1.00 21.89  ? 1688 ARG A N   1 
ATOM   1504 C CA  . ARG A 1 205 ? -20.332 9.313   -5.454  1.00 25.74  ? 1688 ARG A CA  1 
ATOM   1505 C C   . ARG A 1 205 ? -20.979 7.969   -5.723  1.00 26.52  ? 1688 ARG A C   1 
ATOM   1506 O O   . ARG A 1 205 ? -20.310 6.930   -5.634  1.00 26.54  ? 1688 ARG A O   1 
ATOM   1507 C CB  . ARG A 1 205 ? -20.685 9.876   -4.084  1.00 28.81  ? 1688 ARG A CB  1 
ATOM   1508 C CG  . ARG A 1 205 ? -19.885 11.173  -3.904  1.00 37.03  ? 1688 ARG A CG  1 
ATOM   1509 C CD  . ARG A 1 205 ? -19.651 11.593  -2.490  1.00 41.69  ? 1688 ARG A CD  1 
ATOM   1510 N NE  . ARG A 1 205 ? -18.560 12.565  -2.453  1.00 45.12  ? 1688 ARG A NE  1 
ATOM   1511 C CZ  . ARG A 1 205 ? -18.133 13.163  -1.345  1.00 46.95  ? 1688 ARG A CZ  1 
ATOM   1512 N NH1 . ARG A 1 205 ? -18.713 12.881  -0.181  1.00 47.19  ? 1688 ARG A NH1 1 
ATOM   1513 N NH2 . ARG A 1 205 ? -17.132 14.040  -1.397  1.00 46.56  ? 1688 ARG A NH2 1 
ATOM   1514 N N   . ASP A 1 206 ? -22.261 7.973   -6.086  1.00 28.47  ? 1689 ASP A N   1 
ATOM   1515 C CA  . ASP A 1 206 ? -22.939 6.719   -6.389  1.00 27.46  ? 1689 ASP A CA  1 
ATOM   1516 C C   . ASP A 1 206 ? -22.211 6.008   -7.517  1.00 27.95  ? 1689 ASP A C   1 
ATOM   1517 O O   . ASP A 1 206 ? -22.055 4.784   -7.467  1.00 29.90  ? 1689 ASP A O   1 
ATOM   1518 C CB  . ASP A 1 206 ? -24.396 6.950   -6.789  1.00 30.35  ? 1689 ASP A CB  1 
ATOM   1519 C CG  . ASP A 1 206 ? -25.296 7.223   -5.580  1.00 34.20  ? 1689 ASP A CG  1 
ATOM   1520 O OD1 . ASP A 1 206 ? -24.852 6.971   -4.435  1.00 33.95  ? 1689 ASP A OD1 1 
ATOM   1521 O OD2 . ASP A 1 206 ? -26.450 7.676   -5.773  1.00 35.46  ? 1689 ASP A OD2 1 
ATOM   1522 N N   . GLU A 1 207 ? -21.754 6.761   -8.524  1.00 25.00  ? 1690 GLU A N   1 
ATOM   1523 C CA  . GLU A 1 207 ? -21.035 6.145   -9.640  1.00 23.05  ? 1690 GLU A CA  1 
ATOM   1524 C C   . GLU A 1 207 ? -19.682 5.577   -9.182  1.00 21.62  ? 1690 GLU A C   1 
ATOM   1525 O O   . GLU A 1 207 ? -19.330 4.463   -9.524  1.00 17.83  ? 1690 GLU A O   1 
ATOM   1526 C CB  . GLU A 1 207 ? -20.805 7.168   -10.757 1.00 23.88  ? 1690 GLU A CB  1 
ATOM   1527 C CG  . GLU A 1 207 ? -20.406 6.560   -12.094 1.00 22.01  ? 1690 GLU A CG  1 
ATOM   1528 C CD  . GLU A 1 207 ? -20.124 7.602   -13.167 1.00 24.21  ? 1690 GLU A CD  1 
ATOM   1529 O OE1 . GLU A 1 207 ? -20.556 8.760   -13.024 1.00 24.94  ? 1690 GLU A OE1 1 
ATOM   1530 O OE2 . GLU A 1 207 ? -19.467 7.270   -14.170 1.00 26.19  ? 1690 GLU A OE2 1 
ATOM   1531 N N   . ILE A 1 208 ? -18.927 6.363   -8.417  1.00 21.52  ? 1691 ILE A N   1 
ATOM   1532 C CA  . ILE A 1 208 ? -17.625 5.929   -7.922  1.00 22.10  ? 1691 ILE A CA  1 
ATOM   1533 C C   . ILE A 1 208 ? -17.761 4.642   -7.094  1.00 22.91  ? 1691 ILE A C   1 
ATOM   1534 O O   . ILE A 1 208 ? -16.974 3.694   -7.246  1.00 20.99  ? 1691 ILE A O   1 
ATOM   1535 C CB  . ILE A 1 208 ? -16.952 7.057   -7.068  1.00 21.72  ? 1691 ILE A CB  1 
ATOM   1536 C CG1 . ILE A 1 208 ? -16.627 8.251   -7.974  1.00 20.26  ? 1691 ILE A CG1 1 
ATOM   1537 C CG2 . ILE A 1 208 ? -15.670 6.535   -6.366  1.00 19.24  ? 1691 ILE A CG2 1 
ATOM   1538 C CD1 . ILE A 1 208 ? -15.883 9.381   -7.287  1.00 15.58  ? 1691 ILE A CD1 1 
ATOM   1539 N N   . GLU A 1 209 ? -18.771 4.608   -6.234  1.00 24.72  ? 1692 GLU A N   1 
ATOM   1540 C CA  . GLU A 1 209 ? -19.014 3.421   -5.416  1.00 27.63  ? 1692 GLU A CA  1 
ATOM   1541 C C   . GLU A 1 209 ? -19.281 2.193   -6.285  1.00 23.18  ? 1692 GLU A C   1 
ATOM   1542 O O   . GLU A 1 209 ? -18.755 1.128   -6.043  1.00 24.77  ? 1692 GLU A O   1 
ATOM   1543 C CB  . GLU A 1 209 ? -20.195 3.649   -4.471  1.00 31.77  ? 1692 GLU A CB  1 
ATOM   1544 C CG  . GLU A 1 209 ? -20.365 2.517   -3.488  1.00 41.24  ? 1692 GLU A CG  1 
ATOM   1545 C CD  . GLU A 1 209 ? -20.883 2.973   -2.142  1.00 47.96  ? 1692 GLU A CD  1 
ATOM   1546 O OE1 . GLU A 1 209 ? -20.872 2.150   -1.190  1.00 51.69  ? 1692 GLU A OE1 1 
ATOM   1547 O OE2 . GLU A 1 209 ? -21.295 4.153   -2.037  1.00 51.24  ? 1692 GLU A OE2 1 
ATOM   1548 N N   . ALA A 1 210 ? -20.109 2.363   -7.297  1.00 20.60  ? 1693 ALA A N   1 
ATOM   1549 C CA  . ALA A 1 210 ? -20.430 1.300   -8.227  1.00 20.27  ? 1693 ALA A CA  1 
ATOM   1550 C C   . ALA A 1 210 ? -19.182 0.773   -8.946  1.00 22.00  ? 1693 ALA A C   1 
ATOM   1551 O O   . ALA A 1 210 ? -19.016 -0.432  -9.096  1.00 22.77  ? 1693 ALA A O   1 
ATOM   1552 C CB  . ALA A 1 210 ? -21.448 1.810   -9.266  1.00 18.74  ? 1693 ALA A CB  1 
ATOM   1553 N N   . LEU A 1 211 ? -18.316 1.685   -9.397  1.00 21.53  ? 1694 LEU A N   1 
ATOM   1554 C CA  . LEU A 1 211 ? -17.100 1.322   -10.112 1.00 20.67  ? 1694 LEU A CA  1 
ATOM   1555 C C   . LEU A 1 211 ? -16.120 0.609   -9.200  1.00 19.68  ? 1694 LEU A C   1 
ATOM   1556 O O   . LEU A 1 211 ? -15.322 -0.214  -9.637  1.00 16.96  ? 1694 LEU A O   1 
ATOM   1557 C CB  . LEU A 1 211 ? -16.428 2.570   -10.716 1.00 21.83  ? 1694 LEU A CB  1 
ATOM   1558 C CG  . LEU A 1 211 ? -17.266 3.377   -11.715 1.00 24.06  ? 1694 LEU A CG  1 
ATOM   1559 C CD1 . LEU A 1 211 ? -16.502 4.634   -12.175 1.00 21.26  ? 1694 LEU A CD1 1 
ATOM   1560 C CD2 . LEU A 1 211 ? -17.613 2.477   -12.889 1.00 25.53  ? 1694 LEU A CD2 1 
ATOM   1561 N N   . ILE A 1 212 ? -16.159 0.941   -7.923  1.00 20.94  ? 1695 ILE A N   1 
ATOM   1562 C CA  . ILE A 1 212 ? -15.257 0.290   -6.981  1.00 22.35  ? 1695 ILE A CA  1 
ATOM   1563 C C   . ILE A 1 212 ? -15.597 -1.206  -6.854  1.00 22.92  ? 1695 ILE A C   1 
ATOM   1564 O O   . ILE A 1 212 ? -14.743 -2.037  -6.552  1.00 21.88  ? 1695 ILE A O   1 
ATOM   1565 C CB  . ILE A 1 212 ? -15.306 1.002   -5.604  1.00 21.07  ? 1695 ILE A CB  1 
ATOM   1566 C CG1 . ILE A 1 212 ? -14.553 2.331   -5.712  1.00 17.16  ? 1695 ILE A CG1 1 
ATOM   1567 C CG2 . ILE A 1 212 ? -14.693 0.138   -4.526  1.00 19.14  ? 1695 ILE A CG2 1 
ATOM   1568 C CD1 . ILE A 1 212 ? -14.496 3.076   -4.439  1.00 16.72  ? 1695 ILE A CD1 1 
ATOM   1569 N N   . HIS A 1 213 ? -16.845 -1.533  -7.146  1.00 23.30  ? 1696 HIS A N   1 
ATOM   1570 C CA  . HIS A 1 213 ? -17.328 -2.894  -7.077  1.00 24.66  ? 1696 HIS A CA  1 
ATOM   1571 C C   . HIS A 1 213 ? -17.561 -3.422  -8.468  1.00 25.99  ? 1696 HIS A C   1 
ATOM   1572 O O   . HIS A 1 213 ? -18.250 -4.429  -8.627  1.00 28.93  ? 1696 HIS A O   1 
ATOM   1573 C CB  . HIS A 1 213 ? -18.657 -2.953  -6.306  1.00 24.55  ? 1696 HIS A CB  1 
ATOM   1574 C CG  . HIS A 1 213 ? -18.546 -2.542  -4.873  1.00 22.54  ? 1696 HIS A CG  1 
ATOM   1575 N ND1 . HIS A 1 213 ? -17.810 -3.252  -3.956  1.00 23.82  ? 1696 HIS A ND1 1 
ATOM   1576 C CD2 . HIS A 1 213 ? -19.060 -1.483  -4.203  1.00 25.54  ? 1696 HIS A CD2 1 
ATOM   1577 C CE1 . HIS A 1 213 ? -17.870 -2.651  -2.780  1.00 25.00  ? 1696 HIS A CE1 1 
ATOM   1578 N NE2 . HIS A 1 213 ? -18.622 -1.573  -2.902  1.00 25.51  ? 1696 HIS A NE2 1 
ATOM   1579 N N   . ARG A 1 214 ? -17.017 -2.737  -9.472  1.00 27.14  ? 1697 ARG A N   1 
ATOM   1580 C CA  . ARG A 1 214 ? -17.190 -3.125  -10.879 1.00 27.17  ? 1697 ARG A CA  1 
ATOM   1581 C C   . ARG A 1 214 ? -18.635 -3.524  -11.198 1.00 27.37  ? 1697 ARG A C   1 
ATOM   1582 O O   . ARG A 1 214 ? -18.876 -4.447  -11.973 1.00 26.83  ? 1697 ARG A O   1 
ATOM   1583 C CB  . ARG A 1 214 ? -16.248 -4.271  -11.254 1.00 25.69  ? 1697 ARG A CB  1 
ATOM   1584 C CG  . ARG A 1 214 ? -14.764 -3.930  -11.127 1.00 26.79  ? 1697 ARG A CG  1 
ATOM   1585 C CD  . ARG A 1 214 ? -13.881 -5.153  -11.358 1.00 24.80  ? 1697 ARG A CD  1 
ATOM   1586 N NE  . ARG A 1 214 ? -14.126 -6.208  -10.377 1.00 27.49  ? 1697 ARG A NE  1 
ATOM   1587 C CZ  . ARG A 1 214 ? -13.468 -6.340  -9.229  1.00 28.16  ? 1697 ARG A CZ  1 
ATOM   1588 N NH1 . ARG A 1 214 ? -12.513 -5.488  -8.913  1.00 31.49  ? 1697 ARG A NH1 1 
ATOM   1589 N NH2 . ARG A 1 214 ? -13.761 -7.322  -8.391  1.00 27.59  ? 1697 ARG A NH2 1 
ATOM   1590 N N   . GLN A 1 215 ? -19.575 -2.800  -10.597 1.00 27.55  ? 1698 GLN A N   1 
ATOM   1591 C CA  . GLN A 1 215 ? -21.012 -3.007  -10.764 1.00 30.44  ? 1698 GLN A CA  1 
ATOM   1592 C C   . GLN A 1 215 ? -21.633 -1.783  -11.438 1.00 30.81  ? 1698 GLN A C   1 
ATOM   1593 O O   . GLN A 1 215 ? -21.002 -0.735  -11.550 1.00 29.72  ? 1698 GLN A O   1 
ATOM   1594 C CB  . GLN A 1 215 ? -21.677 -3.192  -9.388  1.00 30.97  ? 1698 GLN A CB  1 
ATOM   1595 C CG  . GLN A 1 215 ? -21.680 -4.628  -8.869  1.00 35.54  ? 1698 GLN A CG  1 
ATOM   1596 C CD  . GLN A 1 215 ? -21.758 -4.716  -7.346  1.00 38.21  ? 1698 GLN A CD  1 
ATOM   1597 O OE1 . GLN A 1 215 ? -22.517 -3.999  -6.703  1.00 39.87  ? 1698 GLN A OE1 1 
ATOM   1598 N NE2 . GLN A 1 215 ? -20.971 -5.616  -6.767  1.00 42.61  ? 1698 GLN A NE2 1 
ATOM   1599 N N   . GLU A 1 216 ? -22.880 -1.921  -11.874 1.00 31.48  ? 1699 GLU A N   1 
ATOM   1600 C CA  . GLU A 1 216 ? -23.598 -0.807  -12.476 1.00 30.50  ? 1699 GLU A CA  1 
ATOM   1601 C C   . GLU A 1 216 ? -24.212 0.045   -11.346 1.00 28.67  ? 1699 GLU A C   1 
ATOM   1602 O O   . GLU A 1 216 ? -24.342 -0.408  -10.215 1.00 27.70  ? 1699 GLU A O   1 
ATOM   1603 C CB  . GLU A 1 216 ? -24.697 -1.335  -13.383 1.00 33.57  ? 1699 GLU A CB  1 
ATOM   1604 C CG  . GLU A 1 216 ? -24.197 -2.131  -14.576 1.00 40.82  ? 1699 GLU A CG  1 
ATOM   1605 C CD  . GLU A 1 216 ? -25.329 -2.820  -15.359 1.00 45.73  ? 1699 GLU A CD  1 
ATOM   1606 O OE1 . GLU A 1 216 ? -25.994 -3.738  -14.791 1.00 44.47  ? 1699 GLU A OE1 1 
ATOM   1607 O OE2 . GLU A 1 216 ? -25.545 -2.432  -16.539 1.00 45.93  ? 1699 GLU A OE2 1 
ATOM   1608 N N   . MET A 1 217 ? -24.574 1.288   -11.638 1.00 26.73  ? 1700 MET A N   1 
ATOM   1609 C CA  . MET A 1 217 ? -25.174 2.131   -10.611 1.00 25.50  ? 1700 MET A CA  1 
ATOM   1610 C C   . MET A 1 217 ? -26.679 2.199   -10.853 1.00 25.25  ? 1700 MET A C   1 
ATOM   1611 O O   . MET A 1 217 ? -27.133 1.991   -11.979 1.00 27.56  ? 1700 MET A O   1 
ATOM   1612 C CB  . MET A 1 217 ? -24.552 3.542   -10.630 1.00 25.34  ? 1700 MET A CB  1 
ATOM   1613 C CG  . MET A 1 217 ? -24.669 4.303   -11.943 1.00 27.64  ? 1700 MET A CG  1 
ATOM   1614 S SD  . MET A 1 217 ? -23.874 5.951   -11.886 1.00 28.37  ? 1700 MET A SD  1 
ATOM   1615 C CE  . MET A 1 217 ? -24.701 6.605   -10.539 1.00 24.12  ? 1700 MET A CE  1 
ATOM   1616 N N   . THR A 1 218 ? -27.465 2.439   -9.812  1.00 23.46  ? 1701 THR A N   1 
ATOM   1617 C CA  . THR A 1 218 ? -28.903 2.539   -10.025 1.00 23.77  ? 1701 THR A CA  1 
ATOM   1618 C C   . THR A 1 218 ? -29.355 3.982   -9.841  1.00 23.34  ? 1701 THR A C   1 
ATOM   1619 O O   . THR A 1 218 ? -28.666 4.793   -9.232  1.00 24.10  ? 1701 THR A O   1 
ATOM   1620 C CB  . THR A 1 218 ? -29.728 1.666   -9.042  1.00 25.46  ? 1701 THR A CB  1 
ATOM   1621 O OG1 . THR A 1 218 ? -29.789 2.315   -7.758  1.00 23.75  ? 1701 THR A OG1 1 
ATOM   1622 C CG2 . THR A 1 218 ? -29.118 0.265   -8.922  1.00 23.64  ? 1701 THR A CG2 1 
ATOM   1623 N N   . SER A 1 219 ? -30.511 4.305   -10.390 1.00 21.58  ? 1702 SER A N   1 
ATOM   1624 C CA  . SER A 1 219 ? -31.052 5.634   -10.244 1.00 20.87  ? 1702 SER A CA  1 
ATOM   1625 C C   . SER A 1 219 ? -32.548 5.537   -10.487 1.00 23.47  ? 1702 SER A C   1 
ATOM   1626 O O   . SER A 1 219 ? -33.107 4.432   -10.574 1.00 22.18  ? 1702 SER A O   1 
ATOM   1627 C CB  . SER A 1 219 ? -30.418 6.588   -11.239 1.00 21.42  ? 1702 SER A CB  1 
ATOM   1628 O OG  . SER A 1 219 ? -30.723 7.919   -10.873 1.00 20.39  ? 1702 SER A OG  1 
ATOM   1629 N N   . THR A 1 220 ? -33.199 6.688   -10.609 1.00 23.44  ? 1703 THR A N   1 
ATOM   1630 C CA  . THR A 1 220 ? -34.623 6.680   -10.810 1.00 24.67  ? 1703 THR A CA  1 
ATOM   1631 C C   . THR A 1 220 ? -35.160 7.718   -11.778 1.00 26.42  ? 1703 THR A C   1 
ATOM   1632 O O   . THR A 1 220 ? -34.761 8.895   -11.759 1.00 27.71  ? 1703 THR A O   1 
ATOM   1633 C CB  . THR A 1 220 ? -35.348 6.886   -9.489  1.00 25.92  ? 1703 THR A CB  1 
ATOM   1634 O OG1 . THR A 1 220 ? -34.760 6.048   -8.495  1.00 27.47  ? 1703 THR A OG1 1 
ATOM   1635 C CG2 . THR A 1 220 ? -36.821 6.534   -9.637  1.00 25.06  ? 1703 THR A CG2 1 
ATOM   1636 N N   . VAL A 1 221 ? -36.075 7.266   -12.623 1.00 24.52  ? 1704 VAL A N   1 
ATOM   1637 C CA  . VAL A 1 221 ? -36.727 8.152   -13.554 1.00 24.57  ? 1704 VAL A CA  1 
ATOM   1638 C C   . VAL A 1 221 ? -38.190 8.231   -13.137 1.00 26.61  ? 1704 VAL A C   1 
ATOM   1639 O O   . VAL A 1 221 ? -38.768 7.247   -12.649 1.00 22.23  ? 1704 VAL A O   1 
ATOM   1640 C CB  . VAL A 1 221 ? -36.636 7.636   -14.970 1.00 22.29  ? 1704 VAL A CB  1 
ATOM   1641 C CG1 . VAL A 1 221 ? -37.327 8.578   -15.867 1.00 18.85  ? 1704 VAL A CG1 1 
ATOM   1642 C CG2 . VAL A 1 221 ? -35.175 7.468   -15.364 1.00 22.22  ? 1704 VAL A CG2 1 
ATOM   1643 N N   . TYR A 1 222 ? -38.770 9.416   -13.299 1.00 29.32  ? 1705 TYR A N   1 
ATOM   1644 C CA  . TYR A 1 222 ? -40.168 9.642   -12.950 1.00 33.12  ? 1705 TYR A CA  1 
ATOM   1645 C C   . TYR A 1 222 ? -40.958 10.107  -14.163 1.00 35.73  ? 1705 TYR A C   1 
ATOM   1646 O O   . TYR A 1 222 ? -40.400 10.440  -15.203 1.00 36.44  ? 1705 TYR A O   1 
ATOM   1647 C CB  . TYR A 1 222 ? -40.307 10.711  -11.870 1.00 32.26  ? 1705 TYR A CB  1 
ATOM   1648 C CG  . TYR A 1 222 ? -39.513 10.477  -10.613 1.00 33.51  ? 1705 TYR A CG  1 
ATOM   1649 C CD1 . TYR A 1 222 ? -38.158 10.758  -10.565 1.00 33.30  ? 1705 TYR A CD1 1 
ATOM   1650 C CD2 . TYR A 1 222 ? -40.132 10.014  -9.449  1.00 34.39  ? 1705 TYR A CD2 1 
ATOM   1651 C CE1 . TYR A 1 222 ? -37.427 10.586  -9.385  1.00 35.59  ? 1705 TYR A CE1 1 
ATOM   1652 C CE2 . TYR A 1 222 ? -39.420 9.845   -8.270  1.00 33.58  ? 1705 TYR A CE2 1 
ATOM   1653 C CZ  . TYR A 1 222 ? -38.063 10.133  -8.245  1.00 36.14  ? 1705 TYR A CZ  1 
ATOM   1654 O OH  . TYR A 1 222 ? -37.330 9.971   -7.082  1.00 38.92  ? 1705 TYR A OH  1 
ATOM   1655 N N   . CYS A 1 223 ? -42.270 10.151  -14.013 1.00 39.73  ? 1706 CYS A N   1 
ATOM   1656 C CA  . CYS A 1 223 ? -43.126 10.606  -15.087 1.00 44.89  ? 1706 CYS A CA  1 
ATOM   1657 C C   . CYS A 1 223 ? -44.385 11.157  -14.466 1.00 45.54  ? 1706 CYS A C   1 
ATOM   1658 O O   . CYS A 1 223 ? -44.879 10.588  -13.496 1.00 45.60  ? 1706 CYS A O   1 
ATOM   1659 C CB  . CYS A 1 223 ? -43.455 9.442   -16.019 1.00 46.04  ? 1706 CYS A CB  1 
ATOM   1660 S SG  . CYS A 1 223 ? -44.127 8.030   -15.162 1.00 53.31  ? 1706 CYS A SG  1 
ATOM   1661 N N   . HIS A 1 224 ? -44.885 12.269  -15.014 1.00 47.87  ? 1707 HIS A N   1 
ATOM   1662 C CA  . HIS A 1 224 ? -46.114 12.910  -14.525 1.00 48.76  ? 1707 HIS A CA  1 
ATOM   1663 C C   . HIS A 1 224 ? -47.169 11.840  -14.261 1.00 49.96  ? 1707 HIS A C   1 
ATOM   1664 O O   . HIS A 1 224 ? -47.358 10.928  -15.068 1.00 49.12  ? 1707 HIS A O   1 
ATOM   1665 C CB  . HIS A 1 224 ? -46.628 13.924  -15.548 1.00 47.98  ? 1707 HIS A CB  1 
ATOM   1666 C CG  . HIS A 1 224 ? -45.682 15.053  -15.796 1.00 49.54  ? 1707 HIS A CG  1 
ATOM   1667 N ND1 . HIS A 1 224 ? -45.242 15.394  -17.057 1.00 50.69  ? 1707 HIS A ND1 1 
ATOM   1668 C CD2 . HIS A 1 224 ? -45.046 15.888  -14.938 1.00 49.78  ? 1707 HIS A CD2 1 
ATOM   1669 C CE1 . HIS A 1 224 ? -44.371 16.385  -16.964 1.00 51.34  ? 1707 HIS A CE1 1 
ATOM   1670 N NE2 . HIS A 1 224 ? -44.233 16.702  -15.688 1.00 49.72  ? 1707 HIS A NE2 1 
ATOM   1671 N N   . GLY A 1 225 ? -47.841 11.949  -13.121 1.00 52.05  ? 1708 GLY A N   1 
ATOM   1672 C CA  . GLY A 1 225 ? -48.842 10.961  -12.765 1.00 54.62  ? 1708 GLY A CA  1 
ATOM   1673 C C   . GLY A 1 225 ? -48.328 10.108  -11.614 1.00 56.77  ? 1708 GLY A C   1 
ATOM   1674 O O   . GLY A 1 225 ? -48.845 9.010   -11.353 1.00 57.38  ? 1708 GLY A O   1 
ATOM   1675 N N   . GLY A 1 226 ? -47.292 10.613  -10.939 1.00 56.50  ? 1709 GLY A N   1 
ATOM   1676 C CA  . GLY A 1 226 ? -46.711 9.912   -9.811  1.00 56.14  ? 1709 GLY A CA  1 
ATOM   1677 C C   . GLY A 1 226 ? -46.216 8.506   -10.099 1.00 56.05  ? 1709 GLY A C   1 
ATOM   1678 O O   . GLY A 1 226 ? -46.460 7.581   -9.324  1.00 58.39  ? 1709 GLY A O   1 
ATOM   1679 N N   . GLY A 1 227 ? -45.526 8.337   -11.219 1.00 55.05  ? 1710 GLY A N   1 
ATOM   1680 C CA  . GLY A 1 227 ? -44.981 7.038   -11.577 1.00 51.33  ? 1710 GLY A CA  1 
ATOM   1681 C C   . GLY A 1 227 ? -43.469 7.114   -11.423 1.00 49.58  ? 1710 GLY A C   1 
ATOM   1682 O O   . GLY A 1 227 ? -42.876 8.191   -11.566 1.00 49.27  ? 1710 GLY A O   1 
ATOM   1683 N N   . SER A 1 228 ? -42.833 5.987   -11.128 1.00 45.87  ? 1711 SER A N   1 
ATOM   1684 C CA  . SER A 1 228 ? -41.395 5.986   -10.942 1.00 42.98  ? 1711 SER A CA  1 
ATOM   1685 C C   . SER A 1 228 ? -40.811 4.683   -11.430 1.00 41.18  ? 1711 SER A C   1 
ATOM   1686 O O   . SER A 1 228 ? -41.480 3.660   -11.459 1.00 39.26  ? 1711 SER A O   1 
ATOM   1687 C CB  . SER A 1 228 ? -41.043 6.171   -9.472  1.00 42.58  ? 1711 SER A CB  1 
ATOM   1688 O OG  . SER A 1 228 ? -41.182 4.939   -8.796  1.00 45.98  ? 1711 SER A OG  1 
ATOM   1689 N N   . CYS A 1 229 ? -39.541 4.724   -11.798 1.00 39.69  ? 1712 CYS A N   1 
ATOM   1690 C CA  . CYS A 1 229 ? -38.888 3.547   -12.309 1.00 40.39  ? 1712 CYS A CA  1 
ATOM   1691 C C   . CYS A 1 229 ? -37.419 3.525   -11.922 1.00 39.80  ? 1712 CYS A C   1 
ATOM   1692 O O   . CYS A 1 229 ? -36.719 4.540   -11.984 1.00 41.40  ? 1712 CYS A O   1 
ATOM   1693 C CB  . CYS A 1 229 ? -39.042 3.523   -13.829 1.00 41.01  ? 1712 CYS A CB  1 
ATOM   1694 S SG  . CYS A 1 229 ? -37.922 2.400   -14.714 1.00 49.45  ? 1712 CYS A SG  1 
ATOM   1695 N N   . LYS A 1 230 ? -36.942 2.363   -11.510 1.00 37.77  ? 1713 LYS A N   1 
ATOM   1696 C CA  . LYS A 1 230 ? -35.545 2.262   -11.154 1.00 36.60  ? 1713 LYS A CA  1 
ATOM   1697 C C   . LYS A 1 230 ? -34.734 1.892   -12.399 1.00 33.96  ? 1713 LYS A C   1 
ATOM   1698 O O   . LYS A 1 230 ? -35.105 0.982   -13.129 1.00 33.51  ? 1713 LYS A O   1 
ATOM   1699 C CB  . LYS A 1 230 ? -35.366 1.226   -10.041 1.00 38.53  ? 1713 LYS A CB  1 
ATOM   1700 C CG  . LYS A 1 230 ? -34.906 1.832   -8.705  1.00 43.00  ? 1713 LYS A CG  1 
ATOM   1701 C CD  . LYS A 1 230 ? -35.801 3.021   -8.253  1.00 44.90  ? 1713 LYS A CD  1 
ATOM   1702 C CE  . LYS A 1 230 ? -35.413 3.548   -6.856  1.00 46.18  ? 1713 LYS A CE  1 
ATOM   1703 N NZ  . LYS A 1 230 ? -33.951 3.918   -6.724  1.00 45.77  ? 1713 LYS A NZ  1 
ATOM   1704 N N   . ILE A 1 231 ? -33.651 2.619   -12.663 1.00 31.23  ? 1714 ILE A N   1 
ATOM   1705 C CA  . ILE A 1 231 ? -32.829 2.313   -13.827 1.00 27.23  ? 1714 ILE A CA  1 
ATOM   1706 C C   . ILE A 1 231 ? -31.413 1.909   -13.438 1.00 28.09  ? 1714 ILE A C   1 
ATOM   1707 O O   . ILE A 1 231 ? -30.843 2.402   -12.466 1.00 25.21  ? 1714 ILE A O   1 
ATOM   1708 C CB  . ILE A 1 231 ? -32.728 3.503   -14.815 1.00 23.79  ? 1714 ILE A CB  1 
ATOM   1709 C CG1 . ILE A 1 231 ? -32.045 4.706   -14.140 1.00 21.01  ? 1714 ILE A CG1 1 
ATOM   1710 C CG2 . ILE A 1 231 ? -34.132 3.903   -15.312 1.00 22.04  ? 1714 ILE A CG2 1 
ATOM   1711 C CD1 . ILE A 1 231 ? -31.566 5.748   -15.118 1.00 11.21  ? 1714 ILE A CD1 1 
ATOM   1712 N N   . THR A 1 232 ? -30.853 0.989   -14.209 1.00 30.90  ? 1715 THR A N   1 
ATOM   1713 C CA  . THR A 1 232 ? -29.500 0.517   -13.966 1.00 32.84  ? 1715 THR A CA  1 
ATOM   1714 C C   . THR A 1 232 ? -28.610 0.978   -15.110 1.00 32.88  ? 1715 THR A C   1 
ATOM   1715 O O   . THR A 1 232 ? -28.943 0.799   -16.289 1.00 32.36  ? 1715 THR A O   1 
ATOM   1716 C CB  . THR A 1 232 ? -29.471 -0.987  -13.871 1.00 34.75  ? 1715 THR A CB  1 
ATOM   1717 O OG1 . THR A 1 232 ? -30.098 -1.393  -12.644 1.00 38.52  ? 1715 THR A OG1 1 
ATOM   1718 C CG2 . THR A 1 232 ? -28.041 -1.467  -13.913 1.00 39.95  ? 1715 THR A CG2 1 
ATOM   1719 N N   . ILE A 1 233 ? -27.480 1.586   -14.771 1.00 30.36  ? 1716 ILE A N   1 
ATOM   1720 C CA  . ILE A 1 233 ? -26.595 2.096   -15.807 1.00 27.49  ? 1716 ILE A CA  1 
ATOM   1721 C C   . ILE A 1 233 ? -25.128 1.957   -15.455 1.00 26.53  ? 1716 ILE A C   1 
ATOM   1722 O O   . ILE A 1 233 ? -24.771 1.747   -14.279 1.00 23.98  ? 1716 ILE A O   1 
ATOM   1723 C CB  . ILE A 1 233 ? -26.857 3.603   -16.071 1.00 28.20  ? 1716 ILE A CB  1 
ATOM   1724 C CG1 . ILE A 1 233 ? -26.614 4.416   -14.790 1.00 26.13  ? 1716 ILE A CG1 1 
ATOM   1725 C CG2 . ILE A 1 233 ? -28.280 3.821   -16.513 1.00 29.12  ? 1716 ILE A CG2 1 
ATOM   1726 C CD1 . ILE A 1 233 ? -26.626 5.923   -15.020 1.00 26.70  ? 1716 ILE A CD1 1 
ATOM   1727 N N   . ASN A 1 234 ? -24.283 2.054   -16.483 1.00 23.77  ? 1717 ASN A N   1 
ATOM   1728 C CA  . ASN A 1 234 ? -22.855 2.030   -16.277 1.00 22.65  ? 1717 ASN A CA  1 
ATOM   1729 C C   . ASN A 1 234 ? -22.402 3.452   -16.566 1.00 23.84  ? 1717 ASN A C   1 
ATOM   1730 O O   . ASN A 1 234 ? -23.250 4.347   -16.645 1.00 25.60  ? 1717 ASN A O   1 
ATOM   1731 C CB  . ASN A 1 234 ? -22.144 0.997   -17.149 1.00 20.70  ? 1717 ASN A CB  1 
ATOM   1732 C CG  . ASN A 1 234 ? -22.540 1.054   -18.618 1.00 21.93  ? 1717 ASN A CG  1 
ATOM   1733 O OD1 . ASN A 1 234 ? -22.375 2.070   -19.309 1.00 20.52  ? 1717 ASN A OD1 1 
ATOM   1734 N ND2 . ASN A 1 234 ? -23.026 -0.070  -19.116 1.00 19.94  ? 1717 ASN A ND2 1 
ATOM   1735 N N   . SER A 1 235 ? -21.098 3.678   -16.704 1.00 24.38  ? 1718 SER A N   1 
ATOM   1736 C CA  . SER A 1 235 ? -20.562 5.026   -16.935 1.00 22.30  ? 1718 SER A CA  1 
ATOM   1737 C C   . SER A 1 235 ? -20.676 5.467   -18.377 1.00 22.17  ? 1718 SER A C   1 
ATOM   1738 O O   . SER A 1 235 ? -20.142 6.514   -18.762 1.00 21.30  ? 1718 SER A O   1 
ATOM   1739 C CB  . SER A 1 235 ? -19.088 5.092   -16.498 1.00 19.87  ? 1718 SER A CB  1 
ATOM   1740 O OG  . SER A 1 235 ? -18.972 4.807   -15.120 1.00 16.41  ? 1718 SER A OG  1 
ATOM   1741 N N   . HIS A 1 236 ? -21.391 4.672   -19.168 1.00 22.04  ? 1719 HIS A N   1 
ATOM   1742 C CA  . HIS A 1 236 ? -21.561 4.960   -20.589 1.00 22.06  ? 1719 HIS A CA  1 
ATOM   1743 C C   . HIS A 1 236 ? -22.989 4.926   -21.136 1.00 23.02  ? 1719 HIS A C   1 
ATOM   1744 O O   . HIS A 1 236 ? -23.218 5.380   -22.255 1.00 23.70  ? 1719 HIS A O   1 
ATOM   1745 C CB  . HIS A 1 236 ? -20.663 4.013   -21.395 1.00 18.48  ? 1719 HIS A CB  1 
ATOM   1746 C CG  . HIS A 1 236 ? -19.251 4.000   -20.913 1.00 17.13  ? 1719 HIS A CG  1 
ATOM   1747 N ND1 . HIS A 1 236 ? -18.801 3.105   -19.963 1.00 17.59  ? 1719 HIS A ND1 1 
ATOM   1748 C CD2 . HIS A 1 236 ? -18.238 4.871   -21.119 1.00 16.25  ? 1719 HIS A CD2 1 
ATOM   1749 C CE1 . HIS A 1 236 ? -17.576 3.434   -19.597 1.00 15.01  ? 1719 HIS A CE1 1 
ATOM   1750 N NE2 . HIS A 1 236 ? -17.211 4.503   -20.280 1.00 16.54  ? 1719 HIS A NE2 1 
ATOM   1751 N N   . THR A 1 237 ? -23.943 4.404   -20.360 1.00 23.30  ? 1720 THR A N   1 
ATOM   1752 C CA  . THR A 1 237 ? -25.319 4.334   -20.816 1.00 24.70  ? 1720 THR A CA  1 
ATOM   1753 C C   . THR A 1 237 ? -25.812 5.714   -21.268 1.00 26.56  ? 1720 THR A C   1 
ATOM   1754 O O   . THR A 1 237 ? -25.628 6.722   -20.567 1.00 26.58  ? 1720 THR A O   1 
ATOM   1755 C CB  . THR A 1 237 ? -26.220 3.821   -19.707 1.00 26.99  ? 1720 THR A CB  1 
ATOM   1756 O OG1 . THR A 1 237 ? -25.658 2.629   -19.148 1.00 26.85  ? 1720 THR A OG1 1 
ATOM   1757 C CG2 . THR A 1 237 ? -27.610 3.520   -20.251 1.00 27.18  ? 1720 THR A CG2 1 
ATOM   1758 N N   . THR A 1 238 ? -26.429 5.768   -22.447 1.00 27.22  ? 1721 THR A N   1 
ATOM   1759 C CA  . THR A 1 238 ? -26.939 7.042   -22.958 1.00 26.50  ? 1721 THR A CA  1 
ATOM   1760 C C   . THR A 1 238 ? -28.426 7.256   -22.665 1.00 25.51  ? 1721 THR A C   1 
ATOM   1761 O O   . THR A 1 238 ? -29.165 6.314   -22.406 1.00 23.48  ? 1721 THR A O   1 
ATOM   1762 C CB  . THR A 1 238 ? -26.736 7.179   -24.479 1.00 28.81  ? 1721 THR A CB  1 
ATOM   1763 O OG1 . THR A 1 238 ? -27.547 6.214   -25.166 1.00 32.05  ? 1721 THR A OG1 1 
ATOM   1764 C CG2 . THR A 1 238 ? -25.271 6.985   -24.841 1.00 27.01  ? 1721 THR A CG2 1 
ATOM   1765 N N   . ALA A 1 239 ? -28.843 8.517   -22.689 1.00 26.06  ? 1722 ALA A N   1 
ATOM   1766 C CA  . ALA A 1 239 ? -30.235 8.894   -22.445 1.00 26.45  ? 1722 ALA A CA  1 
ATOM   1767 C C   . ALA A 1 239 ? -31.154 8.201   -23.450 1.00 27.37  ? 1722 ALA A C   1 
ATOM   1768 O O   . ALA A 1 239 ? -32.228 7.713   -23.093 1.00 26.52  ? 1722 ALA A O   1 
ATOM   1769 C CB  . ALA A 1 239 ? -30.385 10.401  -22.568 1.00 26.27  ? 1722 ALA A CB  1 
ATOM   1770 N N   . GLY A 1 240 ? -30.719 8.179   -24.710 1.00 27.81  ? 1723 GLY A N   1 
ATOM   1771 C CA  . GLY A 1 240 ? -31.484 7.539   -25.749 1.00 27.42  ? 1723 GLY A CA  1 
ATOM   1772 C C   . GLY A 1 240 ? -31.757 6.074   -25.454 1.00 29.17  ? 1723 GLY A C   1 
ATOM   1773 O O   . GLY A 1 240 ? -32.864 5.576   -25.698 1.00 29.67  ? 1723 GLY A O   1 
ATOM   1774 N N   . GLU A 1 241 ? -30.768 5.369   -24.918 1.00 29.55  ? 1724 GLU A N   1 
ATOM   1775 C CA  . GLU A 1 241 ? -30.973 3.960   -24.630 1.00 31.21  ? 1724 GLU A CA  1 
ATOM   1776 C C   . GLU A 1 241 ? -32.006 3.759   -23.536 1.00 31.00  ? 1724 GLU A C   1 
ATOM   1777 O O   . GLU A 1 241 ? -32.874 2.887   -23.637 1.00 32.50  ? 1724 GLU A O   1 
ATOM   1778 C CB  . GLU A 1 241 ? -29.670 3.289   -24.216 1.00 33.82  ? 1724 GLU A CB  1 
ATOM   1779 C CG  . GLU A 1 241 ? -29.759 1.788   -24.412 1.00 39.61  ? 1724 GLU A CG  1 
ATOM   1780 C CD  . GLU A 1 241 ? -29.056 0.990   -23.333 1.00 42.34  ? 1724 GLU A CD  1 
ATOM   1781 O OE1 . GLU A 1 241 ? -27.793 1.007   -23.274 1.00 42.41  ? 1724 GLU A OE1 1 
ATOM   1782 O OE2 . GLU A 1 241 ? -29.785 0.339   -22.552 1.00 42.79  ? 1724 GLU A OE2 1 
ATOM   1783 N N   . VAL A 1 242 ? -31.899 4.554   -22.475 1.00 30.29  ? 1725 VAL A N   1 
ATOM   1784 C CA  . VAL A 1 242 ? -32.842 4.490   -21.373 1.00 28.27  ? 1725 VAL A CA  1 
ATOM   1785 C C   . VAL A 1 242 ? -34.223 4.795   -21.960 1.00 30.81  ? 1725 VAL A C   1 
ATOM   1786 O O   . VAL A 1 242 ? -35.176 4.035   -21.747 1.00 29.85  ? 1725 VAL A O   1 
ATOM   1787 C CB  . VAL A 1 242 ? -32.457 5.522   -20.279 1.00 29.49  ? 1725 VAL A CB  1 
ATOM   1788 C CG1 . VAL A 1 242 ? -33.595 5.718   -19.278 1.00 27.60  ? 1725 VAL A CG1 1 
ATOM   1789 C CG2 . VAL A 1 242 ? -31.197 5.044   -19.544 1.00 26.21  ? 1725 VAL A CG2 1 
ATOM   1790 N N   . VAL A 1 243 ? -34.317 5.885   -22.731 1.00 30.26  ? 1726 VAL A N   1 
ATOM   1791 C CA  . VAL A 1 243 ? -35.571 6.281   -23.356 1.00 29.97  ? 1726 VAL A CA  1 
ATOM   1792 C C   . VAL A 1 243 ? -36.194 5.149   -24.188 1.00 30.97  ? 1726 VAL A C   1 
ATOM   1793 O O   . VAL A 1 243 ? -37.391 4.859   -24.063 1.00 30.28  ? 1726 VAL A O   1 
ATOM   1794 C CB  . VAL A 1 243 ? -35.392 7.547   -24.257 1.00 28.78  ? 1726 VAL A CB  1 
ATOM   1795 C CG1 . VAL A 1 243 ? -36.640 7.757   -25.136 1.00 24.31  ? 1726 VAL A CG1 1 
ATOM   1796 C CG2 . VAL A 1 243 ? -35.204 8.781   -23.381 1.00 27.47  ? 1726 VAL A CG2 1 
ATOM   1797 N N   . GLU A 1 244 ? -35.384 4.516   -25.028 1.00 31.25  ? 1727 GLU A N   1 
ATOM   1798 C CA  . GLU A 1 244 ? -35.856 3.422   -25.865 1.00 32.55  ? 1727 GLU A CA  1 
ATOM   1799 C C   . GLU A 1 244 ? -36.327 2.273   -24.981 1.00 34.99  ? 1727 GLU A C   1 
ATOM   1800 O O   . GLU A 1 244 ? -37.365 1.647   -25.248 1.00 34.42  ? 1727 GLU A O   1 
ATOM   1801 C CB  . GLU A 1 244 ? -34.730 2.927   -26.783 1.00 32.39  ? 1727 GLU A CB  1 
ATOM   1802 N N   . LYS A 1 245 ? -35.566 2.001   -23.923 1.00 36.00  ? 1728 LYS A N   1 
ATOM   1803 C CA  . LYS A 1 245 ? -35.915 0.920   -23.009 1.00 38.34  ? 1728 LYS A CA  1 
ATOM   1804 C C   . LYS A 1 245 ? -37.261 1.193   -22.323 1.00 38.65  ? 1728 LYS A C   1 
ATOM   1805 O O   . LYS A 1 245 ? -38.125 0.315   -22.277 1.00 40.07  ? 1728 LYS A O   1 
ATOM   1806 C CB  . LYS A 1 245 ? -34.796 0.734   -21.963 1.00 39.27  ? 1728 LYS A CB  1 
ATOM   1807 N N   . LEU A 1 246 ? -37.433 2.411   -21.801 1.00 38.91  ? 1729 LEU A N   1 
ATOM   1808 C CA  . LEU A 1 246 ? -38.673 2.812   -21.122 1.00 39.66  ? 1729 LEU A CA  1 
ATOM   1809 C C   . LEU A 1 246 ? -39.871 2.768   -22.062 1.00 40.96  ? 1729 LEU A C   1 
ATOM   1810 O O   . LEU A 1 246 ? -40.962 2.388   -21.650 1.00 40.30  ? 1729 LEU A O   1 
ATOM   1811 C CB  . LEU A 1 246 ? -38.558 4.232   -20.529 1.00 37.20  ? 1729 LEU A CB  1 
ATOM   1812 C CG  . LEU A 1 246 ? -37.684 4.385   -19.273 1.00 36.53  ? 1729 LEU A CG  1 
ATOM   1813 C CD1 . LEU A 1 246 ? -37.380 5.866   -18.990 1.00 34.04  ? 1729 LEU A CD1 1 
ATOM   1814 C CD2 . LEU A 1 246 ? -38.409 3.743   -18.088 1.00 33.58  ? 1729 LEU A CD2 1 
ATOM   1815 N N   . ILE A 1 247 ? -39.667 3.167   -23.318 1.00 43.21  ? 1730 ILE A N   1 
ATOM   1816 C CA  . ILE A 1 247 ? -40.749 3.157   -24.296 1.00 45.08  ? 1730 ILE A CA  1 
ATOM   1817 C C   . ILE A 1 247 ? -41.266 1.743   -24.462 1.00 47.78  ? 1730 ILE A C   1 
ATOM   1818 O O   . ILE A 1 247 ? -42.478 1.510   -24.384 1.00 48.57  ? 1730 ILE A O   1 
ATOM   1819 C CB  . ILE A 1 247 ? -40.296 3.720   -25.665 1.00 43.58  ? 1730 ILE A CB  1 
ATOM   1820 C CG1 . ILE A 1 247 ? -40.231 5.254   -25.588 1.00 42.38  ? 1730 ILE A CG1 1 
ATOM   1821 C CG2 . ILE A 1 247 ? -41.229 3.253   -26.770 1.00 40.17  ? 1730 ILE A CG2 1 
ATOM   1822 C CD1 . ILE A 1 247 ? -39.907 5.941   -26.913 1.00 42.25  ? 1730 ILE A CD1 1 
ATOM   1823 N N   . ARG A 1 248 ? -40.351 0.798   -24.674 1.00 49.94  ? 1731 ARG A N   1 
ATOM   1824 C CA  . ARG A 1 248 ? -40.736 -0.600  -24.831 1.00 51.97  ? 1731 ARG A CA  1 
ATOM   1825 C C   . ARG A 1 248 ? -41.455 -1.019  -23.550 1.00 52.61  ? 1731 ARG A C   1 
ATOM   1826 O O   . ARG A 1 248 ? -42.578 -1.533  -23.589 1.00 52.86  ? 1731 ARG A O   1 
ATOM   1827 C CB  . ARG A 1 248 ? -39.503 -1.478  -25.030 1.00 54.14  ? 1731 ARG A CB  1 
ATOM   1828 C CG  . ARG A 1 248 ? -38.512 -0.979  -26.070 1.00 57.80  ? 1731 ARG A CG  1 
ATOM   1829 C CD  . ARG A 1 248 ? -39.027 -1.119  -27.497 1.00 59.76  ? 1731 ARG A CD  1 
ATOM   1830 N NE  . ARG A 1 248 ? -39.532 -2.463  -27.741 1.00 62.14  ? 1731 ARG A NE  1 
ATOM   1831 C CZ  . ARG A 1 248 ? -39.669 -3.008  -28.943 1.00 63.14  ? 1731 ARG A CZ  1 
ATOM   1832 N NH1 . ARG A 1 248 ? -39.330 -2.333  -30.032 1.00 63.33  ? 1731 ARG A NH1 1 
ATOM   1833 N NH2 . ARG A 1 248 ? -40.170 -4.231  -29.053 1.00 64.47  ? 1731 ARG A NH2 1 
ATOM   1834 N N   . GLY A 1 249 ? -40.804 -0.774  -22.415 1.00 52.31  ? 1732 GLY A N   1 
ATOM   1835 C CA  . GLY A 1 249 ? -41.379 -1.127  -21.129 1.00 53.38  ? 1732 GLY A CA  1 
ATOM   1836 C C   . GLY A 1 249 ? -42.840 -0.745  -20.916 1.00 54.29  ? 1732 GLY A C   1 
ATOM   1837 O O   . GLY A 1 249 ? -43.674 -1.610  -20.675 1.00 54.78  ? 1732 GLY A O   1 
ATOM   1838 N N   . LEU A 1 250 ? -43.151 0.546   -20.990 1.00 55.07  ? 1733 LEU A N   1 
ATOM   1839 C CA  . LEU A 1 250 ? -44.516 1.024   -20.786 1.00 54.90  ? 1733 LEU A CA  1 
ATOM   1840 C C   . LEU A 1 250 ? -45.416 0.662   -21.957 1.00 55.37  ? 1733 LEU A C   1 
ATOM   1841 O O   . LEU A 1 250 ? -46.559 1.112   -22.043 1.00 54.68  ? 1733 LEU A O   1 
ATOM   1842 C CB  . LEU A 1 250 ? -44.535 2.545   -20.559 1.00 54.59  ? 1733 LEU A CB  1 
ATOM   1843 C CG  . LEU A 1 250 ? -44.257 3.033   -19.131 1.00 54.64  ? 1733 LEU A CG  1 
ATOM   1844 C CD1 . LEU A 1 250 ? -42.872 2.579   -18.666 1.00 55.56  ? 1733 LEU A CD1 1 
ATOM   1845 C CD2 . LEU A 1 250 ? -44.356 4.552   -19.094 1.00 54.19  ? 1733 LEU A CD2 1 
ATOM   1846 N N   . ALA A 1 251 ? -44.890 -0.152  -22.865 1.00 55.99  ? 1734 ALA A N   1 
ATOM   1847 C CA  . ALA A 1 251 ? -45.667 -0.591  -24.016 1.00 55.75  ? 1734 ALA A CA  1 
ATOM   1848 C C   . ALA A 1 251 ? -46.158 0.577   -24.873 1.00 54.95  ? 1734 ALA A C   1 
ATOM   1849 O O   . ALA A 1 251 ? -47.365 0.817   -24.973 1.00 55.82  ? 1734 ALA A O   1 
ATOM   1850 C CB  . ALA A 1 251 ? -46.859 -1.425  -23.531 1.00 55.92  ? 1734 ALA A CB  1 
ATOM   1851 N N   . MET A 1 252 ? -45.228 1.303   -25.485 1.00 53.40  ? 1735 MET A N   1 
ATOM   1852 C CA  . MET A 1 252 ? -45.596 2.429   -26.334 1.00 52.82  ? 1735 MET A CA  1 
ATOM   1853 C C   . MET A 1 252 ? -44.759 2.411   -27.602 1.00 53.83  ? 1735 MET A C   1 
ATOM   1854 O O   . MET A 1 252 ? -44.487 3.448   -28.212 1.00 53.48  ? 1735 MET A O   1 
ATOM   1855 C CB  . MET A 1 252 ? -45.415 3.751   -25.586 1.00 50.70  ? 1735 MET A CB  1 
ATOM   1856 C CG  . MET A 1 252 ? -46.238 3.836   -24.310 1.00 49.03  ? 1735 MET A CG  1 
ATOM   1857 S SD  . MET A 1 252 ? -46.397 5.506   -23.650 1.00 48.23  ? 1735 MET A SD  1 
ATOM   1858 C CE  . MET A 1 252 ? -44.795 5.771   -22.887 1.00 49.52  ? 1735 MET A CE  1 
ATOM   1859 N N   . GLU A 1 253 ? -44.365 1.206   -27.994 1.00 56.05  ? 1736 GLU A N   1 
ATOM   1860 C CA  . GLU A 1 253 ? -43.560 1.004   -29.185 1.00 57.83  ? 1736 GLU A CA  1 
ATOM   1861 C C   . GLU A 1 253 ? -44.280 1.543   -30.428 1.00 57.53  ? 1736 GLU A C   1 
ATOM   1862 O O   . GLU A 1 253 ? -43.656 2.167   -31.292 1.00 57.17  ? 1736 GLU A O   1 
ATOM   1863 C CB  . GLU A 1 253 ? -43.237 -0.494  -29.354 1.00 60.54  ? 1736 GLU A CB  1 
ATOM   1864 C CG  . GLU A 1 253 ? -44.451 -1.391  -29.616 1.00 64.47  ? 1736 GLU A CG  1 
ATOM   1865 C CD  . GLU A 1 253 ? -45.050 -2.002  -28.348 1.00 67.49  ? 1736 GLU A CD  1 
ATOM   1866 O OE1 . GLU A 1 253 ? -46.226 -2.437  -28.403 1.00 69.29  ? 1736 GLU A OE1 1 
ATOM   1867 O OE2 . GLU A 1 253 ? -44.351 -2.065  -27.310 1.00 66.72  ? 1736 GLU A OE2 1 
ATOM   1868 N N   . ASP A 1 254 ? -45.590 1.318   -30.506 1.00 56.90  ? 1737 ASP A N   1 
ATOM   1869 C CA  . ASP A 1 254 ? -46.375 1.774   -31.648 1.00 57.33  ? 1737 ASP A CA  1 
ATOM   1870 C C   . ASP A 1 254 ? -46.752 3.247   -31.575 1.00 56.15  ? 1737 ASP A C   1 
ATOM   1871 O O   . ASP A 1 254 ? -47.634 3.707   -32.286 1.00 57.10  ? 1737 ASP A O   1 
ATOM   1872 C CB  . ASP A 1 254 ? -47.647 0.934   -31.789 1.00 60.54  ? 1737 ASP A CB  1 
ATOM   1873 C CG  . ASP A 1 254 ? -48.601 1.101   -30.609 1.00 65.06  ? 1737 ASP A CG  1 
ATOM   1874 O OD1 . ASP A 1 254 ? -49.688 0.473   -30.633 1.00 65.92  ? 1737 ASP A OD1 1 
ATOM   1875 O OD2 . ASP A 1 254 ? -48.268 1.853   -29.656 1.00 67.32  ? 1737 ASP A OD2 1 
ATOM   1876 N N   . SER A 1 255 ? -46.085 3.994   -30.713 1.00 55.36  ? 1738 SER A N   1 
ATOM   1877 C CA  . SER A 1 255 ? -46.375 5.408   -30.582 1.00 53.48  ? 1738 SER A CA  1 
ATOM   1878 C C   . SER A 1 255 ? -45.944 6.174   -31.829 1.00 53.25  ? 1738 SER A C   1 
ATOM   1879 O O   . SER A 1 255 ? -44.955 5.831   -32.475 1.00 51.03  ? 1738 SER A O   1 
ATOM   1880 C CB  . SER A 1 255 ? -45.659 5.984   -29.362 1.00 53.63  ? 1738 SER A CB  1 
ATOM   1881 O OG  . SER A 1 255 ? -45.904 7.374   -29.251 1.00 50.56  ? 1738 SER A OG  1 
ATOM   1882 N N   . ARG A 1 256 ? -46.701 7.218   -32.153 1.00 54.14  ? 1739 ARG A N   1 
ATOM   1883 C CA  . ARG A 1 256 ? -46.410 8.057   -33.304 1.00 54.54  ? 1739 ARG A CA  1 
ATOM   1884 C C   . ARG A 1 256 ? -45.738 9.345   -32.848 1.00 53.42  ? 1739 ARG A C   1 
ATOM   1885 O O   . ARG A 1 256 ? -45.389 10.197  -33.660 1.00 55.05  ? 1739 ARG A O   1 
ATOM   1886 C CB  . ARG A 1 256 ? -47.697 8.396   -34.064 1.00 57.59  ? 1739 ARG A CB  1 
ATOM   1887 C CG  . ARG A 1 256 ? -48.022 7.456   -35.207 1.00 60.70  ? 1739 ARG A CG  1 
ATOM   1888 C CD  . ARG A 1 256 ? -48.983 8.128   -36.183 1.00 66.23  ? 1739 ARG A CD  1 
ATOM   1889 N NE  . ARG A 1 256 ? -50.395 7.936   -35.842 1.00 70.34  ? 1739 ARG A NE  1 
ATOM   1890 C CZ  . ARG A 1 256 ? -51.093 6.843   -36.145 1.00 72.41  ? 1739 ARG A CZ  1 
ATOM   1891 N NH1 . ARG A 1 256 ? -50.510 5.841   -36.800 1.00 73.16  ? 1739 ARG A NH1 1 
ATOM   1892 N NH2 . ARG A 1 256 ? -52.374 6.747   -35.797 1.00 72.68  ? 1739 ARG A NH2 1 
ATOM   1893 N N   . ASN A 1 257 ? -45.565 9.495   -31.542 1.00 50.80  ? 1740 ASN A N   1 
ATOM   1894 C CA  . ASN A 1 257 ? -44.919 10.687  -31.012 1.00 46.70  ? 1740 ASN A CA  1 
ATOM   1895 C C   . ASN A 1 257 ? -43.532 10.345  -30.515 1.00 45.00  ? 1740 ASN A C   1 
ATOM   1896 O O   . ASN A 1 257 ? -43.128 9.185   -30.511 1.00 45.54  ? 1740 ASN A O   1 
ATOM   1897 C CB  . ASN A 1 257 ? -45.743 11.263  -29.868 1.00 45.12  ? 1740 ASN A CB  1 
ATOM   1898 C CG  . ASN A 1 257 ? -47.130 11.661  -30.304 1.00 43.59  ? 1740 ASN A CG  1 
ATOM   1899 O OD1 . ASN A 1 257 ? -47.303 12.586  -31.100 1.00 43.24  ? 1740 ASN A OD1 1 
ATOM   1900 N ND2 . ASN A 1 257 ? -48.130 10.962  -29.791 1.00 41.84  ? 1740 ASN A ND2 1 
ATOM   1901 N N   . MET A 1 258 ? -42.798 11.358  -30.091 1.00 43.87  ? 1741 MET A N   1 
ATOM   1902 C CA  . MET A 1 258 ? -41.460 11.137  -29.585 1.00 42.14  ? 1741 MET A CA  1 
ATOM   1903 C C   . MET A 1 258 ? -41.366 11.442  -28.083 1.00 39.12  ? 1741 MET A C   1 
ATOM   1904 O O   . MET A 1 258 ? -41.967 12.393  -27.594 1.00 37.69  ? 1741 MET A O   1 
ATOM   1905 C CB  . MET A 1 258 ? -40.473 12.008  -30.348 1.00 45.74  ? 1741 MET A CB  1 
ATOM   1906 C CG  . MET A 1 258 ? -39.026 11.698  -30.010 1.00 51.06  ? 1741 MET A CG  1 
ATOM   1907 S SD  . MET A 1 258 ? -37.919 13.024  -30.489 1.00 60.02  ? 1741 MET A SD  1 
ATOM   1908 C CE  . MET A 1 258 ? -38.126 12.969  -32.285 1.00 58.87  ? 1741 MET A CE  1 
ATOM   1909 N N   . PHE A 1 259 ? -40.602 10.629  -27.361 1.00 36.16  ? 1742 PHE A N   1 
ATOM   1910 C CA  . PHE A 1 259 ? -40.407 10.809  -25.923 1.00 34.82  ? 1742 PHE A CA  1 
ATOM   1911 C C   . PHE A 1 259 ? -38.940 11.174  -25.657 1.00 34.70  ? 1742 PHE A C   1 
ATOM   1912 O O   . PHE A 1 259 ? -38.123 11.149  -26.573 1.00 37.03  ? 1742 PHE A O   1 
ATOM   1913 C CB  . PHE A 1 259 ? -40.752 9.514   -25.193 1.00 32.75  ? 1742 PHE A CB  1 
ATOM   1914 C CG  . PHE A 1 259 ? -42.185 9.112   -25.328 1.00 30.49  ? 1742 PHE A CG  1 
ATOM   1915 C CD1 . PHE A 1 259 ? -43.081 9.354   -24.304 1.00 28.27  ? 1742 PHE A CD1 1 
ATOM   1916 C CD2 . PHE A 1 259 ? -42.645 8.523   -26.497 1.00 29.27  ? 1742 PHE A CD2 1 
ATOM   1917 C CE1 . PHE A 1 259 ? -44.426 9.019   -24.432 1.00 31.05  ? 1742 PHE A CE1 1 
ATOM   1918 C CE2 . PHE A 1 259 ? -43.988 8.185   -26.639 1.00 32.04  ? 1742 PHE A CE2 1 
ATOM   1919 C CZ  . PHE A 1 259 ? -44.886 8.434   -25.600 1.00 30.91  ? 1742 PHE A CZ  1 
ATOM   1920 N N   . ALA A 1 260 ? -38.602 11.498  -24.413 1.00 32.99  ? 1743 ALA A N   1 
ATOM   1921 C CA  . ALA A 1 260 ? -37.223 11.837  -24.058 1.00 30.33  ? 1743 ALA A CA  1 
ATOM   1922 C C   . ALA A 1 260 ? -37.049 11.931  -22.563 1.00 30.86  ? 1743 ALA A C   1 
ATOM   1923 O O   . ALA A 1 260 ? -38.020 11.897  -21.819 1.00 28.67  ? 1743 ALA A O   1 
ATOM   1924 C CB  . ALA A 1 260 ? -36.824 13.161  -24.682 1.00 31.65  ? 1743 ALA A CB  1 
ATOM   1925 N N   . LEU A 1 261 ? -35.796 12.040  -22.127 1.00 33.18  ? 1744 LEU A N   1 
ATOM   1926 C CA  . LEU A 1 261 ? -35.492 12.196  -20.715 1.00 33.83  ? 1744 LEU A CA  1 
ATOM   1927 C C   . LEU A 1 261 ? -35.344 13.698  -20.442 1.00 34.89  ? 1744 LEU A C   1 
ATOM   1928 O O   . LEU A 1 261 ? -34.960 14.467  -21.326 1.00 33.38  ? 1744 LEU A O   1 
ATOM   1929 C CB  . LEU A 1 261 ? -34.196 11.480  -20.359 1.00 35.81  ? 1744 LEU A CB  1 
ATOM   1930 C CG  . LEU A 1 261 ? -34.300 10.188  -19.557 1.00 36.67  ? 1744 LEU A CG  1 
ATOM   1931 C CD1 . LEU A 1 261 ? -32.883 9.771   -19.150 1.00 36.47  ? 1744 LEU A CD1 1 
ATOM   1932 C CD2 . LEU A 1 261 ? -35.165 10.386  -18.315 1.00 35.61  ? 1744 LEU A CD2 1 
ATOM   1933 N N   . PHE A 1 262 ? -35.632 14.105  -19.211 1.00 36.39  ? 1745 PHE A N   1 
ATOM   1934 C CA  . PHE A 1 262 ? -35.567 15.513  -18.830 1.00 38.77  ? 1745 PHE A CA  1 
ATOM   1935 C C   . PHE A 1 262 ? -34.980 15.694  -17.441 1.00 39.88  ? 1745 PHE A C   1 
ATOM   1936 O O   . PHE A 1 262 ? -35.009 14.776  -16.620 1.00 39.14  ? 1745 PHE A O   1 
ATOM   1937 C CB  . PHE A 1 262 ? -36.987 16.138  -18.811 1.00 37.56  ? 1745 PHE A CB  1 
ATOM   1938 C CG  . PHE A 1 262 ? -37.633 16.265  -20.165 1.00 36.28  ? 1745 PHE A CG  1 
ATOM   1939 C CD1 . PHE A 1 262 ? -37.652 17.487  -20.826 1.00 34.66  ? 1745 PHE A CD1 1 
ATOM   1940 C CD2 . PHE A 1 262 ? -38.232 15.160  -20.773 1.00 36.40  ? 1745 PHE A CD2 1 
ATOM   1941 C CE1 . PHE A 1 262 ? -38.257 17.616  -22.077 1.00 36.77  ? 1745 PHE A CE1 1 
ATOM   1942 C CE2 . PHE A 1 262 ? -38.841 15.267  -22.023 1.00 37.62  ? 1745 PHE A CE2 1 
ATOM   1943 C CZ  . PHE A 1 262 ? -38.857 16.502  -22.683 1.00 37.79  ? 1745 PHE A CZ  1 
ATOM   1944 N N   . GLU A 1 263 ? -34.473 16.901  -17.194 1.00 42.24  ? 1746 GLU A N   1 
ATOM   1945 C CA  . GLU A 1 263 ? -33.949 17.277  -15.894 1.00 44.03  ? 1746 GLU A CA  1 
ATOM   1946 C C   . GLU A 1 263 ? -35.018 18.200  -15.307 1.00 46.63  ? 1746 GLU A C   1 
ATOM   1947 O O   . GLU A 1 263 ? -35.457 19.134  -15.976 1.00 44.03  ? 1746 GLU A O   1 
ATOM   1948 C CB  . GLU A 1 263 ? -32.651 18.055  -16.037 1.00 44.46  ? 1746 GLU A CB  1 
ATOM   1949 C CG  . GLU A 1 263 ? -31.680 17.495  -17.030 1.00 42.87  ? 1746 GLU A CG  1 
ATOM   1950 C CD  . GLU A 1 263 ? -30.399 18.294  -17.054 1.00 43.86  ? 1746 GLU A CD  1 
ATOM   1951 O OE1 . GLU A 1 263 ? -29.467 17.911  -17.791 1.00 44.49  ? 1746 GLU A OE1 1 
ATOM   1952 O OE2 . GLU A 1 263 ? -30.318 19.312  -16.328 1.00 46.20  ? 1746 GLU A OE2 1 
ATOM   1953 N N   . TYR A 1 264 ? -35.420 17.927  -14.066 1.00 51.99  ? 1747 TYR A N   1 
ATOM   1954 C CA  . TYR A 1 264 ? -36.442 18.698  -13.349 1.00 57.71  ? 1747 TYR A CA  1 
ATOM   1955 C C   . TYR A 1 264 ? -36.008 19.003  -11.917 1.00 59.95  ? 1747 TYR A C   1 
ATOM   1956 O O   . TYR A 1 264 ? -35.426 18.159  -11.229 1.00 59.74  ? 1747 TYR A O   1 
ATOM   1957 C CB  . TYR A 1 264 ? -37.744 17.905  -13.266 1.00 62.28  ? 1747 TYR A CB  1 
ATOM   1958 C CG  . TYR A 1 264 ? -38.870 18.388  -14.139 1.00 67.58  ? 1747 TYR A CG  1 
ATOM   1959 C CD1 . TYR A 1 264 ? -39.830 19.283  -13.656 1.00 69.76  ? 1747 TYR A CD1 1 
ATOM   1960 C CD2 . TYR A 1 264 ? -39.012 17.903  -15.437 1.00 70.35  ? 1747 TYR A CD2 1 
ATOM   1961 C CE1 . TYR A 1 264 ? -40.906 19.671  -14.454 1.00 72.07  ? 1747 TYR A CE1 1 
ATOM   1962 C CE2 . TYR A 1 264 ? -40.078 18.281  -16.237 1.00 72.22  ? 1747 TYR A CE2 1 
ATOM   1963 C CZ  . TYR A 1 264 ? -41.017 19.157  -15.745 1.00 73.55  ? 1747 TYR A CZ  1 
ATOM   1964 O OH  . TYR A 1 264 ? -42.069 19.493  -16.561 1.00 76.72  ? 1747 TYR A OH  1 
ATOM   1965 N N   . ASN A 1 265 ? -36.323 20.208  -11.462 1.00 63.27  ? 1748 ASN A N   1 
ATOM   1966 C CA  . ASN A 1 265 ? -35.991 20.630  -10.109 1.00 65.52  ? 1748 ASN A CA  1 
ATOM   1967 C C   . ASN A 1 265 ? -37.246 21.269  -9.535  1.00 66.94  ? 1748 ASN A C   1 
ATOM   1968 O O   . ASN A 1 265 ? -37.248 21.736  -8.393  1.00 67.62  ? 1748 ASN A O   1 
ATOM   1969 C CB  . ASN A 1 265 ? -34.863 21.658  -10.134 1.00 66.73  ? 1748 ASN A CB  1 
ATOM   1970 C CG  . ASN A 1 265 ? -35.320 23.002  -10.656 1.00 67.48  ? 1748 ASN A CG  1 
ATOM   1971 O OD1 . ASN A 1 265 ? -36.277 23.086  -11.436 1.00 65.70  ? 1748 ASN A OD1 1 
ATOM   1972 N ND2 . ASN A 1 265 ? -34.627 24.065  -10.243 1.00 67.66  ? 1748 ASN A ND2 1 
ATOM   1973 N N   . GLY A 1 266 ? -38.303 21.281  -10.349 1.00 67.01  ? 1749 GLY A N   1 
ATOM   1974 C CA  . GLY A 1 266 ? -39.570 21.860  -9.941  1.00 68.22  ? 1749 GLY A CA  1 
ATOM   1975 C C   . GLY A 1 266 ? -40.111 22.812  -11.000 1.00 68.90  ? 1749 GLY A C   1 
ATOM   1976 O O   . GLY A 1 266 ? -41.172 22.567  -11.592 1.00 68.72  ? 1749 GLY A O   1 
ATOM   1977 N N   . HIS A 1 267 ? -39.369 23.896  -11.237 1.00 68.38  ? 1750 HIS A N   1 
ATOM   1978 C CA  . HIS A 1 267 ? -39.733 24.918  -12.221 1.00 67.13  ? 1750 HIS A CA  1 
ATOM   1979 C C   . HIS A 1 267 ? -39.051 24.624  -13.552 1.00 66.39  ? 1750 HIS A C   1 
ATOM   1980 O O   . HIS A 1 267 ? -39.701 24.514  -14.603 1.00 66.78  ? 1750 HIS A O   1 
ATOM   1981 C CB  . HIS A 1 267 ? -39.287 26.297  -11.729 1.00 67.37  ? 1750 HIS A CB  1 
ATOM   1982 N N   . VAL A 1 268 ? -37.728 24.500  -13.475 1.00 63.78  ? 1751 VAL A N   1 
ATOM   1983 C CA  . VAL A 1 268 ? -36.864 24.221  -14.609 1.00 61.49  ? 1751 VAL A CA  1 
ATOM   1984 C C   . VAL A 1 268 ? -37.060 22.831  -15.228 1.00 60.73  ? 1751 VAL A C   1 
ATOM   1985 O O   . VAL A 1 268 ? -37.249 21.829  -14.528 1.00 60.66  ? 1751 VAL A O   1 
ATOM   1986 C CB  . VAL A 1 268 ? -35.383 24.396  -14.186 1.00 61.17  ? 1751 VAL A CB  1 
ATOM   1987 C CG1 . VAL A 1 268 ? -34.440 23.999  -15.318 1.00 59.60  ? 1751 VAL A CG1 1 
ATOM   1988 C CG2 . VAL A 1 268 ? -35.146 25.844  -13.772 1.00 60.23  ? 1751 VAL A CG2 1 
ATOM   1989 N N   . ASP A 1 269 ? -37.020 22.796  -16.559 1.00 58.96  ? 1752 ASP A N   1 
ATOM   1990 C CA  . ASP A 1 269 ? -37.158 21.569  -17.328 1.00 57.12  ? 1752 ASP A CA  1 
ATOM   1991 C C   . ASP A 1 269 ? -36.308 21.669  -18.597 1.00 55.24  ? 1752 ASP A C   1 
ATOM   1992 O O   . ASP A 1 269 ? -36.443 22.614  -19.367 1.00 56.90  ? 1752 ASP A O   1 
ATOM   1993 C CB  . ASP A 1 269 ? -38.616 21.335  -17.690 1.00 60.00  ? 1752 ASP A CB  1 
ATOM   1994 C CG  . ASP A 1 269 ? -38.806 20.080  -18.493 1.00 63.66  ? 1752 ASP A CG  1 
ATOM   1995 O OD1 . ASP A 1 269 ? -37.988 19.154  -18.304 1.00 67.95  ? 1752 ASP A OD1 1 
ATOM   1996 O OD2 . ASP A 1 269 ? -39.762 20.006  -19.297 1.00 64.97  ? 1752 ASP A OD2 1 
ATOM   1997 N N   . LYS A 1 270 ? -35.422 20.701  -18.809 1.00 51.75  ? 1753 LYS A N   1 
ATOM   1998 C CA  . LYS A 1 270 ? -34.552 20.726  -19.981 1.00 47.30  ? 1753 LYS A CA  1 
ATOM   1999 C C   . LYS A 1 270 ? -34.461 19.341  -20.618 1.00 42.69  ? 1753 LYS A C   1 
ATOM   2000 O O   . LYS A 1 270 ? -34.326 18.340  -19.920 1.00 42.36  ? 1753 LYS A O   1 
ATOM   2001 C CB  . LYS A 1 270 ? -33.161 21.220  -19.567 1.00 49.37  ? 1753 LYS A CB  1 
ATOM   2002 C CG  . LYS A 1 270 ? -33.209 22.481  -18.714 1.00 52.47  ? 1753 LYS A CG  1 
ATOM   2003 C CD  . LYS A 1 270 ? -31.819 23.069  -18.409 1.00 55.95  ? 1753 LYS A CD  1 
ATOM   2004 C CE  . LYS A 1 270 ? -31.101 22.344  -17.261 1.00 57.27  ? 1753 LYS A CE  1 
ATOM   2005 N NZ  . LYS A 1 270 ? -29.663 22.778  -17.139 1.00 58.32  ? 1753 LYS A NZ  1 
ATOM   2006 N N   . ALA A 1 271 ? -34.542 19.286  -21.939 1.00 38.29  ? 1754 ALA A N   1 
ATOM   2007 C CA  . ALA A 1 271 ? -34.486 18.015  -22.643 1.00 36.65  ? 1754 ALA A CA  1 
ATOM   2008 C C   . ALA A 1 271 ? -33.069 17.488  -22.770 1.00 36.50  ? 1754 ALA A C   1 
ATOM   2009 O O   . ALA A 1 271 ? -32.164 18.212  -23.213 1.00 37.91  ? 1754 ALA A O   1 
ATOM   2010 C CB  . ALA A 1 271 ? -35.095 18.149  -24.020 1.00 34.94  ? 1754 ALA A CB  1 
ATOM   2011 N N   . ILE A 1 272 ? -32.882 16.223  -22.399 1.00 33.54  ? 1755 ILE A N   1 
ATOM   2012 C CA  . ILE A 1 272 ? -31.572 15.592  -22.488 1.00 32.38  ? 1755 ILE A CA  1 
ATOM   2013 C C   . ILE A 1 272 ? -31.336 15.005  -23.869 1.00 32.93  ? 1755 ILE A C   1 
ATOM   2014 O O   . ILE A 1 272 ? -32.146 14.233  -24.374 1.00 29.38  ? 1755 ILE A O   1 
ATOM   2015 C CB  . ILE A 1 272 ? -31.410 14.462  -21.457 1.00 31.49  ? 1755 ILE A CB  1 
ATOM   2016 C CG1 . ILE A 1 272 ? -31.389 15.048  -20.046 1.00 30.18  ? 1755 ILE A CG1 1 
ATOM   2017 C CG2 . ILE A 1 272 ? -30.143 13.655  -21.761 1.00 30.72  ? 1755 ILE A CG2 1 
ATOM   2018 C CD1 . ILE A 1 272 ? -31.371 14.027  -18.970 1.00 29.90  ? 1755 ILE A CD1 1 
ATOM   2019 N N   . GLU A 1 273 ? -30.207 15.362  -24.465 1.00 35.54  ? 1756 GLU A N   1 
ATOM   2020 C CA  . GLU A 1 273 ? -29.866 14.869  -25.791 1.00 38.58  ? 1756 GLU A CA  1 
ATOM   2021 C C   . GLU A 1 273 ? -29.665 13.362  -25.751 1.00 38.72  ? 1756 GLU A C   1 
ATOM   2022 O O   . GLU A 1 273 ? -29.117 12.817  -24.789 1.00 39.20  ? 1756 GLU A O   1 
ATOM   2023 C CB  . GLU A 1 273 ? -28.619 15.586  -26.308 1.00 42.91  ? 1756 GLU A CB  1 
ATOM   2024 C CG  . GLU A 1 273 ? -28.769 17.115  -26.245 1.00 48.42  ? 1756 GLU A CG  1 
ATOM   2025 C CD  . GLU A 1 273 ? -28.137 17.830  -27.424 1.00 52.37  ? 1756 GLU A CD  1 
ATOM   2026 O OE1 . GLU A 1 273 ? -27.039 18.433  -27.260 1.00 52.19  ? 1756 GLU A OE1 1 
ATOM   2027 O OE2 . GLU A 1 273 ? -28.752 17.777  -28.518 1.00 53.63  ? 1756 GLU A OE2 1 
ATOM   2028 N N   . SER A 1 274 ? -30.139 12.696  -26.798 1.00 37.48  ? 1757 SER A N   1 
ATOM   2029 C CA  . SER A 1 274 ? -30.066 11.253  -26.901 1.00 36.07  ? 1757 SER A CA  1 
ATOM   2030 C C   . SER A 1 274 ? -28.703 10.643  -26.600 1.00 34.81  ? 1757 SER A C   1 
ATOM   2031 O O   . SER A 1 274 ? -28.618 9.585   -25.967 1.00 34.78  ? 1757 SER A O   1 
ATOM   2032 C CB  . SER A 1 274 ? -30.525 10.829  -28.291 1.00 36.73  ? 1757 SER A CB  1 
ATOM   2033 O OG  . SER A 1 274 ? -30.161 9.486   -28.558 1.00 42.37  ? 1757 SER A OG  1 
ATOM   2034 N N   . ARG A 1 275 ? -27.650 11.312  -27.058 1.00 33.47  ? 1758 ARG A N   1 
ATOM   2035 C CA  . ARG A 1 275 ? -26.266 10.853  -26.893 1.00 31.32  ? 1758 ARG A CA  1 
ATOM   2036 C C   . ARG A 1 275 ? -25.621 11.167  -25.543 1.00 30.68  ? 1758 ARG A C   1 
ATOM   2037 O O   . ARG A 1 275 ? -24.486 10.759  -25.286 1.00 31.27  ? 1758 ARG A O   1 
ATOM   2038 C CB  . ARG A 1 275 ? -25.384 11.454  -27.995 1.00 30.55  ? 1758 ARG A CB  1 
ATOM   2039 N N   . THR A 1 276 ? -26.329 11.892  -24.684 1.00 28.71  ? 1759 THR A N   1 
ATOM   2040 C CA  . THR A 1 276 ? -25.780 12.256  -23.383 1.00 26.05  ? 1759 THR A CA  1 
ATOM   2041 C C   . THR A 1 276 ? -25.709 11.077  -22.425 1.00 25.93  ? 1759 THR A C   1 
ATOM   2042 O O   . THR A 1 276 ? -26.626 10.246  -22.359 1.00 27.10  ? 1759 THR A O   1 
ATOM   2043 C CB  . THR A 1 276 ? -26.595 13.374  -22.744 1.00 25.81  ? 1759 THR A CB  1 
ATOM   2044 O OG1 . THR A 1 276 ? -26.589 14.505  -23.622 1.00 27.51  ? 1759 THR A OG1 1 
ATOM   2045 C CG2 . THR A 1 276 ? -26.010 13.767  -21.384 1.00 23.90  ? 1759 THR A CG2 1 
ATOM   2046 N N   . VAL A 1 277 ? -24.607 11.007  -21.694 1.00 22.10  ? 1760 VAL A N   1 
ATOM   2047 C CA  . VAL A 1 277 ? -24.383 9.946   -20.736 1.00 20.63  ? 1760 VAL A CA  1 
ATOM   2048 C C   . VAL A 1 277 ? -25.160 10.234  -19.474 1.00 19.22  ? 1760 VAL A C   1 
ATOM   2049 O O   . VAL A 1 277 ? -24.920 11.236  -18.832 1.00 21.03  ? 1760 VAL A O   1 
ATOM   2050 C CB  . VAL A 1 277 ? -22.859 9.829   -20.422 1.00 21.66  ? 1760 VAL A CB  1 
ATOM   2051 C CG1 . VAL A 1 277 ? -22.611 8.985   -19.139 1.00 19.73  ? 1760 VAL A CG1 1 
ATOM   2052 C CG2 . VAL A 1 277 ? -22.158 9.221   -21.622 1.00 19.24  ? 1760 VAL A CG2 1 
ATOM   2053 N N   . VAL A 1 278 ? -26.088 9.356   -19.111 1.00 18.93  ? 1761 VAL A N   1 
ATOM   2054 C CA  . VAL A 1 278 ? -26.892 9.566   -17.913 1.00 18.48  ? 1761 VAL A CA  1 
ATOM   2055 C C   . VAL A 1 278 ? -25.990 9.863   -16.696 1.00 19.80  ? 1761 VAL A C   1 
ATOM   2056 O O   . VAL A 1 278 ? -26.135 10.912  -16.046 1.00 19.74  ? 1761 VAL A O   1 
ATOM   2057 C CB  . VAL A 1 278 ? -27.832 8.324   -17.660 1.00 21.65  ? 1761 VAL A CB  1 
ATOM   2058 C CG1 . VAL A 1 278 ? -28.691 8.503   -16.379 1.00 14.88  ? 1761 VAL A CG1 1 
ATOM   2059 C CG2 . VAL A 1 278 ? -28.742 8.129   -18.866 1.00 16.90  ? 1761 VAL A CG2 1 
ATOM   2060 N N   . ALA A 1 279 ? -25.041 8.972   -16.408 1.00 19.16  ? 1762 ALA A N   1 
ATOM   2061 C CA  . ALA A 1 279 ? -24.107 9.175   -15.287 1.00 17.43  ? 1762 ALA A CA  1 
ATOM   2062 C C   . ALA A 1 279 ? -23.604 10.612  -15.248 1.00 17.42  ? 1762 ALA A C   1 
ATOM   2063 O O   . ALA A 1 279 ? -23.449 11.184  -14.167 1.00 14.49  ? 1762 ALA A O   1 
ATOM   2064 C CB  . ALA A 1 279 ? -22.931 8.231   -15.404 1.00 18.09  ? 1762 ALA A CB  1 
ATOM   2065 N N   . ASP A 1 280 ? -23.338 11.190  -16.421 1.00 18.26  ? 1763 ASP A N   1 
ATOM   2066 C CA  . ASP A 1 280 ? -22.885 12.581  -16.486 1.00 22.63  ? 1763 ASP A CA  1 
ATOM   2067 C C   . ASP A 1 280 ? -23.959 13.566  -15.929 1.00 23.57  ? 1763 ASP A C   1 
ATOM   2068 O O   . ASP A 1 280 ? -23.628 14.457  -15.122 1.00 23.95  ? 1763 ASP A O   1 
ATOM   2069 C CB  . ASP A 1 280 ? -22.492 12.950  -17.929 1.00 25.94  ? 1763 ASP A CB  1 
ATOM   2070 C CG  . ASP A 1 280 ? -21.330 13.960  -17.983 1.00 28.44  ? 1763 ASP A CG  1 
ATOM   2071 O OD1 . ASP A 1 280 ? -20.345 13.774  -17.244 1.00 29.48  ? 1763 ASP A OD1 1 
ATOM   2072 O OD2 . ASP A 1 280 ? -21.391 14.928  -18.761 1.00 30.08  ? 1763 ASP A OD2 1 
ATOM   2073 N N   . VAL A 1 281 ? -25.227 13.409  -16.328 1.00 20.83  ? 1764 VAL A N   1 
ATOM   2074 C CA  . VAL A 1 281 ? -26.283 14.271  -15.795 1.00 21.62  ? 1764 VAL A CA  1 
ATOM   2075 C C   . VAL A 1 281 ? -26.411 13.995  -14.285 1.00 22.11  ? 1764 VAL A C   1 
ATOM   2076 O O   . VAL A 1 281 ? -26.663 14.898  -13.473 1.00 21.30  ? 1764 VAL A O   1 
ATOM   2077 C CB  . VAL A 1 281 ? -27.659 14.004  -16.477 1.00 22.64  ? 1764 VAL A CB  1 
ATOM   2078 C CG1 . VAL A 1 281 ? -28.762 14.721  -15.736 1.00 22.20  ? 1764 VAL A CG1 1 
ATOM   2079 C CG2 . VAL A 1 281 ? -27.636 14.504  -17.905 1.00 24.19  ? 1764 VAL A CG2 1 
ATOM   2080 N N   . LEU A 1 282 ? -26.235 12.739  -13.907 1.00 23.31  ? 1765 LEU A N   1 
ATOM   2081 C CA  . LEU A 1 282 ? -26.300 12.381  -12.492 1.00 25.23  ? 1765 LEU A CA  1 
ATOM   2082 C C   . LEU A 1 282 ? -25.155 13.077  -11.737 1.00 25.07  ? 1765 LEU A C   1 
ATOM   2083 O O   . LEU A 1 282 ? -25.326 13.505  -10.601 1.00 23.42  ? 1765 LEU A O   1 
ATOM   2084 C CB  . LEU A 1 282 ? -26.175 10.871  -12.310 1.00 24.81  ? 1765 LEU A CB  1 
ATOM   2085 C CG  . LEU A 1 282 ? -27.361 10.060  -11.798 1.00 26.59  ? 1765 LEU A CG  1 
ATOM   2086 C CD1 . LEU A 1 282 ? -28.488 10.959  -11.229 1.00 26.27  ? 1765 LEU A CD1 1 
ATOM   2087 C CD2 . LEU A 1 282 ? -27.850 9.232   -12.928 1.00 25.48  ? 1765 LEU A CD2 1 
ATOM   2088 N N   . ALA A 1 283 ? -23.996 13.195  -12.379 1.00 25.32  ? 1766 ALA A N   1 
ATOM   2089 C CA  . ALA A 1 283 ? -22.867 13.846  -11.727 1.00 28.46  ? 1766 ALA A CA  1 
ATOM   2090 C C   . ALA A 1 283 ? -23.165 15.336  -11.557 1.00 30.17  ? 1766 ALA A C   1 
ATOM   2091 O O   . ALA A 1 283 ? -22.813 15.946  -10.541 1.00 30.50  ? 1766 ALA A O   1 
ATOM   2092 C CB  . ALA A 1 283 ? -21.618 13.651  -12.536 1.00 28.07  ? 1766 ALA A CB  1 
ATOM   2093 N N   . LYS A 1 284 ? -23.821 15.915  -12.559 1.00 30.85  ? 1767 LYS A N   1 
ATOM   2094 C CA  . LYS A 1 284 ? -24.200 17.319  -12.517 1.00 30.16  ? 1767 LYS A CA  1 
ATOM   2095 C C   . LYS A 1 284 ? -25.209 17.565  -11.372 1.00 29.69  ? 1767 LYS A C   1 
ATOM   2096 O O   . LYS A 1 284 ? -25.090 18.533  -10.637 1.00 24.66  ? 1767 LYS A O   1 
ATOM   2097 C CB  . LYS A 1 284 ? -24.802 17.709  -13.865 1.00 32.94  ? 1767 LYS A CB  1 
ATOM   2098 C CG  . LYS A 1 284 ? -25.393 19.119  -13.934 1.00 34.58  ? 1767 LYS A CG  1 
ATOM   2099 C CD  . LYS A 1 284 ? -25.956 19.328  -15.317 1.00 36.00  ? 1767 LYS A CD  1 
ATOM   2100 C CE  . LYS A 1 284 ? -26.994 20.411  -15.374 1.00 37.96  ? 1767 LYS A CE  1 
ATOM   2101 N NZ  . LYS A 1 284 ? -27.705 20.285  -16.684 1.00 41.42  ? 1767 LYS A NZ  1 
ATOM   2102 N N   . PHE A 1 285 ? -26.203 16.689  -11.217 1.00 30.87  ? 1768 PHE A N   1 
ATOM   2103 C CA  . PHE A 1 285 ? -27.171 16.858  -10.133 1.00 30.95  ? 1768 PHE A CA  1 
ATOM   2104 C C   . PHE A 1 285 ? -26.441 16.915  -8.787  1.00 32.29  ? 1768 PHE A C   1 
ATOM   2105 O O   . PHE A 1 285 ? -26.864 17.624  -7.877  1.00 33.27  ? 1768 PHE A O   1 
ATOM   2106 C CB  . PHE A 1 285 ? -28.195 15.706  -10.091 1.00 27.93  ? 1768 PHE A CB  1 
ATOM   2107 C CG  . PHE A 1 285 ? -29.184 15.706  -11.235 1.00 29.52  ? 1768 PHE A CG  1 
ATOM   2108 C CD1 . PHE A 1 285 ? -29.292 16.797  -12.095 1.00 28.65  ? 1768 PHE A CD1 1 
ATOM   2109 C CD2 . PHE A 1 285 ? -30.004 14.596  -11.459 1.00 29.01  ? 1768 PHE A CD2 1 
ATOM   2110 C CE1 . PHE A 1 285 ? -30.198 16.789  -13.160 1.00 29.07  ? 1768 PHE A CE1 1 
ATOM   2111 C CE2 . PHE A 1 285 ? -30.913 14.575  -12.518 1.00 30.56  ? 1768 PHE A CE2 1 
ATOM   2112 C CZ  . PHE A 1 285 ? -31.008 15.682  -13.373 1.00 30.36  ? 1768 PHE A CZ  1 
ATOM   2113 N N   . GLU A 1 286 ? -25.352 16.160  -8.655  1.00 32.23  ? 1769 GLU A N   1 
ATOM   2114 C CA  . GLU A 1 286 ? -24.595 16.138  -7.406  1.00 32.85  ? 1769 GLU A CA  1 
ATOM   2115 C C   . GLU A 1 286 ? -23.937 17.501  -7.166  1.00 33.59  ? 1769 GLU A C   1 
ATOM   2116 O O   . GLU A 1 286 ? -23.972 18.029  -6.060  1.00 32.70  ? 1769 GLU A O   1 
ATOM   2117 C CB  . GLU A 1 286 ? -23.534 15.036  -7.444  1.00 30.42  ? 1769 GLU A CB  1 
ATOM   2118 C CG  . GLU A 1 286 ? -22.944 14.728  -6.089  1.00 26.66  ? 1769 GLU A CG  1 
ATOM   2119 C CD  . GLU A 1 286 ? -21.906 13.631  -6.129  1.00 26.71  ? 1769 GLU A CD  1 
ATOM   2120 O OE1 . GLU A 1 286 ? -20.790 13.861  -6.621  1.00 30.84  ? 1769 GLU A OE1 1 
ATOM   2121 O OE2 . GLU A 1 286 ? -22.197 12.519  -5.675  1.00 26.43  ? 1769 GLU A OE2 1 
ATOM   2122 N N   . LYS A 1 287 ? -23.331 18.052  -8.209  1.00 36.00  ? 1770 LYS A N   1 
ATOM   2123 C CA  . LYS A 1 287 ? -22.699 19.360  -8.139  1.00 40.20  ? 1770 LYS A CA  1 
ATOM   2124 C C   . LYS A 1 287 ? -23.746 20.432  -7.755  1.00 42.78  ? 1770 LYS A C   1 
ATOM   2125 O O   . LYS A 1 287 ? -23.556 21.187  -6.795  1.00 43.71  ? 1770 LYS A O   1 
ATOM   2126 C CB  . LYS A 1 287 ? -22.098 19.707  -9.492  1.00 40.83  ? 1770 LYS A CB  1 
ATOM   2127 C CG  . LYS A 1 287 ? -20.744 20.371  -9.411  1.00 46.91  ? 1770 LYS A CG  1 
ATOM   2128 C CD  . LYS A 1 287 ? -19.625 19.348  -9.180  1.00 49.70  ? 1770 LYS A CD  1 
ATOM   2129 C CE  . LYS A 1 287 ? -18.255 19.959  -9.483  1.00 53.37  ? 1770 LYS A CE  1 
ATOM   2130 N NZ  . LYS A 1 287 ? -18.200 20.573  -10.858 1.00 53.90  ? 1770 LYS A NZ  1 
ATOM   2131 N N   . LEU A 1 288 ? -24.846 20.495  -8.511  1.00 42.94  ? 1771 LEU A N   1 
ATOM   2132 C CA  . LEU A 1 288 ? -25.916 21.454  -8.252  1.00 44.35  ? 1771 LEU A CA  1 
ATOM   2133 C C   . LEU A 1 288 ? -26.474 21.292  -6.822  1.00 46.32  ? 1771 LEU A C   1 
ATOM   2134 O O   . LEU A 1 288 ? -26.820 22.268  -6.159  1.00 46.63  ? 1771 LEU A O   1 
ATOM   2135 C CB  . LEU A 1 288 ? -27.057 21.262  -9.272  1.00 42.63  ? 1771 LEU A CB  1 
ATOM   2136 C CG  . LEU A 1 288 ? -26.765 21.397  -10.780 1.00 43.32  ? 1771 LEU A CG  1 
ATOM   2137 C CD1 . LEU A 1 288 ? -27.966 20.927  -11.576 1.00 40.46  ? 1771 LEU A CD1 1 
ATOM   2138 C CD2 . LEU A 1 288 ? -26.421 22.838  -11.147 1.00 43.10  ? 1771 LEU A CD2 1 
ATOM   2139 N N   . ALA A 1 289 ? -26.571 20.051  -6.358  1.00 48.03  ? 1772 ALA A N   1 
ATOM   2140 C CA  . ALA A 1 289 ? -27.088 19.777  -5.028  1.00 50.06  ? 1772 ALA A CA  1 
ATOM   2141 C C   . ALA A 1 289 ? -26.112 20.252  -3.951  1.00 52.47  ? 1772 ALA A C   1 
ATOM   2142 O O   . ALA A 1 289 ? -26.528 20.645  -2.855  1.00 53.01  ? 1772 ALA A O   1 
ATOM   2143 C CB  . ALA A 1 289 ? -27.368 18.282  -4.869  1.00 46.99  ? 1772 ALA A CB  1 
ATOM   2144 N N   . ALA A 1 290 ? -24.820 20.221  -4.263  1.00 54.30  ? 1773 ALA A N   1 
ATOM   2145 C CA  . ALA A 1 290 ? -23.793 20.646  -3.313  1.00 56.42  ? 1773 ALA A CA  1 
ATOM   2146 C C   . ALA A 1 290 ? -23.878 22.145  -3.061  1.00 57.93  ? 1773 ALA A C   1 
ATOM   2147 O O   . ALA A 1 290 ? -23.645 22.622  -1.952  1.00 58.13  ? 1773 ALA A O   1 
ATOM   2148 C CB  . ALA A 1 290 ? -22.400 20.296  -3.856  1.00 56.14  ? 1773 ALA A CB  1 
ATOM   2149 N N   . THR A 1 291 ? -24.228 22.877  -4.109  1.00 59.70  ? 1774 THR A N   1 
ATOM   2150 C CA  . THR A 1 291 ? -24.307 24.326  -4.053  1.00 61.03  ? 1774 THR A CA  1 
ATOM   2151 C C   . THR A 1 291 ? -25.720 24.858  -4.290  1.00 61.96  ? 1774 THR A C   1 
ATOM   2152 O O   . THR A 1 291 ? -25.899 25.942  -4.841  1.00 60.91  ? 1774 THR A O   1 
ATOM   2153 C CB  . THR A 1 291 ? -23.346 24.918  -5.103  1.00 61.31  ? 1774 THR A CB  1 
ATOM   2154 O OG1 . THR A 1 291 ? -23.631 24.351  -6.391  1.00 59.80  ? 1774 THR A OG1 1 
ATOM   2155 C CG2 . THR A 1 291 ? -21.903 24.588  -4.740  1.00 61.66  ? 1774 THR A CG2 1 
ATOM   2156 N N   . SER A 1 292 ? -26.719 24.097  -3.852  1.00 63.54  ? 1775 SER A N   1 
ATOM   2157 C CA  . SER A 1 292 ? -28.118 24.476  -4.041  1.00 64.88  ? 1775 SER A CA  1 
ATOM   2158 C C   . SER A 1 292 ? -28.535 25.675  -3.177  1.00 64.91  ? 1775 SER A C   1 
ATOM   2159 O O   . SER A 1 292 ? -29.236 26.584  -3.644  1.00 64.54  ? 1775 SER A O   1 
ATOM   2160 C CB  . SER A 1 292 ? -29.033 23.268  -3.760  1.00 64.37  ? 1775 SER A CB  1 
ATOM   2161 O OG  . SER A 1 292 ? -28.999 22.885  -2.395  1.00 64.11  ? 1775 SER A OG  1 
ATOM   2162 N N   . LEU A 1 297 ? -35.642 22.398  -4.509  1.00 55.04  ? 1780 LEU A N   1 
ATOM   2163 C CA  . LEU A 1 297 ? -35.914 20.969  -4.686  1.00 54.62  ? 1780 LEU A CA  1 
ATOM   2164 C C   . LEU A 1 297 ? -34.772 20.222  -5.377  1.00 53.92  ? 1780 LEU A C   1 
ATOM   2165 O O   . LEU A 1 297 ? -33.998 20.805  -6.144  1.00 54.13  ? 1780 LEU A O   1 
ATOM   2166 C CB  . LEU A 1 297 ? -37.203 20.755  -5.492  1.00 55.69  ? 1780 LEU A CB  1 
ATOM   2167 C CG  . LEU A 1 297 ? -38.551 20.676  -4.754  1.00 57.80  ? 1780 LEU A CG  1 
ATOM   2168 C CD1 . LEU A 1 297 ? -38.950 22.046  -4.215  1.00 57.47  ? 1780 LEU A CD1 1 
ATOM   2169 C CD2 . LEU A 1 297 ? -39.620 20.150  -5.714  1.00 56.67  ? 1780 LEU A CD2 1 
ATOM   2170 N N   . PRO A 1 298 ? -34.653 18.910  -5.113  1.00 51.85  ? 1781 PRO A N   1 
ATOM   2171 C CA  . PRO A 1 298 ? -33.590 18.110  -5.730  1.00 49.52  ? 1781 PRO A CA  1 
ATOM   2172 C C   . PRO A 1 298 ? -33.881 17.938  -7.215  1.00 47.35  ? 1781 PRO A C   1 
ATOM   2173 O O   . PRO A 1 298 ? -35.035 17.982  -7.615  1.00 47.81  ? 1781 PRO A O   1 
ATOM   2174 C CB  . PRO A 1 298 ? -33.667 16.777  -4.976  1.00 49.15  ? 1781 PRO A CB  1 
ATOM   2175 C CG  . PRO A 1 298 ? -34.383 17.122  -3.679  1.00 50.33  ? 1781 PRO A CG  1 
ATOM   2176 C CD  . PRO A 1 298 ? -35.421 18.112  -4.143  1.00 51.22  ? 1781 PRO A CD  1 
ATOM   2177 N N   . TRP A 1 299 ? -32.839 17.756  -8.023  1.00 46.73  ? 1782 TRP A N   1 
ATOM   2178 C CA  . TRP A 1 299 ? -33.004 17.558  -9.463  1.00 44.89  ? 1782 TRP A CA  1 
ATOM   2179 C C   . TRP A 1 299 ? -33.362 16.105  -9.728  1.00 43.01  ? 1782 TRP A C   1 
ATOM   2180 O O   . TRP A 1 299 ? -32.818 15.197  -9.100  1.00 42.38  ? 1782 TRP A O   1 
ATOM   2181 C CB  . TRP A 1 299 ? -31.721 17.905  -10.211 1.00 47.84  ? 1782 TRP A CB  1 
ATOM   2182 C CG  . TRP A 1 299 ? -31.530 19.369  -10.457 1.00 49.02  ? 1782 TRP A CG  1 
ATOM   2183 C CD1 . TRP A 1 299 ? -30.877 20.263  -9.660  1.00 49.35  ? 1782 TRP A CD1 1 
ATOM   2184 C CD2 . TRP A 1 299 ? -32.007 20.109  -11.584 1.00 49.95  ? 1782 TRP A CD2 1 
ATOM   2185 N NE1 . TRP A 1 299 ? -30.917 21.518  -10.223 1.00 49.92  ? 1782 TRP A NE1 1 
ATOM   2186 C CE2 . TRP A 1 299 ? -31.606 21.448  -11.405 1.00 50.28  ? 1782 TRP A CE2 1 
ATOM   2187 C CE3 . TRP A 1 299 ? -32.738 19.768  -12.728 1.00 50.92  ? 1782 TRP A CE3 1 
ATOM   2188 C CZ2 . TRP A 1 299 ? -31.908 22.444  -12.326 1.00 51.03  ? 1782 TRP A CZ2 1 
ATOM   2189 C CZ3 . TRP A 1 299 ? -33.040 20.761  -13.647 1.00 51.39  ? 1782 TRP A CZ3 1 
ATOM   2190 C CH2 . TRP A 1 299 ? -32.624 22.083  -13.438 1.00 52.33  ? 1782 TRP A CH2 1 
ATOM   2191 N N   . LYS A 1 300 ? -34.276 15.888  -10.664 1.00 41.75  ? 1783 LYS A N   1 
ATOM   2192 C CA  . LYS A 1 300 ? -34.726 14.537  -10.970 1.00 39.41  ? 1783 LYS A CA  1 
ATOM   2193 C C   . LYS A 1 300 ? -34.891 14.298  -12.458 1.00 37.03  ? 1783 LYS A C   1 
ATOM   2194 O O   . LYS A 1 300 ? -35.051 15.233  -13.236 1.00 34.97  ? 1783 LYS A O   1 
ATOM   2195 C CB  . LYS A 1 300 ? -36.058 14.275  -10.259 1.00 40.71  ? 1783 LYS A CB  1 
ATOM   2196 C CG  . LYS A 1 300 ? -36.005 14.434  -8.737  1.00 42.99  ? 1783 LYS A CG  1 
ATOM   2197 C CD  . LYS A 1 300 ? -37.332 14.942  -8.153  1.00 46.57  ? 1783 LYS A CD  1 
ATOM   2198 C CE  . LYS A 1 300 ? -38.529 14.043  -8.487  1.00 47.45  ? 1783 LYS A CE  1 
ATOM   2199 N NZ  . LYS A 1 300 ? -39.841 14.722  -8.222  1.00 47.82  ? 1783 LYS A NZ  1 
ATOM   2200 N N   . PHE A 1 301 ? -34.835 13.030  -12.846 1.00 35.47  ? 1784 PHE A N   1 
ATOM   2201 C CA  . PHE A 1 301 ? -35.014 12.639  -14.235 1.00 32.16  ? 1784 PHE A CA  1 
ATOM   2202 C C   . PHE A 1 301 ? -36.522 12.467  -14.461 1.00 33.43  ? 1784 PHE A C   1 
ATOM   2203 O O   . PHE A 1 301 ? -37.234 11.930  -13.602 1.00 34.33  ? 1784 PHE A O   1 
ATOM   2204 C CB  . PHE A 1 301 ? -34.338 11.298  -14.505 1.00 28.94  ? 1784 PHE A CB  1 
ATOM   2205 C CG  . PHE A 1 301 ? -32.861 11.370  -14.680 1.00 28.06  ? 1784 PHE A CG  1 
ATOM   2206 C CD1 . PHE A 1 301 ? -32.304 12.140  -15.687 1.00 29.89  ? 1784 PHE A CD1 1 
ATOM   2207 C CD2 . PHE A 1 301 ? -32.019 10.608  -13.880 1.00 28.49  ? 1784 PHE A CD2 1 
ATOM   2208 C CE1 . PHE A 1 301 ? -30.918 12.150  -15.902 1.00 32.34  ? 1784 PHE A CE1 1 
ATOM   2209 C CE2 . PHE A 1 301 ? -30.636 10.611  -14.084 1.00 28.72  ? 1784 PHE A CE2 1 
ATOM   2210 C CZ  . PHE A 1 301 ? -30.081 11.385  -15.099 1.00 29.06  ? 1784 PHE A CZ  1 
ATOM   2211 N N   . TYR A 1 302 ? -37.012 12.917  -15.612 1.00 33.28  ? 1785 TYR A N   1 
ATOM   2212 C CA  . TYR A 1 302 ? -38.422 12.770  -15.957 1.00 32.38  ? 1785 TYR A CA  1 
ATOM   2213 C C   . TYR A 1 302 ? -38.531 12.231  -17.375 1.00 31.49  ? 1785 TYR A C   1 
ATOM   2214 O O   . TYR A 1 302 ? -37.759 12.605  -18.254 1.00 29.34  ? 1785 TYR A O   1 
ATOM   2215 C CB  . TYR A 1 302 ? -39.152 14.111  -15.852 1.00 36.05  ? 1785 TYR A CB  1 
ATOM   2216 C CG  . TYR A 1 302 ? -39.867 14.295  -14.543 1.00 40.99  ? 1785 TYR A CG  1 
ATOM   2217 C CD1 . TYR A 1 302 ? -41.195 13.899  -14.388 1.00 41.87  ? 1785 TYR A CD1 1 
ATOM   2218 C CD2 . TYR A 1 302 ? -39.189 14.808  -13.424 1.00 44.30  ? 1785 TYR A CD2 1 
ATOM   2219 C CE1 . TYR A 1 302 ? -41.834 14.001  -13.150 1.00 43.75  ? 1785 TYR A CE1 1 
ATOM   2220 C CE2 . TYR A 1 302 ? -39.818 14.916  -12.186 1.00 45.08  ? 1785 TYR A CE2 1 
ATOM   2221 C CZ  . TYR A 1 302 ? -41.136 14.508  -12.058 1.00 44.63  ? 1785 TYR A CZ  1 
ATOM   2222 O OH  . TYR A 1 302 ? -41.735 14.592  -10.825 1.00 48.02  ? 1785 TYR A OH  1 
ATOM   2223 N N   . PHE A 1 303 ? -39.501 11.352  -17.590 1.00 30.96  ? 1786 PHE A N   1 
ATOM   2224 C CA  . PHE A 1 303 ? -39.726 10.748  -18.897 1.00 30.42  ? 1786 PHE A CA  1 
ATOM   2225 C C   . PHE A 1 303 ? -41.063 11.257  -19.428 1.00 30.30  ? 1786 PHE A C   1 
ATOM   2226 O O   . PHE A 1 303 ? -42.094 10.994  -18.826 1.00 31.71  ? 1786 PHE A O   1 
ATOM   2227 C CB  . PHE A 1 303 ? -39.750 9.226   -18.740 1.00 28.18  ? 1786 PHE A CB  1 
ATOM   2228 C CG  . PHE A 1 303 ? -40.175 8.511   -19.963 1.00 26.89  ? 1786 PHE A CG  1 
ATOM   2229 C CD1 . PHE A 1 303 ? -39.440 8.628   -21.137 1.00 27.45  ? 1786 PHE A CD1 1 
ATOM   2230 C CD2 . PHE A 1 303 ? -41.313 7.734   -19.958 1.00 24.12  ? 1786 PHE A CD2 1 
ATOM   2231 C CE1 . PHE A 1 303 ? -39.843 7.975   -22.287 1.00 27.29  ? 1786 PHE A CE1 1 
ATOM   2232 C CE2 . PHE A 1 303 ? -41.720 7.080   -21.100 1.00 26.54  ? 1786 PHE A CE2 1 
ATOM   2233 C CZ  . PHE A 1 303 ? -40.987 7.197   -22.270 1.00 24.97  ? 1786 PHE A CZ  1 
ATOM   2234 N N   . LYS A 1 304 ? -41.047 11.975  -20.549 1.00 30.56  ? 1787 LYS A N   1 
ATOM   2235 C CA  . LYS A 1 304 ? -42.268 12.542  -21.112 1.00 31.27  ? 1787 LYS A CA  1 
ATOM   2236 C C   . LYS A 1 304 ? -42.284 12.606  -22.630 1.00 32.13  ? 1787 LYS A C   1 
ATOM   2237 O O   . LYS A 1 304 ? -41.299 12.259  -23.307 1.00 30.33  ? 1787 LYS A O   1 
ATOM   2238 C CB  . LYS A 1 304 ? -42.457 13.986  -20.642 1.00 34.32  ? 1787 LYS A CB  1 
ATOM   2239 C CG  . LYS A 1 304 ? -41.869 14.324  -19.304 1.00 38.63  ? 1787 LYS A CG  1 
ATOM   2240 C CD  . LYS A 1 304 ? -41.321 15.758  -19.302 1.00 43.07  ? 1787 LYS A CD  1 
ATOM   2241 C CE  . LYS A 1 304 ? -42.393 16.824  -19.532 1.00 44.30  ? 1787 LYS A CE  1 
ATOM   2242 N NZ  . LYS A 1 304 ? -41.819 18.204  -19.397 1.00 46.48  ? 1787 LYS A NZ  1 
ATOM   2243 N N   . LEU A 1 305 ? -43.419 13.091  -23.146 1.00 31.53  ? 1788 LEU A N   1 
ATOM   2244 C CA  . LEU A 1 305 ? -43.602 13.298  -24.579 1.00 30.90  ? 1788 LEU A CA  1 
ATOM   2245 C C   . LEU A 1 305 ? -42.731 14.511  -24.901 1.00 29.96  ? 1788 LEU A C   1 
ATOM   2246 O O   . LEU A 1 305 ? -42.772 15.511  -24.188 1.00 27.80  ? 1788 LEU A O   1 
ATOM   2247 C CB  . LEU A 1 305 ? -45.058 13.666  -24.918 1.00 30.87  ? 1788 LEU A CB  1 
ATOM   2248 C CG  . LEU A 1 305 ? -46.129 12.660  -25.343 1.00 29.99  ? 1788 LEU A CG  1 
ATOM   2249 C CD1 . LEU A 1 305 ? -45.535 11.636  -26.294 1.00 31.24  ? 1788 LEU A CD1 1 
ATOM   2250 C CD2 . LEU A 1 305 ? -46.707 11.997  -24.142 1.00 31.11  ? 1788 LEU A CD2 1 
ATOM   2251 N N   . TYR A 1 306 ? -41.949 14.422  -25.968 1.00 30.34  ? 1789 TYR A N   1 
ATOM   2252 C CA  . TYR A 1 306 ? -41.082 15.522  -26.375 1.00 31.01  ? 1789 TYR A CA  1 
ATOM   2253 C C   . TYR A 1 306 ? -41.649 16.175  -27.639 1.00 31.93  ? 1789 TYR A C   1 
ATOM   2254 O O   . TYR A 1 306 ? -41.831 17.391  -27.690 1.00 31.79  ? 1789 TYR A O   1 
ATOM   2255 C CB  . TYR A 1 306 ? -39.660 15.007  -26.621 1.00 31.03  ? 1789 TYR A CB  1 
ATOM   2256 C CG  . TYR A 1 306 ? -38.653 16.091  -26.911 1.00 30.05  ? 1789 TYR A CG  1 
ATOM   2257 C CD1 . TYR A 1 306 ? -38.568 17.214  -26.095 1.00 30.60  ? 1789 TYR A CD1 1 
ATOM   2258 C CD2 . TYR A 1 306 ? -37.781 15.991  -27.995 1.00 29.32  ? 1789 TYR A CD2 1 
ATOM   2259 C CE1 . TYR A 1 306 ? -37.638 18.217  -26.349 1.00 31.28  ? 1789 TYR A CE1 1 
ATOM   2260 C CE2 . TYR A 1 306 ? -36.848 16.983  -28.266 1.00 29.29  ? 1789 TYR A CE2 1 
ATOM   2261 C CZ  . TYR A 1 306 ? -36.783 18.098  -27.439 1.00 31.59  ? 1789 TYR A CZ  1 
ATOM   2262 O OH  . TYR A 1 306 ? -35.890 19.112  -27.707 1.00 30.73  ? 1789 TYR A OH  1 
ATOM   2263 N N   . CYS A 1 307 ? -41.931 15.368  -28.655 1.00 32.36  ? 1790 CYS A N   1 
ATOM   2264 C CA  . CYS A 1 307 ? -42.497 15.900  -29.893 1.00 34.19  ? 1790 CYS A CA  1 
ATOM   2265 C C   . CYS A 1 307 ? -43.916 15.407  -30.116 1.00 33.73  ? 1790 CYS A C   1 
ATOM   2266 O O   . CYS A 1 307 ? -44.171 14.195  -30.195 1.00 33.17  ? 1790 CYS A O   1 
ATOM   2267 C CB  . CYS A 1 307 ? -41.666 15.494  -31.109 1.00 35.20  ? 1790 CYS A CB  1 
ATOM   2268 S SG  . CYS A 1 307 ? -40.004 16.085  -31.079 1.00 42.40  ? 1790 CYS A SG  1 
ATOM   2269 N N   . PHE A 1 308 ? -44.837 16.355  -30.224 1.00 32.57  ? 1791 PHE A N   1 
ATOM   2270 C CA  . PHE A 1 308 ? -46.233 16.035  -30.460 1.00 32.32  ? 1791 PHE A CA  1 
ATOM   2271 C C   . PHE A 1 308 ? -46.435 16.023  -31.976 1.00 34.10  ? 1791 PHE A C   1 
ATOM   2272 O O   . PHE A 1 308 ? -46.520 17.075  -32.616 1.00 32.34  ? 1791 PHE A O   1 
ATOM   2273 C CB  . PHE A 1 308 ? -47.111 17.083  -29.786 1.00 28.89  ? 1791 PHE A CB  1 
ATOM   2274 C CG  . PHE A 1 308 ? -46.989 17.087  -28.299 1.00 27.63  ? 1791 PHE A CG  1 
ATOM   2275 C CD1 . PHE A 1 308 ? -47.965 16.479  -27.508 1.00 26.23  ? 1791 PHE A CD1 1 
ATOM   2276 C CD2 . PHE A 1 308 ? -45.867 17.651  -27.683 1.00 28.08  ? 1791 PHE A CD2 1 
ATOM   2277 C CE1 . PHE A 1 308 ? -47.828 16.428  -26.130 1.00 27.67  ? 1791 PHE A CE1 1 
ATOM   2278 C CE2 . PHE A 1 308 ? -45.706 17.608  -26.295 1.00 28.90  ? 1791 PHE A CE2 1 
ATOM   2279 C CZ  . PHE A 1 308 ? -46.688 16.994  -25.508 1.00 29.10  ? 1791 PHE A CZ  1 
ATOM   2280 N N   . LEU A 1 309 ? -46.480 14.818  -32.538 1.00 36.50  ? 1792 LEU A N   1 
ATOM   2281 C CA  . LEU A 1 309 ? -46.656 14.639  -33.972 1.00 39.27  ? 1792 LEU A CA  1 
ATOM   2282 C C   . LEU A 1 309 ? -48.076 14.160  -34.296 1.00 41.23  ? 1792 LEU A C   1 
ATOM   2283 O O   . LEU A 1 309 ? -48.669 14.587  -35.281 1.00 41.14  ? 1792 LEU A O   1 
ATOM   2284 C CB  . LEU A 1 309 ? -45.621 13.635  -34.500 1.00 38.52  ? 1792 LEU A CB  1 
ATOM   2285 C CG  . LEU A 1 309 ? -44.123 13.961  -34.316 1.00 39.92  ? 1792 LEU A CG  1 
ATOM   2286 C CD1 . LEU A 1 309 ? -43.282 12.764  -34.715 1.00 39.09  ? 1792 LEU A CD1 1 
ATOM   2287 C CD2 . LEU A 1 309 ? -43.720 15.167  -35.144 1.00 38.03  ? 1792 LEU A CD2 1 
ATOM   2288 N N   . ASP A 1 310 ? -48.625 13.299  -33.445 1.00 43.84  ? 1793 ASP A N   1 
ATOM   2289 C CA  . ASP A 1 310 ? -49.951 12.748  -33.651 1.00 45.82  ? 1793 ASP A CA  1 
ATOM   2290 C C   . ASP A 1 310 ? -50.756 12.534  -32.367 1.00 47.87  ? 1793 ASP A C   1 
ATOM   2291 O O   . ASP A 1 310 ? -50.576 11.540  -31.652 1.00 46.61  ? 1793 ASP A O   1 
ATOM   2292 C CB  . ASP A 1 310 ? -49.838 11.413  -34.392 1.00 48.58  ? 1793 ASP A CB  1 
ATOM   2293 C CG  . ASP A 1 310 ? -51.104 10.572  -34.273 1.00 52.49  ? 1793 ASP A CG  1 
ATOM   2294 O OD1 . ASP A 1 310 ? -52.137 10.971  -34.877 1.00 50.69  ? 1793 ASP A OD1 1 
ATOM   2295 O OD2 . ASP A 1 310 ? -51.059 9.528   -33.559 1.00 51.75  ? 1793 ASP A OD2 1 
ATOM   2296 N N   . THR A 1 311 ? -51.671 13.451  -32.092 1.00 49.97  ? 1794 THR A N   1 
ATOM   2297 C CA  . THR A 1 311 ? -52.506 13.338  -30.903 1.00 52.56  ? 1794 THR A CA  1 
ATOM   2298 C C   . THR A 1 311 ? -53.961 13.023  -31.285 1.00 54.01  ? 1794 THR A C   1 
ATOM   2299 O O   . THR A 1 311 ? -54.823 12.822  -30.424 1.00 53.23  ? 1794 THR A O   1 
ATOM   2300 C CB  . THR A 1 311 ? -52.457 14.636  -30.093 1.00 52.87  ? 1794 THR A CB  1 
ATOM   2301 O OG1 . THR A 1 311 ? -52.759 15.746  -30.950 1.00 52.62  ? 1794 THR A OG1 1 
ATOM   2302 C CG2 . THR A 1 311 ? -51.075 14.817  -29.491 1.00 52.65  ? 1794 THR A CG2 1 
ATOM   2303 N N   . ASP A 1 312 ? -54.216 12.963  -32.587 1.00 55.40  ? 1795 ASP A N   1 
ATOM   2304 C CA  . ASP A 1 312 ? -55.550 12.675  -33.098 1.00 56.83  ? 1795 ASP A CA  1 
ATOM   2305 C C   . ASP A 1 312 ? -55.883 11.191  -33.147 1.00 56.81  ? 1795 ASP A C   1 
ATOM   2306 O O   . ASP A 1 312 ? -57.056 10.812  -33.035 1.00 56.96  ? 1795 ASP A O   1 
ATOM   2307 C CB  . ASP A 1 312 ? -55.706 13.263  -34.501 1.00 58.40  ? 1795 ASP A CB  1 
ATOM   2308 C CG  . ASP A 1 312 ? -55.898 14.764  -34.485 1.00 60.20  ? 1795 ASP A CG  1 
ATOM   2309 O OD1 . ASP A 1 312 ? -55.564 15.415  -35.496 1.00 60.79  ? 1795 ASP A OD1 1 
ATOM   2310 O OD2 . ASP A 1 312 ? -56.398 15.291  -33.467 1.00 61.37  ? 1795 ASP A OD2 1 
ATOM   2311 N N   . ASN A 1 313 ? -54.854 10.357  -33.302 1.00 55.72  ? 1796 ASN A N   1 
ATOM   2312 C CA  . ASN A 1 313 ? -55.045 8.911   -33.409 1.00 54.42  ? 1796 ASN A CA  1 
ATOM   2313 C C   . ASN A 1 313 ? -54.529 8.085   -32.233 1.00 53.86  ? 1796 ASN A C   1 
ATOM   2314 O O   . ASN A 1 313 ? -54.091 6.946   -32.402 1.00 53.21  ? 1796 ASN A O   1 
ATOM   2315 C CB  . ASN A 1 313 ? -54.402 8.426   -34.710 1.00 55.13  ? 1796 ASN A CB  1 
ATOM   2316 C CG  . ASN A 1 313 ? -54.918 9.181   -35.926 1.00 55.29  ? 1796 ASN A CG  1 
ATOM   2317 O OD1 . ASN A 1 313 ? -54.140 9.729   -36.714 1.00 53.26  ? 1796 ASN A OD1 1 
ATOM   2318 N ND2 . ASN A 1 313 ? -56.242 9.215   -36.079 1.00 54.80  ? 1796 ASN A ND2 1 
ATOM   2319 N N   . VAL A 1 314 ? -54.606 8.649   -31.035 1.00 53.80  ? 1797 VAL A N   1 
ATOM   2320 C CA  . VAL A 1 314 ? -54.140 7.943   -29.857 1.00 52.82  ? 1797 VAL A CA  1 
ATOM   2321 C C   . VAL A 1 314 ? -55.313 7.304   -29.113 1.00 53.48  ? 1797 VAL A C   1 
ATOM   2322 O O   . VAL A 1 314 ? -56.223 7.997   -28.647 1.00 52.73  ? 1797 VAL A O   1 
ATOM   2323 C CB  . VAL A 1 314 ? -53.398 8.901   -28.913 1.00 51.50  ? 1797 VAL A CB  1 
ATOM   2324 C CG1 . VAL A 1 314 ? -52.713 8.116   -27.807 1.00 50.83  ? 1797 VAL A CG1 1 
ATOM   2325 C CG2 . VAL A 1 314 ? -52.401 9.728   -29.698 1.00 50.32  ? 1797 VAL A CG2 1 
ATOM   2326 N N   . PRO A 1 315 ? -55.307 5.964   -29.006 1.00 54.43  ? 1798 PRO A N   1 
ATOM   2327 C CA  . PRO A 1 315 ? -56.335 5.160   -28.329 1.00 55.19  ? 1798 PRO A CA  1 
ATOM   2328 C C   . PRO A 1 315 ? -56.545 5.605   -26.884 1.00 57.16  ? 1798 PRO A C   1 
ATOM   2329 O O   . PRO A 1 315 ? -55.629 5.520   -26.060 1.00 57.77  ? 1798 PRO A O   1 
ATOM   2330 C CB  . PRO A 1 315 ? -55.769 3.747   -28.407 1.00 54.54  ? 1798 PRO A CB  1 
ATOM   2331 C CG  . PRO A 1 315 ? -55.015 3.766   -29.697 1.00 54.85  ? 1798 PRO A CG  1 
ATOM   2332 C CD  . PRO A 1 315 ? -54.293 5.091   -29.629 1.00 54.87  ? 1798 PRO A CD  1 
ATOM   2333 N N   . LYS A 1 316 ? -57.755 6.060   -26.575 1.00 58.63  ? 1799 LYS A N   1 
ATOM   2334 C CA  . LYS A 1 316 ? -58.082 6.539   -25.233 1.00 59.77  ? 1799 LYS A CA  1 
ATOM   2335 C C   . LYS A 1 316 ? -57.729 5.535   -24.124 1.00 59.82  ? 1799 LYS A C   1 
ATOM   2336 O O   . LYS A 1 316 ? -57.724 5.882   -22.942 1.00 59.33  ? 1799 LYS A O   1 
ATOM   2337 C CB  . LYS A 1 316 ? -59.575 6.874   -25.139 1.00 61.37  ? 1799 LYS A CB  1 
ATOM   2338 C CG  . LYS A 1 316 ? -60.176 7.585   -26.344 1.00 63.73  ? 1799 LYS A CG  1 
ATOM   2339 C CD  . LYS A 1 316 ? -59.660 9.001   -26.503 1.00 65.49  ? 1799 LYS A CD  1 
ATOM   2340 C CE  . LYS A 1 316 ? -60.493 9.758   -27.527 1.00 66.55  ? 1799 LYS A CE  1 
ATOM   2341 N NZ  . LYS A 1 316 ? -60.491 9.078   -28.858 1.00 68.45  ? 1799 LYS A NZ  1 
ATOM   2342 N N   . ASP A 1 317 ? -57.433 4.294   -24.498 1.00 60.30  ? 1800 ASP A N   1 
ATOM   2343 C CA  . ASP A 1 317 ? -57.109 3.271   -23.503 1.00 60.41  ? 1800 ASP A CA  1 
ATOM   2344 C C   . ASP A 1 317 ? -55.611 3.095   -23.262 1.00 59.66  ? 1800 ASP A C   1 
ATOM   2345 O O   . ASP A 1 317 ? -55.193 2.703   -22.169 1.00 59.86  ? 1800 ASP A O   1 
ATOM   2346 C CB  . ASP A 1 317 ? -57.711 1.924   -23.920 1.00 61.68  ? 1800 ASP A CB  1 
ATOM   2347 C CG  . ASP A 1 317 ? -57.241 1.477   -25.293 1.00 63.95  ? 1800 ASP A CG  1 
ATOM   2348 O OD1 . ASP A 1 317 ? -57.300 0.262   -25.588 1.00 66.39  ? 1800 ASP A OD1 1 
ATOM   2349 O OD2 . ASP A 1 317 ? -56.819 2.343   -26.086 1.00 63.55  ? 1800 ASP A OD2 1 
ATOM   2350 N N   . SER A 1 318 ? -54.812 3.389   -24.285 1.00 57.97  ? 1801 SER A N   1 
ATOM   2351 C CA  . SER A 1 318 ? -53.360 3.249   -24.211 1.00 56.08  ? 1801 SER A CA  1 
ATOM   2352 C C   . SER A 1 318 ? -52.670 4.115   -23.150 1.00 53.55  ? 1801 SER A C   1 
ATOM   2353 O O   . SER A 1 318 ? -53.186 5.150   -22.720 1.00 52.67  ? 1801 SER A O   1 
ATOM   2354 C CB  . SER A 1 318 ? -52.740 3.554   -25.583 1.00 57.95  ? 1801 SER A CB  1 
ATOM   2355 O OG  . SER A 1 318 ? -52.913 4.920   -25.929 1.00 59.25  ? 1801 SER A OG  1 
ATOM   2356 N N   . VAL A 1 319 ? -51.485 3.674   -22.744 1.00 50.03  ? 1802 VAL A N   1 
ATOM   2357 C CA  . VAL A 1 319 ? -50.695 4.387   -21.753 1.00 46.61  ? 1802 VAL A CA  1 
ATOM   2358 C C   . VAL A 1 319 ? -50.308 5.762   -22.297 1.00 43.85  ? 1802 VAL A C   1 
ATOM   2359 O O   . VAL A 1 319 ? -50.137 6.721   -21.544 1.00 42.46  ? 1802 VAL A O   1 
ATOM   2360 C CB  . VAL A 1 319 ? -49.412 3.603   -21.409 1.00 47.30  ? 1802 VAL A CB  1 
ATOM   2361 C CG1 . VAL A 1 319 ? -48.734 4.222   -20.210 1.00 46.74  ? 1802 VAL A CG1 1 
ATOM   2362 C CG2 . VAL A 1 319 ? -49.756 2.141   -21.137 1.00 47.42  ? 1802 VAL A CG2 1 
ATOM   2363 N N   . GLU A 1 320 ? -50.172 5.854   -23.611 1.00 40.49  ? 1803 GLU A N   1 
ATOM   2364 C CA  . GLU A 1 320 ? -49.830 7.118   -24.231 1.00 39.77  ? 1803 GLU A CA  1 
ATOM   2365 C C   . GLU A 1 320 ? -50.878 8.207   -23.883 1.00 38.27  ? 1803 GLU A C   1 
ATOM   2366 O O   . GLU A 1 320 ? -50.527 9.349   -23.564 1.00 36.44  ? 1803 GLU A O   1 
ATOM   2367 C CB  . GLU A 1 320 ? -49.749 6.937   -25.747 1.00 41.60  ? 1803 GLU A CB  1 
ATOM   2368 C CG  . GLU A 1 320 ? -48.685 7.761   -26.453 1.00 42.88  ? 1803 GLU A CG  1 
ATOM   2369 C CD  . GLU A 1 320 ? -48.776 7.624   -27.969 1.00 47.34  ? 1803 GLU A CD  1 
ATOM   2370 O OE1 . GLU A 1 320 ? -49.024 6.499   -28.460 1.00 49.36  ? 1803 GLU A OE1 1 
ATOM   2371 O OE2 . GLU A 1 320 ? -48.597 8.637   -28.678 1.00 49.20  ? 1803 GLU A OE2 1 
ATOM   2372 N N   . PHE A 1 321 ? -52.158 7.848   -23.936 1.00 35.70  ? 1804 PHE A N   1 
ATOM   2373 C CA  . PHE A 1 321 ? -53.220 8.806   -23.647 1.00 34.30  ? 1804 PHE A CA  1 
ATOM   2374 C C   . PHE A 1 321 ? -53.068 9.344   -22.238 1.00 33.65  ? 1804 PHE A C   1 
ATOM   2375 O O   . PHE A 1 321 ? -53.316 10.516  -21.981 1.00 33.89  ? 1804 PHE A O   1 
ATOM   2376 C CB  . PHE A 1 321 ? -54.600 8.160   -23.823 1.00 33.46  ? 1804 PHE A CB  1 
ATOM   2377 C CG  . PHE A 1 321 ? -55.696 9.146   -24.102 1.00 33.46  ? 1804 PHE A CG  1 
ATOM   2378 C CD1 . PHE A 1 321 ? -55.702 9.888   -25.291 1.00 33.53  ? 1804 PHE A CD1 1 
ATOM   2379 C CD2 . PHE A 1 321 ? -56.699 9.373   -23.163 1.00 32.94  ? 1804 PHE A CD2 1 
ATOM   2380 C CE1 . PHE A 1 321 ? -56.693 10.850  -25.539 1.00 32.53  ? 1804 PHE A CE1 1 
ATOM   2381 C CE2 . PHE A 1 321 ? -57.701 10.335  -23.399 1.00 33.22  ? 1804 PHE A CE2 1 
ATOM   2382 C CZ  . PHE A 1 321 ? -57.697 11.075  -24.588 1.00 32.58  ? 1804 PHE A CZ  1 
ATOM   2383 N N   . ALA A 1 322 ? -52.654 8.482   -21.323 1.00 33.06  ? 1805 ALA A N   1 
ATOM   2384 C CA  . ALA A 1 322 ? -52.440 8.892   -19.948 1.00 33.76  ? 1805 ALA A CA  1 
ATOM   2385 C C   . ALA A 1 322 ? -51.324 9.954   -19.872 1.00 34.95  ? 1805 ALA A C   1 
ATOM   2386 O O   . ALA A 1 322 ? -51.424 10.916  -19.095 1.00 35.62  ? 1805 ALA A O   1 
ATOM   2387 C CB  . ALA A 1 322 ? -52.070 7.676   -19.099 1.00 34.64  ? 1805 ALA A CB  1 
ATOM   2388 N N   . PHE A 1 323 ? -50.267 9.769   -20.664 1.00 32.64  ? 1806 PHE A N   1 
ATOM   2389 C CA  . PHE A 1 323 ? -49.154 10.707  -20.688 1.00 33.21  ? 1806 PHE A CA  1 
ATOM   2390 C C   . PHE A 1 323 ? -49.604 12.055  -21.239 1.00 34.12  ? 1806 PHE A C   1 
ATOM   2391 O O   . PHE A 1 323 ? -49.197 13.125  -20.751 1.00 33.92  ? 1806 PHE A O   1 
ATOM   2392 C CB  . PHE A 1 323 ? -48.012 10.175  -21.574 1.00 36.29  ? 1806 PHE A CB  1 
ATOM   2393 C CG  . PHE A 1 323 ? -46.983 9.384   -20.831 1.00 37.72  ? 1806 PHE A CG  1 
ATOM   2394 C CD1 . PHE A 1 323 ? -47.273 8.117   -20.352 1.00 38.50  ? 1806 PHE A CD1 1 
ATOM   2395 C CD2 . PHE A 1 323 ? -45.732 9.929   -20.567 1.00 41.10  ? 1806 PHE A CD2 1 
ATOM   2396 C CE1 . PHE A 1 323 ? -46.344 7.405   -19.619 1.00 39.16  ? 1806 PHE A CE1 1 
ATOM   2397 C CE2 . PHE A 1 323 ? -44.786 9.222   -19.828 1.00 39.53  ? 1806 PHE A CE2 1 
ATOM   2398 C CZ  . PHE A 1 323 ? -45.099 7.958   -19.354 1.00 40.90  ? 1806 PHE A CZ  1 
ATOM   2399 N N   . MET A 1 324 ? -50.428 12.004  -22.279 1.00 33.59  ? 1807 MET A N   1 
ATOM   2400 C CA  . MET A 1 324 ? -50.921 13.222  -22.877 1.00 34.13  ? 1807 MET A CA  1 
ATOM   2401 C C   . MET A 1 324 ? -51.745 13.941  -21.833 1.00 33.64  ? 1807 MET A C   1 
ATOM   2402 O O   . MET A 1 324 ? -51.636 15.159  -21.643 1.00 35.02  ? 1807 MET A O   1 
ATOM   2403 C CB  . MET A 1 324 ? -51.773 12.909  -24.102 1.00 35.20  ? 1807 MET A CB  1 
ATOM   2404 C CG  . MET A 1 324 ? -50.983 12.602  -25.362 1.00 37.69  ? 1807 MET A CG  1 
ATOM   2405 S SD  . MET A 1 324 ? -52.081 11.943  -26.656 1.00 46.30  ? 1807 MET A SD  1 
ATOM   2406 C CE  . MET A 1 324 ? -53.129 13.361  -27.004 1.00 36.83  ? 1807 MET A CE  1 
ATOM   2407 N N   . PHE A 1 325 ? -52.557 13.168  -21.133 1.00 31.97  ? 1808 PHE A N   1 
ATOM   2408 C CA  . PHE A 1 325 ? -53.417 13.724  -20.110 1.00 32.04  ? 1808 PHE A CA  1 
ATOM   2409 C C   . PHE A 1 325 ? -52.597 14.355  -18.977 1.00 29.91  ? 1808 PHE A C   1 
ATOM   2410 O O   . PHE A 1 325 ? -52.791 15.523  -18.646 1.00 27.42  ? 1808 PHE A O   1 
ATOM   2411 C CB  . PHE A 1 325 ? -54.382 12.624  -19.608 1.00 32.81  ? 1808 PHE A CB  1 
ATOM   2412 C CG  . PHE A 1 325 ? -55.242 13.044  -18.464 1.00 32.06  ? 1808 PHE A CG  1 
ATOM   2413 C CD1 . PHE A 1 325 ? -56.069 14.150  -18.574 1.00 33.10  ? 1808 PHE A CD1 1 
ATOM   2414 C CD2 . PHE A 1 325 ? -55.203 12.350  -17.262 1.00 32.64  ? 1808 PHE A CD2 1 
ATOM   2415 C CE1 . PHE A 1 325 ? -56.839 14.564  -17.501 1.00 33.70  ? 1808 PHE A CE1 1 
ATOM   2416 C CE2 . PHE A 1 325 ? -55.976 12.757  -16.172 1.00 33.31  ? 1808 PHE A CE2 1 
ATOM   2417 C CZ  . PHE A 1 325 ? -56.788 13.859  -16.293 1.00 33.69  ? 1808 PHE A CZ  1 
ATOM   2418 N N   . GLU A 1 326 ? -51.668 13.599  -18.407 1.00 29.67  ? 1809 GLU A N   1 
ATOM   2419 C CA  . GLU A 1 326 ? -50.844 14.123  -17.326 1.00 31.15  ? 1809 GLU A CA  1 
ATOM   2420 C C   . GLU A 1 326 ? -50.032 15.335  -17.751 1.00 31.86  ? 1809 GLU A C   1 
ATOM   2421 O O   . GLU A 1 326 ? -49.891 16.304  -16.999 1.00 31.98  ? 1809 GLU A O   1 
ATOM   2422 C CB  . GLU A 1 326 ? -49.904 13.045  -16.794 1.00 30.10  ? 1809 GLU A CB  1 
ATOM   2423 C CG  . GLU A 1 326 ? -50.582 11.983  -15.942 1.00 31.86  ? 1809 GLU A CG  1 
ATOM   2424 C CD  . GLU A 1 326 ? -51.499 12.590  -14.879 1.00 35.84  ? 1809 GLU A CD  1 
ATOM   2425 O OE1 . GLU A 1 326 ? -51.135 13.647  -14.283 1.00 35.63  ? 1809 GLU A OE1 1 
ATOM   2426 O OE2 . GLU A 1 326 ? -52.585 12.003  -14.644 1.00 36.51  ? 1809 GLU A OE2 1 
ATOM   2427 N N   . GLN A 1 327 ? -49.507 15.283  -18.967 1.00 32.91  ? 1810 GLN A N   1 
ATOM   2428 C CA  . GLN A 1 327 ? -48.698 16.372  -19.489 1.00 32.44  ? 1810 GLN A CA  1 
ATOM   2429 C C   . GLN A 1 327 ? -49.540 17.605  -19.810 1.00 32.26  ? 1810 GLN A C   1 
ATOM   2430 O O   . GLN A 1 327 ? -49.111 18.740  -19.587 1.00 32.55  ? 1810 GLN A O   1 
ATOM   2431 C CB  . GLN A 1 327 ? -47.966 15.891  -20.734 1.00 32.13  ? 1810 GLN A CB  1 
ATOM   2432 C CG  . GLN A 1 327 ? -46.532 16.333  -20.802 1.00 31.75  ? 1810 GLN A CG  1 
ATOM   2433 C CD  . GLN A 1 327 ? -45.715 15.454  -21.709 1.00 31.30  ? 1810 GLN A CD  1 
ATOM   2434 O OE1 . GLN A 1 327 ? -45.711 14.229  -21.569 1.00 32.16  ? 1810 GLN A OE1 1 
ATOM   2435 N NE2 . GLN A 1 327 ? -45.008 16.069  -22.645 1.00 33.88  ? 1810 GLN A NE2 1 
ATOM   2436 N N   . ALA A 1 328 ? -50.740 17.393  -20.339 1.00 31.06  ? 1811 ALA A N   1 
ATOM   2437 C CA  . ALA A 1 328 ? -51.587 18.533  -20.667 1.00 30.05  ? 1811 ALA A CA  1 
ATOM   2438 C C   . ALA A 1 328 ? -52.013 19.246  -19.380 1.00 30.85  ? 1811 ALA A C   1 
ATOM   2439 O O   . ALA A 1 328 ? -52.117 20.479  -19.328 1.00 30.79  ? 1811 ALA A O   1 
ATOM   2440 C CB  . ALA A 1 328 ? -52.804 18.083  -21.475 1.00 24.72  ? 1811 ALA A CB  1 
ATOM   2441 N N   . HIS A 1 329 ? -52.255 18.474  -18.325 1.00 31.27  ? 1812 HIS A N   1 
ATOM   2442 C CA  . HIS A 1 329 ? -52.651 19.086  -17.070 1.00 31.08  ? 1812 HIS A CA  1 
ATOM   2443 C C   . HIS A 1 329 ? -51.471 19.879  -16.489 1.00 30.36  ? 1812 HIS A C   1 
ATOM   2444 O O   . HIS A 1 329 ? -51.643 20.984  -15.978 1.00 29.28  ? 1812 HIS A O   1 
ATOM   2445 C CB  . HIS A 1 329 ? -53.129 18.039  -16.069 1.00 29.08  ? 1812 HIS A CB  1 
ATOM   2446 C CG  . HIS A 1 329 ? -53.573 18.643  -14.782 1.00 29.43  ? 1812 HIS A CG  1 
ATOM   2447 N ND1 . HIS A 1 329 ? -54.584 19.582  -14.724 1.00 29.09  ? 1812 HIS A ND1 1 
ATOM   2448 C CD2 . HIS A 1 329 ? -53.052 18.572  -13.539 1.00 28.41  ? 1812 HIS A CD2 1 
ATOM   2449 C CE1 . HIS A 1 329 ? -54.659 20.070  -13.503 1.00 28.32  ? 1812 HIS A CE1 1 
ATOM   2450 N NE2 . HIS A 1 329 ? -53.738 19.476  -12.765 1.00 30.53  ? 1812 HIS A NE2 1 
ATOM   2451 N N   . GLU A 1 330 ? -50.280 19.302  -16.573 1.00 30.04  ? 1813 GLU A N   1 
ATOM   2452 C CA  . GLU A 1 330 ? -49.078 19.968  -16.103 1.00 32.76  ? 1813 GLU A CA  1 
ATOM   2453 C C   . GLU A 1 330 ? -48.955 21.374  -16.700 1.00 33.48  ? 1813 GLU A C   1 
ATOM   2454 O O   . GLU A 1 330 ? -48.658 22.337  -15.992 1.00 34.01  ? 1813 GLU A O   1 
ATOM   2455 C CB  . GLU A 1 330 ? -47.862 19.147  -16.490 1.00 37.14  ? 1813 GLU A CB  1 
ATOM   2456 C CG  . GLU A 1 330 ? -47.322 18.308  -15.377 1.00 42.41  ? 1813 GLU A CG  1 
ATOM   2457 C CD  . GLU A 1 330 ? -46.616 19.166  -14.366 1.00 48.13  ? 1813 GLU A CD  1 
ATOM   2458 O OE1 . GLU A 1 330 ? -45.637 19.859  -14.762 1.00 49.53  ? 1813 GLU A OE1 1 
ATOM   2459 O OE2 . GLU A 1 330 ? -47.048 19.159  -13.191 1.00 49.35  ? 1813 GLU A OE2 1 
ATOM   2460 N N   . ALA A 1 331 ? -49.199 21.486  -18.002 1.00 33.77  ? 1814 ALA A N   1 
ATOM   2461 C CA  . ALA A 1 331 ? -49.127 22.768  -18.701 1.00 35.13  ? 1814 ALA A CA  1 
ATOM   2462 C C   . ALA A 1 331 ? -50.252 23.721  -18.290 1.00 36.04  ? 1814 ALA A C   1 
ATOM   2463 O O   . ALA A 1 331 ? -50.066 24.947  -18.257 1.00 34.27  ? 1814 ALA A O   1 
ATOM   2464 C CB  . ALA A 1 331 ? -49.171 22.549  -20.216 1.00 31.87  ? 1814 ALA A CB  1 
ATOM   2465 N N   . VAL A 1 332 ? -51.418 23.159  -17.995 1.00 36.81  ? 1815 VAL A N   1 
ATOM   2466 C CA  . VAL A 1 332 ? -52.546 23.971  -17.603 1.00 39.51  ? 1815 VAL A CA  1 
ATOM   2467 C C   . VAL A 1 332 ? -52.315 24.693  -16.272 1.00 42.09  ? 1815 VAL A C   1 
ATOM   2468 O O   . VAL A 1 332 ? -52.544 25.905  -16.170 1.00 42.30  ? 1815 VAL A O   1 
ATOM   2469 C CB  . VAL A 1 332 ? -53.833 23.122  -17.530 1.00 39.62  ? 1815 VAL A CB  1 
ATOM   2470 C CG1 . VAL A 1 332 ? -55.005 23.961  -16.988 1.00 35.62  ? 1815 VAL A CG1 1 
ATOM   2471 C CG2 . VAL A 1 332 ? -54.159 22.603  -18.919 1.00 38.59  ? 1815 VAL A CG2 1 
ATOM   2472 N N   . ILE A 1 333 ? -51.848 23.974  -15.259 1.00 43.07  ? 1816 ILE A N   1 
ATOM   2473 C CA  . ILE A 1 333 ? -51.623 24.613  -13.966 1.00 44.96  ? 1816 ILE A CA  1 
ATOM   2474 C C   . ILE A 1 333 ? -50.349 25.464  -13.936 1.00 48.03  ? 1816 ILE A C   1 
ATOM   2475 O O   . ILE A 1 333 ? -49.970 25.990  -12.883 1.00 49.47  ? 1816 ILE A O   1 
ATOM   2476 C CB  . ILE A 1 333 ? -51.557 23.582  -12.823 1.00 42.28  ? 1816 ILE A CB  1 
ATOM   2477 C CG1 . ILE A 1 333 ? -50.318 22.711  -12.978 1.00 39.96  ? 1816 ILE A CG1 1 
ATOM   2478 C CG2 . ILE A 1 333 ? -52.816 22.730  -12.827 1.00 41.19  ? 1816 ILE A CG2 1 
ATOM   2479 C CD1 . ILE A 1 333 ? -50.096 21.799  -11.814 1.00 38.15  ? 1816 ILE A CD1 1 
ATOM   2480 N N   . HIS A 1 334 ? -49.681 25.587  -15.082 1.00 49.05  ? 1817 HIS A N   1 
ATOM   2481 C CA  . HIS A 1 334 ? -48.474 26.405  -15.174 1.00 49.23  ? 1817 HIS A CA  1 
ATOM   2482 C C   . HIS A 1 334 ? -48.728 27.585  -16.107 1.00 48.65  ? 1817 HIS A C   1 
ATOM   2483 O O   . HIS A 1 334 ? -47.830 28.365  -16.382 1.00 50.54  ? 1817 HIS A O   1 
ATOM   2484 C CB  . HIS A 1 334 ? -47.276 25.593  -15.688 1.00 50.45  ? 1817 HIS A CB  1 
ATOM   2485 C CG  . HIS A 1 334 ? -46.731 24.607  -14.696 1.00 53.70  ? 1817 HIS A CG  1 
ATOM   2486 N ND1 . HIS A 1 334 ? -46.578 24.901  -13.356 1.00 56.82  ? 1817 HIS A ND1 1 
ATOM   2487 C CD2 . HIS A 1 334 ? -46.291 23.336  -14.851 1.00 54.40  ? 1817 HIS A CD2 1 
ATOM   2488 C CE1 . HIS A 1 334 ? -46.075 23.851  -12.728 1.00 56.34  ? 1817 HIS A CE1 1 
ATOM   2489 N NE2 . HIS A 1 334 ? -45.892 22.888  -13.613 1.00 56.25  ? 1817 HIS A NE2 1 
ATOM   2490 N N   . GLY A 1 335 ? -49.957 27.712  -16.591 1.00 47.74  ? 1818 GLY A N   1 
ATOM   2491 C CA  . GLY A 1 335 ? -50.296 28.806  -17.485 1.00 46.18  ? 1818 GLY A CA  1 
ATOM   2492 C C   . GLY A 1 335 ? -49.890 28.625  -18.943 1.00 46.31  ? 1818 GLY A C   1 
ATOM   2493 O O   . GLY A 1 335 ? -49.842 29.605  -19.689 1.00 46.35  ? 1818 GLY A O   1 
ATOM   2494 N N   . HIS A 1 336 ? -49.616 27.394  -19.368 1.00 45.82  ? 1819 HIS A N   1 
ATOM   2495 C CA  . HIS A 1 336 ? -49.202 27.146  -20.750 1.00 47.27  ? 1819 HIS A CA  1 
ATOM   2496 C C   . HIS A 1 336 ? -50.310 26.599  -21.646 1.00 47.08  ? 1819 HIS A C   1 
ATOM   2497 O O   . HIS A 1 336 ? -50.055 25.784  -22.533 1.00 47.19  ? 1819 HIS A O   1 
ATOM   2498 C CB  . HIS A 1 336 ? -48.002 26.199  -20.777 1.00 48.96  ? 1819 HIS A CB  1 
ATOM   2499 C CG  . HIS A 1 336 ? -46.702 26.856  -20.419 1.00 53.56  ? 1819 HIS A CG  1 
ATOM   2500 N ND1 . HIS A 1 336 ? -45.579 26.140  -20.051 1.00 56.87  ? 1819 HIS A ND1 1 
ATOM   2501 C CD2 . HIS A 1 336 ? -46.337 28.161  -20.400 1.00 55.01  ? 1819 HIS A CD2 1 
ATOM   2502 C CE1 . HIS A 1 336 ? -44.580 26.976  -19.820 1.00 55.78  ? 1819 HIS A CE1 1 
ATOM   2503 N NE2 . HIS A 1 336 ? -45.013 28.208  -20.025 1.00 55.23  ? 1819 HIS A NE2 1 
ATOM   2504 N N   . HIS A 1 337 ? -51.534 27.052  -21.393 1.00 46.25  ? 1820 HIS A N   1 
ATOM   2505 C CA  . HIS A 1 337 ? -52.708 26.665  -22.160 1.00 46.99  ? 1820 HIS A CA  1 
ATOM   2506 C C   . HIS A 1 337 ? -53.682 27.850  -22.150 1.00 47.64  ? 1820 HIS A C   1 
ATOM   2507 O O   . HIS A 1 337 ? -54.557 27.935  -21.303 1.00 46.88  ? 1820 HIS A O   1 
ATOM   2508 C CB  . HIS A 1 337 ? -53.390 25.442  -21.538 1.00 46.73  ? 1820 HIS A CB  1 
ATOM   2509 C CG  . HIS A 1 337 ? -54.512 24.892  -22.368 1.00 44.45  ? 1820 HIS A CG  1 
ATOM   2510 N ND1 . HIS A 1 337 ? -54.300 24.109  -23.484 1.00 44.29  ? 1820 HIS A ND1 1 
ATOM   2511 C CD2 . HIS A 1 337 ? -55.849 25.065  -22.281 1.00 44.98  ? 1820 HIS A CD2 1 
ATOM   2512 C CE1 . HIS A 1 337 ? -55.459 23.825  -24.049 1.00 43.50  ? 1820 HIS A CE1 1 
ATOM   2513 N NE2 . HIS A 1 337 ? -56.417 24.394  -23.340 1.00 45.22  ? 1820 HIS A NE2 1 
ATOM   2514 N N   . PRO A 1 338 ? -53.533 28.778  -23.102 1.00 48.55  ? 1821 PRO A N   1 
ATOM   2515 C CA  . PRO A 1 338 ? -54.376 29.975  -23.227 1.00 48.10  ? 1821 PRO A CA  1 
ATOM   2516 C C   . PRO A 1 338 ? -55.821 29.724  -23.657 1.00 46.91  ? 1821 PRO A C   1 
ATOM   2517 O O   . PRO A 1 338 ? -56.131 29.688  -24.847 1.00 48.24  ? 1821 PRO A O   1 
ATOM   2518 C CB  . PRO A 1 338 ? -53.624 30.800  -24.260 1.00 49.89  ? 1821 PRO A CB  1 
ATOM   2519 C CG  . PRO A 1 338 ? -53.104 29.721  -25.185 1.00 49.87  ? 1821 PRO A CG  1 
ATOM   2520 C CD  . PRO A 1 338 ? -52.538 28.727  -24.190 1.00 49.68  ? 1821 PRO A CD  1 
ATOM   2521 N N   . ALA A 1 339 ? -56.709 29.564  -22.690 1.00 44.54  ? 1822 ALA A N   1 
ATOM   2522 C CA  . ALA A 1 339 ? -58.117 29.336  -22.991 1.00 41.97  ? 1822 ALA A CA  1 
ATOM   2523 C C   . ALA A 1 339 ? -58.979 30.194  -22.059 1.00 40.35  ? 1822 ALA A C   1 
ATOM   2524 O O   . ALA A 1 339 ? -58.519 30.652  -21.012 1.00 38.76  ? 1822 ALA A O   1 
ATOM   2525 C CB  . ALA A 1 339 ? -58.449 27.859  -22.814 1.00 38.74  ? 1822 ALA A CB  1 
ATOM   2526 N N   . PRO A 1 340 ? -60.235 30.442  -22.436 1.00 39.56  ? 1823 PRO A N   1 
ATOM   2527 C CA  . PRO A 1 340 ? -61.112 31.252  -21.579 1.00 41.34  ? 1823 PRO A CA  1 
ATOM   2528 C C   . PRO A 1 340 ? -61.127 30.713  -20.143 1.00 42.21  ? 1823 PRO A C   1 
ATOM   2529 O O   . PRO A 1 340 ? -61.025 29.503  -19.934 1.00 42.61  ? 1823 PRO A O   1 
ATOM   2530 C CB  . PRO A 1 340 ? -62.467 31.127  -22.265 1.00 39.42  ? 1823 PRO A CB  1 
ATOM   2531 C CG  . PRO A 1 340 ? -62.073 31.076  -23.710 1.00 40.23  ? 1823 PRO A CG  1 
ATOM   2532 C CD  . PRO A 1 340 ? -60.900 30.099  -23.702 1.00 39.58  ? 1823 PRO A CD  1 
ATOM   2533 N N   . GLU A 1 341 ? -61.242 31.611  -19.164 1.00 44.27  ? 1824 GLU A N   1 
ATOM   2534 C CA  . GLU A 1 341 ? -61.262 31.226  -17.747 1.00 45.62  ? 1824 GLU A CA  1 
ATOM   2535 C C   . GLU A 1 341 ? -62.285 30.113  -17.506 1.00 45.48  ? 1824 GLU A C   1 
ATOM   2536 O O   . GLU A 1 341 ? -62.084 29.227  -16.672 1.00 43.01  ? 1824 GLU A O   1 
ATOM   2537 C CB  . GLU A 1 341 ? -61.605 32.430  -16.865 1.00 47.20  ? 1824 GLU A CB  1 
ATOM   2538 C CG  . GLU A 1 341 ? -61.212 32.228  -15.425 1.00 49.84  ? 1824 GLU A CG  1 
ATOM   2539 C CD  . GLU A 1 341 ? -59.751 31.842  -15.296 1.00 53.69  ? 1824 GLU A CD  1 
ATOM   2540 O OE1 . GLU A 1 341 ? -58.858 32.677  -15.591 1.00 54.98  ? 1824 GLU A OE1 1 
ATOM   2541 O OE2 . GLU A 1 341 ? -59.495 30.683  -14.912 1.00 57.76  ? 1824 GLU A OE2 1 
ATOM   2542 N N   . GLU A 1 342 ? -63.383 30.182  -18.249 1.00 45.41  ? 1825 GLU A N   1 
ATOM   2543 C CA  . GLU A 1 342 ? -64.431 29.188  -18.170 1.00 46.82  ? 1825 GLU A CA  1 
ATOM   2544 C C   . GLU A 1 342 ? -63.844 27.806  -18.518 1.00 46.47  ? 1825 GLU A C   1 
ATOM   2545 O O   . GLU A 1 342 ? -64.028 26.851  -17.770 1.00 47.30  ? 1825 GLU A O   1 
ATOM   2546 C CB  . GLU A 1 342 ? -65.553 29.585  -19.135 1.00 50.07  ? 1825 GLU A CB  1 
ATOM   2547 C CG  . GLU A 1 342 ? -66.665 28.575  -19.331 1.00 54.57  ? 1825 GLU A CG  1 
ATOM   2548 C CD  . GLU A 1 342 ? -67.434 28.294  -18.060 1.00 58.89  ? 1825 GLU A CD  1 
ATOM   2549 O OE1 . GLU A 1 342 ? -67.536 29.215  -17.207 1.00 61.91  ? 1825 GLU A OE1 1 
ATOM   2550 O OE2 . GLU A 1 342 ? -67.950 27.157  -17.928 1.00 60.28  ? 1825 GLU A OE2 1 
ATOM   2551 N N   . ASN A 1 343 ? -63.137 27.701  -19.644 1.00 45.39  ? 1826 ASN A N   1 
ATOM   2552 C CA  . ASN A 1 343 ? -62.527 26.434  -20.051 1.00 44.83  ? 1826 ASN A CA  1 
ATOM   2553 C C   . ASN A 1 343 ? -61.545 25.913  -19.001 1.00 42.86  ? 1826 ASN A C   1 
ATOM   2554 O O   . ASN A 1 343 ? -61.388 24.706  -18.824 1.00 42.63  ? 1826 ASN A O   1 
ATOM   2555 C CB  . ASN A 1 343 ? -61.771 26.598  -21.377 1.00 47.84  ? 1826 ASN A CB  1 
ATOM   2556 C CG  . ASN A 1 343 ? -62.698 26.727  -22.568 1.00 49.97  ? 1826 ASN A CG  1 
ATOM   2557 O OD1 . ASN A 1 343 ? -63.699 27.428  -22.501 1.00 52.71  ? 1826 ASN A OD1 1 
ATOM   2558 N ND2 . ASN A 1 343 ? -62.361 26.059  -23.671 1.00 50.29  ? 1826 ASN A ND2 1 
ATOM   2559 N N   . LEU A 1 344 ? -60.871 26.827  -18.316 1.00 40.11  ? 1827 LEU A N   1 
ATOM   2560 C CA  . LEU A 1 344 ? -59.899 26.438  -17.306 1.00 38.21  ? 1827 LEU A CA  1 
ATOM   2561 C C   . LEU A 1 344 ? -60.548 25.911  -16.022 1.00 36.95  ? 1827 LEU A C   1 
ATOM   2562 O O   . LEU A 1 344 ? -59.933 25.168  -15.259 1.00 37.91  ? 1827 LEU A O   1 
ATOM   2563 C CB  . LEU A 1 344 ? -58.980 27.622  -16.988 1.00 37.79  ? 1827 LEU A CB  1 
ATOM   2564 C CG  . LEU A 1 344 ? -57.930 27.981  -18.038 1.00 37.38  ? 1827 LEU A CG  1 
ATOM   2565 C CD1 . LEU A 1 344 ? -57.042 29.078  -17.498 1.00 36.75  ? 1827 LEU A CD1 1 
ATOM   2566 C CD2 . LEU A 1 344 ? -57.074 26.756  -18.351 1.00 36.89  ? 1827 LEU A CD2 1 
ATOM   2567 N N   . GLN A 1 345 ? -61.791 26.304  -15.780 1.00 34.03  ? 1828 GLN A N   1 
ATOM   2568 C CA  . GLN A 1 345 ? -62.501 25.861  -14.592 1.00 31.49  ? 1828 GLN A CA  1 
ATOM   2569 C C   . GLN A 1 345 ? -63.020 24.448  -14.791 1.00 29.25  ? 1828 GLN A C   1 
ATOM   2570 O O   . GLN A 1 345 ? -62.925 23.616  -13.887 1.00 25.15  ? 1828 GLN A O   1 
ATOM   2571 C CB  . GLN A 1 345 ? -63.632 26.831  -14.283 1.00 33.03  ? 1828 GLN A CB  1 
ATOM   2572 C CG  . GLN A 1 345 ? -63.083 28.225  -14.057 1.00 35.18  ? 1828 GLN A CG  1 
ATOM   2573 C CD  . GLN A 1 345 ? -63.912 29.066  -13.125 1.00 36.16  ? 1828 GLN A CD  1 
ATOM   2574 O OE1 . GLN A 1 345 ? -63.381 29.967  -12.480 1.00 38.82  ? 1828 GLN A OE1 1 
ATOM   2575 N NE2 . GLN A 1 345 ? -65.211 28.798  -13.054 1.00 33.73  ? 1828 GLN A NE2 1 
ATOM   2576 N N   . VAL A 1 346 ? -63.558 24.183  -15.980 1.00 26.68  ? 1829 VAL A N   1 
ATOM   2577 C CA  . VAL A 1 346 ? -64.040 22.856  -16.312 1.00 26.71  ? 1829 VAL A CA  1 
ATOM   2578 C C   . VAL A 1 346 ? -62.868 21.872  -16.226 1.00 26.72  ? 1829 VAL A C   1 
ATOM   2579 O O   . VAL A 1 346 ? -62.999 20.793  -15.636 1.00 27.74  ? 1829 VAL A O   1 
ATOM   2580 C CB  . VAL A 1 346 ? -64.656 22.821  -17.739 1.00 27.29  ? 1829 VAL A CB  1 
ATOM   2581 C CG1 . VAL A 1 346 ? -64.995 21.399  -18.149 1.00 24.13  ? 1829 VAL A CG1 1 
ATOM   2582 C CG2 . VAL A 1 346 ? -65.910 23.663  -17.757 1.00 27.93  ? 1829 VAL A CG2 1 
ATOM   2583 N N   . LEU A 1 347 ? -61.720 22.259  -16.790 1.00 26.01  ? 1830 LEU A N   1 
ATOM   2584 C CA  . LEU A 1 347 ? -60.536 21.400  -16.769 1.00 24.88  ? 1830 LEU A CA  1 
ATOM   2585 C C   . LEU A 1 347 ? -60.158 21.055  -15.345 1.00 22.88  ? 1830 LEU A C   1 
ATOM   2586 O O   . LEU A 1 347 ? -59.780 19.928  -15.036 1.00 22.72  ? 1830 LEU A O   1 
ATOM   2587 C CB  . LEU A 1 347 ? -59.347 22.084  -17.468 1.00 26.55  ? 1830 LEU A CB  1 
ATOM   2588 C CG  . LEU A 1 347 ? -59.440 22.262  -18.995 1.00 28.73  ? 1830 LEU A CG  1 
ATOM   2589 C CD1 . LEU A 1 347 ? -58.199 23.023  -19.501 1.00 27.13  ? 1830 LEU A CD1 1 
ATOM   2590 C CD2 . LEU A 1 347 ? -59.572 20.901  -19.693 1.00 27.00  ? 1830 LEU A CD2 1 
ATOM   2591 N N   . ALA A 1 348 ? -60.265 22.047  -14.475 1.00 22.73  ? 1831 ALA A N   1 
ATOM   2592 C CA  . ALA A 1 348 ? -59.958 21.882  -13.066 1.00 21.41  ? 1831 ALA A CA  1 
ATOM   2593 C C   . ALA A 1 348 ? -60.975 20.915  -12.439 1.00 20.90  ? 1831 ALA A C   1 
ATOM   2594 O O   . ALA A 1 348 ? -60.611 19.999  -11.700 1.00 19.50  ? 1831 ALA A O   1 
ATOM   2595 C CB  . ALA A 1 348 ? -60.002 23.253  -12.369 1.00 19.42  ? 1831 ALA A CB  1 
ATOM   2596 N N   . ALA A 1 349 ? -62.252 21.119  -12.741 1.00 21.84  ? 1832 ALA A N   1 
ATOM   2597 C CA  . ALA A 1 349 ? -63.303 20.251  -12.199 1.00 24.01  ? 1832 ALA A CA  1 
ATOM   2598 C C   . ALA A 1 349 ? -63.157 18.809  -12.734 1.00 22.87  ? 1832 ALA A C   1 
ATOM   2599 O O   . ALA A 1 349 ? -63.323 17.851  -11.987 1.00 21.30  ? 1832 ALA A O   1 
ATOM   2600 C CB  . ALA A 1 349 ? -64.697 20.811  -12.549 1.00 24.26  ? 1832 ALA A CB  1 
ATOM   2601 N N   . LEU A 1 350 ? -62.849 18.668  -14.021 1.00 21.28  ? 1833 LEU A N   1 
ATOM   2602 C CA  . LEU A 1 350 ? -62.685 17.350  -14.606 1.00 22.16  ? 1833 LEU A CA  1 
ATOM   2603 C C   . LEU A 1 350 ? -61.480 16.636  -13.954 1.00 23.54  ? 1833 LEU A C   1 
ATOM   2604 O O   . LEU A 1 350 ? -61.473 15.405  -13.770 1.00 22.38  ? 1833 LEU A O   1 
ATOM   2605 C CB  . LEU A 1 350 ? -62.500 17.484  -16.129 1.00 20.43  ? 1833 LEU A CB  1 
ATOM   2606 C CG  . LEU A 1 350 ? -63.772 17.850  -16.902 1.00 20.70  ? 1833 LEU A CG  1 
ATOM   2607 C CD1 . LEU A 1 350 ? -63.490 18.152  -18.368 1.00 17.93  ? 1833 LEU A CD1 1 
ATOM   2608 C CD2 . LEU A 1 350 ? -64.726 16.698  -16.800 1.00 21.07  ? 1833 LEU A CD2 1 
ATOM   2609 N N   . ARG A 1 351 ? -60.465 17.419  -13.599 1.00 22.86  ? 1834 ARG A N   1 
ATOM   2610 C CA  . ARG A 1 351 ? -59.273 16.871  -12.973 1.00 22.41  ? 1834 ARG A CA  1 
ATOM   2611 C C   . ARG A 1 351 ? -59.639 16.350  -11.592 1.00 21.01  ? 1834 ARG A C   1 
ATOM   2612 O O   . ARG A 1 351 ? -59.265 15.247  -11.208 1.00 23.11  ? 1834 ARG A O   1 
ATOM   2613 C CB  . ARG A 1 351 ? -58.177 17.945  -12.873 1.00 22.28  ? 1834 ARG A CB  1 
ATOM   2614 C CG  . ARG A 1 351 ? -56.894 17.493  -12.207 1.00 21.67  ? 1834 ARG A CG  1 
ATOM   2615 C CD  . ARG A 1 351 ? -56.097 16.496  -13.042 1.00 22.45  ? 1834 ARG A CD  1 
ATOM   2616 N NE  . ARG A 1 351 ? -54.893 16.081  -12.318 1.00 23.34  ? 1834 ARG A NE  1 
ATOM   2617 C CZ  . ARG A 1 351 ? -53.998 15.196  -12.754 1.00 24.61  ? 1834 ARG A CZ  1 
ATOM   2618 N NH1 . ARG A 1 351 ? -54.135 14.592  -13.933 1.00 25.76  ? 1834 ARG A NH1 1 
ATOM   2619 N NH2 . ARG A 1 351 ? -52.948 14.921  -12.009 1.00 24.53  ? 1834 ARG A NH2 1 
ATOM   2620 N N   . LEU A 1 352 ? -60.369 17.156  -10.838 1.00 20.32  ? 1835 LEU A N   1 
ATOM   2621 C CA  . LEU A 1 352 ? -60.813 16.751  -9.515  1.00 19.96  ? 1835 LEU A CA  1 
ATOM   2622 C C   . LEU A 1 352 ? -61.645 15.451  -9.635  1.00 19.59  ? 1835 LEU A C   1 
ATOM   2623 O O   . LEU A 1 352 ? -61.492 14.531  -8.831  1.00 20.32  ? 1835 LEU A O   1 
ATOM   2624 C CB  . LEU A 1 352 ? -61.642 17.884  -8.896  1.00 22.27  ? 1835 LEU A CB  1 
ATOM   2625 C CG  . LEU A 1 352 ? -61.031 18.789  -7.811  1.00 24.31  ? 1835 LEU A CG  1 
ATOM   2626 C CD1 . LEU A 1 352 ? -59.519 18.797  -7.880  1.00 24.30  ? 1835 LEU A CD1 1 
ATOM   2627 C CD2 . LEU A 1 352 ? -61.590 20.178  -7.954  1.00 22.71  ? 1835 LEU A CD2 1 
ATOM   2628 N N   . GLN A 1 353 ? -62.487 15.374  -10.671 1.00 18.27  ? 1836 GLN A N   1 
ATOM   2629 C CA  . GLN A 1 353 ? -63.344 14.214  -10.932 1.00 17.93  ? 1836 GLN A CA  1 
ATOM   2630 C C   . GLN A 1 353 ? -62.546 12.952  -11.206 1.00 19.25  ? 1836 GLN A C   1 
ATOM   2631 O O   . GLN A 1 353 ? -62.900 11.862  -10.761 1.00 17.36  ? 1836 GLN A O   1 
ATOM   2632 C CB  . GLN A 1 353 ? -64.269 14.509  -12.113 1.00 15.22  ? 1836 GLN A CB  1 
ATOM   2633 C CG  . GLN A 1 353 ? -65.292 13.434  -12.389 1.00 17.21  ? 1836 GLN A CG  1 
ATOM   2634 C CD  . GLN A 1 353 ? -66.196 13.210  -11.207 1.00 18.73  ? 1836 GLN A CD  1 
ATOM   2635 O OE1 . GLN A 1 353 ? -66.650 14.166  -10.589 1.00 20.52  ? 1836 GLN A OE1 1 
ATOM   2636 N NE2 . GLN A 1 353 ? -66.472 11.950  -10.890 1.00 16.58  ? 1836 GLN A NE2 1 
ATOM   2637 N N   . TYR A 1 354 ? -61.465 13.121  -11.959 1.00 22.78  ? 1837 TYR A N   1 
ATOM   2638 C CA  . TYR A 1 354 ? -60.567 12.036  -12.316 1.00 24.26  ? 1837 TYR A CA  1 
ATOM   2639 C C   . TYR A 1 354 ? -59.721 11.571  -11.124 1.00 25.05  ? 1837 TYR A C   1 
ATOM   2640 O O   . TYR A 1 354 ? -59.457 10.377  -10.968 1.00 26.19  ? 1837 TYR A O   1 
ATOM   2641 C CB  . TYR A 1 354 ? -59.641 12.490  -13.437 1.00 26.91  ? 1837 TYR A CB  1 
ATOM   2642 C CG  . TYR A 1 354 ? -58.543 11.503  -13.738 1.00 27.67  ? 1837 TYR A CG  1 
ATOM   2643 C CD1 . TYR A 1 354 ? -58.768 10.421  -14.592 1.00 27.97  ? 1837 TYR A CD1 1 
ATOM   2644 C CD2 . TYR A 1 354 ? -57.288 11.619  -13.124 1.00 28.42  ? 1837 TYR A CD2 1 
ATOM   2645 C CE1 . TYR A 1 354 ? -57.772 9.469   -14.827 1.00 28.72  ? 1837 TYR A CE1 1 
ATOM   2646 C CE2 . TYR A 1 354 ? -56.290 10.672  -13.348 1.00 29.01  ? 1837 TYR A CE2 1 
ATOM   2647 C CZ  . TYR A 1 354 ? -56.542 9.600   -14.197 1.00 30.14  ? 1837 TYR A CZ  1 
ATOM   2648 O OH  . TYR A 1 354 ? -55.579 8.639   -14.384 1.00 31.93  ? 1837 TYR A OH  1 
ATOM   2649 N N   . LEU A 1 355 ? -59.308 12.512  -10.281 1.00 24.40  ? 1838 LEU A N   1 
ATOM   2650 C CA  . LEU A 1 355 ? -58.496 12.189  -9.106  1.00 24.39  ? 1838 LEU A CA  1 
ATOM   2651 C C   . LEU A 1 355 ? -59.237 11.689  -7.856  1.00 23.94  ? 1838 LEU A C   1 
ATOM   2652 O O   . LEU A 1 355 ? -58.668 10.948  -7.067  1.00 22.86  ? 1838 LEU A O   1 
ATOM   2653 C CB  . LEU A 1 355 ? -57.663 13.412  -8.683  1.00 22.88  ? 1838 LEU A CB  1 
ATOM   2654 C CG  . LEU A 1 355 ? -56.475 13.886  -9.534  1.00 22.50  ? 1838 LEU A CG  1 
ATOM   2655 C CD1 . LEU A 1 355 ? -55.924 15.161  -8.941  1.00 14.51  ? 1838 LEU A CD1 1 
ATOM   2656 C CD2 . LEU A 1 355 ? -55.401 12.782  -9.616  1.00 17.90  ? 1838 LEU A CD2 1 
ATOM   2657 N N   . GLN A 1 356 ? -60.494 12.081  -7.665  1.00 24.52  ? 1839 GLN A N   1 
ATOM   2658 C CA  . GLN A 1 356 ? -61.191 11.685  -6.441  1.00 25.19  ? 1839 GLN A CA  1 
ATOM   2659 C C   . GLN A 1 356 ? -62.548 11.062  -6.636  1.00 25.18  ? 1839 GLN A C   1 
ATOM   2660 O O   . GLN A 1 356 ? -63.188 10.638  -5.663  1.00 24.35  ? 1839 GLN A O   1 
ATOM   2661 C CB  . GLN A 1 356 ? -61.361 12.894  -5.518  1.00 25.32  ? 1839 GLN A CB  1 
ATOM   2662 C CG  . GLN A 1 356 ? -60.067 13.504  -5.027  1.00 27.10  ? 1839 GLN A CG  1 
ATOM   2663 C CD  . GLN A 1 356 ? -60.282 14.849  -4.362  1.00 29.45  ? 1839 GLN A CD  1 
ATOM   2664 O OE1 . GLN A 1 356 ? -59.327 15.565  -4.074  1.00 33.86  ? 1839 GLN A OE1 1 
ATOM   2665 N NE2 . GLN A 1 356 ? -61.537 15.199  -4.108  1.00 27.31  ? 1839 GLN A NE2 1 
ATOM   2666 N N   . GLY A 1 357 ? -62.989 10.995  -7.888  1.00 24.61  ? 1840 GLY A N   1 
ATOM   2667 C CA  . GLY A 1 357 ? -64.301 10.448  -8.148  1.00 21.15  ? 1840 GLY A CA  1 
ATOM   2668 C C   . GLY A 1 357 ? -65.361 11.499  -7.888  1.00 22.48  ? 1840 GLY A C   1 
ATOM   2669 O O   . GLY A 1 357 ? -65.135 12.699  -8.059  1.00 21.65  ? 1840 GLY A O   1 
ATOM   2670 N N   . ASP A 1 358 ? -66.522 11.042  -7.444  1.00 24.42  ? 1841 ASP A N   1 
ATOM   2671 C CA  . ASP A 1 358 ? -67.653 11.924  -7.215  1.00 25.10  ? 1841 ASP A CA  1 
ATOM   2672 C C   . ASP A 1 358 ? -67.535 12.888  -6.059  1.00 26.44  ? 1841 ASP A C   1 
ATOM   2673 O O   . ASP A 1 358 ? -67.074 12.541  -4.974  1.00 29.79  ? 1841 ASP A O   1 
ATOM   2674 C CB  . ASP A 1 358 ? -68.941 11.116  -7.013  1.00 23.78  ? 1841 ASP A CB  1 
ATOM   2675 C CG  . ASP A 1 358 ? -69.320 10.317  -8.221  1.00 25.56  ? 1841 ASP A CG  1 
ATOM   2676 O OD1 . ASP A 1 358 ? -68.987 10.718  -9.351  1.00 26.36  ? 1841 ASP A OD1 1 
ATOM   2677 O OD2 . ASP A 1 358 ? -69.979 9.280   -8.048  1.00 32.48  ? 1841 ASP A OD2 1 
ATOM   2678 N N   . TYR A 1 359 ? -67.991 14.102  -6.308  1.00 25.75  ? 1842 TYR A N   1 
ATOM   2679 C CA  . TYR A 1 359 ? -68.047 15.146  -5.314  1.00 25.70  ? 1842 TYR A CA  1 
ATOM   2680 C C   . TYR A 1 359 ? -68.956 14.707  -4.139  1.00 27.05  ? 1842 TYR A C   1 
ATOM   2681 O O   . TYR A 1 359 ? -69.941 13.982  -4.349  1.00 28.33  ? 1842 TYR A O   1 
ATOM   2682 C CB  . TYR A 1 359 ? -68.621 16.398  -6.001  1.00 25.13  ? 1842 TYR A CB  1 
ATOM   2683 C CG  . TYR A 1 359 ? -69.363 17.352  -5.092  1.00 26.15  ? 1842 TYR A CG  1 
ATOM   2684 C CD1 . TYR A 1 359 ? -70.687 17.103  -4.707  1.00 23.73  ? 1842 TYR A CD1 1 
ATOM   2685 C CD2 . TYR A 1 359 ? -68.717 18.480  -4.563  1.00 27.39  ? 1842 TYR A CD2 1 
ATOM   2686 C CE1 . TYR A 1 359 ? -71.351 17.940  -3.821  1.00 23.37  ? 1842 TYR A CE1 1 
ATOM   2687 C CE2 . TYR A 1 359 ? -69.364 19.325  -3.673  1.00 27.31  ? 1842 TYR A CE2 1 
ATOM   2688 C CZ  . TYR A 1 359 ? -70.684 19.048  -3.301  1.00 27.50  ? 1842 TYR A CZ  1 
ATOM   2689 O OH  . TYR A 1 359 ? -71.298 19.857  -2.374  1.00 24.15  ? 1842 TYR A OH  1 
ATOM   2690 N N   . THR A 1 360 ? -68.609 15.128  -2.919  1.00 25.44  ? 1843 THR A N   1 
ATOM   2691 C CA  . THR A 1 360 ? -69.421 14.860  -1.715  1.00 24.06  ? 1843 THR A CA  1 
ATOM   2692 C C   . THR A 1 360 ? -69.486 16.188  -0.945  1.00 25.65  ? 1843 THR A C   1 
ATOM   2693 O O   . THR A 1 360 ? -68.567 17.008  -1.046  1.00 26.75  ? 1843 THR A O   1 
ATOM   2694 C CB  . THR A 1 360 ? -68.807 13.780  -0.810  1.00 20.59  ? 1843 THR A CB  1 
ATOM   2695 O OG1 . THR A 1 360 ? -67.415 14.053  -0.628  1.00 24.44  ? 1843 THR A OG1 1 
ATOM   2696 C CG2 . THR A 1 360 ? -68.963 12.397  -1.427  1.00 14.88  ? 1843 THR A CG2 1 
ATOM   2697 N N   . LEU A 1 361 ? -70.564 16.409  -0.195  1.00 25.66  ? 1844 LEU A N   1 
ATOM   2698 C CA  . LEU A 1 361 ? -70.752 17.659  0.560   1.00 27.12  ? 1844 LEU A CA  1 
ATOM   2699 C C   . LEU A 1 361 ? -69.539 18.257  1.266   1.00 27.80  ? 1844 LEU A C   1 
ATOM   2700 O O   . LEU A 1 361 ? -69.288 19.475  1.179   1.00 28.64  ? 1844 LEU A O   1 
ATOM   2701 C CB  . LEU A 1 361 ? -71.886 17.514  1.588   1.00 26.60  ? 1844 LEU A CB  1 
ATOM   2702 C CG  . LEU A 1 361 ? -73.282 17.841  1.023   1.00 29.71  ? 1844 LEU A CG  1 
ATOM   2703 C CD1 . LEU A 1 361 ? -74.341 17.736  2.115   1.00 30.11  ? 1844 LEU A CD1 1 
ATOM   2704 C CD2 . LEU A 1 361 ? -73.266 19.250  0.431   1.00 28.37  ? 1844 LEU A CD2 1 
ATOM   2705 N N   . HIS A 1 362 ? -68.787 17.419  1.966   1.00 25.47  ? 1845 HIS A N   1 
ATOM   2706 C CA  . HIS A 1 362 ? -67.629 17.912  2.668   1.00 24.73  ? 1845 HIS A CA  1 
ATOM   2707 C C   . HIS A 1 362 ? -66.343 17.222  2.188   1.00 27.24  ? 1845 HIS A C   1 
ATOM   2708 O O   . HIS A 1 362 ? -65.433 16.944  2.979   1.00 29.84  ? 1845 HIS A O   1 
ATOM   2709 C CB  . HIS A 1 362 ? -67.840 17.712  4.169   1.00 23.03  ? 1845 HIS A CB  1 
ATOM   2710 C CG  . HIS A 1 362 ? -69.188 18.163  4.656   1.00 25.70  ? 1845 HIS A CG  1 
ATOM   2711 N ND1 . HIS A 1 362 ? -69.548 19.495  4.751   1.00 22.29  ? 1845 HIS A ND1 1 
ATOM   2712 C CD2 . HIS A 1 362 ? -70.273 17.452  5.056   1.00 22.97  ? 1845 HIS A CD2 1 
ATOM   2713 C CE1 . HIS A 1 362 ? -70.792 19.580  5.187   1.00 22.82  ? 1845 HIS A CE1 1 
ATOM   2714 N NE2 . HIS A 1 362 ? -71.254 18.356  5.380   1.00 21.99  ? 1845 HIS A NE2 1 
ATOM   2715 N N   . ALA A 1 363 ? -66.251 16.951  0.896   1.00 26.60  ? 1846 ALA A N   1 
ATOM   2716 C CA  . ALA A 1 363 ? -65.052 16.318  0.385   1.00 28.64  ? 1846 ALA A CA  1 
ATOM   2717 C C   . ALA A 1 363 ? -63.872 17.282  0.441   1.00 30.81  ? 1846 ALA A C   1 
ATOM   2718 O O   . ALA A 1 363 ? -64.012 18.484  0.187   1.00 30.82  ? 1846 ALA A O   1 
ATOM   2719 C CB  . ALA A 1 363 ? -65.270 15.860  -1.046  1.00 28.82  ? 1846 ALA A CB  1 
ATOM   2720 N N   . ALA A 1 364 ? -62.710 16.738  0.777   1.00 33.65  ? 1847 ALA A N   1 
ATOM   2721 C CA  . ALA A 1 364 ? -61.471 17.509  0.841   1.00 35.05  ? 1847 ALA A CA  1 
ATOM   2722 C C   . ALA A 1 364 ? -60.850 17.527  -0.566  1.00 35.70  ? 1847 ALA A C   1 
ATOM   2723 O O   . ALA A 1 364 ? -60.795 16.493  -1.245  1.00 35.71  ? 1847 ALA A O   1 
ATOM   2724 C CB  . ALA A 1 364 ? -60.503 16.853  1.826   1.00 34.22  ? 1847 ALA A CB  1 
ATOM   2725 N N   . ILE A 1 365 ? -60.393 18.693  -1.007  1.00 35.50  ? 1848 ILE A N   1 
ATOM   2726 C CA  . ILE A 1 365 ? -59.780 18.790  -2.321  1.00 38.08  ? 1848 ILE A CA  1 
ATOM   2727 C C   . ILE A 1 365 ? -58.299 19.184  -2.199  1.00 38.73  ? 1848 ILE A C   1 
ATOM   2728 O O   . ILE A 1 365 ? -57.851 19.659  -1.156  1.00 39.57  ? 1848 ILE A O   1 
ATOM   2729 C CB  . ILE A 1 365 ? -60.537 19.810  -3.220  1.00 39.22  ? 1848 ILE A CB  1 
ATOM   2730 C CG1 . ILE A 1 365 ? -60.551 21.189  -2.573  1.00 40.99  ? 1848 ILE A CG1 1 
ATOM   2731 C CG2 . ILE A 1 365 ? -61.979 19.346  -3.444  1.00 39.77  ? 1848 ILE A CG2 1 
ATOM   2732 C CD1 . ILE A 1 365 ? -61.072 22.278  -3.504  1.00 45.77  ? 1848 ILE A CD1 1 
ATOM   2733 N N   . PRO A 1 366 ? -57.510 18.961  -3.255  1.00 38.62  ? 1849 PRO A N   1 
ATOM   2734 C CA  . PRO A 1 366 ? -56.104 19.345  -3.122  1.00 38.61  ? 1849 PRO A CA  1 
ATOM   2735 C C   . PRO A 1 366 ? -55.989 20.866  -3.200  1.00 38.15  ? 1849 PRO A C   1 
ATOM   2736 O O   . PRO A 1 366 ? -56.987 21.561  -3.408  1.00 38.16  ? 1849 PRO A O   1 
ATOM   2737 C CB  . PRO A 1 366 ? -55.435 18.653  -4.314  1.00 38.60  ? 1849 PRO A CB  1 
ATOM   2738 C CG  . PRO A 1 366 ? -56.386 17.531  -4.674  1.00 39.47  ? 1849 PRO A CG  1 
ATOM   2739 C CD  . PRO A 1 366 ? -57.734 18.171  -4.476  1.00 39.90  ? 1849 PRO A CD  1 
ATOM   2740 N N   . PRO A 1 367 ? -54.780 21.403  -2.980  1.00 37.30  ? 1850 PRO A N   1 
ATOM   2741 C CA  . PRO A 1 367 ? -54.581 22.855  -3.054  1.00 37.33  ? 1850 PRO A CA  1 
ATOM   2742 C C   . PRO A 1 367 ? -54.921 23.312  -4.479  1.00 38.19  ? 1850 PRO A C   1 
ATOM   2743 O O   . PRO A 1 367 ? -54.397 22.750  -5.440  1.00 38.02  ? 1850 PRO A O   1 
ATOM   2744 C CB  . PRO A 1 367 ? -53.100 23.008  -2.742  1.00 35.68  ? 1850 PRO A CB  1 
ATOM   2745 C CG  . PRO A 1 367 ? -52.856 21.909  -1.763  1.00 35.78  ? 1850 PRO A CG  1 
ATOM   2746 C CD  . PRO A 1 367 ? -53.617 20.742  -2.360  1.00 36.86  ? 1850 PRO A CD  1 
ATOM   2747 N N   . LEU A 1 368 ? -55.794 24.319  -4.606  1.00 38.93  ? 1851 LEU A N   1 
ATOM   2748 C CA  . LEU A 1 368 ? -56.228 24.842  -5.909  1.00 38.44  ? 1851 LEU A CA  1 
ATOM   2749 C C   . LEU A 1 368 ? -55.126 24.863  -6.969  1.00 39.07  ? 1851 LEU A C   1 
ATOM   2750 O O   . LEU A 1 368 ? -55.354 24.462  -8.110  1.00 38.18  ? 1851 LEU A O   1 
ATOM   2751 C CB  . LEU A 1 368 ? -56.803 26.253  -5.755  1.00 37.83  ? 1851 LEU A CB  1 
ATOM   2752 C CG  . LEU A 1 368 ? -57.512 26.848  -6.980  1.00 40.07  ? 1851 LEU A CG  1 
ATOM   2753 C CD1 . LEU A 1 368 ? -58.874 26.190  -7.135  1.00 39.18  ? 1851 LEU A CD1 1 
ATOM   2754 C CD2 . LEU A 1 368 ? -57.695 28.355  -6.820  1.00 39.59  ? 1851 LEU A CD2 1 
ATOM   2755 N N   . GLU A 1 369 ? -53.929 25.312  -6.589  1.00 40.59  ? 1852 GLU A N   1 
ATOM   2756 C CA  . GLU A 1 369 ? -52.807 25.396  -7.526  1.00 41.29  ? 1852 GLU A CA  1 
ATOM   2757 C C   . GLU A 1 369 ? -52.487 24.073  -8.232  1.00 39.97  ? 1852 GLU A C   1 
ATOM   2758 O O   . GLU A 1 369 ? -51.767 24.063  -9.238  1.00 39.67  ? 1852 GLU A O   1 
ATOM   2759 C CB  . GLU A 1 369 ? -51.552 25.925  -6.819  1.00 43.75  ? 1852 GLU A CB  1 
ATOM   2760 C CG  . GLU A 1 369 ? -51.162 25.168  -5.549  1.00 48.56  ? 1852 GLU A CG  1 
ATOM   2761 C CD  . GLU A 1 369 ? -51.728 25.803  -4.272  1.00 52.40  ? 1852 GLU A CD  1 
ATOM   2762 O OE1 . GLU A 1 369 ? -52.965 26.022  -4.181  1.00 50.31  ? 1852 GLU A OE1 1 
ATOM   2763 O OE2 . GLU A 1 369 ? -50.919 26.079  -3.351  1.00 54.35  ? 1852 GLU A OE2 1 
ATOM   2764 N N   . GLU A 1 370 ? -53.025 22.969  -7.717  1.00 37.56  ? 1853 GLU A N   1 
ATOM   2765 C CA  . GLU A 1 370 ? -52.801 21.659  -8.319  1.00 36.49  ? 1853 GLU A CA  1 
ATOM   2766 C C   . GLU A 1 370 ? -53.747 21.331  -9.476  1.00 33.77  ? 1853 GLU A C   1 
ATOM   2767 O O   . GLU A 1 370 ? -53.465 20.441  -10.262 1.00 32.01  ? 1853 GLU A O   1 
ATOM   2768 C CB  . GLU A 1 370 ? -52.892 20.569  -7.252  1.00 38.65  ? 1853 GLU A CB  1 
ATOM   2769 C CG  . GLU A 1 370 ? -51.539 20.222  -6.633  1.00 46.00  ? 1853 GLU A CG  1 
ATOM   2770 C CD  . GLU A 1 370 ? -51.652 19.593  -5.251  1.00 47.64  ? 1853 GLU A CD  1 
ATOM   2771 O OE1 . GLU A 1 370 ? -52.261 18.512  -5.128  1.00 50.46  ? 1853 GLU A OE1 1 
ATOM   2772 O OE2 . GLU A 1 370 ? -51.126 20.186  -4.285  1.00 48.16  ? 1853 GLU A OE2 1 
ATOM   2773 N N   . VAL A 1 371 ? -54.860 22.051  -9.577  1.00 32.22  ? 1854 VAL A N   1 
ATOM   2774 C CA  . VAL A 1 371 ? -55.829 21.799  -10.639 1.00 33.46  ? 1854 VAL A CA  1 
ATOM   2775 C C   . VAL A 1 371 ? -56.193 23.072  -11.418 1.00 35.93  ? 1854 VAL A C   1 
ATOM   2776 O O   . VAL A 1 371 ? -56.861 23.015  -12.461 1.00 36.71  ? 1854 VAL A O   1 
ATOM   2777 C CB  . VAL A 1 371 ? -57.152 21.193  -10.065 1.00 31.85  ? 1854 VAL A CB  1 
ATOM   2778 C CG1 . VAL A 1 371 ? -56.843 19.980  -9.203  1.00 27.52  ? 1854 VAL A CG1 1 
ATOM   2779 C CG2 . VAL A 1 371 ? -57.914 22.246  -9.251  1.00 30.48  ? 1854 VAL A CG2 1 
ATOM   2780 N N   . TYR A 1 372 ? -55.740 24.213  -10.909 1.00 36.74  ? 1855 TYR A N   1 
ATOM   2781 C CA  . TYR A 1 372 ? -56.048 25.509  -11.506 1.00 39.00  ? 1855 TYR A CA  1 
ATOM   2782 C C   . TYR A 1 372 ? -54.859 26.451  -11.371 1.00 42.94  ? 1855 TYR A C   1 
ATOM   2783 O O   . TYR A 1 372 ? -54.318 26.632  -10.272 1.00 44.53  ? 1855 TYR A O   1 
ATOM   2784 C CB  . TYR A 1 372 ? -57.240 26.115  -10.780 1.00 35.25  ? 1855 TYR A CB  1 
ATOM   2785 C CG  . TYR A 1 372 ? -57.795 27.391  -11.361 1.00 31.67  ? 1855 TYR A CG  1 
ATOM   2786 C CD1 . TYR A 1 372 ? -58.600 27.376  -12.499 1.00 31.81  ? 1855 TYR A CD1 1 
ATOM   2787 C CD2 . TYR A 1 372 ? -57.599 28.598  -10.714 1.00 32.04  ? 1855 TYR A CD2 1 
ATOM   2788 C CE1 . TYR A 1 372 ? -59.214 28.532  -12.969 1.00 30.66  ? 1855 TYR A CE1 1 
ATOM   2789 C CE2 . TYR A 1 372 ? -58.194 29.767  -11.173 1.00 31.57  ? 1855 TYR A CE2 1 
ATOM   2790 C CZ  . TYR A 1 372 ? -59.011 29.730  -12.290 1.00 32.50  ? 1855 TYR A CZ  1 
ATOM   2791 O OH  . TYR A 1 372 ? -59.691 30.877  -12.659 1.00 32.31  ? 1855 TYR A OH  1 
ATOM   2792 N N   . SER A 1 373 ? -54.465 27.055  -12.485 1.00 45.94  ? 1856 SER A N   1 
ATOM   2793 C CA  . SER A 1 373 ? -53.346 27.975  -12.484 1.00 50.01  ? 1856 SER A CA  1 
ATOM   2794 C C   . SER A 1 373 ? -53.698 29.317  -11.859 1.00 52.05  ? 1856 SER A C   1 
ATOM   2795 O O   . SER A 1 373 ? -54.711 29.924  -12.196 1.00 50.07  ? 1856 SER A O   1 
ATOM   2796 C CB  . SER A 1 373 ? -52.856 28.208  -13.904 1.00 51.28  ? 1856 SER A CB  1 
ATOM   2797 O OG  . SER A 1 373 ? -51.905 29.261  -13.919 1.00 55.14  ? 1856 SER A OG  1 
ATOM   2798 N N   . LEU A 1 374 ? -52.843 29.775  -10.952 1.00 56.00  ? 1857 LEU A N   1 
ATOM   2799 C CA  . LEU A 1 374 ? -53.051 31.053  -10.292 1.00 60.74  ? 1857 LEU A CA  1 
ATOM   2800 C C   . LEU A 1 374 ? -52.200 32.117  -10.996 1.00 64.07  ? 1857 LEU A C   1 
ATOM   2801 O O   . LEU A 1 374 ? -52.389 33.319  -10.796 1.00 63.58  ? 1857 LEU A O   1 
ATOM   2802 C CB  . LEU A 1 374 ? -52.660 30.946  -8.814  1.00 60.47  ? 1857 LEU A CB  1 
ATOM   2803 N N   . GLN A 1 375 ? -51.271 31.660  -11.836 1.00 67.71  ? 1858 GLN A N   1 
ATOM   2804 C CA  . GLN A 1 375 ? -50.381 32.553  -12.574 1.00 70.37  ? 1858 GLN A CA  1 
ATOM   2805 C C   . GLN A 1 375 ? -51.157 33.511  -13.477 1.00 72.04  ? 1858 GLN A C   1 
ATOM   2806 O O   . GLN A 1 375 ? -50.655 34.580  -13.833 1.00 72.59  ? 1858 GLN A O   1 
ATOM   2807 C CB  . GLN A 1 375 ? -49.394 31.736  -13.414 1.00 69.88  ? 1858 GLN A CB  1 
ATOM   2808 N N   . ARG A 1 376 ? -52.379 33.130  -13.839 1.00 73.71  ? 1859 ARG A N   1 
ATOM   2809 C CA  . ARG A 1 376 ? -53.215 33.970  -14.696 1.00 75.31  ? 1859 ARG A CA  1 
ATOM   2810 C C   . ARG A 1 376 ? -53.741 35.217  -13.962 1.00 75.83  ? 1859 ARG A C   1 
ATOM   2811 O O   . ARG A 1 376 ? -53.939 36.273  -14.572 1.00 75.35  ? 1859 ARG A O   1 
ATOM   2812 C CB  . ARG A 1 376 ? -54.387 33.145  -15.245 1.00 76.13  ? 1859 ARG A CB  1 
ATOM   2813 N N   . LEU A 1 377 ? -53.975 35.087  -12.655 1.00 76.54  ? 1860 LEU A N   1 
ATOM   2814 C CA  . LEU A 1 377 ? -54.463 36.205  -11.843 1.00 76.40  ? 1860 LEU A CA  1 
ATOM   2815 C C   . LEU A 1 377 ? -53.264 37.081  -11.482 1.00 76.49  ? 1860 LEU A C   1 
ATOM   2816 O O   . LEU A 1 377 ? -53.377 38.307  -11.406 1.00 76.20  ? 1860 LEU A O   1 
ATOM   2817 C CB  . LEU A 1 377 ? -55.133 35.692  -10.560 1.00 75.92  ? 1860 LEU A CB  1 
ATOM   2818 C CG  . LEU A 1 377 ? -56.230 36.551  -9.915  1.00 76.10  ? 1860 LEU A CG  1 
ATOM   2819 C CD1 . LEU A 1 377 ? -56.554 35.987  -8.548  1.00 76.15  ? 1860 LEU A CD1 1 
ATOM   2820 C CD2 . LEU A 1 377 ? -55.790 37.998  -9.772  1.00 75.83  ? 1860 LEU A CD2 1 
ATOM   2821 N N   . LYS A 1 378 ? -52.119 36.436  -11.263 1.00 76.78  ? 1861 LYS A N   1 
ATOM   2822 C CA  . LYS A 1 378 ? -50.877 37.129  -10.929 1.00 77.09  ? 1861 LYS A CA  1 
ATOM   2823 C C   . LYS A 1 378 ? -50.591 38.190  -11.990 1.00 77.73  ? 1861 LYS A C   1 
ATOM   2824 O O   . LYS A 1 378 ? -50.103 39.285  -11.682 1.00 77.86  ? 1861 LYS A O   1 
ATOM   2825 C CB  . LYS A 1 378 ? -49.711 36.136  -10.870 1.00 76.33  ? 1861 LYS A CB  1 
ATOM   2826 C CG  . LYS A 1 378 ? -49.872 35.033  -9.831  1.00 75.29  ? 1861 LYS A CG  1 
ATOM   2827 C CD  . LYS A 1 378 ? -50.246 35.612  -8.469  1.00 75.10  ? 1861 LYS A CD  1 
ATOM   2828 C CE  . LYS A 1 378 ? -50.231 34.556  -7.376  1.00 74.55  ? 1861 LYS A CE  1 
ATOM   2829 N NZ  . LYS A 1 378 ? -48.857 34.026  -7.161  1.00 74.42  ? 1861 LYS A NZ  1 
ATOM   2830 N N   . ALA A 1 379 ? -50.900 37.851  -13.240 1.00 77.78  ? 1862 ALA A N   1 
ATOM   2831 C CA  . ALA A 1 379 ? -50.702 38.754  -14.368 1.00 77.51  ? 1862 ALA A CA  1 
ATOM   2832 C C   . ALA A 1 379 ? -51.551 40.008  -14.183 1.00 77.45  ? 1862 ALA A C   1 
ATOM   2833 O O   . ALA A 1 379 ? -51.018 41.092  -13.944 1.00 77.98  ? 1862 ALA A O   1 
ATOM   2834 C CB  . ALA A 1 379 ? -51.078 38.053  -15.671 1.00 76.78  ? 1862 ALA A CB  1 
ATOM   2835 N N   . ARG A 1 380 ? -52.870 39.853  -14.291 1.00 77.09  ? 1863 ARG A N   1 
ATOM   2836 C CA  . ARG A 1 380 ? -53.788 40.977  -14.129 1.00 76.37  ? 1863 ARG A CA  1 
ATOM   2837 C C   . ARG A 1 380 ? -53.580 41.635  -12.768 1.00 76.13  ? 1863 ARG A C   1 
ATOM   2838 O O   . ARG A 1 380 ? -52.656 42.431  -12.586 1.00 75.07  ? 1863 ARG A O   1 
ATOM   2839 C CB  . ARG A 1 380 ? -55.241 40.505  -14.259 1.00 75.23  ? 1863 ARG A CB  1 
ATOM   2840 N N   . ILE A 1 410 ? -55.977 39.360  -3.225  1.00 57.20  ? 1913 ILE A N   1 
ATOM   2841 C CA  . ILE A 1 410 ? -56.774 38.707  -4.270  1.00 55.82  ? 1913 ILE A CA  1 
ATOM   2842 C C   . ILE A 1 410 ? -57.509 37.480  -3.734  1.00 55.41  ? 1913 ILE A C   1 
ATOM   2843 O O   . ILE A 1 410 ? -57.905 36.597  -4.501  1.00 54.91  ? 1913 ILE A O   1 
ATOM   2844 C CB  . ILE A 1 410 ? -55.893 38.245  -5.441  1.00 55.10  ? 1913 ILE A CB  1 
ATOM   2845 C CG1 . ILE A 1 410 ? -54.879 37.205  -4.954  1.00 54.24  ? 1913 ILE A CG1 1 
ATOM   2846 C CG2 . ILE A 1 410 ? -55.180 39.431  -6.032  1.00 56.90  ? 1913 ILE A CG2 1 
ATOM   2847 C CD1 . ILE A 1 410 ? -54.149 36.501  -6.056  1.00 51.88  ? 1913 ILE A CD1 1 
ATOM   2848 N N   . LYS A 1 411 ? -57.685 37.433  -2.418  1.00 54.01  ? 1914 LYS A N   1 
ATOM   2849 C CA  . LYS A 1 411 ? -58.364 36.325  -1.772  1.00 54.04  ? 1914 LYS A CA  1 
ATOM   2850 C C   . LYS A 1 411 ? -59.790 36.086  -2.291  1.00 55.34  ? 1914 LYS A C   1 
ATOM   2851 O O   . LYS A 1 411 ? -60.297 34.966  -2.213  1.00 55.74  ? 1914 LYS A O   1 
ATOM   2852 C CB  . LYS A 1 411 ? -58.405 36.554  -0.259  1.00 52.43  ? 1914 LYS A CB  1 
ATOM   2853 N N   . GLU A 1 412 ? -60.444 37.121  -2.812  1.00 55.71  ? 1915 GLU A N   1 
ATOM   2854 C CA  . GLU A 1 412 ? -61.806 36.948  -3.305  1.00 57.00  ? 1915 GLU A CA  1 
ATOM   2855 C C   . GLU A 1 412 ? -61.836 36.230  -4.649  1.00 57.21  ? 1915 GLU A C   1 
ATOM   2856 O O   . GLU A 1 412 ? -62.664 35.336  -4.856  1.00 57.42  ? 1915 GLU A O   1 
ATOM   2857 C CB  . GLU A 1 412 ? -62.537 38.297  -3.398  1.00 58.55  ? 1915 GLU A CB  1 
ATOM   2858 C CG  . GLU A 1 412 ? -62.836 38.932  -2.028  1.00 62.32  ? 1915 GLU A CG  1 
ATOM   2859 C CD  . GLU A 1 412 ? -63.549 37.975  -1.060  1.00 64.94  ? 1915 GLU A CD  1 
ATOM   2860 O OE1 . GLU A 1 412 ? -63.606 38.270  0.156   1.00 65.78  ? 1915 GLU A OE1 1 
ATOM   2861 O OE2 . GLU A 1 412 ? -64.058 36.927  -1.513  1.00 67.34  ? 1915 GLU A OE2 1 
ATOM   2862 N N   . GLU A 1 413 ? -60.935 36.610  -5.555  1.00 55.75  ? 1916 GLU A N   1 
ATOM   2863 C CA  . GLU A 1 413 ? -60.858 35.958  -6.863  1.00 54.00  ? 1916 GLU A CA  1 
ATOM   2864 C C   . GLU A 1 413 ? -60.748 34.456  -6.651  1.00 51.66  ? 1916 GLU A C   1 
ATOM   2865 O O   . GLU A 1 413 ? -61.615 33.696  -7.062  1.00 50.47  ? 1916 GLU A O   1 
ATOM   2866 C CB  . GLU A 1 413 ? -59.626 36.428  -7.636  1.00 55.69  ? 1916 GLU A CB  1 
ATOM   2867 C CG  . GLU A 1 413 ? -59.783 37.764  -8.302  1.00 56.73  ? 1916 GLU A CG  1 
ATOM   2868 C CD  . GLU A 1 413 ? -60.822 37.717  -9.383  1.00 57.16  ? 1916 GLU A CD  1 
ATOM   2869 O OE1 . GLU A 1 413 ? -60.490 37.315  -10.529 1.00 54.93  ? 1916 GLU A OE1 1 
ATOM   2870 O OE2 . GLU A 1 413 ? -61.979 38.068  -9.066  1.00 58.45  ? 1916 GLU A OE2 1 
ATOM   2871 N N   . VAL A 1 414 ? -59.663 34.046  -6.005  1.00 49.62  ? 1917 VAL A N   1 
ATOM   2872 C CA  . VAL A 1 414 ? -59.410 32.648  -5.721  1.00 47.57  ? 1917 VAL A CA  1 
ATOM   2873 C C   . VAL A 1 414 ? -60.675 31.977  -5.160  1.00 48.34  ? 1917 VAL A C   1 
ATOM   2874 O O   . VAL A 1 414 ? -61.157 30.988  -5.720  1.00 48.83  ? 1917 VAL A O   1 
ATOM   2875 C CB  . VAL A 1 414 ? -58.231 32.522  -4.725  1.00 46.13  ? 1917 VAL A CB  1 
ATOM   2876 C CG1 . VAL A 1 414 ? -57.750 31.085  -4.634  1.00 44.68  ? 1917 VAL A CG1 1 
ATOM   2877 C CG2 . VAL A 1 414 ? -57.087 33.432  -5.178  1.00 45.59  ? 1917 VAL A CG2 1 
ATOM   2878 N N   . SER A 1 415 ? -61.229 32.522  -4.078  1.00 47.93  ? 1918 SER A N   1 
ATOM   2879 C CA  . SER A 1 415 ? -62.432 31.951  -3.468  1.00 46.47  ? 1918 SER A CA  1 
ATOM   2880 C C   . SER A 1 415 ? -63.561 31.788  -4.468  1.00 46.44  ? 1918 SER A C   1 
ATOM   2881 O O   . SER A 1 415 ? -64.281 30.788  -4.445  1.00 47.12  ? 1918 SER A O   1 
ATOM   2882 C CB  . SER A 1 415 ? -62.931 32.814  -2.297  1.00 45.14  ? 1918 SER A CB  1 
ATOM   2883 O OG  . SER A 1 415 ? -62.164 32.592  -1.126  1.00 43.65  ? 1918 SER A OG  1 
ATOM   2884 N N   . SER A 1 416 ? -63.731 32.770  -5.343  1.00 45.56  ? 1919 SER A N   1 
ATOM   2885 C CA  . SER A 1 416 ? -64.794 32.681  -6.328  1.00 44.46  ? 1919 SER A CA  1 
ATOM   2886 C C   . SER A 1 416 ? -64.512 31.575  -7.361  1.00 44.92  ? 1919 SER A C   1 
ATOM   2887 O O   . SER A 1 416 ? -65.385 30.761  -7.658  1.00 46.05  ? 1919 SER A O   1 
ATOM   2888 C CB  . SER A 1 416 ? -64.972 34.022  -7.021  1.00 42.83  ? 1919 SER A CB  1 
ATOM   2889 O OG  . SER A 1 416 ? -66.178 34.017  -7.752  1.00 43.64  ? 1919 SER A OG  1 
ATOM   2890 N N   . ALA A 1 417 ? -63.295 31.550  -7.902  1.00 43.66  ? 1920 ALA A N   1 
ATOM   2891 C CA  . ALA A 1 417 ? -62.902 30.541  -8.873  1.00 42.89  ? 1920 ALA A CA  1 
ATOM   2892 C C   . ALA A 1 417 ? -63.036 29.171  -8.211  1.00 42.60  ? 1920 ALA A C   1 
ATOM   2893 O O   . ALA A 1 417 ? -63.526 28.208  -8.807  1.00 39.94  ? 1920 ALA A O   1 
ATOM   2894 C CB  . ALA A 1 417 ? -61.441 30.776  -9.318  1.00 41.68  ? 1920 ALA A CB  1 
ATOM   2895 N N   . ARG A 1 418 ? -62.585 29.102  -6.966  1.00 42.50  ? 1921 ARG A N   1 
ATOM   2896 C CA  . ARG A 1 418 ? -62.646 27.879  -6.199  1.00 43.34  ? 1921 ARG A CA  1 
ATOM   2897 C C   . ARG A 1 418 ? -64.094 27.426  -6.013  1.00 42.70  ? 1921 ARG A C   1 
ATOM   2898 O O   . ARG A 1 418 ? -64.417 26.256  -6.201  1.00 43.79  ? 1921 ARG A O   1 
ATOM   2899 C CB  . ARG A 1 418 ? -61.985 28.098  -4.849  1.00 43.94  ? 1921 ARG A CB  1 
ATOM   2900 C CG  . ARG A 1 418 ? -61.857 26.857  -4.004  1.00 48.98  ? 1921 ARG A CG  1 
ATOM   2901 C CD  . ARG A 1 418 ? -60.915 27.119  -2.829  1.00 53.47  ? 1921 ARG A CD  1 
ATOM   2902 N NE  . ARG A 1 418 ? -60.714 25.924  -2.017  1.00 58.52  ? 1921 ARG A NE  1 
ATOM   2903 C CZ  . ARG A 1 418 ? -61.666 25.344  -1.290  1.00 59.99  ? 1921 ARG A CZ  1 
ATOM   2904 N NH1 . ARG A 1 418 ? -62.889 25.863  -1.275  1.00 59.81  ? 1921 ARG A NH1 1 
ATOM   2905 N NH2 . ARG A 1 418 ? -61.397 24.240  -0.592  1.00 59.67  ? 1921 ARG A NH2 1 
ATOM   2906 N N   . ALA A 1 419 ? -64.972 28.350  -5.661  1.00 42.27  ? 1922 ALA A N   1 
ATOM   2907 C CA  . ALA A 1 419 ? -66.372 27.996  -5.449  1.00 42.34  ? 1922 ALA A CA  1 
ATOM   2908 C C   . ALA A 1 419 ? -67.031 27.658  -6.771  1.00 41.30  ? 1922 ALA A C   1 
ATOM   2909 O O   . ALA A 1 419 ? -68.082 27.036  -6.810  1.00 43.40  ? 1922 ALA A O   1 
ATOM   2910 C CB  . ALA A 1 419 ? -67.113 29.148  -4.771  1.00 40.45  ? 1922 ALA A CB  1 
ATOM   2911 N N   . SER A 1 420 ? -66.395 28.063  -7.859  1.00 41.25  ? 1923 SER A N   1 
ATOM   2912 C CA  . SER A 1 420 ? -66.936 27.827  -9.189  1.00 40.03  ? 1923 SER A CA  1 
ATOM   2913 C C   . SER A 1 420 ? -66.560 26.442  -9.700  1.00 37.88  ? 1923 SER A C   1 
ATOM   2914 O O   . SER A 1 420 ? -67.388 25.736  -10.264 1.00 37.83  ? 1923 SER A O   1 
ATOM   2915 C CB  . SER A 1 420 ? -66.426 28.905  -10.156 1.00 40.53  ? 1923 SER A CB  1 
ATOM   2916 O OG  . SER A 1 420 ? -67.058 28.810  -11.421 1.00 43.15  ? 1923 SER A OG  1 
ATOM   2917 N N   . ILE A 1 421 ? -65.304 26.070  -9.510  1.00 35.26  ? 1924 ILE A N   1 
ATOM   2918 C CA  . ILE A 1 421 ? -64.801 24.777  -9.942  1.00 33.84  ? 1924 ILE A CA  1 
ATOM   2919 C C   . ILE A 1 421 ? -65.510 23.632  -9.185  1.00 33.26  ? 1924 ILE A C   1 
ATOM   2920 O O   . ILE A 1 421 ? -65.880 22.628  -9.787  1.00 32.48  ? 1924 ILE A O   1 
ATOM   2921 C CB  . ILE A 1 421 ? -63.265 24.734  -9.720  1.00 32.38  ? 1924 ILE A CB  1 
ATOM   2922 C CG1 . ILE A 1 421 ? -62.611 25.711  -10.688 1.00 33.24  ? 1924 ILE A CG1 1 
ATOM   2923 C CG2 . ILE A 1 421 ? -62.715 23.323  -9.858  1.00 27.59  ? 1924 ILE A CG2 1 
ATOM   2924 C CD1 . ILE A 1 421 ? -61.237 26.206  -10.211 1.00 35.57  ? 1924 ILE A CD1 1 
ATOM   2925 N N   . ILE A 1 422 ? -65.684 23.805  -7.873  1.00 31.71  ? 1925 ILE A N   1 
ATOM   2926 C CA  . ILE A 1 422 ? -66.337 22.828  -7.005  1.00 31.33  ? 1925 ILE A CA  1 
ATOM   2927 C C   . ILE A 1 422 ? -67.793 22.649  -7.433  1.00 33.59  ? 1925 ILE A C   1 
ATOM   2928 O O   . ILE A 1 422 ? -68.370 21.563  -7.353  1.00 34.93  ? 1925 ILE A O   1 
ATOM   2929 C CB  . ILE A 1 422 ? -66.243 23.284  -5.516  1.00 29.09  ? 1925 ILE A CB  1 
ATOM   2930 C CG1 . ILE A 1 422 ? -64.845 22.938  -4.989  1.00 26.95  ? 1925 ILE A CG1 1 
ATOM   2931 C CG2 . ILE A 1 422 ? -67.335 22.646  -4.661  1.00 25.78  ? 1925 ILE A CG2 1 
ATOM   2932 C CD1 . ILE A 1 422 ? -64.622 23.309  -3.553  1.00 27.01  ? 1925 ILE A CD1 1 
ATOM   2933 N N   . ASP A 1 423 ? -68.383 23.730  -7.900  1.00 33.00  ? 1926 ASP A N   1 
ATOM   2934 C CA  . ASP A 1 423 ? -69.744 23.686  -8.367  1.00 32.60  ? 1926 ASP A CA  1 
ATOM   2935 C C   . ASP A 1 423 ? -69.805 22.886  -9.673  1.00 32.18  ? 1926 ASP A C   1 
ATOM   2936 O O   . ASP A 1 423 ? -70.806 22.208  -9.966  1.00 31.42  ? 1926 ASP A O   1 
ATOM   2937 C CB  . ASP A 1 423 ? -70.245 25.103  -8.636  1.00 34.55  ? 1926 ASP A CB  1 
ATOM   2938 C CG  . ASP A 1 423 ? -71.660 25.114  -9.154  1.00 36.70  ? 1926 ASP A CG  1 
ATOM   2939 O OD1 . ASP A 1 423 ? -72.569 24.860  -8.333  1.00 38.66  ? 1926 ASP A OD1 1 
ATOM   2940 O OD2 . ASP A 1 423 ? -71.856 25.344  -10.369 1.00 35.56  ? 1926 ASP A OD2 1 
ATOM   2941 N N   . LYS A 1 424 ? -68.743 22.988  -10.469 1.00 29.63  ? 1927 LYS A N   1 
ATOM   2942 C CA  . LYS A 1 424 ? -68.696 22.295  -11.750 1.00 28.40  ? 1927 LYS A CA  1 
ATOM   2943 C C   . LYS A 1 424 ? -68.418 20.813  -11.556 1.00 26.90  ? 1927 LYS A C   1 
ATOM   2944 O O   . LYS A 1 424 ? -68.930 19.959  -12.296 1.00 24.60  ? 1927 LYS A O   1 
ATOM   2945 C CB  . LYS A 1 424 ? -67.620 22.906  -12.649 1.00 27.27  ? 1927 LYS A CB  1 
ATOM   2946 C CG  . LYS A 1 424 ? -68.067 24.104  -13.424 1.00 26.69  ? 1927 LYS A CG  1 
ATOM   2947 C CD  . LYS A 1 424 ? -66.893 24.789  -14.104 1.00 30.17  ? 1927 LYS A CD  1 
ATOM   2948 C CE  . LYS A 1 424 ? -67.373 25.863  -15.064 1.00 32.38  ? 1927 LYS A CE  1 
ATOM   2949 N NZ  . LYS A 1 424 ? -68.218 26.877  -14.365 1.00 36.60  ? 1927 LYS A NZ  1 
ATOM   2950 N N   . TRP A 1 425 ? -67.598 20.536  -10.554 1.00 25.00  ? 1928 TRP A N   1 
ATOM   2951 C CA  . TRP A 1 425 ? -67.209 19.181  -10.234 1.00 25.45  ? 1928 TRP A CA  1 
ATOM   2952 C C   . TRP A 1 425 ? -68.456 18.439  -9.790  1.00 25.81  ? 1928 TRP A C   1 
ATOM   2953 O O   . TRP A 1 425 ? -68.642 17.260  -10.095 1.00 24.11  ? 1928 TRP A O   1 
ATOM   2954 C CB  . TRP A 1 425 ? -66.158 19.201  -9.121  1.00 22.46  ? 1928 TRP A CB  1 
ATOM   2955 C CG  . TRP A 1 425 ? -65.830 17.842  -8.580  1.00 18.53  ? 1928 TRP A CG  1 
ATOM   2956 C CD1 . TRP A 1 425 ? -65.754 16.673  -9.284  1.00 16.79  ? 1928 TRP A CD1 1 
ATOM   2957 C CD2 . TRP A 1 425 ? -65.401 17.543  -7.258  1.00 16.03  ? 1928 TRP A CD2 1 
ATOM   2958 N NE1 . TRP A 1 425 ? -65.289 15.667  -8.480  1.00 16.22  ? 1928 TRP A NE1 1 
ATOM   2959 C CE2 . TRP A 1 425 ? -65.066 16.176  -7.227  1.00 16.25  ? 1928 TRP A CE2 1 
ATOM   2960 C CE3 . TRP A 1 425 ? -65.261 18.301  -6.089  1.00 18.78  ? 1928 TRP A CE3 1 
ATOM   2961 C CZ2 . TRP A 1 425 ? -64.600 15.545  -6.062  1.00 14.18  ? 1928 TRP A CZ2 1 
ATOM   2962 C CZ3 . TRP A 1 425 ? -64.795 17.679  -4.936  1.00 15.92  ? 1928 TRP A CZ3 1 
ATOM   2963 C CH2 . TRP A 1 425 ? -64.472 16.310  -4.936  1.00 14.09  ? 1928 TRP A CH2 1 
ATOM   2964 N N   . ARG A 1 426 ? -69.303 19.167  -9.072  1.00 27.40  ? 1929 ARG A N   1 
ATOM   2965 C CA  . ARG A 1 426 ? -70.573 18.652  -8.564  1.00 31.08  ? 1929 ARG A CA  1 
ATOM   2966 C C   . ARG A 1 426 ? -71.412 18.092  -9.717  1.00 30.01  ? 1929 ARG A C   1 
ATOM   2967 O O   . ARG A 1 426 ? -72.077 17.082  -9.552  1.00 30.91  ? 1929 ARG A O   1 
ATOM   2968 C CB  . ARG A 1 426 ? -71.364 19.783  -7.877  1.00 32.11  ? 1929 ARG A CB  1 
ATOM   2969 C CG  . ARG A 1 426 ? -72.430 19.341  -6.910  1.00 37.04  ? 1929 ARG A CG  1 
ATOM   2970 C CD  . ARG A 1 426 ? -73.442 20.458  -6.653  1.00 42.52  ? 1929 ARG A CD  1 
ATOM   2971 N NE  . ARG A 1 426 ? -74.420 20.528  -7.751  1.00 49.80  ? 1929 ARG A NE  1 
ATOM   2972 C CZ  . ARG A 1 426 ? -74.488 21.514  -8.641  1.00 50.20  ? 1929 ARG A CZ  1 
ATOM   2973 N NH1 . ARG A 1 426 ? -73.646 22.538  -8.559  1.00 51.27  ? 1929 ARG A NH1 1 
ATOM   2974 N NH2 . ARG A 1 426 ? -75.353 21.449  -9.649  1.00 51.13  ? 1929 ARG A NH2 1 
ATOM   2975 N N   . LYS A 1 427 ? -71.367 18.742  -10.880 1.00 28.39  ? 1930 LYS A N   1 
ATOM   2976 C CA  . LYS A 1 427 ? -72.153 18.303  -12.023 1.00 29.55  ? 1930 LYS A CA  1 
ATOM   2977 C C   . LYS A 1 427 ? -71.569 17.144  -12.817 1.00 29.17  ? 1930 LYS A C   1 
ATOM   2978 O O   . LYS A 1 427 ? -72.151 16.722  -13.812 1.00 31.35  ? 1930 LYS A O   1 
ATOM   2979 C CB  . LYS A 1 427 ? -72.419 19.472  -12.981 1.00 33.26  ? 1930 LYS A CB  1 
ATOM   2980 C CG  . LYS A 1 427 ? -73.069 20.712  -12.336 1.00 34.01  ? 1930 LYS A CG  1 
ATOM   2981 C CD  . LYS A 1 427 ? -73.544 21.693  -13.411 1.00 36.56  ? 1930 LYS A CD  1 
ATOM   2982 C CE  . LYS A 1 427 ? -73.624 23.161  -12.920 1.00 38.71  ? 1930 LYS A CE  1 
ATOM   2983 N NZ  . LYS A 1 427 ? -72.293 23.881  -12.874 1.00 38.14  ? 1930 LYS A NZ  1 
ATOM   2984 N N   . PHE A 1 428 ? -70.428 16.624  -12.394 1.00 28.15  ? 1931 PHE A N   1 
ATOM   2985 C CA  . PHE A 1 428 ? -69.823 15.505  -13.094 1.00 26.96  ? 1931 PHE A CA  1 
ATOM   2986 C C   . PHE A 1 428 ? -70.007 14.214  -12.294 1.00 27.46  ? 1931 PHE A C   1 
ATOM   2987 O O   . PHE A 1 428 ? -69.202 13.276  -12.427 1.00 25.23  ? 1931 PHE A O   1 
ATOM   2988 C CB  . PHE A 1 428 ? -68.322 15.717  -13.290 1.00 28.68  ? 1931 PHE A CB  1 
ATOM   2989 C CG  . PHE A 1 428 ? -67.968 16.860  -14.187 1.00 29.93  ? 1931 PHE A CG  1 
ATOM   2990 C CD1 . PHE A 1 428 ? -68.733 17.147  -15.308 1.00 30.91  ? 1931 PHE A CD1 1 
ATOM   2991 C CD2 . PHE A 1 428 ? -66.840 17.632  -13.930 1.00 28.07  ? 1931 PHE A CD2 1 
ATOM   2992 C CE1 . PHE A 1 428 ? -68.381 18.180  -16.154 1.00 30.28  ? 1931 PHE A CE1 1 
ATOM   2993 C CE2 . PHE A 1 428 ? -66.486 18.659  -14.770 1.00 29.13  ? 1931 PHE A CE2 1 
ATOM   2994 C CZ  . PHE A 1 428 ? -67.253 18.938  -15.880 1.00 29.04  ? 1931 PHE A CZ  1 
ATOM   2995 N N   . GLN A 1 429 ? -71.035 14.174  -11.446 1.00 24.77  ? 1932 GLN A N   1 
ATOM   2996 C CA  . GLN A 1 429 ? -71.270 12.984  -10.642 1.00 23.00  ? 1932 GLN A CA  1 
ATOM   2997 C C   . GLN A 1 429 ? -71.581 11.822  -11.575 1.00 22.03  ? 1932 GLN A C   1 
ATOM   2998 O O   . GLN A 1 429 ? -72.336 11.979  -12.530 1.00 20.62  ? 1932 GLN A O   1 
ATOM   2999 C CB  . GLN A 1 429 ? -72.437 13.210  -9.676  1.00 22.67  ? 1932 GLN A CB  1 
ATOM   3000 C CG  . GLN A 1 429 ? -72.735 12.049  -8.716  1.00 19.11  ? 1932 GLN A CG  1 
ATOM   3001 C CD  . GLN A 1 429 ? -73.879 12.386  -7.749  1.00 21.25  ? 1932 GLN A CD  1 
ATOM   3002 O OE1 . GLN A 1 429 ? -74.925 12.897  -8.156  1.00 21.80  ? 1932 GLN A OE1 1 
ATOM   3003 N NE2 . GLN A 1 429 ? -73.682 12.103  -6.475  1.00 19.43  ? 1932 GLN A NE2 1 
ATOM   3004 N N   . GLY A 1 430 ? -70.967 10.673  -11.299 1.00 21.03  ? 1933 GLY A N   1 
ATOM   3005 C CA  . GLY A 1 430 ? -71.187 9.483   -12.088 1.00 20.62  ? 1933 GLY A CA  1 
ATOM   3006 C C   . GLY A 1 430 ? -70.161 9.282   -13.174 1.00 22.71  ? 1933 GLY A C   1 
ATOM   3007 O O   . GLY A 1 430 ? -70.143 8.236   -13.837 1.00 24.53  ? 1933 GLY A O   1 
ATOM   3008 N N   . MET A 1 431 ? -69.292 10.270  -13.356 1.00 22.04  ? 1934 MET A N   1 
ATOM   3009 C CA  . MET A 1 431 ? -68.292 10.201  -14.411 1.00 23.10  ? 1934 MET A CA  1 
ATOM   3010 C C   . MET A 1 431 ? -67.076 9.383   -14.039 1.00 26.03  ? 1934 MET A C   1 
ATOM   3011 O O   . MET A 1 431 ? -66.344 9.738   -13.104 1.00 26.29  ? 1934 MET A O   1 
ATOM   3012 C CB  . MET A 1 431 ? -67.857 11.601  -14.805 1.00 20.64  ? 1934 MET A CB  1 
ATOM   3013 C CG  . MET A 1 431 ? -67.004 11.667  -16.060 1.00 19.32  ? 1934 MET A CG  1 
ATOM   3014 S SD  . MET A 1 431 ? -66.405 13.352  -16.365 1.00 21.82  ? 1934 MET A SD  1 
ATOM   3015 C CE  . MET A 1 431 ? -67.905 14.171  -16.782 1.00 12.73  ? 1934 MET A CE  1 
ATOM   3016 N N   . ASN A 1 432 ? -66.853 8.286   -14.773 1.00 27.33  ? 1935 ASN A N   1 
ATOM   3017 C CA  . ASN A 1 432 ? -65.690 7.440   -14.495 1.00 27.75  ? 1935 ASN A CA  1 
ATOM   3018 C C   . ASN A 1 432 ? -64.392 8.112   -14.984 1.00 27.62  ? 1935 ASN A C   1 
ATOM   3019 O O   . ASN A 1 432 ? -64.425 9.138   -15.686 1.00 25.76  ? 1935 ASN A O   1 
ATOM   3020 C CB  . ASN A 1 432 ? -65.867 6.017   -15.087 1.00 24.94  ? 1935 ASN A CB  1 
ATOM   3021 C CG  . ASN A 1 432 ? -65.947 5.994   -16.599 1.00 28.72  ? 1935 ASN A CG  1 
ATOM   3022 O OD1 . ASN A 1 432 ? -65.129 6.599   -17.280 1.00 29.14  ? 1935 ASN A OD1 1 
ATOM   3023 N ND2 . ASN A 1 432 ? -66.932 5.262   -17.138 1.00 29.56  ? 1935 ASN A ND2 1 
ATOM   3024 N N   . GLN A 1 433 ? -63.247 7.563   -14.583 1.00 28.73  ? 1936 GLN A N   1 
ATOM   3025 C CA  . GLN A 1 433 ? -61.969 8.139   -14.992 1.00 28.99  ? 1936 GLN A CA  1 
ATOM   3026 C C   . GLN A 1 433 ? -61.773 8.221   -16.497 1.00 30.20  ? 1936 GLN A C   1 
ATOM   3027 O O   . GLN A 1 433 ? -61.348 9.252   -17.009 1.00 31.88  ? 1936 GLN A O   1 
ATOM   3028 C CB  . GLN A 1 433 ? -60.820 7.389   -14.345 1.00 27.74  ? 1936 GLN A CB  1 
ATOM   3029 C CG  . GLN A 1 433 ? -60.678 7.750   -12.893 1.00 28.99  ? 1936 GLN A CG  1 
ATOM   3030 C CD  . GLN A 1 433 ? -59.569 6.985   -12.223 1.00 31.75  ? 1936 GLN A CD  1 
ATOM   3031 O OE1 . GLN A 1 433 ? -59.613 5.758   -12.149 1.00 35.20  ? 1936 GLN A OE1 1 
ATOM   3032 N NE2 . GLN A 1 433 ? -58.565 7.700   -11.729 1.00 28.71  ? 1936 GLN A NE2 1 
ATOM   3033 N N   . GLU A 1 434 ? -62.090 7.160   -17.220 1.00 31.10  ? 1937 GLU A N   1 
ATOM   3034 C CA  . GLU A 1 434 ? -61.930 7.212   -18.666 1.00 33.66  ? 1937 GLU A CA  1 
ATOM   3035 C C   . GLU A 1 434 ? -62.715 8.371   -19.281 1.00 31.85  ? 1937 GLU A C   1 
ATOM   3036 O O   . GLU A 1 434 ? -62.206 9.086   -20.125 1.00 32.53  ? 1937 GLU A O   1 
ATOM   3037 C CB  . GLU A 1 434 ? -62.361 5.893   -19.308 1.00 37.18  ? 1937 GLU A CB  1 
ATOM   3038 C CG  . GLU A 1 434 ? -61.315 4.805   -19.198 1.00 42.93  ? 1937 GLU A CG  1 
ATOM   3039 C CD  . GLU A 1 434 ? -61.906 3.399   -19.248 1.00 48.91  ? 1937 GLU A CD  1 
ATOM   3040 O OE1 . GLU A 1 434 ? -61.120 2.431   -19.055 1.00 48.10  ? 1937 GLU A OE1 1 
ATOM   3041 O OE2 . GLU A 1 434 ? -63.149 3.262   -19.470 1.00 51.33  ? 1937 GLU A OE2 1 
ATOM   3042 N N   . GLN A 1 435 ? -63.954 8.552   -18.851 1.00 31.35  ? 1938 GLN A N   1 
ATOM   3043 C CA  . GLN A 1 435 ? -64.791 9.633   -19.363 1.00 31.44  ? 1938 GLN A CA  1 
ATOM   3044 C C   . GLN A 1 435 ? -64.178 11.009  -19.043 1.00 30.32  ? 1938 GLN A C   1 
ATOM   3045 O O   . GLN A 1 435 ? -64.148 11.900  -19.903 1.00 26.09  ? 1938 GLN A O   1 
ATOM   3046 C CB  . GLN A 1 435 ? -66.208 9.531   -18.779 1.00 31.64  ? 1938 GLN A CB  1 
ATOM   3047 C CG  . GLN A 1 435 ? -67.045 8.381   -19.345 1.00 33.82  ? 1938 GLN A CG  1 
ATOM   3048 C CD  . GLN A 1 435 ? -68.424 8.239   -18.668 1.00 35.38  ? 1938 GLN A CD  1 
ATOM   3049 O OE1 . GLN A 1 435 ? -69.399 7.849   -19.309 1.00 32.11  ? 1938 GLN A OE1 1 
ATOM   3050 N NE2 . GLN A 1 435 ? -68.493 8.540   -17.366 1.00 34.98  ? 1938 GLN A NE2 1 
ATOM   3051 N N   . ALA A 1 436 ? -63.688 11.170  -17.811 1.00 30.06  ? 1939 ALA A N   1 
ATOM   3052 C CA  . ALA A 1 436 ? -63.069 12.430  -17.406 1.00 30.34  ? 1939 ALA A CA  1 
ATOM   3053 C C   . ALA A 1 436 ? -61.838 12.716  -18.260 1.00 29.92  ? 1939 ALA A C   1 
ATOM   3054 O O   . ALA A 1 436 ? -61.610 13.851  -18.667 1.00 29.86  ? 1939 ALA A O   1 
ATOM   3055 C CB  . ALA A 1 436 ? -62.686 12.395  -15.902 1.00 29.01  ? 1939 ALA A CB  1 
ATOM   3056 N N   . MET A 1 437 ? -61.062 11.679  -18.553 1.00 31.11  ? 1940 MET A N   1 
ATOM   3057 C CA  . MET A 1 437 ? -59.837 11.842  -19.343 1.00 32.97  ? 1940 MET A CA  1 
ATOM   3058 C C   . MET A 1 437 ? -60.149 12.267  -20.772 1.00 31.06  ? 1940 MET A C   1 
ATOM   3059 O O   . MET A 1 437 ? -59.551 13.212  -21.300 1.00 30.01  ? 1940 MET A O   1 
ATOM   3060 C CB  . MET A 1 437 ? -59.036 10.535  -19.365 1.00 34.74  ? 1940 MET A CB  1 
ATOM   3061 C CG  . MET A 1 437 ? -57.567 10.717  -19.039 1.00 40.04  ? 1940 MET A CG  1 
ATOM   3062 S SD  . MET A 1 437 ? -56.501 9.269   -19.367 1.00 45.45  ? 1940 MET A SD  1 
ATOM   3063 C CE  . MET A 1 437 ? -56.450 8.518   -17.765 1.00 41.30  ? 1940 MET A CE  1 
ATOM   3064 N N   . ALA A 1 438 ? -61.097 11.561  -21.382 1.00 29.29  ? 1941 ALA A N   1 
ATOM   3065 C CA  . ALA A 1 438 ? -61.514 11.830  -22.753 1.00 28.27  ? 1941 ALA A CA  1 
ATOM   3066 C C   . ALA A 1 438 ? -62.085 13.252  -22.870 1.00 27.72  ? 1941 ALA A C   1 
ATOM   3067 O O   . ALA A 1 438 ? -61.701 14.024  -23.753 1.00 27.86  ? 1941 ALA A O   1 
ATOM   3068 C CB  . ALA A 1 438 ? -62.538 10.781  -23.188 1.00 24.04  ? 1941 ALA A CB  1 
ATOM   3069 N N   . LYS A 1 439 ? -62.986 13.600  -21.964 1.00 27.39  ? 1942 LYS A N   1 
ATOM   3070 C CA  . LYS A 1 439 ? -63.582 14.920  -21.965 1.00 29.07  ? 1942 LYS A CA  1 
ATOM   3071 C C   . LYS A 1 439 ? -62.550 15.997  -21.665 1.00 29.88  ? 1942 LYS A C   1 
ATOM   3072 O O   . LYS A 1 439 ? -62.642 17.121  -22.174 1.00 30.47  ? 1942 LYS A O   1 
ATOM   3073 C CB  . LYS A 1 439 ? -64.719 14.999  -20.945 1.00 31.29  ? 1942 LYS A CB  1 
ATOM   3074 C CG  . LYS A 1 439 ? -66.111 14.835  -21.553 1.00 32.85  ? 1942 LYS A CG  1 
ATOM   3075 C CD  . LYS A 1 439 ? -67.203 14.783  -20.474 1.00 35.68  ? 1942 LYS A CD  1 
ATOM   3076 C CE  . LYS A 1 439 ? -68.580 14.578  -21.092 1.00 36.81  ? 1942 LYS A CE  1 
ATOM   3077 N NZ  . LYS A 1 439 ? -68.840 15.563  -22.187 1.00 37.80  ? 1942 LYS A NZ  1 
ATOM   3078 N N   . TYR A 1 440 ? -61.567 15.663  -20.840 1.00 28.30  ? 1943 TYR A N   1 
ATOM   3079 C CA  . TYR A 1 440 ? -60.532 16.631  -20.521 1.00 29.39  ? 1943 TYR A CA  1 
ATOM   3080 C C   . TYR A 1 440 ? -59.666 16.906  -21.764 1.00 29.52  ? 1943 TYR A C   1 
ATOM   3081 O O   . TYR A 1 440 ? -59.404 18.061  -22.118 1.00 28.49  ? 1943 TYR A O   1 
ATOM   3082 C CB  . TYR A 1 440 ? -59.653 16.111  -19.375 1.00 30.06  ? 1943 TYR A CB  1 
ATOM   3083 C CG  . TYR A 1 440 ? -58.631 17.112  -18.905 1.00 27.86  ? 1943 TYR A CG  1 
ATOM   3084 C CD1 . TYR A 1 440 ? -58.863 17.896  -17.768 1.00 25.38  ? 1943 TYR A CD1 1 
ATOM   3085 C CD2 . TYR A 1 440 ? -57.440 17.304  -19.613 1.00 27.16  ? 1943 TYR A CD2 1 
ATOM   3086 C CE1 . TYR A 1 440 ? -57.943 18.841  -17.344 1.00 24.45  ? 1943 TYR A CE1 1 
ATOM   3087 C CE2 . TYR A 1 440 ? -56.502 18.257  -19.199 1.00 28.16  ? 1943 TYR A CE2 1 
ATOM   3088 C CZ  . TYR A 1 440 ? -56.761 19.021  -18.060 1.00 28.17  ? 1943 TYR A CZ  1 
ATOM   3089 O OH  . TYR A 1 440 ? -55.838 19.946  -17.632 1.00 28.09  ? 1943 TYR A OH  1 
ATOM   3090 N N   . MET A 1 441 ? -59.221 15.841  -22.424 1.00 30.57  ? 1944 MET A N   1 
ATOM   3091 C CA  . MET A 1 441 ? -58.390 15.998  -23.606 1.00 31.04  ? 1944 MET A CA  1 
ATOM   3092 C C   . MET A 1 441 ? -59.131 16.638  -24.775 1.00 32.63  ? 1944 MET A C   1 
ATOM   3093 O O   . MET A 1 441 ? -58.548 17.401  -25.536 1.00 34.35  ? 1944 MET A O   1 
ATOM   3094 C CB  . MET A 1 441 ? -57.806 14.653  -24.011 1.00 29.75  ? 1944 MET A CB  1 
ATOM   3095 C CG  . MET A 1 441 ? -56.676 14.191  -23.115 1.00 28.68  ? 1944 MET A CG  1 
ATOM   3096 S SD  . MET A 1 441 ? -55.432 15.488  -22.779 1.00 26.02  ? 1944 MET A SD  1 
ATOM   3097 C CE  . MET A 1 441 ? -54.699 15.679  -24.425 1.00 28.54  ? 1944 MET A CE  1 
ATOM   3098 N N   . ALA A 1 442 ? -60.419 16.346  -24.917 1.00 33.49  ? 1945 ALA A N   1 
ATOM   3099 C CA  . ALA A 1 442 ? -61.190 16.938  -25.996 1.00 32.51  ? 1945 ALA A CA  1 
ATOM   3100 C C   . ALA A 1 442 ? -61.223 18.457  -25.809 1.00 33.78  ? 1945 ALA A C   1 
ATOM   3101 O O   . ALA A 1 442 ? -61.165 19.229  -26.777 1.00 34.83  ? 1945 ALA A O   1 
ATOM   3102 C CB  . ALA A 1 442 ? -62.600 16.386  -25.992 1.00 29.69  ? 1945 ALA A CB  1 
ATOM   3103 N N   . LEU A 1 443 ? -61.329 18.890  -24.561 1.00 33.74  ? 1946 LEU A N   1 
ATOM   3104 C CA  . LEU A 1 443 ? -61.384 20.310  -24.282 1.00 35.63  ? 1946 LEU A CA  1 
ATOM   3105 C C   . LEU A 1 443 ? -60.019 20.958  -24.568 1.00 37.21  ? 1946 LEU A C   1 
ATOM   3106 O O   . LEU A 1 443 ? -59.941 22.108  -25.031 1.00 37.28  ? 1946 LEU A O   1 
ATOM   3107 C CB  . LEU A 1 443 ? -61.820 20.534  -22.831 1.00 35.75  ? 1946 LEU A CB  1 
ATOM   3108 C CG  . LEU A 1 443 ? -61.960 21.997  -22.402 1.00 37.72  ? 1946 LEU A CG  1 
ATOM   3109 C CD1 . LEU A 1 443 ? -62.755 22.763  -23.450 1.00 35.58  ? 1946 LEU A CD1 1 
ATOM   3110 C CD2 . LEU A 1 443 ? -62.634 22.078  -21.027 1.00 37.90  ? 1946 LEU A CD2 1 
ATOM   3111 N N   . ILE A 1 444 ? -58.949 20.209  -24.311 1.00 37.13  ? 1947 ILE A N   1 
ATOM   3112 C CA  . ILE A 1 444 ? -57.588 20.692  -24.555 1.00 37.05  ? 1947 ILE A CA  1 
ATOM   3113 C C   . ILE A 1 444 ? -57.348 20.847  -26.058 1.00 38.02  ? 1947 ILE A C   1 
ATOM   3114 O O   . ILE A 1 444 ? -56.730 21.809  -26.511 1.00 37.58  ? 1947 ILE A O   1 
ATOM   3115 C CB  . ILE A 1 444 ? -56.530 19.705  -23.990 1.00 36.86  ? 1947 ILE A CB  1 
ATOM   3116 C CG1 . ILE A 1 444 ? -56.511 19.774  -22.465 1.00 35.78  ? 1947 ILE A CG1 1 
ATOM   3117 C CG2 . ILE A 1 444 ? -55.154 20.041  -24.537 1.00 36.40  ? 1947 ILE A CG2 1 
ATOM   3118 C CD1 . ILE A 1 444 ? -56.114 21.127  -21.925 1.00 33.24  ? 1947 ILE A CD1 1 
ATOM   3119 N N   . LYS A 1 445 ? -57.840 19.893  -26.832 1.00 37.93  ? 1948 LYS A N   1 
ATOM   3120 C CA  . LYS A 1 445 ? -57.658 19.948  -28.264 1.00 38.59  ? 1948 LYS A CA  1 
ATOM   3121 C C   . LYS A 1 445 ? -58.437 21.070  -28.944 1.00 38.72  ? 1948 LYS A C   1 
ATOM   3122 O O   . LYS A 1 445 ? -58.308 21.257  -30.150 1.00 38.35  ? 1948 LYS A O   1 
ATOM   3123 C CB  . LYS A 1 445 ? -58.023 18.599  -28.879 1.00 39.66  ? 1948 LYS A CB  1 
ATOM   3124 C CG  . LYS A 1 445 ? -56.963 17.540  -28.652 1.00 41.43  ? 1948 LYS A CG  1 
ATOM   3125 C CD  . LYS A 1 445 ? -57.330 16.240  -29.335 1.00 44.73  ? 1948 LYS A CD  1 
ATOM   3126 C CE  . LYS A 1 445 ? -56.225 15.195  -29.146 1.00 49.50  ? 1948 LYS A CE  1 
ATOM   3127 N NZ  . LYS A 1 445 ? -56.680 13.769  -29.372 1.00 49.78  ? 1948 LYS A NZ  1 
ATOM   3128 N N   . GLU A 1 446 ? -59.234 21.819  -28.181 1.00 39.88  ? 1949 GLU A N   1 
ATOM   3129 C CA  . GLU A 1 446 ? -60.007 22.913  -28.765 1.00 40.84  ? 1949 GLU A CA  1 
ATOM   3130 C C   . GLU A 1 446 ? -59.108 24.123  -28.970 1.00 41.62  ? 1949 GLU A C   1 
ATOM   3131 O O   . GLU A 1 446 ? -59.520 25.132  -29.543 1.00 41.33  ? 1949 GLU A O   1 
ATOM   3132 C CB  . GLU A 1 446 ? -61.224 23.267  -27.890 1.00 41.18  ? 1949 GLU A CB  1 
ATOM   3133 C CG  . GLU A 1 446 ? -62.495 22.502  -28.290 1.00 44.65  ? 1949 GLU A CG  1 
ATOM   3134 C CD  . GLU A 1 446 ? -63.668 22.660  -27.310 1.00 47.50  ? 1949 GLU A CD  1 
ATOM   3135 O OE1 . GLU A 1 446 ? -64.426 21.665  -27.127 1.00 46.39  ? 1949 GLU A OE1 1 
ATOM   3136 O OE2 . GLU A 1 446 ? -63.838 23.768  -26.736 1.00 47.90  ? 1949 GLU A OE2 1 
ATOM   3137 N N   . TRP A 1 447 ? -57.869 24.008  -28.500 1.00 42.76  ? 1950 TRP A N   1 
ATOM   3138 C CA  . TRP A 1 447 ? -56.885 25.071  -28.664 1.00 43.24  ? 1950 TRP A CA  1 
ATOM   3139 C C   . TRP A 1 447 ? -55.960 24.681  -29.806 1.00 42.71  ? 1950 TRP A C   1 
ATOM   3140 O O   . TRP A 1 447 ? -55.094 23.839  -29.627 1.00 42.80  ? 1950 TRP A O   1 
ATOM   3141 C CB  . TRP A 1 447 ? -56.057 25.252  -27.396 1.00 43.99  ? 1950 TRP A CB  1 
ATOM   3142 C CG  . TRP A 1 447 ? -54.968 26.274  -27.564 1.00 46.41  ? 1950 TRP A CG  1 
ATOM   3143 C CD1 . TRP A 1 447 ? -55.114 27.564  -27.992 1.00 46.76  ? 1950 TRP A CD1 1 
ATOM   3144 C CD2 . TRP A 1 447 ? -53.577 26.106  -27.264 1.00 46.60  ? 1950 TRP A CD2 1 
ATOM   3145 N NE1 . TRP A 1 447 ? -53.902 28.211  -27.969 1.00 47.86  ? 1950 TRP A NE1 1 
ATOM   3146 C CE2 . TRP A 1 447 ? -52.941 27.342  -27.528 1.00 47.21  ? 1950 TRP A CE2 1 
ATOM   3147 C CE3 . TRP A 1 447 ? -52.807 25.034  -26.798 1.00 46.34  ? 1950 TRP A CE3 1 
ATOM   3148 C CZ2 . TRP A 1 447 ? -51.562 27.537  -27.337 1.00 47.56  ? 1950 TRP A CZ2 1 
ATOM   3149 C CZ3 . TRP A 1 447 ? -51.427 25.230  -26.606 1.00 47.70  ? 1950 TRP A CZ3 1 
ATOM   3150 C CH2 . TRP A 1 447 ? -50.825 26.473  -26.875 1.00 46.97  ? 1950 TRP A CH2 1 
ATOM   3151 N N   . PRO A 1 448 ? -56.139 25.288  -30.995 1.00 42.52  ? 1951 PRO A N   1 
ATOM   3152 C CA  . PRO A 1 448 ? -55.351 25.040  -32.209 1.00 41.57  ? 1951 PRO A CA  1 
ATOM   3153 C C   . PRO A 1 448 ? -53.863 24.889  -31.944 1.00 40.18  ? 1951 PRO A C   1 
ATOM   3154 O O   . PRO A 1 448 ? -53.144 24.256  -32.706 1.00 39.14  ? 1951 PRO A O   1 
ATOM   3155 C CB  . PRO A 1 448 ? -55.643 26.273  -33.056 1.00 43.23  ? 1951 PRO A CB  1 
ATOM   3156 C CG  . PRO A 1 448 ? -57.066 26.552  -32.727 1.00 43.42  ? 1951 PRO A CG  1 
ATOM   3157 C CD  . PRO A 1 448 ? -57.068 26.413  -31.214 1.00 44.20  ? 1951 PRO A CD  1 
ATOM   3158 N N   . GLY A 1 449 ? -53.412 25.490  -30.851 1.00 39.66  ? 1952 GLY A N   1 
ATOM   3159 C CA  . GLY A 1 449 ? -52.014 25.429  -30.504 1.00 36.83  ? 1952 GLY A CA  1 
ATOM   3160 C C   . GLY A 1 449 ? -51.631 24.191  -29.731 1.00 36.97  ? 1952 GLY A C   1 
ATOM   3161 O O   . GLY A 1 449 ? -50.460 24.031  -29.352 1.00 35.14  ? 1952 GLY A O   1 
ATOM   3162 N N   . TYR A 1 450 ? -52.591 23.301  -29.484 1.00 35.42  ? 1953 TYR A N   1 
ATOM   3163 C CA  . TYR A 1 450 ? -52.250 22.108  -28.727 1.00 34.08  ? 1953 TYR A CA  1 
ATOM   3164 C C   . TYR A 1 450 ? -51.201 21.297  -29.464 1.00 31.74  ? 1953 TYR A C   1 
ATOM   3165 O O   . TYR A 1 450 ? -51.329 21.040  -30.657 1.00 31.97  ? 1953 TYR A O   1 
ATOM   3166 C CB  . TYR A 1 450 ? -53.472 21.233  -28.436 1.00 33.53  ? 1953 TYR A CB  1 
ATOM   3167 C CG  . TYR A 1 450 ? -53.074 19.953  -27.752 1.00 33.25  ? 1953 TYR A CG  1 
ATOM   3168 C CD1 . TYR A 1 450 ? -52.444 19.980  -26.504 1.00 32.32  ? 1953 TYR A CD1 1 
ATOM   3169 C CD2 . TYR A 1 450 ? -53.220 18.718  -28.394 1.00 32.17  ? 1953 TYR A CD2 1 
ATOM   3170 C CE1 . TYR A 1 450 ? -51.956 18.810  -25.907 1.00 31.27  ? 1953 TYR A CE1 1 
ATOM   3171 C CE2 . TYR A 1 450 ? -52.746 17.543  -27.811 1.00 31.90  ? 1953 TYR A CE2 1 
ATOM   3172 C CZ  . TYR A 1 450 ? -52.112 17.598  -26.563 1.00 32.71  ? 1953 TYR A CZ  1 
ATOM   3173 O OH  . TYR A 1 450 ? -51.659 16.445  -25.963 1.00 31.74  ? 1953 TYR A OH  1 
ATOM   3174 N N   . GLY A 1 451 ? -50.179 20.897  -28.716 1.00 31.03  ? 1954 GLY A N   1 
ATOM   3175 C CA  . GLY A 1 451 ? -49.069 20.138  -29.250 1.00 31.73  ? 1954 GLY A CA  1 
ATOM   3176 C C   . GLY A 1 451 ? -47.821 21.006  -29.289 1.00 32.59  ? 1954 GLY A C   1 
ATOM   3177 O O   . GLY A 1 451 ? -46.745 20.537  -29.634 1.00 35.41  ? 1954 GLY A O   1 
ATOM   3178 N N   . SER A 1 452 ? -47.970 22.275  -28.928 1.00 33.91  ? 1955 SER A N   1 
ATOM   3179 C CA  . SER A 1 452 ? -46.874 23.241  -28.930 1.00 36.38  ? 1955 SER A CA  1 
ATOM   3180 C C   . SER A 1 452 ? -46.154 23.330  -27.599 1.00 37.13  ? 1955 SER A C   1 
ATOM   3181 O O   . SER A 1 452 ? -46.760 23.157  -26.562 1.00 37.54  ? 1955 SER A O   1 
ATOM   3182 C CB  . SER A 1 452 ? -47.398 24.653  -29.233 1.00 37.04  ? 1955 SER A CB  1 
ATOM   3183 O OG  . SER A 1 452 ? -48.276 24.697  -30.345 1.00 41.45  ? 1955 SER A OG  1 
ATOM   3184 N N   . THR A 1 453 ? -44.859 23.610  -27.636 1.00 38.70  ? 1956 THR A N   1 
ATOM   3185 C CA  . THR A 1 453 ? -44.095 23.810  -26.416 1.00 40.85  ? 1956 THR A CA  1 
ATOM   3186 C C   . THR A 1 453 ? -43.853 25.333  -26.295 1.00 42.96  ? 1956 THR A C   1 
ATOM   3187 O O   . THR A 1 453 ? -43.025 25.906  -27.023 1.00 42.18  ? 1956 THR A O   1 
ATOM   3188 C CB  . THR A 1 453 ? -42.748 23.106  -26.470 1.00 39.83  ? 1956 THR A CB  1 
ATOM   3189 O OG1 . THR A 1 453 ? -42.953 21.693  -26.503 1.00 40.83  ? 1956 THR A OG1 1 
ATOM   3190 C CG2 . THR A 1 453 ? -41.915 23.483  -25.250 1.00 40.52  ? 1956 THR A CG2 1 
ATOM   3191 N N   . LEU A 1 454 ? -44.583 25.975  -25.383 1.00 42.92  ? 1957 LEU A N   1 
ATOM   3192 C CA  . LEU A 1 454 ? -44.482 27.415  -25.161 1.00 44.41  ? 1957 LEU A CA  1 
ATOM   3193 C C   . LEU A 1 454 ? -43.234 27.849  -24.382 1.00 46.68  ? 1957 LEU A C   1 
ATOM   3194 O O   . LEU A 1 454 ? -43.043 27.455  -23.237 1.00 45.53  ? 1957 LEU A O   1 
ATOM   3195 C CB  . LEU A 1 454 ? -45.731 27.905  -24.420 1.00 42.54  ? 1957 LEU A CB  1 
ATOM   3196 C CG  . LEU A 1 454 ? -46.951 28.444  -25.177 1.00 41.36  ? 1957 LEU A CG  1 
ATOM   3197 C CD1 . LEU A 1 454 ? -47.018 27.925  -26.594 1.00 40.64  ? 1957 LEU A CD1 1 
ATOM   3198 C CD2 . LEU A 1 454 ? -48.190 28.078  -24.401 1.00 38.71  ? 1957 LEU A CD2 1 
ATOM   3199 N N   . PHE A 1 455 ? -42.384 28.663  -25.010 1.00 50.66  ? 1958 PHE A N   1 
ATOM   3200 C CA  . PHE A 1 455 ? -41.184 29.172  -24.346 1.00 53.42  ? 1958 PHE A CA  1 
ATOM   3201 C C   . PHE A 1 455 ? -41.337 30.660  -24.071 1.00 56.21  ? 1958 PHE A C   1 
ATOM   3202 O O   . PHE A 1 455 ? -41.489 31.449  -25.002 1.00 56.16  ? 1958 PHE A O   1 
ATOM   3203 C CB  . PHE A 1 455 ? -39.939 28.993  -25.204 1.00 50.94  ? 1958 PHE A CB  1 
ATOM   3204 C CG  . PHE A 1 455 ? -39.551 27.577  -25.426 1.00 51.06  ? 1958 PHE A CG  1 
ATOM   3205 C CD1 . PHE A 1 455 ? -39.912 26.921  -26.596 1.00 50.33  ? 1958 PHE A CD1 1 
ATOM   3206 C CD2 . PHE A 1 455 ? -38.771 26.906  -24.491 1.00 50.75  ? 1958 PHE A CD2 1 
ATOM   3207 C CE1 . PHE A 1 455 ? -39.494 25.614  -26.841 1.00 49.15  ? 1958 PHE A CE1 1 
ATOM   3208 C CE2 . PHE A 1 455 ? -38.350 25.598  -24.725 1.00 49.95  ? 1958 PHE A CE2 1 
ATOM   3209 C CZ  . PHE A 1 455 ? -38.714 24.954  -25.907 1.00 49.79  ? 1958 PHE A CZ  1 
ATOM   3210 N N   . ASP A 1 456 ? -41.293 31.041  -22.797 1.00 61.13  ? 1959 ASP A N   1 
ATOM   3211 C CA  . ASP A 1 456 ? -41.404 32.453  -22.412 1.00 65.77  ? 1959 ASP A CA  1 
ATOM   3212 C C   . ASP A 1 456 ? -40.153 33.216  -22.848 1.00 66.73  ? 1959 ASP A C   1 
ATOM   3213 O O   . ASP A 1 456 ? -39.068 33.007  -22.293 1.00 66.70  ? 1959 ASP A O   1 
ATOM   3214 C CB  . ASP A 1 456 ? -41.580 32.595  -20.896 1.00 66.70  ? 1959 ASP A CB  1 
ATOM   3215 C CG  . ASP A 1 456 ? -43.015 32.418  -20.462 1.00 69.26  ? 1959 ASP A CG  1 
ATOM   3216 O OD1 . ASP A 1 456 ? -43.465 31.261  -20.324 1.00 71.52  ? 1959 ASP A OD1 1 
ATOM   3217 O OD2 . ASP A 1 456 ? -43.701 33.441  -20.272 1.00 70.34  ? 1959 ASP A OD2 1 
ATOM   3218 N N   . VAL A 1 457 ? -40.311 34.097  -23.830 1.00 67.98  ? 1960 VAL A N   1 
ATOM   3219 C CA  . VAL A 1 457 ? -39.191 34.871  -24.348 1.00 69.74  ? 1960 VAL A CA  1 
ATOM   3220 C C   . VAL A 1 457 ? -39.486 36.370  -24.342 1.00 70.84  ? 1960 VAL A C   1 
ATOM   3221 O O   . VAL A 1 457 ? -40.635 36.789  -24.192 1.00 70.04  ? 1960 VAL A O   1 
ATOM   3222 C CB  . VAL A 1 457 ? -38.840 34.422  -25.789 1.00 69.43  ? 1960 VAL A CB  1 
ATOM   3223 C CG1 . VAL A 1 457 ? -38.441 32.957  -25.796 1.00 68.93  ? 1960 VAL A CG1 1 
ATOM   3224 C CG2 . VAL A 1 457 ? -40.025 34.638  -26.701 1.00 68.83  ? 1960 VAL A CG2 1 
ATOM   3225 N N   . GLU A 1 458 ? -38.435 37.170  -24.493 1.00 72.91  ? 1961 GLU A N   1 
ATOM   3226 C CA  . GLU A 1 458 ? -38.561 38.627  -24.512 1.00 75.63  ? 1961 GLU A CA  1 
ATOM   3227 C C   . GLU A 1 458 ? -38.124 39.163  -25.871 1.00 76.21  ? 1961 GLU A C   1 
ATOM   3228 O O   . GLU A 1 458 ? -37.021 38.856  -26.348 1.00 75.54  ? 1961 GLU A O   1 
ATOM   3229 C CB  . GLU A 1 458 ? -37.688 39.255  -23.418 1.00 77.09  ? 1961 GLU A CB  1 
ATOM   3230 C CG  . GLU A 1 458 ? -38.117 38.913  -22.000 1.00 79.97  ? 1961 GLU A CG  1 
ATOM   3231 C CD  . GLU A 1 458 ? -39.229 39.809  -21.495 1.00 81.91  ? 1961 GLU A CD  1 
ATOM   3232 O OE1 . GLU A 1 458 ? -38.951 41.007  -21.263 1.00 83.18  ? 1961 GLU A OE1 1 
ATOM   3233 O OE2 . GLU A 1 458 ? -40.376 39.322  -21.337 1.00 82.46  ? 1961 GLU A OE2 1 
ATOM   3234 N N   . CYS A 1 459 ? -38.987 39.957  -26.498 1.00 76.78  ? 1962 CYS A N   1 
ATOM   3235 C CA  . CYS A 1 459 ? -38.653 40.522  -27.795 1.00 77.21  ? 1962 CYS A CA  1 
ATOM   3236 C C   . CYS A 1 459 ? -38.015 41.893  -27.652 1.00 76.89  ? 1962 CYS A C   1 
ATOM   3237 O O   . CYS A 1 459 ? -38.641 42.836  -27.152 1.00 75.93  ? 1962 CYS A O   1 
ATOM   3238 C CB  . CYS A 1 459 ? -39.887 40.646  -28.680 1.00 77.88  ? 1962 CYS A CB  1 
ATOM   3239 S SG  . CYS A 1 459 ? -39.499 41.407  -30.275 1.00 79.78  ? 1962 CYS A SG  1 
ATOM   3240 N N   . LYS A 1 460 ? -36.762 41.992  -28.082 1.00 76.49  ? 1963 LYS A N   1 
ATOM   3241 C CA  . LYS A 1 460 ? -36.039 43.246  -28.005 1.00 76.00  ? 1963 LYS A CA  1 
ATOM   3242 C C   . LYS A 1 460 ? -36.209 43.990  -29.321 1.00 75.82  ? 1963 LYS A C   1 
ATOM   3243 O O   . LYS A 1 460 ? -36.108 45.217  -29.359 1.00 74.82  ? 1963 LYS A O   1 
ATOM   3244 C CB  . LYS A 1 460 ? -34.557 42.984  -27.722 1.00 76.28  ? 1963 LYS A CB  1 
ATOM   3245 N N   . GLU A 1 461 ? -36.486 43.248  -30.393 1.00 75.88  ? 1964 GLU A N   1 
ATOM   3246 C CA  . GLU A 1 461 ? -36.666 43.863  -31.705 1.00 76.89  ? 1964 GLU A CA  1 
ATOM   3247 C C   . GLU A 1 461 ? -37.275 42.951  -32.775 1.00 77.34  ? 1964 GLU A C   1 
ATOM   3248 O O   . GLU A 1 461 ? -36.691 41.933  -33.146 1.00 78.00  ? 1964 GLU A O   1 
ATOM   3249 C CB  . GLU A 1 461 ? -35.318 44.391  -32.213 1.00 76.48  ? 1964 GLU A CB  1 
ATOM   3250 N N   . GLY A 1 462 ? -38.443 43.324  -33.286 1.00 77.20  ? 1965 GLY A N   1 
ATOM   3251 C CA  . GLY A 1 462 ? -39.047 42.510  -34.328 1.00 76.76  ? 1965 GLY A CA  1 
ATOM   3252 C C   . GLY A 1 462 ? -40.422 42.985  -34.756 1.00 76.10  ? 1965 GLY A C   1 
ATOM   3253 O O   . GLY A 1 462 ? -40.941 42.578  -35.806 1.00 76.37  ? 1965 GLY A O   1 
ATOM   3254 N N   . GLY A 1 463 ? -40.998 43.863  -33.938 1.00 74.19  ? 1966 GLY A N   1 
ATOM   3255 C CA  . GLY A 1 463 ? -42.327 44.366  -34.203 1.00 72.83  ? 1966 GLY A CA  1 
ATOM   3256 C C   . GLY A 1 463 ? -43.317 43.750  -33.241 1.00 71.66  ? 1966 GLY A C   1 
ATOM   3257 O O   . GLY A 1 463 ? -44.499 44.092  -33.254 1.00 71.79  ? 1966 GLY A O   1 
ATOM   3258 N N   . PHE A 1 464 ? -42.840 42.834  -32.409 1.00 70.20  ? 1967 PHE A N   1 
ATOM   3259 C CA  . PHE A 1 464 ? -43.717 42.209  -31.447 1.00 68.30  ? 1967 PHE A CA  1 
ATOM   3260 C C   . PHE A 1 464 ? -43.479 42.857  -30.102 1.00 67.95  ? 1967 PHE A C   1 
ATOM   3261 O O   . PHE A 1 464 ? -42.435 43.476  -29.875 1.00 68.69  ? 1967 PHE A O   1 
ATOM   3262 C CB  . PHE A 1 464 ? -43.416 40.718  -31.342 1.00 65.82  ? 1967 PHE A CB  1 
ATOM   3263 C CG  . PHE A 1 464 ? -43.425 40.011  -32.651 1.00 62.07  ? 1967 PHE A CG  1 
ATOM   3264 C CD1 . PHE A 1 464 ? -44.604 39.834  -33.357 1.00 61.04  ? 1967 PHE A CD1 1 
ATOM   3265 C CD2 . PHE A 1 464 ? -42.249 39.510  -33.174 1.00 62.44  ? 1967 PHE A CD2 1 
ATOM   3266 C CE1 . PHE A 1 464 ? -44.610 39.159  -34.568 1.00 60.80  ? 1967 PHE A CE1 1 
ATOM   3267 C CE2 . PHE A 1 464 ? -42.247 38.835  -34.382 1.00 62.21  ? 1967 PHE A CE2 1 
ATOM   3268 C CZ  . PHE A 1 464 ? -43.432 38.657  -35.081 1.00 60.92  ? 1967 PHE A CZ  1 
ATOM   3269 N N   . PRO A 1 465 ? -44.460 42.737  -29.193 1.00 67.07  ? 1968 PRO A N   1 
ATOM   3270 C CA  . PRO A 1 465 ? -44.360 43.305  -27.848 1.00 66.75  ? 1968 PRO A CA  1 
ATOM   3271 C C   . PRO A 1 465 ? -43.172 42.707  -27.086 1.00 66.86  ? 1968 PRO A C   1 
ATOM   3272 O O   . PRO A 1 465 ? -42.354 41.986  -27.659 1.00 67.05  ? 1968 PRO A O   1 
ATOM   3273 C CB  . PRO A 1 465 ? -45.689 42.915  -27.217 1.00 65.81  ? 1968 PRO A CB  1 
ATOM   3274 C CG  . PRO A 1 465 ? -46.623 42.967  -28.377 1.00 65.80  ? 1968 PRO A CG  1 
ATOM   3275 C CD  . PRO A 1 465 ? -45.836 42.277  -29.460 1.00 66.21  ? 1968 PRO A CD  1 
ATOM   3276 N N   . GLN A 1 466 ? -43.078 42.999  -25.795 1.00 66.84  ? 1969 GLN A N   1 
ATOM   3277 C CA  . GLN A 1 466 ? -41.976 42.472  -24.997 1.00 67.11  ? 1969 GLN A CA  1 
ATOM   3278 C C   . GLN A 1 466 ? -42.351 41.129  -24.355 1.00 66.61  ? 1969 GLN A C   1 
ATOM   3279 O O   . GLN A 1 466 ? -41.567 40.177  -24.386 1.00 66.75  ? 1969 GLN A O   1 
ATOM   3280 C CB  . GLN A 1 466 ? -41.579 43.490  -23.919 1.00 68.20  ? 1969 GLN A CB  1 
ATOM   3281 C CG  . GLN A 1 466 ? -40.276 43.169  -23.192 1.00 70.08  ? 1969 GLN A CG  1 
ATOM   3282 C CD  . GLN A 1 466 ? -39.843 44.272  -22.234 1.00 71.41  ? 1969 GLN A CD  1 
ATOM   3283 O OE1 . GLN A 1 466 ? -39.595 45.410  -22.642 1.00 71.84  ? 1969 GLN A OE1 1 
ATOM   3284 N NE2 . GLN A 1 466 ? -39.746 43.935  -20.953 1.00 71.74  ? 1969 GLN A NE2 1 
ATOM   3285 N N   . GLU A 1 467 ? -43.552 41.067  -23.777 1.00 65.42  ? 1970 GLU A N   1 
ATOM   3286 C CA  . GLU A 1 467 ? -44.073 39.855  -23.128 1.00 64.05  ? 1970 GLU A CA  1 
ATOM   3287 C C   . GLU A 1 467 ? -44.407 38.813  -24.198 1.00 61.83  ? 1970 GLU A C   1 
ATOM   3288 O O   . GLU A 1 467 ? -45.549 38.722  -24.662 1.00 61.70  ? 1970 GLU A O   1 
ATOM   3289 C CB  . GLU A 1 467 ? -45.351 40.191  -22.343 1.00 65.31  ? 1970 GLU A CB  1 
ATOM   3290 C CG  . GLU A 1 467 ? -45.264 39.975  -20.838 1.00 66.87  ? 1970 GLU A CG  1 
ATOM   3291 C CD  . GLU A 1 467 ? -46.499 40.508  -20.088 1.00 66.62  ? 1970 GLU A CD  1 
ATOM   3292 O OE1 . GLU A 1 467 ? -46.743 41.737  -20.110 1.00 63.87  ? 1970 GLU A OE1 1 
ATOM   3293 O OE2 . GLU A 1 467 ? -47.225 39.691  -19.479 1.00 66.35  ? 1970 GLU A OE2 1 
ATOM   3294 N N   . LEU A 1 468 ? -43.423 38.009  -24.570 1.00 58.32  ? 1971 LEU A N   1 
ATOM   3295 C CA  . LEU A 1 468 ? -43.647 37.024  -25.612 1.00 55.48  ? 1971 LEU A CA  1 
ATOM   3296 C C   . LEU A 1 468 ? -43.693 35.539  -25.237 1.00 53.19  ? 1971 LEU A C   1 
ATOM   3297 O O   . LEU A 1 468 ? -43.218 35.106  -24.179 1.00 52.10  ? 1971 LEU A O   1 
ATOM   3298 C CB  . LEU A 1 468 ? -42.605 37.229  -26.725 1.00 53.29  ? 1971 LEU A CB  1 
ATOM   3299 C CG  . LEU A 1 468 ? -43.135 37.903  -27.993 1.00 53.57  ? 1971 LEU A CG  1 
ATOM   3300 C CD1 . LEU A 1 468 ? -43.971 39.130  -27.634 1.00 52.13  ? 1971 LEU A CD1 1 
ATOM   3301 C CD2 . LEU A 1 468 ? -41.965 38.261  -28.913 1.00 51.98  ? 1971 LEU A CD2 1 
ATOM   3302 N N   . TRP A 1 469 ? -44.289 34.774  -26.143 1.00 49.52  ? 1972 TRP A N   1 
ATOM   3303 C CA  . TRP A 1 469 ? -44.398 33.335  -26.013 1.00 45.51  ? 1972 TRP A CA  1 
ATOM   3304 C C   . TRP A 1 469 ? -43.873 32.751  -27.314 1.00 43.25  ? 1972 TRP A C   1 
ATOM   3305 O O   . TRP A 1 469 ? -44.444 32.991  -28.377 1.00 42.27  ? 1972 TRP A O   1 
ATOM   3306 C CB  . TRP A 1 469 ? -45.855 32.920  -25.880 1.00 47.61  ? 1972 TRP A CB  1 
ATOM   3307 C CG  . TRP A 1 469 ? -46.274 32.326  -24.564 1.00 48.06  ? 1972 TRP A CG  1 
ATOM   3308 C CD1 . TRP A 1 469 ? -45.504 32.110  -23.450 1.00 46.94  ? 1972 TRP A CD1 1 
ATOM   3309 C CD2 . TRP A 1 469 ? -47.608 31.951  -24.207 1.00 46.73  ? 1972 TRP A CD2 1 
ATOM   3310 N NE1 . TRP A 1 469 ? -46.285 31.637  -22.423 1.00 45.77  ? 1972 TRP A NE1 1 
ATOM   3311 C CE2 . TRP A 1 469 ? -47.579 31.530  -22.864 1.00 46.97  ? 1972 TRP A CE2 1 
ATOM   3312 C CE3 . TRP A 1 469 ? -48.828 31.937  -24.897 1.00 45.40  ? 1972 TRP A CE3 1 
ATOM   3313 C CZ2 . TRP A 1 469 ? -48.721 31.100  -22.197 1.00 48.21  ? 1972 TRP A CZ2 1 
ATOM   3314 C CZ3 . TRP A 1 469 ? -49.963 31.513  -24.238 1.00 47.21  ? 1972 TRP A CZ3 1 
ATOM   3315 C CH2 . TRP A 1 469 ? -49.904 31.099  -22.900 1.00 48.92  ? 1972 TRP A CH2 1 
ATOM   3316 N N   . LEU A 1 470 ? -42.780 32.007  -27.256 1.00 40.43  ? 1973 LEU A N   1 
ATOM   3317 C CA  . LEU A 1 470 ? -42.289 31.380  -28.470 1.00 38.81  ? 1973 LEU A CA  1 
ATOM   3318 C C   . LEU A 1 470 ? -42.871 29.964  -28.461 1.00 37.54  ? 1973 LEU A C   1 
ATOM   3319 O O   . LEU A 1 470 ? -42.404 29.119  -27.692 1.00 36.38  ? 1973 LEU A O   1 
ATOM   3320 C CB  . LEU A 1 470 ? -40.770 31.306  -28.465 1.00 41.00  ? 1973 LEU A CB  1 
ATOM   3321 C CG  . LEU A 1 470 ? -40.134 31.640  -29.811 1.00 44.50  ? 1973 LEU A CG  1 
ATOM   3322 C CD1 . LEU A 1 470 ? -40.449 33.094  -30.161 1.00 45.39  ? 1973 LEU A CD1 1 
ATOM   3323 C CD2 . LEU A 1 470 ? -38.631 31.416  -29.756 1.00 43.87  ? 1973 LEU A CD2 1 
ATOM   3324 N N   . GLY A 1 471 ? -43.905 29.725  -29.279 1.00 34.25  ? 1974 GLY A N   1 
ATOM   3325 C CA  . GLY A 1 471 ? -44.526 28.409  -29.360 1.00 30.52  ? 1974 GLY A CA  1 
ATOM   3326 C C   . GLY A 1 471 ? -43.917 27.561  -30.464 1.00 30.39  ? 1974 GLY A C   1 
ATOM   3327 O O   . GLY A 1 471 ? -43.958 27.924  -31.632 1.00 31.51  ? 1974 GLY A O   1 
ATOM   3328 N N   . VAL A 1 472 ? -43.334 26.431  -30.093 1.00 31.02  ? 1975 VAL A N   1 
ATOM   3329 C CA  . VAL A 1 472 ? -42.701 25.526  -31.046 1.00 28.59  ? 1975 VAL A CA  1 
ATOM   3330 C C   . VAL A 1 472 ? -43.568 24.293  -31.189 1.00 27.29  ? 1975 VAL A C   1 
ATOM   3331 O O   . VAL A 1 472 ? -43.955 23.685  -30.185 1.00 26.53  ? 1975 VAL A O   1 
ATOM   3332 C CB  . VAL A 1 472 ? -41.326 25.131  -30.531 1.00 29.37  ? 1975 VAL A CB  1 
ATOM   3333 C CG1 . VAL A 1 472 ? -40.641 24.192  -31.496 1.00 29.53  ? 1975 VAL A CG1 1 
ATOM   3334 C CG2 . VAL A 1 472 ? -40.507 26.383  -30.334 1.00 30.46  ? 1975 VAL A CG2 1 
ATOM   3335 N N   . SER A 1 473 ? -43.874 23.906  -32.425 1.00 27.00  ? 1976 SER A N   1 
ATOM   3336 C CA  . SER A 1 473 ? -44.745 22.746  -32.639 1.00 28.56  ? 1976 SER A CA  1 
ATOM   3337 C C   . SER A 1 473 ? -44.319 21.884  -33.799 1.00 30.00  ? 1976 SER A C   1 
ATOM   3338 O O   . SER A 1 473 ? -43.320 22.162  -34.420 1.00 30.39  ? 1976 SER A O   1 
ATOM   3339 C CB  . SER A 1 473 ? -46.205 23.200  -32.832 1.00 29.29  ? 1976 SER A CB  1 
ATOM   3340 O OG  . SER A 1 473 ? -46.373 24.023  -33.984 1.00 30.34  ? 1976 SER A OG  1 
ATOM   3341 N N   . ALA A 1 474 ? -45.088 20.844  -34.106 1.00 34.88  ? 1977 ALA A N   1 
ATOM   3342 C CA  . ALA A 1 474 ? -44.733 19.932  -35.194 1.00 39.15  ? 1977 ALA A CA  1 
ATOM   3343 C C   . ALA A 1 474 ? -44.394 20.579  -36.534 1.00 44.49  ? 1977 ALA A C   1 
ATOM   3344 O O   . ALA A 1 474 ? -43.470 20.118  -37.214 1.00 47.32  ? 1977 ALA A O   1 
ATOM   3345 C CB  . ALA A 1 474 ? -45.823 18.905  -35.397 1.00 36.37  ? 1977 ALA A CB  1 
ATOM   3346 N N   . ASP A 1 475 ? -45.103 21.637  -36.928 1.00 47.68  ? 1978 ASP A N   1 
ATOM   3347 C CA  . ASP A 1 475 ? -44.802 22.239  -38.224 1.00 50.64  ? 1978 ASP A CA  1 
ATOM   3348 C C   . ASP A 1 475 ? -44.594 23.748  -38.276 1.00 50.35  ? 1978 ASP A C   1 
ATOM   3349 O O   . ASP A 1 475 ? -44.631 24.341  -39.363 1.00 51.30  ? 1978 ASP A O   1 
ATOM   3350 C CB  . ASP A 1 475 ? -45.874 21.836  -39.253 1.00 53.95  ? 1978 ASP A CB  1 
ATOM   3351 C CG  . ASP A 1 475 ? -46.044 20.324  -39.352 1.00 56.26  ? 1978 ASP A CG  1 
ATOM   3352 O OD1 . ASP A 1 475 ? -45.018 19.605  -39.384 1.00 55.60  ? 1978 ASP A OD1 1 
ATOM   3353 O OD2 . ASP A 1 475 ? -47.204 19.859  -39.402 1.00 57.49  ? 1978 ASP A OD2 1 
ATOM   3354 N N   . ALA A 1 476 ? -44.368 24.369  -37.123 1.00 47.67  ? 1979 ALA A N   1 
ATOM   3355 C CA  . ALA A 1 476 ? -44.136 25.809  -37.094 1.00 45.14  ? 1979 ALA A CA  1 
ATOM   3356 C C   . ALA A 1 476 ? -43.687 26.308  -35.738 1.00 44.72  ? 1979 ALA A C   1 
ATOM   3357 O O   . ALA A 1 476 ? -43.766 25.605  -34.732 1.00 44.25  ? 1979 ALA A O   1 
ATOM   3358 C CB  . ALA A 1 476 ? -45.387 26.549  -37.508 1.00 43.07  ? 1979 ALA A CB  1 
ATOM   3359 N N   . VAL A 1 477 ? -43.195 27.537  -35.731 1.00 43.87  ? 1980 VAL A N   1 
ATOM   3360 C CA  . VAL A 1 477 ? -42.773 28.191  -34.510 1.00 43.00  ? 1980 VAL A CA  1 
ATOM   3361 C C   . VAL A 1 477 ? -43.492 29.532  -34.523 1.00 40.21  ? 1980 VAL A C   1 
ATOM   3362 O O   . VAL A 1 477 ? -43.175 30.394  -35.323 1.00 37.54  ? 1980 VAL A O   1 
ATOM   3363 C CB  . VAL A 1 477 ? -41.231 28.366  -34.456 1.00 45.69  ? 1980 VAL A CB  1 
ATOM   3364 C CG1 . VAL A 1 477 ? -40.560 27.010  -34.640 1.00 45.85  ? 1980 VAL A CG1 1 
ATOM   3365 C CG2 . VAL A 1 477 ? -40.753 29.337  -35.524 1.00 49.22  ? 1980 VAL A CG2 1 
ATOM   3366 N N   . SER A 1 478 ? -44.474 29.692  -33.640 1.00 39.33  ? 1981 SER A N   1 
ATOM   3367 C CA  . SER A 1 478 ? -45.272 30.911  -33.598 1.00 38.60  ? 1981 SER A CA  1 
ATOM   3368 C C   . SER A 1 478 ? -44.937 31.880  -32.471 1.00 38.79  ? 1981 SER A C   1 
ATOM   3369 O O   . SER A 1 478 ? -44.338 31.507  -31.464 1.00 39.17  ? 1981 SER A O   1 
ATOM   3370 C CB  . SER A 1 478 ? -46.743 30.538  -33.505 1.00 37.24  ? 1981 SER A CB  1 
ATOM   3371 O OG  . SER A 1 478 ? -47.028 29.466  -34.377 1.00 37.22  ? 1981 SER A OG  1 
ATOM   3372 N N   . VAL A 1 479 ? -45.330 33.134  -32.656 1.00 38.20  ? 1982 VAL A N   1 
ATOM   3373 C CA  . VAL A 1 479 ? -45.109 34.158  -31.646 1.00 38.58  ? 1982 VAL A CA  1 
ATOM   3374 C C   . VAL A 1 479 ? -46.456 34.569  -31.039 1.00 39.37  ? 1982 VAL A C   1 
ATOM   3375 O O   . VAL A 1 479 ? -47.349 35.042  -31.737 1.00 39.08  ? 1982 VAL A O   1 
ATOM   3376 C CB  . VAL A 1 479 ? -44.385 35.409  -32.255 1.00 38.85  ? 1982 VAL A CB  1 
ATOM   3377 C CG1 . VAL A 1 479 ? -44.517 36.621  -31.329 1.00 36.95  ? 1982 VAL A CG1 1 
ATOM   3378 C CG2 . VAL A 1 479 ? -42.910 35.093  -32.458 1.00 37.14  ? 1982 VAL A CG2 1 
ATOM   3379 N N   . TYR A 1 480 ? -46.613 34.372  -29.738 1.00 40.57  ? 1983 TYR A N   1 
ATOM   3380 C CA  . TYR A 1 480 ? -47.860 34.748  -29.094 1.00 43.56  ? 1983 TYR A CA  1 
ATOM   3381 C C   . TYR A 1 480 ? -47.615 35.901  -28.122 1.00 46.25  ? 1983 TYR A C   1 
ATOM   3382 O O   . TYR A 1 480 ? -46.507 36.073  -27.612 1.00 47.05  ? 1983 TYR A O   1 
ATOM   3383 C CB  . TYR A 1 480 ? -48.458 33.583  -28.277 1.00 42.04  ? 1983 TYR A CB  1 
ATOM   3384 C CG  . TYR A 1 480 ? -48.711 32.273  -28.989 1.00 39.69  ? 1983 TYR A CG  1 
ATOM   3385 C CD1 . TYR A 1 480 ? -47.648 31.451  -29.375 1.00 38.07  ? 1983 TYR A CD1 1 
ATOM   3386 C CD2 . TYR A 1 480 ? -50.022 31.832  -29.238 1.00 38.43  ? 1983 TYR A CD2 1 
ATOM   3387 C CE1 . TYR A 1 480 ? -47.880 30.218  -29.995 1.00 39.08  ? 1983 TYR A CE1 1 
ATOM   3388 C CE2 . TYR A 1 480 ? -50.271 30.593  -29.859 1.00 37.33  ? 1983 TYR A CE2 1 
ATOM   3389 C CZ  . TYR A 1 480 ? -49.197 29.797  -30.236 1.00 38.74  ? 1983 TYR A CZ  1 
ATOM   3390 O OH  . TYR A 1 480 ? -49.416 28.594  -30.867 1.00 37.53  ? 1983 TYR A OH  1 
ATOM   3391 N N   . LYS A 1 481 ? -48.650 36.691  -27.873 1.00 49.51  ? 1984 LYS A N   1 
ATOM   3392 C CA  . LYS A 1 481 ? -48.536 37.758  -26.897 1.00 52.56  ? 1984 LYS A CA  1 
ATOM   3393 C C   . LYS A 1 481 ? -48.659 36.963  -25.583 1.00 54.15  ? 1984 LYS A C   1 
ATOM   3394 O O   . LYS A 1 481 ? -49.766 36.605  -25.179 1.00 54.46  ? 1984 LYS A O   1 
ATOM   3395 C CB  . LYS A 1 481 ? -49.700 38.745  -27.057 1.00 52.72  ? 1984 LYS A CB  1 
ATOM   3396 N N   . ARG A 1 482 ? -47.519 36.671  -24.949 1.00 56.64  ? 1985 ARG A N   1 
ATOM   3397 C CA  . ARG A 1 482 ? -47.452 35.876  -23.709 1.00 58.58  ? 1985 ARG A CA  1 
ATOM   3398 C C   . ARG A 1 482 ? -48.751 35.811  -22.923 1.00 59.08  ? 1985 ARG A C   1 
ATOM   3399 O O   . ARG A 1 482 ? -49.071 36.722  -22.172 1.00 60.38  ? 1985 ARG A O   1 
ATOM   3400 C CB  . ARG A 1 482 ? -46.338 36.390  -22.786 1.00 60.02  ? 1985 ARG A CB  1 
ATOM   3401 C CG  . ARG A 1 482 ? -46.045 35.461  -21.605 1.00 60.72  ? 1985 ARG A CG  1 
ATOM   3402 C CD  . ARG A 1 482 ? -44.931 35.989  -20.692 1.00 63.10  ? 1985 ARG A CD  1 
ATOM   3403 N NE  . ARG A 1 482 ? -43.639 36.086  -21.375 1.00 65.87  ? 1985 ARG A NE  1 
ATOM   3404 C CZ  . ARG A 1 482 ? -42.467 36.294  -20.765 1.00 67.35  ? 1985 ARG A CZ  1 
ATOM   3405 N NH1 . ARG A 1 482 ? -42.403 36.424  -19.444 1.00 67.02  ? 1985 ARG A NH1 1 
ATOM   3406 N NH2 . ARG A 1 482 ? -41.347 36.387  -21.477 1.00 67.11  ? 1985 ARG A NH2 1 
ATOM   3407 N N   . GLY A 1 483 ? -49.493 34.721  -23.090 1.00 59.82  ? 1986 GLY A N   1 
ATOM   3408 C CA  . GLY A 1 483 ? -50.761 34.572  -22.399 1.00 59.64  ? 1986 GLY A CA  1 
ATOM   3409 C C   . GLY A 1 483 ? -51.928 34.552  -23.374 1.00 59.98  ? 1986 GLY A C   1 
ATOM   3410 O O   . GLY A 1 483 ? -53.028 34.112  -23.040 1.00 60.75  ? 1986 GLY A O   1 
ATOM   3411 N N   . GLU A 1 484 ? -51.698 35.035  -24.588 1.00 59.68  ? 1987 GLU A N   1 
ATOM   3412 C CA  . GLU A 1 484 ? -52.751 35.045  -25.593 1.00 59.42  ? 1987 GLU A CA  1 
ATOM   3413 C C   . GLU A 1 484 ? -52.867 33.638  -26.180 1.00 58.36  ? 1987 GLU A C   1 
ATOM   3414 O O   . GLU A 1 484 ? -51.912 32.851  -26.132 1.00 57.67  ? 1987 GLU A O   1 
ATOM   3415 C CB  . GLU A 1 484 ? -52.426 36.059  -26.701 1.00 60.40  ? 1987 GLU A CB  1 
ATOM   3416 N N   . GLY A 1 485 ? -54.042 33.332  -26.721 1.00 56.15  ? 1988 GLY A N   1 
ATOM   3417 C CA  . GLY A 1 485 ? -54.277 32.031  -27.314 1.00 54.09  ? 1988 GLY A CA  1 
ATOM   3418 C C   . GLY A 1 485 ? -54.022 32.016  -28.808 1.00 53.00  ? 1988 GLY A C   1 
ATOM   3419 O O   . GLY A 1 485 ? -53.589 30.999  -29.354 1.00 52.60  ? 1988 GLY A O   1 
ATOM   3420 N N   . ARG A 1 486 ? -54.299 33.137  -29.473 1.00 52.14  ? 1989 ARG A N   1 
ATOM   3421 C CA  . ARG A 1 486 ? -54.089 33.260  -30.917 1.00 50.46  ? 1989 ARG A CA  1 
ATOM   3422 C C   . ARG A 1 486 ? -52.713 33.866  -31.174 1.00 49.64  ? 1989 ARG A C   1 
ATOM   3423 O O   . ARG A 1 486 ? -52.279 34.783  -30.465 1.00 49.39  ? 1989 ARG A O   1 
ATOM   3424 C CB  . ARG A 1 486 ? -55.162 34.144  -31.554 1.00 49.80  ? 1989 ARG A CB  1 
ATOM   3425 N N   . PRO A 1 487 ? -52.001 33.343  -32.182 1.00 48.04  ? 1990 PRO A N   1 
ATOM   3426 C CA  . PRO A 1 487 ? -50.666 33.837  -32.522 1.00 48.39  ? 1990 PRO A CA  1 
ATOM   3427 C C   . PRO A 1 487 ? -50.619 35.132  -33.338 1.00 48.16  ? 1990 PRO A C   1 
ATOM   3428 O O   . PRO A 1 487 ? -51.399 35.329  -34.267 1.00 47.25  ? 1990 PRO A O   1 
ATOM   3429 C CB  . PRO A 1 487 ? -50.047 32.652  -33.264 1.00 48.38  ? 1990 PRO A CB  1 
ATOM   3430 C CG  . PRO A 1 487 ? -51.236 32.054  -33.961 1.00 46.58  ? 1990 PRO A CG  1 
ATOM   3431 C CD  . PRO A 1 487 ? -52.291 32.080  -32.886 1.00 46.60  ? 1990 PRO A CD  1 
ATOM   3432 N N   . LEU A 1 488 ? -49.689 36.011  -32.970 1.00 48.64  ? 1991 LEU A N   1 
ATOM   3433 C CA  . LEU A 1 488 ? -49.494 37.282  -33.660 1.00 48.75  ? 1991 LEU A CA  1 
ATOM   3434 C C   . LEU A 1 488 ? -48.899 37.002  -35.038 1.00 48.44  ? 1991 LEU A C   1 
ATOM   3435 O O   . LEU A 1 488 ? -48.952 37.844  -35.933 1.00 49.17  ? 1991 LEU A O   1 
ATOM   3436 C CB  . LEU A 1 488 ? -48.528 38.183  -32.876 1.00 49.78  ? 1991 LEU A CB  1 
ATOM   3437 C CG  . LEU A 1 488 ? -48.928 39.046  -31.670 1.00 49.72  ? 1991 LEU A CG  1 
ATOM   3438 C CD1 . LEU A 1 488 ? -49.926 38.316  -30.779 1.00 52.31  ? 1991 LEU A CD1 1 
ATOM   3439 C CD2 . LEU A 1 488 ? -47.652 39.403  -30.891 1.00 46.93  ? 1991 LEU A CD2 1 
ATOM   3440 N N   . GLU A 1 489 ? -48.328 35.815  -35.200 1.00 48.49  ? 1992 GLU A N   1 
ATOM   3441 C CA  . GLU A 1 489 ? -47.712 35.421  -36.463 1.00 49.39  ? 1992 GLU A CA  1 
ATOM   3442 C C   . GLU A 1 489 ? -47.040 34.061  -36.313 1.00 49.13  ? 1992 GLU A C   1 
ATOM   3443 O O   . GLU A 1 489 ? -46.334 33.805  -35.335 1.00 48.91  ? 1992 GLU A O   1 
ATOM   3444 C CB  . GLU A 1 489 ? -46.689 36.480  -36.904 1.00 50.81  ? 1992 GLU A CB  1 
ATOM   3445 C CG  . GLU A 1 489 ? -45.856 36.108  -38.119 1.00 52.04  ? 1992 GLU A CG  1 
ATOM   3446 C CD  . GLU A 1 489 ? -45.073 37.292  -38.711 1.00 52.80  ? 1992 GLU A CD  1 
ATOM   3447 O OE1 . GLU A 1 489 ? -44.749 38.246  -37.958 1.00 50.67  ? 1992 GLU A OE1 1 
ATOM   3448 O OE2 . GLU A 1 489 ? -44.770 37.249  -39.935 1.00 51.85  ? 1992 GLU A OE2 1 
ATOM   3449 N N   . VAL A 1 490 ? -47.283 33.181  -37.279 1.00 49.52  ? 1993 VAL A N   1 
ATOM   3450 C CA  . VAL A 1 490 ? -46.700 31.842  -37.264 1.00 48.95  ? 1993 VAL A CA  1 
ATOM   3451 C C   . VAL A 1 490 ? -45.788 31.647  -38.471 1.00 50.70  ? 1993 VAL A C   1 
ATOM   3452 O O   . VAL A 1 490 ? -46.174 31.909  -39.611 1.00 51.83  ? 1993 VAL A O   1 
ATOM   3453 C CB  . VAL A 1 490 ? -47.799 30.754  -37.249 1.00 45.33  ? 1993 VAL A CB  1 
ATOM   3454 C CG1 . VAL A 1 490 ? -49.147 31.399  -37.002 1.00 43.59  ? 1993 VAL A CG1 1 
ATOM   3455 C CG2 . VAL A 1 490 ? -47.781 29.948  -38.532 1.00 41.90  ? 1993 VAL A CG2 1 
ATOM   3456 N N   . PHE A 1 491 ? -44.572 31.196  -38.194 1.00 51.73  ? 1994 PHE A N   1 
ATOM   3457 C CA  . PHE A 1 491 ? -43.562 30.952  -39.209 1.00 52.80  ? 1994 PHE A CA  1 
ATOM   3458 C C   . PHE A 1 491 ? -43.430 29.460  -39.468 1.00 53.83  ? 1994 PHE A C   1 
ATOM   3459 O O   . PHE A 1 491 ? -42.789 28.749  -38.698 1.00 52.66  ? 1994 PHE A O   1 
ATOM   3460 C CB  . PHE A 1 491 ? -42.221 31.502  -38.732 1.00 53.32  ? 1994 PHE A CB  1 
ATOM   3461 C CG  . PHE A 1 491 ? -42.271 32.949  -38.335 1.00 55.43  ? 1994 PHE A CG  1 
ATOM   3462 C CD1 . PHE A 1 491 ? -41.914 33.348  -37.050 1.00 55.76  ? 1994 PHE A CD1 1 
ATOM   3463 C CD2 . PHE A 1 491 ? -42.686 33.920  -39.246 1.00 56.46  ? 1994 PHE A CD2 1 
ATOM   3464 C CE1 . PHE A 1 491 ? -41.971 34.691  -36.678 1.00 56.74  ? 1994 PHE A CE1 1 
ATOM   3465 C CE2 . PHE A 1 491 ? -42.745 35.266  -38.884 1.00 56.39  ? 1994 PHE A CE2 1 
ATOM   3466 C CZ  . PHE A 1 491 ? -42.387 35.652  -37.599 1.00 56.28  ? 1994 PHE A CZ  1 
ATOM   3467 N N   . GLN A 1 492 ? -44.034 28.979  -40.549 1.00 55.78  ? 1995 GLN A N   1 
ATOM   3468 C CA  . GLN A 1 492 ? -43.943 27.561  -40.860 1.00 58.54  ? 1995 GLN A CA  1 
ATOM   3469 C C   . GLN A 1 492 ? -42.477 27.187  -41.060 1.00 59.09  ? 1995 GLN A C   1 
ATOM   3470 O O   . GLN A 1 492 ? -41.682 28.007  -41.509 1.00 59.37  ? 1995 GLN A O   1 
ATOM   3471 C CB  . GLN A 1 492 ? -44.761 27.243  -42.110 1.00 59.88  ? 1995 GLN A CB  1 
ATOM   3472 C CG  . GLN A 1 492 ? -45.741 26.102  -41.910 1.00 61.83  ? 1995 GLN A CG  1 
ATOM   3473 C CD  . GLN A 1 492 ? -47.182 26.519  -42.147 1.00 64.02  ? 1995 GLN A CD  1 
ATOM   3474 O OE1 . GLN A 1 492 ? -47.576 26.806  -43.280 1.00 64.73  ? 1995 GLN A OE1 1 
ATOM   3475 N NE2 . GLN A 1 492 ? -47.978 26.561  -41.073 1.00 63.99  ? 1995 GLN A NE2 1 
ATOM   3476 N N   . TYR A 1 493 ? -42.112 25.961  -40.705 1.00 60.69  ? 1996 TYR A N   1 
ATOM   3477 C CA  . TYR A 1 493 ? -40.723 25.520  -40.857 1.00 62.88  ? 1996 TYR A CA  1 
ATOM   3478 C C   . TYR A 1 493 ? -40.294 25.630  -42.307 1.00 64.53  ? 1996 TYR A C   1 
ATOM   3479 O O   . TYR A 1 493 ? -39.114 25.789  -42.612 1.00 65.76  ? 1996 TYR A O   1 
ATOM   3480 C CB  . TYR A 1 493 ? -40.558 24.068  -40.384 1.00 61.39  ? 1996 TYR A CB  1 
ATOM   3481 C CG  . TYR A 1 493 ? -40.564 23.908  -38.884 1.00 58.98  ? 1996 TYR A CG  1 
ATOM   3482 C CD1 . TYR A 1 493 ? -39.647 24.593  -38.091 1.00 58.44  ? 1996 TYR A CD1 1 
ATOM   3483 C CD2 . TYR A 1 493 ? -41.464 23.053  -38.259 1.00 59.07  ? 1996 TYR A CD2 1 
ATOM   3484 C CE1 . TYR A 1 493 ? -39.622 24.429  -36.713 1.00 57.90  ? 1996 TYR A CE1 1 
ATOM   3485 C CE2 . TYR A 1 493 ? -41.449 22.878  -36.880 1.00 58.13  ? 1996 TYR A CE2 1 
ATOM   3486 C CZ  . TYR A 1 493 ? -40.526 23.568  -36.113 1.00 58.35  ? 1996 TYR A CZ  1 
ATOM   3487 O OH  . TYR A 1 493 ? -40.494 23.396  -34.748 1.00 57.79  ? 1996 TYR A OH  1 
ATOM   3488 N N   . GLU A 1 494 ? -41.274 25.550  -43.196 1.00 66.54  ? 1997 GLU A N   1 
ATOM   3489 C CA  . GLU A 1 494 ? -41.045 25.637  -44.633 1.00 67.57  ? 1997 GLU A CA  1 
ATOM   3490 C C   . GLU A 1 494 ? -40.419 26.972  -45.051 1.00 67.04  ? 1997 GLU A C   1 
ATOM   3491 O O   . GLU A 1 494 ? -39.698 27.029  -46.038 1.00 66.79  ? 1997 GLU A O   1 
ATOM   3492 C CB  . GLU A 1 494 ? -42.380 25.450  -45.369 1.00 68.61  ? 1997 GLU A CB  1 
ATOM   3493 C CG  . GLU A 1 494 ? -42.256 25.079  -46.827 1.00 68.86  ? 1997 GLU A CG  1 
ATOM   3494 C CD  . GLU A 1 494 ? -41.725 23.675  -47.007 1.00 69.42  ? 1997 GLU A CD  1 
ATOM   3495 O OE1 . GLU A 1 494 ? -40.532 23.448  -46.719 1.00 68.64  ? 1997 GLU A OE1 1 
ATOM   3496 O OE2 . GLU A 1 494 ? -42.508 22.795  -47.427 1.00 70.50  ? 1997 GLU A OE2 1 
ATOM   3497 N N   . HIS A 1 495 ? -40.691 28.034  -44.295 1.00 67.81  ? 1998 HIS A N   1 
ATOM   3498 C CA  . HIS A 1 495 ? -40.184 29.367  -44.625 1.00 69.32  ? 1998 HIS A CA  1 
ATOM   3499 C C   . HIS A 1 495 ? -39.079 29.898  -43.721 1.00 69.79  ? 1998 HIS A C   1 
ATOM   3500 O O   . HIS A 1 495 ? -38.718 31.071  -43.819 1.00 70.45  ? 1998 HIS A O   1 
ATOM   3501 C CB  . HIS A 1 495 ? -41.336 30.380  -44.622 1.00 70.14  ? 1998 HIS A CB  1 
ATOM   3502 C CG  . HIS A 1 495 ? -42.556 29.917  -45.358 1.00 71.92  ? 1998 HIS A CG  1 
ATOM   3503 N ND1 . HIS A 1 495 ? -43.288 28.817  -44.966 1.00 72.97  ? 1998 HIS A ND1 1 
ATOM   3504 C CD2 . HIS A 1 495 ? -43.173 30.403  -46.463 1.00 73.10  ? 1998 HIS A CD2 1 
ATOM   3505 C CE1 . HIS A 1 495 ? -44.303 28.644  -45.795 1.00 73.56  ? 1998 HIS A CE1 1 
ATOM   3506 N NE2 . HIS A 1 495 ? -44.256 29.592  -46.713 1.00 73.80  ? 1998 HIS A NE2 1 
ATOM   3507 N N   . ILE A 1 496 ? -38.544 29.058  -42.839 1.00 70.48  ? 1999 ILE A N   1 
ATOM   3508 C CA  . ILE A 1 496 ? -37.488 29.504  -41.934 1.00 70.01  ? 1999 ILE A CA  1 
ATOM   3509 C C   . ILE A 1 496 ? -36.126 29.179  -42.492 1.00 70.32  ? 1999 ILE A C   1 
ATOM   3510 O O   . ILE A 1 496 ? -35.725 28.021  -42.541 1.00 70.25  ? 1999 ILE A O   1 
ATOM   3511 C CB  . ILE A 1 496 ? -37.588 28.846  -40.547 1.00 70.01  ? 1999 ILE A CB  1 
ATOM   3512 C CG1 . ILE A 1 496 ? -38.951 29.138  -39.917 1.00 68.39  ? 1999 ILE A CG1 1 
ATOM   3513 C CG2 . ILE A 1 496 ? -36.457 29.362  -39.655 1.00 69.25  ? 1999 ILE A CG2 1 
ATOM   3514 C CD1 . ILE A 1 496 ? -39.124 28.520  -38.545 1.00 67.34  ? 1999 ILE A CD1 1 
ATOM   3515 N N   . LEU A 1 497 ? -35.408 30.213  -42.900 1.00 71.79  ? 2000 LEU A N   1 
ATOM   3516 C CA  . LEU A 1 497 ? -34.084 30.033  -43.471 1.00 73.09  ? 2000 LEU A CA  1 
ATOM   3517 C C   . LEU A 1 497 ? -33.099 29.474  -42.446 1.00 74.06  ? 2000 LEU A C   1 
ATOM   3518 O O   . LEU A 1 497 ? -32.639 28.333  -42.571 1.00 74.66  ? 2000 LEU A O   1 
ATOM   3519 C CB  . LEU A 1 497 ? -33.570 31.365  -44.017 1.00 73.97  ? 2000 LEU A CB  1 
ATOM   3520 N N   . SER A 1 498 ? -32.777 30.270  -41.430 1.00 74.01  ? 2001 SER A N   1 
ATOM   3521 C CA  . SER A 1 498 ? -31.835 29.824  -40.414 1.00 74.25  ? 2001 SER A CA  1 
ATOM   3522 C C   . SER A 1 498 ? -32.311 30.165  -39.014 1.00 73.43  ? 2001 SER A C   1 
ATOM   3523 O O   . SER A 1 498 ? -33.135 31.058  -38.824 1.00 73.10  ? 2001 SER A O   1 
ATOM   3524 C CB  . SER A 1 498 ? -30.460 30.465  -40.648 1.00 76.06  ? 2001 SER A CB  1 
ATOM   3525 O OG  . SER A 1 498 ? -30.471 31.859  -40.355 1.00 76.62  ? 2001 SER A OG  1 
ATOM   3526 N N   . PHE A 1 499 ? -31.783 29.439  -38.035 1.00 72.40  ? 2002 PHE A N   1 
ATOM   3527 C CA  . PHE A 1 499 ? -32.125 29.672  -36.639 1.00 71.88  ? 2002 PHE A CA  1 
ATOM   3528 C C   . PHE A 1 499 ? -30.991 29.183  -35.752 1.00 72.81  ? 2002 PHE A C   1 
ATOM   3529 O O   . PHE A 1 499 ? -30.199 28.327  -36.153 1.00 73.18  ? 2002 PHE A O   1 
ATOM   3530 C CB  . PHE A 1 499 ? -33.431 28.959  -36.278 1.00 68.27  ? 2002 PHE A CB  1 
ATOM   3531 C CG  . PHE A 1 499 ? -33.361 27.469  -36.383 1.00 64.66  ? 2002 PHE A CG  1 
ATOM   3532 C CD1 . PHE A 1 499 ? -32.910 26.705  -35.315 1.00 64.06  ? 2002 PHE A CD1 1 
ATOM   3533 C CD2 . PHE A 1 499 ? -33.749 26.825  -37.551 1.00 63.70  ? 2002 PHE A CD2 1 
ATOM   3534 C CE1 . PHE A 1 499 ? -32.847 25.313  -35.406 1.00 63.43  ? 2002 PHE A CE1 1 
ATOM   3535 C CE2 . PHE A 1 499 ? -33.691 25.438  -37.659 1.00 62.99  ? 2002 PHE A CE2 1 
ATOM   3536 C CZ  . PHE A 1 499 ? -33.239 24.678  -36.581 1.00 63.49  ? 2002 PHE A CZ  1 
ATOM   3537 N N   . GLY A 1 500 ? -30.912 29.736  -34.550 1.00 73.62  ? 2003 GLY A N   1 
ATOM   3538 C CA  . GLY A 1 500 ? -29.864 29.341  -33.634 1.00 75.37  ? 2003 GLY A CA  1 
ATOM   3539 C C   . GLY A 1 500 ? -29.599 30.468  -32.670 1.00 77.18  ? 2003 GLY A C   1 
ATOM   3540 O O   . GLY A 1 500 ? -30.316 31.467  -32.674 1.00 76.80  ? 2003 GLY A O   1 
ATOM   3541 N N   . ALA A 1 501 ? -28.580 30.309  -31.837 1.00 79.05  ? 2004 ALA A N   1 
ATOM   3542 C CA  . ALA A 1 501 ? -28.222 31.337  -30.872 1.00 80.99  ? 2004 ALA A CA  1 
ATOM   3543 C C   . ALA A 1 501 ? -26.891 31.956  -31.292 1.00 82.43  ? 2004 ALA A C   1 
ATOM   3544 O O   . ALA A 1 501 ? -25.817 31.425  -30.995 1.00 82.32  ? 2004 ALA A O   1 
ATOM   3545 C CB  . ALA A 1 501 ? -28.118 30.738  -29.472 1.00 80.84  ? 2004 ALA A CB  1 
ATOM   3546 N N   . PRO A 1 502 ? -26.948 33.081  -32.022 1.00 83.77  ? 2005 PRO A N   1 
ATOM   3547 C CA  . PRO A 1 502 ? -25.732 33.757  -32.475 1.00 84.72  ? 2005 PRO A CA  1 
ATOM   3548 C C   . PRO A 1 502 ? -25.027 34.460  -31.312 1.00 85.17  ? 2005 PRO A C   1 
ATOM   3549 O O   . PRO A 1 502 ? -23.797 34.558  -31.280 1.00 85.48  ? 2005 PRO A O   1 
ATOM   3550 C CB  . PRO A 1 502 ? -26.259 34.730  -33.529 1.00 84.67  ? 2005 PRO A CB  1 
ATOM   3551 C CG  . PRO A 1 502 ? -27.601 35.104  -32.977 1.00 84.54  ? 2005 PRO A CG  1 
ATOM   3552 C CD  . PRO A 1 502 ? -28.150 33.763  -32.538 1.00 84.39  ? 2005 PRO A CD  1 
ATOM   3553 N N   . LEU A 1 503 ? -25.814 34.949  -30.358 1.00 85.28  ? 2006 LEU A N   1 
ATOM   3554 C CA  . LEU A 1 503 ? -25.263 35.627  -29.195 1.00 85.35  ? 2006 LEU A CA  1 
ATOM   3555 C C   . LEU A 1 503 ? -25.610 34.829  -27.949 1.00 85.15  ? 2006 LEU A C   1 
ATOM   3556 O O   . LEU A 1 503 ? -26.319 33.819  -28.015 1.00 84.65  ? 2006 LEU A O   1 
ATOM   3557 C CB  . LEU A 1 503 ? -25.838 37.041  -29.069 1.00 86.01  ? 2006 LEU A CB  1 
ATOM   3558 C CG  . LEU A 1 503 ? -24.853 38.200  -28.876 1.00 85.95  ? 2006 LEU A CG  1 
ATOM   3559 C CD1 . LEU A 1 503 ? -24.124 38.476  -30.187 1.00 85.68  ? 2006 LEU A CD1 1 
ATOM   3560 C CD2 . LEU A 1 503 ? -25.613 39.447  -28.435 1.00 86.35  ? 2006 LEU A CD2 1 
ATOM   3561 N N   . ALA A 1 504 ? -25.105 35.288  -26.813 1.00 85.12  ? 2007 ALA A N   1 
ATOM   3562 C CA  . ALA A 1 504 ? -25.369 34.622  -25.547 1.00 84.74  ? 2007 ALA A CA  1 
ATOM   3563 C C   . ALA A 1 504 ? -26.790 34.945  -25.094 1.00 83.64  ? 2007 ALA A C   1 
ATOM   3564 O O   . ALA A 1 504 ? -27.115 36.104  -24.836 1.00 84.40  ? 2007 ALA A O   1 
ATOM   3565 C CB  . ALA A 1 504 ? -24.356 35.077  -24.492 1.00 84.29  ? 2007 ALA A CB  1 
ATOM   3566 N N   . ASN A 1 505 ? -27.633 33.919  -25.014 1.00 82.03  ? 2008 ASN A N   1 
ATOM   3567 C CA  . ASN A 1 505 ? -29.019 34.089  -24.585 1.00 79.87  ? 2008 ASN A CA  1 
ATOM   3568 C C   . ASN A 1 505 ? -29.843 34.901  -25.586 1.00 78.38  ? 2008 ASN A C   1 
ATOM   3569 O O   . ASN A 1 505 ? -30.823 35.559  -25.223 1.00 77.81  ? 2008 ASN A O   1 
ATOM   3570 C CB  . ASN A 1 505 ? -29.051 34.736  -23.194 1.00 80.17  ? 2008 ASN A CB  1 
ATOM   3571 C CG  . ASN A 1 505 ? -28.509 33.810  -22.107 1.00 80.38  ? 2008 ASN A CG  1 
ATOM   3572 O OD1 . ASN A 1 505 ? -27.620 32.993  -22.358 1.00 80.45  ? 2008 ASN A OD1 1 
ATOM   3573 N ND2 . ASN A 1 505 ? -29.035 33.944  -20.894 1.00 80.84  ? 2008 ASN A ND2 1 
ATOM   3574 N N   . THR A 1 506 ? -29.437 34.837  -26.852 1.00 76.55  ? 2009 THR A N   1 
ATOM   3575 C CA  . THR A 1 506 ? -30.129 35.538  -27.929 1.00 74.07  ? 2009 THR A CA  1 
ATOM   3576 C C   . THR A 1 506 ? -30.488 34.528  -29.009 1.00 72.30  ? 2009 THR A C   1 
ATOM   3577 O O   . THR A 1 506 ? -29.613 33.954  -29.662 1.00 71.33  ? 2009 THR A O   1 
ATOM   3578 C CB  . THR A 1 506 ? -29.248 36.628  -28.593 1.00 74.15  ? 2009 THR A CB  1 
ATOM   3579 O OG1 . THR A 1 506 ? -28.497 37.327  -27.596 1.00 73.82  ? 2009 THR A OG1 1 
ATOM   3580 C CG2 . THR A 1 506 ? -30.127 37.628  -29.334 1.00 73.46  ? 2009 THR A CG2 1 
ATOM   3581 N N   . TYR A 1 507 ? -31.781 34.299  -29.193 1.00 70.70  ? 2010 TYR A N   1 
ATOM   3582 C CA  . TYR A 1 507 ? -32.213 33.367  -30.217 1.00 68.18  ? 2010 TYR A CA  1 
ATOM   3583 C C   . TYR A 1 507 ? -32.476 34.173  -31.481 1.00 67.20  ? 2010 TYR A C   1 
ATOM   3584 O O   . TYR A 1 507 ? -33.133 35.211  -31.449 1.00 66.62  ? 2010 TYR A O   1 
ATOM   3585 C CB  . TYR A 1 507 ? -33.487 32.621  -29.791 1.00 66.29  ? 2010 TYR A CB  1 
ATOM   3586 C CG  . TYR A 1 507 ? -33.673 31.310  -30.528 1.00 64.25  ? 2010 TYR A CG  1 
ATOM   3587 C CD1 . TYR A 1 507 ? -32.863 30.210  -30.244 1.00 64.10  ? 2010 TYR A CD1 1 
ATOM   3588 C CD2 . TYR A 1 507 ? -34.618 31.180  -31.541 1.00 63.28  ? 2010 TYR A CD2 1 
ATOM   3589 C CE1 . TYR A 1 507 ? -32.987 29.014  -30.952 1.00 63.14  ? 2010 TYR A CE1 1 
ATOM   3590 C CE2 . TYR A 1 507 ? -34.748 29.988  -32.255 1.00 62.89  ? 2010 TYR A CE2 1 
ATOM   3591 C CZ  . TYR A 1 507 ? -33.930 28.909  -31.958 1.00 63.37  ? 2010 TYR A CZ  1 
ATOM   3592 O OH  . TYR A 1 507 ? -34.040 27.732  -32.671 1.00 62.14  ? 2010 TYR A OH  1 
ATOM   3593 N N   . LYS A 1 508 ? -31.945 33.697  -32.596 1.00 67.34  ? 2011 LYS A N   1 
ATOM   3594 C CA  . LYS A 1 508 ? -32.130 34.381  -33.857 1.00 67.13  ? 2011 LYS A CA  1 
ATOM   3595 C C   . LYS A 1 508 ? -32.950 33.520  -34.802 1.00 67.68  ? 2011 LYS A C   1 
ATOM   3596 O O   . LYS A 1 508 ? -32.568 32.400  -35.143 1.00 66.98  ? 2011 LYS A O   1 
ATOM   3597 C CB  . LYS A 1 508 ? -30.767 34.710  -34.489 1.00 67.40  ? 2011 LYS A CB  1 
ATOM   3598 N N   . ILE A 1 509 ? -34.102 34.036  -35.205 1.00 68.40  ? 2012 ILE A N   1 
ATOM   3599 C CA  . ILE A 1 509 ? -34.947 33.317  -36.142 1.00 69.54  ? 2012 ILE A CA  1 
ATOM   3600 C C   . ILE A 1 509 ? -34.962 34.131  -37.417 1.00 70.83  ? 2012 ILE A C   1 
ATOM   3601 O O   . ILE A 1 509 ? -35.328 35.308  -37.418 1.00 70.77  ? 2012 ILE A O   1 
ATOM   3602 C CB  . ILE A 1 509 ? -36.381 33.160  -35.628 1.00 68.97  ? 2012 ILE A CB  1 
ATOM   3603 C CG1 . ILE A 1 509 ? -36.411 32.130  -34.497 1.00 68.92  ? 2012 ILE A CG1 1 
ATOM   3604 C CG2 . ILE A 1 509 ? -37.291 32.756  -36.777 1.00 68.31  ? 2012 ILE A CG2 1 
ATOM   3605 C CD1 . ILE A 1 509 ? -37.755 31.955  -33.856 1.00 68.25  ? 2012 ILE A CD1 1 
ATOM   3606 N N   . VAL A 1 510 ? -34.546 33.496  -38.500 1.00 72.28  ? 2013 VAL A N   1 
ATOM   3607 C CA  . VAL A 1 510 ? -34.499 34.180  -39.763 1.00 73.36  ? 2013 VAL A CA  1 
ATOM   3608 C C   . VAL A 1 510 ? -35.493 33.617  -40.761 1.00 74.67  ? 2013 VAL A C   1 
ATOM   3609 O O   . VAL A 1 510 ? -35.321 32.527  -41.305 1.00 74.60  ? 2013 VAL A O   1 
ATOM   3610 C CB  . VAL A 1 510 ? -33.088 34.125  -40.353 1.00 73.24  ? 2013 VAL A CB  1 
ATOM   3611 C CG1 . VAL A 1 510 ? -32.957 35.143  -41.452 1.00 73.22  ? 2013 VAL A CG1 1 
ATOM   3612 C CG2 . VAL A 1 510 ? -32.064 34.402  -39.270 1.00 73.46  ? 2013 VAL A CG2 1 
ATOM   3613 N N   . VAL A 1 511 ? -36.553 34.379  -40.969 1.00 76.76  ? 2014 VAL A N   1 
ATOM   3614 C CA  . VAL A 1 511 ? -37.607 34.059  -41.916 1.00 79.49  ? 2014 VAL A CA  1 
ATOM   3615 C C   . VAL A 1 511 ? -37.579 35.355  -42.719 1.00 81.25  ? 2014 VAL A C   1 
ATOM   3616 O O   . VAL A 1 511 ? -37.648 36.435  -42.144 1.00 81.86  ? 2014 VAL A O   1 
ATOM   3617 C CB  . VAL A 1 511 ? -38.978 33.904  -41.216 1.00 78.42  ? 2014 VAL A CB  1 
ATOM   3618 N N   . ASP A 1 512 ? -37.464 35.268  -44.036 1.00 83.06  ? 2015 ASP A N   1 
ATOM   3619 C CA  . ASP A 1 512 ? -37.372 36.476  -44.850 1.00 84.50  ? 2015 ASP A CA  1 
ATOM   3620 C C   . ASP A 1 512 ? -36.288 37.430  -44.339 1.00 84.75  ? 2015 ASP A C   1 
ATOM   3621 O O   . ASP A 1 512 ? -35.569 37.123  -43.385 1.00 84.99  ? 2015 ASP A O   1 
ATOM   3622 C CB  . ASP A 1 512 ? -38.738 37.201  -44.968 1.00 85.83  ? 2015 ASP A CB  1 
ATOM   3623 C CG  . ASP A 1 512 ? -39.177 37.912  -43.682 1.00 86.57  ? 2015 ASP A CG  1 
ATOM   3624 O OD1 . ASP A 1 512 ? -38.450 38.809  -43.202 1.00 86.43  ? 2015 ASP A OD1 1 
ATOM   3625 O OD2 . ASP A 1 512 ? -40.272 37.583  -43.163 1.00 86.04  ? 2015 ASP A OD2 1 
ATOM   3626 N N   . GLU A 1 513 ? -36.165 38.583  -44.983 1.00 84.58  ? 2016 GLU A N   1 
ATOM   3627 C CA  . GLU A 1 513 ? -35.154 39.573  -44.616 1.00 84.16  ? 2016 GLU A CA  1 
ATOM   3628 C C   . GLU A 1 513 ? -35.379 40.212  -43.246 1.00 83.49  ? 2016 GLU A C   1 
ATOM   3629 O O   . GLU A 1 513 ? -34.892 41.313  -42.974 1.00 83.25  ? 2016 GLU A O   1 
ATOM   3630 C CB  . GLU A 1 513 ? -35.089 40.671  -45.683 1.00 84.60  ? 2016 GLU A CB  1 
ATOM   3631 N N   . ARG A 1 514 ? -36.113 39.521  -42.381 1.00 82.77  ? 2017 ARG A N   1 
ATOM   3632 C CA  . ARG A 1 514 ? -36.386 40.048  -41.051 1.00 81.96  ? 2017 ARG A CA  1 
ATOM   3633 C C   . ARG A 1 514 ? -35.747 39.119  -40.024 1.00 81.43  ? 2017 ARG A C   1 
ATOM   3634 O O   . ARG A 1 514 ? -36.332 38.121  -39.613 1.00 81.64  ? 2017 ARG A O   1 
ATOM   3635 C CB  . ARG A 1 514 ? -37.902 40.160  -40.826 1.00 81.16  ? 2017 ARG A CB  1 
ATOM   3636 C CG  . ARG A 1 514 ? -38.329 41.229  -39.824 1.00 80.75  ? 2017 ARG A CG  1 
ATOM   3637 C CD  . ARG A 1 514 ? -39.649 41.841  -40.249 1.00 81.05  ? 2017 ARG A CD  1 
ATOM   3638 N NE  . ARG A 1 514 ? -40.601 40.799  -40.623 1.00 82.36  ? 2017 ARG A NE  1 
ATOM   3639 C CZ  . ARG A 1 514 ? -41.300 40.077  -39.755 1.00 82.26  ? 2017 ARG A CZ  1 
ATOM   3640 N NH1 . ARG A 1 514 ? -41.164 40.293  -38.452 1.00 83.67  ? 2017 ARG A NH1 1 
ATOM   3641 N NH2 . ARG A 1 514 ? -42.117 39.126  -40.185 1.00 80.85  ? 2017 ARG A NH2 1 
ATOM   3642 N N   . GLU A 1 515 ? -34.522 39.450  -39.639 1.00 80.69  ? 2018 GLU A N   1 
ATOM   3643 C CA  . GLU A 1 515 ? -33.780 38.667  -38.670 1.00 80.15  ? 2018 GLU A CA  1 
ATOM   3644 C C   . GLU A 1 515 ? -34.331 38.933  -37.267 1.00 79.74  ? 2018 GLU A C   1 
ATOM   3645 O O   . GLU A 1 515 ? -33.780 39.743  -36.516 1.00 80.57  ? 2018 GLU A O   1 
ATOM   3646 C CB  . GLU A 1 515 ? -32.291 39.037  -38.740 1.00 79.89  ? 2018 GLU A CB  1 
ATOM   3647 N N   . LEU A 1 516 ? -35.420 38.246  -36.919 1.00 78.63  ? 2019 LEU A N   1 
ATOM   3648 C CA  . LEU A 1 516 ? -36.057 38.409  -35.610 1.00 77.11  ? 2019 LEU A CA  1 
ATOM   3649 C C   . LEU A 1 516 ? -35.171 37.885  -34.476 1.00 76.69  ? 2019 LEU A C   1 
ATOM   3650 O O   . LEU A 1 516 ? -34.740 36.729  -34.490 1.00 76.62  ? 2019 LEU A O   1 
ATOM   3651 C CB  . LEU A 1 516 ? -37.401 37.683  -35.596 1.00 75.85  ? 2019 LEU A CB  1 
ATOM   3652 C CG  . LEU A 1 516 ? -38.303 37.970  -36.799 1.00 74.86  ? 2019 LEU A CG  1 
ATOM   3653 C CD1 . LEU A 1 516 ? -39.605 37.227  -36.629 1.00 74.83  ? 2019 LEU A CD1 1 
ATOM   3654 C CD2 . LEU A 1 516 ? -38.557 39.457  -36.929 1.00 74.10  ? 2019 LEU A CD2 1 
ATOM   3655 N N   . LEU A 1 517 ? -34.905 38.740  -33.493 1.00 75.76  ? 2020 LEU A N   1 
ATOM   3656 C CA  . LEU A 1 517 ? -34.057 38.364  -32.369 1.00 75.25  ? 2020 LEU A CA  1 
ATOM   3657 C C   . LEU A 1 517 ? -34.836 38.320  -31.062 1.00 74.95  ? 2020 LEU A C   1 
ATOM   3658 O O   . LEU A 1 517 ? -35.491 39.293  -30.681 1.00 74.88  ? 2020 LEU A O   1 
ATOM   3659 C CB  . LEU A 1 517 ? -32.890 39.350  -32.239 1.00 74.84  ? 2020 LEU A CB  1 
ATOM   3660 N N   . PHE A 1 518 ? -34.751 37.186  -30.373 1.00 74.49  ? 2021 PHE A N   1 
ATOM   3661 C CA  . PHE A 1 518 ? -35.439 37.004  -29.098 1.00 73.80  ? 2021 PHE A CA  1 
ATOM   3662 C C   . PHE A 1 518 ? -34.444 36.782  -27.964 1.00 74.31  ? 2021 PHE A C   1 
ATOM   3663 O O   . PHE A 1 518 ? -33.384 36.181  -28.156 1.00 73.64  ? 2021 PHE A O   1 
ATOM   3664 C CB  . PHE A 1 518 ? -36.393 35.813  -29.185 1.00 71.33  ? 2021 PHE A CB  1 
ATOM   3665 C CG  . PHE A 1 518 ? -37.443 35.956  -30.249 1.00 69.75  ? 2021 PHE A CG  1 
ATOM   3666 C CD1 . PHE A 1 518 ? -38.524 36.816  -30.068 1.00 67.62  ? 2021 PHE A CD1 1 
ATOM   3667 C CD2 . PHE A 1 518 ? -37.359 35.218  -31.428 1.00 68.21  ? 2021 PHE A CD2 1 
ATOM   3668 C CE1 . PHE A 1 518 ? -39.504 36.931  -31.041 1.00 67.77  ? 2021 PHE A CE1 1 
ATOM   3669 C CE2 . PHE A 1 518 ? -38.339 35.330  -32.404 1.00 67.95  ? 2021 PHE A CE2 1 
ATOM   3670 C CZ  . PHE A 1 518 ? -39.416 36.188  -32.211 1.00 67.61  ? 2021 PHE A CZ  1 
ATOM   3671 N N   . GLU A 1 519 ? -34.794 37.272  -26.782 1.00 75.00  ? 2022 GLU A N   1 
ATOM   3672 C CA  . GLU A 1 519 ? -33.935 37.124  -25.619 1.00 76.71  ? 2022 GLU A CA  1 
ATOM   3673 C C   . GLU A 1 519 ? -34.577 36.214  -24.577 1.00 77.70  ? 2022 GLU A C   1 
ATOM   3674 O O   . GLU A 1 519 ? -35.625 36.537  -24.007 1.00 77.97  ? 2022 GLU A O   1 
ATOM   3675 C CB  . GLU A 1 519 ? -33.646 38.492  -24.995 1.00 77.16  ? 2022 GLU A CB  1 
ATOM   3676 N N   . THR A 1 520 ? -33.938 35.075  -24.336 1.00 78.16  ? 2023 THR A N   1 
ATOM   3677 C CA  . THR A 1 520 ? -34.423 34.114  -23.354 1.00 78.25  ? 2023 THR A CA  1 
ATOM   3678 C C   . THR A 1 520 ? -33.270 33.220  -22.909 1.00 77.79  ? 2023 THR A C   1 
ATOM   3679 O O   . THR A 1 520 ? -32.338 32.975  -23.674 1.00 76.74  ? 2023 THR A O   1 
ATOM   3680 C CB  . THR A 1 520 ? -35.547 33.231  -23.946 1.00 78.91  ? 2023 THR A CB  1 
ATOM   3681 O OG1 . THR A 1 520 ? -36.012 32.306  -22.951 1.00 78.47  ? 2023 THR A OG1 1 
ATOM   3682 C CG2 . THR A 1 520 ? -35.034 32.462  -25.162 1.00 79.17  ? 2023 THR A CG2 1 
ATOM   3683 N N   . SER A 1 521 ? -33.337 32.738  -21.673 1.00 78.13  ? 2024 SER A N   1 
ATOM   3684 C CA  . SER A 1 521 ? -32.295 31.861  -21.134 1.00 78.33  ? 2024 SER A CA  1 
ATOM   3685 C C   . SER A 1 521 ? -32.414 30.421  -21.652 1.00 78.18  ? 2024 SER A C   1 
ATOM   3686 O O   . SER A 1 521 ? -31.443 29.655  -21.639 1.00 78.16  ? 2024 SER A O   1 
ATOM   3687 C CB  . SER A 1 521 ? -32.348 31.878  -19.605 1.00 77.71  ? 2024 SER A CB  1 
ATOM   3688 O OG  . SER A 1 521 ? -33.687 31.930  -19.147 1.00 77.99  ? 2024 SER A OG  1 
ATOM   3689 N N   . GLU A 1 522 ? -33.607 30.072  -22.124 1.00 77.69  ? 2025 GLU A N   1 
ATOM   3690 C CA  . GLU A 1 522 ? -33.885 28.739  -22.646 1.00 76.69  ? 2025 GLU A CA  1 
ATOM   3691 C C   . GLU A 1 522 ? -33.699 28.666  -24.158 1.00 75.54  ? 2025 GLU A C   1 
ATOM   3692 O O   . GLU A 1 522 ? -34.535 28.097  -24.856 1.00 76.10  ? 2025 GLU A O   1 
ATOM   3693 C CB  . GLU A 1 522 ? -35.323 28.347  -22.294 1.00 77.22  ? 2025 GLU A CB  1 
ATOM   3694 C CG  . GLU A 1 522 ? -35.617 28.325  -20.800 1.00 77.97  ? 2025 GLU A CG  1 
ATOM   3695 C CD  . GLU A 1 522 ? -37.049 27.933  -20.494 1.00 78.42  ? 2025 GLU A CD  1 
ATOM   3696 O OE1 . GLU A 1 522 ? -37.939 28.809  -20.557 1.00 77.80  ? 2025 GLU A OE1 1 
ATOM   3697 O OE2 . GLU A 1 522 ? -37.285 26.740  -20.199 1.00 79.45  ? 2025 GLU A OE2 1 
ATOM   3698 N N   . VAL A 1 523 ? -32.609 29.231  -24.668 1.00 73.59  ? 2026 VAL A N   1 
ATOM   3699 C CA  . VAL A 1 523 ? -32.377 29.218  -26.108 1.00 71.55  ? 2026 VAL A CA  1 
ATOM   3700 C C   . VAL A 1 523 ? -31.793 27.926  -26.627 1.00 69.37  ? 2026 VAL A C   1 
ATOM   3701 O O   . VAL A 1 523 ? -31.841 27.659  -27.826 1.00 70.29  ? 2026 VAL A O   1 
ATOM   3702 C CB  . VAL A 1 523 ? -31.455 30.367  -26.556 1.00 72.45  ? 2026 VAL A CB  1 
ATOM   3703 C CG1 . VAL A 1 523 ? -32.259 31.645  -26.672 1.00 73.48  ? 2026 VAL A CG1 1 
ATOM   3704 C CG2 . VAL A 1 523 ? -30.313 30.547  -25.566 1.00 72.77  ? 2026 VAL A CG2 1 
ATOM   3705 N N   . VAL A 1 524 ? -31.231 27.122  -25.738 1.00 66.81  ? 2027 VAL A N   1 
ATOM   3706 C CA  . VAL A 1 524 ? -30.648 25.857  -26.165 1.00 64.69  ? 2027 VAL A CA  1 
ATOM   3707 C C   . VAL A 1 524 ? -31.797 24.890  -26.422 1.00 63.47  ? 2027 VAL A C   1 
ATOM   3708 O O   . VAL A 1 524 ? -31.830 24.186  -27.435 1.00 61.42  ? 2027 VAL A O   1 
ATOM   3709 C CB  . VAL A 1 524 ? -29.724 25.269  -25.078 1.00 65.08  ? 2027 VAL A CB  1 
ATOM   3710 C CG1 . VAL A 1 524 ? -28.679 24.360  -25.725 1.00 63.39  ? 2027 VAL A CG1 1 
ATOM   3711 C CG2 . VAL A 1 524 ? -29.081 26.394  -24.275 1.00 63.49  ? 2027 VAL A CG2 1 
ATOM   3712 N N   . ASP A 1 525 ? -32.741 24.870  -25.484 1.00 62.31  ? 2028 ASP A N   1 
ATOM   3713 C CA  . ASP A 1 525 ? -33.914 24.019  -25.591 1.00 61.63  ? 2028 ASP A CA  1 
ATOM   3714 C C   . ASP A 1 525 ? -34.601 24.273  -26.936 1.00 59.20  ? 2028 ASP A C   1 
ATOM   3715 O O   . ASP A 1 525 ? -34.766 23.355  -27.735 1.00 59.59  ? 2028 ASP A O   1 
ATOM   3716 C CB  . ASP A 1 525 ? -34.904 24.321  -24.453 1.00 64.99  ? 2028 ASP A CB  1 
ATOM   3717 C CG  . ASP A 1 525 ? -34.329 24.042  -23.073 1.00 68.22  ? 2028 ASP A CG  1 
ATOM   3718 O OD1 . ASP A 1 525 ? -33.952 22.880  -22.801 1.00 69.91  ? 2028 ASP A OD1 1 
ATOM   3719 O OD2 . ASP A 1 525 ? -34.264 24.989  -22.256 1.00 69.67  ? 2028 ASP A OD2 1 
ATOM   3720 N N   . VAL A 1 526 ? -34.997 25.525  -27.172 1.00 56.12  ? 2029 VAL A N   1 
ATOM   3721 C CA  . VAL A 1 526 ? -35.675 25.914  -28.408 1.00 53.30  ? 2029 VAL A CA  1 
ATOM   3722 C C   . VAL A 1 526 ? -34.961 25.335  -29.622 1.00 52.78  ? 2029 VAL A C   1 
ATOM   3723 O O   . VAL A 1 526 ? -35.591 24.784  -30.519 1.00 50.96  ? 2029 VAL A O   1 
ATOM   3724 C CB  . VAL A 1 526 ? -35.728 27.454  -28.568 1.00 53.57  ? 2029 VAL A CB  1 
ATOM   3725 C CG1 . VAL A 1 526 ? -36.491 27.815  -29.829 1.00 50.83  ? 2029 VAL A CG1 1 
ATOM   3726 C CG2 . VAL A 1 526 ? -36.373 28.095  -27.353 1.00 51.99  ? 2029 VAL A CG2 1 
ATOM   3727 N N   . ALA A 1 527 ? -33.637 25.464  -29.636 1.00 52.98  ? 2030 ALA A N   1 
ATOM   3728 C CA  . ALA A 1 527 ? -32.813 24.952  -30.727 1.00 52.87  ? 2030 ALA A CA  1 
ATOM   3729 C C   . ALA A 1 527 ? -33.017 23.455  -30.872 1.00 53.01  ? 2030 ALA A C   1 
ATOM   3730 O O   . ALA A 1 527 ? -33.267 22.949  -31.975 1.00 53.35  ? 2030 ALA A O   1 
ATOM   3731 C CB  . ALA A 1 527 ? -31.352 25.246  -30.451 1.00 52.38  ? 2030 ALA A CB  1 
ATOM   3732 N N   . LYS A 1 528 ? -32.915 22.749  -29.748 1.00 52.86  ? 2031 LYS A N   1 
ATOM   3733 C CA  . LYS A 1 528 ? -33.084 21.299  -29.744 1.00 53.72  ? 2031 LYS A CA  1 
ATOM   3734 C C   . LYS A 1 528 ? -34.479 20.890  -30.234 1.00 53.27  ? 2031 LYS A C   1 
ATOM   3735 O O   . LYS A 1 528 ? -34.611 20.095  -31.187 1.00 52.32  ? 2031 LYS A O   1 
ATOM   3736 C CB  . LYS A 1 528 ? -32.824 20.731  -28.334 1.00 54.81  ? 2031 LYS A CB  1 
ATOM   3737 C CG  . LYS A 1 528 ? -31.344 20.564  -27.995 1.00 56.54  ? 2031 LYS A CG  1 
ATOM   3738 C CD  . LYS A 1 528 ? -31.111 19.611  -26.826 1.00 59.39  ? 2031 LYS A CD  1 
ATOM   3739 C CE  . LYS A 1 528 ? -31.223 20.286  -25.451 1.00 62.60  ? 2031 LYS A CE  1 
ATOM   3740 N NZ  . LYS A 1 528 ? -32.562 20.888  -25.161 1.00 64.78  ? 2031 LYS A NZ  1 
ATOM   3741 N N   . LEU A 1 529 ? -35.509 21.451  -29.595 1.00 50.73  ? 2032 LEU A N   1 
ATOM   3742 C CA  . LEU A 1 529 ? -36.883 21.138  -29.948 1.00 50.28  ? 2032 LEU A CA  1 
ATOM   3743 C C   . LEU A 1 529 ? -37.127 21.347  -31.439 1.00 49.85  ? 2032 LEU A C   1 
ATOM   3744 O O   . LEU A 1 529 ? -37.607 20.446  -32.125 1.00 49.31  ? 2032 LEU A O   1 
ATOM   3745 C CB  . LEU A 1 529 ? -37.857 21.984  -29.119 1.00 48.56  ? 2032 LEU A CB  1 
ATOM   3746 C CG  . LEU A 1 529 ? -39.327 21.544  -29.197 1.00 47.85  ? 2032 LEU A CG  1 
ATOM   3747 C CD1 . LEU A 1 529 ? -39.458 20.070  -28.866 1.00 45.25  ? 2032 LEU A CD1 1 
ATOM   3748 C CD2 . LEU A 1 529 ? -40.149 22.382  -28.242 1.00 47.21  ? 2032 LEU A CD2 1 
ATOM   3749 N N   . MET A 1 530 ? -36.778 22.528  -31.937 1.00 50.79  ? 2033 MET A N   1 
ATOM   3750 C CA  . MET A 1 530 ? -36.951 22.840  -33.355 1.00 51.90  ? 2033 MET A CA  1 
ATOM   3751 C C   . MET A 1 530 ? -36.199 21.845  -34.240 1.00 51.41  ? 2033 MET A C   1 
ATOM   3752 O O   . MET A 1 530 ? -36.727 21.385  -35.265 1.00 48.34  ? 2033 MET A O   1 
ATOM   3753 C CB  . MET A 1 530 ? -36.439 24.245  -33.665 1.00 53.36  ? 2033 MET A CB  1 
ATOM   3754 C CG  . MET A 1 530 ? -37.371 25.391  -33.321 1.00 53.63  ? 2033 MET A CG  1 
ATOM   3755 S SD  . MET A 1 530 ? -36.711 26.915  -34.070 1.00 57.78  ? 2033 MET A SD  1 
ATOM   3756 C CE  . MET A 1 530 ? -37.245 28.120  -32.901 1.00 59.11  ? 2033 MET A CE  1 
ATOM   3757 N N   . LYS A 1 531 ? -34.966 21.521  -33.841 1.00 51.15  ? 2034 LYS A N   1 
ATOM   3758 C CA  . LYS A 1 531 ? -34.145 20.584  -34.605 1.00 51.75  ? 2034 LYS A CA  1 
ATOM   3759 C C   . LYS A 1 531 ? -34.825 19.213  -34.674 1.00 51.79  ? 2034 LYS A C   1 
ATOM   3760 O O   . LYS A 1 531 ? -34.794 18.545  -35.714 1.00 51.24  ? 2034 LYS A O   1 
ATOM   3761 C CB  . LYS A 1 531 ? -32.756 20.458  -33.974 1.00 51.20  ? 2034 LYS A CB  1 
ATOM   3762 N N   . ALA A 1 532 ? -35.443 18.803  -33.566 1.00 51.57  ? 2035 ALA A N   1 
ATOM   3763 C CA  . ALA A 1 532 ? -36.150 17.525  -33.506 1.00 51.04  ? 2035 ALA A CA  1 
ATOM   3764 C C   . ALA A 1 532 ? -37.350 17.541  -34.454 1.00 51.63  ? 2035 ALA A C   1 
ATOM   3765 O O   . ALA A 1 532 ? -37.504 16.655  -35.293 1.00 51.82  ? 2035 ALA A O   1 
ATOM   3766 C CB  . ALA A 1 532 ? -36.615 17.244  -32.073 1.00 49.31  ? 2035 ALA A CB  1 
ATOM   3767 N N   . TYR A 1 533 ? -38.197 18.555  -34.332 1.00 52.19  ? 2036 TYR A N   1 
ATOM   3768 C CA  . TYR A 1 533 ? -39.373 18.638  -35.198 1.00 54.23  ? 2036 TYR A CA  1 
ATOM   3769 C C   . TYR A 1 533 ? -39.041 18.696  -36.695 1.00 55.48  ? 2036 TYR A C   1 
ATOM   3770 O O   . TYR A 1 533 ? -39.811 18.201  -37.527 1.00 53.17  ? 2036 TYR A O   1 
ATOM   3771 C CB  . TYR A 1 533 ? -40.238 19.853  -34.810 1.00 52.21  ? 2036 TYR A CB  1 
ATOM   3772 C CG  . TYR A 1 533 ? -41.224 19.572  -33.699 1.00 50.40  ? 2036 TYR A CG  1 
ATOM   3773 C CD1 . TYR A 1 533 ? -42.097 18.474  -33.780 1.00 49.91  ? 2036 TYR A CD1 1 
ATOM   3774 C CD2 . TYR A 1 533 ? -41.296 20.393  -32.565 1.00 48.26  ? 2036 TYR A CD2 1 
ATOM   3775 C CE1 . TYR A 1 533 ? -43.015 18.198  -32.763 1.00 46.93  ? 2036 TYR A CE1 1 
ATOM   3776 C CE2 . TYR A 1 533 ? -42.210 20.117  -31.546 1.00 48.47  ? 2036 TYR A CE2 1 
ATOM   3777 C CZ  . TYR A 1 533 ? -43.062 19.016  -31.656 1.00 46.55  ? 2036 TYR A CZ  1 
ATOM   3778 O OH  . TYR A 1 533 ? -43.925 18.716  -30.637 1.00 47.89  ? 2036 TYR A OH  1 
ATOM   3779 N N   . ILE A 1 534 ? -37.900 19.308  -37.025 1.00 57.84  ? 2037 ILE A N   1 
ATOM   3780 C CA  . ILE A 1 534 ? -37.470 19.436  -38.414 1.00 59.15  ? 2037 ILE A CA  1 
ATOM   3781 C C   . ILE A 1 534 ? -36.882 18.133  -38.930 1.00 60.98  ? 2037 ILE A C   1 
ATOM   3782 O O   . ILE A 1 534 ? -37.089 17.774  -40.093 1.00 60.79  ? 2037 ILE A O   1 
ATOM   3783 C CB  . ILE A 1 534 ? -36.416 20.555  -38.582 1.00 59.29  ? 2037 ILE A CB  1 
ATOM   3784 C CG1 . ILE A 1 534 ? -37.052 21.930  -38.333 1.00 59.04  ? 2037 ILE A CG1 1 
ATOM   3785 C CG2 . ILE A 1 534 ? -35.828 20.503  -39.985 1.00 59.24  ? 2037 ILE A CG2 1 
ATOM   3786 C CD1 . ILE A 1 534 ? -36.085 23.099  -38.497 1.00 56.30  ? 2037 ILE A CD1 1 
ATOM   3787 N N   . SER A 1 535 ? -36.147 17.432  -38.064 1.00 62.14  ? 2038 SER A N   1 
ATOM   3788 C CA  . SER A 1 535 ? -35.542 16.155  -38.429 1.00 64.31  ? 2038 SER A CA  1 
ATOM   3789 C C   . SER A 1 535 ? -36.634 15.089  -38.479 1.00 65.29  ? 2038 SER A C   1 
ATOM   3790 O O   . SER A 1 535 ? -36.435 13.989  -38.999 1.00 66.17  ? 2038 SER A O   1 
ATOM   3791 C CB  . SER A 1 535 ? -34.471 15.761  -37.411 1.00 64.44  ? 2038 SER A CB  1 
ATOM   3792 O OG  . SER A 1 535 ? -35.035 15.611  -36.122 1.00 66.08  ? 2038 SER A OG  1 
ATOM   3793 N N   . MET A 1 536 ? -37.794 15.430  -37.930 1.00 66.28  ? 2039 MET A N   1 
ATOM   3794 C CA  . MET A 1 536 ? -38.931 14.530  -37.929 1.00 67.51  ? 2039 MET A CA  1 
ATOM   3795 C C   . MET A 1 536 ? -39.687 14.641  -39.243 1.00 68.22  ? 2039 MET A C   1 
ATOM   3796 O O   . MET A 1 536 ? -40.200 13.642  -39.758 1.00 67.82  ? 2039 MET A O   1 
ATOM   3797 C CB  . MET A 1 536 ? -39.865 14.861  -36.767 1.00 68.62  ? 2039 MET A CB  1 
ATOM   3798 C CG  . MET A 1 536 ? -39.517 14.152  -35.475 1.00 70.20  ? 2039 MET A CG  1 
ATOM   3799 S SD  . MET A 1 536 ? -39.633 12.372  -35.673 1.00 71.31  ? 2039 MET A SD  1 
ATOM   3800 C CE  . MET A 1 536 ? -37.900 11.960  -36.023 1.00 71.63  ? 2039 MET A CE  1 
ATOM   3801 N N   . ILE A 1 537 ? -39.776 15.858  -39.774 1.00 68.91  ? 2040 ILE A N   1 
ATOM   3802 C CA  . ILE A 1 537 ? -40.462 16.070  -41.044 1.00 70.48  ? 2040 ILE A CA  1 
ATOM   3803 C C   . ILE A 1 537 ? -39.623 15.396  -42.141 1.00 73.47  ? 2040 ILE A C   1 
ATOM   3804 O O   . ILE A 1 537 ? -40.164 14.799  -43.082 1.00 74.10  ? 2040 ILE A O   1 
ATOM   3805 C CB  . ILE A 1 537 ? -40.613 17.572  -41.360 1.00 68.56  ? 2040 ILE A CB  1 
ATOM   3806 C CG1 . ILE A 1 537 ? -41.286 18.291  -40.192 1.00 66.37  ? 2040 ILE A CG1 1 
ATOM   3807 C CG2 . ILE A 1 537 ? -41.460 17.748  -42.611 1.00 68.98  ? 2040 ILE A CG2 1 
ATOM   3808 C CD1 . ILE A 1 537 ? -41.289 19.792  -40.320 1.00 62.74  ? 2040 ILE A CD1 1 
ATOM   3809 N N   . VAL A 1 538 ? -38.300 15.497  -42.002 1.00 75.30  ? 2041 VAL A N   1 
ATOM   3810 C CA  . VAL A 1 538 ? -37.363 14.880  -42.935 1.00 77.26  ? 2041 VAL A CA  1 
ATOM   3811 C C   . VAL A 1 538 ? -37.715 13.403  -43.049 1.00 79.49  ? 2041 VAL A C   1 
ATOM   3812 O O   . VAL A 1 538 ? -37.844 12.860  -44.148 1.00 79.12  ? 2041 VAL A O   1 
ATOM   3813 C CB  . VAL A 1 538 ? -35.911 14.992  -42.416 1.00 76.97  ? 2041 VAL A CB  1 
ATOM   3814 C CG1 . VAL A 1 538 ? -35.050 13.877  -42.998 1.00 75.85  ? 2041 VAL A CG1 1 
ATOM   3815 C CG2 . VAL A 1 538 ? -35.337 16.347  -42.786 1.00 76.44  ? 2041 VAL A CG2 1 
ATOM   3816 N N   . LYS A 1 539 ? -37.853 12.761  -41.893 1.00 81.95  ? 2042 LYS A N   1 
ATOM   3817 C CA  . LYS A 1 539 ? -38.201 11.355  -41.837 1.00 84.65  ? 2042 LYS A CA  1 
ATOM   3818 C C   . LYS A 1 539 ? -39.433 11.102  -42.700 1.00 87.03  ? 2042 LYS A C   1 
ATOM   3819 O O   . LYS A 1 539 ? -39.321 10.480  -43.740 1.00 87.73  ? 2042 LYS A O   1 
ATOM   3820 C CB  . LYS A 1 539 ? -38.481 10.938  -40.395 1.00 83.97  ? 2042 LYS A CB  1 
ATOM   3821 N N   . LYS A 1 540 ? -40.595 11.597  -42.276 1.00 89.23  ? 2043 LYS A N   1 
ATOM   3822 C CA  . LYS A 1 540 ? -41.867 11.423  -42.993 1.00 91.93  ? 2043 LYS A CA  1 
ATOM   3823 C C   . LYS A 1 540 ? -41.802 11.315  -44.526 1.00 93.85  ? 2043 LYS A C   1 
ATOM   3824 O O   . LYS A 1 540 ? -42.329 10.363  -45.111 1.00 94.04  ? 2043 LYS A O   1 
ATOM   3825 C CB  . LYS A 1 540 ? -42.832 12.562  -42.635 1.00 91.52  ? 2043 LYS A CB  1 
ATOM   3826 C CG  . LYS A 1 540 ? -44.222 12.415  -43.261 1.00 91.21  ? 2043 LYS A CG  1 
ATOM   3827 C CD  . LYS A 1 540 ? -45.079 13.666  -43.100 1.00 91.09  ? 2043 LYS A CD  1 
ATOM   3828 C CE  . LYS A 1 540 ? -44.582 14.809  -43.978 1.00 91.54  ? 2043 LYS A CE  1 
ATOM   3829 N NZ  . LYS A 1 540 ? -45.458 16.001  -43.880 1.00 90.71  ? 2043 LYS A NZ  1 
ATOM   3830 N N   . ARG A 1 541 ? -41.186 12.308  -45.167 1.00 95.86  ? 2044 ARG A N   1 
ATOM   3831 C CA  . ARG A 1 541 ? -41.062 12.335  -46.624 1.00 97.35  ? 2044 ARG A CA  1 
ATOM   3832 C C   . ARG A 1 541 ? -40.170 11.200  -47.131 1.00 98.69  ? 2044 ARG A C   1 
ATOM   3833 O O   . ARG A 1 541 ? -40.610 10.342  -47.901 1.00 98.64  ? 2044 ARG A O   1 
ATOM   3834 C CB  . ARG A 1 541 ? -40.493 13.684  -47.078 1.00 96.44  ? 2044 ARG A CB  1 
ATOM   3835 N N   . TYR A 1 542 ? -38.916 11.201  -46.682 1.00 100.46 ? 2045 TYR A N   1 
ATOM   3836 C CA  . TYR A 1 542 ? -37.941 10.184  -47.072 1.00 102.03 ? 2045 TYR A CA  1 
ATOM   3837 C C   . TYR A 1 542 ? -38.197 8.817   -46.419 1.00 103.60 ? 2045 TYR A C   1 
ATOM   3838 O O   . TYR A 1 542 ? -37.399 7.891   -46.574 1.00 103.91 ? 2045 TYR A O   1 
ATOM   3839 C CB  . TYR A 1 542 ? -36.527 10.660  -46.727 1.00 100.91 ? 2045 TYR A CB  1 
ATOM   3840 N N   . SER A 1 543 ? -39.307 8.693   -45.693 1.00 105.17 ? 2046 SER A N   1 
ATOM   3841 C CA  . SER A 1 543 ? -39.650 7.434   -45.026 1.00 106.13 ? 2046 SER A CA  1 
ATOM   3842 C C   . SER A 1 543 ? -40.921 6.821   -45.608 1.00 106.82 ? 2046 SER A C   1 
ATOM   3843 O O   . SER A 1 543 ? -41.231 5.656   -45.353 1.00 106.78 ? 2046 SER A O   1 
ATOM   3844 C CB  . SER A 1 543 ? -39.830 7.654   -43.520 1.00 105.70 ? 2046 SER A CB  1 
ATOM   3845 N N   . THR A 1 544 ? -41.662 7.612   -46.379 1.00 107.76 ? 2047 THR A N   1 
ATOM   3846 C CA  . THR A 1 544 ? -42.891 7.130   -47.003 1.00 108.52 ? 2047 THR A CA  1 
ATOM   3847 C C   . THR A 1 544 ? -42.569 6.444   -48.330 1.00 109.33 ? 2047 THR A C   1 
ATOM   3848 O O   . THR A 1 544 ? -43.430 5.797   -48.933 1.00 109.89 ? 2047 THR A O   1 
ATOM   3849 C CB  . THR A 1 544 ? -43.904 8.284   -47.255 1.00 107.94 ? 2047 THR A CB  1 
ATOM   3850 O OG1 . THR A 1 544 ? -43.196 9.476   -47.617 1.00 107.05 ? 2047 THR A OG1 1 
ATOM   3851 C CG2 . THR A 1 544 ? -44.747 8.543   -46.012 1.00 107.03 ? 2047 THR A CG2 1 
ATOM   3852 N N   . THR A 1 545 ? -41.321 6.586   -48.774 1.00 109.41 ? 2048 THR A N   1 
ATOM   3853 C CA  . THR A 1 545 ? -40.874 5.975   -50.024 1.00 109.50 ? 2048 THR A CA  1 
ATOM   3854 C C   . THR A 1 545 ? -41.766 6.376   -51.200 1.00 109.69 ? 2048 THR A C   1 
ATOM   3855 O O   . THR A 1 545 ? -42.754 5.653   -51.456 1.00 109.55 ? 2048 THR A O   1 
ATOM   3856 C CB  . THR A 1 545 ? -40.857 4.434   -49.910 1.00 109.04 ? 2048 THR A CB  1 
ATOM   3857 N N   . ILE B 1 19  ? -49.600 -8.132  -55.168 1.00 69.05  ? 1502 ILE B N   1 
ATOM   3858 C CA  . ILE B 1 19  ? -49.878 -9.171  -54.124 1.00 69.16  ? 1502 ILE B CA  1 
ATOM   3859 C C   . ILE B 1 19  ? -49.221 -10.492 -54.535 1.00 68.28  ? 1502 ILE B C   1 
ATOM   3860 O O   . ILE B 1 19  ? -48.072 -10.751 -54.184 1.00 68.43  ? 1502 ILE B O   1 
ATOM   3861 C CB  . ILE B 1 19  ? -51.407 -9.406  -53.945 1.00 69.43  ? 1502 ILE B CB  1 
ATOM   3862 C CG1 . ILE B 1 19  ? -52.130 -8.071  -53.727 1.00 69.32  ? 1502 ILE B CG1 1 
ATOM   3863 C CG2 . ILE B 1 19  ? -51.654 -10.335 -52.754 1.00 68.83  ? 1502 ILE B CG2 1 
ATOM   3864 C CD1 . ILE B 1 19  ? -53.657 -8.201  -53.629 1.00 68.95  ? 1502 ILE B CD1 1 
ATOM   3865 N N   . ASP B 1 20  ? -49.959 -11.321 -55.275 1.00 67.52  ? 1503 ASP B N   1 
ATOM   3866 C CA  . ASP B 1 20  ? -49.447 -12.605 -55.757 1.00 66.21  ? 1503 ASP B CA  1 
ATOM   3867 C C   . ASP B 1 20  ? -49.467 -12.641 -57.295 1.00 63.71  ? 1503 ASP B C   1 
ATOM   3868 O O   . ASP B 1 20  ? -49.325 -11.604 -57.949 1.00 64.37  ? 1503 ASP B O   1 
ATOM   3869 C CB  . ASP B 1 20  ? -50.263 -13.773 -55.164 1.00 68.06  ? 1503 ASP B CB  1 
ATOM   3870 C CG  . ASP B 1 20  ? -51.708 -13.796 -55.645 1.00 70.99  ? 1503 ASP B CG  1 
ATOM   3871 O OD1 . ASP B 1 20  ? -52.352 -12.723 -55.663 1.00 73.64  ? 1503 ASP B OD1 1 
ATOM   3872 O OD2 . ASP B 1 20  ? -52.208 -14.890 -55.993 1.00 71.86  ? 1503 ASP B OD2 1 
ATOM   3873 N N   . THR B 1 21  ? -49.632 -13.826 -57.869 1.00 59.71  ? 1504 THR B N   1 
ATOM   3874 C CA  . THR B 1 21  ? -49.658 -13.973 -59.320 1.00 55.03  ? 1504 THR B CA  1 
ATOM   3875 C C   . THR B 1 21  ? -50.116 -15.400 -59.643 1.00 52.25  ? 1504 THR B C   1 
ATOM   3876 O O   . THR B 1 21  ? -50.032 -16.289 -58.800 1.00 52.15  ? 1504 THR B O   1 
ATOM   3877 C CB  . THR B 1 21  ? -48.245 -13.671 -59.922 1.00 54.78  ? 1504 THR B CB  1 
ATOM   3878 O OG1 . THR B 1 21  ? -48.386 -13.295 -61.294 1.00 54.88  ? 1504 THR B OG1 1 
ATOM   3879 C CG2 . THR B 1 21  ? -47.324 -14.884 -59.817 1.00 51.65  ? 1504 THR B CG2 1 
ATOM   3880 N N   . PRO B 1 22  ? -50.624 -15.636 -60.859 1.00 49.66  ? 1505 PRO B N   1 
ATOM   3881 C CA  . PRO B 1 22  ? -51.085 -16.981 -61.219 1.00 48.28  ? 1505 PRO B CA  1 
ATOM   3882 C C   . PRO B 1 22  ? -50.072 -18.105 -60.969 1.00 47.63  ? 1505 PRO B C   1 
ATOM   3883 O O   . PRO B 1 22  ? -50.398 -19.119 -60.341 1.00 46.86  ? 1505 PRO B O   1 
ATOM   3884 C CB  . PRO B 1 22  ? -51.459 -16.828 -62.693 1.00 46.95  ? 1505 PRO B CB  1 
ATOM   3885 C CG  . PRO B 1 22  ? -51.978 -15.437 -62.743 1.00 47.06  ? 1505 PRO B CG  1 
ATOM   3886 C CD  . PRO B 1 22  ? -50.940 -14.674 -61.928 1.00 48.99  ? 1505 PRO B CD  1 
ATOM   3887 N N   . THR B 1 23  ? -48.851 -17.923 -61.474 1.00 47.47  ? 1506 THR B N   1 
ATOM   3888 C CA  . THR B 1 23  ? -47.772 -18.906 -61.305 1.00 45.56  ? 1506 THR B CA  1 
ATOM   3889 C C   . THR B 1 23  ? -47.470 -19.069 -59.822 1.00 44.81  ? 1506 THR B C   1 
ATOM   3890 O O   . THR B 1 23  ? -47.225 -20.178 -59.349 1.00 43.03  ? 1506 THR B O   1 
ATOM   3891 C CB  . THR B 1 23  ? -46.476 -18.470 -62.065 1.00 44.57  ? 1506 THR B CB  1 
ATOM   3892 O OG1 . THR B 1 23  ? -46.717 -18.515 -63.476 1.00 44.32  ? 1506 THR B OG1 1 
ATOM   3893 C CG2 . THR B 1 23  ? -45.304 -19.393 -61.739 1.00 42.91  ? 1506 THR B CG2 1 
ATOM   3894 N N   . GLN B 1 24  ? -47.501 -17.958 -59.090 1.00 45.78  ? 1507 GLN B N   1 
ATOM   3895 C CA  . GLN B 1 24  ? -47.257 -17.985 -57.648 1.00 47.65  ? 1507 GLN B CA  1 
ATOM   3896 C C   . GLN B 1 24  ? -48.226 -18.916 -56.913 1.00 48.14  ? 1507 GLN B C   1 
ATOM   3897 O O   . GLN B 1 24  ? -47.790 -19.765 -56.136 1.00 50.17  ? 1507 GLN B O   1 
ATOM   3898 C CB  . GLN B 1 24  ? -47.380 -16.590 -57.072 1.00 48.23  ? 1507 GLN B CB  1 
ATOM   3899 C CG  . GLN B 1 24  ? -46.881 -16.501 -55.675 1.00 50.83  ? 1507 GLN B CG  1 
ATOM   3900 C CD  . GLN B 1 24  ? -46.288 -15.146 -55.385 1.00 53.38  ? 1507 GLN B CD  1 
ATOM   3901 O OE1 . GLN B 1 24  ? -45.586 -14.960 -54.387 1.00 52.67  ? 1507 GLN B OE1 1 
ATOM   3902 N NE2 . GLN B 1 24  ? -46.569 -14.178 -56.265 1.00 54.11  ? 1507 GLN B NE2 1 
ATOM   3903 N N   . GLN B 1 25  ? -49.531 -18.750 -57.143 1.00 46.70  ? 1508 GLN B N   1 
ATOM   3904 C CA  . GLN B 1 25  ? -50.531 -19.603 -56.516 0.50 47.38  ? 1508 GLN B CA  1 
ATOM   3905 C C   . GLN B 1 25  ? -50.498 -21.017 -57.092 1.00 48.18  ? 1508 GLN B C   1 
ATOM   3906 O O   . GLN B 1 25  ? -50.700 -21.999 -56.363 1.00 48.41  ? 1508 GLN B O   1 
ATOM   3907 C CB  . GLN B 1 25  ? -51.929 -19.011 -56.696 0.50 47.91  ? 1508 GLN B CB  1 
ATOM   3908 C CG  . GLN B 1 25  ? -53.042 -20.042 -56.597 0.50 48.73  ? 1508 GLN B CG  1 
ATOM   3909 C CD  . GLN B 1 25  ? -54.339 -19.460 -56.105 0.50 50.42  ? 1508 GLN B CD  1 
ATOM   3910 O OE1 . GLN B 1 25  ? -55.390 -20.101 -56.180 0.50 52.21  ? 1508 GLN B OE1 1 
ATOM   3911 N NE2 . GLN B 1 25  ? -54.281 -18.239 -55.588 0.50 50.39  ? 1508 GLN B NE2 1 
ATOM   3912 N N   . LEU B 1 26  ? -50.258 -21.127 -58.396 1.00 48.25  ? 1509 LEU B N   1 
ATOM   3913 C CA  . LEU B 1 26  ? -50.192 -22.438 -59.039 1.00 49.52  ? 1509 LEU B CA  1 
ATOM   3914 C C   . LEU B 1 26  ? -49.003 -23.271 -58.527 1.00 50.56  ? 1509 LEU B C   1 
ATOM   3915 O O   . LEU B 1 26  ? -49.125 -24.491 -58.363 1.00 50.31  ? 1509 LEU B O   1 
ATOM   3916 C CB  . LEU B 1 26  ? -50.129 -22.282 -60.566 1.00 48.73  ? 1509 LEU B CB  1 
ATOM   3917 C CG  . LEU B 1 26  ? -51.485 -22.034 -61.237 1.00 48.18  ? 1509 LEU B CG  1 
ATOM   3918 C CD1 . LEU B 1 26  ? -51.301 -21.716 -62.713 1.00 48.25  ? 1509 LEU B CD1 1 
ATOM   3919 C CD2 . LEU B 1 26  ? -52.354 -23.259 -61.072 1.00 45.76  ? 1509 LEU B CD2 1 
ATOM   3920 N N   . ILE B 1 27  ? -47.859 -22.620 -58.283 1.00 50.50  ? 1510 ILE B N   1 
ATOM   3921 C CA  . ILE B 1 27  ? -46.690 -23.322 -57.759 1.00 50.71  ? 1510 ILE B CA  1 
ATOM   3922 C C   . ILE B 1 27  ? -47.085 -23.835 -56.382 1.00 52.78  ? 1510 ILE B C   1 
ATOM   3923 O O   . ILE B 1 27  ? -46.772 -24.969 -56.011 1.00 52.03  ? 1510 ILE B O   1 
ATOM   3924 C CB  . ILE B 1 27  ? -45.457 -22.392 -57.625 1.00 48.84  ? 1510 ILE B CB  1 
ATOM   3925 C CG1 . ILE B 1 27  ? -44.816 -22.161 -59.003 1.00 47.10  ? 1510 ILE B CG1 1 
ATOM   3926 C CG2 . ILE B 1 27  ? -44.443 -23.008 -56.677 1.00 46.48  ? 1510 ILE B CG2 1 
ATOM   3927 C CD1 . ILE B 1 27  ? -43.682 -21.154 -59.008 1.00 44.10  ? 1510 ILE B CD1 1 
ATOM   3928 N N   . GLN B 1 28  ? -47.788 -22.994 -55.632 1.00 54.74  ? 1511 GLN B N   1 
ATOM   3929 C CA  . GLN B 1 28  ? -48.262 -23.382 -54.312 1.00 58.05  ? 1511 GLN B CA  1 
ATOM   3930 C C   . GLN B 1 28  ? -49.167 -24.614 -54.439 1.00 59.78  ? 1511 GLN B C   1 
ATOM   3931 O O   . GLN B 1 28  ? -49.048 -25.568 -53.659 1.00 58.94  ? 1511 GLN B O   1 
ATOM   3932 C CB  . GLN B 1 28  ? -49.037 -22.234 -53.672 1.00 58.81  ? 1511 GLN B CB  1 
ATOM   3933 C CG  . GLN B 1 28  ? -49.541 -22.558 -52.287 1.00 62.12  ? 1511 GLN B CG  1 
ATOM   3934 C CD  . GLN B 1 28  ? -48.440 -23.079 -51.389 1.00 64.57  ? 1511 GLN B CD  1 
ATOM   3935 O OE1 . GLN B 1 28  ? -47.420 -22.413 -51.193 1.00 65.85  ? 1511 GLN B OE1 1 
ATOM   3936 N NE2 . GLN B 1 28  ? -48.636 -24.279 -50.837 1.00 65.25  ? 1511 GLN B NE2 1 
ATOM   3937 N N   . ASP B 1 29  ? -50.068 -24.589 -55.425 1.00 61.90  ? 1512 ASP B N   1 
ATOM   3938 C CA  . ASP B 1 29  ? -50.975 -25.713 -55.654 1.00 64.92  ? 1512 ASP B CA  1 
ATOM   3939 C C   . ASP B 1 29  ? -50.191 -27.011 -55.892 1.00 66.27  ? 1512 ASP B C   1 
ATOM   3940 O O   . ASP B 1 29  ? -50.609 -28.084 -55.441 1.00 66.82  ? 1512 ASP B O   1 
ATOM   3941 C CB  . ASP B 1 29  ? -51.909 -25.449 -56.855 1.00 66.13  ? 1512 ASP B CB  1 
ATOM   3942 C CG  . ASP B 1 29  ? -53.070 -24.503 -56.519 1.00 68.09  ? 1512 ASP B CG  1 
ATOM   3943 O OD1 . ASP B 1 29  ? -53.580 -24.545 -55.374 1.00 69.08  ? 1512 ASP B OD1 1 
ATOM   3944 O OD2 . ASP B 1 29  ? -53.490 -23.728 -57.408 1.00 67.23  ? 1512 ASP B OD2 1 
ATOM   3945 N N   . ILE B 1 30  ? -49.061 -26.914 -56.598 1.00 66.93  ? 1513 ILE B N   1 
ATOM   3946 C CA  . ILE B 1 30  ? -48.230 -28.082 -56.881 1.00 66.46  ? 1513 ILE B CA  1 
ATOM   3947 C C   . ILE B 1 30  ? -47.422 -28.478 -55.650 1.00 67.22  ? 1513 ILE B C   1 
ATOM   3948 O O   . ILE B 1 30  ? -47.038 -29.633 -55.503 1.00 67.00  ? 1513 ILE B O   1 
ATOM   3949 C CB  . ILE B 1 30  ? -47.263 -27.821 -58.058 1.00 65.79  ? 1513 ILE B CB  1 
ATOM   3950 C CG1 . ILE B 1 30  ? -48.059 -27.582 -59.343 1.00 65.37  ? 1513 ILE B CG1 1 
ATOM   3951 C CG2 . ILE B 1 30  ? -46.325 -29.010 -58.245 1.00 64.57  ? 1513 ILE B CG2 1 
ATOM   3952 C CD1 . ILE B 1 30  ? -47.197 -27.289 -60.555 1.00 63.13  ? 1513 ILE B CD1 1 
ATOM   3953 N N   . LYS B 1 31  ? -47.166 -27.518 -54.766 1.00 68.68  ? 1514 LYS B N   1 
ATOM   3954 C CA  . LYS B 1 31  ? -46.419 -27.793 -53.546 1.00 69.91  ? 1514 LYS B CA  1 
ATOM   3955 C C   . LYS B 1 31  ? -47.235 -28.723 -52.664 1.00 71.04  ? 1514 LYS B C   1 
ATOM   3956 O O   . LYS B 1 31  ? -46.725 -29.724 -52.164 1.00 71.45  ? 1514 LYS B O   1 
ATOM   3957 C CB  . LYS B 1 31  ? -46.147 -26.500 -52.779 1.00 70.86  ? 1514 LYS B CB  1 
ATOM   3958 C CG  . LYS B 1 31  ? -45.401 -26.722 -51.469 1.00 72.40  ? 1514 LYS B CG  1 
ATOM   3959 C CD  . LYS B 1 31  ? -45.575 -25.560 -50.496 1.00 72.65  ? 1514 LYS B CD  1 
ATOM   3960 C CE  . LYS B 1 31  ? -44.958 -25.893 -49.139 1.00 73.09  ? 1514 LYS B CE  1 
ATOM   3961 N NZ  . LYS B 1 31  ? -45.175 -24.815 -48.127 1.00 74.05  ? 1514 LYS B NZ  1 
ATOM   3962 N N   . GLU B 1 32  ? -48.508 -28.378 -52.483 1.00 72.36  ? 1515 GLU B N   1 
ATOM   3963 C CA  . GLU B 1 32  ? -49.429 -29.153 -51.656 1.00 72.91  ? 1515 GLU B CA  1 
ATOM   3964 C C   . GLU B 1 32  ? -49.907 -30.435 -52.344 1.00 73.55  ? 1515 GLU B C   1 
ATOM   3965 O O   . GLU B 1 32  ? -50.868 -31.062 -51.895 1.00 74.10  ? 1515 GLU B O   1 
ATOM   3966 C CB  . GLU B 1 32  ? -50.654 -28.304 -51.300 1.00 72.64  ? 1515 GLU B CB  1 
ATOM   3967 C CG  . GLU B 1 32  ? -50.345 -26.881 -50.851 1.00 73.84  ? 1515 GLU B CG  1 
ATOM   3968 C CD  . GLU B 1 32  ? -51.610 -26.075 -50.542 1.00 73.62  ? 1515 GLU B CD  1 
ATOM   3969 O OE1 . GLU B 1 32  ? -52.309 -26.429 -49.571 1.00 72.95  ? 1515 GLU B OE1 1 
ATOM   3970 O OE2 . GLU B 1 32  ? -51.909 -25.096 -51.270 1.00 72.28  ? 1515 GLU B OE2 1 
ATOM   3971 N N   . ASN B 1 33  ? -49.253 -30.830 -53.430 1.00 73.27  ? 1516 ASN B N   1 
ATOM   3972 C CA  . ASN B 1 33  ? -49.664 -32.039 -54.143 1.00 74.39  ? 1516 ASN B CA  1 
ATOM   3973 C C   . ASN B 1 33  ? -48.483 -32.737 -54.799 1.00 75.31  ? 1516 ASN B C   1 
ATOM   3974 O O   . ASN B 1 33  ? -48.653 -33.595 -55.667 1.00 74.48  ? 1516 ASN B O   1 
ATOM   3975 C CB  . ASN B 1 33  ? -50.708 -31.691 -55.205 1.00 74.25  ? 1516 ASN B CB  1 
ATOM   3976 C CG  . ASN B 1 33  ? -52.025 -31.259 -54.605 1.00 74.12  ? 1516 ASN B CG  1 
ATOM   3977 O OD1 . ASN B 1 33  ? -52.913 -32.075 -54.377 1.00 73.85  ? 1516 ASN B OD1 1 
ATOM   3978 N ND2 . ASN B 1 33  ? -52.154 -29.967 -54.331 1.00 74.77  ? 1516 ASN B ND2 1 
ATOM   3979 N N   . CYS B 1 34  ? -47.284 -32.359 -54.367 1.00 77.31  ? 1517 CYS B N   1 
ATOM   3980 C CA  . CYS B 1 34  ? -46.041 -32.920 -54.891 1.00 78.10  ? 1517 CYS B CA  1 
ATOM   3981 C C   . CYS B 1 34  ? -46.023 -34.440 -54.842 1.00 78.35  ? 1517 CYS B C   1 
ATOM   3982 O O   . CYS B 1 34  ? -45.517 -35.100 -55.751 1.00 77.55  ? 1517 CYS B O   1 
ATOM   3983 C CB  . CYS B 1 34  ? -44.858 -32.361 -54.098 1.00 78.18  ? 1517 CYS B CB  1 
ATOM   3984 S SG  . CYS B 1 34  ? -45.194 -32.127 -52.339 1.00 80.48  ? 1517 CYS B SG  1 
ATOM   3985 N N   . LEU B 1 35  ? -46.583 -34.989 -53.772 1.00 79.40  ? 1518 LEU B N   1 
ATOM   3986 C CA  . LEU B 1 35  ? -46.636 -36.432 -53.584 1.00 79.97  ? 1518 LEU B CA  1 
ATOM   3987 C C   . LEU B 1 35  ? -47.410 -37.118 -54.714 1.00 80.00  ? 1518 LEU B C   1 
ATOM   3988 O O   . LEU B 1 35  ? -46.986 -38.149 -55.228 1.00 80.46  ? 1518 LEU B O   1 
ATOM   3989 C CB  . LEU B 1 35  ? -47.289 -36.752 -52.234 1.00 79.79  ? 1518 LEU B CB  1 
ATOM   3990 C CG  . LEU B 1 35  ? -46.848 -35.949 -50.998 1.00 80.06  ? 1518 LEU B CG  1 
ATOM   3991 C CD1 . LEU B 1 35  ? -45.321 -35.915 -50.915 1.00 79.30  ? 1518 LEU B CD1 1 
ATOM   3992 C CD2 . LEU B 1 35  ? -47.422 -34.531 -51.064 1.00 79.39  ? 1518 LEU B CD2 1 
ATOM   3993 N N   . ASN B 1 36  ? -48.542 -36.541 -55.101 1.00 79.99  ? 1519 ASN B N   1 
ATOM   3994 C CA  . ASN B 1 36  ? -49.359 -37.115 -56.164 1.00 80.10  ? 1519 ASN B CA  1 
ATOM   3995 C C   . ASN B 1 36  ? -48.917 -36.616 -57.537 1.00 79.96  ? 1519 ASN B C   1 
ATOM   3996 O O   . ASN B 1 36  ? -48.722 -35.417 -57.736 1.00 80.56  ? 1519 ASN B O   1 
ATOM   3997 C CB  . ASN B 1 36  ? -50.832 -36.776 -55.930 1.00 80.25  ? 1519 ASN B CB  1 
ATOM   3998 C CG  . ASN B 1 36  ? -51.743 -37.439 -56.936 1.00 80.84  ? 1519 ASN B CG  1 
ATOM   3999 O OD1 . ASN B 1 36  ? -51.711 -37.119 -58.120 1.00 80.93  ? 1519 ASN B OD1 1 
ATOM   4000 N ND2 . ASN B 1 36  ? -52.559 -38.377 -56.470 1.00 82.14  ? 1519 ASN B ND2 1 
ATOM   4001 N N   . SER B 1 37  ? -48.770 -37.539 -58.483 1.00 79.68  ? 1520 SER B N   1 
ATOM   4002 C CA  . SER B 1 37  ? -48.332 -37.204 -59.839 1.00 79.49  ? 1520 SER B CA  1 
ATOM   4003 C C   . SER B 1 37  ? -49.438 -36.649 -60.721 1.00 79.31  ? 1520 SER B C   1 
ATOM   4004 O O   . SER B 1 37  ? -49.283 -35.593 -61.336 1.00 79.69  ? 1520 SER B O   1 
ATOM   4005 C CB  . SER B 1 37  ? -47.740 -38.436 -60.517 1.00 78.94  ? 1520 SER B CB  1 
ATOM   4006 O OG  . SER B 1 37  ? -46.757 -39.028 -59.695 1.00 79.45  ? 1520 SER B OG  1 
ATOM   4007 N N   . ASP B 1 38  ? -50.549 -37.370 -60.798 1.00 79.12  ? 1521 ASP B N   1 
ATOM   4008 C CA  . ASP B 1 38  ? -51.671 -36.940 -61.622 1.00 79.25  ? 1521 ASP B CA  1 
ATOM   4009 C C   . ASP B 1 38  ? -52.159 -35.527 -61.301 1.00 78.36  ? 1521 ASP B C   1 
ATOM   4010 O O   . ASP B 1 38  ? -52.479 -34.761 -62.212 1.00 78.35  ? 1521 ASP B O   1 
ATOM   4011 C CB  . ASP B 1 38  ? -52.839 -37.928 -61.500 1.00 81.06  ? 1521 ASP B CB  1 
ATOM   4012 C CG  . ASP B 1 38  ? -52.632 -39.191 -62.327 1.00 82.41  ? 1521 ASP B CG  1 
ATOM   4013 O OD1 . ASP B 1 38  ? -51.861 -40.080 -61.896 1.00 82.78  ? 1521 ASP B OD1 1 
ATOM   4014 O OD2 . ASP B 1 38  ? -53.242 -39.287 -63.418 1.00 82.70  ? 1521 ASP B OD2 1 
ATOM   4015 N N   . VAL B 1 39  ? -52.233 -35.184 -60.018 1.00 77.02  ? 1522 VAL B N   1 
ATOM   4016 C CA  . VAL B 1 39  ? -52.676 -33.848 -59.629 1.00 75.79  ? 1522 VAL B CA  1 
ATOM   4017 C C   . VAL B 1 39  ? -51.783 -32.809 -60.304 1.00 75.36  ? 1522 VAL B C   1 
ATOM   4018 O O   . VAL B 1 39  ? -52.260 -31.962 -61.064 1.00 75.10  ? 1522 VAL B O   1 
ATOM   4019 C CB  . VAL B 1 39  ? -52.620 -33.652 -58.093 1.00 75.85  ? 1522 VAL B CB  1 
ATOM   4020 C CG1 . VAL B 1 39  ? -51.220 -33.934 -57.576 1.00 75.71  ? 1522 VAL B CG1 1 
ATOM   4021 C CG2 . VAL B 1 39  ? -53.034 -32.233 -57.734 1.00 74.93  ? 1522 VAL B CG2 1 
ATOM   4022 N N   . VAL B 1 40  ? -50.484 -32.890 -60.038 1.00 74.21  ? 1523 VAL B N   1 
ATOM   4023 C CA  . VAL B 1 40  ? -49.530 -31.963 -60.621 1.00 73.04  ? 1523 VAL B CA  1 
ATOM   4024 C C   . VAL B 1 40  ? -49.591 -32.012 -62.144 1.00 72.44  ? 1523 VAL B C   1 
ATOM   4025 O O   . VAL B 1 40  ? -49.532 -30.977 -62.806 1.00 71.49  ? 1523 VAL B O   1 
ATOM   4026 C CB  . VAL B 1 40  ? -48.104 -32.288 -60.160 1.00 72.93  ? 1523 VAL B CB  1 
ATOM   4027 C CG1 . VAL B 1 40  ? -47.137 -31.269 -60.723 1.00 73.60  ? 1523 VAL B CG1 1 
ATOM   4028 C CG2 . VAL B 1 40  ? -48.044 -32.301 -58.644 1.00 72.66  ? 1523 VAL B CG2 1 
ATOM   4029 N N   . GLU B 1 41  ? -49.710 -33.217 -62.695 1.00 71.95  ? 1524 GLU B N   1 
ATOM   4030 C CA  . GLU B 1 41  ? -49.790 -33.380 -64.146 1.00 72.24  ? 1524 GLU B CA  1 
ATOM   4031 C C   . GLU B 1 41  ? -51.075 -32.779 -64.710 1.00 71.23  ? 1524 GLU B C   1 
ATOM   4032 O O   . GLU B 1 41  ? -51.193 -32.554 -65.914 1.00 70.77  ? 1524 GLU B O   1 
ATOM   4033 C CB  . GLU B 1 41  ? -49.699 -34.859 -64.529 1.00 72.81  ? 1524 GLU B CB  1 
ATOM   4034 C CG  . GLU B 1 41  ? -48.295 -35.426 -64.418 1.00 75.07  ? 1524 GLU B CG  1 
ATOM   4035 C CD  . GLU B 1 41  ? -47.274 -34.573 -65.158 1.00 75.62  ? 1524 GLU B CD  1 
ATOM   4036 O OE1 . GLU B 1 41  ? -47.454 -34.343 -66.373 1.00 75.31  ? 1524 GLU B OE1 1 
ATOM   4037 O OE2 . GLU B 1 41  ? -46.295 -34.133 -64.521 1.00 75.39  ? 1524 GLU B OE2 1 
ATOM   4038 N N   . GLN B 1 42  ? -52.040 -32.528 -63.831 1.00 70.05  ? 1525 GLN B N   1 
ATOM   4039 C CA  . GLN B 1 42  ? -53.302 -31.929 -64.244 1.00 68.17  ? 1525 GLN B CA  1 
ATOM   4040 C C   . GLN B 1 42  ? -53.126 -30.417 -64.112 1.00 66.15  ? 1525 GLN B C   1 
ATOM   4041 O O   . GLN B 1 42  ? -53.665 -29.647 -64.905 1.00 65.07  ? 1525 GLN B O   1 
ATOM   4042 C CB  . GLN B 1 42  ? -54.453 -32.410 -63.346 1.00 68.27  ? 1525 GLN B CB  1 
ATOM   4043 N N   . ILE B 1 43  ? -52.347 -30.010 -63.112 1.00 63.55  ? 1526 ILE B N   1 
ATOM   4044 C CA  . ILE B 1 43  ? -52.079 -28.604 -62.860 1.00 61.76  ? 1526 ILE B CA  1 
ATOM   4045 C C   . ILE B 1 43  ? -51.219 -27.986 -63.962 1.00 61.91  ? 1526 ILE B C   1 
ATOM   4046 O O   . ILE B 1 43  ? -51.289 -26.783 -64.202 1.00 62.88  ? 1526 ILE B O   1 
ATOM   4047 C CB  . ILE B 1 43  ? -51.376 -28.421 -61.518 1.00 60.26  ? 1526 ILE B CB  1 
ATOM   4048 C CG1 . ILE B 1 43  ? -52.213 -29.070 -60.418 1.00 59.69  ? 1526 ILE B CG1 1 
ATOM   4049 C CG2 . ILE B 1 43  ? -51.181 -26.950 -61.242 1.00 58.93  ? 1526 ILE B CG2 1 
ATOM   4050 C CD1 . ILE B 1 43  ? -51.511 -29.201 -59.088 1.00 60.60  ? 1526 ILE B CD1 1 
ATOM   4051 N N   . TYR B 1 44  ? -50.408 -28.800 -64.632 1.00 61.07  ? 1527 TYR B N   1 
ATOM   4052 C CA  . TYR B 1 44  ? -49.567 -28.293 -65.713 1.00 60.31  ? 1527 TYR B CA  1 
ATOM   4053 C C   . TYR B 1 44  ? -50.383 -28.216 -66.994 1.00 61.45  ? 1527 TYR B C   1 
ATOM   4054 O O   . TYR B 1 44  ? -50.374 -27.201 -67.696 1.00 61.11  ? 1527 TYR B O   1 
ATOM   4055 C CB  . TYR B 1 44  ? -48.337 -29.183 -65.923 1.00 57.85  ? 1527 TYR B CB  1 
ATOM   4056 C CG  . TYR B 1 44  ? -47.214 -28.921 -64.935 1.00 56.99  ? 1527 TYR B CG  1 
ATOM   4057 C CD1 . TYR B 1 44  ? -47.025 -27.649 -64.381 1.00 56.22  ? 1527 TYR B CD1 1 
ATOM   4058 C CD2 . TYR B 1 44  ? -46.308 -29.926 -64.590 1.00 55.78  ? 1527 TYR B CD2 1 
ATOM   4059 C CE1 . TYR B 1 44  ? -45.960 -27.385 -63.514 1.00 54.86  ? 1527 TYR B CE1 1 
ATOM   4060 C CE2 . TYR B 1 44  ? -45.240 -29.669 -63.721 1.00 54.78  ? 1527 TYR B CE2 1 
ATOM   4061 C CZ  . TYR B 1 44  ? -45.070 -28.396 -63.191 1.00 54.39  ? 1527 TYR B CZ  1 
ATOM   4062 O OH  . TYR B 1 44  ? -44.003 -28.127 -62.360 1.00 52.07  ? 1527 TYR B OH  1 
ATOM   4063 N N   . LYS B 1 45  ? -51.096 -29.296 -67.292 1.00 63.26  ? 1528 LYS B N   1 
ATOM   4064 C CA  . LYS B 1 45  ? -51.942 -29.349 -68.474 1.00 64.51  ? 1528 LYS B CA  1 
ATOM   4065 C C   . LYS B 1 45  ? -53.033 -28.295 -68.375 1.00 64.90  ? 1528 LYS B C   1 
ATOM   4066 O O   . LYS B 1 45  ? -53.295 -27.561 -69.324 1.00 66.50  ? 1528 LYS B O   1 
ATOM   4067 C CB  . LYS B 1 45  ? -52.597 -30.723 -68.599 1.00 66.03  ? 1528 LYS B CB  1 
ATOM   4068 C CG  . LYS B 1 45  ? -53.640 -30.807 -69.707 1.00 67.71  ? 1528 LYS B CG  1 
ATOM   4069 C CD  . LYS B 1 45  ? -54.384 -32.136 -69.672 1.00 69.19  ? 1528 LYS B CD  1 
ATOM   4070 C CE  . LYS B 1 45  ? -55.398 -32.244 -70.807 1.00 69.30  ? 1528 LYS B CE  1 
ATOM   4071 N NZ  . LYS B 1 45  ? -56.197 -33.497 -70.707 1.00 68.86  ? 1528 LYS B NZ  1 
ATOM   4072 N N   . ARG B 1 46  ? -53.666 -28.229 -67.212 1.00 64.44  ? 1529 ARG B N   1 
ATOM   4073 C CA  . ARG B 1 46  ? -54.755 -27.289 -66.979 1.00 63.94  ? 1529 ARG B CA  1 
ATOM   4074 C C   . ARG B 1 46  ? -54.351 -25.830 -67.163 1.00 62.30  ? 1529 ARG B C   1 
ATOM   4075 O O   . ARG B 1 46  ? -55.082 -25.060 -67.786 1.00 62.47  ? 1529 ARG B O   1 
ATOM   4076 C CB  . ARG B 1 46  ? -55.316 -27.485 -65.567 1.00 66.12  ? 1529 ARG B CB  1 
ATOM   4077 C CG  . ARG B 1 46  ? -56.662 -26.822 -65.336 1.00 67.56  ? 1529 ARG B CG  1 
ATOM   4078 C CD  . ARG B 1 46  ? -57.767 -27.590 -66.043 1.00 69.07  ? 1529 ARG B CD  1 
ATOM   4079 N NE  . ARG B 1 46  ? -58.849 -26.701 -66.469 1.00 69.41  ? 1529 ARG B NE  1 
ATOM   4080 C CZ  . ARG B 1 46  ? -59.993 -27.113 -66.999 1.00 68.43  ? 1529 ARG B CZ  1 
ATOM   4081 N NH1 . ARG B 1 46  ? -60.224 -28.410 -67.171 1.00 66.34  ? 1529 ARG B NH1 1 
ATOM   4082 N NH2 . ARG B 1 46  ? -60.895 -26.218 -67.370 1.00 67.65  ? 1529 ARG B NH2 1 
ATOM   4083 N N   . ASN B 1 47  ? -53.195 -25.455 -66.614 1.00 59.94  ? 1530 ASN B N   1 
ATOM   4084 C CA  . ASN B 1 47  ? -52.697 -24.079 -66.698 1.00 56.72  ? 1530 ASN B CA  1 
ATOM   4085 C C   . ASN B 1 47  ? -51.482 -23.908 -67.591 1.00 54.50  ? 1530 ASN B C   1 
ATOM   4086 O O   . ASN B 1 47  ? -50.354 -24.206 -67.193 1.00 54.00  ? 1530 ASN B O   1 
ATOM   4087 C CB  . ASN B 1 47  ? -52.369 -23.578 -65.306 1.00 55.99  ? 1530 ASN B CB  1 
ATOM   4088 C CG  . ASN B 1 47  ? -53.548 -23.667 -64.397 1.00 55.03  ? 1530 ASN B CG  1 
ATOM   4089 O OD1 . ASN B 1 47  ? -54.434 -22.816 -64.433 1.00 55.13  ? 1530 ASN B OD1 1 
ATOM   4090 N ND2 . ASN B 1 47  ? -53.589 -24.715 -63.590 1.00 53.40  ? 1530 ASN B ND2 1 
ATOM   4091 N N   . PRO B 1 48  ? -51.706 -23.400 -68.809 1.00 52.02  ? 1531 PRO B N   1 
ATOM   4092 C CA  . PRO B 1 48  ? -50.705 -23.148 -69.844 1.00 50.31  ? 1531 PRO B CA  1 
ATOM   4093 C C   . PRO B 1 48  ? -49.580 -22.222 -69.407 1.00 48.19  ? 1531 PRO B C   1 
ATOM   4094 O O   . PRO B 1 48  ? -48.443 -22.397 -69.827 1.00 49.15  ? 1531 PRO B O   1 
ATOM   4095 C CB  . PRO B 1 48  ? -51.534 -22.540 -70.965 1.00 51.45  ? 1531 PRO B CB  1 
ATOM   4096 C CG  . PRO B 1 48  ? -52.856 -23.176 -70.773 1.00 50.98  ? 1531 PRO B CG  1 
ATOM   4097 C CD  . PRO B 1 48  ? -53.039 -23.032 -69.304 1.00 50.69  ? 1531 PRO B CD  1 
ATOM   4098 N N   . ILE B 1 49  ? -49.905 -21.233 -68.579 1.00 44.78  ? 1532 ILE B N   1 
ATOM   4099 C CA  . ILE B 1 49  ? -48.918 -20.277 -68.097 1.00 41.85  ? 1532 ILE B CA  1 
ATOM   4100 C C   . ILE B 1 49  ? -47.713 -20.962 -67.422 1.00 41.29  ? 1532 ILE B C   1 
ATOM   4101 O O   . ILE B 1 49  ? -46.634 -20.375 -67.318 1.00 40.09  ? 1532 ILE B O   1 
ATOM   4102 C CB  . ILE B 1 49  ? -49.576 -19.276 -67.102 1.00 40.92  ? 1532 ILE B CB  1 
ATOM   4103 C CG1 . ILE B 1 49  ? -48.612 -18.144 -66.761 1.00 40.28  ? 1532 ILE B CG1 1 
ATOM   4104 C CG2 . ILE B 1 49  ? -49.959 -19.983 -65.825 1.00 41.44  ? 1532 ILE B CG2 1 
ATOM   4105 C CD1 . ILE B 1 49  ? -48.404 -17.162 -67.881 1.00 37.75  ? 1532 ILE B CD1 1 
ATOM   4106 N N   . LEU B 1 50  ? -47.896 -22.208 -66.989 1.00 41.00  ? 1533 LEU B N   1 
ATOM   4107 C CA  . LEU B 1 50  ? -46.845 -22.971 -66.305 1.00 40.92  ? 1533 LEU B CA  1 
ATOM   4108 C C   . LEU B 1 50  ? -45.910 -23.784 -67.203 1.00 40.75  ? 1533 LEU B C   1 
ATOM   4109 O O   . LEU B 1 50  ? -44.927 -24.341 -66.735 1.00 39.91  ? 1533 LEU B O   1 
ATOM   4110 C CB  . LEU B 1 50  ? -47.472 -23.915 -65.271 1.00 39.77  ? 1533 LEU B CB  1 
ATOM   4111 C CG  . LEU B 1 50  ? -48.179 -23.222 -64.111 1.00 39.80  ? 1533 LEU B CG  1 
ATOM   4112 C CD1 . LEU B 1 50  ? -48.931 -24.241 -63.234 1.00 39.62  ? 1533 LEU B CD1 1 
ATOM   4113 C CD2 . LEU B 1 50  ? -47.137 -22.458 -63.321 1.00 39.89  ? 1533 LEU B CD2 1 
ATOM   4114 N N   . ARG B 1 51  ? -46.218 -23.867 -68.486 1.00 41.67  ? 1534 ARG B N   1 
ATOM   4115 C CA  . ARG B 1 51  ? -45.369 -24.627 -69.388 1.00 42.69  ? 1534 ARG B CA  1 
ATOM   4116 C C   . ARG B 1 51  ? -44.962 -23.820 -70.609 1.00 42.93  ? 1534 ARG B C   1 
ATOM   4117 O O   . ARG B 1 51  ? -45.264 -22.627 -70.709 1.00 42.55  ? 1534 ARG B O   1 
ATOM   4118 C CB  . ARG B 1 51  ? -46.067 -25.919 -69.806 1.00 44.13  ? 1534 ARG B CB  1 
ATOM   4119 C CG  . ARG B 1 51  ? -47.540 -25.755 -70.131 1.00 45.38  ? 1534 ARG B CG  1 
ATOM   4120 C CD  . ARG B 1 51  ? -48.270 -27.081 -69.973 1.00 47.16  ? 1534 ARG B CD  1 
ATOM   4121 N NE  . ARG B 1 51  ? -49.688 -26.965 -70.302 1.00 48.74  ? 1534 ARG B NE  1 
ATOM   4122 C CZ  . ARG B 1 51  ? -50.155 -26.772 -71.534 1.00 49.49  ? 1534 ARG B CZ  1 
ATOM   4123 N NH1 . ARG B 1 51  ? -49.316 -26.674 -72.559 1.00 47.83  ? 1534 ARG B NH1 1 
ATOM   4124 N NH2 . ARG B 1 51  ? -51.462 -26.678 -71.740 1.00 50.44  ? 1534 ARG B NH2 1 
ATOM   4125 N N   . TYR B 1 52  ? -44.262 -24.483 -71.521 1.00 42.64  ? 1535 TYR B N   1 
ATOM   4126 C CA  . TYR B 1 52  ? -43.766 -23.858 -72.733 1.00 42.85  ? 1535 TYR B CA  1 
ATOM   4127 C C   . TYR B 1 52  ? -44.877 -23.245 -73.560 1.00 44.26  ? 1535 TYR B C   1 
ATOM   4128 O O   . TYR B 1 52  ? -46.027 -23.655 -73.473 1.00 45.76  ? 1535 TYR B O   1 
ATOM   4129 C CB  . TYR B 1 52  ? -43.021 -24.893 -73.571 1.00 43.08  ? 1535 TYR B CB  1 
ATOM   4130 C CG  . TYR B 1 52  ? -42.537 -24.346 -74.881 1.00 44.60  ? 1535 TYR B CG  1 
ATOM   4131 C CD1 . TYR B 1 52  ? -41.314 -23.672 -74.970 1.00 43.85  ? 1535 TYR B CD1 1 
ATOM   4132 C CD2 . TYR B 1 52  ? -43.342 -24.422 -76.025 1.00 43.78  ? 1535 TYR B CD2 1 
ATOM   4133 C CE1 . TYR B 1 52  ? -40.909 -23.086 -76.160 1.00 45.22  ? 1535 TYR B CE1 1 
ATOM   4134 C CE2 . TYR B 1 52  ? -42.948 -23.838 -77.219 1.00 44.67  ? 1535 TYR B CE2 1 
ATOM   4135 C CZ  . TYR B 1 52  ? -41.732 -23.173 -77.282 1.00 46.18  ? 1535 TYR B CZ  1 
ATOM   4136 O OH  . TYR B 1 52  ? -41.336 -22.592 -78.460 1.00 45.75  ? 1535 TYR B OH  1 
ATOM   4137 N N   . THR B 1 53  ? -44.520 -22.257 -74.369 1.00 46.45  ? 1536 THR B N   1 
ATOM   4138 C CA  . THR B 1 53  ? -45.472 -21.584 -75.243 1.00 47.54  ? 1536 THR B CA  1 
ATOM   4139 C C   . THR B 1 53  ? -44.740 -20.722 -76.277 1.00 48.71  ? 1536 THR B C   1 
ATOM   4140 O O   . THR B 1 53  ? -43.585 -20.331 -76.060 1.00 48.30  ? 1536 THR B O   1 
ATOM   4141 C CB  . THR B 1 53  ? -46.430 -20.687 -74.426 1.00 47.19  ? 1536 THR B CB  1 
ATOM   4142 O OG1 . THR B 1 53  ? -47.347 -20.038 -75.314 1.00 49.29  ? 1536 THR B OG1 1 
ATOM   4143 C CG2 . THR B 1 53  ? -45.660 -19.632 -73.659 1.00 44.41  ? 1536 THR B CG2 1 
ATOM   4144 N N   . HIS B 1 54  ? -45.405 -20.436 -77.399 1.00 49.76  ? 1537 HIS B N   1 
ATOM   4145 C CA  . HIS B 1 54  ? -44.817 -19.586 -78.447 1.00 50.87  ? 1537 HIS B CA  1 
ATOM   4146 C C   . HIS B 1 54  ? -45.439 -18.202 -78.378 1.00 49.71  ? 1537 HIS B C   1 
ATOM   4147 O O   . HIS B 1 54  ? -44.943 -17.260 -78.996 1.00 49.36  ? 1537 HIS B O   1 
ATOM   4148 C CB  . HIS B 1 54  ? -45.028 -20.164 -79.861 1.00 52.32  ? 1537 HIS B CB  1 
ATOM   4149 C CG  . HIS B 1 54  ? -45.993 -21.301 -79.914 1.00 56.11  ? 1537 HIS B CG  1 
ATOM   4150 N ND1 . HIS B 1 54  ? -45.589 -22.614 -80.049 1.00 57.26  ? 1537 HIS B ND1 1 
ATOM   4151 C CD2 . HIS B 1 54  ? -47.343 -21.331 -79.789 1.00 57.74  ? 1537 HIS B CD2 1 
ATOM   4152 C CE1 . HIS B 1 54  ? -46.649 -23.404 -79.999 1.00 58.96  ? 1537 HIS B CE1 1 
ATOM   4153 N NE2 . HIS B 1 54  ? -47.726 -22.651 -79.842 1.00 58.78  ? 1537 HIS B NE2 1 
ATOM   4154 N N   . HIS B 1 55  ? -46.521 -18.081 -77.617 1.00 48.70  ? 1538 HIS B N   1 
ATOM   4155 C CA  . HIS B 1 55  ? -47.204 -16.808 -77.468 1.00 48.86  ? 1538 HIS B CA  1 
ATOM   4156 C C   . HIS B 1 55  ? -46.389 -15.873 -76.587 1.00 46.92  ? 1538 HIS B C   1 
ATOM   4157 O O   . HIS B 1 55  ? -45.621 -16.317 -75.738 1.00 46.01  ? 1538 HIS B O   1 
ATOM   4158 C CB  . HIS B 1 55  ? -48.594 -17.033 -76.873 1.00 52.85  ? 1538 HIS B CB  1 
ATOM   4159 C CG  . HIS B 1 55  ? -49.447 -17.957 -77.690 1.00 57.76  ? 1538 HIS B CG  1 
ATOM   4160 N ND1 . HIS B 1 55  ? -49.963 -17.603 -78.919 1.00 59.21  ? 1538 HIS B ND1 1 
ATOM   4161 C CD2 . HIS B 1 55  ? -49.831 -19.241 -77.478 1.00 59.31  ? 1538 HIS B CD2 1 
ATOM   4162 C CE1 . HIS B 1 55  ? -50.624 -18.628 -79.428 1.00 60.60  ? 1538 HIS B CE1 1 
ATOM   4163 N NE2 . HIS B 1 55  ? -50.560 -19.635 -78.575 1.00 59.93  ? 1538 HIS B NE2 1 
ATOM   4164 N N   . PRO B 1 56  ? -46.550 -14.558 -76.780 1.00 45.78  ? 1539 PRO B N   1 
ATOM   4165 C CA  . PRO B 1 56  ? -45.832 -13.543 -76.013 1.00 46.43  ? 1539 PRO B CA  1 
ATOM   4166 C C   . PRO B 1 56  ? -46.356 -13.352 -74.595 1.00 48.54  ? 1539 PRO B C   1 
ATOM   4167 O O   . PRO B 1 56  ? -47.523 -13.628 -74.303 1.00 50.57  ? 1539 PRO B O   1 
ATOM   4168 C CB  . PRO B 1 56  ? -46.040 -12.296 -76.850 1.00 45.07  ? 1539 PRO B CB  1 
ATOM   4169 C CG  . PRO B 1 56  ? -47.440 -12.478 -77.297 1.00 43.60  ? 1539 PRO B CG  1 
ATOM   4170 C CD  . PRO B 1 56  ? -47.436 -13.916 -77.765 1.00 44.47  ? 1539 PRO B CD  1 
ATOM   4171 N N   . LEU B 1 57  ? -45.478 -12.882 -73.717 1.00 49.56  ? 1540 LEU B N   1 
ATOM   4172 C CA  . LEU B 1 57  ? -45.837 -12.615 -72.337 1.00 49.62  ? 1540 LEU B CA  1 
ATOM   4173 C C   . LEU B 1 57  ? -46.278 -11.158 -72.355 1.00 51.19  ? 1540 LEU B C   1 
ATOM   4174 O O   . LEU B 1 57  ? -45.916 -10.401 -73.260 1.00 51.16  ? 1540 LEU B O   1 
ATOM   4175 C CB  . LEU B 1 57  ? -44.622 -12.793 -71.425 1.00 48.50  ? 1540 LEU B CB  1 
ATOM   4176 C CG  . LEU B 1 57  ? -44.860 -13.395 -70.035 1.00 49.50  ? 1540 LEU B CG  1 
ATOM   4177 C CD1 . LEU B 1 57  ? -45.164 -14.887 -70.155 1.00 47.06  ? 1540 LEU B CD1 1 
ATOM   4178 C CD2 . LEU B 1 57  ? -43.623 -13.178 -69.174 1.00 48.32  ? 1540 LEU B CD2 1 
ATOM   4179 N N   . HIS B 1 58  ? -47.073 -10.761 -71.375 1.00 52.40  ? 1541 HIS B N   1 
ATOM   4180 C CA  . HIS B 1 58  ? -47.553 -9.383  -71.339 1.00 53.63  ? 1541 HIS B CA  1 
ATOM   4181 C C   . HIS B 1 58  ? -47.309 -8.816  -69.964 1.00 53.21  ? 1541 HIS B C   1 
ATOM   4182 O O   . HIS B 1 58  ? -47.332 -7.597  -69.768 1.00 53.08  ? 1541 HIS B O   1 
ATOM   4183 C CB  . HIS B 1 58  ? -49.048 -9.330  -71.650 1.00 55.16  ? 1541 HIS B CB  1 
ATOM   4184 C CG  . HIS B 1 58  ? -49.413 -9.960  -72.956 1.00 56.36  ? 1541 HIS B CG  1 
ATOM   4185 N ND1 . HIS B 1 58  ? -48.960 -9.477  -74.165 1.00 56.40  ? 1541 HIS B ND1 1 
ATOM   4186 C CD2 . HIS B 1 58  ? -50.184 -11.036 -73.242 1.00 57.67  ? 1541 HIS B CD2 1 
ATOM   4187 C CE1 . HIS B 1 58  ? -49.438 -10.229 -75.142 1.00 59.03  ? 1541 HIS B CE1 1 
ATOM   4188 N NE2 . HIS B 1 58  ? -50.184 -11.182 -74.610 1.00 59.58  ? 1541 HIS B NE2 1 
ATOM   4189 N N   . SER B 1 59  ? -47.070 -9.720  -69.019 1.00 51.70  ? 1542 SER B N   1 
ATOM   4190 C CA  . SER B 1 59  ? -46.815 -9.341  -67.646 1.00 51.38  ? 1542 SER B CA  1 
ATOM   4191 C C   . SER B 1 59  ? -45.772 -10.268 -67.035 1.00 50.78  ? 1542 SER B C   1 
ATOM   4192 O O   . SER B 1 59  ? -45.621 -11.413 -67.451 1.00 51.02  ? 1542 SER B O   1 
ATOM   4193 C CB  . SER B 1 59  ? -48.119 -9.413  -66.843 1.00 51.11  ? 1542 SER B CB  1 
ATOM   4194 O OG  . SER B 1 59  ? -47.951 -8.913  -65.529 1.00 50.52  ? 1542 SER B OG  1 
ATOM   4195 N N   . PRO B 1 60  ? -45.016 -9.770  -66.056 1.00 49.99  ? 1543 PRO B N   1 
ATOM   4196 C CA  . PRO B 1 60  ? -44.001 -10.595 -65.408 1.00 50.35  ? 1543 PRO B CA  1 
ATOM   4197 C C   . PRO B 1 60  ? -44.661 -11.892 -64.961 1.00 49.90  ? 1543 PRO B C   1 
ATOM   4198 O O   . PRO B 1 60  ? -45.857 -11.923 -64.728 1.00 50.97  ? 1543 PRO B O   1 
ATOM   4199 C CB  . PRO B 1 60  ? -43.575 -9.725  -64.231 1.00 50.49  ? 1543 PRO B CB  1 
ATOM   4200 C CG  . PRO B 1 60  ? -43.645 -8.352  -64.815 1.00 50.50  ? 1543 PRO B CG  1 
ATOM   4201 C CD  . PRO B 1 60  ? -44.961 -8.383  -65.563 1.00 49.99  ? 1543 PRO B CD  1 
ATOM   4202 N N   . LEU B 1 61  ? -43.895 -12.962 -64.837 1.00 50.67  ? 1544 LEU B N   1 
ATOM   4203 C CA  . LEU B 1 61  ? -44.461 -14.233 -64.407 1.00 51.06  ? 1544 LEU B CA  1 
ATOM   4204 C C   . LEU B 1 61  ? -44.709 -14.220 -62.882 1.00 51.71  ? 1544 LEU B C   1 
ATOM   4205 O O   . LEU B 1 61  ? -45.592 -14.920 -62.383 1.00 51.80  ? 1544 LEU B O   1 
ATOM   4206 C CB  . LEU B 1 61  ? -43.500 -15.360 -64.799 1.00 51.35  ? 1544 LEU B CB  1 
ATOM   4207 C CG  . LEU B 1 61  ? -44.045 -16.708 -65.278 1.00 51.87  ? 1544 LEU B CG  1 
ATOM   4208 C CD1 . LEU B 1 61  ? -45.213 -16.495 -66.258 1.00 52.42  ? 1544 LEU B CD1 1 
ATOM   4209 C CD2 . LEU B 1 61  ? -42.911 -17.489 -65.940 1.00 48.52  ? 1544 LEU B CD2 1 
ATOM   4210 N N   . LEU B 1 62  ? -43.931 -13.413 -62.158 1.00 51.87  ? 1545 LEU B N   1 
ATOM   4211 C CA  . LEU B 1 62  ? -44.040 -13.280 -60.698 1.00 52.92  ? 1545 LEU B CA  1 
ATOM   4212 C C   . LEU B 1 62  ? -44.097 -11.790 -60.312 1.00 55.12  ? 1545 LEU B C   1 
ATOM   4213 O O   . LEU B 1 62  ? -43.852 -10.913 -61.144 1.00 54.71  ? 1545 LEU B O   1 
ATOM   4214 C CB  . LEU B 1 62  ? -42.824 -13.920 -60.006 1.00 50.27  ? 1545 LEU B CB  1 
ATOM   4215 C CG  . LEU B 1 62  ? -42.461 -15.381 -60.273 1.00 48.41  ? 1545 LEU B CG  1 
ATOM   4216 C CD1 . LEU B 1 62  ? -41.093 -15.689 -59.677 1.00 47.51  ? 1545 LEU B CD1 1 
ATOM   4217 C CD2 . LEU B 1 62  ? -43.523 -16.293 -59.697 1.00 45.19  ? 1545 LEU B CD2 1 
ATOM   4218 N N   . PRO B 1 63  ? -44.427 -11.485 -59.043 1.00 57.58  ? 1546 PRO B N   1 
ATOM   4219 C CA  . PRO B 1 63  ? -44.491 -10.082 -58.611 1.00 60.31  ? 1546 PRO B CA  1 
ATOM   4220 C C   . PRO B 1 63  ? -43.094 -9.460  -58.645 1.00 64.59  ? 1546 PRO B C   1 
ATOM   4221 O O   . PRO B 1 63  ? -42.103 -10.148 -58.406 1.00 65.62  ? 1546 PRO B O   1 
ATOM   4222 C CB  . PRO B 1 63  ? -45.036 -10.187 -57.189 1.00 58.66  ? 1546 PRO B CB  1 
ATOM   4223 C CG  . PRO B 1 63  ? -45.847 -11.453 -57.220 1.00 57.19  ? 1546 PRO B CG  1 
ATOM   4224 C CD  . PRO B 1 63  ? -44.956 -12.379 -57.999 1.00 57.17  ? 1546 PRO B CD  1 
ATOM   4225 N N   . LEU B 1 64  ? -42.999 -8.169  -58.944 1.00 68.90  ? 1547 LEU B N   1 
ATOM   4226 C CA  . LEU B 1 64  ? -41.686 -7.528  -58.984 1.00 73.57  ? 1547 LEU B CA  1 
ATOM   4227 C C   . LEU B 1 64  ? -41.678 -6.202  -58.220 1.00 78.19  ? 1547 LEU B C   1 
ATOM   4228 O O   . LEU B 1 64  ? -42.216 -5.195  -58.696 1.00 79.33  ? 1547 LEU B O   1 
ATOM   4229 C CB  . LEU B 1 64  ? -41.256 -7.294  -60.432 1.00 72.36  ? 1547 LEU B CB  1 
ATOM   4230 C CG  . LEU B 1 64  ? -41.346 -8.492  -61.380 1.00 71.62  ? 1547 LEU B CG  1 
ATOM   4231 C CD1 . LEU B 1 64  ? -40.853 -8.075  -62.757 1.00 71.39  ? 1547 LEU B CD1 1 
ATOM   4232 C CD2 . LEU B 1 64  ? -40.529 -9.657  -60.854 1.00 70.67  ? 1547 LEU B CD2 1 
ATOM   4233 N N   . PRO B 1 65  ? -41.076 -6.193  -57.013 1.00 81.35  ? 1548 PRO B N   1 
ATOM   4234 C CA  . PRO B 1 65  ? -40.979 -5.008  -56.150 1.00 83.73  ? 1548 PRO B CA  1 
ATOM   4235 C C   . PRO B 1 65  ? -40.059 -3.882  -56.643 1.00 86.33  ? 1548 PRO B C   1 
ATOM   4236 O O   . PRO B 1 65  ? -38.832 -3.996  -56.568 1.00 87.13  ? 1548 PRO B O   1 
ATOM   4237 C CB  . PRO B 1 65  ? -40.492 -5.586  -54.820 1.00 83.15  ? 1548 PRO B CB  1 
ATOM   4238 C CG  . PRO B 1 65  ? -41.041 -6.976  -54.830 1.00 82.71  ? 1548 PRO B CG  1 
ATOM   4239 C CD  . PRO B 1 65  ? -40.751 -7.410  -56.248 1.00 81.81  ? 1548 PRO B CD  1 
ATOM   4240 N N   . TYR B 1 66  ? -40.661 -2.791  -57.123 1.00 88.52  ? 1549 TYR B N   1 
ATOM   4241 C CA  . TYR B 1 66  ? -39.925 -1.617  -57.597 1.00 90.05  ? 1549 TYR B CA  1 
ATOM   4242 C C   . TYR B 1 66  ? -40.792 -0.355  -57.531 1.00 90.12  ? 1549 TYR B C   1 
ATOM   4243 O O   . TYR B 1 66  ? -41.943 -0.339  -57.983 1.00 89.72  ? 1549 TYR B O   1 
ATOM   4244 C CB  . TYR B 1 66  ? -39.420 -1.814  -59.035 1.00 92.02  ? 1549 TYR B CB  1 
ATOM   4245 C CG  . TYR B 1 66  ? -40.494 -1.903  -60.107 1.00 94.16  ? 1549 TYR B CG  1 
ATOM   4246 C CD1 . TYR B 1 66  ? -40.306 -1.295  -61.351 1.00 95.07  ? 1549 TYR B CD1 1 
ATOM   4247 C CD2 . TYR B 1 66  ? -41.673 -2.628  -59.900 1.00 94.99  ? 1549 TYR B CD2 1 
ATOM   4248 C CE1 . TYR B 1 66  ? -41.261 -1.409  -62.364 1.00 96.47  ? 1549 TYR B CE1 1 
ATOM   4249 C CE2 . TYR B 1 66  ? -42.635 -2.751  -60.908 1.00 96.08  ? 1549 TYR B CE2 1 
ATOM   4250 C CZ  . TYR B 1 66  ? -42.422 -2.139  -62.136 1.00 96.62  ? 1549 TYR B CZ  1 
ATOM   4251 O OH  . TYR B 1 66  ? -43.359 -2.260  -63.138 1.00 97.16  ? 1549 TYR B OH  1 
ATOM   4252 N N   . LEU B 1 74  ? -32.258 3.046   -58.768 1.00 102.36 ? 1557 LEU B N   1 
ATOM   4253 C CA  . LEU B 1 74  ? -31.515 1.895   -59.279 1.00 102.77 ? 1557 LEU B CA  1 
ATOM   4254 C C   . LEU B 1 74  ? -30.299 2.366   -60.079 1.00 103.03 ? 1557 LEU B C   1 
ATOM   4255 O O   . LEU B 1 74  ? -29.757 3.443   -59.817 1.00 103.05 ? 1557 LEU B O   1 
ATOM   4256 C CB  . LEU B 1 74  ? -32.411 1.031   -60.176 1.00 102.44 ? 1557 LEU B CB  1 
ATOM   4257 C CG  . LEU B 1 74  ? -32.774 1.579   -61.562 1.00 102.58 ? 1557 LEU B CG  1 
ATOM   4258 C CD1 . LEU B 1 74  ? -33.478 0.494   -62.365 1.00 102.14 ? 1557 LEU B CD1 1 
ATOM   4259 C CD2 . LEU B 1 74  ? -33.650 2.819   -61.426 1.00 102.33 ? 1557 LEU B CD2 1 
ATOM   4260 N N   . LYS B 1 75  ? -29.866 1.556   -61.046 1.00 103.02 ? 1558 LYS B N   1 
ATOM   4261 C CA  . LYS B 1 75  ? -28.725 1.919   -61.883 1.00 102.69 ? 1558 LYS B CA  1 
ATOM   4262 C C   . LYS B 1 75  ? -29.078 3.248   -62.541 1.00 102.34 ? 1558 LYS B C   1 
ATOM   4263 O O   . LYS B 1 75  ? -30.163 3.396   -63.110 1.00 102.30 ? 1558 LYS B O   1 
ATOM   4264 C CB  . LYS B 1 75  ? -28.473 0.849   -62.953 1.00 102.14 ? 1558 LYS B CB  1 
ATOM   4265 N N   . ASP B 1 76  ? -28.166 4.212   -62.449 1.00 101.73 ? 1559 ASP B N   1 
ATOM   4266 C CA  . ASP B 1 76  ? -28.391 5.536   -63.016 1.00 101.07 ? 1559 ASP B CA  1 
ATOM   4267 C C   . ASP B 1 76  ? -28.525 5.513   -64.539 1.00 100.38 ? 1559 ASP B C   1 
ATOM   4268 O O   . ASP B 1 76  ? -28.531 6.565   -65.182 1.00 100.72 ? 1559 ASP B O   1 
ATOM   4269 C CB  . ASP B 1 76  ? -27.256 6.487   -62.608 1.00 101.35 ? 1559 ASP B CB  1 
ATOM   4270 C CG  . ASP B 1 76  ? -27.771 7.803   -62.027 1.00 101.77 ? 1559 ASP B CG  1 
ATOM   4271 O OD1 . ASP B 1 76  ? -26.948 8.710   -61.760 1.00 100.77 ? 1559 ASP B OD1 1 
ATOM   4272 O OD2 . ASP B 1 76  ? -29.001 7.927   -61.833 1.00 102.04 ? 1559 ASP B OD2 1 
ATOM   4273 N N   . LYS B 1 77  ? -28.630 4.315   -65.111 1.00 98.96  ? 1560 LYS B N   1 
ATOM   4274 C CA  . LYS B 1 77  ? -28.777 4.163   -66.557 1.00 97.35  ? 1560 LYS B CA  1 
ATOM   4275 C C   . LYS B 1 77  ? -28.858 2.699   -66.984 1.00 96.13  ? 1560 LYS B C   1 
ATOM   4276 O O   . LYS B 1 77  ? -28.563 1.789   -66.201 1.00 95.36  ? 1560 LYS B O   1 
ATOM   4277 C CB  . LYS B 1 77  ? -27.610 4.838   -67.288 1.00 96.81  ? 1560 LYS B CB  1 
ATOM   4278 N N   . GLY B 1 78  ? -29.277 2.489   -68.233 1.00 94.49  ? 1561 GLY B N   1 
ATOM   4279 C CA  . GLY B 1 78  ? -29.378 1.149   -68.780 1.00 91.50  ? 1561 GLY B CA  1 
ATOM   4280 C C   . GLY B 1 78  ? -30.761 0.533   -68.901 1.00 89.66  ? 1561 GLY B C   1 
ATOM   4281 O O   . GLY B 1 78  ? -31.231 0.281   -70.016 1.00 89.01  ? 1561 GLY B O   1 
ATOM   4282 N N   . TYR B 1 79  ? -31.411 0.290   -67.761 1.00 87.86  ? 1562 TYR B N   1 
ATOM   4283 C CA  . TYR B 1 79  ? -32.733 -0.349  -67.719 1.00 85.94  ? 1562 TYR B CA  1 
ATOM   4284 C C   . TYR B 1 79  ? -33.931 0.585   -67.884 1.00 84.01  ? 1562 TYR B C   1 
ATOM   4285 O O   . TYR B 1 79  ? -33.759 1.783   -68.105 1.00 84.96  ? 1562 TYR B O   1 
ATOM   4286 C CB  . TYR B 1 79  ? -32.878 -1.132  -66.408 1.00 86.42  ? 1562 TYR B CB  1 
ATOM   4287 C CG  . TYR B 1 79  ? -31.863 -2.241  -66.248 1.00 86.92  ? 1562 TYR B CG  1 
ATOM   4288 C CD1 . TYR B 1 79  ? -31.881 -3.354  -67.087 1.00 87.43  ? 1562 TYR B CD1 1 
ATOM   4289 C CD2 . TYR B 1 79  ? -30.862 -2.161  -65.281 1.00 87.95  ? 1562 TYR B CD2 1 
ATOM   4290 C CE1 . TYR B 1 79  ? -30.926 -4.361  -66.971 1.00 88.61  ? 1562 TYR B CE1 1 
ATOM   4291 C CE2 . TYR B 1 79  ? -29.898 -3.162  -65.154 1.00 88.71  ? 1562 TYR B CE2 1 
ATOM   4292 C CZ  . TYR B 1 79  ? -29.936 -4.259  -66.005 1.00 89.02  ? 1562 TYR B CZ  1 
ATOM   4293 O OH  . TYR B 1 79  ? -28.982 -5.246  -65.904 1.00 89.40  ? 1562 TYR B OH  1 
ATOM   4294 N N   . THR B 1 80  ? -35.140 0.021   -67.791 1.00 81.22  ? 1563 THR B N   1 
ATOM   4295 C CA  . THR B 1 80  ? -36.392 0.783   -67.911 1.00 78.28  ? 1563 THR B CA  1 
ATOM   4296 C C   . THR B 1 80  ? -37.302 0.499   -66.705 1.00 77.22  ? 1563 THR B C   1 
ATOM   4297 O O   . THR B 1 80  ? -37.399 1.307   -65.777 1.00 76.68  ? 1563 THR B O   1 
ATOM   4298 C CB  . THR B 1 80  ? -37.157 0.425   -69.212 1.00 77.63  ? 1563 THR B CB  1 
ATOM   4299 O OG1 . THR B 1 80  ? -37.528 -0.958  -69.187 1.00 76.75  ? 1563 THR B OG1 1 
ATOM   4300 C CG2 . THR B 1 80  ? -36.288 0.691   -70.442 1.00 76.91  ? 1563 THR B CG2 1 
ATOM   4301 N N   . THR B 1 81  ? -37.969 -0.651  -66.719 1.00 75.96  ? 1564 THR B N   1 
ATOM   4302 C CA  . THR B 1 81  ? -38.842 -1.040  -65.617 1.00 74.87  ? 1564 THR B CA  1 
ATOM   4303 C C   . THR B 1 81  ? -38.649 -2.527  -65.346 1.00 74.47  ? 1564 THR B C   1 
ATOM   4304 O O   . THR B 1 81  ? -38.482 -3.320  -66.276 1.00 74.14  ? 1564 THR B O   1 
ATOM   4305 C CB  . THR B 1 81  ? -40.327 -0.789  -65.948 1.00 73.89  ? 1564 THR B CB  1 
ATOM   4306 N N   . LEU B 1 82  ? -38.660 -2.908  -64.074 1.00 73.66  ? 1565 LEU B N   1 
ATOM   4307 C CA  . LEU B 1 82  ? -38.494 -4.312  -63.730 1.00 73.05  ? 1565 LEU B CA  1 
ATOM   4308 C C   . LEU B 1 82  ? -39.524 -5.143  -64.488 1.00 73.12  ? 1565 LEU B C   1 
ATOM   4309 O O   . LEU B 1 82  ? -39.184 -6.162  -65.088 1.00 73.92  ? 1565 LEU B O   1 
ATOM   4310 C CB  . LEU B 1 82  ? -38.637 -4.524  -62.214 1.00 72.26  ? 1565 LEU B CB  1 
ATOM   4311 C CG  . LEU B 1 82  ? -37.348 -4.470  -61.378 1.00 72.15  ? 1565 LEU B CG  1 
ATOM   4312 C CD1 . LEU B 1 82  ? -36.675 -3.117  -61.519 1.00 71.59  ? 1565 LEU B CD1 1 
ATOM   4313 C CD2 . LEU B 1 82  ? -37.675 -4.747  -59.923 1.00 71.91  ? 1565 LEU B CD2 1 
ATOM   4314 N N   . GLN B 1 83  ? -40.775 -4.690  -64.481 1.00 72.55  ? 1566 GLN B N   1 
ATOM   4315 C CA  . GLN B 1 83  ? -41.852 -5.395  -65.168 0.50 72.32  ? 1566 GLN B CA  1 
ATOM   4316 C C   . GLN B 1 83  ? -41.652 -5.465  -66.684 1.00 72.43  ? 1566 GLN B C   1 
ATOM   4317 O O   . GLN B 1 83  ? -41.971 -6.478  -67.305 1.00 71.53  ? 1566 GLN B O   1 
ATOM   4318 C CB  . GLN B 1 83  ? -43.196 -4.730  -64.858 0.50 71.89  ? 1566 GLN B CB  1 
ATOM   4319 N N   . ASP B 1 84  ? -41.124 -4.392  -67.277 1.00 73.20  ? 1567 ASP B N   1 
ATOM   4320 C CA  . ASP B 1 84  ? -40.887 -4.352  -68.722 1.00 73.54  ? 1567 ASP B CA  1 
ATOM   4321 C C   . ASP B 1 84  ? -39.693 -5.209  -69.114 1.00 72.95  ? 1567 ASP B C   1 
ATOM   4322 O O   . ASP B 1 84  ? -39.751 -5.966  -70.087 1.00 72.86  ? 1567 ASP B O   1 
ATOM   4323 C CB  . ASP B 1 84  ? -40.636 -2.915  -69.205 1.00 75.39  ? 1567 ASP B CB  1 
ATOM   4324 C CG  . ASP B 1 84  ? -40.116 -2.861  -70.654 1.00 78.12  ? 1567 ASP B CG  1 
ATOM   4325 O OD1 . ASP B 1 84  ? -40.801 -3.386  -71.565 1.00 79.14  ? 1567 ASP B OD1 1 
ATOM   4326 O OD2 . ASP B 1 84  ? -39.016 -2.299  -70.886 1.00 79.06  ? 1567 ASP B OD2 1 
ATOM   4327 N N   . GLU B 1 85  ? -38.609 -5.081  -68.354 1.00 72.02  ? 1568 GLU B N   1 
ATOM   4328 C CA  . GLU B 1 85  ? -37.397 -5.837  -68.638 1.00 71.04  ? 1568 GLU B CA  1 
ATOM   4329 C C   . GLU B 1 85  ? -37.667 -7.333  -68.578 1.00 69.42  ? 1568 GLU B C   1 
ATOM   4330 O O   . GLU B 1 85  ? -37.167 -8.105  -69.397 1.00 69.19  ? 1568 GLU B O   1 
ATOM   4331 C CB  . GLU B 1 85  ? -36.289 -5.458  -67.650 1.00 71.38  ? 1568 GLU B CB  1 
ATOM   4332 C CG  . GLU B 1 85  ? -34.928 -5.321  -68.322 1.00 72.80  ? 1568 GLU B CG  1 
ATOM   4333 C CD  . GLU B 1 85  ? -34.909 -4.229  -69.390 1.00 73.28  ? 1568 GLU B CD  1 
ATOM   4334 O OE1 . GLU B 1 85  ? -34.885 -3.041  -69.018 1.00 73.67  ? 1568 GLU B OE1 1 
ATOM   4335 O OE2 . GLU B 1 85  ? -34.925 -4.551  -70.601 1.00 73.99  ? 1568 GLU B OE2 1 
ATOM   4336 N N   . ALA B 1 86  ? -38.473 -7.734  -67.608 1.00 67.87  ? 1569 ALA B N   1 
ATOM   4337 C CA  . ALA B 1 86  ? -38.814 -9.129  -67.443 1.00 66.51  ? 1569 ALA B CA  1 
ATOM   4338 C C   . ALA B 1 86  ? -39.404 -9.687  -68.727 1.00 66.50  ? 1569 ALA B C   1 
ATOM   4339 O O   . ALA B 1 86  ? -38.887 -10.665 -69.272 1.00 65.77  ? 1569 ALA B O   1 
ATOM   4340 C CB  . ALA B 1 86  ? -39.798 -9.289  -66.298 1.00 66.37  ? 1569 ALA B CB  1 
ATOM   4341 N N   . ILE B 1 87  ? -40.482 -9.070  -69.215 1.00 67.11  ? 1570 ILE B N   1 
ATOM   4342 C CA  . ILE B 1 87  ? -41.123 -9.550  -70.439 1.00 67.99  ? 1570 ILE B CA  1 
ATOM   4343 C C   . ILE B 1 87  ? -40.180 -9.351  -71.619 1.00 67.89  ? 1570 ILE B C   1 
ATOM   4344 O O   . ILE B 1 87  ? -40.195 -10.135 -72.570 1.00 67.61  ? 1570 ILE B O   1 
ATOM   4345 C CB  . ILE B 1 87  ? -42.477 -8.829  -70.737 1.00 68.56  ? 1570 ILE B CB  1 
ATOM   4346 C CG1 . ILE B 1 87  ? -42.241 -7.354  -71.046 1.00 69.56  ? 1570 ILE B CG1 1 
ATOM   4347 C CG2 . ILE B 1 87  ? -43.421 -8.962  -69.554 1.00 68.09  ? 1570 ILE B CG2 1 
ATOM   4348 C CD1 . ILE B 1 87  ? -43.486 -6.633  -71.510 1.00 69.88  ? 1570 ILE B CD1 1 
ATOM   4349 N N   . LYS B 1 88  ? -39.355 -8.307  -71.546 1.00 67.60  ? 1571 LYS B N   1 
ATOM   4350 C CA  . LYS B 1 88  ? -38.392 -8.016  -72.608 1.00 67.46  ? 1571 LYS B CA  1 
ATOM   4351 C C   . LYS B 1 88  ? -37.522 -9.253  -72.831 1.00 66.49  ? 1571 LYS B C   1 
ATOM   4352 O O   . LYS B 1 88  ? -37.390 -9.747  -73.951 1.00 66.97  ? 1571 LYS B O   1 
ATOM   4353 C CB  . LYS B 1 88  ? -37.516 -6.816  -72.222 1.00 67.57  ? 1571 LYS B CB  1 
ATOM   4354 N N   . ILE B 1 89  ? -36.929 -9.749  -71.753 1.00 65.72  ? 1572 ILE B N   1 
ATOM   4355 C CA  . ILE B 1 89  ? -36.095 -10.937 -71.824 1.00 64.89  ? 1572 ILE B CA  1 
ATOM   4356 C C   . ILE B 1 89  ? -36.864 -12.087 -72.489 1.00 64.75  ? 1572 ILE B C   1 
ATOM   4357 O O   . ILE B 1 89  ? -36.421 -12.632 -73.497 1.00 65.10  ? 1572 ILE B O   1 
ATOM   4358 C CB  . ILE B 1 89  ? -35.652 -11.381 -70.407 1.00 64.68  ? 1572 ILE B CB  1 
ATOM   4359 C CG1 . ILE B 1 89  ? -34.717 -10.329 -69.809 1.00 64.39  ? 1572 ILE B CG1 1 
ATOM   4360 C CG2 . ILE B 1 89  ? -34.987 -12.754 -70.465 1.00 63.68  ? 1572 ILE B CG2 1 
ATOM   4361 C CD1 . ILE B 1 89  ? -34.227 -10.655 -68.400 1.00 64.90  ? 1572 ILE B CD1 1 
ATOM   4362 N N   . PHE B 1 90  ? -38.021 -12.433 -71.924 1.00 63.43  ? 1573 PHE B N   1 
ATOM   4363 C CA  . PHE B 1 90  ? -38.856 -13.522 -72.430 1.00 61.95  ? 1573 PHE B CA  1 
ATOM   4364 C C   . PHE B 1 90  ? -39.201 -13.374 -73.909 1.00 63.93  ? 1573 PHE B C   1 
ATOM   4365 O O   . PHE B 1 90  ? -39.170 -14.352 -74.653 1.00 63.36  ? 1573 PHE B O   1 
ATOM   4366 C CB  . PHE B 1 90  ? -40.161 -13.624 -71.611 1.00 56.95  ? 1573 PHE B CB  1 
ATOM   4367 C CG  . PHE B 1 90  ? -40.955 -14.872 -71.887 1.00 50.74  ? 1573 PHE B CG  1 
ATOM   4368 C CD1 . PHE B 1 90  ? -40.551 -16.095 -71.375 1.00 49.58  ? 1573 PHE B CD1 1 
ATOM   4369 C CD2 . PHE B 1 90  ? -42.065 -14.838 -72.715 1.00 49.35  ? 1573 PHE B CD2 1 
ATOM   4370 C CE1 . PHE B 1 90  ? -41.235 -17.268 -71.691 1.00 47.38  ? 1573 PHE B CE1 1 
ATOM   4371 C CE2 . PHE B 1 90  ? -42.755 -16.007 -73.037 1.00 47.33  ? 1573 PHE B CE2 1 
ATOM   4372 C CZ  . PHE B 1 90  ? -42.337 -17.223 -72.525 1.00 46.32  ? 1573 PHE B CZ  1 
ATOM   4373 N N   . ASN B 1 91  ? -39.548 -12.160 -74.332 1.00 67.36  ? 1574 ASN B N   1 
ATOM   4374 C CA  . ASN B 1 91  ? -39.902 -11.920 -75.729 1.00 70.66  ? 1574 ASN B CA  1 
ATOM   4375 C C   . ASN B 1 91  ? -38.735 -12.266 -76.628 1.00 72.77  ? 1574 ASN B C   1 
ATOM   4376 O O   . ASN B 1 91  ? -38.865 -13.066 -77.557 1.00 73.33  ? 1574 ASN B O   1 
ATOM   4377 C CB  . ASN B 1 91  ? -40.314 -10.462 -75.945 1.00 70.95  ? 1574 ASN B CB  1 
ATOM   4378 C CG  . ASN B 1 91  ? -41.783 -10.221 -75.634 1.00 72.10  ? 1574 ASN B CG  1 
ATOM   4379 O OD1 . ASN B 1 91  ? -42.255 -9.085  -75.672 1.00 73.18  ? 1574 ASN B OD1 1 
ATOM   4380 N ND2 . ASN B 1 91  ? -42.516 -11.295 -75.332 1.00 71.53  ? 1574 ASN B ND2 1 
ATOM   4381 N N   . SER B 1 92  ? -37.587 -11.668 -76.344 1.00 74.34  ? 1575 SER B N   1 
ATOM   4382 C CA  . SER B 1 92  ? -36.399 -11.939 -77.126 1.00 76.21  ? 1575 SER B CA  1 
ATOM   4383 C C   . SER B 1 92  ? -36.013 -13.409 -76.938 1.00 76.45  ? 1575 SER B C   1 
ATOM   4384 O O   . SER B 1 92  ? -35.612 -14.083 -77.885 1.00 77.22  ? 1575 SER B O   1 
ATOM   4385 C CB  . SER B 1 92  ? -35.266 -11.011 -76.676 1.00 77.44  ? 1575 SER B CB  1 
ATOM   4386 O OG  . SER B 1 92  ? -35.594 -9.653  -76.940 1.00 77.72  ? 1575 SER B OG  1 
ATOM   4387 N N   . LEU B 1 93  ? -36.153 -13.902 -75.712 1.00 76.72  ? 1576 LEU B N   1 
ATOM   4388 C CA  . LEU B 1 93  ? -35.830 -15.292 -75.381 1.00 76.51  ? 1576 LEU B CA  1 
ATOM   4389 C C   . LEU B 1 93  ? -36.619 -16.241 -76.284 1.00 76.86  ? 1576 LEU B C   1 
ATOM   4390 O O   . LEU B 1 93  ? -36.301 -17.425 -76.381 1.00 76.42  ? 1576 LEU B O   1 
ATOM   4391 C CB  . LEU B 1 93  ? -36.157 -15.564 -73.902 1.00 76.37  ? 1576 LEU B CB  1 
ATOM   4392 C CG  . LEU B 1 93  ? -35.783 -16.892 -73.224 1.00 75.40  ? 1576 LEU B CG  1 
ATOM   4393 C CD1 . LEU B 1 93  ? -34.282 -17.055 -73.216 1.00 74.20  ? 1576 LEU B CD1 1 
ATOM   4394 C CD2 . LEU B 1 93  ? -36.317 -16.919 -71.790 1.00 73.94  ? 1576 LEU B CD2 1 
ATOM   4395 N N   . GLN B 1 94  ? -37.652 -15.713 -76.936 1.00 77.69  ? 1577 GLN B N   1 
ATOM   4396 C CA  . GLN B 1 94  ? -38.475 -16.501 -77.849 1.00 78.63  ? 1577 GLN B CA  1 
ATOM   4397 C C   . GLN B 1 94  ? -38.043 -16.226 -79.282 1.00 80.39  ? 1577 GLN B C   1 
ATOM   4398 O O   . GLN B 1 94  ? -38.348 -16.996 -80.195 1.00 80.92  ? 1577 GLN B O   1 
ATOM   4399 C CB  . GLN B 1 94  ? -39.955 -16.146 -77.703 1.00 77.04  ? 1577 GLN B CB  1 
ATOM   4400 C CG  . GLN B 1 94  ? -40.641 -16.750 -76.497 1.00 76.12  ? 1577 GLN B CG  1 
ATOM   4401 C CD  . GLN B 1 94  ? -42.144 -16.506 -76.500 1.00 75.82  ? 1577 GLN B CD  1 
ATOM   4402 O OE1 . GLN B 1 94  ? -42.607 -15.364 -76.391 1.00 74.35  ? 1577 GLN B OE1 1 
ATOM   4403 N NE2 . GLN B 1 94  ? -42.915 -17.583 -76.630 1.00 74.96  ? 1577 GLN B NE2 1 
ATOM   4404 N N   . GLN B 1 95  ? -37.334 -15.119 -79.474 1.00 81.94  ? 1578 GLN B N   1 
ATOM   4405 C CA  . GLN B 1 95  ? -36.864 -14.733 -80.798 1.00 83.79  ? 1578 GLN B CA  1 
ATOM   4406 C C   . GLN B 1 95  ? -35.513 -15.379 -81.114 1.00 84.10  ? 1578 GLN B C   1 
ATOM   4407 O O   . GLN B 1 95  ? -34.847 -15.001 -82.078 1.00 84.18  ? 1578 GLN B O   1 
ATOM   4408 C CB  . GLN B 1 95  ? -36.746 -13.206 -80.896 1.00 84.62  ? 1578 GLN B CB  1 
ATOM   4409 C CG  . GLN B 1 95  ? -38.001 -12.430 -80.465 1.00 86.59  ? 1578 GLN B CG  1 
ATOM   4410 C CD  . GLN B 1 95  ? -39.278 -12.882 -81.173 1.00 87.50  ? 1578 GLN B CD  1 
ATOM   4411 O OE1 . GLN B 1 95  ? -39.297 -13.063 -82.391 1.00 88.06  ? 1578 GLN B OE1 1 
ATOM   4412 N NE2 . GLN B 1 95  ? -40.356 -13.048 -80.407 1.00 87.63  ? 1578 GLN B NE2 1 
ATOM   4413 N N   . LEU B 1 96  ? -35.121 -16.358 -80.301 1.00 84.18  ? 1579 LEU B N   1 
ATOM   4414 C CA  . LEU B 1 96  ? -33.853 -17.060 -80.485 1.00 83.92  ? 1579 LEU B CA  1 
ATOM   4415 C C   . LEU B 1 96  ? -33.986 -18.545 -80.134 1.00 83.74  ? 1579 LEU B C   1 
ATOM   4416 O O   . LEU B 1 96  ? -34.968 -19.199 -80.492 1.00 83.22  ? 1579 LEU B O   1 
ATOM   4417 C CB  . LEU B 1 96  ? -32.771 -16.420 -79.612 1.00 83.73  ? 1579 LEU B CB  1 
ATOM   4418 N N   . SER B 1 100 ? -26.325 -19.998 -84.504 1.00 85.26  ? 1583 SER B N   1 
ATOM   4419 C CA  . SER B 1 100 ? -26.541 -18.559 -84.604 1.00 85.24  ? 1583 SER B CA  1 
ATOM   4420 C C   . SER B 1 100 ? -25.806 -17.809 -83.493 1.00 84.53  ? 1583 SER B C   1 
ATOM   4421 O O   . SER B 1 100 ? -26.087 -16.633 -83.238 1.00 84.92  ? 1583 SER B O   1 
ATOM   4422 C CB  . SER B 1 100 ? -28.041 -18.248 -84.530 1.00 85.87  ? 1583 SER B CB  1 
ATOM   4423 N N   . ASP B 1 101 ? -24.866 -18.502 -82.847 1.00 83.39  ? 1584 ASP B N   1 
ATOM   4424 C CA  . ASP B 1 101 ? -24.065 -17.956 -81.746 1.00 81.57  ? 1584 ASP B CA  1 
ATOM   4425 C C   . ASP B 1 101 ? -24.910 -17.198 -80.716 1.00 79.29  ? 1584 ASP B C   1 
ATOM   4426 O O   . ASP B 1 101 ? -25.047 -15.972 -80.776 1.00 79.47  ? 1584 ASP B O   1 
ATOM   4427 C CB  . ASP B 1 101 ? -22.956 -17.048 -82.292 1.00 82.29  ? 1584 ASP B CB  1 
ATOM   4428 C CG  . ASP B 1 101 ? -22.083 -16.470 -81.192 1.00 83.26  ? 1584 ASP B CG  1 
ATOM   4429 O OD1 . ASP B 1 101 ? -21.757 -17.223 -80.249 1.00 82.99  ? 1584 ASP B OD1 1 
ATOM   4430 O OD2 . ASP B 1 101 ? -21.716 -15.273 -81.277 1.00 83.55  ? 1584 ASP B OD2 1 
ATOM   4431 N N   . PRO B 1 102 ? -25.484 -17.926 -79.745 1.00 76.85  ? 1585 PRO B N   1 
ATOM   4432 C CA  . PRO B 1 102 ? -26.320 -17.311 -78.706 1.00 74.23  ? 1585 PRO B CA  1 
ATOM   4433 C C   . PRO B 1 102 ? -25.531 -16.616 -77.587 1.00 70.79  ? 1585 PRO B C   1 
ATOM   4434 O O   . PRO B 1 102 ? -25.992 -15.630 -77.017 1.00 70.34  ? 1585 PRO B O   1 
ATOM   4435 C CB  . PRO B 1 102 ? -27.145 -18.491 -78.200 1.00 75.26  ? 1585 PRO B CB  1 
ATOM   4436 C CG  . PRO B 1 102 ? -26.136 -19.625 -78.266 1.00 76.44  ? 1585 PRO B CG  1 
ATOM   4437 C CD  . PRO B 1 102 ? -25.443 -19.396 -79.599 1.00 76.36  ? 1585 PRO B CD  1 
ATOM   4438 N N   . ILE B 1 103 ? -24.338 -17.129 -77.303 1.00 66.31  ? 1586 ILE B N   1 
ATOM   4439 C CA  . ILE B 1 103 ? -23.480 -16.590 -76.258 1.00 62.00  ? 1586 ILE B CA  1 
ATOM   4440 C C   . ILE B 1 103 ? -23.667 -15.100 -75.905 1.00 59.82  ? 1586 ILE B C   1 
ATOM   4441 O O   . ILE B 1 103 ? -23.877 -14.760 -74.735 1.00 59.89  ? 1586 ILE B O   1 
ATOM   4442 C CB  . ILE B 1 103 ? -21.992 -16.899 -76.583 1.00 61.53  ? 1586 ILE B CB  1 
ATOM   4443 C CG1 . ILE B 1 103 ? -21.766 -18.414 -76.478 1.00 60.25  ? 1586 ILE B CG1 1 
ATOM   4444 C CG2 . ILE B 1 103 ? -21.054 -16.136 -75.647 1.00 59.60  ? 1586 ILE B CG2 1 
ATOM   4445 C CD1 . ILE B 1 103 ? -20.330 -18.857 -76.648 1.00 60.50  ? 1586 ILE B CD1 1 
ATOM   4446 N N   . PRO B 1 104 ? -23.604 -14.194 -76.891 1.00 57.29  ? 1587 PRO B N   1 
ATOM   4447 C CA  . PRO B 1 104 ? -23.782 -12.770 -76.560 1.00 55.74  ? 1587 PRO B CA  1 
ATOM   4448 C C   . PRO B 1 104 ? -25.139 -12.516 -75.886 1.00 54.86  ? 1587 PRO B C   1 
ATOM   4449 O O   . PRO B 1 104 ? -25.257 -11.733 -74.940 1.00 54.75  ? 1587 PRO B O   1 
ATOM   4450 C CB  . PRO B 1 104 ? -23.686 -12.086 -77.921 1.00 55.74  ? 1587 PRO B CB  1 
ATOM   4451 C CG  . PRO B 1 104 ? -22.794 -12.999 -78.698 1.00 56.80  ? 1587 PRO B CG  1 
ATOM   4452 C CD  . PRO B 1 104 ? -23.309 -14.370 -78.321 1.00 56.97  ? 1587 PRO B CD  1 
ATOM   4453 N N   . ILE B 1 105 ? -26.166 -13.190 -76.388 1.00 52.75  ? 1588 ILE B N   1 
ATOM   4454 C CA  . ILE B 1 105 ? -27.506 -13.056 -75.838 1.00 51.76  ? 1588 ILE B CA  1 
ATOM   4455 C C   . ILE B 1 105 ? -27.512 -13.575 -74.388 1.00 50.83  ? 1588 ILE B C   1 
ATOM   4456 O O   . ILE B 1 105 ? -27.916 -12.866 -73.454 1.00 50.67  ? 1588 ILE B O   1 
ATOM   4457 C CB  . ILE B 1 105 ? -28.547 -13.869 -76.684 1.00 51.42  ? 1588 ILE B CB  1 
ATOM   4458 C CG1 . ILE B 1 105 ? -28.429 -13.510 -78.169 1.00 51.15  ? 1588 ILE B CG1 1 
ATOM   4459 C CG2 . ILE B 1 105 ? -29.960 -13.558 -76.217 1.00 50.24  ? 1588 ILE B CG2 1 
ATOM   4460 C CD1 . ILE B 1 105 ? -29.370 -14.315 -79.070 1.00 52.89  ? 1588 ILE B CD1 1 
ATOM   4461 N N   . ILE B 1 106 ? -27.067 -14.816 -74.213 1.00 48.31  ? 1589 ILE B N   1 
ATOM   4462 C CA  . ILE B 1 106 ? -27.018 -15.436 -72.904 1.00 46.84  ? 1589 ILE B CA  1 
ATOM   4463 C C   . ILE B 1 106 ? -26.366 -14.498 -71.890 1.00 47.68  ? 1589 ILE B C   1 
ATOM   4464 O O   . ILE B 1 106 ? -26.865 -14.311 -70.781 1.00 47.26  ? 1589 ILE B O   1 
ATOM   4465 C CB  . ILE B 1 106 ? -26.234 -16.767 -72.960 1.00 45.32  ? 1589 ILE B CB  1 
ATOM   4466 C CG1 . ILE B 1 106 ? -27.003 -17.784 -73.805 1.00 44.15  ? 1589 ILE B CG1 1 
ATOM   4467 C CG2 . ILE B 1 106 ? -26.016 -17.308 -71.565 1.00 43.47  ? 1589 ILE B CG2 1 
ATOM   4468 C CD1 . ILE B 1 106 ? -26.385 -19.147 -73.838 1.00 40.79  ? 1589 ILE B CD1 1 
ATOM   4469 N N   . GLN B 1 107 ? -25.255 -13.890 -72.280 1.00 48.44  ? 1590 GLN B N   1 
ATOM   4470 C CA  . GLN B 1 107 ? -24.552 -12.994 -71.380 1.00 48.34  ? 1590 GLN B CA  1 
ATOM   4471 C C   . GLN B 1 107 ? -25.421 -11.812 -70.960 1.00 47.10  ? 1590 GLN B C   1 
ATOM   4472 O O   . GLN B 1 107 ? -25.329 -11.344 -69.819 1.00 46.55  ? 1590 GLN B O   1 
ATOM   4473 C CB  . GLN B 1 107 ? -23.260 -12.506 -72.040 1.00 50.38  ? 1590 GLN B CB  1 
ATOM   4474 C CG  . GLN B 1 107 ? -22.346 -11.738 -71.105 1.00 52.95  ? 1590 GLN B CG  1 
ATOM   4475 C CD  . GLN B 1 107 ? -20.948 -11.606 -71.647 1.00 55.07  ? 1590 GLN B CD  1 
ATOM   4476 O OE1 . GLN B 1 107 ? -20.717 -10.979 -72.693 1.00 56.21  ? 1590 GLN B OE1 1 
ATOM   4477 N NE2 . GLN B 1 107 ? -19.997 -12.205 -70.943 1.00 54.35  ? 1590 GLN B NE2 1 
ATOM   4478 N N   . GLY B 1 108 ? -26.270 -11.338 -71.874 1.00 45.96  ? 1591 GLY B N   1 
ATOM   4479 C CA  . GLY B 1 108 ? -27.144 -10.212 -71.564 1.00 42.93  ? 1591 GLY B CA  1 
ATOM   4480 C C   . GLY B 1 108 ? -28.151 -10.554 -70.478 1.00 40.96  ? 1591 GLY B C   1 
ATOM   4481 O O   . GLY B 1 108 ? -28.377 -9.785  -69.534 1.00 38.22  ? 1591 GLY B O   1 
ATOM   4482 N N   . ILE B 1 109 ? -28.752 -11.729 -70.621 1.00 40.07  ? 1592 ILE B N   1 
ATOM   4483 C CA  . ILE B 1 109 ? -29.741 -12.224 -69.674 1.00 39.75  ? 1592 ILE B CA  1 
ATOM   4484 C C   . ILE B 1 109 ? -29.119 -12.346 -68.277 1.00 40.33  ? 1592 ILE B C   1 
ATOM   4485 O O   . ILE B 1 109 ? -29.701 -11.915 -67.268 1.00 40.23  ? 1592 ILE B O   1 
ATOM   4486 C CB  . ILE B 1 109 ? -30.274 -13.591 -70.138 1.00 39.21  ? 1592 ILE B CB  1 
ATOM   4487 C CG1 . ILE B 1 109 ? -30.943 -13.431 -71.510 1.00 38.84  ? 1592 ILE B CG1 1 
ATOM   4488 C CG2 . ILE B 1 109 ? -31.243 -14.152 -69.108 1.00 38.50  ? 1592 ILE B CG2 1 
ATOM   4489 C CD1 . ILE B 1 109 ? -31.422 -14.720 -72.135 1.00 40.16  ? 1592 ILE B CD1 1 
ATOM   4490 N N   . LEU B 1 110 ? -27.932 -12.937 -68.220 1.00 40.45  ? 1593 LEU B N   1 
ATOM   4491 C CA  . LEU B 1 110 ? -27.222 -13.074 -66.954 1.00 40.22  ? 1593 LEU B CA  1 
ATOM   4492 C C   . LEU B 1 110 ? -26.989 -11.683 -66.348 1.00 40.82  ? 1593 LEU B C   1 
ATOM   4493 O O   . LEU B 1 110 ? -27.259 -11.459 -65.169 1.00 41.60  ? 1593 LEU B O   1 
ATOM   4494 C CB  . LEU B 1 110 ? -25.889 -13.798 -67.177 1.00 38.29  ? 1593 LEU B CB  1 
ATOM   4495 C CG  . LEU B 1 110 ? -25.862 -15.332 -67.133 1.00 37.17  ? 1593 LEU B CG  1 
ATOM   4496 C CD1 . LEU B 1 110 ? -27.253 -15.911 -67.187 1.00 37.61  ? 1593 LEU B CD1 1 
ATOM   4497 C CD2 . LEU B 1 110 ? -25.033 -15.845 -68.281 1.00 34.49  ? 1593 LEU B CD2 1 
ATOM   4498 N N   . GLN B 1 111 ? -26.518 -10.737 -67.157 1.00 40.68  ? 1594 GLN B N   1 
ATOM   4499 C CA  . GLN B 1 111 ? -26.270 -9.401  -66.638 1.00 41.61  ? 1594 GLN B CA  1 
ATOM   4500 C C   . GLN B 1 111 ? -27.506 -8.802  -65.966 1.00 43.32  ? 1594 GLN B C   1 
ATOM   4501 O O   . GLN B 1 111 ? -27.457 -8.350  -64.814 1.00 43.03  ? 1594 GLN B O   1 
ATOM   4502 C CB  . GLN B 1 111 ? -25.819 -8.474  -67.755 1.00 41.83  ? 1594 GLN B CB  1 
ATOM   4503 C CG  . GLN B 1 111 ? -25.320 -7.132  -67.244 1.00 42.58  ? 1594 GLN B CG  1 
ATOM   4504 C CD  . GLN B 1 111 ? -24.045 -7.276  -66.424 1.00 41.57  ? 1594 GLN B CD  1 
ATOM   4505 O OE1 . GLN B 1 111 ? -23.019 -7.711  -66.938 1.00 41.59  ? 1594 GLN B OE1 1 
ATOM   4506 N NE2 . GLN B 1 111 ? -24.110 -6.915  -65.148 1.00 40.17  ? 1594 GLN B NE2 1 
ATOM   4507 N N   . THR B 1 112 ? -28.613 -8.794  -66.698 1.00 43.62  ? 1595 THR B N   1 
ATOM   4508 C CA  . THR B 1 112 ? -29.847 -8.251  -66.177 1.00 44.02  ? 1595 THR B CA  1 
ATOM   4509 C C   . THR B 1 112 ? -30.183 -8.895  -64.837 1.00 45.06  ? 1595 THR B C   1 
ATOM   4510 O O   . THR B 1 112 ? -30.467 -8.202  -63.857 1.00 45.64  ? 1595 THR B O   1 
ATOM   4511 C CB  . THR B 1 112 ? -30.986 -8.490  -67.161 1.00 44.08  ? 1595 THR B CB  1 
ATOM   4512 O OG1 . THR B 1 112 ? -30.506 -8.278  -68.495 1.00 43.38  ? 1595 THR B OG1 1 
ATOM   4513 C CG2 . THR B 1 112 ? -32.132 -7.518  -66.883 1.00 44.91  ? 1595 THR B CG2 1 
ATOM   4514 N N   . GLY B 1 113 ? -30.140 -10.222 -64.792 1.00 45.85  ? 1596 GLY B N   1 
ATOM   4515 C CA  . GLY B 1 113 ? -30.443 -10.926 -63.554 1.00 47.02  ? 1596 GLY B CA  1 
ATOM   4516 C C   . GLY B 1 113 ? -29.515 -10.536 -62.413 1.00 47.48  ? 1596 GLY B C   1 
ATOM   4517 O O   . GLY B 1 113 ? -29.930 -10.385 -61.263 1.00 46.66  ? 1596 GLY B O   1 
ATOM   4518 N N   . HIS B 1 114 ? -28.238 -10.378 -62.733 1.00 48.51  ? 1597 HIS B N   1 
ATOM   4519 C CA  . HIS B 1 114 ? -27.263 -9.991  -61.736 1.00 49.08  ? 1597 HIS B CA  1 
ATOM   4520 C C   . HIS B 1 114 ? -27.641 -8.651  -61.105 1.00 48.69  ? 1597 HIS B C   1 
ATOM   4521 O O   . HIS B 1 114 ? -27.807 -8.560  -59.886 1.00 46.66  ? 1597 HIS B O   1 
ATOM   4522 C CB  . HIS B 1 114 ? -25.886 -9.887  -62.382 1.00 52.60  ? 1597 HIS B CB  1 
ATOM   4523 C CG  . HIS B 1 114 ? -24.786 -9.634  -61.403 1.00 54.38  ? 1597 HIS B CG  1 
ATOM   4524 N ND1 . HIS B 1 114 ? -24.453 -10.536 -60.415 1.00 53.88  ? 1597 HIS B ND1 1 
ATOM   4525 C CD2 . HIS B 1 114 ? -23.964 -8.570  -61.239 1.00 54.42  ? 1597 HIS B CD2 1 
ATOM   4526 C CE1 . HIS B 1 114 ? -23.475 -10.035 -59.683 1.00 55.79  ? 1597 HIS B CE1 1 
ATOM   4527 N NE2 . HIS B 1 114 ? -23.159 -8.845  -60.161 1.00 54.81  ? 1597 HIS B NE2 1 
ATOM   4528 N N   . ASP B 1 115 ? -27.785 -7.623  -61.949 1.00 50.36  ? 1598 ASP B N   1 
ATOM   4529 C CA  . ASP B 1 115 ? -28.131 -6.260  -61.514 1.00 51.48  ? 1598 ASP B CA  1 
ATOM   4530 C C   . ASP B 1 115 ? -29.481 -6.163  -60.798 1.00 52.80  ? 1598 ASP B C   1 
ATOM   4531 O O   . ASP B 1 115 ? -29.564 -5.669  -59.675 1.00 53.53  ? 1598 ASP B O   1 
ATOM   4532 C CB  . ASP B 1 115 ? -28.173 -5.280  -62.699 1.00 50.93  ? 1598 ASP B CB  1 
ATOM   4533 C CG  . ASP B 1 115 ? -26.906 -5.284  -63.532 1.00 50.65  ? 1598 ASP B CG  1 
ATOM   4534 O OD1 . ASP B 1 115 ? -25.844 -5.717  -63.033 1.00 51.19  ? 1598 ASP B OD1 1 
ATOM   4535 O OD2 . ASP B 1 115 ? -26.977 -4.831  -64.696 1.00 48.99  ? 1598 ASP B OD2 1 
ATOM   4536 N N   . LEU B 1 116 ? -30.543 -6.620  -61.457 1.00 53.25  ? 1599 LEU B N   1 
ATOM   4537 C CA  . LEU B 1 116 ? -31.876 -6.550  -60.868 1.00 53.65  ? 1599 LEU B CA  1 
ATOM   4538 C C   . LEU B 1 116 ? -32.200 -7.836  -60.104 1.00 54.38  ? 1599 LEU B C   1 
ATOM   4539 O O   . LEU B 1 116 ? -32.704 -8.804  -60.675 1.00 52.39  ? 1599 LEU B O   1 
ATOM   4540 C CB  . LEU B 1 116 ? -32.899 -6.297  -61.976 1.00 52.28  ? 1599 LEU B CB  1 
ATOM   4541 C CG  . LEU B 1 116 ? -32.516 -5.159  -62.934 1.00 50.27  ? 1599 LEU B CG  1 
ATOM   4542 C CD1 . LEU B 1 116 ? -33.575 -5.010  -64.014 1.00 51.28  ? 1599 LEU B CD1 1 
ATOM   4543 C CD2 . LEU B 1 116 ? -32.367 -3.869  -62.171 1.00 48.53  ? 1599 LEU B CD2 1 
ATOM   4544 N N   . ARG B 1 117 ? -31.913 -7.835  -58.803 1.00 56.57  ? 1600 ARG B N   1 
ATOM   4545 C CA  . ARG B 1 117 ? -32.148 -9.016  -57.963 1.00 59.14  ? 1600 ARG B CA  1 
ATOM   4546 C C   . ARG B 1 117 ? -33.588 -9.570  -58.028 1.00 59.06  ? 1600 ARG B C   1 
ATOM   4547 O O   . ARG B 1 117 ? -33.794 -10.787 -58.030 1.00 58.97  ? 1600 ARG B O   1 
ATOM   4548 C CB  . ARG B 1 117 ? -31.755 -8.719  -56.506 1.00 60.31  ? 1600 ARG B CB  1 
ATOM   4549 C CG  . ARG B 1 117 ? -31.342 -9.955  -55.693 1.00 62.26  ? 1600 ARG B CG  1 
ATOM   4550 C CD  . ARG B 1 117 ? -31.004 -9.586  -54.252 1.00 64.92  ? 1600 ARG B CD  1 
ATOM   4551 N NE  . ARG B 1 117 ? -30.020 -8.505  -54.197 1.00 68.56  ? 1600 ARG B NE  1 
ATOM   4552 C CZ  . ARG B 1 117 ? -28.715 -8.651  -54.424 1.00 69.52  ? 1600 ARG B CZ  1 
ATOM   4553 N NH1 . ARG B 1 117 ? -28.216 -9.851  -54.717 1.00 70.32  ? 1600 ARG B NH1 1 
ATOM   4554 N NH2 . ARG B 1 117 ? -27.911 -7.591  -54.387 1.00 68.00  ? 1600 ARG B NH2 1 
ATOM   4555 N N   . PRO B 1 118 ? -34.603 -8.688  -58.072 1.00 59.17  ? 1601 PRO B N   1 
ATOM   4556 C CA  . PRO B 1 118 ? -36.000 -9.152  -58.143 1.00 58.66  ? 1601 PRO B CA  1 
ATOM   4557 C C   . PRO B 1 118 ? -36.322 -9.994  -59.395 1.00 58.00  ? 1601 PRO B C   1 
ATOM   4558 O O   . PRO B 1 118 ? -37.304 -10.733 -59.413 1.00 59.54  ? 1601 PRO B O   1 
ATOM   4559 C CB  . PRO B 1 118 ? -36.795 -7.849  -58.098 1.00 58.11  ? 1601 PRO B CB  1 
ATOM   4560 C CG  . PRO B 1 118 ? -35.950 -6.989  -57.220 1.00 58.76  ? 1601 PRO B CG  1 
ATOM   4561 C CD  . PRO B 1 118 ? -34.551 -7.248  -57.764 1.00 59.28  ? 1601 PRO B CD  1 
ATOM   4562 N N   . LEU B 1 119 ? -35.500 -9.882  -60.434 1.00 56.16  ? 1602 LEU B N   1 
ATOM   4563 C CA  . LEU B 1 119 ? -35.705 -10.641 -61.657 1.00 54.63  ? 1602 LEU B CA  1 
ATOM   4564 C C   . LEU B 1 119 ? -35.087 -12.041 -61.596 1.00 53.76  ? 1602 LEU B C   1 
ATOM   4565 O O   . LEU B 1 119 ? -35.345 -12.878 -62.455 1.00 53.67  ? 1602 LEU B O   1 
ATOM   4566 C CB  . LEU B 1 119 ? -35.104 -9.889  -62.843 1.00 56.18  ? 1602 LEU B CB  1 
ATOM   4567 C CG  . LEU B 1 119 ? -35.689 -8.518  -63.182 1.00 57.83  ? 1602 LEU B CG  1 
ATOM   4568 C CD1 . LEU B 1 119 ? -35.231 -8.114  -64.585 1.00 57.74  ? 1602 LEU B CD1 1 
ATOM   4569 C CD2 . LEU B 1 119 ? -37.214 -8.580  -63.137 1.00 58.46  ? 1602 LEU B CD2 1 
ATOM   4570 N N   . ARG B 1 120 ? -34.264 -12.299 -60.588 1.00 52.14  ? 1603 ARG B N   1 
ATOM   4571 C CA  . ARG B 1 120 ? -33.626 -13.602 -60.458 1.00 50.08  ? 1603 ARG B CA  1 
ATOM   4572 C C   . ARG B 1 120 ? -34.635 -14.732 -60.370 1.00 48.49  ? 1603 ARG B C   1 
ATOM   4573 O O   . ARG B 1 120 ? -34.461 -15.762 -61.012 1.00 48.11  ? 1603 ARG B O   1 
ATOM   4574 C CB  . ARG B 1 120 ? -32.693 -13.624 -59.243 1.00 49.96  ? 1603 ARG B CB  1 
ATOM   4575 C CG  . ARG B 1 120 ? -31.515 -12.682 -59.404 1.00 49.74  ? 1603 ARG B CG  1 
ATOM   4576 C CD  . ARG B 1 120 ? -30.554 -12.736 -58.241 1.00 49.63  ? 1603 ARG B CD  1 
ATOM   4577 N NE  . ARG B 1 120 ? -29.466 -11.784 -58.445 1.00 49.94  ? 1603 ARG B NE  1 
ATOM   4578 C CZ  . ARG B 1 120 ? -28.438 -11.625 -57.618 1.00 49.59  ? 1603 ARG B CZ  1 
ATOM   4579 N NH1 . ARG B 1 120 ? -28.351 -12.368 -56.518 1.00 48.03  ? 1603 ARG B NH1 1 
ATOM   4580 N NH2 . ARG B 1 120 ? -27.511 -10.709 -57.890 1.00 48.81  ? 1603 ARG B NH2 1 
ATOM   4581 N N   . ASP B 1 121 ? -35.684 -14.549 -59.572 1.00 47.20  ? 1604 ASP B N   1 
ATOM   4582 C CA  . ASP B 1 121 ? -36.710 -15.573 -59.445 1.00 45.09  ? 1604 ASP B CA  1 
ATOM   4583 C C   . ASP B 1 121 ? -37.452 -15.637 -60.755 1.00 43.46  ? 1604 ASP B C   1 
ATOM   4584 O O   . ASP B 1 121 ? -37.784 -16.712 -61.230 1.00 43.32  ? 1604 ASP B O   1 
ATOM   4585 C CB  . ASP B 1 121 ? -37.706 -15.237 -58.330 1.00 47.55  ? 1604 ASP B CB  1 
ATOM   4586 C CG  . ASP B 1 121 ? -37.247 -15.721 -56.961 1.00 49.04  ? 1604 ASP B CG  1 
ATOM   4587 O OD1 . ASP B 1 121 ? -36.189 -16.378 -56.873 1.00 48.61  ? 1604 ASP B OD1 1 
ATOM   4588 O OD2 . ASP B 1 121 ? -37.954 -15.446 -55.969 1.00 49.40  ? 1604 ASP B OD2 1 
ATOM   4589 N N   . GLU B 1 122 ? -37.701 -14.469 -61.338 1.00 42.37  ? 1605 GLU B N   1 
ATOM   4590 C CA  . GLU B 1 122 ? -38.422 -14.360 -62.596 1.00 40.80  ? 1605 GLU B CA  1 
ATOM   4591 C C   . GLU B 1 122 ? -37.804 -15.189 -63.709 1.00 39.44  ? 1605 GLU B C   1 
ATOM   4592 O O   . GLU B 1 122 ? -38.493 -16.020 -64.314 1.00 38.52  ? 1605 GLU B O   1 
ATOM   4593 C CB  . GLU B 1 122 ? -38.500 -12.897 -63.020 1.00 41.83  ? 1605 GLU B CB  1 
ATOM   4594 C CG  . GLU B 1 122 ? -39.207 -12.666 -64.353 1.00 45.67  ? 1605 GLU B CG  1 
ATOM   4595 C CD  . GLU B 1 122 ? -40.681 -13.061 -64.331 1.00 47.22  ? 1605 GLU B CD  1 
ATOM   4596 O OE1 . GLU B 1 122 ? -41.341 -12.829 -63.289 1.00 47.90  ? 1605 GLU B OE1 1 
ATOM   4597 O OE2 . GLU B 1 122 ? -41.180 -13.585 -65.357 1.00 47.15  ? 1605 GLU B OE2 1 
ATOM   4598 N N   . LEU B 1 123 ? -36.512 -14.970 -63.964 1.00 38.36  ? 1606 LEU B N   1 
ATOM   4599 C CA  . LEU B 1 123 ? -35.798 -15.691 -65.009 1.00 38.47  ? 1606 LEU B CA  1 
ATOM   4600 C C   . LEU B 1 123 ? -35.889 -17.194 -64.804 1.00 38.27  ? 1606 LEU B C   1 
ATOM   4601 O O   . LEU B 1 123 ? -36.034 -17.955 -65.773 1.00 39.30  ? 1606 LEU B O   1 
ATOM   4602 C CB  . LEU B 1 123 ? -34.330 -15.288 -65.058 1.00 39.80  ? 1606 LEU B CB  1 
ATOM   4603 C CG  . LEU B 1 123 ? -33.993 -13.808 -65.236 1.00 41.88  ? 1606 LEU B CG  1 
ATOM   4604 C CD1 . LEU B 1 123 ? -32.516 -13.703 -65.566 1.00 42.94  ? 1606 LEU B CD1 1 
ATOM   4605 C CD2 . LEU B 1 123 ? -34.820 -13.176 -66.326 1.00 41.04  ? 1606 LEU B CD2 1 
ATOM   4606 N N   . TYR B 1 124 ? -35.808 -17.626 -63.552 1.00 35.54  ? 1607 TYR B N   1 
ATOM   4607 C CA  . TYR B 1 124 ? -35.905 -19.045 -63.248 1.00 33.44  ? 1607 TYR B CA  1 
ATOM   4608 C C   . TYR B 1 124 ? -37.280 -19.615 -63.591 1.00 31.92  ? 1607 TYR B C   1 
ATOM   4609 O O   . TYR B 1 124 ? -37.391 -20.688 -64.198 1.00 30.70  ? 1607 TYR B O   1 
ATOM   4610 C CB  . TYR B 1 124 ? -35.559 -19.292 -61.781 1.00 32.29  ? 1607 TYR B CB  1 
ATOM   4611 C CG  . TYR B 1 124 ? -34.078 -19.475 -61.538 1.00 31.24  ? 1607 TYR B CG  1 
ATOM   4612 C CD1 . TYR B 1 124 ? -33.435 -20.649 -61.925 1.00 31.64  ? 1607 TYR B CD1 1 
ATOM   4613 C CD2 . TYR B 1 124 ? -33.321 -18.482 -60.926 1.00 28.40  ? 1607 TYR B CD2 1 
ATOM   4614 C CE1 . TYR B 1 124 ? -32.071 -20.831 -61.700 1.00 31.97  ? 1607 TYR B CE1 1 
ATOM   4615 C CE2 . TYR B 1 124 ? -31.965 -18.648 -60.704 1.00 28.84  ? 1607 TYR B CE2 1 
ATOM   4616 C CZ  . TYR B 1 124 ? -31.345 -19.825 -61.088 1.00 30.20  ? 1607 TYR B CZ  1 
ATOM   4617 O OH  . TYR B 1 124 ? -30.009 -20.027 -60.836 1.00 29.91  ? 1607 TYR B OH  1 
ATOM   4618 N N   . CYS B 1 125 ? -38.335 -18.907 -63.220 1.00 31.36  ? 1608 CYS B N   1 
ATOM   4619 C CA  . CYS B 1 125 ? -39.673 -19.400 -63.540 1.00 31.71  ? 1608 CYS B CA  1 
ATOM   4620 C C   . CYS B 1 125 ? -39.854 -19.377 -65.050 1.00 31.27  ? 1608 CYS B C   1 
ATOM   4621 O O   . CYS B 1 125 ? -40.465 -20.280 -65.623 1.00 31.16  ? 1608 CYS B O   1 
ATOM   4622 C CB  . CYS B 1 125 ? -40.741 -18.556 -62.846 1.00 31.96  ? 1608 CYS B CB  1 
ATOM   4623 S SG  . CYS B 1 125 ? -40.777 -18.827 -61.051 1.00 33.68  ? 1608 CYS B SG  1 
ATOM   4624 N N   . GLN B 1 126 ? -39.296 -18.354 -65.690 1.00 30.52  ? 1609 GLN B N   1 
ATOM   4625 C CA  . GLN B 1 126 ? -39.367 -18.236 -67.135 1.00 29.14  ? 1609 GLN B CA  1 
ATOM   4626 C C   . GLN B 1 126 ? -38.652 -19.414 -67.799 1.00 30.23  ? 1609 GLN B C   1 
ATOM   4627 O O   . GLN B 1 126 ? -39.189 -19.989 -68.750 1.00 30.60  ? 1609 GLN B O   1 
ATOM   4628 C CB  . GLN B 1 126 ? -38.758 -16.915 -67.597 1.00 29.35  ? 1609 GLN B CB  1 
ATOM   4629 C CG  . GLN B 1 126 ? -39.714 -15.733 -67.551 1.00 26.69  ? 1609 GLN B CG  1 
ATOM   4630 C CD  . GLN B 1 126 ? -39.130 -14.491 -68.200 1.00 28.81  ? 1609 GLN B CD  1 
ATOM   4631 O OE1 . GLN B 1 126 ? -38.224 -14.587 -69.016 1.00 34.27  ? 1609 GLN B OE1 1 
ATOM   4632 N NE2 . GLN B 1 126 ? -39.655 -13.321 -67.857 1.00 26.47  ? 1609 GLN B NE2 1 
ATOM   4633 N N   . LEU B 1 127 ? -37.458 -19.783 -67.321 1.00 29.72  ? 1610 LEU B N   1 
ATOM   4634 C CA  . LEU B 1 127 ? -36.755 -20.940 -67.896 1.00 31.15  ? 1610 LEU B CA  1 
ATOM   4635 C C   . LEU B 1 127 ? -37.389 -22.271 -67.479 1.00 33.94  ? 1610 LEU B C   1 
ATOM   4636 O O   . LEU B 1 127 ? -37.362 -23.246 -68.245 1.00 36.22  ? 1610 LEU B O   1 
ATOM   4637 C CB  . LEU B 1 127 ? -35.270 -20.980 -67.519 1.00 31.47  ? 1610 LEU B CB  1 
ATOM   4638 C CG  . LEU B 1 127 ? -34.249 -20.188 -68.341 1.00 31.11  ? 1610 LEU B CG  1 
ATOM   4639 C CD1 . LEU B 1 127 ? -34.519 -20.402 -69.804 1.00 31.37  ? 1610 LEU B CD1 1 
ATOM   4640 C CD2 . LEU B 1 127 ? -34.327 -18.718 -68.028 1.00 33.13  ? 1610 LEU B CD2 1 
ATOM   4641 N N   . ILE B 1 128 ? -37.938 -22.340 -66.266 1.00 35.09  ? 1611 ILE B N   1 
ATOM   4642 C CA  . ILE B 1 128 ? -38.599 -23.571 -65.840 1.00 35.59  ? 1611 ILE B CA  1 
ATOM   4643 C C   . ILE B 1 128 ? -39.844 -23.739 -66.731 1.00 37.27  ? 1611 ILE B C   1 
ATOM   4644 O O   . ILE B 1 128 ? -40.169 -24.847 -67.168 1.00 38.24  ? 1611 ILE B O   1 
ATOM   4645 C CB  . ILE B 1 128 ? -39.027 -23.509 -64.362 1.00 35.58  ? 1611 ILE B CB  1 
ATOM   4646 C CG1 . ILE B 1 128 ? -37.816 -23.756 -63.456 1.00 34.48  ? 1611 ILE B CG1 1 
ATOM   4647 C CG2 . ILE B 1 128 ? -40.129 -24.539 -64.099 1.00 33.38  ? 1611 ILE B CG2 1 
ATOM   4648 C CD1 . ILE B 1 128 ? -38.126 -23.653 -61.965 1.00 33.96  ? 1611 ILE B CD1 1 
ATOM   4649 N N   . LYS B 1 129 ? -40.524 -22.624 -67.000 1.00 37.24  ? 1612 LYS B N   1 
ATOM   4650 C CA  . LYS B 1 129 ? -41.714 -22.621 -67.854 1.00 38.72  ? 1612 LYS B CA  1 
ATOM   4651 C C   . LYS B 1 129 ? -41.358 -23.065 -69.280 1.00 39.23  ? 1612 LYS B C   1 
ATOM   4652 O O   . LYS B 1 129 ? -41.960 -23.999 -69.802 1.00 37.95  ? 1612 LYS B O   1 
ATOM   4653 C CB  . LYS B 1 129 ? -42.329 -21.212 -67.896 1.00 39.55  ? 1612 LYS B CB  1 
ATOM   4654 C CG  . LYS B 1 129 ? -43.231 -20.938 -69.102 1.00 40.40  ? 1612 LYS B CG  1 
ATOM   4655 C CD  . LYS B 1 129 ? -43.697 -19.483 -69.121 1.00 40.06  ? 1612 LYS B CD  1 
ATOM   4656 C CE  . LYS B 1 129 ? -44.608 -19.177 -70.312 1.00 37.17  ? 1612 LYS B CE  1 
ATOM   4657 N NZ  . LYS B 1 129 ? -45.881 -19.943 -70.256 1.00 37.50  ? 1612 LYS B NZ  1 
ATOM   4658 N N   . GLN B 1 130 ? -40.370 -22.404 -69.890 1.00 39.59  ? 1613 GLN B N   1 
ATOM   4659 C CA  . GLN B 1 130 ? -39.947 -22.728 -71.259 1.00 39.27  ? 1613 GLN B CA  1 
ATOM   4660 C C   . GLN B 1 130 ? -39.227 -24.065 -71.413 1.00 39.62  ? 1613 GLN B C   1 
ATOM   4661 O O   . GLN B 1 130 ? -38.915 -24.470 -72.529 1.00 37.62  ? 1613 GLN B O   1 
ATOM   4662 C CB  . GLN B 1 130 ? -39.070 -21.614 -71.843 1.00 37.16  ? 1613 GLN B CB  1 
ATOM   4663 C CG  . GLN B 1 130 ? -39.795 -20.307 -72.129 1.00 38.45  ? 1613 GLN B CG  1 
ATOM   4664 C CD  . GLN B 1 130 ? -41.054 -20.483 -72.986 1.00 40.23  ? 1613 GLN B CD  1 
ATOM   4665 O OE1 . GLN B 1 130 ? -42.051 -21.059 -72.547 1.00 42.42  ? 1613 GLN B OE1 1 
ATOM   4666 N NE2 . GLN B 1 130 ? -41.009 -19.982 -74.212 1.00 40.28  ? 1613 GLN B NE2 1 
ATOM   4667 N N   . THR B 1 131 ? -38.945 -24.745 -70.306 1.00 41.05  ? 1614 THR B N   1 
ATOM   4668 C CA  . THR B 1 131 ? -38.305 -26.050 -70.416 1.00 44.75  ? 1614 THR B CA  1 
ATOM   4669 C C   . THR B 1 131 ? -39.274 -27.124 -69.955 1.00 46.53  ? 1614 THR B C   1 
ATOM   4670 O O   . THR B 1 131 ? -38.904 -28.289 -69.837 1.00 48.05  ? 1614 THR B O   1 
ATOM   4671 C CB  . THR B 1 131 ? -37.000 -26.161 -69.579 1.00 44.55  ? 1614 THR B CB  1 
ATOM   4672 O OG1 . THR B 1 131 ? -37.279 -25.894 -68.201 1.00 45.13  ? 1614 THR B OG1 1 
ATOM   4673 C CG2 . THR B 1 131 ? -35.954 -25.190 -70.099 1.00 44.26  ? 1614 THR B CG2 1 
ATOM   4674 N N   . ASN B 1 132 ? -40.520 -26.724 -69.705 1.00 48.45  ? 1615 ASN B N   1 
ATOM   4675 C CA  . ASN B 1 132 ? -41.553 -27.650 -69.256 1.00 49.72  ? 1615 ASN B CA  1 
ATOM   4676 C C   . ASN B 1 132 ? -42.632 -27.899 -70.315 1.00 50.80  ? 1615 ASN B C   1 
ATOM   4677 O O   . ASN B 1 132 ? -43.351 -26.984 -70.724 1.00 49.87  ? 1615 ASN B O   1 
ATOM   4678 C CB  . ASN B 1 132 ? -42.196 -27.132 -67.968 1.00 49.36  ? 1615 ASN B CB  1 
ATOM   4679 C CG  . ASN B 1 132 ? -43.201 -28.115 -67.382 1.00 50.96  ? 1615 ASN B CG  1 
ATOM   4680 O OD1 . ASN B 1 132 ? -42.940 -29.324 -67.303 1.00 50.36  ? 1615 ASN B OD1 1 
ATOM   4681 N ND2 . ASN B 1 132 ? -44.349 -27.601 -66.956 1.00 49.49  ? 1615 ASN B ND2 1 
ATOM   4682 N N   . LYS B 1 133 ? -42.730 -29.154 -70.750 1.00 52.47  ? 1616 LYS B N   1 
ATOM   4683 C CA  . LYS B 1 133 ? -43.706 -29.580 -71.748 1.00 54.35  ? 1616 LYS B CA  1 
ATOM   4684 C C   . LYS B 1 133 ? -43.545 -28.885 -73.109 1.00 55.56  ? 1616 LYS B C   1 
ATOM   4685 O O   . LYS B 1 133 ? -44.506 -28.376 -73.682 1.00 55.70  ? 1616 LYS B O   1 
ATOM   4686 C CB  . LYS B 1 133 ? -45.129 -29.360 -71.207 1.00 53.99  ? 1616 LYS B CB  1 
ATOM   4687 C CG  . LYS B 1 133 ? -45.349 -29.877 -69.788 1.00 52.45  ? 1616 LYS B CG  1 
ATOM   4688 C CD  . LYS B 1 133 ? -45.092 -31.363 -69.677 1.00 51.91  ? 1616 LYS B CD  1 
ATOM   4689 C CE  . LYS B 1 133 ? -45.174 -31.819 -68.234 1.00 52.03  ? 1616 LYS B CE  1 
ATOM   4690 N NZ  . LYS B 1 133 ? -44.570 -33.167 -68.074 1.00 53.45  ? 1616 LYS B NZ  1 
ATOM   4691 N N   . VAL B 1 134 ? -42.322 -28.861 -73.617 1.00 57.48  ? 1617 VAL B N   1 
ATOM   4692 C CA  . VAL B 1 134 ? -42.047 -28.246 -74.909 1.00 58.99  ? 1617 VAL B CA  1 
ATOM   4693 C C   . VAL B 1 134 ? -42.520 -29.195 -76.017 1.00 59.73  ? 1617 VAL B C   1 
ATOM   4694 O O   . VAL B 1 134 ? -42.649 -30.399 -75.806 1.00 58.82  ? 1617 VAL B O   1 
ATOM   4695 C CB  . VAL B 1 134 ? -40.527 -27.964 -75.074 1.00 59.40  ? 1617 VAL B CB  1 
ATOM   4696 C CG1 . VAL B 1 134 ? -40.089 -26.903 -74.082 1.00 58.06  ? 1617 VAL B CG1 1 
ATOM   4697 C CG2 . VAL B 1 134 ? -39.729 -29.244 -74.849 1.00 59.16  ? 1617 VAL B CG2 1 
ATOM   4698 N N   . PRO B 1 135 ? -42.783 -28.659 -77.215 1.00 61.92  ? 1618 PRO B N   1 
ATOM   4699 C CA  . PRO B 1 135 ? -43.248 -29.476 -78.346 1.00 63.11  ? 1618 PRO B CA  1 
ATOM   4700 C C   . PRO B 1 135 ? -42.164 -30.383 -78.949 1.00 64.43  ? 1618 PRO B C   1 
ATOM   4701 O O   . PRO B 1 135 ? -42.456 -31.476 -79.437 1.00 64.91  ? 1618 PRO B O   1 
ATOM   4702 C CB  . PRO B 1 135 ? -43.735 -28.427 -79.338 1.00 62.41  ? 1618 PRO B CB  1 
ATOM   4703 C CG  . PRO B 1 135 ? -42.729 -27.320 -79.133 1.00 63.09  ? 1618 PRO B CG  1 
ATOM   4704 C CD  . PRO B 1 135 ? -42.626 -27.245 -77.612 1.00 62.34  ? 1618 PRO B CD  1 
ATOM   4705 N N   . HIS B 1 136 ? -40.916 -29.925 -78.916 1.00 65.11  ? 1619 HIS B N   1 
ATOM   4706 C CA  . HIS B 1 136 ? -39.822 -30.704 -79.468 1.00 65.44  ? 1619 HIS B CA  1 
ATOM   4707 C C   . HIS B 1 136 ? -38.655 -30.871 -78.522 1.00 64.54  ? 1619 HIS B C   1 
ATOM   4708 O O   . HIS B 1 136 ? -37.654 -30.153 -78.611 1.00 64.58  ? 1619 HIS B O   1 
ATOM   4709 C CB  . HIS B 1 136 ? -39.329 -30.080 -80.770 1.00 68.71  ? 1619 HIS B CB  1 
ATOM   4710 C CG  . HIS B 1 136 ? -40.312 -30.184 -81.893 1.00 71.95  ? 1619 HIS B CG  1 
ATOM   4711 N ND1 . HIS B 1 136 ? -40.911 -31.376 -82.246 1.00 72.48  ? 1619 HIS B ND1 1 
ATOM   4712 C CD2 . HIS B 1 136 ? -40.809 -29.247 -82.735 1.00 72.21  ? 1619 HIS B CD2 1 
ATOM   4713 C CE1 . HIS B 1 136 ? -41.737 -31.166 -83.255 1.00 73.20  ? 1619 HIS B CE1 1 
ATOM   4714 N NE2 . HIS B 1 136 ? -41.694 -29.883 -83.572 1.00 73.93  ? 1619 HIS B NE2 1 
ATOM   4715 N N   . PRO B 1 137 ? -38.760 -31.835 -77.605 1.00 63.22  ? 1620 PRO B N   1 
ATOM   4716 C CA  . PRO B 1 137 ? -37.676 -32.072 -76.652 1.00 62.65  ? 1620 PRO B CA  1 
ATOM   4717 C C   . PRO B 1 137 ? -36.393 -32.457 -77.387 1.00 61.74  ? 1620 PRO B C   1 
ATOM   4718 O O   . PRO B 1 137 ? -36.407 -33.326 -78.262 1.00 62.48  ? 1620 PRO B O   1 
ATOM   4719 C CB  . PRO B 1 137 ? -38.224 -33.205 -75.784 1.00 62.22  ? 1620 PRO B CB  1 
ATOM   4720 C CG  . PRO B 1 137 ? -39.120 -33.948 -76.729 1.00 62.60  ? 1620 PRO B CG  1 
ATOM   4721 C CD  . PRO B 1 137 ? -39.833 -32.830 -77.443 1.00 62.88  ? 1620 PRO B CD  1 
ATOM   4722 N N   . GLY B 1 138 ? -35.289 -31.800 -77.043 1.00 60.90  ? 1621 GLY B N   1 
ATOM   4723 C CA  . GLY B 1 138 ? -34.018 -32.099 -77.678 1.00 57.94  ? 1621 GLY B CA  1 
ATOM   4724 C C   . GLY B 1 138 ? -33.668 -31.132 -78.785 1.00 55.49  ? 1621 GLY B C   1 
ATOM   4725 O O   . GLY B 1 138 ? -32.506 -30.986 -79.133 1.00 55.64  ? 1621 GLY B O   1 
ATOM   4726 N N   . SER B 1 139 ? -34.674 -30.461 -79.333 1.00 54.30  ? 1622 SER B N   1 
ATOM   4727 C CA  . SER B 1 139 ? -34.446 -29.507 -80.414 1.00 52.69  ? 1622 SER B CA  1 
ATOM   4728 C C   . SER B 1 139 ? -33.434 -28.464 -79.987 1.00 51.71  ? 1622 SER B C   1 
ATOM   4729 O O   . SER B 1 139 ? -33.163 -28.300 -78.801 1.00 52.70  ? 1622 SER B O   1 
ATOM   4730 C CB  . SER B 1 139 ? -35.746 -28.793 -80.795 1.00 52.05  ? 1622 SER B CB  1 
ATOM   4731 O OG  . SER B 1 139 ? -36.046 -27.751 -79.884 1.00 51.30  ? 1622 SER B OG  1 
ATOM   4732 N N   . VAL B 1 140 ? -32.882 -27.752 -80.959 1.00 51.04  ? 1623 VAL B N   1 
ATOM   4733 C CA  . VAL B 1 140 ? -31.915 -26.709 -80.663 1.00 51.04  ? 1623 VAL B CA  1 
ATOM   4734 C C   . VAL B 1 140 ? -32.494 -25.810 -79.578 1.00 49.27  ? 1623 VAL B C   1 
ATOM   4735 O O   . VAL B 1 140 ? -31.899 -25.647 -78.513 1.00 50.39  ? 1623 VAL B O   1 
ATOM   4736 C CB  . VAL B 1 140 ? -31.605 -25.845 -81.921 1.00 52.70  ? 1623 VAL B CB  1 
ATOM   4737 C CG1 . VAL B 1 140 ? -30.767 -24.612 -81.530 1.00 53.42  ? 1623 VAL B CG1 1 
ATOM   4738 C CG2 . VAL B 1 140 ? -30.866 -26.679 -82.948 1.00 51.01  ? 1623 VAL B CG2 1 
ATOM   4739 N N   . GLY B 1 141 ? -33.661 -25.238 -79.853 1.00 46.54  ? 1624 GLY B N   1 
ATOM   4740 C CA  . GLY B 1 141 ? -34.305 -24.359 -78.890 1.00 44.62  ? 1624 GLY B CA  1 
ATOM   4741 C C   . GLY B 1 141 ? -34.381 -24.899 -77.468 1.00 42.79  ? 1624 GLY B C   1 
ATOM   4742 O O   . GLY B 1 141 ? -34.108 -24.183 -76.502 1.00 39.27  ? 1624 GLY B O   1 
ATOM   4743 N N   . ASN B 1 142 ? -34.750 -26.168 -77.332 1.00 42.61  ? 1625 ASN B N   1 
ATOM   4744 C CA  . ASN B 1 142 ? -34.867 -26.760 -76.012 1.00 42.65  ? 1625 ASN B CA  1 
ATOM   4745 C C   . ASN B 1 142 ? -33.498 -26.748 -75.345 1.00 43.75  ? 1625 ASN B C   1 
ATOM   4746 O O   . ASN B 1 142 ? -33.372 -26.434 -74.155 1.00 44.12  ? 1625 ASN B O   1 
ATOM   4747 C CB  . ASN B 1 142 ? -35.388 -28.199 -76.108 1.00 39.92  ? 1625 ASN B CB  1 
ATOM   4748 C CG  . ASN B 1 142 ? -35.894 -28.728 -74.771 1.00 37.42  ? 1625 ASN B CG  1 
ATOM   4749 O OD1 . ASN B 1 142 ? -35.776 -29.913 -74.481 1.00 37.22  ? 1625 ASN B OD1 1 
ATOM   4750 N ND2 . ASN B 1 142 ? -36.471 -27.849 -73.961 1.00 34.07  ? 1625 ASN B ND2 1 
ATOM   4751 N N   . LEU B 1 143 ? -32.474 -27.096 -76.122 1.00 44.37  ? 1626 LEU B N   1 
ATOM   4752 C CA  . LEU B 1 143 ? -31.109 -27.134 -75.619 1.00 43.26  ? 1626 LEU B CA  1 
ATOM   4753 C C   . LEU B 1 143 ? -30.632 -25.750 -75.213 1.00 42.19  ? 1626 LEU B C   1 
ATOM   4754 O O   . LEU B 1 143 ? -29.899 -25.617 -74.251 1.00 42.61  ? 1626 LEU B O   1 
ATOM   4755 C CB  . LEU B 1 143 ? -30.172 -27.721 -76.669 1.00 43.89  ? 1626 LEU B CB  1 
ATOM   4756 C CG  . LEU B 1 143 ? -30.394 -29.186 -77.037 1.00 45.34  ? 1626 LEU B CG  1 
ATOM   4757 C CD1 . LEU B 1 143 ? -29.151 -29.691 -77.784 1.00 46.44  ? 1626 LEU B CD1 1 
ATOM   4758 C CD2 . LEU B 1 143 ? -30.616 -30.031 -75.785 1.00 45.98  ? 1626 LEU B CD2 1 
ATOM   4759 N N   . TYR B 1 144 ? -31.044 -24.724 -75.949 1.00 41.36  ? 1627 TYR B N   1 
ATOM   4760 C CA  . TYR B 1 144 ? -30.658 -23.362 -75.611 1.00 42.67  ? 1627 TYR B CA  1 
ATOM   4761 C C   . TYR B 1 144 ? -31.179 -23.022 -74.220 1.00 40.54  ? 1627 TYR B C   1 
ATOM   4762 O O   . TYR B 1 144 ? -30.449 -22.507 -73.374 1.00 39.18  ? 1627 TYR B O   1 
ATOM   4763 C CB  . TYR B 1 144 ? -31.223 -22.365 -76.630 1.00 45.93  ? 1627 TYR B CB  1 
ATOM   4764 C CG  . TYR B 1 144 ? -30.369 -22.166 -77.863 1.00 52.43  ? 1627 TYR B CG  1 
ATOM   4765 C CD1 . TYR B 1 144 ? -29.246 -22.980 -78.112 1.00 55.15  ? 1627 TYR B CD1 1 
ATOM   4766 C CD2 . TYR B 1 144 ? -30.683 -21.175 -78.796 1.00 55.42  ? 1627 TYR B CD2 1 
ATOM   4767 C CE1 . TYR B 1 144 ? -28.458 -22.812 -79.263 1.00 56.46  ? 1627 TYR B CE1 1 
ATOM   4768 C CE2 . TYR B 1 144 ? -29.900 -20.995 -79.961 1.00 58.19  ? 1627 TYR B CE2 1 
ATOM   4769 C CZ  . TYR B 1 144 ? -28.792 -21.820 -80.184 1.00 58.73  ? 1627 TYR B CZ  1 
ATOM   4770 O OH  . TYR B 1 144 ? -28.039 -21.651 -81.327 1.00 59.73  ? 1627 TYR B OH  1 
ATOM   4771 N N   . SER B 1 145 ? -32.452 -23.322 -73.994 1.00 39.60  ? 1628 SER B N   1 
ATOM   4772 C CA  . SER B 1 145 ? -33.092 -23.067 -72.720 1.00 37.51  ? 1628 SER B CA  1 
ATOM   4773 C C   . SER B 1 145 ? -32.305 -23.692 -71.573 1.00 37.59  ? 1628 SER B C   1 
ATOM   4774 O O   . SER B 1 145 ? -31.949 -22.998 -70.618 1.00 38.48  ? 1628 SER B O   1 
ATOM   4775 C CB  . SER B 1 145 ? -34.515 -23.611 -72.746 1.00 36.85  ? 1628 SER B CB  1 
ATOM   4776 O OG  . SER B 1 145 ? -35.317 -22.814 -73.590 1.00 36.31  ? 1628 SER B OG  1 
ATOM   4777 N N   . TRP B 1 146 ? -32.031 -24.990 -71.661 1.00 35.56  ? 1629 TRP B N   1 
ATOM   4778 C CA  . TRP B 1 146 ? -31.270 -25.659 -70.620 1.00 36.59  ? 1629 TRP B CA  1 
ATOM   4779 C C   . TRP B 1 146 ? -29.854 -25.080 -70.502 1.00 37.45  ? 1629 TRP B C   1 
ATOM   4780 O O   . TRP B 1 146 ? -29.199 -25.194 -69.452 1.00 35.73  ? 1629 TRP B O   1 
ATOM   4781 C CB  . TRP B 1 146 ? -31.195 -27.166 -70.889 1.00 37.97  ? 1629 TRP B CB  1 
ATOM   4782 C CG  . TRP B 1 146 ? -32.393 -27.899 -70.406 1.00 37.63  ? 1629 TRP B CG  1 
ATOM   4783 C CD1 . TRP B 1 146 ? -33.336 -28.515 -71.164 1.00 38.54  ? 1629 TRP B CD1 1 
ATOM   4784 C CD2 . TRP B 1 146 ? -32.814 -28.038 -69.050 1.00 38.01  ? 1629 TRP B CD2 1 
ATOM   4785 N NE1 . TRP B 1 146 ? -34.328 -29.031 -70.367 1.00 38.65  ? 1629 TRP B NE1 1 
ATOM   4786 C CE2 . TRP B 1 146 ? -34.034 -28.750 -69.061 1.00 38.32  ? 1629 TRP B CE2 1 
ATOM   4787 C CE3 . TRP B 1 146 ? -32.285 -27.627 -67.824 1.00 38.08  ? 1629 TRP B CE3 1 
ATOM   4788 C CZ2 . TRP B 1 146 ? -34.738 -29.061 -67.887 1.00 35.67  ? 1629 TRP B CZ2 1 
ATOM   4789 C CZ3 . TRP B 1 146 ? -32.989 -27.936 -66.658 1.00 39.27  ? 1629 TRP B CZ3 1 
ATOM   4790 C CH2 . TRP B 1 146 ? -34.204 -28.648 -66.704 1.00 34.78  ? 1629 TRP B CH2 1 
ATOM   4791 N N   . GLN B 1 147 ? -29.379 -24.468 -71.581 1.00 36.86  ? 1630 GLN B N   1 
ATOM   4792 C CA  . GLN B 1 147 ? -28.056 -23.862 -71.561 1.00 38.95  ? 1630 GLN B CA  1 
ATOM   4793 C C   . GLN B 1 147 ? -28.101 -22.553 -70.770 1.00 38.65  ? 1630 GLN B C   1 
ATOM   4794 O O   . GLN B 1 147 ? -27.197 -22.254 -69.998 1.00 39.46  ? 1630 GLN B O   1 
ATOM   4795 C CB  . GLN B 1 147 ? -27.568 -23.617 -72.989 1.00 39.88  ? 1630 GLN B CB  1 
ATOM   4796 C CG  . GLN B 1 147 ? -26.831 -24.804 -73.593 1.00 39.15  ? 1630 GLN B CG  1 
ATOM   4797 C CD  . GLN B 1 147 ? -26.844 -24.769 -75.094 1.00 39.67  ? 1630 GLN B CD  1 
ATOM   4798 O OE1 . GLN B 1 147 ? -26.827 -23.696 -75.701 1.00 38.34  ? 1630 GLN B OE1 1 
ATOM   4799 N NE2 . GLN B 1 147 ? -26.870 -25.944 -75.711 1.00 39.47  ? 1630 GLN B NE2 1 
ATOM   4800 N N   . ILE B 1 148 ? -29.162 -21.782 -70.965 1.00 38.51  ? 1631 ILE B N   1 
ATOM   4801 C CA  . ILE B 1 148 ? -29.342 -20.529 -70.247 1.00 38.89  ? 1631 ILE B CA  1 
ATOM   4802 C C   . ILE B 1 148 ? -29.523 -20.827 -68.754 1.00 39.32  ? 1631 ILE B C   1 
ATOM   4803 O O   . ILE B 1 148 ? -28.989 -20.122 -67.898 1.00 39.45  ? 1631 ILE B O   1 
ATOM   4804 C CB  . ILE B 1 148 ? -30.568 -19.785 -70.786 1.00 37.62  ? 1631 ILE B CB  1 
ATOM   4805 C CG1 . ILE B 1 148 ? -30.318 -19.439 -72.255 1.00 38.41  ? 1631 ILE B CG1 1 
ATOM   4806 C CG2 . ILE B 1 148 ? -30.842 -18.544 -69.968 1.00 37.19  ? 1631 ILE B CG2 1 
ATOM   4807 C CD1 . ILE B 1 148 ? -31.499 -18.801 -72.965 1.00 38.25  ? 1631 ILE B CD1 1 
ATOM   4808 N N   . LEU B 1 149 ? -30.261 -21.892 -68.454 1.00 38.94  ? 1632 LEU B N   1 
ATOM   4809 C CA  . LEU B 1 149 ? -30.503 -22.300 -67.071 1.00 38.30  ? 1632 LEU B CA  1 
ATOM   4810 C C   . LEU B 1 149 ? -29.225 -22.824 -66.387 1.00 38.36  ? 1632 LEU B C   1 
ATOM   4811 O O   . LEU B 1 149 ? -29.026 -22.628 -65.181 1.00 39.24  ? 1632 LEU B O   1 
ATOM   4812 C CB  . LEU B 1 149 ? -31.605 -23.369 -67.038 1.00 36.03  ? 1632 LEU B CB  1 
ATOM   4813 C CG  . LEU B 1 149 ? -32.168 -23.833 -65.691 1.00 35.61  ? 1632 LEU B CG  1 
ATOM   4814 C CD1 . LEU B 1 149 ? -32.429 -22.637 -64.790 1.00 29.46  ? 1632 LEU B CD1 1 
ATOM   4815 C CD2 . LEU B 1 149 ? -33.464 -24.642 -65.945 1.00 32.49  ? 1632 LEU B CD2 1 
ATOM   4816 N N   . THR B 1 150 ? -28.362 -23.487 -67.151 1.00 36.63  ? 1633 THR B N   1 
ATOM   4817 C CA  . THR B 1 150 ? -27.126 -24.009 -66.585 1.00 35.97  ? 1633 THR B CA  1 
ATOM   4818 C C   . THR B 1 150 ? -26.195 -22.852 -66.232 1.00 35.37  ? 1633 THR B C   1 
ATOM   4819 O O   . THR B 1 150 ? -25.551 -22.865 -65.175 1.00 34.68  ? 1633 THR B O   1 
ATOM   4820 C CB  . THR B 1 150 ? -26.424 -24.973 -67.566 1.00 36.32  ? 1633 THR B CB  1 
ATOM   4821 O OG1 . THR B 1 150 ? -27.311 -26.054 -67.877 1.00 36.98  ? 1633 THR B OG1 1 
ATOM   4822 C CG2 . THR B 1 150 ? -25.150 -25.539 -66.957 1.00 34.19  ? 1633 THR B CG2 1 
ATOM   4823 N N   . CYS B 1 151 ? -26.144 -21.848 -67.108 1.00 34.32  ? 1634 CYS B N   1 
ATOM   4824 C CA  . CYS B 1 151 ? -25.314 -20.659 -66.898 1.00 33.46  ? 1634 CYS B CA  1 
ATOM   4825 C C   . CYS B 1 151 ? -25.904 -19.797 -65.793 1.00 32.59  ? 1634 CYS B C   1 
ATOM   4826 O O   . CYS B 1 151 ? -25.202 -19.059 -65.097 1.00 31.05  ? 1634 CYS B O   1 
ATOM   4827 C CB  . CYS B 1 151 ? -25.226 -19.838 -68.187 1.00 33.69  ? 1634 CYS B CB  1 
ATOM   4828 S SG  . CYS B 1 151 ? -24.341 -20.691 -69.496 1.00 35.53  ? 1634 CYS B SG  1 
ATOM   4829 N N   . LEU B 1 152 ? -27.214 -19.896 -65.646 1.00 33.88  ? 1635 LEU B N   1 
ATOM   4830 C CA  . LEU B 1 152 ? -27.918 -19.142 -64.625 1.00 34.89  ? 1635 LEU B CA  1 
ATOM   4831 C C   . LEU B 1 152 ? -27.573 -19.712 -63.237 1.00 34.28  ? 1635 LEU B C   1 
ATOM   4832 O O   . LEU B 1 152 ? -27.283 -18.967 -62.300 1.00 32.27  ? 1635 LEU B O   1 
ATOM   4833 C CB  . LEU B 1 152 ? -29.418 -19.222 -64.882 1.00 33.97  ? 1635 LEU B CB  1 
ATOM   4834 C CG  . LEU B 1 152 ? -30.194 -17.964 -64.489 1.00 37.75  ? 1635 LEU B CG  1 
ATOM   4835 C CD1 . LEU B 1 152 ? -29.908 -16.845 -65.485 1.00 38.78  ? 1635 LEU B CD1 1 
ATOM   4836 C CD2 . LEU B 1 152 ? -31.683 -18.281 -64.456 1.00 37.50  ? 1635 LEU B CD2 1 
ATOM   4837 N N   . SER B 1 153 ? -27.575 -21.038 -63.133 1.00 35.26  ? 1636 SER B N   1 
ATOM   4838 C CA  . SER B 1 153 ? -27.283 -21.718 -61.882 1.00 36.83  ? 1636 SER B CA  1 
ATOM   4839 C C   . SER B 1 153 ? -25.823 -21.628 -61.509 1.00 37.99  ? 1636 SER B C   1 
ATOM   4840 O O   . SER B 1 153 ? -25.399 -22.243 -60.537 1.00 38.75  ? 1636 SER B O   1 
ATOM   4841 C CB  . SER B 1 153 ? -27.686 -23.196 -61.965 1.00 37.80  ? 1636 SER B CB  1 
ATOM   4842 O OG  . SER B 1 153 ? -26.817 -23.937 -62.802 1.00 39.10  ? 1636 SER B OG  1 
ATOM   4843 N N   . CYS B 1 154 ? -25.050 -20.893 -62.301 1.00 39.18  ? 1637 CYS B N   1 
ATOM   4844 C CA  . CYS B 1 154 ? -23.624 -20.706 -62.035 1.00 39.23  ? 1637 CYS B CA  1 
ATOM   4845 C C   . CYS B 1 154 ? -23.320 -19.215 -61.827 1.00 38.44  ? 1637 CYS B C   1 
ATOM   4846 O O   . CYS B 1 154 ? -22.166 -18.819 -61.745 1.00 38.76  ? 1637 CYS B O   1 
ATOM   4847 C CB  . CYS B 1 154 ? -22.773 -21.253 -63.194 1.00 39.56  ? 1637 CYS B CB  1 
ATOM   4848 S SG  . CYS B 1 154 ? -22.359 -23.039 -63.142 1.00 42.14  ? 1637 CYS B SG  1 
ATOM   4849 N N   . THR B 1 155 ? -24.358 -18.391 -61.737 1.00 37.39  ? 1638 THR B N   1 
ATOM   4850 C CA  . THR B 1 155 ? -24.168 -16.959 -61.545 1.00 37.89  ? 1638 THR B CA  1 
ATOM   4851 C C   . THR B 1 155 ? -24.803 -16.491 -60.232 1.00 39.11  ? 1638 THR B C   1 
ATOM   4852 O O   . THR B 1 155 ? -24.158 -15.822 -59.425 1.00 40.14  ? 1638 THR B O   1 
ATOM   4853 C CB  . THR B 1 155 ? -24.790 -16.161 -62.695 1.00 36.95  ? 1638 THR B CB  1 
ATOM   4854 O OG1 . THR B 1 155 ? -24.379 -16.728 -63.942 1.00 34.55  ? 1638 THR B OG1 1 
ATOM   4855 C CG2 . THR B 1 155 ? -24.350 -14.697 -62.626 1.00 36.44  ? 1638 THR B CG2 1 
ATOM   4856 N N   . PHE B 1 156 ? -26.071 -16.838 -60.033 1.00 39.40  ? 1639 PHE B N   1 
ATOM   4857 C CA  . PHE B 1 156 ? -26.792 -16.473 -58.815 1.00 39.65  ? 1639 PHE B CA  1 
ATOM   4858 C C   . PHE B 1 156 ? -27.900 -17.461 -58.504 1.00 41.35  ? 1639 PHE B C   1 
ATOM   4859 O O   . PHE B 1 156 ? -28.407 -18.154 -59.382 1.00 40.57  ? 1639 PHE B O   1 
ATOM   4860 C CB  . PHE B 1 156 ? -27.386 -15.072 -58.908 1.00 36.49  ? 1639 PHE B CB  1 
ATOM   4861 C CG  . PHE B 1 156 ? -28.122 -14.804 -60.177 1.00 33.88  ? 1639 PHE B CG  1 
ATOM   4862 C CD1 . PHE B 1 156 ? -27.501 -14.142 -61.222 1.00 33.50  ? 1639 PHE B CD1 1 
ATOM   4863 C CD2 . PHE B 1 156 ? -29.460 -15.179 -60.313 1.00 34.13  ? 1639 PHE B CD2 1 
ATOM   4864 C CE1 . PHE B 1 156 ? -28.201 -13.845 -62.389 1.00 34.53  ? 1639 PHE B CE1 1 
ATOM   4865 C CE2 . PHE B 1 156 ? -30.167 -14.891 -61.461 1.00 32.22  ? 1639 PHE B CE2 1 
ATOM   4866 C CZ  . PHE B 1 156 ? -29.541 -14.220 -62.504 1.00 32.93  ? 1639 PHE B CZ  1 
ATOM   4867 N N   . LEU B 1 157 ? -28.270 -17.524 -57.235 1.00 43.93  ? 1640 LEU B N   1 
ATOM   4868 C CA  . LEU B 1 157 ? -29.300 -18.442 -56.807 1.00 46.25  ? 1640 LEU B CA  1 
ATOM   4869 C C   . LEU B 1 157 ? -30.685 -17.815 -56.811 1.00 47.19  ? 1640 LEU B C   1 
ATOM   4870 O O   . LEU B 1 157 ? -30.838 -16.589 -56.752 1.00 47.58  ? 1640 LEU B O   1 
ATOM   4871 C CB  . LEU B 1 157 ? -28.976 -18.955 -55.411 1.00 46.72  ? 1640 LEU B CB  1 
ATOM   4872 C CG  . LEU B 1 157 ? -27.717 -19.801 -55.267 1.00 50.43  ? 1640 LEU B CG  1 
ATOM   4873 C CD1 . LEU B 1 157 ? -27.360 -19.926 -53.789 1.00 51.23  ? 1640 LEU B CD1 1 
ATOM   4874 C CD2 . LEU B 1 157 ? -27.946 -21.176 -55.890 1.00 50.55  ? 1640 LEU B CD2 1 
ATOM   4875 N N   . PRO B 1 158 ? -31.713 -18.655 -56.929 1.00 48.16  ? 1641 PRO B N   1 
ATOM   4876 C CA  . PRO B 1 158 ? -33.096 -18.188 -56.930 1.00 50.10  ? 1641 PRO B CA  1 
ATOM   4877 C C   . PRO B 1 158 ? -33.578 -18.227 -55.478 1.00 52.14  ? 1641 PRO B C   1 
ATOM   4878 O O   . PRO B 1 158 ? -32.898 -18.776 -54.601 1.00 50.72  ? 1641 PRO B O   1 
ATOM   4879 C CB  . PRO B 1 158 ? -33.804 -19.222 -57.797 1.00 49.20  ? 1641 PRO B CB  1 
ATOM   4880 C CG  . PRO B 1 158 ? -33.107 -20.491 -57.429 1.00 49.15  ? 1641 PRO B CG  1 
ATOM   4881 C CD  . PRO B 1 158 ? -31.635 -20.062 -57.374 1.00 49.53  ? 1641 PRO B CD  1 
ATOM   4882 N N   . SER B 1 159 ? -34.740 -17.634 -55.229 1.00 54.12  ? 1642 SER B N   1 
ATOM   4883 C CA  . SER B 1 159 ? -35.319 -17.618 -53.896 1.00 55.10  ? 1642 SER B CA  1 
ATOM   4884 C C   . SER B 1 159 ? -35.434 -19.067 -53.416 1.00 55.46  ? 1642 SER B C   1 
ATOM   4885 O O   . SER B 1 159 ? -35.452 -20.007 -54.219 1.00 54.40  ? 1642 SER B O   1 
ATOM   4886 C CB  . SER B 1 159 ? -36.696 -16.953 -53.945 1.00 56.19  ? 1642 SER B CB  1 
ATOM   4887 O OG  . SER B 1 159 ? -37.413 -17.140 -52.741 1.00 60.71  ? 1642 SER B OG  1 
ATOM   4888 N N   . ARG B 1 160 ? -35.514 -19.238 -52.102 1.00 56.38  ? 1643 ARG B N   1 
ATOM   4889 C CA  . ARG B 1 160 ? -35.609 -20.563 -51.504 1.00 57.53  ? 1643 ARG B CA  1 
ATOM   4890 C C   . ARG B 1 160 ? -36.881 -21.264 -51.963 1.00 56.18  ? 1643 ARG B C   1 
ATOM   4891 O O   . ARG B 1 160 ? -36.927 -22.492 -52.066 1.00 56.35  ? 1643 ARG B O   1 
ATOM   4892 C CB  . ARG B 1 160 ? -35.569 -20.451 -49.974 1.00 61.19  ? 1643 ARG B CB  1 
ATOM   4893 C CG  . ARG B 1 160 ? -34.468 -19.493 -49.465 1.00 65.02  ? 1643 ARG B CG  1 
ATOM   4894 C CD  . ARG B 1 160 ? -34.872 -18.034 -49.698 1.00 66.63  ? 1643 ARG B CD  1 
ATOM   4895 N NE  . ARG B 1 160 ? -33.732 -17.135 -49.859 1.00 68.74  ? 1643 ARG B NE  1 
ATOM   4896 C CZ  . ARG B 1 160 ? -33.847 -15.830 -50.096 1.00 69.73  ? 1643 ARG B CZ  1 
ATOM   4897 N NH1 . ARG B 1 160 ? -35.049 -15.279 -50.196 1.00 69.74  ? 1643 ARG B NH1 1 
ATOM   4898 N NH2 . ARG B 1 160 ? -32.764 -15.074 -50.236 1.00 70.05  ? 1643 ARG B NH2 1 
ATOM   4899 N N   . GLY B 1 161 ? -37.917 -20.481 -52.239 1.00 54.11  ? 1644 GLY B N   1 
ATOM   4900 C CA  . GLY B 1 161 ? -39.154 -21.073 -52.705 1.00 51.11  ? 1644 GLY B CA  1 
ATOM   4901 C C   . GLY B 1 161 ? -39.004 -21.505 -54.153 1.00 49.90  ? 1644 GLY B C   1 
ATOM   4902 O O   . GLY B 1 161 ? -39.476 -22.579 -54.551 1.00 49.33  ? 1644 GLY B O   1 
ATOM   4903 N N   . ILE B 1 162 ? -38.337 -20.674 -54.950 1.00 46.60  ? 1645 ILE B N   1 
ATOM   4904 C CA  . ILE B 1 162 ? -38.154 -20.993 -56.356 1.00 45.59  ? 1645 ILE B CA  1 
ATOM   4905 C C   . ILE B 1 162 ? -37.090 -22.066 -56.554 1.00 44.81  ? 1645 ILE B C   1 
ATOM   4906 O O   . ILE B 1 162 ? -37.153 -22.846 -57.508 1.00 42.49  ? 1645 ILE B O   1 
ATOM   4907 C CB  . ILE B 1 162 ? -37.799 -19.733 -57.163 1.00 45.02  ? 1645 ILE B CB  1 
ATOM   4908 C CG1 . ILE B 1 162 ? -38.897 -18.684 -56.974 1.00 45.71  ? 1645 ILE B CG1 1 
ATOM   4909 C CG2 . ILE B 1 162 ? -37.680 -20.067 -58.638 1.00 44.61  ? 1645 ILE B CG2 1 
ATOM   4910 C CD1 . ILE B 1 162 ? -40.307 -19.234 -57.122 1.00 41.68  ? 1645 ILE B CD1 1 
ATOM   4911 N N   . LEU B 1 163 ? -36.120 -22.108 -55.644 1.00 45.30  ? 1646 LEU B N   1 
ATOM   4912 C CA  . LEU B 1 163 ? -35.063 -23.109 -55.712 1.00 46.25  ? 1646 LEU B CA  1 
ATOM   4913 C C   . LEU B 1 163 ? -35.689 -24.484 -55.493 1.00 47.77  ? 1646 LEU B C   1 
ATOM   4914 O O   . LEU B 1 163 ? -35.271 -25.469 -56.103 1.00 47.93  ? 1646 LEU B O   1 
ATOM   4915 C CB  . LEU B 1 163 ? -33.989 -22.827 -54.657 1.00 45.77  ? 1646 LEU B CB  1 
ATOM   4916 C CG  . LEU B 1 163 ? -32.866 -23.852 -54.417 1.00 46.80  ? 1646 LEU B CG  1 
ATOM   4917 C CD1 . LEU B 1 163 ? -32.372 -24.479 -55.721 1.00 44.97  ? 1646 LEU B CD1 1 
ATOM   4918 C CD2 . LEU B 1 163 ? -31.732 -23.145 -53.695 1.00 44.14  ? 1646 LEU B CD2 1 
ATOM   4919 N N   . LYS B 1 164 ? -36.703 -24.541 -54.630 1.00 48.28  ? 1647 LYS B N   1 
ATOM   4920 C CA  . LYS B 1 164 ? -37.407 -25.789 -54.361 1.00 49.08  ? 1647 LYS B CA  1 
ATOM   4921 C C   . LYS B 1 164 ? -38.145 -26.220 -55.620 1.00 47.91  ? 1647 LYS B C   1 
ATOM   4922 O O   . LYS B 1 164 ? -38.022 -27.361 -56.074 1.00 47.91  ? 1647 LYS B O   1 
ATOM   4923 C CB  . LYS B 1 164 ? -38.417 -25.609 -53.219 1.00 51.89  ? 1647 LYS B CB  1 
ATOM   4924 C CG  . LYS B 1 164 ? -37.785 -25.450 -51.847 1.00 54.89  ? 1647 LYS B CG  1 
ATOM   4925 C CD  . LYS B 1 164 ? -38.837 -25.393 -50.760 1.00 56.98  ? 1647 LYS B CD  1 
ATOM   4926 C CE  . LYS B 1 164 ? -38.392 -26.184 -49.534 1.00 58.41  ? 1647 LYS B CE  1 
ATOM   4927 N NZ  . LYS B 1 164 ? -38.154 -27.631 -49.857 1.00 58.22  ? 1647 LYS B NZ  1 
ATOM   4928 N N   . TYR B 1 165 ? -38.913 -25.296 -56.184 1.00 45.93  ? 1648 TYR B N   1 
ATOM   4929 C CA  . TYR B 1 165 ? -39.656 -25.587 -57.393 1.00 44.54  ? 1648 TYR B CA  1 
ATOM   4930 C C   . TYR B 1 165 ? -38.689 -25.937 -58.530 1.00 43.34  ? 1648 TYR B C   1 
ATOM   4931 O O   . TYR B 1 165 ? -38.999 -26.785 -59.363 1.00 42.95  ? 1648 TYR B O   1 
ATOM   4932 C CB  . TYR B 1 165 ? -40.553 -24.393 -57.763 1.00 45.36  ? 1648 TYR B CB  1 
ATOM   4933 C CG  . TYR B 1 165 ? -41.479 -24.666 -58.927 1.00 42.96  ? 1648 TYR B CG  1 
ATOM   4934 C CD1 . TYR B 1 165 ? -42.133 -25.899 -59.049 1.00 42.93  ? 1648 TYR B CD1 1 
ATOM   4935 C CD2 . TYR B 1 165 ? -41.677 -23.709 -59.923 1.00 41.86  ? 1648 TYR B CD2 1 
ATOM   4936 C CE1 . TYR B 1 165 ? -42.956 -26.173 -60.143 1.00 43.43  ? 1648 TYR B CE1 1 
ATOM   4937 C CE2 . TYR B 1 165 ? -42.501 -23.973 -61.023 1.00 42.18  ? 1648 TYR B CE2 1 
ATOM   4938 C CZ  . TYR B 1 165 ? -43.130 -25.205 -61.127 1.00 42.74  ? 1648 TYR B CZ  1 
ATOM   4939 O OH  . TYR B 1 165 ? -43.902 -25.489 -62.219 1.00 42.95  ? 1648 TYR B OH  1 
ATOM   4940 N N   . LEU B 1 166 ? -37.517 -25.301 -58.567 1.00 42.45  ? 1649 LEU B N   1 
ATOM   4941 C CA  . LEU B 1 166 ? -36.522 -25.627 -59.597 1.00 40.41  ? 1649 LEU B CA  1 
ATOM   4942 C C   . LEU B 1 166 ? -35.999 -27.073 -59.408 1.00 41.04  ? 1649 LEU B C   1 
ATOM   4943 O O   . LEU B 1 166 ? -35.893 -27.837 -60.369 1.00 39.43  ? 1649 LEU B O   1 
ATOM   4944 C CB  . LEU B 1 166 ? -35.361 -24.632 -59.548 1.00 38.60  ? 1649 LEU B CB  1 
ATOM   4945 C CG  . LEU B 1 166 ? -34.135 -24.913 -60.440 1.00 37.61  ? 1649 LEU B CG  1 
ATOM   4946 C CD1 . LEU B 1 166 ? -34.532 -24.912 -61.894 1.00 34.56  ? 1649 LEU B CD1 1 
ATOM   4947 C CD2 . LEU B 1 166 ? -33.081 -23.861 -60.202 1.00 35.22  ? 1649 LEU B CD2 1 
ATOM   4948 N N   . LYS B 1 167 ? -35.690 -27.453 -58.170 1.00 43.54  ? 1650 LYS B N   1 
ATOM   4949 C CA  . LYS B 1 167 ? -35.206 -28.805 -57.893 1.00 45.79  ? 1650 LYS B CA  1 
ATOM   4950 C C   . LYS B 1 167 ? -36.299 -29.802 -58.243 1.00 47.29  ? 1650 LYS B C   1 
ATOM   4951 O O   . LYS B 1 167 ? -36.052 -30.832 -58.877 1.00 48.34  ? 1650 LYS B O   1 
ATOM   4952 C CB  . LYS B 1 167 ? -34.830 -28.952 -56.421 1.00 47.07  ? 1650 LYS B CB  1 
ATOM   4953 C CG  . LYS B 1 167 ? -33.549 -28.245 -56.007 1.00 49.17  ? 1650 LYS B CG  1 
ATOM   4954 C CD  . LYS B 1 167 ? -33.121 -28.716 -54.624 1.00 51.63  ? 1650 LYS B CD  1 
ATOM   4955 C CE  . LYS B 1 167 ? -31.763 -28.175 -54.224 1.00 52.88  ? 1650 LYS B CE  1 
ATOM   4956 N NZ  . LYS B 1 167 ? -31.351 -28.719 -52.894 1.00 55.06  ? 1650 LYS B NZ  1 
ATOM   4957 N N   . PHE B 1 168 ? -37.519 -29.483 -57.829 1.00 48.78  ? 1651 PHE B N   1 
ATOM   4958 C CA  . PHE B 1 168 ? -38.674 -30.328 -58.117 1.00 48.73  ? 1651 PHE B CA  1 
ATOM   4959 C C   . PHE B 1 168 ? -38.728 -30.570 -59.620 1.00 47.52  ? 1651 PHE B C   1 
ATOM   4960 O O   . PHE B 1 168 ? -39.005 -31.678 -60.064 1.00 47.18  ? 1651 PHE B O   1 
ATOM   4961 C CB  . PHE B 1 168 ? -39.958 -29.622 -57.651 1.00 50.26  ? 1651 PHE B CB  1 
ATOM   4962 C CG  . PHE B 1 168 ? -41.236 -30.236 -58.183 1.00 52.58  ? 1651 PHE B CG  1 
ATOM   4963 C CD1 . PHE B 1 168 ? -41.837 -31.310 -57.525 1.00 52.52  ? 1651 PHE B CD1 1 
ATOM   4964 C CD2 . PHE B 1 168 ? -41.841 -29.732 -59.339 1.00 52.47  ? 1651 PHE B CD2 1 
ATOM   4965 C CE1 . PHE B 1 168 ? -43.017 -31.872 -58.000 1.00 51.15  ? 1651 PHE B CE1 1 
ATOM   4966 C CE2 . PHE B 1 168 ? -43.025 -30.292 -59.825 1.00 53.44  ? 1651 PHE B CE2 1 
ATOM   4967 C CZ  . PHE B 1 168 ? -43.611 -31.365 -59.149 1.00 53.07  ? 1651 PHE B CZ  1 
ATOM   4968 N N   . HIS B 1 169 ? -38.452 -29.515 -60.388 1.00 47.72  ? 1652 HIS B N   1 
ATOM   4969 C CA  . HIS B 1 169 ? -38.483 -29.566 -61.850 1.00 48.15  ? 1652 HIS B CA  1 
ATOM   4970 C C   . HIS B 1 169 ? -37.321 -30.370 -62.405 1.00 48.23  ? 1652 HIS B C   1 
ATOM   4971 O O   . HIS B 1 169 ? -37.515 -31.271 -63.227 1.00 48.31  ? 1652 HIS B O   1 
ATOM   4972 C CB  . HIS B 1 169 ? -38.455 -28.145 -62.436 1.00 47.82  ? 1652 HIS B CB  1 
ATOM   4973 C CG  . HIS B 1 169 ? -38.627 -28.095 -63.926 1.00 47.34  ? 1652 HIS B CG  1 
ATOM   4974 N ND1 . HIS B 1 169 ? -39.782 -28.503 -64.558 1.00 46.29  ? 1652 HIS B ND1 1 
ATOM   4975 C CD2 . HIS B 1 169 ? -37.796 -27.668 -64.907 1.00 47.18  ? 1652 HIS B CD2 1 
ATOM   4976 C CE1 . HIS B 1 169 ? -39.655 -28.327 -65.861 1.00 46.27  ? 1652 HIS B CE1 1 
ATOM   4977 N NE2 . HIS B 1 169 ? -38.459 -27.822 -66.100 1.00 46.29  ? 1652 HIS B NE2 1 
ATOM   4978 N N   . LEU B 1 170 ? -36.114 -30.042 -61.955 1.00 47.27  ? 1653 LEU B N   1 
ATOM   4979 C CA  . LEU B 1 170 ? -34.919 -30.745 -62.401 1.00 47.34  ? 1653 LEU B CA  1 
ATOM   4980 C C   . LEU B 1 170 ? -35.110 -32.262 -62.280 1.00 48.91  ? 1653 LEU B C   1 
ATOM   4981 O O   . LEU B 1 170 ? -35.002 -33.009 -63.266 1.00 48.10  ? 1653 LEU B O   1 
ATOM   4982 C CB  . LEU B 1 170 ? -33.722 -30.295 -61.561 1.00 44.66  ? 1653 LEU B CB  1 
ATOM   4983 C CG  . LEU B 1 170 ? -33.422 -28.786 -61.583 1.00 43.84  ? 1653 LEU B CG  1 
ATOM   4984 C CD1 . LEU B 1 170 ? -32.339 -28.449 -60.581 1.00 41.31  ? 1653 LEU B CD1 1 
ATOM   4985 C CD2 . LEU B 1 170 ? -33.010 -28.350 -62.999 1.00 42.24  ? 1653 LEU B CD2 1 
ATOM   4986 N N   . LYS B 1 171 ? -35.410 -32.712 -61.067 1.00 50.36  ? 1654 LYS B N   1 
ATOM   4987 C CA  . LYS B 1 171 ? -35.605 -34.133 -60.821 1.00 53.30  ? 1654 LYS B CA  1 
ATOM   4988 C C   . LYS B 1 171 ? -36.549 -34.751 -61.851 1.00 54.64  ? 1654 LYS B C   1 
ATOM   4989 O O   . LYS B 1 171 ? -36.180 -35.687 -62.567 1.00 55.38  ? 1654 LYS B O   1 
ATOM   4990 C CB  . LYS B 1 171 ? -36.148 -34.340 -59.406 1.00 54.21  ? 1654 LYS B CB  1 
ATOM   4991 C CG  . LYS B 1 171 ? -36.422 -35.786 -59.024 1.00 54.60  ? 1654 LYS B CG  1 
ATOM   4992 C CD  . LYS B 1 171 ? -37.030 -35.851 -57.625 1.00 56.61  ? 1654 LYS B CD  1 
ATOM   4993 C CE  . LYS B 1 171 ? -37.717 -37.189 -57.361 1.00 57.25  ? 1654 LYS B CE  1 
ATOM   4994 N NZ  . LYS B 1 171 ? -36.774 -38.339 -57.347 1.00 57.57  ? 1654 LYS B NZ  1 
ATOM   4995 N N   . ARG B 1 172 ? -37.761 -34.215 -61.927 1.00 55.46  ? 1655 ARG B N   1 
ATOM   4996 C CA  . ARG B 1 172 ? -38.766 -34.705 -62.861 1.00 57.59  ? 1655 ARG B CA  1 
ATOM   4997 C C   . ARG B 1 172 ? -38.265 -34.869 -64.288 1.00 57.90  ? 1655 ARG B C   1 
ATOM   4998 O O   . ARG B 1 172 ? -38.615 -35.842 -64.955 1.00 58.09  ? 1655 ARG B O   1 
ATOM   4999 C CB  . ARG B 1 172 ? -39.988 -33.770 -62.863 1.00 58.95  ? 1655 ARG B CB  1 
ATOM   5000 C CG  . ARG B 1 172 ? -40.910 -33.936 -61.667 1.00 59.22  ? 1655 ARG B CG  1 
ATOM   5001 C CD  . ARG B 1 172 ? -41.925 -32.804 -61.582 1.00 60.65  ? 1655 ARG B CD  1 
ATOM   5002 N NE  . ARG B 1 172 ? -42.621 -32.557 -62.844 1.00 62.36  ? 1655 ARG B NE  1 
ATOM   5003 C CZ  . ARG B 1 172 ? -43.355 -33.457 -63.491 1.00 62.82  ? 1655 ARG B CZ  1 
ATOM   5004 N NH1 . ARG B 1 172 ? -43.501 -34.682 -63.008 1.00 62.96  ? 1655 ARG B NH1 1 
ATOM   5005 N NH2 . ARG B 1 172 ? -43.942 -33.133 -64.631 1.00 64.41  ? 1655 ARG B NH2 1 
ATOM   5006 N N   . ILE B 1 173 ? -37.456 -33.917 -64.754 1.00 58.54  ? 1656 ILE B N   1 
ATOM   5007 C CA  . ILE B 1 173 ? -36.934 -33.953 -66.115 1.00 58.89  ? 1656 ILE B CA  1 
ATOM   5008 C C   . ILE B 1 173 ? -36.051 -35.161 -66.383 1.00 60.98  ? 1656 ILE B C   1 
ATOM   5009 O O   . ILE B 1 173 ? -36.241 -35.872 -67.373 1.00 60.99  ? 1656 ILE B O   1 
ATOM   5010 C CB  . ILE B 1 173 ? -36.135 -32.678 -66.438 1.00 57.54  ? 1656 ILE B CB  1 
ATOM   5011 C CG1 . ILE B 1 173 ? -37.097 -31.515 -66.703 1.00 55.38  ? 1656 ILE B CG1 1 
ATOM   5012 C CG2 . ILE B 1 173 ? -35.218 -32.923 -67.652 1.00 56.18  ? 1656 ILE B CG2 1 
ATOM   5013 C CD1 . ILE B 1 173 ? -37.833 -31.608 -68.011 1.00 50.75  ? 1656 ILE B CD1 1 
ATOM   5014 N N   . ARG B 1 174 ? -35.084 -35.395 -65.506 1.00 62.73  ? 1657 ARG B N   1 
ATOM   5015 C CA  . ARG B 1 174 ? -34.180 -36.521 -65.688 1.00 65.59  ? 1657 ARG B CA  1 
ATOM   5016 C C   . ARG B 1 174 ? -34.898 -37.860 -65.674 1.00 66.48  ? 1657 ARG B C   1 
ATOM   5017 O O   . ARG B 1 174 ? -34.476 -38.804 -66.348 1.00 66.66  ? 1657 ARG B O   1 
ATOM   5018 C CB  . ARG B 1 174 ? -33.108 -36.515 -64.604 1.00 66.61  ? 1657 ARG B CB  1 
ATOM   5019 C CG  . ARG B 1 174 ? -32.100 -35.396 -64.743 1.00 66.44  ? 1657 ARG B CG  1 
ATOM   5020 C CD  . ARG B 1 174 ? -30.942 -35.649 -63.811 1.00 66.63  ? 1657 ARG B CD  1 
ATOM   5021 N NE  . ARG B 1 174 ? -30.506 -37.032 -63.914 1.00 65.85  ? 1657 ARG B NE  1 
ATOM   5022 C CZ  . ARG B 1 174 ? -29.453 -37.527 -63.285 1.00 65.56  ? 1657 ARG B CZ  1 
ATOM   5023 N NH1 . ARG B 1 174 ? -28.732 -36.739 -62.506 1.00 65.19  ? 1657 ARG B NH1 1 
ATOM   5024 N NH2 . ARG B 1 174 ? -29.121 -38.802 -63.451 1.00 65.64  ? 1657 ARG B NH2 1 
ATOM   5025 N N   . GLU B 1 175 ? -35.979 -37.933 -64.901 1.00 68.02  ? 1658 GLU B N   1 
ATOM   5026 C CA  . GLU B 1 175 ? -36.776 -39.154 -64.783 1.00 68.10  ? 1658 GLU B CA  1 
ATOM   5027 C C   . GLU B 1 175 ? -37.636 -39.383 -66.014 1.00 68.23  ? 1658 GLU B C   1 
ATOM   5028 O O   . GLU B 1 175 ? -37.935 -40.521 -66.365 1.00 69.35  ? 1658 GLU B O   1 
ATOM   5029 C CB  . GLU B 1 175 ? -37.676 -39.083 -63.546 1.00 67.57  ? 1658 GLU B CB  1 
ATOM   5030 C CG  . GLU B 1 175 ? -36.926 -38.747 -62.272 1.00 69.07  ? 1658 GLU B CG  1 
ATOM   5031 C CD  . GLU B 1 175 ? -37.829 -38.673 -61.062 1.00 69.58  ? 1658 GLU B CD  1 
ATOM   5032 O OE1 . GLU B 1 175 ? -38.954 -38.152 -61.197 1.00 69.32  ? 1658 GLU B OE1 1 
ATOM   5033 O OE2 . GLU B 1 175 ? -37.409 -39.122 -59.970 1.00 70.43  ? 1658 GLU B OE2 1 
ATOM   5034 N N   . GLN B 1 176 ? -38.024 -38.300 -66.674 1.00 68.41  ? 1659 GLN B N   1 
ATOM   5035 C CA  . GLN B 1 176 ? -38.866 -38.389 -67.859 1.00 68.95  ? 1659 GLN B CA  1 
ATOM   5036 C C   . GLN B 1 176 ? -38.106 -38.188 -69.168 1.00 68.31  ? 1659 GLN B C   1 
ATOM   5037 O O   . GLN B 1 176 ? -38.697 -38.226 -70.245 1.00 67.92  ? 1659 GLN B O   1 
ATOM   5038 C CB  . GLN B 1 176 ? -40.025 -37.382 -67.736 1.00 70.82  ? 1659 GLN B CB  1 
ATOM   5039 C CG  . GLN B 1 176 ? -41.115 -37.823 -66.731 1.00 72.99  ? 1659 GLN B CG  1 
ATOM   5040 C CD  . GLN B 1 176 ? -41.845 -36.662 -66.052 1.00 73.98  ? 1659 GLN B CD  1 
ATOM   5041 O OE1 . GLN B 1 176 ? -42.509 -35.849 -66.703 1.00 73.84  ? 1659 GLN B OE1 1 
ATOM   5042 N NE2 . GLN B 1 176 ? -41.723 -36.590 -64.727 1.00 73.89  ? 1659 GLN B NE2 1 
ATOM   5043 N N   . PHE B 1 177 ? -36.794 -37.984 -69.075 1.00 68.20  ? 1660 PHE B N   1 
ATOM   5044 C CA  . PHE B 1 177 ? -35.958 -37.788 -70.260 1.00 67.78  ? 1660 PHE B CA  1 
ATOM   5045 C C   . PHE B 1 177 ? -34.536 -38.285 -69.992 1.00 68.84  ? 1660 PHE B C   1 
ATOM   5046 O O   . PHE B 1 177 ? -33.573 -37.549 -70.204 1.00 68.49  ? 1660 PHE B O   1 
ATOM   5047 C CB  . PHE B 1 177 ? -35.891 -36.305 -70.626 1.00 66.55  ? 1660 PHE B CB  1 
ATOM   5048 C CG  . PHE B 1 177 ? -37.214 -35.696 -70.990 1.00 65.93  ? 1660 PHE B CG  1 
ATOM   5049 C CD1 . PHE B 1 177 ? -37.788 -35.944 -72.231 1.00 65.44  ? 1660 PHE B CD1 1 
ATOM   5050 C CD2 . PHE B 1 177 ? -37.875 -34.846 -70.099 1.00 65.20  ? 1660 PHE B CD2 1 
ATOM   5051 C CE1 . PHE B 1 177 ? -39.001 -35.352 -72.586 1.00 65.63  ? 1660 PHE B CE1 1 
ATOM   5052 C CE2 . PHE B 1 177 ? -39.087 -34.249 -70.441 1.00 64.87  ? 1660 PHE B CE2 1 
ATOM   5053 C CZ  . PHE B 1 177 ? -39.652 -34.501 -71.688 1.00 65.82  ? 1660 PHE B CZ  1 
ATOM   5054 N N   . PRO B 1 178 ? -34.382 -39.540 -69.527 1.00 69.84  ? 1661 PRO B N   1 
ATOM   5055 C CA  . PRO B 1 178 ? -33.048 -40.087 -69.239 1.00 69.78  ? 1661 PRO B CA  1 
ATOM   5056 C C   . PRO B 1 178 ? -32.160 -40.268 -70.470 1.00 69.57  ? 1661 PRO B C   1 
ATOM   5057 O O   . PRO B 1 178 ? -32.651 -40.430 -71.591 1.00 68.65  ? 1661 PRO B O   1 
ATOM   5058 C CB  . PRO B 1 178 ? -33.364 -41.411 -68.551 1.00 69.54  ? 1661 PRO B CB  1 
ATOM   5059 C CG  . PRO B 1 178 ? -34.604 -41.846 -69.254 1.00 70.04  ? 1661 PRO B CG  1 
ATOM   5060 C CD  . PRO B 1 178 ? -35.420 -40.567 -69.318 1.00 70.31  ? 1661 PRO B CD  1 
ATOM   5061 N N   . GLY B 1 179 ? -30.848 -40.230 -70.247 1.00 69.31  ? 1662 GLY B N   1 
ATOM   5062 C CA  . GLY B 1 179 ? -29.895 -40.395 -71.332 1.00 69.23  ? 1662 GLY B CA  1 
ATOM   5063 C C   . GLY B 1 179 ? -29.890 -39.294 -72.382 1.00 69.58  ? 1662 GLY B C   1 
ATOM   5064 O O   . GLY B 1 179 ? -29.191 -39.406 -73.397 1.00 68.92  ? 1662 GLY B O   1 
ATOM   5065 N N   . THR B 1 180 ? -30.657 -38.229 -72.144 1.00 69.35  ? 1663 THR B N   1 
ATOM   5066 C CA  . THR B 1 180 ? -30.735 -37.108 -73.084 1.00 68.92  ? 1663 THR B CA  1 
ATOM   5067 C C   . THR B 1 180 ? -29.976 -35.878 -72.585 1.00 68.34  ? 1663 THR B C   1 
ATOM   5068 O O   . THR B 1 180 ? -29.618 -35.781 -71.406 1.00 68.78  ? 1663 THR B O   1 
ATOM   5069 C CB  . THR B 1 180 ? -32.207 -36.669 -73.356 1.00 69.53  ? 1663 THR B CB  1 
ATOM   5070 O OG1 . THR B 1 180 ? -32.808 -36.204 -72.139 1.00 69.24  ? 1663 THR B OG1 1 
ATOM   5071 C CG2 . THR B 1 180 ? -33.021 -37.822 -73.918 1.00 70.05  ? 1663 THR B CG2 1 
ATOM   5072 N N   . GLU B 1 181 ? -29.735 -34.942 -73.496 1.00 66.71  ? 1664 GLU B N   1 
ATOM   5073 C CA  . GLU B 1 181 ? -29.041 -33.713 -73.166 1.00 65.12  ? 1664 GLU B CA  1 
ATOM   5074 C C   . GLU B 1 181 ? -29.745 -33.000 -72.019 1.00 65.15  ? 1664 GLU B C   1 
ATOM   5075 O O   . GLU B 1 181 ? -29.127 -32.685 -70.995 1.00 65.18  ? 1664 GLU B O   1 
ATOM   5076 C CB  . GLU B 1 181 ? -28.987 -32.805 -74.397 1.00 65.32  ? 1664 GLU B CB  1 
ATOM   5077 C CG  . GLU B 1 181 ? -27.977 -33.263 -75.442 1.00 63.84  ? 1664 GLU B CG  1 
ATOM   5078 C CD  . GLU B 1 181 ? -26.553 -33.184 -74.927 1.00 63.26  ? 1664 GLU B CD  1 
ATOM   5079 O OE1 . GLU B 1 181 ? -25.972 -32.075 -74.943 1.00 61.69  ? 1664 GLU B OE1 1 
ATOM   5080 O OE2 . GLU B 1 181 ? -26.024 -34.230 -74.488 1.00 62.63  ? 1664 GLU B OE2 1 
ATOM   5081 N N   . MET B 1 182 ? -31.042 -32.757 -72.189 1.00 64.47  ? 1665 MET B N   1 
ATOM   5082 C CA  . MET B 1 182 ? -31.821 -32.078 -71.165 1.00 63.29  ? 1665 MET B CA  1 
ATOM   5083 C C   . MET B 1 182 ? -31.545 -32.720 -69.815 1.00 61.79  ? 1665 MET B C   1 
ATOM   5084 O O   . MET B 1 182 ? -31.371 -32.037 -68.809 1.00 61.22  ? 1665 MET B O   1 
ATOM   5085 C CB  . MET B 1 182 ? -33.313 -32.159 -71.483 1.00 64.34  ? 1665 MET B CB  1 
ATOM   5086 C CG  . MET B 1 182 ? -33.685 -31.673 -72.868 1.00 66.38  ? 1665 MET B CG  1 
ATOM   5087 S SD  . MET B 1 182 ? -33.226 -32.840 -74.180 1.00 68.56  ? 1665 MET B SD  1 
ATOM   5088 C CE  . MET B 1 182 ? -34.820 -33.627 -74.511 1.00 68.13  ? 1665 MET B CE  1 
ATOM   5089 N N   . GLU B 1 183 ? -31.491 -34.041 -69.799 1.00 60.39  ? 1666 GLU B N   1 
ATOM   5090 C CA  . GLU B 1 183 ? -31.238 -34.748 -68.562 1.00 61.40  ? 1666 GLU B CA  1 
ATOM   5091 C C   . GLU B 1 183 ? -29.870 -34.393 -67.997 1.00 60.38  ? 1666 GLU B C   1 
ATOM   5092 O O   . GLU B 1 183 ? -29.725 -34.135 -66.795 1.00 61.08  ? 1666 GLU B O   1 
ATOM   5093 C CB  . GLU B 1 183 ? -31.342 -36.256 -68.798 1.00 63.25  ? 1666 GLU B CB  1 
ATOM   5094 C CG  . GLU B 1 183 ? -31.177 -37.108 -67.552 1.00 67.04  ? 1666 GLU B CG  1 
ATOM   5095 C CD  . GLU B 1 183 ? -29.719 -37.368 -67.216 1.00 69.58  ? 1666 GLU B CD  1 
ATOM   5096 O OE1 . GLU B 1 183 ? -29.032 -38.000 -68.047 1.00 71.06  ? 1666 GLU B OE1 1 
ATOM   5097 O OE2 . GLU B 1 183 ? -29.259 -36.942 -66.130 1.00 70.09  ? 1666 GLU B OE2 1 
ATOM   5098 N N   . LYS B 1 184 ? -28.864 -34.368 -68.864 1.00 58.63  ? 1667 LYS B N   1 
ATOM   5099 C CA  . LYS B 1 184 ? -27.506 -34.059 -68.425 1.00 56.79  ? 1667 LYS B CA  1 
ATOM   5100 C C   . LYS B 1 184 ? -27.365 -32.631 -67.888 1.00 54.12  ? 1667 LYS B C   1 
ATOM   5101 O O   . LYS B 1 184 ? -26.735 -32.413 -66.846 1.00 52.86  ? 1667 LYS B O   1 
ATOM   5102 C CB  . LYS B 1 184 ? -26.512 -34.303 -69.569 1.00 58.12  ? 1667 LYS B CB  1 
ATOM   5103 C CG  . LYS B 1 184 ? -26.457 -35.751 -70.044 1.00 59.16  ? 1667 LYS B CG  1 
ATOM   5104 C CD  . LYS B 1 184 ? -25.425 -35.931 -71.147 1.00 61.07  ? 1667 LYS B CD  1 
ATOM   5105 C CE  . LYS B 1 184 ? -25.325 -37.386 -71.593 1.00 61.96  ? 1667 LYS B CE  1 
ATOM   5106 N NZ  . LYS B 1 184 ? -26.601 -37.876 -72.192 1.00 63.60  ? 1667 LYS B NZ  1 
ATOM   5107 N N   . TYR B 1 185 ? -27.950 -31.665 -68.593 1.00 51.31  ? 1668 TYR B N   1 
ATOM   5108 C CA  . TYR B 1 185 ? -27.887 -30.273 -68.154 1.00 49.22  ? 1668 TYR B CA  1 
ATOM   5109 C C   . TYR B 1 185 ? -28.576 -30.102 -66.814 1.00 47.97  ? 1668 TYR B C   1 
ATOM   5110 O O   . TYR B 1 185 ? -28.106 -29.375 -65.957 1.00 47.72  ? 1668 TYR B O   1 
ATOM   5111 C CB  . TYR B 1 185 ? -28.552 -29.349 -69.166 1.00 48.29  ? 1668 TYR B CB  1 
ATOM   5112 C CG  . TYR B 1 185 ? -27.677 -28.968 -70.333 1.00 48.15  ? 1668 TYR B CG  1 
ATOM   5113 C CD1 . TYR B 1 185 ? -26.450 -28.339 -70.133 1.00 47.62  ? 1668 TYR B CD1 1 
ATOM   5114 C CD2 . TYR B 1 185 ? -28.090 -29.208 -71.642 1.00 48.29  ? 1668 TYR B CD2 1 
ATOM   5115 C CE1 . TYR B 1 185 ? -25.659 -27.955 -71.208 1.00 49.08  ? 1668 TYR B CE1 1 
ATOM   5116 C CE2 . TYR B 1 185 ? -27.304 -28.831 -72.728 1.00 48.97  ? 1668 TYR B CE2 1 
ATOM   5117 C CZ  . TYR B 1 185 ? -26.092 -28.205 -72.505 1.00 49.14  ? 1668 TYR B CZ  1 
ATOM   5118 O OH  . TYR B 1 185 ? -25.318 -27.836 -73.574 1.00 47.54  ? 1668 TYR B OH  1 
ATOM   5119 N N   . ALA B 1 186 ? -29.702 -30.781 -66.647 1.00 48.55  ? 1669 ALA B N   1 
ATOM   5120 C CA  . ALA B 1 186 ? -30.462 -30.708 -65.411 1.00 47.50  ? 1669 ALA B CA  1 
ATOM   5121 C C   . ALA B 1 186 ? -29.567 -31.137 -64.260 1.00 47.17  ? 1669 ALA B C   1 
ATOM   5122 O O   . ALA B 1 186 ? -29.548 -30.488 -63.212 1.00 46.34  ? 1669 ALA B O   1 
ATOM   5123 C CB  . ALA B 1 186 ? -31.675 -31.611 -65.498 1.00 47.53  ? 1669 ALA B CB  1 
ATOM   5124 N N   . LEU B 1 187 ? -28.829 -32.232 -64.462 1.00 46.48  ? 1670 LEU B N   1 
ATOM   5125 C CA  . LEU B 1 187 ? -27.919 -32.747 -63.443 1.00 46.11  ? 1670 LEU B CA  1 
ATOM   5126 C C   . LEU B 1 187 ? -26.849 -31.730 -63.079 1.00 45.88  ? 1670 LEU B C   1 
ATOM   5127 O O   . LEU B 1 187 ? -26.648 -31.425 -61.903 1.00 47.15  ? 1670 LEU B O   1 
ATOM   5128 C CB  . LEU B 1 187 ? -27.249 -34.036 -63.920 1.00 46.22  ? 1670 LEU B CB  1 
ATOM   5129 C CG  . LEU B 1 187 ? -26.196 -34.640 -62.977 1.00 45.74  ? 1670 LEU B CG  1 
ATOM   5130 C CD1 . LEU B 1 187 ? -26.739 -34.707 -61.551 1.00 47.31  ? 1670 LEU B CD1 1 
ATOM   5131 C CD2 . LEU B 1 187 ? -25.797 -36.018 -63.464 1.00 43.63  ? 1670 LEU B CD2 1 
ATOM   5132 N N   . PHE B 1 188 ? -26.163 -31.209 -64.092 1.00 45.71  ? 1671 PHE B N   1 
ATOM   5133 C CA  . PHE B 1 188 ? -25.111 -30.210 -63.878 1.00 45.55  ? 1671 PHE B CA  1 
ATOM   5134 C C   . PHE B 1 188 ? -25.674 -29.029 -63.068 1.00 44.01  ? 1671 PHE B C   1 
ATOM   5135 O O   . PHE B 1 188 ? -25.131 -28.649 -62.033 1.00 42.92  ? 1671 PHE B O   1 
ATOM   5136 C CB  . PHE B 1 188 ? -24.570 -29.726 -65.236 1.00 45.65  ? 1671 PHE B CB  1 
ATOM   5137 C CG  . PHE B 1 188 ? -23.350 -28.833 -65.139 1.00 45.63  ? 1671 PHE B CG  1 
ATOM   5138 C CD1 . PHE B 1 188 ? -23.450 -27.526 -64.655 1.00 44.07  ? 1671 PHE B CD1 1 
ATOM   5139 C CD2 . PHE B 1 188 ? -22.110 -29.286 -65.578 1.00 46.71  ? 1671 PHE B CD2 1 
ATOM   5140 C CE1 . PHE B 1 188 ? -22.348 -26.691 -64.613 1.00 43.90  ? 1671 PHE B CE1 1 
ATOM   5141 C CE2 . PHE B 1 188 ? -20.992 -28.444 -65.539 1.00 46.03  ? 1671 PHE B CE2 1 
ATOM   5142 C CZ  . PHE B 1 188 ? -21.118 -27.146 -65.055 1.00 44.68  ? 1671 PHE B CZ  1 
ATOM   5143 N N   . THR B 1 189 ? -26.767 -28.459 -63.555 1.00 43.08  ? 1672 THR B N   1 
ATOM   5144 C CA  . THR B 1 189 ? -27.415 -27.340 -62.891 1.00 43.92  ? 1672 THR B CA  1 
ATOM   5145 C C   . THR B 1 189 ? -27.630 -27.625 -61.398 1.00 45.98  ? 1672 THR B C   1 
ATOM   5146 O O   . THR B 1 189 ? -27.264 -26.815 -60.535 1.00 44.40  ? 1672 THR B O   1 
ATOM   5147 C CB  . THR B 1 189 ? -28.773 -27.043 -63.556 1.00 41.10  ? 1672 THR B CB  1 
ATOM   5148 O OG1 . THR B 1 189 ? -28.544 -26.616 -64.904 1.00 39.33  ? 1672 THR B OG1 1 
ATOM   5149 C CG2 . THR B 1 189 ? -29.533 -25.964 -62.787 1.00 39.63  ? 1672 THR B CG2 1 
ATOM   5150 N N   . TYR B 1 190 ? -28.224 -28.780 -61.100 1.00 48.16  ? 1673 TYR B N   1 
ATOM   5151 C CA  . TYR B 1 190 ? -28.484 -29.160 -59.718 1.00 50.38  ? 1673 TYR B CA  1 
ATOM   5152 C C   . TYR B 1 190 ? -27.208 -29.119 -58.890 1.00 50.27  ? 1673 TYR B C   1 
ATOM   5153 O O   . TYR B 1 190 ? -27.222 -28.653 -57.748 1.00 51.27  ? 1673 TYR B O   1 
ATOM   5154 C CB  . TYR B 1 190 ? -29.116 -30.557 -59.642 1.00 52.85  ? 1673 TYR B CB  1 
ATOM   5155 C CG  . TYR B 1 190 ? -29.407 -31.011 -58.224 1.00 56.64  ? 1673 TYR B CG  1 
ATOM   5156 C CD1 . TYR B 1 190 ? -30.101 -30.186 -57.330 1.00 59.24  ? 1673 TYR B CD1 1 
ATOM   5157 C CD2 . TYR B 1 190 ? -28.967 -32.251 -57.763 1.00 57.90  ? 1673 TYR B CD2 1 
ATOM   5158 C CE1 . TYR B 1 190 ? -30.343 -30.584 -56.014 1.00 60.22  ? 1673 TYR B CE1 1 
ATOM   5159 C CE2 . TYR B 1 190 ? -29.205 -32.661 -56.451 1.00 58.65  ? 1673 TYR B CE2 1 
ATOM   5160 C CZ  . TYR B 1 190 ? -29.890 -31.825 -55.583 1.00 60.72  ? 1673 TYR B CZ  1 
ATOM   5161 O OH  . TYR B 1 190 ? -30.117 -32.228 -54.283 1.00 62.03  ? 1673 TYR B OH  1 
ATOM   5162 N N   . GLU B 1 191 ? -26.107 -29.593 -59.465 1.00 49.28  ? 1674 GLU B N   1 
ATOM   5163 C CA  . GLU B 1 191 ? -24.831 -29.595 -58.761 0.50 48.79  ? 1674 GLU B CA  1 
ATOM   5164 C C   . GLU B 1 191 ? -24.260 -28.189 -58.627 1.00 48.79  ? 1674 GLU B C   1 
ATOM   5165 O O   . GLU B 1 191 ? -23.617 -27.864 -57.628 1.00 49.19  ? 1674 GLU B O   1 
ATOM   5166 C CB  . GLU B 1 191 ? -23.822 -30.499 -59.478 0.50 48.02  ? 1674 GLU B CB  1 
ATOM   5167 C CG  . GLU B 1 191 ? -24.061 -31.987 -59.271 0.50 47.04  ? 1674 GLU B CG  1 
ATOM   5168 C CD  . GLU B 1 191 ? -24.145 -32.348 -57.797 0.50 47.20  ? 1674 GLU B CD  1 
ATOM   5169 O OE1 . GLU B 1 191 ? -23.231 -31.957 -57.034 0.50 46.62  ? 1674 GLU B OE1 1 
ATOM   5170 O OE2 . GLU B 1 191 ? -25.124 -33.024 -57.401 0.50 44.89  ? 1674 GLU B OE2 1 
ATOM   5171 N N   . SER B 1 192 ? -24.496 -27.350 -59.631 1.00 48.03  ? 1675 SER B N   1 
ATOM   5172 C CA  . SER B 1 192 ? -23.988 -25.980 -59.591 1.00 47.26  ? 1675 SER B CA  1 
ATOM   5173 C C   . SER B 1 192 ? -24.734 -25.186 -58.522 1.00 47.12  ? 1675 SER B C   1 
ATOM   5174 O O   . SER B 1 192 ? -24.188 -24.262 -57.917 1.00 45.93  ? 1675 SER B O   1 
ATOM   5175 C CB  . SER B 1 192 ? -24.169 -25.316 -60.954 1.00 47.23  ? 1675 SER B CB  1 
ATOM   5176 O OG  . SER B 1 192 ? -23.562 -26.088 -61.970 1.00 49.46  ? 1675 SER B OG  1 
ATOM   5177 N N   . LEU B 1 193 ? -25.992 -25.563 -58.298 1.00 46.67  ? 1676 LEU B N   1 
ATOM   5178 C CA  . LEU B 1 193 ? -26.820 -24.899 -57.307 1.00 45.92  ? 1676 LEU B CA  1 
ATOM   5179 C C   . LEU B 1 193 ? -26.229 -25.100 -55.924 1.00 45.26  ? 1676 LEU B C   1 
ATOM   5180 O O   . LEU B 1 193 ? -26.206 -24.182 -55.104 1.00 43.88  ? 1676 LEU B O   1 
ATOM   5181 C CB  . LEU B 1 193 ? -28.248 -25.454 -57.370 1.00 45.33  ? 1676 LEU B CB  1 
ATOM   5182 C CG  . LEU B 1 193 ? -29.369 -24.561 -57.925 1.00 44.56  ? 1676 LEU B CG  1 
ATOM   5183 C CD1 . LEU B 1 193 ? -28.819 -23.468 -58.816 1.00 43.90  ? 1676 LEU B CD1 1 
ATOM   5184 C CD2 . LEU B 1 193 ? -30.346 -25.420 -58.692 1.00 43.80  ? 1676 LEU B CD2 1 
ATOM   5185 N N   . LYS B 1 194 ? -25.715 -26.299 -55.685 1.00 46.14  ? 1677 LYS B N   1 
ATOM   5186 C CA  . LYS B 1 194 ? -25.132 -26.625 -54.390 1.00 48.45  ? 1677 LYS B CA  1 
ATOM   5187 C C   . LYS B 1 194 ? -23.836 -25.885 -54.117 1.00 49.50  ? 1677 LYS B C   1 
ATOM   5188 O O   . LYS B 1 194 ? -23.397 -25.815 -52.974 1.00 49.71  ? 1677 LYS B O   1 
ATOM   5189 C CB  . LYS B 1 194 ? -24.895 -28.139 -54.274 1.00 48.84  ? 1677 LYS B CB  1 
ATOM   5190 C CG  . LYS B 1 194 ? -26.165 -28.983 -54.481 1.00 50.54  ? 1677 LYS B CG  1 
ATOM   5191 C CD  . LYS B 1 194 ? -25.962 -30.454 -54.123 1.00 50.18  ? 1677 LYS B CD  1 
ATOM   5192 C CE  . LYS B 1 194 ? -24.955 -31.114 -55.039 1.00 52.05  ? 1677 LYS B CE  1 
ATOM   5193 N NZ  . LYS B 1 194 ? -24.679 -32.522 -54.650 1.00 50.60  ? 1677 LYS B NZ  1 
ATOM   5194 N N   . LYS B 1 195 ? -23.233 -25.321 -55.161 1.00 50.90  ? 1678 LYS B N   1 
ATOM   5195 C CA  . LYS B 1 195 ? -21.972 -24.606 -55.006 1.00 51.74  ? 1678 LYS B CA  1 
ATOM   5196 C C   . LYS B 1 195 ? -22.052 -23.101 -55.224 1.00 51.43  ? 1678 LYS B C   1 
ATOM   5197 O O   . LYS B 1 195 ? -21.352 -22.337 -54.567 1.00 51.62  ? 1678 LYS B O   1 
ATOM   5198 C CB  . LYS B 1 195 ? -20.911 -25.184 -55.957 1.00 52.93  ? 1678 LYS B CB  1 
ATOM   5199 C CG  . LYS B 1 195 ? -20.518 -26.627 -55.659 1.00 54.98  ? 1678 LYS B CG  1 
ATOM   5200 C CD  . LYS B 1 195 ? -19.437 -27.125 -56.609 1.00 56.25  ? 1678 LYS B CD  1 
ATOM   5201 C CE  . LYS B 1 195 ? -18.131 -26.363 -56.415 1.00 57.33  ? 1678 LYS B CE  1 
ATOM   5202 N NZ  . LYS B 1 195 ? -17.062 -26.905 -57.301 1.00 58.31  ? 1678 LYS B NZ  1 
ATOM   5203 N N   . THR B 1 196 ? -22.892 -22.664 -56.148 1.00 51.61  ? 1679 THR B N   1 
ATOM   5204 C CA  . THR B 1 196 ? -22.975 -21.241 -56.421 1.00 51.50  ? 1679 THR B CA  1 
ATOM   5205 C C   . THR B 1 196 ? -23.358 -20.431 -55.197 1.00 54.07  ? 1679 THR B C   1 
ATOM   5206 O O   . THR B 1 196 ? -24.284 -20.781 -54.447 1.00 54.10  ? 1679 THR B O   1 
ATOM   5207 C CB  . THR B 1 196 ? -23.958 -20.959 -57.542 1.00 49.93  ? 1679 THR B CB  1 
ATOM   5208 O OG1 . THR B 1 196 ? -23.566 -21.705 -58.697 1.00 47.92  ? 1679 THR B OG1 1 
ATOM   5209 C CG2 . THR B 1 196 ? -23.971 -19.482 -57.874 1.00 48.61  ? 1679 THR B CG2 1 
ATOM   5210 N N   . LYS B 1 197 ? -22.625 -19.344 -54.992 1.00 55.56  ? 1680 LYS B N   1 
ATOM   5211 C CA  . LYS B 1 197 ? -22.871 -18.461 -53.867 1.00 57.89  ? 1680 LYS B CA  1 
ATOM   5212 C C   . LYS B 1 197 ? -23.217 -17.083 -54.416 1.00 59.28  ? 1680 LYS B C   1 
ATOM   5213 O O   . LYS B 1 197 ? -24.368 -16.811 -54.747 1.00 60.94  ? 1680 LYS B O   1 
ATOM   5214 C CB  . LYS B 1 197 ? -21.629 -18.388 -52.969 1.00 57.26  ? 1680 LYS B CB  1 
ATOM   5215 N N   . CYS B 1 198 ? -22.219 -16.223 -54.541 1.00 60.85  ? 1681 CYS B N   1 
ATOM   5216 C CA  . CYS B 1 198 ? -22.454 -14.880 -55.054 1.00 63.29  ? 1681 CYS B CA  1 
ATOM   5217 C C   . CYS B 1 198 ? -21.319 -14.422 -55.957 1.00 62.18  ? 1681 CYS B C   1 
ATOM   5218 O O   . CYS B 1 198 ? -20.223 -14.138 -55.486 1.00 63.57  ? 1681 CYS B O   1 
ATOM   5219 C CB  . CYS B 1 198 ? -22.608 -13.895 -53.891 1.00 66.44  ? 1681 CYS B CB  1 
ATOM   5220 S SG  . CYS B 1 198 ? -22.464 -12.151 -54.380 1.00 73.45  ? 1681 CYS B SG  1 
ATOM   5221 N N   . ARG B 1 199 ? -21.580 -14.352 -57.256 1.00 60.23  ? 1682 ARG B N   1 
ATOM   5222 C CA  . ARG B 1 199 ? -20.560 -13.921 -58.204 1.00 57.28  ? 1682 ARG B CA  1 
ATOM   5223 C C   . ARG B 1 199 ? -20.590 -12.401 -58.251 1.00 57.52  ? 1682 ARG B C   1 
ATOM   5224 O O   . ARG B 1 199 ? -21.631 -11.792 -58.025 1.00 57.80  ? 1682 ARG B O   1 
ATOM   5225 C CB  . ARG B 1 199 ? -20.842 -14.512 -59.599 1.00 54.32  ? 1682 ARG B CB  1 
ATOM   5226 C CG  . ARG B 1 199 ? -20.632 -16.035 -59.703 1.00 47.92  ? 1682 ARG B CG  1 
ATOM   5227 C CD  . ARG B 1 199 ? -19.182 -16.372 -59.991 1.00 42.93  ? 1682 ARG B CD  1 
ATOM   5228 N NE  . ARG B 1 199 ? -18.798 -15.775 -61.265 1.00 40.13  ? 1682 ARG B NE  1 
ATOM   5229 C CZ  . ARG B 1 199 ? -18.542 -16.461 -62.373 1.00 36.02  ? 1682 ARG B CZ  1 
ATOM   5230 N NH1 . ARG B 1 199 ? -18.609 -17.785 -62.352 1.00 35.00  ? 1682 ARG B NH1 1 
ATOM   5231 N NH2 . ARG B 1 199 ? -18.275 -15.815 -63.507 1.00 30.19  ? 1682 ARG B NH2 1 
ATOM   5232 N N   . GLU B 1 200 ? -19.445 -11.791 -58.526 1.00 57.10  ? 1683 GLU B N   1 
ATOM   5233 C CA  . GLU B 1 200 ? -19.368 -10.340 -58.602 1.00 56.04  ? 1683 GLU B CA  1 
ATOM   5234 C C   . GLU B 1 200 ? -19.634 -9.937  -60.049 1.00 54.72  ? 1683 GLU B C   1 
ATOM   5235 O O   . GLU B 1 200 ? -20.184 -8.873  -60.317 1.00 55.07  ? 1683 GLU B O   1 
ATOM   5236 C CB  . GLU B 1 200 ? -17.974 -9.873  -58.159 1.00 56.83  ? 1683 GLU B CB  1 
ATOM   5237 C CG  . GLU B 1 200 ? -17.467 -10.584 -56.898 1.00 59.58  ? 1683 GLU B CG  1 
ATOM   5238 C CD  . GLU B 1 200 ? -15.956 -10.435 -56.686 1.00 61.03  ? 1683 GLU B CD  1 
ATOM   5239 O OE1 . GLU B 1 200 ? -15.337 -11.356 -56.108 1.00 58.86  ? 1683 GLU B OE1 1 
ATOM   5240 O OE2 . GLU B 1 200 ? -15.389 -9.396  -57.090 1.00 63.66  ? 1683 GLU B OE2 1 
ATOM   5241 N N   . PHE B 1 201 ? -19.242 -10.814 -60.971 1.00 53.44  ? 1684 PHE B N   1 
ATOM   5242 C CA  . PHE B 1 201 ? -19.403 -10.594 -62.408 1.00 51.98  ? 1684 PHE B CA  1 
ATOM   5243 C C   . PHE B 1 201 ? -20.072 -11.794 -63.055 1.00 50.94  ? 1684 PHE B C   1 
ATOM   5244 O O   . PHE B 1 201 ? -19.872 -12.928 -62.604 1.00 53.08  ? 1684 PHE B O   1 
ATOM   5245 C CB  . PHE B 1 201 ? -18.047 -10.403 -63.057 1.00 51.61  ? 1684 PHE B CB  1 
ATOM   5246 C CG  . PHE B 1 201 ? -17.423 -9.093  -62.750 1.00 53.82  ? 1684 PHE B CG  1 
ATOM   5247 C CD1 . PHE B 1 201 ? -17.609 -8.013  -63.602 1.00 53.49  ? 1684 PHE B CD1 1 
ATOM   5248 C CD2 . PHE B 1 201 ? -16.649 -8.932  -61.605 1.00 53.58  ? 1684 PHE B CD2 1 
ATOM   5249 C CE1 . PHE B 1 201 ? -17.031 -6.792  -63.318 1.00 56.03  ? 1684 PHE B CE1 1 
ATOM   5250 C CE2 . PHE B 1 201 ? -16.063 -7.708  -61.308 1.00 54.37  ? 1684 PHE B CE2 1 
ATOM   5251 C CZ  . PHE B 1 201 ? -16.250 -6.636  -62.160 1.00 54.75  ? 1684 PHE B CZ  1 
ATOM   5252 N N   . VAL B 1 202 ? -20.855 -11.554 -64.107 1.00 46.98  ? 1685 VAL B N   1 
ATOM   5253 C CA  . VAL B 1 202 ? -21.531 -12.655 -64.794 1.00 43.44  ? 1685 VAL B CA  1 
ATOM   5254 C C   . VAL B 1 202 ? -20.574 -13.321 -65.773 1.00 41.53  ? 1685 VAL B C   1 
ATOM   5255 O O   . VAL B 1 202 ? -19.788 -12.638 -66.433 1.00 39.78  ? 1685 VAL B O   1 
ATOM   5256 C CB  . VAL B 1 202 ? -22.795 -12.180 -65.578 1.00 42.70  ? 1685 VAL B CB  1 
ATOM   5257 C CG1 . VAL B 1 202 ? -23.777 -11.513 -64.626 1.00 40.35  ? 1685 VAL B CG1 1 
ATOM   5258 C CG2 . VAL B 1 202 ? -22.403 -11.220 -66.700 1.00 41.65  ? 1685 VAL B CG2 1 
ATOM   5259 N N   . PRO B 1 203 ? -20.636 -14.664 -65.876 1.00 40.78  ? 1686 PRO B N   1 
ATOM   5260 C CA  . PRO B 1 203 ? -19.821 -15.519 -66.743 1.00 40.99  ? 1686 PRO B CA  1 
ATOM   5261 C C   . PRO B 1 203 ? -19.352 -14.865 -68.025 1.00 41.06  ? 1686 PRO B C   1 
ATOM   5262 O O   . PRO B 1 203 ? -20.119 -14.196 -68.697 1.00 42.56  ? 1686 PRO B O   1 
ATOM   5263 C CB  . PRO B 1 203 ? -20.744 -16.698 -67.019 1.00 40.59  ? 1686 PRO B CB  1 
ATOM   5264 C CG  . PRO B 1 203 ? -21.412 -16.873 -65.707 1.00 41.71  ? 1686 PRO B CG  1 
ATOM   5265 C CD  . PRO B 1 203 ? -21.719 -15.452 -65.262 1.00 41.40  ? 1686 PRO B CD  1 
ATOM   5266 N N   . SER B 1 204 ? -18.083 -15.072 -68.357 1.00 41.97  ? 1687 SER B N   1 
ATOM   5267 C CA  . SER B 1 204 ? -17.490 -14.524 -69.577 1.00 42.28  ? 1687 SER B CA  1 
ATOM   5268 C C   . SER B 1 204 ? -17.794 -15.436 -70.788 1.00 43.06  ? 1687 SER B C   1 
ATOM   5269 O O   . SER B 1 204 ? -18.273 -16.565 -70.619 1.00 43.09  ? 1687 SER B O   1 
ATOM   5270 C CB  . SER B 1 204 ? -15.979 -14.428 -69.399 1.00 40.95  ? 1687 SER B CB  1 
ATOM   5271 O OG  . SER B 1 204 ? -15.434 -15.733 -69.378 1.00 37.66  ? 1687 SER B OG  1 
ATOM   5272 N N   . ARG B 1 205 ? -17.507 -14.947 -71.996 1.00 42.82  ? 1688 ARG B N   1 
ATOM   5273 C CA  . ARG B 1 205 ? -17.721 -15.711 -73.229 1.00 43.70  ? 1688 ARG B CA  1 
ATOM   5274 C C   . ARG B 1 205 ? -17.208 -17.142 -73.106 1.00 42.96  ? 1688 ARG B C   1 
ATOM   5275 O O   . ARG B 1 205 ? -17.943 -18.098 -73.373 1.00 42.63  ? 1688 ARG B O   1 
ATOM   5276 C CB  . ARG B 1 205 ? -17.021 -15.028 -74.411 1.00 47.43  ? 1688 ARG B CB  1 
ATOM   5277 C CG  . ARG B 1 205 ? -17.739 -13.804 -74.956 1.00 49.98  ? 1688 ARG B CG  1 
ATOM   5278 C CD  . ARG B 1 205 ? -17.007 -13.212 -76.148 1.00 54.44  ? 1688 ARG B CD  1 
ATOM   5279 N NE  . ARG B 1 205 ? -17.939 -12.829 -77.207 1.00 59.43  ? 1688 ARG B NE  1 
ATOM   5280 C CZ  . ARG B 1 205 ? -18.547 -13.691 -78.023 1.00 60.63  ? 1688 ARG B CZ  1 
ATOM   5281 N NH1 . ARG B 1 205 ? -18.316 -14.993 -77.899 1.00 62.71  ? 1688 ARG B NH1 1 
ATOM   5282 N NH2 . ARG B 1 205 ? -19.381 -13.256 -78.966 1.00 60.03  ? 1688 ARG B NH2 1 
ATOM   5283 N N   . ASP B 1 206 ? -15.942 -17.276 -72.709 1.00 42.13  ? 1689 ASP B N   1 
ATOM   5284 C CA  . ASP B 1 206 ? -15.307 -18.576 -72.514 1.00 41.82  ? 1689 ASP B CA  1 
ATOM   5285 C C   . ASP B 1 206 ? -16.079 -19.424 -71.515 1.00 41.29  ? 1689 ASP B C   1 
ATOM   5286 O O   . ASP B 1 206 ? -16.403 -20.571 -71.799 1.00 42.47  ? 1689 ASP B O   1 
ATOM   5287 C CB  . ASP B 1 206 ? -13.872 -18.408 -72.005 1.00 43.43  ? 1689 ASP B CB  1 
ATOM   5288 C CG  . ASP B 1 206 ? -12.898 -17.973 -73.091 1.00 45.17  ? 1689 ASP B CG  1 
ATOM   5289 O OD1 . ASP B 1 206 ? -13.332 -17.266 -74.028 1.00 45.10  ? 1689 ASP B OD1 1 
ATOM   5290 O OD2 . ASP B 1 206 ? -11.695 -18.329 -72.988 1.00 44.11  ? 1689 ASP B OD2 1 
ATOM   5291 N N   . GLU B 1 207 ? -16.364 -18.871 -70.338 1.00 40.07  ? 1690 GLU B N   1 
ATOM   5292 C CA  . GLU B 1 207 ? -17.090 -19.618 -69.311 1.00 39.05  ? 1690 GLU B CA  1 
ATOM   5293 C C   . GLU B 1 207 ? -18.394 -20.194 -69.873 1.00 38.11  ? 1690 GLU B C   1 
ATOM   5294 O O   . GLU B 1 207 ? -18.668 -21.386 -69.730 1.00 36.81  ? 1690 GLU B O   1 
ATOM   5295 C CB  . GLU B 1 207 ? -17.397 -18.712 -68.111 1.00 38.64  ? 1690 GLU B CB  1 
ATOM   5296 C CG  . GLU B 1 207 ? -17.450 -19.447 -66.773 1.00 37.49  ? 1690 GLU B CG  1 
ATOM   5297 C CD  . GLU B 1 207 ? -17.882 -18.559 -65.614 1.00 37.54  ? 1690 GLU B CD  1 
ATOM   5298 O OE1 . GLU B 1 207 ? -17.620 -17.331 -65.636 1.00 35.90  ? 1690 GLU B OE1 1 
ATOM   5299 O OE2 . GLU B 1 207 ? -18.481 -19.106 -64.667 1.00 36.52  ? 1690 GLU B OE2 1 
ATOM   5300 N N   . ILE B 1 208 ? -19.184 -19.335 -70.518 1.00 37.98  ? 1691 ILE B N   1 
ATOM   5301 C CA  . ILE B 1 208 ? -20.460 -19.731 -71.107 1.00 37.79  ? 1691 ILE B CA  1 
ATOM   5302 C C   . ILE B 1 208 ? -20.258 -20.895 -72.070 1.00 40.29  ? 1691 ILE B C   1 
ATOM   5303 O O   . ILE B 1 208 ? -21.004 -21.877 -72.039 1.00 41.14  ? 1691 ILE B O   1 
ATOM   5304 C CB  . ILE B 1 208 ? -21.113 -18.549 -71.852 1.00 35.90  ? 1691 ILE B CB  1 
ATOM   5305 C CG1 . ILE B 1 208 ? -21.366 -17.404 -70.864 1.00 35.99  ? 1691 ILE B CG1 1 
ATOM   5306 C CG2 . ILE B 1 208 ? -22.418 -18.992 -72.496 1.00 33.55  ? 1691 ILE B CG2 1 
ATOM   5307 C CD1 . ILE B 1 208 ? -21.843 -16.116 -71.478 1.00 35.21  ? 1691 ILE B CD1 1 
ATOM   5308 N N   . GLU B 1 209 ? -19.247 -20.793 -72.925 1.00 41.95  ? 1692 GLU B N   1 
ATOM   5309 C CA  . GLU B 1 209 ? -18.980 -21.866 -73.861 1.00 43.54  ? 1692 GLU B CA  1 
ATOM   5310 C C   . GLU B 1 209 ? -18.635 -23.127 -73.091 1.00 42.82  ? 1692 GLU B C   1 
ATOM   5311 O O   . GLU B 1 209 ? -19.050 -24.220 -73.466 1.00 44.12  ? 1692 GLU B O   1 
ATOM   5312 C CB  . GLU B 1 209 ? -17.830 -21.504 -74.808 1.00 47.17  ? 1692 GLU B CB  1 
ATOM   5313 C CG  . GLU B 1 209 ? -17.610 -22.542 -75.916 1.00 51.61  ? 1692 GLU B CG  1 
ATOM   5314 C CD  . GLU B 1 209 ? -16.826 -21.995 -77.105 1.00 55.84  ? 1692 GLU B CD  1 
ATOM   5315 O OE1 . GLU B 1 209 ? -17.037 -22.502 -78.238 1.00 56.50  ? 1692 GLU B OE1 1 
ATOM   5316 O OE2 . GLU B 1 209 ? -15.996 -21.070 -76.913 1.00 57.01  ? 1692 GLU B OE2 1 
ATOM   5317 N N   . ALA B 1 210 ? -17.876 -22.985 -72.012 1.00 41.94  ? 1693 ALA B N   1 
ATOM   5318 C CA  . ALA B 1 210 ? -17.508 -24.141 -71.208 1.00 41.45  ? 1693 ALA B CA  1 
ATOM   5319 C C   . ALA B 1 210 ? -18.764 -24.709 -70.577 1.00 41.14  ? 1693 ALA B C   1 
ATOM   5320 O O   . ALA B 1 210 ? -19.013 -25.903 -70.645 1.00 42.12  ? 1693 ALA B O   1 
ATOM   5321 C CB  . ALA B 1 210 ? -16.511 -23.747 -70.126 1.00 42.10  ? 1693 ALA B CB  1 
ATOM   5322 N N   . LEU B 1 211 ? -19.568 -23.846 -69.975 1.00 39.57  ? 1694 LEU B N   1 
ATOM   5323 C CA  . LEU B 1 211 ? -20.790 -24.304 -69.343 1.00 39.26  ? 1694 LEU B CA  1 
ATOM   5324 C C   . LEU B 1 211 ? -21.703 -25.018 -70.336 1.00 38.39  ? 1694 LEU B C   1 
ATOM   5325 O O   . LEU B 1 211 ? -22.307 -26.045 -70.010 1.00 35.72  ? 1694 LEU B O   1 
ATOM   5326 C CB  . LEU B 1 211 ? -21.512 -23.127 -68.683 1.00 39.65  ? 1694 LEU B CB  1 
ATOM   5327 C CG  . LEU B 1 211 ? -20.699 -22.512 -67.532 1.00 39.70  ? 1694 LEU B CG  1 
ATOM   5328 C CD1 . LEU B 1 211 ? -21.430 -21.334 -66.941 1.00 38.45  ? 1694 LEU B CD1 1 
ATOM   5329 C CD2 . LEU B 1 211 ? -20.450 -23.564 -66.464 1.00 39.86  ? 1694 LEU B CD2 1 
ATOM   5330 N N   . ILE B 1 212 ? -21.795 -24.479 -71.545 1.00 38.41  ? 1695 ILE B N   1 
ATOM   5331 C CA  . ILE B 1 212 ? -22.624 -25.085 -72.586 1.00 40.27  ? 1695 ILE B CA  1 
ATOM   5332 C C   . ILE B 1 212 ? -22.223 -26.549 -72.836 1.00 41.88  ? 1695 ILE B C   1 
ATOM   5333 O O   . ILE B 1 212 ? -23.083 -27.417 -73.007 1.00 42.63  ? 1695 ILE B O   1 
ATOM   5334 C CB  . ILE B 1 212 ? -22.540 -24.262 -73.909 1.00 40.31  ? 1695 ILE B CB  1 
ATOM   5335 C CG1 . ILE B 1 212 ? -23.413 -23.001 -73.780 1.00 39.69  ? 1695 ILE B CG1 1 
ATOM   5336 C CG2 . ILE B 1 212 ? -22.953 -25.115 -75.099 1.00 38.30  ? 1695 ILE B CG2 1 
ATOM   5337 C CD1 . ILE B 1 212 ? -23.403 -22.082 -74.982 1.00 36.12  ? 1695 ILE B CD1 1 
ATOM   5338 N N   . HIS B 1 213 ? -20.924 -26.828 -72.827 1.00 43.21  ? 1696 HIS B N   1 
ATOM   5339 C CA  . HIS B 1 213 ? -20.448 -28.190 -73.046 1.00 45.21  ? 1696 HIS B CA  1 
ATOM   5340 C C   . HIS B 1 213 ? -20.292 -28.918 -71.712 1.00 46.74  ? 1696 HIS B C   1 
ATOM   5341 O O   . HIS B 1 213 ? -19.694 -29.994 -71.648 1.00 47.97  ? 1696 HIS B O   1 
ATOM   5342 C CB  . HIS B 1 213 ? -19.108 -28.179 -73.812 1.00 45.55  ? 1696 HIS B CB  1 
ATOM   5343 C CG  . HIS B 1 213 ? -19.185 -27.505 -75.146 1.00 46.20  ? 1696 HIS B CG  1 
ATOM   5344 N ND1 . HIS B 1 213 ? -20.094 -27.877 -76.115 1.00 46.93  ? 1696 HIS B ND1 1 
ATOM   5345 C CD2 . HIS B 1 213 ? -18.513 -26.443 -75.653 1.00 47.96  ? 1696 HIS B CD2 1 
ATOM   5346 C CE1 . HIS B 1 213 ? -19.986 -27.067 -77.155 1.00 46.78  ? 1696 HIS B CE1 1 
ATOM   5347 N NE2 . HIS B 1 213 ? -19.034 -26.187 -76.900 1.00 47.58  ? 1696 HIS B NE2 1 
ATOM   5348 N N   . ARG B 1 214 ? -20.840 -28.330 -70.651 1.00 47.61  ? 1697 ARG B N   1 
ATOM   5349 C CA  . ARG B 1 214 ? -20.772 -28.922 -69.316 1.00 48.85  ? 1697 ARG B CA  1 
ATOM   5350 C C   . ARG B 1 214 ? -19.339 -29.325 -68.951 1.00 49.59  ? 1697 ARG B C   1 
ATOM   5351 O O   . ARG B 1 214 ? -19.110 -30.304 -68.229 1.00 50.32  ? 1697 ARG B O   1 
ATOM   5352 C CB  . ARG B 1 214 ? -21.701 -30.149 -69.213 1.00 49.90  ? 1697 ARG B CB  1 
ATOM   5353 C CG  . ARG B 1 214 ? -23.190 -29.881 -69.455 1.00 50.99  ? 1697 ARG B CG  1 
ATOM   5354 C CD  . ARG B 1 214 ? -24.035 -31.123 -69.141 1.00 51.68  ? 1697 ARG B CD  1 
ATOM   5355 N NE  . ARG B 1 214 ? -23.899 -32.177 -70.144 1.00 51.20  ? 1697 ARG B NE  1 
ATOM   5356 C CZ  . ARG B 1 214 ? -24.486 -32.157 -71.336 1.00 51.30  ? 1697 ARG B CZ  1 
ATOM   5357 N NH1 . ARG B 1 214 ? -25.263 -31.140 -71.687 1.00 52.12  ? 1697 ARG B NH1 1 
ATOM   5358 N NH2 . ARG B 1 214 ? -24.291 -33.151 -72.187 1.00 51.19  ? 1697 ARG B NH2 1 
ATOM   5359 N N   . GLN B 1 215 ? -18.374 -28.556 -69.443 1.00 49.85  ? 1698 GLN B N   1 
ATOM   5360 C CA  . GLN B 1 215 ? -16.961 -28.811 -69.167 1.00 48.59  ? 1698 GLN B CA  1 
ATOM   5361 C C   . GLN B 1 215 ? -16.357 -27.659 -68.381 1.00 47.45  ? 1698 GLN B C   1 
ATOM   5362 O O   . GLN B 1 215 ? -16.975 -26.595 -68.240 1.00 45.24  ? 1698 GLN B O   1 
ATOM   5363 C CB  . GLN B 1 215 ? -16.193 -28.967 -70.476 1.00 49.01  ? 1698 GLN B CB  1 
ATOM   5364 C CG  . GLN B 1 215 ? -16.763 -30.029 -71.383 1.00 53.02  ? 1698 GLN B CG  1 
ATOM   5365 C CD  . GLN B 1 215 ? -16.089 -30.054 -72.728 1.00 54.81  ? 1698 GLN B CD  1 
ATOM   5366 O OE1 . GLN B 1 215 ? -15.628 -29.018 -73.220 1.00 58.32  ? 1698 GLN B OE1 1 
ATOM   5367 N NE2 . GLN B 1 215 ? -16.044 -31.225 -73.349 1.00 55.31  ? 1698 GLN B NE2 1 
ATOM   5368 N N   . GLU B 1 216 ? -15.147 -27.882 -67.875 1.00 45.74  ? 1699 GLU B N   1 
ATOM   5369 C CA  . GLU B 1 216 ? -14.426 -26.860 -67.129 1.00 44.80  ? 1699 GLU B CA  1 
ATOM   5370 C C   . GLU B 1 216 ? -13.773 -25.961 -68.180 1.00 43.69  ? 1699 GLU B C   1 
ATOM   5371 O O   . GLU B 1 216 ? -13.675 -26.352 -69.343 1.00 43.72  ? 1699 GLU B O   1 
ATOM   5372 C CB  . GLU B 1 216 ? -13.358 -27.509 -66.254 1.00 45.20  ? 1699 GLU B CB  1 
ATOM   5373 C CG  . GLU B 1 216 ? -13.816 -28.834 -65.661 1.00 49.86  ? 1699 GLU B CG  1 
ATOM   5374 C CD  . GLU B 1 216 ? -12.830 -29.442 -64.662 1.00 51.46  ? 1699 GLU B CD  1 
ATOM   5375 O OE1 . GLU B 1 216 ? -11.606 -29.449 -64.926 1.00 52.98  ? 1699 GLU B OE1 1 
ATOM   5376 O OE2 . GLU B 1 216 ? -13.292 -29.932 -63.609 1.00 52.66  ? 1699 GLU B OE2 1 
ATOM   5377 N N   . MET B 1 217 ? -13.349 -24.763 -67.790 1.00 41.34  ? 1700 MET B N   1 
ATOM   5378 C CA  . MET B 1 217 ? -12.713 -23.862 -68.734 1.00 40.74  ? 1700 MET B CA  1 
ATOM   5379 C C   . MET B 1 217 ? -11.226 -23.752 -68.415 1.00 40.09  ? 1700 MET B C   1 
ATOM   5380 O O   . MET B 1 217 ? -10.782 -24.148 -67.332 1.00 40.27  ? 1700 MET B O   1 
ATOM   5381 C CB  . MET B 1 217 ? -13.364 -22.480 -68.684 1.00 41.78  ? 1700 MET B CB  1 
ATOM   5382 C CG  . MET B 1 217 ? -13.080 -21.720 -67.419 1.00 45.51  ? 1700 MET B CG  1 
ATOM   5383 S SD  . MET B 1 217 ? -14.236 -20.380 -67.187 1.00 50.07  ? 1700 MET B SD  1 
ATOM   5384 C CE  . MET B 1 217 ? -13.519 -19.142 -68.213 1.00 49.29  ? 1700 MET B CE  1 
ATOM   5385 N N   . THR B 1 218 ? -10.455 -23.229 -69.366 1.00 38.75  ? 1701 THR B N   1 
ATOM   5386 C CA  . THR B 1 218 ? -9.019  -23.070 -69.173 1.00 35.96  ? 1701 THR B CA  1 
ATOM   5387 C C   . THR B 1 218 ? -8.580  -21.599 -69.274 1.00 36.10  ? 1701 THR B C   1 
ATOM   5388 O O   . THR B 1 218 ? -9.247  -20.739 -69.888 1.00 31.68  ? 1701 THR B O   1 
ATOM   5389 C CB  . THR B 1 218 ? -8.192  -23.912 -70.202 1.00 35.33  ? 1701 THR B CB  1 
ATOM   5390 O OG1 . THR B 1 218 ? -8.327  -23.337 -71.501 1.00 33.14  ? 1701 THR B OG1 1 
ATOM   5391 C CG2 . THR B 1 218 ? -8.668  -25.375 -70.247 1.00 32.46  ? 1701 THR B CG2 1 
ATOM   5392 N N   . SER B 1 219 ? -7.441  -21.321 -68.652 1.00 35.57  ? 1702 SER B N   1 
ATOM   5393 C CA  . SER B 1 219 ? -6.892  -19.981 -68.652 1.00 35.68  ? 1702 SER B CA  1 
ATOM   5394 C C   . SER B 1 219 ? -5.383  -20.081 -68.463 1.00 36.84  ? 1702 SER B C   1 
ATOM   5395 O O   . SER B 1 219 ? -4.816  -21.176 -68.366 1.00 35.86  ? 1702 SER B O   1 
ATOM   5396 C CB  . SER B 1 219 ? -7.521  -19.163 -67.519 1.00 35.06  ? 1702 SER B CB  1 
ATOM   5397 O OG  . SER B 1 219 ? -7.520  -17.779 -67.822 1.00 34.82  ? 1702 SER B OG  1 
ATOM   5398 N N   . THR B 1 220 ? -4.723  -18.939 -68.400 1.00 37.81  ? 1703 THR B N   1 
ATOM   5399 C CA  . THR B 1 220 ? -3.294  -18.971 -68.226 1.00 40.11  ? 1703 THR B CA  1 
ATOM   5400 C C   . THR B 1 220 ? -2.811  -18.168 -67.036 1.00 40.18  ? 1703 THR B C   1 
ATOM   5401 O O   . THR B 1 220 ? -3.340  -17.099 -66.729 1.00 41.42  ? 1703 THR B O   1 
ATOM   5402 C CB  . THR B 1 220 ? -2.587  -18.487 -69.492 1.00 40.99  ? 1703 THR B CB  1 
ATOM   5403 O OG1 . THR B 1 220 ? -2.808  -19.439 -70.543 1.00 42.07  ? 1703 THR B OG1 1 
ATOM   5404 C CG2 . THR B 1 220 ? -1.089  -18.339 -69.237 1.00 40.74  ? 1703 THR B CG2 1 
ATOM   5405 N N   . VAL B 1 221 ? -1.800  -18.713 -66.371 1.00 39.51  ? 1704 VAL B N   1 
ATOM   5406 C CA  . VAL B 1 221 ? -1.191  -18.083 -65.213 1.00 39.58  ? 1704 VAL B CA  1 
ATOM   5407 C C   . VAL B 1 221 ? 0.272   -17.798 -65.565 1.00 39.90  ? 1704 VAL B C   1 
ATOM   5408 O O   . VAL B 1 221 ? 1.045   -18.717 -65.848 1.00 34.70  ? 1704 VAL B O   1 
ATOM   5409 C CB  . VAL B 1 221 ? -1.262  -19.010 -63.953 1.00 39.09  ? 1704 VAL B CB  1 
ATOM   5410 C CG1 . VAL B 1 221 ? -0.489  -18.379 -62.799 1.00 39.36  ? 1704 VAL B CG1 1 
ATOM   5411 C CG2 . VAL B 1 221 ? -2.719  -19.235 -63.538 1.00 35.67  ? 1704 VAL B CG2 1 
ATOM   5412 N N   . TYR B 1 222 ? 0.636   -16.518 -65.565 1.00 41.84  ? 1705 TYR B N   1 
ATOM   5413 C CA  . TYR B 1 222 ? 2.003   -16.124 -65.888 1.00 43.88  ? 1705 TYR B CA  1 
ATOM   5414 C C   . TYR B 1 222 ? 2.869   -15.906 -64.652 1.00 43.13  ? 1705 TYR B C   1 
ATOM   5415 O O   . TYR B 1 222 ? 2.368   -15.720 -63.555 1.00 42.09  ? 1705 TYR B O   1 
ATOM   5416 C CB  . TYR B 1 222 ? 2.010   -14.847 -66.725 1.00 44.58  ? 1705 TYR B CB  1 
ATOM   5417 C CG  . TYR B 1 222 ? 1.199   -14.947 -67.990 1.00 47.98  ? 1705 TYR B CG  1 
ATOM   5418 C CD1 . TYR B 1 222 ? -0.193  -14.892 -67.951 1.00 49.07  ? 1705 TYR B CD1 1 
ATOM   5419 C CD2 . TYR B 1 222 ? 1.822   -15.074 -69.233 1.00 48.03  ? 1705 TYR B CD2 1 
ATOM   5420 C CE1 . TYR B 1 222 ? -0.951  -14.956 -69.119 1.00 50.80  ? 1705 TYR B CE1 1 
ATOM   5421 C CE2 . TYR B 1 222 ? 1.078   -15.140 -70.409 1.00 49.72  ? 1705 TYR B CE2 1 
ATOM   5422 C CZ  . TYR B 1 222 ? -0.312  -15.080 -70.347 1.00 51.17  ? 1705 TYR B CZ  1 
ATOM   5423 O OH  . TYR B 1 222 ? -1.070  -15.151 -71.502 1.00 52.62  ? 1705 TYR B OH  1 
ATOM   5424 N N   . CYS B 1 223 ? 4.178   -15.946 -64.845 1.00 43.81  ? 1706 CYS B N   1 
ATOM   5425 C CA  . CYS B 1 223 ? 5.113   -15.708 -63.757 1.00 46.52  ? 1706 CYS B CA  1 
ATOM   5426 C C   . CYS B 1 223 ? 6.293   -14.957 -64.341 1.00 45.19  ? 1706 CYS B C   1 
ATOM   5427 O O   . CYS B 1 223 ? 6.732   -15.257 -65.434 1.00 46.41  ? 1706 CYS B O   1 
ATOM   5428 C CB  . CYS B 1 223 ? 5.564   -17.027 -63.129 1.00 47.44  ? 1706 CYS B CB  1 
ATOM   5429 S SG  . CYS B 1 223 ? 6.527   -18.081 -64.215 1.00 50.48  ? 1706 CYS B SG  1 
ATOM   5430 N N   . HIS B 1 224 ? 6.799   -13.974 -63.613 1.00 47.09  ? 1707 HIS B N   1 
ATOM   5431 C CA  . HIS B 1 224 ? 7.916   -13.154 -64.085 1.00 47.96  ? 1707 HIS B CA  1 
ATOM   5432 C C   . HIS B 1 224 ? 9.010   -13.910 -64.817 1.00 46.62  ? 1707 HIS B C   1 
ATOM   5433 O O   . HIS B 1 224 ? 9.412   -14.991 -64.403 1.00 46.18  ? 1707 HIS B O   1 
ATOM   5434 C CB  . HIS B 1 224 ? 8.486   -12.356 -62.913 1.00 48.62  ? 1707 HIS B CB  1 
ATOM   5435 C CG  . HIS B 1 224 ? 7.496   -11.397 -62.330 1.00 52.30  ? 1707 HIS B CG  1 
ATOM   5436 N ND1 . HIS B 1 224 ? 6.803   -10.485 -63.103 1.00 51.70  ? 1707 HIS B ND1 1 
ATOM   5437 C CD2 . HIS B 1 224 ? 7.054   -11.226 -61.060 1.00 52.55  ? 1707 HIS B CD2 1 
ATOM   5438 C CE1 . HIS B 1 224 ? 5.979   -9.796  -62.334 1.00 53.08  ? 1707 HIS B CE1 1 
ATOM   5439 N NE2 . HIS B 1 224 ? 6.111   -10.226 -61.090 1.00 54.01  ? 1707 HIS B NE2 1 
ATOM   5440 N N   . GLY B 1 225 ? 9.466   -13.339 -65.929 1.00 47.13  ? 1708 GLY B N   1 
ATOM   5441 C CA  . GLY B 1 225 ? 10.504  -13.977 -66.731 1.00 47.52  ? 1708 GLY B CA  1 
ATOM   5442 C C   . GLY B 1 225 ? 9.974   -14.639 -67.999 1.00 47.74  ? 1708 GLY B C   1 
ATOM   5443 O O   . GLY B 1 225 ? 10.685  -15.407 -68.644 1.00 47.05  ? 1708 GLY B O   1 
ATOM   5444 N N   . GLY B 1 226 ? 8.725   -14.349 -68.362 1.00 48.12  ? 1709 GLY B N   1 
ATOM   5445 C CA  . GLY B 1 226 ? 8.149   -14.943 -69.555 1.00 47.81  ? 1709 GLY B CA  1 
ATOM   5446 C C   . GLY B 1 226 ? 7.558   -16.331 -69.347 1.00 48.83  ? 1709 GLY B C   1 
ATOM   5447 O O   . GLY B 1 226 ? 7.077   -16.952 -70.297 1.00 49.11  ? 1709 GLY B O   1 
ATOM   5448 N N   . GLY B 1 227 ? 7.591   -16.828 -68.110 1.00 48.22  ? 1710 GLY B N   1 
ATOM   5449 C CA  . GLY B 1 227 ? 7.031   -18.142 -67.832 1.00 46.10  ? 1710 GLY B CA  1 
ATOM   5450 C C   . GLY B 1 227 ? 5.509   -18.103 -67.801 1.00 45.25  ? 1710 GLY B C   1 
ATOM   5451 O O   . GLY B 1 227 ? 4.912   -17.043 -67.586 1.00 43.58  ? 1710 GLY B O   1 
ATOM   5452 N N   . SER B 1 228 ? 4.871   -19.245 -68.035 1.00 43.10  ? 1711 SER B N   1 
ATOM   5453 C CA  . SER B 1 228 ? 3.417   -19.284 -67.998 1.00 43.85  ? 1711 SER B CA  1 
ATOM   5454 C C   . SER B 1 228 ? 2.912   -20.710 -67.773 1.00 43.91  ? 1711 SER B C   1 
ATOM   5455 O O   . SER B 1 228 ? 3.617   -21.675 -68.058 1.00 43.42  ? 1711 SER B O   1 
ATOM   5456 C CB  . SER B 1 228 ? 2.818   -18.690 -69.280 1.00 41.42  ? 1711 SER B CB  1 
ATOM   5457 O OG  . SER B 1 228 ? 2.799   -19.630 -70.328 1.00 39.80  ? 1711 SER B OG  1 
ATOM   5458 N N   . CYS B 1 229 ? 1.696   -20.826 -67.245 1.00 43.39  ? 1712 CYS B N   1 
ATOM   5459 C CA  . CYS B 1 229 ? 1.100   -22.120 -66.947 1.00 43.26  ? 1712 CYS B CA  1 
ATOM   5460 C C   . CYS B 1 229 ? -0.373  -22.179 -67.336 1.00 42.74  ? 1712 CYS B C   1 
ATOM   5461 O O   . CYS B 1 229 ? -1.088  -21.168 -67.358 1.00 41.70  ? 1712 CYS B O   1 
ATOM   5462 C CB  . CYS B 1 229 ? 1.245   -22.423 -65.457 1.00 44.88  ? 1712 CYS B CB  1 
ATOM   5463 S SG  . CYS B 1 229 ? 0.666   -24.058 -64.971 1.00 54.00  ? 1712 CYS B SG  1 
ATOM   5464 N N   . LYS B 1 230 ? -0.831  -23.381 -67.643 1.00 42.30  ? 1713 LYS B N   1 
ATOM   5465 C CA  . LYS B 1 230 ? -2.213  -23.563 -68.042 1.00 43.44  ? 1713 LYS B CA  1 
ATOM   5466 C C   . LYS B 1 230 ? -3.011  -24.083 -66.852 1.00 42.01  ? 1713 LYS B C   1 
ATOM   5467 O O   . LYS B 1 230 ? -2.553  -24.962 -66.133 1.00 42.53  ? 1713 LYS B O   1 
ATOM   5468 C CB  . LYS B 1 230 ? -2.262  -24.536 -69.218 1.00 44.44  ? 1713 LYS B CB  1 
ATOM   5469 C CG  . LYS B 1 230 ? -3.635  -24.803 -69.758 1.00 48.51  ? 1713 LYS B CG  1 
ATOM   5470 C CD  . LYS B 1 230 ? -3.552  -25.875 -70.828 1.00 51.89  ? 1713 LYS B CD  1 
ATOM   5471 C CE  . LYS B 1 230 ? -4.927  -26.310 -71.302 1.00 53.08  ? 1713 LYS B CE  1 
ATOM   5472 N NZ  . LYS B 1 230 ? -4.803  -27.501 -72.186 1.00 52.95  ? 1713 LYS B NZ  1 
ATOM   5473 N N   . ILE B 1 231 ? -4.195  -23.523 -66.631 1.00 41.28  ? 1714 ILE B N   1 
ATOM   5474 C CA  . ILE B 1 231 ? -5.026  -23.950 -65.508 1.00 39.74  ? 1714 ILE B CA  1 
ATOM   5475 C C   . ILE B 1 231 ? -6.437  -24.350 -65.909 1.00 39.82  ? 1714 ILE B C   1 
ATOM   5476 O O   . ILE B 1 231 ? -6.999  -23.829 -66.879 1.00 38.28  ? 1714 ILE B O   1 
ATOM   5477 C CB  . ILE B 1 231 ? -5.145  -22.840 -64.441 1.00 39.63  ? 1714 ILE B CB  1 
ATOM   5478 C CG1 . ILE B 1 231 ? -5.708  -21.563 -65.079 1.00 37.14  ? 1714 ILE B CG1 1 
ATOM   5479 C CG2 . ILE B 1 231 ? -3.783  -22.583 -63.810 1.00 39.09  ? 1714 ILE B CG2 1 
ATOM   5480 C CD1 . ILE B 1 231 ? -6.340  -20.614 -64.089 1.00 33.78  ? 1714 ILE B CD1 1 
ATOM   5481 N N   . THR B 1 232 ? -6.999  -25.275 -65.138 1.00 40.55  ? 1715 THR B N   1 
ATOM   5482 C CA  . THR B 1 232 ? -8.353  -25.771 -65.360 1.00 43.63  ? 1715 THR B CA  1 
ATOM   5483 C C   . THR B 1 232 ? -9.257  -25.335 -64.193 1.00 43.42  ? 1715 THR B C   1 
ATOM   5484 O O   . THR B 1 232 ? -9.005  -25.683 -63.030 1.00 41.72  ? 1715 THR B O   1 
ATOM   5485 C CB  . THR B 1 232 ? -8.369  -27.307 -65.437 1.00 45.25  ? 1715 THR B CB  1 
ATOM   5486 O OG1 . THR B 1 232 ? -7.182  -27.765 -66.097 1.00 46.70  ? 1715 THR B OG1 1 
ATOM   5487 C CG2 . THR B 1 232 ? -9.584  -27.777 -66.206 1.00 45.39  ? 1715 THR B CG2 1 
ATOM   5488 N N   . ILE B 1 233 ? -10.299 -24.571 -64.507 1.00 43.14  ? 1716 ILE B N   1 
ATOM   5489 C CA  . ILE B 1 233 ? -11.223 -24.085 -63.481 1.00 44.37  ? 1716 ILE B CA  1 
ATOM   5490 C C   . ILE B 1 233 ? -12.702 -24.252 -63.870 1.00 44.52  ? 1716 ILE B C   1 
ATOM   5491 O O   . ILE B 1 233 ? -13.039 -24.394 -65.048 1.00 44.07  ? 1716 ILE B O   1 
ATOM   5492 C CB  . ILE B 1 233 ? -10.997 -22.562 -63.184 1.00 44.32  ? 1716 ILE B CB  1 
ATOM   5493 C CG1 . ILE B 1 233 ? -11.351 -21.725 -64.420 1.00 44.01  ? 1716 ILE B CG1 1 
ATOM   5494 C CG2 . ILE B 1 233 ? -9.558  -22.310 -62.761 1.00 43.58  ? 1716 ILE B CG2 1 
ATOM   5495 C CD1 . ILE B 1 233 ? -11.408 -20.219 -64.163 1.00 45.53  ? 1716 ILE B CD1 1 
ATOM   5496 N N   . ASN B 1 234 ? -13.579 -24.245 -62.871 1.00 44.71  ? 1717 ASN B N   1 
ATOM   5497 C CA  . ASN B 1 234 ? -15.014 -24.322 -63.127 1.00 44.54  ? 1717 ASN B CA  1 
ATOM   5498 C C   . ASN B 1 234 ? -15.582 -22.986 -62.662 1.00 44.37  ? 1717 ASN B C   1 
ATOM   5499 O O   . ASN B 1 234 ? -14.827 -22.075 -62.360 1.00 45.43  ? 1717 ASN B O   1 
ATOM   5500 C CB  . ASN B 1 234 ? -15.676 -25.495 -62.390 1.00 43.82  ? 1717 ASN B CB  1 
ATOM   5501 C CG  . ASN B 1 234 ? -15.432 -25.468 -60.915 1.00 44.47  ? 1717 ASN B CG  1 
ATOM   5502 O OD1 . ASN B 1 234 ? -15.476 -24.412 -60.293 1.00 46.67  ? 1717 ASN B OD1 1 
ATOM   5503 N ND2 . ASN B 1 234 ? -15.177 -26.635 -60.333 1.00 44.85  ? 1717 ASN B ND2 1 
ATOM   5504 N N   . SER B 1 235 ? -16.899 -22.862 -62.607 1.00 45.51  ? 1718 SER B N   1 
ATOM   5505 C CA  . SER B 1 235 ? -17.538 -21.609 -62.205 1.00 45.62  ? 1718 SER B CA  1 
ATOM   5506 C C   . SER B 1 235 ? -17.419 -21.262 -60.726 1.00 46.29  ? 1718 SER B C   1 
ATOM   5507 O O   . SER B 1 235 ? -17.976 -20.254 -60.272 1.00 47.90  ? 1718 SER B O   1 
ATOM   5508 C CB  . SER B 1 235 ? -19.014 -21.654 -62.590 1.00 44.59  ? 1718 SER B CB  1 
ATOM   5509 O OG  . SER B 1 235 ? -19.148 -21.869 -63.982 1.00 46.20  ? 1718 SER B OG  1 
ATOM   5510 N N   . HIS B 1 236 ? -16.683 -22.079 -59.980 1.00 45.13  ? 1719 HIS B N   1 
ATOM   5511 C CA  . HIS B 1 236 ? -16.538 -21.855 -58.550 1.00 45.28  ? 1719 HIS B CA  1 
ATOM   5512 C C   . HIS B 1 236 ? -15.096 -21.893 -58.019 1.00 45.40  ? 1719 HIS B C   1 
ATOM   5513 O O   . HIS B 1 236 ? -14.831 -21.415 -56.913 1.00 46.60  ? 1719 HIS B O   1 
ATOM   5514 C CB  . HIS B 1 236 ? -17.386 -22.885 -57.787 1.00 44.23  ? 1719 HIS B CB  1 
ATOM   5515 C CG  . HIS B 1 236 ? -18.718 -23.152 -58.417 1.00 44.75  ? 1719 HIS B CG  1 
ATOM   5516 N ND1 . HIS B 1 236 ? -18.957 -24.249 -59.221 1.00 44.88  ? 1719 HIS B ND1 1 
ATOM   5517 C CD2 . HIS B 1 236 ? -19.874 -22.449 -58.387 1.00 42.85  ? 1719 HIS B CD2 1 
ATOM   5518 C CE1 . HIS B 1 236 ? -20.203 -24.209 -59.657 1.00 43.21  ? 1719 HIS B CE1 1 
ATOM   5519 N NE2 . HIS B 1 236 ? -20.780 -23.127 -59.166 1.00 43.83  ? 1719 HIS B NE2 1 
ATOM   5520 N N   . THR B 1 237 ? -14.173 -22.462 -58.788 1.00 44.13  ? 1720 THR B N   1 
ATOM   5521 C CA  . THR B 1 237 ? -12.782 -22.546 -58.355 1.00 42.54  ? 1720 THR B CA  1 
ATOM   5522 C C   . THR B 1 237 ? -12.285 -21.226 -57.767 1.00 41.03  ? 1720 THR B C   1 
ATOM   5523 O O   . THR B 1 237 ? -12.361 -20.171 -58.395 1.00 41.13  ? 1720 THR B O   1 
ATOM   5524 C CB  . THR B 1 237 ? -11.862 -22.946 -59.511 1.00 42.77  ? 1720 THR B CB  1 
ATOM   5525 O OG1 . THR B 1 237 ? -12.343 -24.154 -60.108 1.00 43.77  ? 1720 THR B OG1 1 
ATOM   5526 C CG2 . THR B 1 237 ? -10.443 -23.171 -59.004 1.00 41.82  ? 1720 THR B CG2 1 
ATOM   5527 N N   . THR B 1 238 ? -11.774 -21.304 -56.549 1.00 39.25  ? 1721 THR B N   1 
ATOM   5528 C CA  . THR B 1 238 ? -11.263 -20.139 -55.838 1.00 39.69  ? 1721 THR B CA  1 
ATOM   5529 C C   . THR B 1 238 ? -9.777  -19.895 -56.151 1.00 39.07  ? 1721 THR B C   1 
ATOM   5530 O O   . THR B 1 238 ? -9.035  -20.840 -56.379 1.00 37.54  ? 1721 THR B O   1 
ATOM   5531 C CB  . THR B 1 238 ? -11.429 -20.352 -54.317 1.00 39.98  ? 1721 THR B CB  1 
ATOM   5532 O OG1 . THR B 1 238 ? -10.876 -21.627 -53.961 1.00 41.01  ? 1721 THR B OG1 1 
ATOM   5533 C CG2 . THR B 1 238 ? -12.901 -20.341 -53.929 1.00 37.57  ? 1721 THR B CG2 1 
ATOM   5534 N N   . ALA B 1 239 ? -9.349  -18.634 -56.180 1.00 38.47  ? 1722 ALA B N   1 
ATOM   5535 C CA  . ALA B 1 239 ? -7.939  -18.340 -56.445 1.00 39.55  ? 1722 ALA B CA  1 
ATOM   5536 C C   . ALA B 1 239 ? -7.045  -19.152 -55.477 1.00 40.33  ? 1722 ALA B C   1 
ATOM   5537 O O   . ALA B 1 239 ? -6.001  -19.687 -55.861 1.00 41.21  ? 1722 ALA B O   1 
ATOM   5538 C CB  . ALA B 1 239 ? -7.670  -16.831 -56.292 1.00 37.11  ? 1722 ALA B CB  1 
ATOM   5539 N N   . GLY B 1 240 ? -7.466  -19.246 -54.223 1.00 40.53  ? 1723 GLY B N   1 
ATOM   5540 C CA  . GLY B 1 240 ? -6.709  -20.005 -53.255 1.00 43.50  ? 1723 GLY B CA  1 
ATOM   5541 C C   . GLY B 1 240 ? -6.502  -21.456 -53.670 1.00 45.42  ? 1723 GLY B C   1 
ATOM   5542 O O   . GLY B 1 240 ? -5.422  -22.020 -53.452 1.00 44.94  ? 1723 GLY B O   1 
ATOM   5543 N N   . GLU B 1 241 ? -7.528  -22.072 -54.258 1.00 46.79  ? 1724 GLU B N   1 
ATOM   5544 C CA  . GLU B 1 241 ? -7.416  -23.465 -54.698 1.00 49.09  ? 1724 GLU B CA  1 
ATOM   5545 C C   . GLU B 1 241 ? -6.373  -23.563 -55.815 1.00 48.92  ? 1724 GLU B C   1 
ATOM   5546 O O   . GLU B 1 241 ? -5.566  -24.498 -55.844 1.00 48.86  ? 1724 GLU B O   1 
ATOM   5547 C CB  . GLU B 1 241 ? -8.762  -23.983 -55.214 1.00 52.37  ? 1724 GLU B CB  1 
ATOM   5548 C CG  . GLU B 1 241 ? -8.942  -25.493 -55.075 1.00 57.74  ? 1724 GLU B CG  1 
ATOM   5549 C CD  . GLU B 1 241 ? -9.622  -26.148 -56.281 1.00 61.77  ? 1724 GLU B CD  1 
ATOM   5550 O OE1 . GLU B 1 241 ? -8.931  -26.368 -57.311 1.00 62.36  ? 1724 GLU B OE1 1 
ATOM   5551 O OE2 . GLU B 1 241 ? -10.843 -26.443 -56.200 1.00 63.35  ? 1724 GLU B OE2 1 
ATOM   5552 N N   . VAL B 1 242 ? -6.397  -22.587 -56.725 1.00 48.21  ? 1725 VAL B N   1 
ATOM   5553 C CA  . VAL B 1 242 ? -5.461  -22.537 -57.841 1.00 47.44  ? 1725 VAL B CA  1 
ATOM   5554 C C   . VAL B 1 242 ? -4.055  -22.365 -57.283 1.00 48.37  ? 1725 VAL B C   1 
ATOM   5555 O O   . VAL B 1 242 ? -3.122  -23.038 -57.728 1.00 46.80  ? 1725 VAL B O   1 
ATOM   5556 C CB  . VAL B 1 242 ? -5.775  -21.363 -58.809 1.00 46.68  ? 1725 VAL B CB  1 
ATOM   5557 C CG1 . VAL B 1 242 ? -4.655  -21.180 -59.804 1.00 46.51  ? 1725 VAL B CG1 1 
ATOM   5558 C CG2 . VAL B 1 242 ? -7.042  -21.643 -59.564 1.00 46.55  ? 1725 VAL B CG2 1 
ATOM   5559 N N   . VAL B 1 243 ? -3.911  -21.480 -56.295 1.00 49.38  ? 1726 VAL B N   1 
ATOM   5560 C CA  . VAL B 1 243 ? -2.606  -21.226 -55.675 1.00 50.49  ? 1726 VAL B CA  1 
ATOM   5561 C C   . VAL B 1 243 ? -2.021  -22.468 -54.993 1.00 51.69  ? 1726 VAL B C   1 
ATOM   5562 O O   . VAL B 1 243 ? -0.810  -22.650 -54.954 1.00 50.69  ? 1726 VAL B O   1 
ATOM   5563 C CB  . VAL B 1 243 ? -2.692  -20.058 -54.657 1.00 49.16  ? 1726 VAL B CB  1 
ATOM   5564 C CG1 . VAL B 1 243 ? -1.530  -20.114 -53.691 1.00 46.71  ? 1726 VAL B CG1 1 
ATOM   5565 C CG2 . VAL B 1 243 ? -2.676  -18.727 -55.407 1.00 49.14  ? 1726 VAL B CG2 1 
ATOM   5566 N N   . GLU B 1 244 ? -2.884  -23.324 -54.463 1.00 54.93  ? 1727 GLU B N   1 
ATOM   5567 C CA  . GLU B 1 244 ? -2.418  -24.540 -53.810 1.00 58.29  ? 1727 GLU B CA  1 
ATOM   5568 C C   . GLU B 1 244 ? -1.867  -25.520 -54.840 1.00 58.48  ? 1727 GLU B C   1 
ATOM   5569 O O   . GLU B 1 244 ? -0.789  -26.092 -54.653 1.00 58.37  ? 1727 GLU B O   1 
ATOM   5570 C CB  . GLU B 1 244 ? -3.548  -25.208 -53.024 1.00 61.32  ? 1727 GLU B CB  1 
ATOM   5571 C CG  . GLU B 1 244 ? -3.414  -25.056 -51.516 1.00 65.95  ? 1727 GLU B CG  1 
ATOM   5572 C CD  . GLU B 1 244 ? -4.201  -26.106 -50.743 1.00 69.65  ? 1727 GLU B CD  1 
ATOM   5573 O OE1 . GLU B 1 244 ? -4.138  -26.075 -49.490 1.00 70.65  ? 1727 GLU B OE1 1 
ATOM   5574 O OE2 . GLU B 1 244 ? -4.874  -26.958 -51.382 1.00 70.51  ? 1727 GLU B OE2 1 
ATOM   5575 N N   . LYS B 1 245 ? -2.607  -25.722 -55.926 1.00 58.66  ? 1728 LYS B N   1 
ATOM   5576 C CA  . LYS B 1 245 ? -2.141  -26.627 -56.965 1.00 57.76  ? 1728 LYS B CA  1 
ATOM   5577 C C   . LYS B 1 245 ? -0.801  -26.127 -57.515 1.00 56.15  ? 1728 LYS B C   1 
ATOM   5578 O O   . LYS B 1 245 ? 0.160   -26.894 -57.585 1.00 56.93  ? 1728 LYS B O   1 
ATOM   5579 C CB  . LYS B 1 245 ? -3.179  -26.753 -58.088 1.00 58.17  ? 1728 LYS B CB  1 
ATOM   5580 C CG  . LYS B 1 245 ? -4.489  -27.420 -57.661 1.00 59.65  ? 1728 LYS B CG  1 
ATOM   5581 C CD  . LYS B 1 245 ? -5.183  -28.094 -58.853 1.00 61.66  ? 1728 LYS B CD  1 
ATOM   5582 C CE  . LYS B 1 245 ? -6.651  -27.666 -59.016 1.00 62.46  ? 1728 LYS B CE  1 
ATOM   5583 N NZ  . LYS B 1 245 ? -6.821  -26.317 -59.652 1.00 62.02  ? 1728 LYS B NZ  1 
ATOM   5584 N N   . LEU B 1 246 ? -0.730  -24.848 -57.885 1.00 53.40  ? 1729 LEU B N   1 
ATOM   5585 C CA  . LEU B 1 246 ? 0.512   -24.278 -58.401 1.00 52.36  ? 1729 LEU B CA  1 
ATOM   5586 C C   . LEU B 1 246 ? 1.682   -24.557 -57.453 1.00 54.68  ? 1729 LEU B C   1 
ATOM   5587 O O   . LEU B 1 246 ? 2.636   -25.234 -57.824 1.00 54.46  ? 1729 LEU B O   1 
ATOM   5588 C CB  . LEU B 1 246 ? 0.366   -22.765 -58.611 1.00 47.08  ? 1729 LEU B CB  1 
ATOM   5589 C CG  . LEU B 1 246 ? -0.550  -22.309 -59.752 1.00 43.10  ? 1729 LEU B CG  1 
ATOM   5590 C CD1 . LEU B 1 246 ? -0.545  -20.803 -59.825 1.00 40.36  ? 1729 LEU B CD1 1 
ATOM   5591 C CD2 . LEU B 1 246 ? -0.087  -22.890 -61.070 1.00 37.56  ? 1729 LEU B CD2 1 
ATOM   5592 N N   . ILE B 1 247 ? 1.596   -24.034 -56.231 1.00 57.86  ? 1730 ILE B N   1 
ATOM   5593 C CA  . ILE B 1 247 ? 2.633   -24.231 -55.224 1.00 60.20  ? 1730 ILE B CA  1 
ATOM   5594 C C   . ILE B 1 247 ? 3.012   -25.701 -55.140 1.00 63.19  ? 1730 ILE B C   1 
ATOM   5595 O O   . ILE B 1 247 ? 4.183   -26.055 -55.308 1.00 62.99  ? 1730 ILE B O   1 
ATOM   5596 C CB  . ILE B 1 247 ? 2.153   -23.776 -53.827 1.00 59.09  ? 1730 ILE B CB  1 
ATOM   5597 C CG1 . ILE B 1 247 ? 2.096   -22.254 -53.768 1.00 57.89  ? 1730 ILE B CG1 1 
ATOM   5598 C CG2 . ILE B 1 247 ? 3.071   -24.326 -52.750 1.00 57.88  ? 1730 ILE B CG2 1 
ATOM   5599 C CD1 . ILE B 1 247 ? 1.611   -21.723 -52.441 1.00 56.72  ? 1730 ILE B CD1 1 
ATOM   5600 N N   . ARG B 1 248 ? 2.016   -26.547 -54.872 1.00 66.02  ? 1731 ARG B N   1 
ATOM   5601 C CA  . ARG B 1 248 ? 2.231   -27.988 -54.760 1.00 68.37  ? 1731 ARG B CA  1 
ATOM   5602 C C   . ARG B 1 248 ? 2.396   -28.612 -56.141 1.00 68.57  ? 1731 ARG B C   1 
ATOM   5603 O O   . ARG B 1 248 ? 1.935   -29.726 -56.402 1.00 69.59  ? 1731 ARG B O   1 
ATOM   5604 C CB  . ARG B 1 248 ? 1.065   -28.655 -54.014 1.00 71.11  ? 1731 ARG B CB  1 
ATOM   5605 C CG  . ARG B 1 248 ? 0.937   -28.245 -52.545 1.00 74.74  ? 1731 ARG B CG  1 
ATOM   5606 C CD  . ARG B 1 248 ? -0.173  -29.009 -51.824 1.00 78.37  ? 1731 ARG B CD  1 
ATOM   5607 N NE  . ARG B 1 248 ? 0.163   -30.416 -51.592 1.00 82.30  ? 1731 ARG B NE  1 
ATOM   5608 C CZ  . ARG B 1 248 ? 1.113   -30.842 -50.761 1.00 84.16  ? 1731 ARG B CZ  1 
ATOM   5609 N NH1 . ARG B 1 248 ? 1.837   -29.966 -50.068 1.00 85.87  ? 1731 ARG B NH1 1 
ATOM   5610 N NH2 . ARG B 1 248 ? 1.341   -32.146 -50.619 1.00 83.91  ? 1731 ARG B NH2 1 
ATOM   5611 N N   . GLY B 1 249 ? 3.052   -27.869 -57.023 1.00 68.43  ? 1732 GLY B N   1 
ATOM   5612 C CA  . GLY B 1 249 ? 3.306   -28.330 -58.372 1.00 67.34  ? 1732 GLY B CA  1 
ATOM   5613 C C   . GLY B 1 249 ? 4.729   -27.929 -58.704 1.00 67.05  ? 1732 GLY B C   1 
ATOM   5614 O O   . GLY B 1 249 ? 5.330   -28.409 -59.671 1.00 65.98  ? 1732 GLY B O   1 
ATOM   5615 N N   . LEU B 1 250 ? 5.254   -27.016 -57.892 1.00 66.27  ? 1733 LEU B N   1 
ATOM   5616 C CA  . LEU B 1 250 ? 6.615   -26.521 -58.032 1.00 66.44  ? 1733 LEU B CA  1 
ATOM   5617 C C   . LEU B 1 250 ? 7.355   -27.039 -56.804 1.00 67.65  ? 1733 LEU B C   1 
ATOM   5618 O O   . LEU B 1 250 ? 8.536   -26.748 -56.592 1.00 68.42  ? 1733 LEU B O   1 
ATOM   5619 C CB  . LEU B 1 250 ? 6.623   -24.991 -58.054 1.00 65.47  ? 1733 LEU B CB  1 
ATOM   5620 C CG  . LEU B 1 250 ? 5.950   -24.297 -59.243 1.00 64.11  ? 1733 LEU B CG  1 
ATOM   5621 C CD1 . LEU B 1 250 ? 5.390   -22.959 -58.801 1.00 62.93  ? 1733 LEU B CD1 1 
ATOM   5622 C CD2 . LEU B 1 250 ? 6.945   -24.115 -60.373 1.00 62.34  ? 1733 LEU B CD2 1 
ATOM   5623 N N   . ALA B 1 251 ? 6.631   -27.810 -55.995 1.00 68.62  ? 1734 ALA B N   1 
ATOM   5624 C CA  . ALA B 1 251 ? 7.163   -28.403 -54.772 1.00 68.76  ? 1734 ALA B CA  1 
ATOM   5625 C C   . ALA B 1 251 ? 7.615   -27.350 -53.757 1.00 68.84  ? 1734 ALA B C   1 
ATOM   5626 O O   . ALA B 1 251 ? 8.621   -27.534 -53.060 1.00 69.16  ? 1734 ALA B O   1 
ATOM   5627 C CB  . ALA B 1 251 ? 8.318   -29.340 -55.110 1.00 69.00  ? 1734 ALA B CB  1 
ATOM   5628 N N   . MET B 1 252 ? 6.868   -26.251 -53.671 1.00 67.87  ? 1735 MET B N   1 
ATOM   5629 C CA  . MET B 1 252 ? 7.203   -25.187 -52.734 1.00 67.25  ? 1735 MET B CA  1 
ATOM   5630 C C   . MET B 1 252 ? 6.322   -25.231 -51.507 1.00 67.50  ? 1735 MET B C   1 
ATOM   5631 O O   . MET B 1 252 ? 6.224   -24.243 -50.786 1.00 67.10  ? 1735 MET B O   1 
ATOM   5632 C CB  . MET B 1 252 ? 7.058   -23.811 -53.383 1.00 66.79  ? 1735 MET B CB  1 
ATOM   5633 C CG  . MET B 1 252 ? 8.105   -23.477 -54.415 1.00 66.48  ? 1735 MET B CG  1 
ATOM   5634 S SD  . MET B 1 252 ? 8.118   -21.709 -54.767 1.00 67.94  ? 1735 MET B SD  1 
ATOM   5635 C CE  . MET B 1 252 ? 6.839   -21.576 -55.981 1.00 67.04  ? 1735 MET B CE  1 
ATOM   5636 N N   . GLU B 1 253 ? 5.683   -26.369 -51.253 1.00 68.45  ? 1736 GLU B N   1 
ATOM   5637 C CA  . GLU B 1 253 ? 4.816   -26.462 -50.087 1.00 69.60  ? 1736 GLU B CA  1 
ATOM   5638 C C   . GLU B 1 253 ? 5.655   -26.297 -48.827 1.00 68.90  ? 1736 GLU B C   1 
ATOM   5639 O O   . GLU B 1 253 ? 5.126   -26.186 -47.725 1.00 68.03  ? 1736 GLU B O   1 
ATOM   5640 C CB  . GLU B 1 253 ? 4.048   -27.798 -50.062 1.00 71.91  ? 1736 GLU B CB  1 
ATOM   5641 C CG  . GLU B 1 253 ? 4.878   -29.043 -49.765 1.00 75.02  ? 1736 GLU B CG  1 
ATOM   5642 C CD  . GLU B 1 253 ? 5.740   -29.465 -50.936 1.00 77.03  ? 1736 GLU B CD  1 
ATOM   5643 O OE1 . GLU B 1 253 ? 5.182   -29.645 -52.044 1.00 78.47  ? 1736 GLU B OE1 1 
ATOM   5644 O OE2 . GLU B 1 253 ? 6.969   -29.624 -50.741 1.00 77.19  ? 1736 GLU B OE2 1 
ATOM   5645 N N   . ASP B 1 254 ? 6.969   -26.268 -49.016 1.00 69.50  ? 1737 ASP B N   1 
ATOM   5646 C CA  . ASP B 1 254 ? 7.921   -26.102 -47.924 1.00 69.86  ? 1737 ASP B CA  1 
ATOM   5647 C C   . ASP B 1 254 ? 8.283   -24.617 -47.781 1.00 68.69  ? 1737 ASP B C   1 
ATOM   5648 O O   . ASP B 1 254 ? 8.922   -24.212 -46.812 1.00 68.12  ? 1737 ASP B O   1 
ATOM   5649 C CB  . ASP B 1 254 ? 9.194   -26.908 -48.227 1.00 72.31  ? 1737 ASP B CB  1 
ATOM   5650 C CG  . ASP B 1 254 ? 9.520   -27.924 -47.147 1.00 74.63  ? 1737 ASP B CG  1 
ATOM   5651 O OD1 . ASP B 1 254 ? 9.564   -27.534 -45.959 1.00 75.34  ? 1737 ASP B OD1 1 
ATOM   5652 O OD2 . ASP B 1 254 ? 9.745   -29.111 -47.488 1.00 75.25  ? 1737 ASP B OD2 1 
ATOM   5653 N N   . SER B 1 255 ? 7.865   -23.817 -48.761 1.00 67.36  ? 1738 SER B N   1 
ATOM   5654 C CA  . SER B 1 255 ? 8.156   -22.387 -48.795 1.00 66.14  ? 1738 SER B CA  1 
ATOM   5655 C C   . SER B 1 255 ? 8.093   -21.644 -47.477 1.00 65.35  ? 1738 SER B C   1 
ATOM   5656 O O   . SER B 1 255 ? 7.221   -21.884 -46.643 1.00 64.62  ? 1738 SER B O   1 
ATOM   5657 C CB  . SER B 1 255 ? 7.238   -21.674 -49.779 1.00 66.15  ? 1738 SER B CB  1 
ATOM   5658 O OG  . SER B 1 255 ? 7.446   -20.276 -49.695 1.00 66.18  ? 1738 SER B OG  1 
ATOM   5659 N N   . ARG B 1 256 ? 9.020   -20.709 -47.323 1.00 64.93  ? 1739 ARG B N   1 
ATOM   5660 C CA  . ARG B 1 256 ? 9.106   -19.894 -46.119 1.00 64.57  ? 1739 ARG B CA  1 
ATOM   5661 C C   . ARG B 1 256 ? 8.262   -18.625 -46.273 1.00 62.68  ? 1739 ARG B C   1 
ATOM   5662 O O   . ARG B 1 256 ? 8.108   -17.843 -45.335 1.00 62.63  ? 1739 ARG B O   1 
ATOM   5663 C CB  . ARG B 1 256 ? 10.575  -19.520 -45.864 1.00 64.43  ? 1739 ARG B CB  1 
ATOM   5664 N N   . ASN B 1 257 ? 7.704   -18.434 -47.462 1.00 60.17  ? 1740 ASN B N   1 
ATOM   5665 C CA  . ASN B 1 257 ? 6.909   -17.249 -47.740 1.00 57.45  ? 1740 ASN B CA  1 
ATOM   5666 C C   . ASN B 1 257 ? 5.520   -17.586 -48.274 1.00 55.44  ? 1740 ASN B C   1 
ATOM   5667 O O   . ASN B 1 257 ? 5.204   -18.744 -48.514 1.00 55.47  ? 1740 ASN B O   1 
ATOM   5668 C CB  . ASN B 1 257 ? 7.677   -16.389 -48.728 1.00 57.15  ? 1740 ASN B CB  1 
ATOM   5669 C CG  . ASN B 1 257 ? 9.115   -16.196 -48.311 1.00 57.26  ? 1740 ASN B CG  1 
ATOM   5670 O OD1 . ASN B 1 257 ? 9.389   -15.726 -47.206 1.00 56.70  ? 1740 ASN B OD1 1 
ATOM   5671 N ND2 . ASN B 1 257 ? 10.046  -16.563 -49.185 1.00 57.66  ? 1740 ASN B ND2 1 
ATOM   5672 N N   . MET B 1 258 ? 4.688   -16.573 -48.448 1.00 53.57  ? 1741 MET B N   1 
ATOM   5673 C CA  . MET B 1 258 ? 3.339   -16.795 -48.948 1.00 53.86  ? 1741 MET B CA  1 
ATOM   5674 C C   . MET B 1 258 ? 3.221   -16.337 -50.410 1.00 51.67  ? 1741 MET B C   1 
ATOM   5675 O O   . MET B 1 258 ? 3.667   -15.245 -50.771 1.00 50.83  ? 1741 MET B O   1 
ATOM   5676 C CB  . MET B 1 258 ? 2.320   -16.034 -48.084 1.00 57.31  ? 1741 MET B CB  1 
ATOM   5677 C CG  . MET B 1 258 ? 2.373   -16.326 -46.583 1.00 61.93  ? 1741 MET B CG  1 
ATOM   5678 S SD  . MET B 1 258 ? 1.423   -17.779 -46.032 1.00 70.07  ? 1741 MET B SD  1 
ATOM   5679 C CE  . MET B 1 258 ? 2.755   -19.049 -45.836 1.00 66.03  ? 1741 MET B CE  1 
ATOM   5680 N N   . PHE B 1 259 ? 2.623   -17.188 -51.239 1.00 48.43  ? 1742 PHE B N   1 
ATOM   5681 C CA  . PHE B 1 259 ? 2.408   -16.905 -52.652 1.00 45.66  ? 1742 PHE B CA  1 
ATOM   5682 C C   . PHE B 1 259 ? 0.909   -16.742 -52.862 1.00 46.64  ? 1742 PHE B C   1 
ATOM   5683 O O   . PHE B 1 259 ? 0.121   -17.170 -52.016 1.00 46.13  ? 1742 PHE B O   1 
ATOM   5684 C CB  . PHE B 1 259 ? 2.888   -18.076 -53.490 1.00 42.77  ? 1742 PHE B CB  1 
ATOM   5685 C CG  . PHE B 1 259 ? 4.362   -18.255 -53.485 1.00 41.63  ? 1742 PHE B CG  1 
ATOM   5686 C CD1 . PHE B 1 259 ? 5.140   -17.721 -54.509 1.00 40.91  ? 1742 PHE B CD1 1 
ATOM   5687 C CD2 . PHE B 1 259 ? 4.981   -18.977 -52.472 1.00 42.13  ? 1742 PHE B CD2 1 
ATOM   5688 C CE1 . PHE B 1 259 ? 6.514   -17.905 -54.532 1.00 41.04  ? 1742 PHE B CE1 1 
ATOM   5689 C CE2 . PHE B 1 259 ? 6.363   -19.175 -52.475 1.00 41.32  ? 1742 PHE B CE2 1 
ATOM   5690 C CZ  . PHE B 1 259 ? 7.133   -18.640 -53.507 1.00 42.64  ? 1742 PHE B CZ  1 
ATOM   5691 N N   . ALA B 1 260 ? 0.514   -16.144 -53.987 1.00 47.10  ? 1743 ALA B N   1 
ATOM   5692 C CA  . ALA B 1 260 ? -0.907  -15.955 -54.304 1.00 47.43  ? 1743 ALA B CA  1 
ATOM   5693 C C   . ALA B 1 260 ? -1.098  -15.515 -55.760 1.00 47.33  ? 1743 ALA B C   1 
ATOM   5694 O O   . ALA B 1 260 ? -0.121  -15.280 -56.466 1.00 47.23  ? 1743 ALA B O   1 
ATOM   5695 C CB  . ALA B 1 260 ? -1.516  -14.911 -53.358 1.00 47.15  ? 1743 ALA B CB  1 
ATOM   5696 N N   . LEU B 1 261 ? -2.354  -15.408 -56.203 1.00 47.61  ? 1744 LEU B N   1 
ATOM   5697 C CA  . LEU B 1 261 ? -2.664  -14.962 -57.562 1.00 46.84  ? 1744 LEU B CA  1 
ATOM   5698 C C   . LEU B 1 261 ? -2.824  -13.457 -57.571 1.00 47.51  ? 1744 LEU B C   1 
ATOM   5699 O O   . LEU B 1 261 ? -3.374  -12.885 -56.639 1.00 47.96  ? 1744 LEU B O   1 
ATOM   5700 C CB  . LEU B 1 261 ? -3.962  -15.584 -58.073 1.00 46.00  ? 1744 LEU B CB  1 
ATOM   5701 C CG  . LEU B 1 261 ? -3.887  -16.845 -58.936 1.00 46.86  ? 1744 LEU B CG  1 
ATOM   5702 C CD1 . LEU B 1 261 ? -5.279  -17.108 -59.537 1.00 46.12  ? 1744 LEU B CD1 1 
ATOM   5703 C CD2 . LEU B 1 261 ? -2.842  -16.679 -60.042 1.00 43.08  ? 1744 LEU B CD2 1 
ATOM   5704 N N   . PHE B 1 262 ? -2.371  -12.816 -58.638 1.00 48.87  ? 1745 PHE B N   1 
ATOM   5705 C CA  . PHE B 1 262 ? -2.463  -11.364 -58.744 1.00 49.64  ? 1745 PHE B CA  1 
ATOM   5706 C C   . PHE B 1 262 ? -3.122  -10.923 -60.040 1.00 51.63  ? 1745 PHE B C   1 
ATOM   5707 O O   . PHE B 1 262 ? -3.103  -11.631 -61.044 1.00 51.23  ? 1745 PHE B O   1 
ATOM   5708 C CB  . PHE B 1 262 ? -1.070  -10.726 -58.704 1.00 48.52  ? 1745 PHE B CB  1 
ATOM   5709 C CG  . PHE B 1 262 ? -0.360  -10.886 -57.404 1.00 46.78  ? 1745 PHE B CG  1 
ATOM   5710 C CD1 . PHE B 1 262 ? -0.229  -9.808  -56.542 1.00 46.33  ? 1745 PHE B CD1 1 
ATOM   5711 C CD2 . PHE B 1 262 ? 0.208   -12.104 -57.053 1.00 46.22  ? 1745 PHE B CD2 1 
ATOM   5712 C CE1 . PHE B 1 262 ? 0.462   -9.933  -55.344 1.00 46.43  ? 1745 PHE B CE1 1 
ATOM   5713 C CE2 . PHE B 1 262 ? 0.903   -12.245 -55.858 1.00 47.60  ? 1745 PHE B CE2 1 
ATOM   5714 C CZ  . PHE B 1 262 ? 1.033   -11.154 -54.999 1.00 47.39  ? 1745 PHE B CZ  1 
ATOM   5715 N N   . GLU B 1 263 ? -3.683  -9.725  -60.006 1.00 54.26  ? 1746 GLU B N   1 
ATOM   5716 C CA  . GLU B 1 263 ? -4.332  -9.128  -61.156 1.00 55.86  ? 1746 GLU B CA  1 
ATOM   5717 C C   . GLU B 1 263 ? -3.269  -8.163  -61.662 1.00 55.60  ? 1746 GLU B C   1 
ATOM   5718 O O   . GLU B 1 263 ? -3.187  -7.022  -61.213 1.00 55.60  ? 1746 GLU B O   1 
ATOM   5719 C CB  . GLU B 1 263 ? -5.585  -8.381  -60.686 1.00 58.39  ? 1746 GLU B CB  1 
ATOM   5720 C CG  . GLU B 1 263 ? -6.482  -7.819  -61.775 1.00 61.01  ? 1746 GLU B CG  1 
ATOM   5721 C CD  . GLU B 1 263 ? -7.726  -7.163  -61.203 1.00 62.47  ? 1746 GLU B CD  1 
ATOM   5722 O OE1 . GLU B 1 263 ? -8.378  -7.796  -60.337 1.00 62.30  ? 1746 GLU B OE1 1 
ATOM   5723 O OE2 . GLU B 1 263 ? -8.052  -6.025  -61.623 1.00 63.95  ? 1746 GLU B OE2 1 
ATOM   5724 N N   . TYR B 1 264 ? -2.442  -8.634  -62.584 1.00 56.56  ? 1747 TYR B N   1 
ATOM   5725 C CA  . TYR B 1 264 ? -1.352  -7.818  -63.116 1.00 58.62  ? 1747 TYR B CA  1 
ATOM   5726 C C   . TYR B 1 264 ? -1.628  -7.264  -64.503 1.00 59.89  ? 1747 TYR B C   1 
ATOM   5727 O O   . TYR B 1 264 ? -1.910  -8.011  -65.437 1.00 60.88  ? 1747 TYR B O   1 
ATOM   5728 C CB  . TYR B 1 264 ? -0.070  -8.653  -63.153 1.00 57.87  ? 1747 TYR B CB  1 
ATOM   5729 C CG  . TYR B 1 264 ? 1.230   -7.872  -63.193 1.00 57.40  ? 1747 TYR B CG  1 
ATOM   5730 C CD1 . TYR B 1 264 ? 1.567   -6.982  -62.168 1.00 55.62  ? 1747 TYR B CD1 1 
ATOM   5731 C CD2 . TYR B 1 264 ? 2.167   -8.097  -64.207 1.00 55.61  ? 1747 TYR B CD2 1 
ATOM   5732 C CE1 . TYR B 1 264 ? 2.813   -6.345  -62.148 1.00 55.48  ? 1747 TYR B CE1 1 
ATOM   5733 C CE2 . TYR B 1 264 ? 3.407   -7.464  -64.198 1.00 55.31  ? 1747 TYR B CE2 1 
ATOM   5734 C CZ  . TYR B 1 264 ? 3.731   -6.593  -63.168 1.00 55.83  ? 1747 TYR B CZ  1 
ATOM   5735 O OH  . TYR B 1 264 ? 4.974   -5.984  -63.159 1.00 55.30  ? 1747 TYR B OH  1 
ATOM   5736 N N   . ASN B 1 265 ? -1.540  -5.947  -64.636 1.00 62.37  ? 1748 ASN B N   1 
ATOM   5737 C CA  . ASN B 1 265 ? -1.760  -5.297  -65.924 1.00 64.79  ? 1748 ASN B CA  1 
ATOM   5738 C C   . ASN B 1 265 ? -0.408  -4.789  -66.382 1.00 66.71  ? 1748 ASN B C   1 
ATOM   5739 O O   . ASN B 1 265 ? -0.311  -4.019  -67.341 1.00 67.63  ? 1748 ASN B O   1 
ATOM   5740 C CB  . ASN B 1 265 ? -2.707  -4.103  -65.791 1.00 65.05  ? 1748 ASN B CB  1 
ATOM   5741 C CG  . ASN B 1 265 ? -2.029  -2.890  -65.182 1.00 64.10  ? 1748 ASN B CG  1 
ATOM   5742 O OD1 . ASN B 1 265 ? -2.021  -2.710  -63.969 1.00 63.97  ? 1748 ASN B OD1 1 
ATOM   5743 N ND2 . ASN B 1 265 ? -1.438  -2.058  -66.031 1.00 64.30  ? 1748 ASN B ND2 1 
ATOM   5744 N N   . GLY B 1 266 ? 0.633   -5.218  -65.672 1.00 67.72  ? 1749 GLY B N   1 
ATOM   5745 C CA  . GLY B 1 266 ? 1.978   -4.789  -65.994 1.00 69.72  ? 1749 GLY B CA  1 
ATOM   5746 C C   . GLY B 1 266 ? 2.455   -3.659  -65.089 1.00 70.65  ? 1749 GLY B C   1 
ATOM   5747 O O   . GLY B 1 266 ? 3.586   -3.691  -64.607 1.00 70.33  ? 1749 GLY B O   1 
ATOM   5748 N N   . HIS B 1 267 ? 1.602   -2.662  -64.856 1.00 72.05  ? 1750 HIS B N   1 
ATOM   5749 C CA  . HIS B 1 267 ? 1.971   -1.526  -64.006 1.00 73.03  ? 1750 HIS B CA  1 
ATOM   5750 C C   . HIS B 1 267 ? 1.718   -1.783  -62.520 1.00 72.23  ? 1750 HIS B C   1 
ATOM   5751 O O   . HIS B 1 267 ? 2.656   -1.801  -61.716 1.00 72.30  ? 1750 HIS B O   1 
ATOM   5752 C CB  . HIS B 1 267 ? 1.215   -0.258  -64.433 1.00 75.16  ? 1750 HIS B CB  1 
ATOM   5753 C CG  . HIS B 1 267 ? 1.582   0.958   -63.634 1.00 77.13  ? 1750 HIS B CG  1 
ATOM   5754 N ND1 . HIS B 1 267 ? 0.658   1.687   -62.914 1.00 77.52  ? 1750 HIS B ND1 1 
ATOM   5755 C CD2 . HIS B 1 267 ? 2.781   1.555   -63.418 1.00 77.68  ? 1750 HIS B CD2 1 
ATOM   5756 C CE1 . HIS B 1 267 ? 1.271   2.676   -62.287 1.00 77.94  ? 1750 HIS B CE1 1 
ATOM   5757 N NE2 . HIS B 1 267 ? 2.559   2.619   -62.576 1.00 78.12  ? 1750 HIS B NE2 1 
ATOM   5758 N N   . VAL B 1 268 ? 0.452   -1.973  -62.156 1.00 70.55  ? 1751 VAL B N   1 
ATOM   5759 C CA  . VAL B 1 268 ? 0.093   -2.227  -60.768 1.00 69.53  ? 1751 VAL B CA  1 
ATOM   5760 C C   . VAL B 1 268 ? -0.676  -3.530  -60.661 1.00 68.83  ? 1751 VAL B C   1 
ATOM   5761 O O   . VAL B 1 268 ? -1.688  -3.707  -61.334 1.00 69.70  ? 1751 VAL B O   1 
ATOM   5762 C CB  . VAL B 1 268 ? -0.796  -1.099  -60.197 1.00 69.63  ? 1751 VAL B CB  1 
ATOM   5763 N N   . ASP B 1 269 ? -0.199  -4.444  -59.823 1.00 67.04  ? 1752 ASP B N   1 
ATOM   5764 C CA  . ASP B 1 269 ? -0.902  -5.703  -59.656 1.00 67.00  ? 1752 ASP B CA  1 
ATOM   5765 C C   . ASP B 1 269 ? -1.953  -5.553  -58.556 1.00 65.98  ? 1752 ASP B C   1 
ATOM   5766 O O   . ASP B 1 269 ? -2.212  -4.443  -58.085 1.00 66.57  ? 1752 ASP B O   1 
ATOM   5767 C CB  . ASP B 1 269 ? 0.082   -6.842  -59.338 1.00 68.99  ? 1752 ASP B CB  1 
ATOM   5768 C CG  . ASP B 1 269 ? 0.966   -6.550  -58.135 1.00 70.49  ? 1752 ASP B CG  1 
ATOM   5769 O OD1 . ASP B 1 269 ? 1.989   -7.256  -57.965 1.00 69.60  ? 1752 ASP B OD1 1 
ATOM   5770 O OD2 . ASP B 1 269 ? 0.634   -5.626  -57.360 1.00 71.92  ? 1752 ASP B OD2 1 
ATOM   5771 N N   . LYS B 1 270 ? -2.576  -6.662  -58.167 1.00 63.61  ? 1753 LYS B N   1 
ATOM   5772 C CA  . LYS B 1 270 ? -3.592  -6.634  -57.130 1.00 59.24  ? 1753 LYS B CA  1 
ATOM   5773 C C   . LYS B 1 270 ? -3.780  -8.048  -56.606 1.00 57.35  ? 1753 LYS B C   1 
ATOM   5774 O O   . LYS B 1 270 ? -3.980  -8.985  -57.370 1.00 57.21  ? 1753 LYS B O   1 
ATOM   5775 C CB  . LYS B 1 270 ? -4.890  -6.087  -57.706 1.00 59.41  ? 1753 LYS B CB  1 
ATOM   5776 C CG  . LYS B 1 270 ? -5.792  -5.414  -56.697 1.00 59.87  ? 1753 LYS B CG  1 
ATOM   5777 C CD  . LYS B 1 270 ? -6.829  -4.536  -57.403 1.00 61.77  ? 1753 LYS B CD  1 
ATOM   5778 C CE  . LYS B 1 270 ? -6.157  -3.463  -58.272 1.00 62.42  ? 1753 LYS B CE  1 
ATOM   5779 N NZ  . LYS B 1 270 ? -7.122  -2.759  -59.164 1.00 62.82  ? 1753 LYS B NZ  1 
ATOM   5780 N N   . ALA B 1 271 ? -3.688  -8.197  -55.291 1.00 55.90  ? 1754 ALA B N   1 
ATOM   5781 C CA  . ALA B 1 271 ? -3.829  -9.497  -54.655 1.00 54.64  ? 1754 ALA B CA  1 
ATOM   5782 C C   . ALA B 1 271 ? -5.251  -10.025 -54.699 1.00 53.27  ? 1754 ALA B C   1 
ATOM   5783 O O   . ALA B 1 271 ? -6.205  -9.302  -54.420 1.00 53.72  ? 1754 ALA B O   1 
ATOM   5784 C CB  . ALA B 1 271 ? -3.357  -9.428  -53.204 1.00 55.90  ? 1754 ALA B CB  1 
ATOM   5785 N N   . ILE B 1 272 ? -5.379  -11.298 -55.049 1.00 51.01  ? 1755 ILE B N   1 
ATOM   5786 C CA  . ILE B 1 272 ? -6.678  -11.947 -55.105 1.00 49.27  ? 1755 ILE B CA  1 
ATOM   5787 C C   . ILE B 1 272 ? -6.802  -12.772 -53.839 1.00 50.45  ? 1755 ILE B C   1 
ATOM   5788 O O   . ILE B 1 272 ? -5.851  -13.446 -53.455 1.00 51.69  ? 1755 ILE B O   1 
ATOM   5789 C CB  . ILE B 1 272 ? -6.780  -12.879 -56.327 1.00 46.83  ? 1755 ILE B CB  1 
ATOM   5790 C CG1 . ILE B 1 272 ? -6.494  -12.082 -57.609 1.00 42.79  ? 1755 ILE B CG1 1 
ATOM   5791 C CG2 . ILE B 1 272 ? -8.153  -13.555 -56.355 1.00 44.18  ? 1755 ILE B CG2 1 
ATOM   5792 C CD1 . ILE B 1 272 ? -6.331  -12.938 -58.832 1.00 40.33  ? 1755 ILE B CD1 1 
ATOM   5793 N N   . GLU B 1 273 ? -7.955  -12.713 -53.181 1.00 51.42  ? 1756 GLU B N   1 
ATOM   5794 C CA  . GLU B 1 273 ? -8.146  -13.473 -51.953 1.00 51.90  ? 1756 GLU B CA  1 
ATOM   5795 C C   . GLU B 1 273 ? -8.557  -14.910 -52.204 1.00 50.90  ? 1756 GLU B C   1 
ATOM   5796 O O   . GLU B 1 273 ? -9.245  -15.212 -53.167 1.00 50.59  ? 1756 GLU B O   1 
ATOM   5797 C CB  . GLU B 1 273 ? -9.163  -12.776 -51.055 1.00 55.38  ? 1756 GLU B CB  1 
ATOM   5798 C CG  . GLU B 1 273 ? -8.537  -11.716 -50.158 1.00 58.68  ? 1756 GLU B CG  1 
ATOM   5799 C CD  . GLU B 1 273 ? -9.453  -10.535 -49.958 1.00 61.14  ? 1756 GLU B CD  1 
ATOM   5800 O OE1 . GLU B 1 273 ? -10.644 -10.768 -49.659 1.00 62.40  ? 1756 GLU B OE1 1 
ATOM   5801 O OE2 . GLU B 1 273 ? -8.986  -9.380  -50.101 1.00 61.43  ? 1756 GLU B OE2 1 
ATOM   5802 N N   . SER B 1 274 ? -8.125  -15.794 -51.321 1.00 50.89  ? 1757 SER B N   1 
ATOM   5803 C CA  . SER B 1 274 ? -8.404  -17.216 -51.451 1.00 52.20  ? 1757 SER B CA  1 
ATOM   5804 C C   . SER B 1 274 ? -9.808  -17.584 -51.905 1.00 53.24  ? 1757 SER B C   1 
ATOM   5805 O O   . SER B 1 274 ? -9.980  -18.345 -52.864 1.00 53.26  ? 1757 SER B O   1 
ATOM   5806 C CB  . SER B 1 274 ? -8.107  -17.914 -50.134 1.00 50.70  ? 1757 SER B CB  1 
ATOM   5807 O OG  . SER B 1 274 ? -6.787  -17.617 -49.728 1.00 53.46  ? 1757 SER B OG  1 
ATOM   5808 N N   . ARG B 1 275 ? -10.810 -17.048 -51.219 1.00 54.04  ? 1758 ARG B N   1 
ATOM   5809 C CA  . ARG B 1 275 ? -12.189 -17.360 -51.548 1.00 55.56  ? 1758 ARG B CA  1 
ATOM   5810 C C   . ARG B 1 275 ? -12.687 -16.801 -52.887 1.00 54.61  ? 1758 ARG B C   1 
ATOM   5811 O O   . ARG B 1 275 ? -13.677 -17.303 -53.424 1.00 55.17  ? 1758 ARG B O   1 
ATOM   5812 C CB  . ARG B 1 275 ? -13.107 -16.928 -50.394 1.00 58.89  ? 1758 ARG B CB  1 
ATOM   5813 C CG  . ARG B 1 275 ? -12.806 -17.665 -49.078 1.00 64.50  ? 1758 ARG B CG  1 
ATOM   5814 C CD  . ARG B 1 275 ? -13.826 -17.364 -47.973 1.00 70.07  ? 1758 ARG B CD  1 
ATOM   5815 N NE  . ARG B 1 275 ? -13.909 -15.934 -47.665 1.00 75.53  ? 1758 ARG B NE  1 
ATOM   5816 C CZ  . ARG B 1 275 ? -14.776 -15.391 -46.809 1.00 76.46  ? 1758 ARG B CZ  1 
ATOM   5817 N NH1 . ARG B 1 275 ? -15.646 -16.159 -46.159 1.00 76.30  ? 1758 ARG B NH1 1 
ATOM   5818 N NH2 . ARG B 1 275 ? -14.783 -14.074 -46.615 1.00 76.62  ? 1758 ARG B NH2 1 
ATOM   5819 N N   . THR B 1 276 ? -12.012 -15.784 -53.435 1.00 52.31  ? 1759 THR B N   1 
ATOM   5820 C CA  . THR B 1 276 ? -12.420 -15.214 -54.724 1.00 49.30  ? 1759 THR B CA  1 
ATOM   5821 C C   . THR B 1 276 ? -12.464 -16.289 -55.828 1.00 49.26  ? 1759 THR B C   1 
ATOM   5822 O O   . THR B 1 276 ? -11.609 -17.191 -55.903 1.00 48.09  ? 1759 THR B O   1 
ATOM   5823 C CB  . THR B 1 276 ? -11.468 -14.083 -55.192 1.00 48.31  ? 1759 THR B CB  1 
ATOM   5824 O OG1 . THR B 1 276 ? -11.551 -12.974 -54.297 1.00 48.32  ? 1759 THR B OG1 1 
ATOM   5825 C CG2 . THR B 1 276 ? -11.846 -13.605 -56.584 1.00 45.90  ? 1759 THR B CG2 1 
ATOM   5826 N N   . VAL B 1 277 ? -13.475 -16.186 -56.682 1.00 48.17  ? 1760 VAL B N   1 
ATOM   5827 C CA  . VAL B 1 277 ? -13.646 -17.134 -57.768 1.00 46.91  ? 1760 VAL B CA  1 
ATOM   5828 C C   . VAL B 1 277 ? -12.842 -16.689 -58.979 1.00 45.90  ? 1760 VAL B C   1 
ATOM   5829 O O   . VAL B 1 277 ? -12.938 -15.536 -59.409 1.00 45.88  ? 1760 VAL B O   1 
ATOM   5830 C CB  . VAL B 1 277 ? -15.127 -17.256 -58.154 1.00 46.43  ? 1760 VAL B CB  1 
ATOM   5831 C CG1 . VAL B 1 277 ? -15.288 -18.250 -59.285 1.00 48.18  ? 1760 VAL B CG1 1 
ATOM   5832 C CG2 . VAL B 1 277 ? -15.936 -17.699 -56.947 1.00 45.52  ? 1760 VAL B CG2 1 
ATOM   5833 N N   . VAL B 1 278 ? -12.045 -17.607 -59.517 1.00 43.24  ? 1761 VAL B N   1 
ATOM   5834 C CA  . VAL B 1 278 ? -11.225 -17.306 -60.678 1.00 42.30  ? 1761 VAL B CA  1 
ATOM   5835 C C   . VAL B 1 278 ? -12.069 -16.882 -61.875 1.00 42.32  ? 1761 VAL B C   1 
ATOM   5836 O O   . VAL B 1 278 ? -11.800 -15.849 -62.497 1.00 41.07  ? 1761 VAL B O   1 
ATOM   5837 C CB  . VAL B 1 278 ? -10.361 -18.515 -61.081 1.00 42.60  ? 1761 VAL B CB  1 
ATOM   5838 C CG1 . VAL B 1 278 ? -9.634  -18.220 -62.367 1.00 41.55  ? 1761 VAL B CG1 1 
ATOM   5839 C CG2 . VAL B 1 278 ? -9.357  -18.828 -59.984 1.00 42.20  ? 1761 VAL B CG2 1 
ATOM   5840 N N   . ALA B 1 279 ? -13.086 -17.679 -62.201 1.00 42.49  ? 1762 ALA B N   1 
ATOM   5841 C CA  . ALA B 1 279 ? -13.968 -17.381 -63.338 1.00 42.10  ? 1762 ALA B CA  1 
ATOM   5842 C C   . ALA B 1 279 ? -14.474 -15.948 -63.248 1.00 41.81  ? 1762 ALA B C   1 
ATOM   5843 O O   . ALA B 1 279 ? -14.548 -15.231 -64.251 1.00 40.36  ? 1762 ALA B O   1 
ATOM   5844 C CB  . ALA B 1 279 ? -15.154 -18.358 -63.363 1.00 40.44  ? 1762 ALA B CB  1 
ATOM   5845 N N   . ASP B 1 280 ? -14.800 -15.545 -62.023 1.00 43.08  ? 1763 ASP B N   1 
ATOM   5846 C CA  . ASP B 1 280 ? -15.309 -14.212 -61.721 1.00 44.08  ? 1763 ASP B CA  1 
ATOM   5847 C C   . ASP B 1 280 ? -14.293 -13.121 -62.049 1.00 43.64  ? 1763 ASP B C   1 
ATOM   5848 O O   . ASP B 1 280 ? -14.645 -12.090 -62.614 1.00 42.84  ? 1763 ASP B O   1 
ATOM   5849 C CB  . ASP B 1 280 ? -15.687 -14.149 -60.248 1.00 48.25  ? 1763 ASP B CB  1 
ATOM   5850 C CG  . ASP B 1 280 ? -16.823 -13.206 -59.986 1.00 50.66  ? 1763 ASP B CG  1 
ATOM   5851 O OD1 . ASP B 1 280 ? -16.699 -12.021 -60.358 1.00 55.23  ? 1763 ASP B OD1 1 
ATOM   5852 O OD2 . ASP B 1 280 ? -17.838 -13.643 -59.412 1.00 52.82  ? 1763 ASP B OD2 1 
ATOM   5853 N N   . VAL B 1 281 ? -13.034 -13.344 -61.682 1.00 43.81  ? 1764 VAL B N   1 
ATOM   5854 C CA  . VAL B 1 281 ? -11.971 -12.392 -61.987 1.00 44.26  ? 1764 VAL B CA  1 
ATOM   5855 C C   . VAL B 1 281 ? -11.766 -12.338 -63.499 1.00 44.44  ? 1764 VAL B C   1 
ATOM   5856 O O   . VAL B 1 281 ? -11.472 -11.290 -64.073 1.00 45.16  ? 1764 VAL B O   1 
ATOM   5857 C CB  . VAL B 1 281 ? -10.659 -12.823 -61.364 1.00 43.97  ? 1764 VAL B CB  1 
ATOM   5858 C CG1 . VAL B 1 281 ? -9.559  -11.820 -61.704 1.00 46.02  ? 1764 VAL B CG1 1 
ATOM   5859 C CG2 . VAL B 1 281 ? -10.835 -12.963 -59.890 1.00 45.09  ? 1764 VAL B CG2 1 
ATOM   5860 N N   . LEU B 1 282 ? -11.921 -13.488 -64.138 1.00 45.56  ? 1765 LEU B N   1 
ATOM   5861 C CA  . LEU B 1 282 ? -11.766 -13.600 -65.580 1.00 46.49  ? 1765 LEU B CA  1 
ATOM   5862 C C   . LEU B 1 282 ? -12.812 -12.741 -66.270 1.00 46.62  ? 1765 LEU B C   1 
ATOM   5863 O O   . LEU B 1 282 ? -12.488 -11.941 -67.146 1.00 46.33  ? 1765 LEU B O   1 
ATOM   5864 C CB  . LEU B 1 282 ? -11.947 -15.057 -66.000 1.00 47.73  ? 1765 LEU B CB  1 
ATOM   5865 C CG  . LEU B 1 282 ? -11.058 -15.606 -67.110 1.00 47.79  ? 1765 LEU B CG  1 
ATOM   5866 C CD1 . LEU B 1 282 ? -9.597  -15.284 -66.814 1.00 46.34  ? 1765 LEU B CD1 1 
ATOM   5867 C CD2 . LEU B 1 282 ? -11.261 -17.106 -67.202 1.00 47.56  ? 1765 LEU B CD2 1 
ATOM   5868 N N   . ALA B 1 283 ? -14.070 -12.923 -65.869 1.00 46.81  ? 1766 ALA B N   1 
ATOM   5869 C CA  . ALA B 1 283 ? -15.180 -12.167 -66.437 1.00 47.21  ? 1766 ALA B CA  1 
ATOM   5870 C C   . ALA B 1 283 ? -14.892 -10.680 -66.288 1.00 47.83  ? 1766 ALA B C   1 
ATOM   5871 O O   . ALA B 1 283 ? -15.159 -9.880  -67.190 1.00 46.83  ? 1766 ALA B O   1 
ATOM   5872 C CB  . ALA B 1 283 ? -16.477 -12.530 -65.726 1.00 47.87  ? 1766 ALA B CB  1 
ATOM   5873 N N   . LYS B 1 284 ? -14.344 -10.323 -65.133 1.00 48.51  ? 1767 LYS B N   1 
ATOM   5874 C CA  . LYS B 1 284 ? -13.981 -8.945  -64.854 1.00 50.84  ? 1767 LYS B CA  1 
ATOM   5875 C C   . LYS B 1 284 ? -12.966 -8.463  -65.907 1.00 51.90  ? 1767 LYS B C   1 
ATOM   5876 O O   . LYS B 1 284 ? -13.049 -7.329  -66.385 1.00 52.37  ? 1767 LYS B O   1 
ATOM   5877 C CB  . LYS B 1 284 ? -13.391 -8.852  -63.446 1.00 51.69  ? 1767 LYS B CB  1 
ATOM   5878 C CG  . LYS B 1 284 ? -12.883 -7.481  -63.056 1.00 52.43  ? 1767 LYS B CG  1 
ATOM   5879 C CD  . LYS B 1 284 ? -12.135 -7.548  -61.726 1.00 50.68  ? 1767 LYS B CD  1 
ATOM   5880 C CE  . LYS B 1 284 ? -11.320 -6.296  -61.482 1.00 49.52  ? 1767 LYS B CE  1 
ATOM   5881 N NZ  . LYS B 1 284 ? -10.585 -6.401  -60.200 1.00 49.82  ? 1767 LYS B NZ  1 
ATOM   5882 N N   . PHE B 1 285 ? -12.016 -9.322  -66.276 1.00 51.62  ? 1768 PHE B N   1 
ATOM   5883 C CA  . PHE B 1 285 ? -11.023 -8.953  -67.286 1.00 52.65  ? 1768 PHE B CA  1 
ATOM   5884 C C   . PHE B 1 285 ? -11.677 -8.657  -68.640 1.00 53.76  ? 1768 PHE B C   1 
ATOM   5885 O O   . PHE B 1 285 ? -11.378 -7.646  -69.278 1.00 53.12  ? 1768 PHE B O   1 
ATOM   5886 C CB  . PHE B 1 285 ? -9.991  -10.079 -67.478 1.00 52.46  ? 1768 PHE B CB  1 
ATOM   5887 C CG  . PHE B 1 285 ? -8.979  -10.194 -66.369 1.00 51.31  ? 1768 PHE B CG  1 
ATOM   5888 C CD1 . PHE B 1 285 ? -8.931  -9.259  -65.335 1.00 51.76  ? 1768 PHE B CD1 1 
ATOM   5889 C CD2 . PHE B 1 285 ? -8.057  -11.233 -66.372 1.00 50.16  ? 1768 PHE B CD2 1 
ATOM   5890 C CE1 . PHE B 1 285 ? -7.979  -9.360  -64.324 1.00 50.90  ? 1768 PHE B CE1 1 
ATOM   5891 C CE2 . PHE B 1 285 ? -7.099  -11.348 -65.371 1.00 50.10  ? 1768 PHE B CE2 1 
ATOM   5892 C CZ  . PHE B 1 285 ? -7.060  -10.407 -64.342 1.00 51.61  ? 1768 PHE B CZ  1 
ATOM   5893 N N   . GLU B 1 286 ? -12.565 -9.552  -69.070 1.00 55.71  ? 1769 GLU B N   1 
ATOM   5894 C CA  . GLU B 1 286 ? -13.257 -9.416  -70.352 1.00 57.41  ? 1769 GLU B CA  1 
ATOM   5895 C C   . GLU B 1 286 ? -14.035 -8.099  -70.488 1.00 58.11  ? 1769 GLU B C   1 
ATOM   5896 O O   . GLU B 1 286 ? -13.988 -7.446  -71.538 1.00 57.25  ? 1769 GLU B O   1 
ATOM   5897 C CB  . GLU B 1 286 ? -14.217 -10.586 -70.550 1.00 56.95  ? 1769 GLU B CB  1 
ATOM   5898 C CG  . GLU B 1 286 ? -14.797 -10.675 -71.944 1.00 56.82  ? 1769 GLU B CG  1 
ATOM   5899 C CD  . GLU B 1 286 ? -16.016 -11.563 -71.998 1.00 56.85  ? 1769 GLU B CD  1 
ATOM   5900 O OE1 . GLU B 1 286 ? -17.096 -11.103 -71.581 1.00 57.05  ? 1769 GLU B OE1 1 
ATOM   5901 O OE2 . GLU B 1 286 ? -15.898 -12.723 -72.446 1.00 57.39  ? 1769 GLU B OE2 1 
ATOM   5902 N N   . LYS B 1 287 ? -14.756 -7.723  -69.436 1.00 58.81  ? 1770 LYS B N   1 
ATOM   5903 C CA  . LYS B 1 287 ? -15.530 -6.485  -69.448 1.00 60.25  ? 1770 LYS B CA  1 
ATOM   5904 C C   . LYS B 1 287 ? -14.549 -5.320  -69.485 1.00 61.23  ? 1770 LYS B C   1 
ATOM   5905 O O   . LYS B 1 287 ? -14.631 -4.454  -70.363 1.00 61.81  ? 1770 LYS B O   1 
ATOM   5906 C CB  . LYS B 1 287 ? -16.404 -6.393  -68.198 1.00 60.61  ? 1770 LYS B CB  1 
ATOM   5907 C CG  . LYS B 1 287 ? -17.726 -5.666  -68.402 1.00 61.10  ? 1770 LYS B CG  1 
ATOM   5908 C CD  . LYS B 1 287 ? -18.485 -5.515  -67.078 1.00 61.67  ? 1770 LYS B CD  1 
ATOM   5909 C CE  . LYS B 1 287 ? -19.896 -4.986  -67.302 1.00 62.21  ? 1770 LYS B CE  1 
ATOM   5910 N NZ  . LYS B 1 287 ? -19.919 -3.749  -68.151 1.00 61.07  ? 1770 LYS B NZ  1 
ATOM   5911 N N   . LEU B 1 288 ? -13.613 -5.315  -68.534 1.00 62.19  ? 1771 LEU B N   1 
ATOM   5912 C CA  . LEU B 1 288 ? -12.587 -4.276  -68.448 1.00 62.50  ? 1771 LEU B CA  1 
ATOM   5913 C C   . LEU B 1 288 ? -11.809 -4.129  -69.759 1.00 62.65  ? 1771 LEU B C   1 
ATOM   5914 O O   . LEU B 1 288 ? -11.230 -3.081  -70.024 1.00 63.02  ? 1771 LEU B O   1 
ATOM   5915 C CB  . LEU B 1 288 ? -11.620 -4.584  -67.299 1.00 62.35  ? 1771 LEU B CB  1 
ATOM   5916 C CG  . LEU B 1 288 ? -12.122 -4.283  -65.882 1.00 62.88  ? 1771 LEU B CG  1 
ATOM   5917 C CD1 . LEU B 1 288 ? -11.383 -5.149  -64.860 1.00 63.26  ? 1771 LEU B CD1 1 
ATOM   5918 C CD2 . LEU B 1 288 ? -11.929 -2.802  -65.584 1.00 62.88  ? 1771 LEU B CD2 1 
ATOM   5919 N N   . ALA B 1 289 ? -11.796 -5.177  -70.577 1.00 62.75  ? 1772 ALA B N   1 
ATOM   5920 C CA  . ALA B 1 289 ? -11.100 -5.127  -71.860 1.00 63.35  ? 1772 ALA B CA  1 
ATOM   5921 C C   . ALA B 1 289 ? -11.883 -4.253  -72.836 1.00 64.40  ? 1772 ALA B C   1 
ATOM   5922 O O   . ALA B 1 289 ? -11.455 -4.025  -73.966 1.00 64.97  ? 1772 ALA B O   1 
ATOM   5923 C CB  . ALA B 1 289 ? -10.932 -6.535  -72.435 1.00 60.71  ? 1772 ALA B CB  1 
ATOM   5924 N N   . ALA B 1 290 ? -13.035 -3.764  -72.396 1.00 64.95  ? 1773 ALA B N   1 
ATOM   5925 C CA  . ALA B 1 290 ? -13.855 -2.912  -73.244 1.00 65.62  ? 1773 ALA B CA  1 
ATOM   5926 C C   . ALA B 1 290 ? -14.665 -1.919  -72.410 1.00 65.26  ? 1773 ALA B C   1 
ATOM   5927 O O   . ALA B 1 290 ? -14.189 -1.405  -71.392 1.00 64.17  ? 1773 ALA B O   1 
ATOM   5928 C CB  . ALA B 1 290 ? -14.778 -3.774  -74.098 1.00 65.92  ? 1773 ALA B CB  1 
ATOM   5929 N N   . LEU B 1 297 ? -2.689  -1.798  -71.806 1.00 75.54  ? 1780 LEU B N   1 
ATOM   5930 C CA  . LEU B 1 297 ? -2.160  -2.800  -70.883 1.00 76.09  ? 1780 LEU B CA  1 
ATOM   5931 C C   . LEU B 1 297 ? -3.234  -3.824  -70.508 1.00 75.94  ? 1780 LEU B C   1 
ATOM   5932 O O   . LEU B 1 297 ? -4.094  -3.547  -69.674 1.00 77.47  ? 1780 LEU B O   1 
ATOM   5933 C CB  . LEU B 1 297 ? -1.633  -2.120  -69.610 1.00 75.55  ? 1780 LEU B CB  1 
ATOM   5934 C CG  . LEU B 1 297 ? -0.326  -1.324  -69.701 1.00 74.44  ? 1780 LEU B CG  1 
ATOM   5935 C CD1 . LEU B 1 297 ? -0.169  -0.422  -68.487 1.00 73.77  ? 1780 LEU B CD1 1 
ATOM   5936 C CD2 . LEU B 1 297 ? 0.839   -2.287  -69.807 1.00 74.27  ? 1780 LEU B CD2 1 
ATOM   5937 N N   . PRO B 1 298 ? -3.196  -5.020  -71.121 1.00 75.09  ? 1781 PRO B N   1 
ATOM   5938 C CA  . PRO B 1 298 ? -4.177  -6.076  -70.835 1.00 74.03  ? 1781 PRO B CA  1 
ATOM   5939 C C   . PRO B 1 298 ? -3.937  -6.750  -69.482 1.00 72.84  ? 1781 PRO B C   1 
ATOM   5940 O O   . PRO B 1 298 ? -2.793  -6.889  -69.037 1.00 73.30  ? 1781 PRO B O   1 
ATOM   5941 C CB  . PRO B 1 298 ? -3.993  -7.032  -72.005 1.00 74.17  ? 1781 PRO B CB  1 
ATOM   5942 C CG  . PRO B 1 298 ? -2.515  -6.938  -72.255 1.00 74.37  ? 1781 PRO B CG  1 
ATOM   5943 C CD  . PRO B 1 298 ? -2.263  -5.446  -72.179 1.00 74.48  ? 1781 PRO B CD  1 
ATOM   5944 N N   . TRP B 1 299 ? -5.016  -7.154  -68.824 1.00 70.85  ? 1782 TRP B N   1 
ATOM   5945 C CA  . TRP B 1 299 ? -4.891  -7.795  -67.523 1.00 69.58  ? 1782 TRP B CA  1 
ATOM   5946 C C   . TRP B 1 299 ? -4.581  -9.279  -67.656 1.00 67.01  ? 1782 TRP B C   1 
ATOM   5947 O O   . TRP B 1 299 ? -5.035  -9.925  -68.597 1.00 68.32  ? 1782 TRP B O   1 
ATOM   5948 C CB  . TRP B 1 299 ? -6.170  -7.599  -66.713 1.00 71.19  ? 1782 TRP B CB  1 
ATOM   5949 C CG  . TRP B 1 299 ? -6.390  -6.181  -66.305 1.00 72.29  ? 1782 TRP B CG  1 
ATOM   5950 C CD1 . TRP B 1 299 ? -7.097  -5.237  -66.981 1.00 73.43  ? 1782 TRP B CD1 1 
ATOM   5951 C CD2 . TRP B 1 299 ? -5.898  -5.542  -65.120 1.00 72.94  ? 1782 TRP B CD2 1 
ATOM   5952 N NE1 . TRP B 1 299 ? -7.084  -4.049  -66.291 1.00 73.48  ? 1782 TRP B NE1 1 
ATOM   5953 C CE2 . TRP B 1 299 ? -6.355  -4.209  -65.144 1.00 73.34  ? 1782 TRP B CE2 1 
ATOM   5954 C CE3 . TRP B 1 299 ? -5.114  -5.970  -64.039 1.00 73.11  ? 1782 TRP B CE3 1 
ATOM   5955 C CZ2 . TRP B 1 299 ? -6.058  -3.294  -64.124 1.00 74.19  ? 1782 TRP B CZ2 1 
ATOM   5956 C CZ3 . TRP B 1 299 ? -4.816  -5.060  -63.023 1.00 73.17  ? 1782 TRP B CZ3 1 
ATOM   5957 C CH2 . TRP B 1 299 ? -5.290  -3.738  -63.075 1.00 73.77  ? 1782 TRP B CH2 1 
ATOM   5958 N N   . LYS B 1 300 ? -3.808  -9.822  -66.717 1.00 62.30  ? 1783 LYS B N   1 
ATOM   5959 C CA  . LYS B 1 300 ? -3.451  -11.233 -66.779 1.00 58.16  ? 1783 LYS B CA  1 
ATOM   5960 C C   . LYS B 1 300 ? -3.150  -11.837 -65.409 1.00 54.49  ? 1783 LYS B C   1 
ATOM   5961 O O   . LYS B 1 300 ? -2.693  -11.142 -64.517 1.00 52.49  ? 1783 LYS B O   1 
ATOM   5962 C CB  . LYS B 1 300 ? -2.247  -11.399 -67.706 1.00 58.58  ? 1783 LYS B CB  1 
ATOM   5963 C CG  . LYS B 1 300 ? -2.534  -10.988 -69.151 1.00 61.77  ? 1783 LYS B CG  1 
ATOM   5964 C CD  . LYS B 1 300 ? -1.290  -10.477 -69.901 1.00 63.25  ? 1783 LYS B CD  1 
ATOM   5965 C CE  . LYS B 1 300 ? -0.315  -11.593 -70.265 1.00 62.24  ? 1783 LYS B CE  1 
ATOM   5966 N NZ  . LYS B 1 300 ? 0.974   -11.033 -70.769 1.00 63.41  ? 1783 LYS B NZ  1 
ATOM   5967 N N   . PHE B 1 301 ? -3.428  -13.129 -65.248 1.00 51.79  ? 1784 PHE B N   1 
ATOM   5968 C CA  . PHE B 1 301 ? -3.150  -13.820 -63.990 1.00 49.97  ? 1784 PHE B CA  1 
ATOM   5969 C C   . PHE B 1 301 ? -1.651  -14.033 -63.832 1.00 48.68  ? 1784 PHE B C   1 
ATOM   5970 O O   . PHE B 1 301 ? -0.992  -14.585 -64.718 1.00 48.45  ? 1784 PHE B O   1 
ATOM   5971 C CB  . PHE B 1 301 ? -3.821  -15.200 -63.933 1.00 49.78  ? 1784 PHE B CB  1 
ATOM   5972 C CG  . PHE B 1 301 ? -5.301  -15.158 -63.717 1.00 49.78  ? 1784 PHE B CG  1 
ATOM   5973 C CD1 . PHE B 1 301 ? -5.845  -14.369 -62.709 1.00 49.23  ? 1784 PHE B CD1 1 
ATOM   5974 C CD2 . PHE B 1 301 ? -6.156  -15.910 -64.527 1.00 48.99  ? 1784 PHE B CD2 1 
ATOM   5975 C CE1 . PHE B 1 301 ? -7.224  -14.323 -62.513 1.00 49.88  ? 1784 PHE B CE1 1 
ATOM   5976 C CE2 . PHE B 1 301 ? -7.529  -15.874 -64.341 1.00 48.13  ? 1784 PHE B CE2 1 
ATOM   5977 C CZ  . PHE B 1 301 ? -8.069  -15.077 -63.332 1.00 49.39  ? 1784 PHE B CZ  1 
ATOM   5978 N N   . TYR B 1 302 ? -1.123  -13.604 -62.694 1.00 47.12  ? 1785 TYR B N   1 
ATOM   5979 C CA  . TYR B 1 302 ? 0.296   -13.740 -62.386 1.00 46.43  ? 1785 TYR B CA  1 
ATOM   5980 C C   . TYR B 1 302 ? 0.477   -14.470 -61.067 1.00 45.23  ? 1785 TYR B C   1 
ATOM   5981 O O   . TYR B 1 302 ? -0.334  -14.320 -60.154 1.00 45.10  ? 1785 TYR B O   1 
ATOM   5982 C CB  . TYR B 1 302 ? 0.954   -12.360 -62.310 1.00 47.34  ? 1785 TYR B CB  1 
ATOM   5983 C CG  . TYR B 1 302 ? 1.690   -11.979 -63.568 1.00 48.28  ? 1785 TYR B CG  1 
ATOM   5984 C CD1 . TYR B 1 302 ? 3.083   -12.041 -63.628 1.00 48.65  ? 1785 TYR B CD1 1 
ATOM   5985 C CD2 . TYR B 1 302 ? 0.998   -11.576 -64.715 1.00 49.39  ? 1785 TYR B CD2 1 
ATOM   5986 C CE1 . TYR B 1 302 ? 3.778   -11.710 -64.796 1.00 49.18  ? 1785 TYR B CE1 1 
ATOM   5987 C CE2 . TYR B 1 302 ? 1.683   -11.244 -65.893 1.00 49.98  ? 1785 TYR B CE2 1 
ATOM   5988 C CZ  . TYR B 1 302 ? 3.071   -11.312 -65.921 1.00 49.13  ? 1785 TYR B CZ  1 
ATOM   5989 O OH  . TYR B 1 302 ? 3.753   -10.957 -67.059 1.00 51.09  ? 1785 TYR B OH  1 
ATOM   5990 N N   . PHE B 1 303 ? 1.533   -15.270 -60.974 1.00 43.66  ? 1786 PHE B N   1 
ATOM   5991 C CA  . PHE B 1 303 ? 1.813   -16.018 -59.760 1.00 43.46  ? 1786 PHE B CA  1 
ATOM   5992 C C   . PHE B 1 303 ? 3.103   -15.518 -59.138 1.00 42.51  ? 1786 PHE B C   1 
ATOM   5993 O O   . PHE B 1 303 ? 4.164   -15.604 -59.746 1.00 42.83  ? 1786 PHE B O   1 
ATOM   5994 C CB  . PHE B 1 303 ? 1.931   -17.520 -60.065 1.00 42.86  ? 1786 PHE B CB  1 
ATOM   5995 C CG  . PHE B 1 303 ? 2.237   -18.377 -58.847 1.00 44.98  ? 1786 PHE B CG  1 
ATOM   5996 C CD1 . PHE B 1 303 ? 1.279   -18.582 -57.854 1.00 46.33  ? 1786 PHE B CD1 1 
ATOM   5997 C CD2 . PHE B 1 303 ? 3.481   -18.972 -58.694 1.00 44.31  ? 1786 PHE B CD2 1 
ATOM   5998 C CE1 . PHE B 1 303 ? 1.560   -19.370 -56.729 1.00 46.92  ? 1786 PHE B CE1 1 
ATOM   5999 C CE2 . PHE B 1 303 ? 3.769   -19.757 -57.573 1.00 46.40  ? 1786 PHE B CE2 1 
ATOM   6000 C CZ  . PHE B 1 303 ? 2.808   -19.957 -56.591 1.00 46.13  ? 1786 PHE B CZ  1 
ATOM   6001 N N   . LYS B 1 304 ? 3.014   -14.975 -57.933 1.00 43.61  ? 1787 LYS B N   1 
ATOM   6002 C CA  . LYS B 1 304 ? 4.215   -14.498 -57.255 1.00 44.49  ? 1787 LYS B CA  1 
ATOM   6003 C C   . LYS B 1 304 ? 4.180   -14.427 -55.735 1.00 44.62  ? 1787 LYS B C   1 
ATOM   6004 O O   . LYS B 1 304 ? 3.152   -14.638 -55.088 1.00 45.53  ? 1787 LYS B O   1 
ATOM   6005 C CB  . LYS B 1 304 ? 4.661   -13.135 -57.800 1.00 44.70  ? 1787 LYS B CB  1 
ATOM   6006 C CG  . LYS B 1 304 ? 3.578   -12.136 -58.112 1.00 46.65  ? 1787 LYS B CG  1 
ATOM   6007 C CD  . LYS B 1 304 ? 4.195   -10.747 -58.220 1.00 49.42  ? 1787 LYS B CD  1 
ATOM   6008 C CE  . LYS B 1 304 ? 3.238   -9.732  -58.827 1.00 51.84  ? 1787 LYS B CE  1 
ATOM   6009 N NZ  . LYS B 1 304 ? 3.202   -9.846  -60.312 1.00 52.92  ? 1787 LYS B NZ  1 
ATOM   6010 N N   . LEU B 1 305 ? 5.353   -14.145 -55.185 1.00 45.22  ? 1788 LEU B N   1 
ATOM   6011 C CA  . LEU B 1 305 ? 5.567   -14.010 -53.760 1.00 44.13  ? 1788 LEU B CA  1 
ATOM   6012 C C   . LEU B 1 305 ? 4.656   -12.882 -53.253 1.00 44.48  ? 1788 LEU B C   1 
ATOM   6013 O O   . LEU B 1 305 ? 4.637   -11.789 -53.825 1.00 44.07  ? 1788 LEU B O   1 
ATOM   6014 C CB  . LEU B 1 305 ? 7.033   -13.644 -53.541 1.00 45.67  ? 1788 LEU B CB  1 
ATOM   6015 C CG  . LEU B 1 305 ? 7.880   -14.240 -52.422 1.00 46.59  ? 1788 LEU B CG  1 
ATOM   6016 C CD1 . LEU B 1 305 ? 7.212   -13.993 -51.081 1.00 49.24  ? 1788 LEU B CD1 1 
ATOM   6017 C CD2 . LEU B 1 305 ? 8.078   -15.707 -52.670 1.00 46.38  ? 1788 LEU B CD2 1 
ATOM   6018 N N   . TYR B 1 306 ? 3.887   -13.146 -52.198 1.00 44.58  ? 1789 TYR B N   1 
ATOM   6019 C CA  . TYR B 1 306 ? 3.007   -12.123 -51.632 1.00 44.19  ? 1789 TYR B CA  1 
ATOM   6020 C C   . TYR B 1 306 ? 3.579   -11.605 -50.319 1.00 44.09  ? 1789 TYR B C   1 
ATOM   6021 O O   . TYR B 1 306 ? 3.698   -10.400 -50.115 1.00 43.55  ? 1789 TYR B O   1 
ATOM   6022 C CB  . TYR B 1 306 ? 1.594   -12.672 -51.384 1.00 43.57  ? 1789 TYR B CB  1 
ATOM   6023 C CG  . TYR B 1 306 ? 0.600   -11.586 -51.025 1.00 40.13  ? 1789 TYR B CG  1 
ATOM   6024 C CD1 . TYR B 1 306 ? 0.482   -10.448 -51.822 1.00 39.57  ? 1789 TYR B CD1 1 
ATOM   6025 C CD2 . TYR B 1 306 ? -0.205  -11.687 -49.894 1.00 38.76  ? 1789 TYR B CD2 1 
ATOM   6026 C CE1 . TYR B 1 306 ? -0.410  -9.428  -51.506 1.00 41.49  ? 1789 TYR B CE1 1 
ATOM   6027 C CE2 . TYR B 1 306 ? -1.113  -10.669 -49.562 1.00 40.44  ? 1789 TYR B CE2 1 
ATOM   6028 C CZ  . TYR B 1 306 ? -1.207  -9.537  -50.379 1.00 42.38  ? 1789 TYR B CZ  1 
ATOM   6029 O OH  . TYR B 1 306 ? -2.084  -8.508  -50.096 1.00 41.01  ? 1789 TYR B OH  1 
ATOM   6030 N N   . CYS B 1 307 ? 3.927   -12.528 -49.431 1.00 44.98  ? 1790 CYS B N   1 
ATOM   6031 C CA  . CYS B 1 307 ? 4.494   -12.160 -48.133 1.00 46.09  ? 1790 CYS B CA  1 
ATOM   6032 C C   . CYS B 1 307 ? 5.927   -12.659 -47.965 1.00 45.99  ? 1790 CYS B C   1 
ATOM   6033 O O   . CYS B 1 307 ? 6.208   -13.857 -48.081 1.00 44.93  ? 1790 CYS B O   1 
ATOM   6034 C CB  . CYS B 1 307 ? 3.629   -12.705 -46.980 1.00 45.71  ? 1790 CYS B CB  1 
ATOM   6035 S SG  . CYS B 1 307 ? 2.041   -11.863 -46.728 1.00 46.35  ? 1790 CYS B SG  1 
ATOM   6036 N N   . PHE B 1 308 ? 6.830   -11.722 -47.705 1.00 45.86  ? 1791 PHE B N   1 
ATOM   6037 C CA  . PHE B 1 308 ? 8.225   -12.046 -47.489 1.00 47.48  ? 1791 PHE B CA  1 
ATOM   6038 C C   . PHE B 1 308 ? 8.397   -12.299 -46.002 1.00 47.42  ? 1791 PHE B C   1 
ATOM   6039 O O   . PHE B 1 308 ? 8.462   -11.361 -45.222 1.00 46.66  ? 1791 PHE B O   1 
ATOM   6040 C CB  . PHE B 1 308 ? 9.097   -10.880 -47.929 1.00 48.65  ? 1791 PHE B CB  1 
ATOM   6041 C CG  . PHE B 1 308 ? 9.078   -10.649 -49.401 1.00 50.47  ? 1791 PHE B CG  1 
ATOM   6042 C CD1 . PHE B 1 308 ? 9.900   -11.393 -50.244 1.00 50.92  ? 1791 PHE B CD1 1 
ATOM   6043 C CD2 . PHE B 1 308 ? 8.243   -9.689  -49.954 1.00 52.01  ? 1791 PHE B CD2 1 
ATOM   6044 C CE1 . PHE B 1 308 ? 9.897   -11.183 -51.620 1.00 51.46  ? 1791 PHE B CE1 1 
ATOM   6045 C CE2 . PHE B 1 308 ? 8.228   -9.468  -51.338 1.00 53.46  ? 1791 PHE B CE2 1 
ATOM   6046 C CZ  . PHE B 1 308 ? 9.062   -10.220 -52.171 1.00 52.85  ? 1791 PHE B CZ  1 
ATOM   6047 N N   . LEU B 1 309 ? 8.448   -13.567 -45.612 1.00 48.74  ? 1792 LEU B N   1 
ATOM   6048 C CA  . LEU B 1 309 ? 8.595   -13.910 -44.208 1.00 51.14  ? 1792 LEU B CA  1 
ATOM   6049 C C   . LEU B 1 309 ? 10.005  -14.357 -43.876 1.00 53.12  ? 1792 LEU B C   1 
ATOM   6050 O O   . LEU B 1 309 ? 10.486  -14.124 -42.769 1.00 53.24  ? 1792 LEU B O   1 
ATOM   6051 C CB  . LEU B 1 309 ? 7.598   -15.001 -43.827 1.00 50.39  ? 1792 LEU B CB  1 
ATOM   6052 C CG  . LEU B 1 309 ? 6.148   -14.597 -44.073 1.00 50.03  ? 1792 LEU B CG  1 
ATOM   6053 C CD1 . LEU B 1 309 ? 5.228   -15.741 -43.675 1.00 51.66  ? 1792 LEU B CD1 1 
ATOM   6054 C CD2 . LEU B 1 309 ? 5.831   -13.339 -43.279 1.00 48.69  ? 1792 LEU B CD2 1 
ATOM   6055 N N   . ASP B 1 310 ? 10.663  -14.997 -44.838 1.00 55.25  ? 1793 ASP B N   1 
ATOM   6056 C CA  . ASP B 1 310 ? 12.032  -15.468 -44.654 1.00 56.77  ? 1793 ASP B CA  1 
ATOM   6057 C C   . ASP B 1 310 ? 12.767  -15.467 -45.996 1.00 57.95  ? 1793 ASP B C   1 
ATOM   6058 O O   . ASP B 1 310 ? 12.617  -16.396 -46.807 1.00 56.37  ? 1793 ASP B O   1 
ATOM   6059 C CB  . ASP B 1 310 ? 12.030  -16.884 -44.073 1.00 57.88  ? 1793 ASP B CB  1 
ATOM   6060 C CG  . ASP B 1 310 ? 13.410  -17.347 -43.647 1.00 60.58  ? 1793 ASP B CG  1 
ATOM   6061 O OD1 . ASP B 1 310 ? 14.410  -16.971 -44.300 1.00 61.07  ? 1793 ASP B OD1 1 
ATOM   6062 O OD2 . ASP B 1 310 ? 13.491  -18.106 -42.658 1.00 62.51  ? 1793 ASP B OD2 1 
ATOM   6063 N N   . THR B 1 311 ? 13.557  -14.420 -46.226 1.00 59.46  ? 1794 THR B N   1 
ATOM   6064 C CA  . THR B 1 311 ? 14.330  -14.293 -47.461 1.00 61.24  ? 1794 THR B CA  1 
ATOM   6065 C C   . THR B 1 311 ? 15.809  -14.606 -47.219 1.00 61.53  ? 1794 THR B C   1 
ATOM   6066 O O   . THR B 1 311 ? 16.650  -14.351 -48.071 1.00 61.17  ? 1794 THR B O   1 
ATOM   6067 C CB  . THR B 1 311 ? 14.239  -12.869 -48.030 1.00 61.80  ? 1794 THR B CB  1 
ATOM   6068 O OG1 . THR B 1 311 ? 14.890  -11.956 -47.138 1.00 64.01  ? 1794 THR B OG1 1 
ATOM   6069 C CG2 . THR B 1 311 ? 12.797  -12.461 -48.190 1.00 62.77  ? 1794 THR B CG2 1 
ATOM   6070 N N   . ASP B 1 312 ? 16.123  -15.156 -46.052 1.00 62.47  ? 1795 ASP B N   1 
ATOM   6071 C CA  . ASP B 1 312 ? 17.507  -15.475 -45.721 1.00 63.41  ? 1795 ASP B CA  1 
ATOM   6072 C C   . ASP B 1 312 ? 17.794  -16.969 -45.686 1.00 63.89  ? 1795 ASP B C   1 
ATOM   6073 O O   . ASP B 1 312 ? 18.894  -17.407 -46.021 1.00 64.43  ? 1795 ASP B O   1 
ATOM   6074 C CB  . ASP B 1 312 ? 17.888  -14.845 -44.375 1.00 62.68  ? 1795 ASP B CB  1 
ATOM   6075 C CG  . ASP B 1 312 ? 18.252  -13.378 -44.501 1.00 63.64  ? 1795 ASP B CG  1 
ATOM   6076 O OD1 . ASP B 1 312 ? 17.348  -12.540 -44.724 1.00 63.25  ? 1795 ASP B OD1 1 
ATOM   6077 O OD2 . ASP B 1 312 ? 19.456  -13.065 -44.390 1.00 64.25  ? 1795 ASP B OD2 1 
ATOM   6078 N N   . ASN B 1 313 ? 16.799  -17.747 -45.284 1.00 64.10  ? 1796 ASN B N   1 
ATOM   6079 C CA  . ASN B 1 313 ? 16.947  -19.188 -45.192 1.00 63.85  ? 1796 ASN B CA  1 
ATOM   6080 C C   . ASN B 1 313 ? 16.531  -19.892 -46.466 1.00 63.54  ? 1796 ASN B C   1 
ATOM   6081 O O   . ASN B 1 313 ? 16.448  -21.114 -46.501 1.00 64.05  ? 1796 ASN B O   1 
ATOM   6082 C CB  . ASN B 1 313 ? 16.120  -19.709 -44.019 1.00 65.66  ? 1796 ASN B CB  1 
ATOM   6083 C CG  . ASN B 1 313 ? 16.646  -19.227 -42.679 1.00 66.34  ? 1796 ASN B CG  1 
ATOM   6084 O OD1 . ASN B 1 313 ? 15.999  -19.394 -41.646 1.00 65.47  ? 1796 ASN B OD1 1 
ATOM   6085 N ND2 . ASN B 1 313 ? 17.839  -18.636 -42.693 1.00 66.85  ? 1796 ASN B ND2 1 
ATOM   6086 N N   . VAL B 1 314 ? 16.252  -19.125 -47.513 1.00 63.35  ? 1797 VAL B N   1 
ATOM   6087 C CA  . VAL B 1 314 ? 15.855  -19.724 -48.776 1.00 63.19  ? 1797 VAL B CA  1 
ATOM   6088 C C   . VAL B 1 314 ? 17.109  -20.240 -49.480 1.00 64.09  ? 1797 VAL B C   1 
ATOM   6089 O O   . VAL B 1 314 ? 17.980  -19.463 -49.902 1.00 62.90  ? 1797 VAL B O   1 
ATOM   6090 C CB  . VAL B 1 314 ? 15.118  -18.718 -49.688 1.00 62.69  ? 1797 VAL B CB  1 
ATOM   6091 C CG1 . VAL B 1 314 ? 14.777  -19.376 -51.023 1.00 62.68  ? 1797 VAL B CG1 1 
ATOM   6092 C CG2 . VAL B 1 314 ? 13.841  -18.242 -49.014 1.00 61.93  ? 1797 VAL B CG2 1 
ATOM   6093 N N   . PRO B 1 315 ? 17.213  -21.572 -49.611 1.00 64.66  ? 1798 PRO B N   1 
ATOM   6094 C CA  . PRO B 1 315 ? 18.354  -22.218 -50.256 1.00 65.04  ? 1798 PRO B CA  1 
ATOM   6095 C C   . PRO B 1 315 ? 18.467  -21.853 -51.725 1.00 66.08  ? 1798 PRO B C   1 
ATOM   6096 O O   . PRO B 1 315 ? 17.534  -22.088 -52.501 1.00 66.26  ? 1798 PRO B O   1 
ATOM   6097 C CB  . PRO B 1 315 ? 18.069  -23.704 -50.042 1.00 65.09  ? 1798 PRO B CB  1 
ATOM   6098 C CG  . PRO B 1 315 ? 16.575  -23.766 -50.085 1.00 63.78  ? 1798 PRO B CG  1 
ATOM   6099 C CD  . PRO B 1 315 ? 16.174  -22.563 -49.263 1.00 64.31  ? 1798 PRO B CD  1 
ATOM   6100 N N   . LYS B 1 316 ? 19.601  -21.262 -52.102 1.00 66.49  ? 1799 LYS B N   1 
ATOM   6101 C CA  . LYS B 1 316 ? 19.844  -20.899 -53.493 1.00 66.34  ? 1799 LYS B CA  1 
ATOM   6102 C C   . LYS B 1 316 ? 19.597  -22.193 -54.240 1.00 65.93  ? 1799 LYS B C   1 
ATOM   6103 O O   . LYS B 1 316 ? 19.585  -23.258 -53.627 1.00 66.12  ? 1799 LYS B O   1 
ATOM   6104 C CB  . LYS B 1 316 ? 21.295  -20.469 -53.692 1.00 67.57  ? 1799 LYS B CB  1 
ATOM   6105 C CG  . LYS B 1 316 ? 21.750  -19.357 -52.758 1.00 69.97  ? 1799 LYS B CG  1 
ATOM   6106 C CD  . LYS B 1 316 ? 23.257  -19.170 -52.808 1.00 70.68  ? 1799 LYS B CD  1 
ATOM   6107 C CE  . LYS B 1 316 ? 23.695  -18.018 -51.922 1.00 71.36  ? 1799 LYS B CE  1 
ATOM   6108 N NZ  . LYS B 1 316 ? 23.162  -16.708 -52.408 1.00 72.49  ? 1799 LYS B NZ  1 
ATOM   6109 N N   . ASP B 1 317 ? 19.394  -22.103 -55.545 1.00 65.17  ? 1800 ASP B N   1 
ATOM   6110 C CA  . ASP B 1 317 ? 19.138  -23.275 -56.386 1.00 65.87  ? 1800 ASP B CA  1 
ATOM   6111 C C   . ASP B 1 317 ? 17.704  -23.833 -56.323 1.00 64.73  ? 1800 ASP B C   1 
ATOM   6112 O O   . ASP B 1 317 ? 17.276  -24.545 -57.240 1.00 66.43  ? 1800 ASP B O   1 
ATOM   6113 C CB  . ASP B 1 317 ? 20.170  -24.398 -56.107 1.00 66.82  ? 1800 ASP B CB  1 
ATOM   6114 C CG  . ASP B 1 317 ? 19.754  -25.356 -54.983 1.00 67.92  ? 1800 ASP B CG  1 
ATOM   6115 O OD1 . ASP B 1 317 ? 20.573  -26.241 -54.647 1.00 68.01  ? 1800 ASP B OD1 1 
ATOM   6116 O OD2 . ASP B 1 317 ? 18.631  -25.240 -54.439 1.00 69.04  ? 1800 ASP B OD2 1 
ATOM   6117 N N   . SER B 1 318 ? 16.959  -23.523 -55.263 1.00 61.77  ? 1801 SER B N   1 
ATOM   6118 C CA  . SER B 1 318 ? 15.578  -23.997 -55.172 1.00 58.76  ? 1801 SER B CA  1 
ATOM   6119 C C   . SER B 1 318 ? 14.713  -23.119 -56.077 1.00 56.96  ? 1801 SER B C   1 
ATOM   6120 O O   . SER B 1 318 ? 15.094  -21.997 -56.423 1.00 55.36  ? 1801 SER B O   1 
ATOM   6121 C CB  . SER B 1 318 ? 15.060  -23.916 -53.733 1.00 59.17  ? 1801 SER B CB  1 
ATOM   6122 O OG  . SER B 1 318 ? 15.015  -22.575 -53.271 1.00 59.28  ? 1801 SER B OG  1 
ATOM   6123 N N   . VAL B 1 319 ? 13.553  -23.632 -56.468 1.00 54.86  ? 1802 VAL B N   1 
ATOM   6124 C CA  . VAL B 1 319 ? 12.674  -22.875 -57.343 1.00 53.40  ? 1802 VAL B CA  1 
ATOM   6125 C C   . VAL B 1 319 ? 12.261  -21.569 -56.667 1.00 51.51  ? 1802 VAL B C   1 
ATOM   6126 O O   . VAL B 1 319 ? 12.117  -20.548 -57.334 1.00 52.84  ? 1802 VAL B O   1 
ATOM   6127 C CB  . VAL B 1 319 ? 11.405  -23.681 -57.712 1.00 54.21  ? 1802 VAL B CB  1 
ATOM   6128 C CG1 . VAL B 1 319 ? 10.586  -22.919 -58.735 1.00 53.49  ? 1802 VAL B CG1 1 
ATOM   6129 C CG2 . VAL B 1 319 ? 11.798  -25.042 -58.271 1.00 55.23  ? 1802 VAL B CG2 1 
ATOM   6130 N N   . GLU B 1 320 ? 12.079  -21.605 -55.349 1.00 47.26  ? 1803 GLU B N   1 
ATOM   6131 C CA  . GLU B 1 320 ? 11.688  -20.423 -54.598 1.00 43.92  ? 1803 GLU B CA  1 
ATOM   6132 C C   . GLU B 1 320 ? 12.702  -19.290 -54.781 1.00 43.53  ? 1803 GLU B C   1 
ATOM   6133 O O   . GLU B 1 320 ? 12.329  -18.148 -55.034 1.00 41.16  ? 1803 GLU B O   1 
ATOM   6134 C CB  . GLU B 1 320 ? 11.553  -20.785 -53.125 1.00 43.43  ? 1803 GLU B CB  1 
ATOM   6135 C CG  . GLU B 1 320 ? 11.325  -19.616 -52.177 1.00 45.48  ? 1803 GLU B CG  1 
ATOM   6136 C CD  . GLU B 1 320 ? 10.795  -20.075 -50.816 1.00 45.56  ? 1803 GLU B CD  1 
ATOM   6137 O OE1 . GLU B 1 320 ? 11.236  -21.128 -50.306 1.00 44.59  ? 1803 GLU B OE1 1 
ATOM   6138 O OE2 . GLU B 1 320 ? 9.934   -19.381 -50.251 1.00 47.07  ? 1803 GLU B OE2 1 
ATOM   6139 N N   . PHE B 1 321 ? 13.986  -19.607 -54.658 1.00 42.70  ? 1804 PHE B N   1 
ATOM   6140 C CA  . PHE B 1 321 ? 15.022  -18.603 -54.819 1.00 43.59  ? 1804 PHE B CA  1 
ATOM   6141 C C   . PHE B 1 321 ? 14.938  -18.040 -56.231 1.00 44.68  ? 1804 PHE B C   1 
ATOM   6142 O O   . PHE B 1 321 ? 15.100  -16.835 -56.454 1.00 44.81  ? 1804 PHE B O   1 
ATOM   6143 C CB  . PHE B 1 321 ? 16.402  -19.224 -54.585 1.00 44.21  ? 1804 PHE B CB  1 
ATOM   6144 C CG  . PHE B 1 321 ? 17.529  -18.235 -54.633 1.00 42.79  ? 1804 PHE B CG  1 
ATOM   6145 C CD1 . PHE B 1 321 ? 17.710  -17.322 -53.608 1.00 42.56  ? 1804 PHE B CD1 1 
ATOM   6146 C CD2 . PHE B 1 321 ? 18.414  -18.222 -55.707 1.00 44.13  ? 1804 PHE B CD2 1 
ATOM   6147 C CE1 . PHE B 1 321 ? 18.759  -16.405 -53.640 1.00 43.02  ? 1804 PHE B CE1 1 
ATOM   6148 C CE2 . PHE B 1 321 ? 19.473  -17.307 -55.749 1.00 43.97  ? 1804 PHE B CE2 1 
ATOM   6149 C CZ  . PHE B 1 321 ? 19.642  -16.399 -54.710 1.00 42.97  ? 1804 PHE B CZ  1 
ATOM   6150 N N   . ALA B 1 322 ? 14.684  -18.923 -57.188 1.00 45.26  ? 1805 ALA B N   1 
ATOM   6151 C CA  . ALA B 1 322 ? 14.555  -18.517 -58.579 1.00 46.22  ? 1805 ALA B CA  1 
ATOM   6152 C C   . ALA B 1 322 ? 13.395  -17.525 -58.714 1.00 46.73  ? 1805 ALA B C   1 
ATOM   6153 O O   . ALA B 1 322 ? 13.474  -16.571 -59.490 1.00 47.77  ? 1805 ALA B O   1 
ATOM   6154 C CB  . ALA B 1 322 ? 14.307  -19.735 -59.456 1.00 45.39  ? 1805 ALA B CB  1 
ATOM   6155 N N   . PHE B 1 323 ? 12.322  -17.753 -57.959 1.00 45.49  ? 1806 PHE B N   1 
ATOM   6156 C CA  . PHE B 1 323 ? 11.169  -16.863 -57.991 1.00 44.70  ? 1806 PHE B CA  1 
ATOM   6157 C C   . PHE B 1 323 ? 11.527  -15.492 -57.434 1.00 44.10  ? 1806 PHE B C   1 
ATOM   6158 O O   . PHE B 1 323 ? 11.146  -14.465 -57.996 1.00 45.04  ? 1806 PHE B O   1 
ATOM   6159 C CB  . PHE B 1 323 ? 10.012  -17.439 -57.169 1.00 44.26  ? 1806 PHE B CB  1 
ATOM   6160 C CG  . PHE B 1 323 ? 8.959   -18.084 -57.994 1.00 44.11  ? 1806 PHE B CG  1 
ATOM   6161 C CD1 . PHE B 1 323 ? 8.917   -19.461 -58.140 1.00 45.26  ? 1806 PHE B CD1 1 
ATOM   6162 C CD2 . PHE B 1 323 ? 8.039   -17.308 -58.673 1.00 44.87  ? 1806 PHE B CD2 1 
ATOM   6163 C CE1 . PHE B 1 323 ? 7.979   -20.063 -58.952 1.00 46.38  ? 1806 PHE B CE1 1 
ATOM   6164 C CE2 . PHE B 1 323 ? 7.093   -17.889 -59.493 1.00 46.48  ? 1806 PHE B CE2 1 
ATOM   6165 C CZ  . PHE B 1 323 ? 7.059   -19.277 -59.637 1.00 48.25  ? 1806 PHE B CZ  1 
ATOM   6166 N N   . MET B 1 324 ? 12.245  -15.479 -56.319 1.00 42.97  ? 1807 MET B N   1 
ATOM   6167 C CA  . MET B 1 324 ? 12.642  -14.234 -55.691 1.00 43.93  ? 1807 MET B CA  1 
ATOM   6168 C C   . MET B 1 324 ? 13.511  -13.420 -56.643 1.00 44.25  ? 1807 MET B C   1 
ATOM   6169 O O   . MET B 1 324 ? 13.432  -12.185 -56.683 1.00 43.17  ? 1807 MET B O   1 
ATOM   6170 C CB  . MET B 1 324 ? 13.405  -14.527 -54.401 1.00 45.99  ? 1807 MET B CB  1 
ATOM   6171 C CG  . MET B 1 324 ? 12.559  -15.162 -53.316 1.00 48.39  ? 1807 MET B CG  1 
ATOM   6172 S SD  . MET B 1 324 ? 13.597  -15.885 -52.036 1.00 54.50  ? 1807 MET B SD  1 
ATOM   6173 C CE  . MET B 1 324 ? 14.072  -14.435 -51.069 1.00 54.16  ? 1807 MET B CE  1 
ATOM   6174 N N   . PHE B 1 325 ? 14.333  -14.127 -57.412 1.00 43.75  ? 1808 PHE B N   1 
ATOM   6175 C CA  . PHE B 1 325 ? 15.226  -13.493 -58.370 1.00 42.89  ? 1808 PHE B CA  1 
ATOM   6176 C C   . PHE B 1 325 ? 14.427  -12.789 -59.476 1.00 41.70  ? 1808 PHE B C   1 
ATOM   6177 O O   . PHE B 1 325 ? 14.576  -11.577 -59.681 1.00 40.98  ? 1808 PHE B O   1 
ATOM   6178 C CB  . PHE B 1 325 ? 16.174  -14.554 -58.952 1.00 43.16  ? 1808 PHE B CB  1 
ATOM   6179 C CG  . PHE B 1 325 ? 17.044  -14.058 -60.077 1.00 43.66  ? 1808 PHE B CG  1 
ATOM   6180 C CD1 . PHE B 1 325 ? 17.899  -12.976 -59.895 1.00 42.62  ? 1808 PHE B CD1 1 
ATOM   6181 C CD2 . PHE B 1 325 ? 17.002  -14.679 -61.331 1.00 43.18  ? 1808 PHE B CD2 1 
ATOM   6182 C CE1 . PHE B 1 325 ? 18.698  -12.521 -60.952 1.00 43.30  ? 1808 PHE B CE1 1 
ATOM   6183 C CE2 . PHE B 1 325 ? 17.801  -14.227 -62.396 1.00 43.06  ? 1808 PHE B CE2 1 
ATOM   6184 C CZ  . PHE B 1 325 ? 18.648  -13.147 -62.202 1.00 42.09  ? 1808 PHE B CZ  1 
ATOM   6185 N N   . GLU B 1 326 ? 13.580  -13.534 -60.181 1.00 40.12  ? 1809 GLU B N   1 
ATOM   6186 C CA  . GLU B 1 326 ? 12.779  -12.942 -61.252 1.00 40.84  ? 1809 GLU B CA  1 
ATOM   6187 C C   . GLU B 1 326 ? 11.920  -11.786 -60.741 1.00 41.32  ? 1809 GLU B C   1 
ATOM   6188 O O   . GLU B 1 326 ? 11.781  -10.750 -61.418 1.00 41.23  ? 1809 GLU B O   1 
ATOM   6189 C CB  . GLU B 1 326 ? 11.857  -13.983 -61.888 1.00 41.50  ? 1809 GLU B CB  1 
ATOM   6190 C CG  . GLU B 1 326 ? 12.541  -15.044 -62.743 1.00 42.21  ? 1809 GLU B CG  1 
ATOM   6191 C CD  . GLU B 1 326 ? 13.426  -14.446 -63.801 1.00 43.74  ? 1809 GLU B CD  1 
ATOM   6192 O OE1 . GLU B 1 326 ? 13.074  -13.351 -64.300 1.00 46.43  ? 1809 GLU B OE1 1 
ATOM   6193 O OE2 . GLU B 1 326 ? 14.460  -15.073 -64.136 1.00 42.34  ? 1809 GLU B OE2 1 
ATOM   6194 N N   . GLN B 1 327 ? 11.335  -11.968 -59.555 1.00 39.81  ? 1810 GLN B N   1 
ATOM   6195 C CA  . GLN B 1 327 ? 10.496  -10.935 -58.976 1.00 39.28  ? 1810 GLN B CA  1 
ATOM   6196 C C   . GLN B 1 327 ? 11.344  -9.714  -58.597 1.00 40.06  ? 1810 GLN B C   1 
ATOM   6197 O O   . GLN B 1 327 ? 10.946  -8.563  -58.835 1.00 38.69  ? 1810 GLN B O   1 
ATOM   6198 C CB  . GLN B 1 327 ? 9.736   -11.473 -57.753 1.00 36.13  ? 1810 GLN B CB  1 
ATOM   6199 C CG  . GLN B 1 327 ? 8.465   -10.669 -57.432 1.00 34.85  ? 1810 GLN B CG  1 
ATOM   6200 C CD  . GLN B 1 327 ? 7.567   -11.338 -56.398 1.00 35.56  ? 1810 GLN B CD  1 
ATOM   6201 O OE1 . GLN B 1 327 ? 7.430   -12.560 -56.375 1.00 35.60  ? 1810 GLN B OE1 1 
ATOM   6202 N NE2 . GLN B 1 327 ? 6.932   -10.535 -55.553 1.00 36.19  ? 1810 GLN B NE2 1 
ATOM   6203 N N   . ALA B 1 328 ? 12.517  -9.969  -58.020 1.00 40.06  ? 1811 ALA B N   1 
ATOM   6204 C CA  . ALA B 1 328 ? 13.397  -8.882  -57.631 1.00 40.12  ? 1811 ALA B CA  1 
ATOM   6205 C C   . ALA B 1 328 ? 13.748  -8.080  -58.882 1.00 40.97  ? 1811 ALA B C   1 
ATOM   6206 O O   . ALA B 1 328 ? 13.564  -6.859  -58.923 1.00 40.86  ? 1811 ALA B O   1 
ATOM   6207 C CB  . ALA B 1 328 ? 14.645  -9.428  -56.966 1.00 39.00  ? 1811 ALA B CB  1 
ATOM   6208 N N   . HIS B 1 329 ? 14.233  -8.763  -59.918 1.00 41.73  ? 1812 HIS B N   1 
ATOM   6209 C CA  . HIS B 1 329 ? 14.588  -8.058  -61.146 1.00 42.09  ? 1812 HIS B CA  1 
ATOM   6210 C C   . HIS B 1 329 ? 13.425  -7.204  -61.665 1.00 42.58  ? 1812 HIS B C   1 
ATOM   6211 O O   . HIS B 1 329 ? 13.632  -6.043  -62.027 1.00 43.26  ? 1812 HIS B O   1 
ATOM   6212 C CB  . HIS B 1 329 ? 15.035  -9.040  -62.232 1.00 40.56  ? 1812 HIS B CB  1 
ATOM   6213 C CG  . HIS B 1 329 ? 15.397  -8.370  -63.522 1.00 40.37  ? 1812 HIS B CG  1 
ATOM   6214 N ND1 . HIS B 1 329 ? 16.398  -7.424  -63.613 1.00 38.75  ? 1812 HIS B ND1 1 
ATOM   6215 C CD2 . HIS B 1 329 ? 14.849  -8.458  -64.756 1.00 37.65  ? 1812 HIS B CD2 1 
ATOM   6216 C CE1 . HIS B 1 329 ? 16.446  -6.956  -64.846 1.00 38.03  ? 1812 HIS B CE1 1 
ATOM   6217 N NE2 . HIS B 1 329 ? 15.517  -7.566  -65.560 1.00 38.10  ? 1812 HIS B NE2 1 
ATOM   6218 N N   . GLU B 1 330 ? 12.221  -7.781  -61.717 1.00 42.00  ? 1813 GLU B N   1 
ATOM   6219 C CA  . GLU B 1 330 ? 11.026  -7.055  -62.162 1.00 43.46  ? 1813 GLU B CA  1 
ATOM   6220 C C   . GLU B 1 330 ? 10.860  -5.751  -61.383 1.00 42.96  ? 1813 GLU B C   1 
ATOM   6221 O O   . GLU B 1 330 ? 10.611  -4.680  -61.958 1.00 41.00  ? 1813 GLU B O   1 
ATOM   6222 C CB  . GLU B 1 330 ? 9.766   -7.899  -61.944 1.00 45.64  ? 1813 GLU B CB  1 
ATOM   6223 C CG  . GLU B 1 330 ? 9.211   -8.538  -63.192 1.00 50.02  ? 1813 GLU B CG  1 
ATOM   6224 C CD  . GLU B 1 330 ? 8.531   -7.544  -64.104 1.00 52.93  ? 1813 GLU B CD  1 
ATOM   6225 O OE1 . GLU B 1 330 ? 7.438   -7.044  -63.723 1.00 54.76  ? 1813 GLU B OE1 1 
ATOM   6226 O OE2 . GLU B 1 330 ? 9.097   -7.272  -65.191 1.00 51.52  ? 1813 GLU B OE2 1 
ATOM   6227 N N   . ALA B 1 331 ? 10.992  -5.860  -60.064 1.00 42.03  ? 1814 ALA B N   1 
ATOM   6228 C CA  . ALA B 1 331 ? 10.858  -4.709  -59.196 1.00 43.43  ? 1814 ALA B CA  1 
ATOM   6229 C C   . ALA B 1 331 ? 11.950  -3.689  -59.496 1.00 44.09  ? 1814 ALA B C   1 
ATOM   6230 O O   . ALA B 1 331 ? 11.723  -2.478  -59.402 1.00 43.92  ? 1814 ALA B O   1 
ATOM   6231 C CB  . ALA B 1 331 ? 10.920  -5.160  -57.732 1.00 43.04  ? 1814 ALA B CB  1 
ATOM   6232 N N   . VAL B 1 332 ? 13.129  -4.183  -59.873 1.00 45.04  ? 1815 VAL B N   1 
ATOM   6233 C CA  . VAL B 1 332 ? 14.264  -3.323  -60.183 1.00 46.07  ? 1815 VAL B CA  1 
ATOM   6234 C C   . VAL B 1 332 ? 14.019  -2.493  -61.424 1.00 47.26  ? 1815 VAL B C   1 
ATOM   6235 O O   . VAL B 1 332 ? 14.040  -1.268  -61.368 1.00 48.18  ? 1815 VAL B O   1 
ATOM   6236 C CB  . VAL B 1 332 ? 15.553  -4.148  -60.392 1.00 47.03  ? 1815 VAL B CB  1 
ATOM   6237 C CG1 . VAL B 1 332 ? 16.686  -3.246  -60.894 1.00 45.55  ? 1815 VAL B CG1 1 
ATOM   6238 C CG2 . VAL B 1 332 ? 15.942  -4.823  -59.088 1.00 45.65  ? 1815 VAL B CG2 1 
ATOM   6239 N N   . ILE B 1 333 ? 13.781  -3.158  -62.545 1.00 48.36  ? 1816 ILE B N   1 
ATOM   6240 C CA  . ILE B 1 333 ? 13.540  -2.446  -63.794 1.00 49.90  ? 1816 ILE B CA  1 
ATOM   6241 C C   . ILE B 1 333 ? 12.273  -1.576  -63.781 1.00 51.18  ? 1816 ILE B C   1 
ATOM   6242 O O   . ILE B 1 333 ? 11.995  -0.870  -64.747 1.00 51.18  ? 1816 ILE B O   1 
ATOM   6243 C CB  . ILE B 1 333 ? 13.467  -3.421  -64.981 1.00 47.81  ? 1816 ILE B CB  1 
ATOM   6244 C CG1 . ILE B 1 333 ? 12.282  -4.364  -64.801 1.00 45.51  ? 1816 ILE B CG1 1 
ATOM   6245 C CG2 . ILE B 1 333 ? 14.792  -4.176  -65.103 1.00 46.46  ? 1816 ILE B CG2 1 
ATOM   6246 C CD1 . ILE B 1 333 ? 12.133  -5.363  -65.902 1.00 43.97  ? 1816 ILE B CD1 1 
ATOM   6247 N N   . HIS B 1 334 ? 11.502  -1.638  -62.699 1.00 52.00  ? 1817 HIS B N   1 
ATOM   6248 C CA  . HIS B 1 334 ? 10.305  -0.810  -62.594 1.00 53.78  ? 1817 HIS B CA  1 
ATOM   6249 C C   . HIS B 1 334 ? 10.483  0.316   -61.577 1.00 53.75  ? 1817 HIS B C   1 
ATOM   6250 O O   . HIS B 1 334 ? 9.532   1.027   -61.264 1.00 53.72  ? 1817 HIS B O   1 
ATOM   6251 C CB  . HIS B 1 334 ? 9.074   -1.649  -62.223 1.00 54.96  ? 1817 HIS B CB  1 
ATOM   6252 C CG  . HIS B 1 334 ? 8.503   -2.426  -63.370 1.00 57.26  ? 1817 HIS B CG  1 
ATOM   6253 N ND1 . HIS B 1 334 ? 7.215   -2.920  -63.366 1.00 58.25  ? 1817 HIS B ND1 1 
ATOM   6254 C CD2 . HIS B 1 334 ? 9.045   -2.799  -64.554 1.00 57.39  ? 1817 HIS B CD2 1 
ATOM   6255 C CE1 . HIS B 1 334 ? 6.989   -3.564  -64.498 1.00 57.83  ? 1817 HIS B CE1 1 
ATOM   6256 N NE2 . HIS B 1 334 ? 8.083   -3.505  -65.235 1.00 58.52  ? 1817 HIS B NE2 1 
ATOM   6257 N N   . GLY B 1 335 ? 11.696  0.468   -61.055 1.00 54.16  ? 1818 GLY B N   1 
ATOM   6258 C CA  . GLY B 1 335 ? 11.959  1.530   -60.097 1.00 55.43  ? 1818 GLY B CA  1 
ATOM   6259 C C   . GLY B 1 335 ? 11.574  1.244   -58.655 1.00 56.95  ? 1818 GLY B C   1 
ATOM   6260 O O   . GLY B 1 335 ? 11.631  2.138   -57.820 1.00 56.41  ? 1818 GLY B O   1 
ATOM   6261 N N   . HIS B 1 336 ? 11.177  0.008   -58.359 1.00 58.68  ? 1819 HIS B N   1 
ATOM   6262 C CA  . HIS B 1 336 ? 10.802  -0.375  -57.000 1.00 60.49  ? 1819 HIS B CA  1 
ATOM   6263 C C   . HIS B 1 336 ? 11.954  -0.950  -56.186 1.00 60.30  ? 1819 HIS B C   1 
ATOM   6264 O O   . HIS B 1 336 ? 11.749  -1.796  -55.315 1.00 60.23  ? 1819 HIS B O   1 
ATOM   6265 C CB  . HIS B 1 336 ? 9.656   -1.384  -57.012 1.00 63.76  ? 1819 HIS B CB  1 
ATOM   6266 C CG  . HIS B 1 336 ? 8.313   -0.763  -57.209 1.00 67.56  ? 1819 HIS B CG  1 
ATOM   6267 N ND1 . HIS B 1 336 ? 7.930   -0.173  -58.395 1.00 69.90  ? 1819 HIS B ND1 1 
ATOM   6268 C CD2 . HIS B 1 336 ? 7.267   -0.618  -56.362 1.00 69.29  ? 1819 HIS B CD2 1 
ATOM   6269 C CE1 . HIS B 1 336 ? 6.706   0.307   -58.271 1.00 71.01  ? 1819 HIS B CE1 1 
ATOM   6270 N NE2 . HIS B 1 336 ? 6.280   0.050   -57.047 1.00 71.48  ? 1819 HIS B NE2 1 
ATOM   6271 N N   . HIS B 1 337 ? 13.165  -0.506  -56.493 1.00 60.66  ? 1820 HIS B N   1 
ATOM   6272 C CA  . HIS B 1 337 ? 14.351  -0.932  -55.762 1.00 61.50  ? 1820 HIS B CA  1 
ATOM   6273 C C   . HIS B 1 337 ? 15.286  0.278   -55.645 1.00 63.25  ? 1820 HIS B C   1 
ATOM   6274 O O   . HIS B 1 337 ? 16.106  0.536   -56.522 1.00 62.51  ? 1820 HIS B O   1 
ATOM   6275 C CB  . HIS B 1 337 ? 15.064  -2.087  -56.477 1.00 58.93  ? 1820 HIS B CB  1 
ATOM   6276 C CG  . HIS B 1 337 ? 16.245  -2.619  -55.723 1.00 56.45  ? 1820 HIS B CG  1 
ATOM   6277 N ND1 . HIS B 1 337 ? 16.120  -3.343  -54.556 1.00 56.05  ? 1820 HIS B ND1 1 
ATOM   6278 C CD2 . HIS B 1 337 ? 17.572  -2.501  -55.950 1.00 54.60  ? 1820 HIS B CD2 1 
ATOM   6279 C CE1 . HIS B 1 337 ? 17.320  -3.648  -54.097 1.00 53.79  ? 1820 HIS B CE1 1 
ATOM   6280 N NE2 . HIS B 1 337 ? 18.218  -3.148  -54.925 1.00 55.12  ? 1820 HIS B NE2 1 
ATOM   6281 N N   . PRO B 1 338 ? 15.161  1.041   -54.549 1.00 65.43  ? 1821 PRO B N   1 
ATOM   6282 C CA  . PRO B 1 338 ? 15.992  2.227   -54.320 1.00 66.70  ? 1821 PRO B CA  1 
ATOM   6283 C C   . PRO B 1 338 ? 17.439  1.863   -54.006 1.00 67.63  ? 1821 PRO B C   1 
ATOM   6284 O O   . PRO B 1 338 ? 17.751  1.409   -52.897 1.00 68.75  ? 1821 PRO B O   1 
ATOM   6285 C CB  . PRO B 1 338 ? 15.302  2.899   -53.143 1.00 66.75  ? 1821 PRO B CB  1 
ATOM   6286 C CG  . PRO B 1 338 ? 14.858  1.709   -52.331 1.00 67.13  ? 1821 PRO B CG  1 
ATOM   6287 C CD  . PRO B 1 338 ? 14.283  0.784   -53.390 1.00 66.69  ? 1821 PRO B CD  1 
ATOM   6288 N N   . ALA B 1 339 ? 18.318  2.063   -54.984 1.00 66.90  ? 1822 ALA B N   1 
ATOM   6289 C CA  . ALA B 1 339 ? 19.732  1.766   -54.808 1.00 65.91  ? 1822 ALA B CA  1 
ATOM   6290 C C   . ALA B 1 339 ? 20.552  2.753   -55.625 1.00 65.71  ? 1822 ALA B C   1 
ATOM   6291 O O   . ALA B 1 339 ? 20.067  3.309   -56.609 1.00 65.00  ? 1822 ALA B O   1 
ATOM   6292 C CB  . ALA B 1 339 ? 20.023  0.339   -55.253 1.00 65.11  ? 1822 ALA B CB  1 
ATOM   6293 N N   . PRO B 1 340 ? 21.806  2.999   -55.216 1.00 66.35  ? 1823 PRO B N   1 
ATOM   6294 C CA  . PRO B 1 340 ? 22.673  3.930   -55.938 1.00 67.36  ? 1823 PRO B CA  1 
ATOM   6295 C C   . PRO B 1 340 ? 22.948  3.493   -57.375 1.00 68.99  ? 1823 PRO B C   1 
ATOM   6296 O O   . PRO B 1 340 ? 23.166  2.315   -57.649 1.00 69.79  ? 1823 PRO B O   1 
ATOM   6297 C CB  . PRO B 1 340 ? 23.937  3.949   -55.089 1.00 66.95  ? 1823 PRO B CB  1 
ATOM   6298 C CG  . PRO B 1 340 ? 23.951  2.580   -54.480 1.00 67.26  ? 1823 PRO B CG  1 
ATOM   6299 C CD  . PRO B 1 340 ? 22.514  2.408   -54.070 1.00 66.12  ? 1823 PRO B CD  1 
ATOM   6300 N N   . GLU B 1 341 ? 22.921  4.460   -58.285 1.00 70.05  ? 1824 GLU B N   1 
ATOM   6301 C CA  . GLU B 1 341 ? 23.176  4.230   -59.702 1.00 70.42  ? 1824 GLU B CA  1 
ATOM   6302 C C   . GLU B 1 341 ? 24.106  3.039   -59.928 1.00 70.41  ? 1824 GLU B C   1 
ATOM   6303 O O   . GLU B 1 341 ? 23.747  2.073   -60.601 1.00 70.99  ? 1824 GLU B O   1 
ATOM   6304 C CB  . GLU B 1 341 ? 23.798  5.492   -60.303 1.00 70.98  ? 1824 GLU B CB  1 
ATOM   6305 C CG  . GLU B 1 341 ? 23.941  5.465   -61.802 1.00 71.82  ? 1824 GLU B CG  1 
ATOM   6306 C CD  . GLU B 1 341 ? 22.647  5.096   -62.480 1.00 71.98  ? 1824 GLU B CD  1 
ATOM   6307 O OE1 . GLU B 1 341 ? 21.578  5.542   -62.010 1.00 72.45  ? 1824 GLU B OE1 1 
ATOM   6308 O OE2 . GLU B 1 341 ? 22.701  4.365   -63.488 1.00 73.11  ? 1824 GLU B OE2 1 
ATOM   6309 N N   . GLU B 1 342 ? 25.303  3.122   -59.358 1.00 70.35  ? 1825 GLU B N   1 
ATOM   6310 C CA  . GLU B 1 342 ? 26.304  2.065   -59.469 1.00 69.55  ? 1825 GLU B CA  1 
ATOM   6311 C C   . GLU B 1 342 ? 25.650  0.695   -59.345 1.00 67.23  ? 1825 GLU B C   1 
ATOM   6312 O O   . GLU B 1 342 ? 25.781  -0.149  -60.228 1.00 67.02  ? 1825 GLU B O   1 
ATOM   6313 C CB  . GLU B 1 342 ? 27.359  2.240   -58.367 1.00 72.58  ? 1825 GLU B CB  1 
ATOM   6314 C CG  . GLU B 1 342 ? 28.422  1.139   -58.277 1.00 76.28  ? 1825 GLU B CG  1 
ATOM   6315 C CD  . GLU B 1 342 ? 29.340  1.094   -59.490 1.00 78.58  ? 1825 GLU B CD  1 
ATOM   6316 O OE1 . GLU B 1 342 ? 29.702  2.178   -60.005 1.00 79.67  ? 1825 GLU B OE1 1 
ATOM   6317 O OE2 . GLU B 1 342 ? 29.709  -0.025  -59.918 1.00 79.61  ? 1825 GLU B OE2 1 
ATOM   6318 N N   . ASN B 1 343 ? 24.945  0.488   -58.239 1.00 64.24  ? 1826 ASN B N   1 
ATOM   6319 C CA  . ASN B 1 343 ? 24.266  -0.771  -57.968 1.00 62.17  ? 1826 ASN B CA  1 
ATOM   6320 C C   . ASN B 1 343 ? 23.332  -1.230  -59.097 1.00 60.34  ? 1826 ASN B C   1 
ATOM   6321 O O   . ASN B 1 343 ? 23.336  -2.399  -59.479 1.00 59.84  ? 1826 ASN B O   1 
ATOM   6322 C CB  . ASN B 1 343 ? 23.470  -0.654  -56.663 1.00 63.04  ? 1826 ASN B CB  1 
ATOM   6323 C CG  . ASN B 1 343 ? 24.260  -1.095  -55.447 1.00 63.56  ? 1826 ASN B CG  1 
ATOM   6324 O OD1 . ASN B 1 343 ? 25.405  -0.692  -55.252 1.00 63.54  ? 1826 ASN B OD1 1 
ATOM   6325 N ND2 . ASN B 1 343 ? 23.635  -1.921  -54.608 1.00 64.70  ? 1826 ASN B ND2 1 
ATOM   6326 N N   . LEU B 1 344 ? 22.532  -0.317  -59.634 1.00 57.62  ? 1827 LEU B N   1 
ATOM   6327 C CA  . LEU B 1 344 ? 21.605  -0.687  -60.691 1.00 54.85  ? 1827 LEU B CA  1 
ATOM   6328 C C   . LEU B 1 344 ? 22.280  -1.158  -61.968 1.00 53.69  ? 1827 LEU B C   1 
ATOM   6329 O O   . LEU B 1 344 ? 21.803  -2.079  -62.627 1.00 54.33  ? 1827 LEU B O   1 
ATOM   6330 C CB  . LEU B 1 344 ? 20.660  0.474   -61.000 1.00 53.96  ? 1827 LEU B CB  1 
ATOM   6331 C CG  . LEU B 1 344 ? 19.776  0.975   -59.853 1.00 52.65  ? 1827 LEU B CG  1 
ATOM   6332 C CD1 . LEU B 1 344 ? 18.713  1.863   -60.454 1.00 51.64  ? 1827 LEU B CD1 1 
ATOM   6333 C CD2 . LEU B 1 344 ? 19.127  -0.177  -59.087 1.00 49.38  ? 1827 LEU B CD2 1 
ATOM   6334 N N   . GLN B 1 345 ? 23.384  -0.527  -62.335 1.00 52.52  ? 1828 GLN B N   1 
ATOM   6335 C CA  . GLN B 1 345 ? 24.097  -0.933  -63.541 1.00 51.65  ? 1828 GLN B CA  1 
ATOM   6336 C C   . GLN B 1 345 ? 24.711  -2.321  -63.359 1.00 49.11  ? 1828 GLN B C   1 
ATOM   6337 O O   . GLN B 1 345 ? 24.688  -3.152  -64.266 1.00 48.51  ? 1828 GLN B O   1 
ATOM   6338 C CB  . GLN B 1 345 ? 25.184  0.087   -63.863 1.00 52.91  ? 1828 GLN B CB  1 
ATOM   6339 C CG  . GLN B 1 345 ? 24.638  1.389   -64.392 1.00 54.12  ? 1828 GLN B CG  1 
ATOM   6340 C CD  . GLN B 1 345 ? 25.631  2.512   -64.259 1.00 55.06  ? 1828 GLN B CD  1 
ATOM   6341 O OE1 . GLN B 1 345 ? 26.836  2.315   -64.409 1.00 54.37  ? 1828 GLN B OE1 1 
ATOM   6342 N NE2 . GLN B 1 345 ? 25.130  3.708   -63.987 1.00 56.24  ? 1828 GLN B NE2 1 
ATOM   6343 N N   . VAL B 1 346 ? 25.255  -2.567  -62.177 1.00 46.59  ? 1829 VAL B N   1 
ATOM   6344 C CA  . VAL B 1 346 ? 25.853  -3.860  -61.882 1.00 46.11  ? 1829 VAL B CA  1 
ATOM   6345 C C   . VAL B 1 346 ? 24.797  -4.942  -61.991 1.00 44.65  ? 1829 VAL B C   1 
ATOM   6346 O O   . VAL B 1 346 ? 25.035  -6.000  -62.577 1.00 43.59  ? 1829 VAL B O   1 
ATOM   6347 C CB  . VAL B 1 346 ? 26.450  -3.892  -60.464 1.00 46.46  ? 1829 VAL B CB  1 
ATOM   6348 C CG1 . VAL B 1 346 ? 26.985  -5.287  -60.151 1.00 46.01  ? 1829 VAL B CG1 1 
ATOM   6349 C CG2 . VAL B 1 346 ? 27.547  -2.865  -60.357 1.00 44.49  ? 1829 VAL B CG2 1 
ATOM   6350 N N   . LEU B 1 347 ? 23.626  -4.665  -61.422 1.00 44.55  ? 1830 LEU B N   1 
ATOM   6351 C CA  . LEU B 1 347 ? 22.509  -5.605  -61.467 1.00 43.45  ? 1830 LEU B CA  1 
ATOM   6352 C C   . LEU B 1 347 ? 22.075  -5.859  -62.907 1.00 43.01  ? 1830 LEU B C   1 
ATOM   6353 O O   . LEU B 1 347 ? 21.651  -6.965  -63.247 1.00 43.80  ? 1830 LEU B O   1 
ATOM   6354 C CB  . LEU B 1 347 ? 21.325  -5.078  -60.647 1.00 41.72  ? 1830 LEU B CB  1 
ATOM   6355 C CG  . LEU B 1 347 ? 21.484  -5.131  -59.122 1.00 42.53  ? 1830 LEU B CG  1 
ATOM   6356 C CD1 . LEU B 1 347 ? 20.357  -4.342  -58.466 1.00 41.08  ? 1830 LEU B CD1 1 
ATOM   6357 C CD2 . LEU B 1 347 ? 21.496  -6.590  -58.640 1.00 41.99  ? 1830 LEU B CD2 1 
ATOM   6358 N N   . ALA B 1 348 ? 22.188  -4.838  -63.754 1.00 42.26  ? 1831 ALA B N   1 
ATOM   6359 C CA  . ALA B 1 348 ? 21.799  -4.976  -65.151 1.00 41.92  ? 1831 ALA B CA  1 
ATOM   6360 C C   . ALA B 1 348 ? 22.784  -5.927  -65.822 1.00 41.55  ? 1831 ALA B C   1 
ATOM   6361 O O   . ALA B 1 348 ? 22.403  -6.819  -66.590 1.00 40.78  ? 1831 ALA B O   1 
ATOM   6362 C CB  . ALA B 1 348 ? 21.822  -3.616  -65.833 1.00 41.01  ? 1831 ALA B CB  1 
ATOM   6363 N N   . ALA B 1 349 ? 24.057  -5.738  -65.502 1.00 41.24  ? 1832 ALA B N   1 
ATOM   6364 C CA  . ALA B 1 349 ? 25.101  -6.563  -66.070 1.00 40.86  ? 1832 ALA B CA  1 
ATOM   6365 C C   . ALA B 1 349 ? 24.979  -8.022  -65.603 1.00 41.30  ? 1832 ALA B C   1 
ATOM   6366 O O   . ALA B 1 349 ? 25.257  -8.946  -66.365 1.00 42.31  ? 1832 ALA B O   1 
ATOM   6367 C CB  . ALA B 1 349 ? 26.453  -5.989  -65.710 1.00 40.73  ? 1832 ALA B CB  1 
ATOM   6368 N N   . LEU B 1 350 ? 24.559  -8.240  -64.361 1.00 40.31  ? 1833 LEU B N   1 
ATOM   6369 C CA  . LEU B 1 350 ? 24.419  -9.607  -63.875 1.00 39.19  ? 1833 LEU B CA  1 
ATOM   6370 C C   . LEU B 1 350 ? 23.274  -10.313 -64.607 1.00 38.39  ? 1833 LEU B C   1 
ATOM   6371 O O   . LEU B 1 350 ? 23.402  -11.475 -65.008 1.00 35.81  ? 1833 LEU B O   1 
ATOM   6372 C CB  . LEU B 1 350 ? 24.175  -9.626  -62.360 1.00 40.50  ? 1833 LEU B CB  1 
ATOM   6373 C CG  . LEU B 1 350 ? 25.333  -9.191  -61.455 1.00 40.71  ? 1833 LEU B CG  1 
ATOM   6374 C CD1 . LEU B 1 350 ? 24.904  -9.261  -60.001 1.00 41.37  ? 1833 LEU B CD1 1 
ATOM   6375 C CD2 . LEU B 1 350 ? 26.528  -10.096 -61.675 1.00 42.38  ? 1833 LEU B CD2 1 
ATOM   6376 N N   . ARG B 1 351 ? 22.163  -9.599  -64.783 1.00 38.41  ? 1834 ARG B N   1 
ATOM   6377 C CA  . ARG B 1 351 ? 20.986  -10.132 -65.472 1.00 38.10  ? 1834 ARG B CA  1 
ATOM   6378 C C   . ARG B 1 351 ? 21.439  -10.501 -66.872 1.00 37.47  ? 1834 ARG B C   1 
ATOM   6379 O O   . ARG B 1 351 ? 21.100  -11.557 -67.391 1.00 38.30  ? 1834 ARG B O   1 
ATOM   6380 C CB  . ARG B 1 351 ? 19.876  -9.071  -65.532 1.00 39.40  ? 1834 ARG B CB  1 
ATOM   6381 C CG  . ARG B 1 351 ? 18.591  -9.505  -66.253 1.00 38.14  ? 1834 ARG B CG  1 
ATOM   6382 C CD  . ARG B 1 351 ? 17.824  -10.540 -65.473 1.00 38.98  ? 1834 ARG B CD  1 
ATOM   6383 N NE  . ARG B 1 351 ? 16.584  -10.931 -66.139 1.00 40.18  ? 1834 ARG B NE  1 
ATOM   6384 C CZ  . ARG B 1 351 ? 15.733  -11.834 -65.660 1.00 39.20  ? 1834 ARG B CZ  1 
ATOM   6385 N NH1 . ARG B 1 351 ? 15.985  -12.434 -64.505 1.00 41.69  ? 1834 ARG B NH1 1 
ATOM   6386 N NH2 . ARG B 1 351 ? 14.643  -12.155 -66.341 1.00 38.16  ? 1834 ARG B NH2 1 
ATOM   6387 N N   . LEU B 1 352 ? 22.205  -9.612  -67.480 1.00 36.86  ? 1835 LEU B N   1 
ATOM   6388 C CA  . LEU B 1 352 ? 22.764  -9.864  -68.806 1.00 37.99  ? 1835 LEU B CA  1 
ATOM   6389 C C   . LEU B 1 352 ? 23.645  -11.139 -68.781 1.00 37.87  ? 1835 LEU B C   1 
ATOM   6390 O O   . LEU B 1 352 ? 23.549  -11.986 -69.670 1.00 38.45  ? 1835 LEU B O   1 
ATOM   6391 C CB  . LEU B 1 352 ? 23.610  -8.670  -69.228 1.00 35.89  ? 1835 LEU B CB  1 
ATOM   6392 C CG  . LEU B 1 352 ? 23.167  -7.874  -70.442 1.00 36.40  ? 1835 LEU B CG  1 
ATOM   6393 C CD1 . LEU B 1 352 ? 21.650  -7.763  -70.534 1.00 32.55  ? 1835 LEU B CD1 1 
ATOM   6394 C CD2 . LEU B 1 352 ? 23.847  -6.512  -70.345 1.00 34.85  ? 1835 LEU B CD2 1 
ATOM   6395 N N   . GLN B 1 353 ? 24.495  -11.264 -67.761 1.00 36.61  ? 1836 GLN B N   1 
ATOM   6396 C CA  . GLN B 1 353 ? 25.365  -12.432 -67.605 1.00 37.47  ? 1836 GLN B CA  1 
ATOM   6397 C C   . GLN B 1 353 ? 24.555  -13.727 -67.399 1.00 37.87  ? 1836 GLN B C   1 
ATOM   6398 O O   . GLN B 1 353 ? 24.967  -14.809 -67.816 1.00 37.53  ? 1836 GLN B O   1 
ATOM   6399 C CB  . GLN B 1 353 ? 26.308  -12.222 -66.409 1.00 36.54  ? 1836 GLN B CB  1 
ATOM   6400 C CG  . GLN B 1 353 ? 27.370  -13.289 -66.236 1.00 34.81  ? 1836 GLN B CG  1 
ATOM   6401 C CD  . GLN B 1 353 ? 28.184  -13.490 -67.500 1.00 36.97  ? 1836 GLN B CD  1 
ATOM   6402 O OE1 . GLN B 1 353 ? 28.545  -12.523 -68.180 1.00 37.09  ? 1836 GLN B OE1 1 
ATOM   6403 N NE2 . GLN B 1 353 ? 28.479  -14.744 -67.824 1.00 37.88  ? 1836 GLN B NE2 1 
ATOM   6404 N N   . TYR B 1 354 ? 23.409  -13.600 -66.740 1.00 37.68  ? 1837 TYR B N   1 
ATOM   6405 C CA  . TYR B 1 354 ? 22.532  -14.729 -66.472 1.00 37.83  ? 1837 TYR B CA  1 
ATOM   6406 C C   . TYR B 1 354 ? 21.652  -15.086 -67.662 1.00 37.59  ? 1837 TYR B C   1 
ATOM   6407 O O   . TYR B 1 354 ? 21.337  -16.260 -67.887 1.00 36.41  ? 1837 TYR B O   1 
ATOM   6408 C CB  . TYR B 1 354 ? 21.623  -14.414 -65.279 1.00 38.32  ? 1837 TYR B CB  1 
ATOM   6409 C CG  . TYR B 1 354 ? 20.469  -15.375 -65.118 1.00 36.49  ? 1837 TYR B CG  1 
ATOM   6410 C CD1 . TYR B 1 354 ? 20.618  -16.564 -64.415 1.00 36.83  ? 1837 TYR B CD1 1 
ATOM   6411 C CD2 . TYR B 1 354 ? 19.227  -15.092 -65.686 1.00 38.59  ? 1837 TYR B CD2 1 
ATOM   6412 C CE1 . TYR B 1 354 ? 19.564  -17.450 -64.275 1.00 39.29  ? 1837 TYR B CE1 1 
ATOM   6413 C CE2 . TYR B 1 354 ? 18.160  -15.970 -65.561 1.00 39.20  ? 1837 TYR B CE2 1 
ATOM   6414 C CZ  . TYR B 1 354 ? 18.333  -17.151 -64.854 1.00 41.18  ? 1837 TYR B CZ  1 
ATOM   6415 O OH  . TYR B 1 354 ? 17.286  -18.040 -64.749 1.00 41.44  ? 1837 TYR B OH  1 
ATOM   6416 N N   . LEU B 1 355 ? 21.245  -14.072 -68.416 1.00 38.05  ? 1838 LEU B N   1 
ATOM   6417 C CA  . LEU B 1 355 ? 20.367  -14.300 -69.559 1.00 38.82  ? 1838 LEU B CA  1 
ATOM   6418 C C   . LEU B 1 355 ? 21.036  -14.868 -70.793 1.00 40.15  ? 1838 LEU B C   1 
ATOM   6419 O O   . LEU B 1 355 ? 20.500  -15.783 -71.415 1.00 40.95  ? 1838 LEU B O   1 
ATOM   6420 C CB  . LEU B 1 355 ? 19.634  -13.009 -69.932 1.00 36.40  ? 1838 LEU B CB  1 
ATOM   6421 C CG  . LEU B 1 355 ? 18.525  -12.610 -68.959 1.00 32.79  ? 1838 LEU B CG  1 
ATOM   6422 C CD1 . LEU B 1 355 ? 17.952  -11.254 -69.333 1.00 30.78  ? 1838 LEU B CD1 1 
ATOM   6423 C CD2 . LEU B 1 355 ? 17.459  -13.682 -68.972 1.00 29.32  ? 1838 LEU B CD2 1 
ATOM   6424 N N   . GLN B 1 356 ? 22.210  -14.352 -71.142 1.00 41.65  ? 1839 GLN B N   1 
ATOM   6425 C CA  . GLN B 1 356 ? 22.891  -14.835 -72.341 1.00 42.98  ? 1839 GLN B CA  1 
ATOM   6426 C C   . GLN B 1 356 ? 24.366  -15.203 -72.199 1.00 42.52  ? 1839 GLN B C   1 
ATOM   6427 O O   . GLN B 1 356 ? 25.095  -15.241 -73.183 1.00 42.07  ? 1839 GLN B O   1 
ATOM   6428 C CB  . GLN B 1 356 ? 22.705  -13.819 -73.481 1.00 43.82  ? 1839 GLN B CB  1 
ATOM   6429 C CG  . GLN B 1 356 ? 23.121  -12.396 -73.160 1.00 45.04  ? 1839 GLN B CG  1 
ATOM   6430 C CD  . GLN B 1 356 ? 22.687  -11.438 -74.248 1.00 47.98  ? 1839 GLN B CD  1 
ATOM   6431 O OE1 . GLN B 1 356 ? 21.513  -11.075 -74.336 1.00 48.15  ? 1839 GLN B OE1 1 
ATOM   6432 N NE2 . GLN B 1 356 ? 23.627  -11.041 -75.107 1.00 51.08  ? 1839 GLN B NE2 1 
ATOM   6433 N N   . GLY B 1 357 ? 24.796  -15.491 -70.976 1.00 43.29  ? 1840 GLY B N   1 
ATOM   6434 C CA  . GLY B 1 357 ? 26.178  -15.878 -70.749 1.00 43.55  ? 1840 GLY B CA  1 
ATOM   6435 C C   . GLY B 1 357 ? 27.232  -14.790 -70.870 1.00 43.83  ? 1840 GLY B C   1 
ATOM   6436 O O   . GLY B 1 357 ? 26.988  -13.625 -70.563 1.00 42.98  ? 1840 GLY B O   1 
ATOM   6437 N N   . ASP B 1 358 ? 28.412  -15.183 -71.337 1.00 45.85  ? 1841 ASP B N   1 
ATOM   6438 C CA  . ASP B 1 358 ? 29.537  -14.268 -71.478 1.00 47.95  ? 1841 ASP B CA  1 
ATOM   6439 C C   . ASP B 1 358 ? 29.394  -13.214 -72.557 1.00 48.86  ? 1841 ASP B C   1 
ATOM   6440 O O   . ASP B 1 358 ? 28.857  -13.461 -73.635 1.00 50.85  ? 1841 ASP B O   1 
ATOM   6441 C CB  . ASP B 1 358 ? 30.836  -15.049 -71.725 1.00 48.42  ? 1841 ASP B CB  1 
ATOM   6442 C CG  . ASP B 1 358 ? 31.310  -15.808 -70.491 1.00 50.07  ? 1841 ASP B CG  1 
ATOM   6443 O OD1 . ASP B 1 358 ? 31.350  -15.193 -69.410 1.00 51.62  ? 1841 ASP B OD1 1 
ATOM   6444 O OD2 . ASP B 1 358 ? 31.653  -17.008 -70.599 1.00 52.04  ? 1841 ASP B OD2 1 
ATOM   6445 N N   . TYR B 1 359 ? 29.890  -12.027 -72.253 1.00 49.27  ? 1842 TYR B N   1 
ATOM   6446 C CA  . TYR B 1 359 ? 29.872  -10.929 -73.190 1.00 50.96  ? 1842 TYR B CA  1 
ATOM   6447 C C   . TYR B 1 359 ? 30.879  -11.191 -74.308 1.00 52.70  ? 1842 TYR B C   1 
ATOM   6448 O O   . TYR B 1 359 ? 31.902  -11.843 -74.094 1.00 53.14  ? 1842 TYR B O   1 
ATOM   6449 C CB  . TYR B 1 359 ? 30.232  -9.644  -72.458 1.00 50.53  ? 1842 TYR B CB  1 
ATOM   6450 C CG  . TYR B 1 359 ? 31.005  -8.644  -73.278 1.00 51.74  ? 1842 TYR B CG  1 
ATOM   6451 C CD1 . TYR B 1 359 ? 32.348  -8.866  -73.610 1.00 53.32  ? 1842 TYR B CD1 1 
ATOM   6452 C CD2 . TYR B 1 359 ? 30.412  -7.456  -73.691 1.00 51.70  ? 1842 TYR B CD2 1 
ATOM   6453 C CE1 . TYR B 1 359 ? 33.081  -7.923  -74.331 1.00 53.33  ? 1842 TYR B CE1 1 
ATOM   6454 C CE2 . TYR B 1 359 ? 31.131  -6.504  -74.409 1.00 53.40  ? 1842 TYR B CE2 1 
ATOM   6455 C CZ  . TYR B 1 359 ? 32.466  -6.737  -74.725 1.00 54.41  ? 1842 TYR B CZ  1 
ATOM   6456 O OH  . TYR B 1 359 ? 33.187  -5.770  -75.401 1.00 54.99  ? 1842 TYR B OH  1 
ATOM   6457 N N   . THR B 1 360 ? 30.579  -10.678 -75.498 1.00 54.15  ? 1843 THR B N   1 
ATOM   6458 C CA  . THR B 1 360 ? 31.455  -10.809 -76.657 1.00 54.74  ? 1843 THR B CA  1 
ATOM   6459 C C   . THR B 1 360 ? 31.420  -9.475  -77.400 1.00 56.70  ? 1843 THR B C   1 
ATOM   6460 O O   . THR B 1 360 ? 30.362  -8.860  -77.535 1.00 56.44  ? 1843 THR B O   1 
ATOM   6461 C CB  . THR B 1 360 ? 30.995  -11.943 -77.588 1.00 53.26  ? 1843 THR B CB  1 
ATOM   6462 O OG1 . THR B 1 360 ? 29.656  -11.697 -78.013 1.00 54.07  ? 1843 THR B OG1 1 
ATOM   6463 C CG2 . THR B 1 360 ? 31.043  -13.277 -76.872 1.00 51.44  ? 1843 THR B CG2 1 
ATOM   6464 N N   . LEU B 1 361 ? 32.585  -9.036  -77.877 1.00 59.37  ? 1844 LEU B N   1 
ATOM   6465 C CA  . LEU B 1 361 ? 32.739  -7.752  -78.571 1.00 60.94  ? 1844 LEU B CA  1 
ATOM   6466 C C   . LEU B 1 361 ? 31.560  -7.149  -79.338 1.00 60.75  ? 1844 LEU B C   1 
ATOM   6467 O O   . LEU B 1 361 ? 31.371  -5.930  -79.298 1.00 61.79  ? 1844 LEU B O   1 
ATOM   6468 C CB  . LEU B 1 361 ? 33.972  -7.786  -79.489 1.00 63.73  ? 1844 LEU B CB  1 
ATOM   6469 C CG  . LEU B 1 361 ? 35.199  -6.994  -78.988 1.00 65.91  ? 1844 LEU B CG  1 
ATOM   6470 C CD1 . LEU B 1 361 ? 36.401  -7.281  -79.875 1.00 67.82  ? 1844 LEU B CD1 1 
ATOM   6471 C CD2 . LEU B 1 361 ? 34.900  -5.490  -78.986 1.00 66.89  ? 1844 LEU B CD2 1 
ATOM   6472 N N   . HIS B 1 362 ? 30.768  -7.964  -80.030 1.00 59.51  ? 1845 HIS B N   1 
ATOM   6473 C CA  . HIS B 1 362 ? 29.637  -7.413  -80.778 1.00 58.80  ? 1845 HIS B CA  1 
ATOM   6474 C C   . HIS B 1 362 ? 28.308  -8.059  -80.405 1.00 58.25  ? 1845 HIS B C   1 
ATOM   6475 O O   . HIS B 1 362 ? 27.388  -8.142  -81.221 1.00 57.26  ? 1845 HIS B O   1 
ATOM   6476 C CB  . HIS B 1 362 ? 29.905  -7.558  -82.278 1.00 58.63  ? 1845 HIS B CB  1 
ATOM   6477 C CG  . HIS B 1 362 ? 31.227  -6.998  -82.693 1.00 58.51  ? 1845 HIS B CG  1 
ATOM   6478 N ND1 . HIS B 1 362 ? 31.511  -5.652  -82.638 1.00 59.23  ? 1845 HIS B ND1 1 
ATOM   6479 C CD2 . HIS B 1 362 ? 32.377  -7.610  -83.061 1.00 58.42  ? 1845 HIS B CD2 1 
ATOM   6480 C CE1 . HIS B 1 362 ? 32.781  -5.458  -82.946 1.00 59.23  ? 1845 HIS B CE1 1 
ATOM   6481 N NE2 . HIS B 1 362 ? 33.329  -6.631  -83.205 1.00 59.25  ? 1845 HIS B NE2 1 
ATOM   6482 N N   . ALA B 1 363 ? 28.207  -8.496  -79.157 1.00 58.41  ? 1846 ALA B N   1 
ATOM   6483 C CA  . ALA B 1 363 ? 26.998  -9.147  -78.682 1.00 58.20  ? 1846 ALA B CA  1 
ATOM   6484 C C   . ALA B 1 363 ? 25.796  -8.210  -78.665 1.00 58.03  ? 1846 ALA B C   1 
ATOM   6485 O O   . ALA B 1 363 ? 25.902  -7.029  -78.314 1.00 57.42  ? 1846 ALA B O   1 
ATOM   6486 C CB  . ALA B 1 363 ? 27.228  -9.723  -77.297 1.00 58.53  ? 1846 ALA B CB  1 
ATOM   6487 N N   . ALA B 1 364 ? 24.653  -8.751  -79.068 1.00 57.43  ? 1847 ALA B N   1 
ATOM   6488 C CA  . ALA B 1 364 ? 23.417  -7.994  -79.084 1.00 57.38  ? 1847 ALA B CA  1 
ATOM   6489 C C   . ALA B 1 364 ? 22.731  -8.218  -77.740 1.00 57.39  ? 1847 ALA B C   1 
ATOM   6490 O O   . ALA B 1 364 ? 22.694  -9.342  -77.217 1.00 55.22  ? 1847 ALA B O   1 
ATOM   6491 C CB  . ALA B 1 364 ? 22.515  -8.464  -80.226 1.00 56.56  ? 1847 ALA B CB  1 
ATOM   6492 N N   . ILE B 1 365 ? 22.211  -7.133  -77.181 1.00 57.71  ? 1848 ILE B N   1 
ATOM   6493 C CA  . ILE B 1 365 ? 21.522  -7.183  -75.902 1.00 58.35  ? 1848 ILE B CA  1 
ATOM   6494 C C   . ILE B 1 365 ? 20.065  -6.775  -76.072 1.00 57.78  ? 1848 ILE B C   1 
ATOM   6495 O O   . ILE B 1 365 ? 19.718  -6.023  -76.983 1.00 58.36  ? 1848 ILE B O   1 
ATOM   6496 C CB  . ILE B 1 365 ? 22.204  -6.254  -74.869 1.00 58.72  ? 1848 ILE B CB  1 
ATOM   6497 C CG1 . ILE B 1 365 ? 22.416  -4.865  -75.471 1.00 59.59  ? 1848 ILE B CG1 1 
ATOM   6498 C CG2 . ILE B 1 365 ? 23.540  -6.837  -74.450 1.00 58.57  ? 1848 ILE B CG2 1 
ATOM   6499 C CD1 . ILE B 1 365 ? 22.862  -3.830  -74.466 1.00 60.70  ? 1848 ILE B CD1 1 
ATOM   6500 N N   . PRO B 1 366 ? 19.187  -7.281  -75.200 1.00 57.35  ? 1849 PRO B N   1 
ATOM   6501 C CA  . PRO B 1 366 ? 17.762  -6.952  -75.273 1.00 55.94  ? 1849 PRO B CA  1 
ATOM   6502 C C   . PRO B 1 366 ? 17.515  -5.464  -75.062 1.00 55.11  ? 1849 PRO B C   1 
ATOM   6503 O O   . PRO B 1 366 ? 18.446  -4.703  -74.798 1.00 55.59  ? 1849 PRO B O   1 
ATOM   6504 C CB  . PRO B 1 366 ? 17.158  -7.804  -74.158 1.00 56.52  ? 1849 PRO B CB  1 
ATOM   6505 C CG  . PRO B 1 366 ? 18.083  -8.999  -74.107 1.00 57.82  ? 1849 PRO B CG  1 
ATOM   6506 C CD  . PRO B 1 366 ? 19.438  -8.338  -74.205 1.00 57.42  ? 1849 PRO B CD  1 
ATOM   6507 N N   . PRO B 1 367 ? 16.256  -5.025  -75.202 1.00 54.82  ? 1850 PRO B N   1 
ATOM   6508 C CA  . PRO B 1 367 ? 15.898  -3.615  -75.010 1.00 54.03  ? 1850 PRO B CA  1 
ATOM   6509 C C   . PRO B 1 367 ? 16.347  -3.170  -73.612 1.00 54.23  ? 1850 PRO B C   1 
ATOM   6510 O O   . PRO B 1 367 ? 15.987  -3.793  -72.612 1.00 54.53  ? 1850 PRO B O   1 
ATOM   6511 C CB  . PRO B 1 367 ? 14.387  -3.637  -75.138 1.00 53.67  ? 1850 PRO B CB  1 
ATOM   6512 C CG  . PRO B 1 367 ? 14.166  -4.725  -76.138 1.00 54.53  ? 1850 PRO B CG  1 
ATOM   6513 C CD  . PRO B 1 367 ? 15.092  -5.802  -75.663 1.00 54.26  ? 1850 PRO B CD  1 
ATOM   6514 N N   . LEU B 1 368 ? 17.123  -2.096  -73.540 1.00 52.62  ? 1851 LEU B N   1 
ATOM   6515 C CA  . LEU B 1 368 ? 17.634  -1.601  -72.266 1.00 52.32  ? 1851 LEU B CA  1 
ATOM   6516 C C   . LEU B 1 368 ? 16.666  -1.653  -71.066 1.00 53.51  ? 1851 LEU B C   1 
ATOM   6517 O O   . LEU B 1 368 ? 16.980  -2.245  -70.028 1.00 52.44  ? 1851 LEU B O   1 
ATOM   6518 C CB  . LEU B 1 368 ? 18.155  -0.181  -72.463 1.00 50.74  ? 1851 LEU B CB  1 
ATOM   6519 C CG  . LEU B 1 368 ? 19.033  0.375   -71.349 1.00 51.32  ? 1851 LEU B CG  1 
ATOM   6520 C CD1 . LEU B 1 368 ? 20.176  -0.590  -71.050 1.00 49.89  ? 1851 LEU B CD1 1 
ATOM   6521 C CD2 . LEU B 1 368 ? 19.563  1.742   -71.776 1.00 48.97  ? 1851 LEU B CD2 1 
ATOM   6522 N N   . GLU B 1 369 ? 15.488  -1.048  -71.205 1.00 54.77  ? 1852 GLU B N   1 
ATOM   6523 C CA  . GLU B 1 369 ? 14.513  -1.027  -70.119 1.00 55.46  ? 1852 GLU B CA  1 
ATOM   6524 C C   . GLU B 1 369 ? 14.182  -2.433  -69.631 1.00 54.95  ? 1852 GLU B C   1 
ATOM   6525 O O   . GLU B 1 369 ? 13.518  -2.605  -68.605 1.00 54.60  ? 1852 GLU B O   1 
ATOM   6526 C CB  . GLU B 1 369 ? 13.220  -0.333  -70.558 1.00 57.13  ? 1852 GLU B CB  1 
ATOM   6527 C CG  . GLU B 1 369 ? 12.302  -1.205  -71.423 1.00 61.54  ? 1852 GLU B CG  1 
ATOM   6528 C CD  . GLU B 1 369 ? 12.652  -1.176  -72.916 1.00 63.01  ? 1852 GLU B CD  1 
ATOM   6529 O OE1 . GLU B 1 369 ? 13.855  -1.076  -73.256 1.00 62.33  ? 1852 GLU B OE1 1 
ATOM   6530 O OE2 . GLU B 1 369 ? 11.716  -1.271  -73.745 1.00 62.93  ? 1852 GLU B OE2 1 
ATOM   6531 N N   . GLU B 1 370 ? 14.648  -3.437  -70.365 1.00 54.41  ? 1853 GLU B N   1 
ATOM   6532 C CA  . GLU B 1 370 ? 14.399  -4.825  -70.001 1.00 54.03  ? 1853 GLU B CA  1 
ATOM   6533 C C   . GLU B 1 370 ? 15.389  -5.328  -68.943 1.00 53.58  ? 1853 GLU B C   1 
ATOM   6534 O O   . GLU B 1 370 ? 15.155  -6.356  -68.304 1.00 53.07  ? 1853 GLU B O   1 
ATOM   6535 C CB  . GLU B 1 370 ? 14.445  -5.707  -71.250 1.00 53.47  ? 1853 GLU B CB  1 
ATOM   6536 C CG  . GLU B 1 370 ? 13.147  -6.446  -71.519 1.00 54.72  ? 1853 GLU B CG  1 
ATOM   6537 C CD  . GLU B 1 370 ? 13.046  -6.985  -72.942 1.00 55.86  ? 1853 GLU B CD  1 
ATOM   6538 O OE1 . GLU B 1 370 ? 13.929  -7.765  -73.359 1.00 55.51  ? 1853 GLU B OE1 1 
ATOM   6539 O OE2 . GLU B 1 370 ? 12.074  -6.633  -73.643 1.00 55.40  ? 1853 GLU B OE2 1 
ATOM   6540 N N   . VAL B 1 371 ? 16.482  -4.595  -68.745 1.00 52.38  ? 1854 VAL B N   1 
ATOM   6541 C CA  . VAL B 1 371 ? 17.480  -4.981  -67.743 1.00 53.85  ? 1854 VAL B CA  1 
ATOM   6542 C C   . VAL B 1 371 ? 17.884  -3.775  -66.895 1.00 56.30  ? 1854 VAL B C   1 
ATOM   6543 O O   . VAL B 1 371 ? 18.582  -3.912  -65.894 1.00 56.03  ? 1854 VAL B O   1 
ATOM   6544 C CB  . VAL B 1 371 ? 18.774  -5.556  -68.394 1.00 51.12  ? 1854 VAL B CB  1 
ATOM   6545 C CG1 . VAL B 1 371 ? 18.441  -6.743  -69.256 1.00 49.09  ? 1854 VAL B CG1 1 
ATOM   6546 C CG2 . VAL B 1 371 ? 19.488  -4.478  -69.210 1.00 48.35  ? 1854 VAL B CG2 1 
ATOM   6547 N N   . TYR B 1 372 ? 17.422  -2.599  -67.305 1.00 59.03  ? 1855 TYR B N   1 
ATOM   6548 C CA  . TYR B 1 372 ? 17.758  -1.348  -66.640 1.00 61.27  ? 1855 TYR B CA  1 
ATOM   6549 C C   . TYR B 1 372 ? 16.547  -0.417  -66.625 1.00 64.24  ? 1855 TYR B C   1 
ATOM   6550 O O   . TYR B 1 372 ? 16.004  -0.072  -67.678 1.00 64.34  ? 1855 TYR B O   1 
ATOM   6551 C CB  . TYR B 1 372 ? 18.900  -0.699  -67.408 1.00 60.21  ? 1855 TYR B CB  1 
ATOM   6552 C CG  . TYR B 1 372 ? 19.470  0.552   -66.808 1.00 59.80  ? 1855 TYR B CG  1 
ATOM   6553 C CD1 . TYR B 1 372 ? 20.239  0.512   -65.639 1.00 59.52  ? 1855 TYR B CD1 1 
ATOM   6554 C CD2 . TYR B 1 372 ? 19.289  1.779   -67.439 1.00 59.36  ? 1855 TYR B CD2 1 
ATOM   6555 C CE1 . TYR B 1 372 ? 20.817  1.673   -65.121 1.00 59.33  ? 1855 TYR B CE1 1 
ATOM   6556 C CE2 . TYR B 1 372 ? 19.857  2.940   -66.930 1.00 59.29  ? 1855 TYR B CE2 1 
ATOM   6557 C CZ  . TYR B 1 372 ? 20.618  2.880   -65.778 1.00 58.45  ? 1855 TYR B CZ  1 
ATOM   6558 O OH  . TYR B 1 372 ? 21.170  4.034   -65.293 1.00 57.77  ? 1855 TYR B OH  1 
ATOM   6559 N N   . SER B 1 373 ? 16.119  -0.018  -65.432 1.00 67.38  ? 1856 SER B N   1 
ATOM   6560 C CA  . SER B 1 373 ? 14.975  0.876   -65.305 1.00 71.23  ? 1856 SER B CA  1 
ATOM   6561 C C   . SER B 1 373 ? 15.359  2.285   -65.727 1.00 74.05  ? 1856 SER B C   1 
ATOM   6562 O O   . SER B 1 373 ? 16.468  2.738   -65.461 1.00 74.78  ? 1856 SER B O   1 
ATOM   6563 C CB  . SER B 1 373 ? 14.463  0.896   -63.867 1.00 70.79  ? 1856 SER B CB  1 
ATOM   6564 O OG  . SER B 1 373 ? 13.403  1.825   -63.742 1.00 71.52  ? 1856 SER B OG  1 
ATOM   6565 N N   . LEU B 1 374 ? 14.443  2.979   -66.388 1.00 77.31  ? 1857 LEU B N   1 
ATOM   6566 C CA  . LEU B 1 374 ? 14.733  4.326   -66.845 1.00 81.22  ? 1857 LEU B CA  1 
ATOM   6567 C C   . LEU B 1 374 ? 13.842  5.414   -66.266 1.00 84.59  ? 1857 LEU B C   1 
ATOM   6568 O O   . LEU B 1 374 ? 13.458  6.346   -66.976 1.00 85.13  ? 1857 LEU B O   1 
ATOM   6569 C CB  . LEU B 1 374 ? 14.667  4.384   -68.367 1.00 80.48  ? 1857 LEU B CB  1 
ATOM   6570 C CG  . LEU B 1 374 ? 15.934  3.918   -69.075 1.00 80.64  ? 1857 LEU B CG  1 
ATOM   6571 C CD1 . LEU B 1 374 ? 15.750  4.064   -70.583 1.00 79.20  ? 1857 LEU B CD1 1 
ATOM   6572 C CD2 . LEU B 1 374 ? 17.124  4.753   -68.581 1.00 80.21  ? 1857 LEU B CD2 1 
ATOM   6573 N N   . GLN B 1 375 ? 13.512  5.310   -64.983 1.00 88.06  ? 1858 GLN B N   1 
ATOM   6574 C CA  . GLN B 1 375 ? 12.677  6.330   -64.362 1.00 90.43  ? 1858 GLN B CA  1 
ATOM   6575 C C   . GLN B 1 375 ? 13.567  7.484   -63.888 1.00 91.58  ? 1858 GLN B C   1 
ATOM   6576 O O   . GLN B 1 375 ? 13.173  8.649   -63.947 1.00 91.63  ? 1858 GLN B O   1 
ATOM   6577 C CB  . GLN B 1 375 ? 11.898  5.749   -63.185 1.00 90.94  ? 1858 GLN B CB  1 
ATOM   6578 C CG  . GLN B 1 375 ? 10.597  6.478   -62.943 1.00 92.32  ? 1858 GLN B CG  1 
ATOM   6579 C CD  . GLN B 1 375 ? 10.224  6.534   -61.483 1.00 92.90  ? 1858 GLN B CD  1 
ATOM   6580 O OE1 . GLN B 1 375 ? 9.162   7.045   -61.129 1.00 92.86  ? 1858 GLN B OE1 1 
ATOM   6581 N NE2 . GLN B 1 375 ? 11.098  6.016   -60.623 1.00 93.23  ? 1858 GLN B NE2 1 
ATOM   6582 N N   . ARG B 1 376 ? 14.771  7.152   -63.426 1.00 92.90  ? 1859 ARG B N   1 
ATOM   6583 C CA  . ARG B 1 376 ? 15.724  8.163   -62.971 1.00 93.87  ? 1859 ARG B CA  1 
ATOM   6584 C C   . ARG B 1 376 ? 15.967  9.130   -64.126 1.00 94.45  ? 1859 ARG B C   1 
ATOM   6585 O O   . ARG B 1 376 ? 16.443  10.253  -63.928 1.00 94.35  ? 1859 ARG B O   1 
ATOM   6586 C CB  . ARG B 1 376 ? 17.048  7.509   -62.558 1.00 93.65  ? 1859 ARG B CB  1 
ATOM   6587 N N   . LEU B 1 377 ? 15.625  8.673   -65.331 1.00 94.99  ? 1860 LEU B N   1 
ATOM   6588 C CA  . LEU B 1 377 ? 15.771  9.456   -66.553 1.00 95.37  ? 1860 LEU B CA  1 
ATOM   6589 C C   . LEU B 1 377 ? 14.420  10.045  -66.928 1.00 95.65  ? 1860 LEU B C   1 
ATOM   6590 O O   . LEU B 1 377 ? 14.343  11.126  -67.507 1.00 95.94  ? 1860 LEU B O   1 
ATOM   6591 C CB  . LEU B 1 377 ? 16.279  8.572   -67.695 1.00 94.82  ? 1860 LEU B CB  1 
ATOM   6592 N N   . LYS B 1 378 ? 13.355  9.321   -66.596 1.00 96.05  ? 1861 LYS B N   1 
ATOM   6593 C CA  . LYS B 1 378 ? 12.000  9.776   -66.885 1.00 96.47  ? 1861 LYS B CA  1 
ATOM   6594 C C   . LYS B 1 378 ? 11.539  10.709  -65.765 1.00 97.21  ? 1861 LYS B C   1 
ATOM   6595 O O   . LYS B 1 378 ? 10.340  10.965  -65.601 1.00 97.42  ? 1861 LYS B O   1 
ATOM   6596 C CB  . LYS B 1 378 ? 11.044  8.585   -66.996 1.00 96.15  ? 1861 LYS B CB  1 
ATOM   6597 C CG  . LYS B 1 378 ? 9.653   8.959   -67.476 1.00 95.28  ? 1861 LYS B CG  1 
ATOM   6598 C CD  . LYS B 1 378 ? 8.713   7.769   -67.475 1.00 94.88  ? 1861 LYS B CD  1 
ATOM   6599 C CE  . LYS B 1 378 ? 7.330   8.190   -67.934 1.00 94.43  ? 1861 LYS B CE  1 
ATOM   6600 N NZ  . LYS B 1 378 ? 6.346   7.077   -67.887 1.00 93.91  ? 1861 LYS B NZ  1 
ATOM   6601 N N   . ALA B 1 379 ? 12.506  11.208  -64.995 1.00 97.16  ? 1862 ALA B N   1 
ATOM   6602 C CA  . ALA B 1 379 ? 12.239  12.132  -63.896 1.00 96.44  ? 1862 ALA B CA  1 
ATOM   6603 C C   . ALA B 1 379 ? 12.007  13.517  -64.486 1.00 95.97  ? 1862 ALA B C   1 
ATOM   6604 O O   . ALA B 1 379 ? 11.571  14.434  -63.796 1.00 96.47  ? 1862 ALA B O   1 
ATOM   6605 C CB  . ALA B 1 379 ? 13.422  12.168  -62.932 1.00 96.13  ? 1862 ALA B CB  1 
ATOM   6606 N N   . ARG B 1 380 ? 12.311  13.656  -65.771 1.00 94.93  ? 1863 ARG B N   1 
ATOM   6607 C CA  . ARG B 1 380 ? 12.133  14.914  -66.479 1.00 94.43  ? 1863 ARG B CA  1 
ATOM   6608 C C   . ARG B 1 380 ? 10.746  15.508  -66.228 1.00 94.15  ? 1863 ARG B C   1 
ATOM   6609 O O   . ARG B 1 380 ? 9.796   14.785  -65.926 1.00 93.59  ? 1863 ARG B O   1 
ATOM   6610 C CB  . ARG B 1 380 ? 12.349  14.689  -67.978 1.00 93.97  ? 1863 ARG B CB  1 
ATOM   6611 C CG  . ARG B 1 380 ? 11.641  13.456  -68.546 1.00 93.38  ? 1863 ARG B CG  1 
ATOM   6612 C CD  . ARG B 1 380 ? 10.121  13.585  -68.533 1.00 92.68  ? 1863 ARG B CD  1 
ATOM   6613 N NE  . ARG B 1 380 ? 9.482   12.433  -69.166 1.00 93.20  ? 1863 ARG B NE  1 
ATOM   6614 C CZ  . ARG B 1 380 ? 8.190   12.358  -69.476 1.00 93.02  ? 1863 ARG B CZ  1 
ATOM   6615 N NH1 . ARG B 1 380 ? 7.376   13.374  -69.213 1.00 92.97  ? 1863 ARG B NH1 1 
ATOM   6616 N NH2 . ARG B 1 380 ? 7.712   11.266  -70.059 1.00 92.31  ? 1863 ARG B NH2 1 
ATOM   6617 N N   . MET B 1 408 ? 17.368  13.994  -76.951 1.00 83.46  ? 1911 MET B N   1 
ATOM   6618 C CA  . MET B 1 408 ? 18.777  14.193  -76.628 1.00 84.67  ? 1911 MET B CA  1 
ATOM   6619 C C   . MET B 1 408 ? 19.058  13.806  -75.182 1.00 85.48  ? 1911 MET B C   1 
ATOM   6620 O O   . MET B 1 408 ? 19.799  12.863  -74.930 1.00 85.64  ? 1911 MET B O   1 
ATOM   6621 C CB  . MET B 1 408 ? 19.167  15.641  -76.868 1.00 83.83  ? 1911 MET B CB  1 
ATOM   6622 N N   . TRP B 1 409 ? 18.466  14.533  -74.237 1.00 86.39  ? 1912 TRP B N   1 
ATOM   6623 C CA  . TRP B 1 409 ? 18.639  14.247  -72.814 1.00 86.54  ? 1912 TRP B CA  1 
ATOM   6624 C C   . TRP B 1 409 ? 18.283  12.784  -72.540 1.00 86.61  ? 1912 TRP B C   1 
ATOM   6625 O O   . TRP B 1 409 ? 18.757  12.197  -71.571 1.00 86.42  ? 1912 TRP B O   1 
ATOM   6626 C CB  . TRP B 1 409 ? 17.755  15.172  -71.978 1.00 85.91  ? 1912 TRP B CB  1 
ATOM   6627 N N   . ILE B 1 410 ? 17.448  12.206  -73.404 1.00 86.66  ? 1913 ILE B N   1 
ATOM   6628 C CA  . ILE B 1 410 ? 17.034  10.810  -73.277 1.00 87.08  ? 1913 ILE B CA  1 
ATOM   6629 C C   . ILE B 1 410 ? 18.028  9.883   -73.981 1.00 87.68  ? 1913 ILE B C   1 
ATOM   6630 O O   . ILE B 1 410 ? 18.616  9.003   -73.353 1.00 88.53  ? 1913 ILE B O   1 
ATOM   6631 C CB  . ILE B 1 410 ? 15.635  10.621  -73.862 1.00 86.67  ? 1913 ILE B CB  1 
ATOM   6632 N N   . LYS B 1 411 ? 18.216  10.085  -75.282 1.00 88.00  ? 1914 LYS B N   1 
ATOM   6633 C CA  . LYS B 1 411 ? 19.143  9.266   -76.061 1.00 88.09  ? 1914 LYS B CA  1 
ATOM   6634 C C   . LYS B 1 411 ? 20.575  9.443   -75.560 1.00 88.29  ? 1914 LYS B C   1 
ATOM   6635 O O   . LYS B 1 411 ? 21.378  8.512   -75.604 1.00 88.60  ? 1914 LYS B O   1 
ATOM   6636 C CB  . LYS B 1 411 ? 19.055  9.634   -77.547 1.00 87.21  ? 1914 LYS B CB  1 
ATOM   6637 N N   . GLU B 1 412 ? 20.885  10.644  -75.084 1.00 88.51  ? 1915 GLU B N   1 
ATOM   6638 C CA  . GLU B 1 412 ? 22.214  10.963  -74.568 1.00 88.62  ? 1915 GLU B CA  1 
ATOM   6639 C C   . GLU B 1 412 ? 22.694  9.928   -73.559 1.00 87.97  ? 1915 GLU B C   1 
ATOM   6640 O O   . GLU B 1 412 ? 23.614  9.158   -73.830 1.00 88.33  ? 1915 GLU B O   1 
ATOM   6641 C CB  . GLU B 1 412 ? 22.195  12.347  -73.903 1.00 89.82  ? 1915 GLU B CB  1 
ATOM   6642 C CG  . GLU B 1 412 ? 23.332  12.603  -72.921 1.00 90.91  ? 1915 GLU B CG  1 
ATOM   6643 C CD  . GLU B 1 412 ? 24.591  13.095  -73.594 1.00 91.88  ? 1915 GLU B CD  1 
ATOM   6644 O OE1 . GLU B 1 412 ? 24.928  12.581  -74.683 1.00 92.04  ? 1915 GLU B OE1 1 
ATOM   6645 O OE2 . GLU B 1 412 ? 25.252  13.990  -73.023 1.00 92.08  ? 1915 GLU B OE2 1 
ATOM   6646 N N   . GLU B 1 413 ? 22.065  9.922   -72.389 1.00 87.05  ? 1916 GLU B N   1 
ATOM   6647 C CA  . GLU B 1 413 ? 22.451  8.999   -71.334 1.00 85.84  ? 1916 GLU B CA  1 
ATOM   6648 C C   . GLU B 1 413 ? 22.075  7.538   -71.570 1.00 84.75  ? 1916 GLU B C   1 
ATOM   6649 O O   . GLU B 1 413 ? 22.729  6.652   -71.021 1.00 85.27  ? 1916 GLU B O   1 
ATOM   6650 C CB  . GLU B 1 413 ? 21.898  9.475   -69.993 1.00 85.76  ? 1916 GLU B CB  1 
ATOM   6651 C CG  . GLU B 1 413 ? 22.399  10.844  -69.622 1.00 85.65  ? 1916 GLU B CG  1 
ATOM   6652 C CD  . GLU B 1 413 ? 22.060  11.225  -68.205 1.00 85.44  ? 1916 GLU B CD  1 
ATOM   6653 O OE1 . GLU B 1 413 ? 20.941  10.910  -67.751 1.00 85.01  ? 1916 GLU B OE1 1 
ATOM   6654 O OE2 . GLU B 1 413 ? 22.915  11.855  -67.551 1.00 85.49  ? 1916 GLU B OE2 1 
ATOM   6655 N N   . VAL B 1 414 ? 21.035  7.265   -72.358 1.00 82.48  ? 1917 VAL B N   1 
ATOM   6656 C CA  . VAL B 1 414 ? 20.674  5.871   -72.628 1.00 80.05  ? 1917 VAL B CA  1 
ATOM   6657 C C   . VAL B 1 414 ? 21.886  5.201   -73.267 1.00 79.49  ? 1917 VAL B C   1 
ATOM   6658 O O   . VAL B 1 414 ? 22.084  3.994   -73.148 1.00 79.93  ? 1917 VAL B O   1 
ATOM   6659 C CB  . VAL B 1 414 ? 19.475  5.743   -73.597 1.00 79.23  ? 1917 VAL B CB  1 
ATOM   6660 C CG1 . VAL B 1 414 ? 19.445  4.348   -74.202 1.00 77.51  ? 1917 VAL B CG1 1 
ATOM   6661 C CG2 . VAL B 1 414 ? 18.178  5.997   -72.857 1.00 78.05  ? 1917 VAL B CG2 1 
ATOM   6662 N N   . SER B 1 415 ? 22.695  6.001   -73.948 1.00 77.81  ? 1918 SER B N   1 
ATOM   6663 C CA  . SER B 1 415 ? 23.893  5.498   -74.593 1.00 76.25  ? 1918 SER B CA  1 
ATOM   6664 C C   . SER B 1 415 ? 24.941  5.283   -73.505 1.00 74.94  ? 1918 SER B C   1 
ATOM   6665 O O   . SER B 1 415 ? 25.666  4.288   -73.505 1.00 75.18  ? 1918 SER B O   1 
ATOM   6666 C CB  . SER B 1 415 ? 24.392  6.515   -75.619 1.00 76.09  ? 1918 SER B CB  1 
ATOM   6667 O OG  . SER B 1 415 ? 25.320  5.926   -76.510 1.00 76.96  ? 1918 SER B OG  1 
ATOM   6668 N N   . SER B 1 416 ? 24.995  6.224   -72.570 1.00 73.23  ? 1919 SER B N   1 
ATOM   6669 C CA  . SER B 1 416 ? 25.941  6.175   -71.462 1.00 72.24  ? 1919 SER B CA  1 
ATOM   6670 C C   . SER B 1 416 ? 25.699  4.974   -70.552 1.00 71.07  ? 1919 SER B C   1 
ATOM   6671 O O   . SER B 1 416 ? 26.620  4.218   -70.237 1.00 70.93  ? 1919 SER B O   1 
ATOM   6672 C CB  . SER B 1 416 ? 25.843  7.466   -70.647 1.00 72.82  ? 1919 SER B CB  1 
ATOM   6673 O OG  . SER B 1 416 ? 26.757  7.452   -69.565 1.00 73.15  ? 1919 SER B OG  1 
ATOM   6674 N N   . ALA B 1 417 ? 24.454  4.813   -70.120 1.00 69.88  ? 1920 ALA B N   1 
ATOM   6675 C CA  . ALA B 1 417 ? 24.075  3.702   -69.254 1.00 69.02  ? 1920 ALA B CA  1 
ATOM   6676 C C   . ALA B 1 417 ? 24.402  2.384   -69.930 1.00 68.21  ? 1920 ALA B C   1 
ATOM   6677 O O   . ALA B 1 417 ? 25.065  1.527   -69.357 1.00 68.08  ? 1920 ALA B O   1 
ATOM   6678 C CB  . ALA B 1 417 ? 22.592  3.768   -68.951 1.00 68.90  ? 1920 ALA B CB  1 
ATOM   6679 N N   . ARG B 1 418 ? 23.913  2.237   -71.155 1.00 67.99  ? 1921 ARG B N   1 
ATOM   6680 C CA  . ARG B 1 418 ? 24.135  1.043   -71.957 1.00 67.97  ? 1921 ARG B CA  1 
ATOM   6681 C C   . ARG B 1 418 ? 25.619  0.711   -72.038 1.00 67.56  ? 1921 ARG B C   1 
ATOM   6682 O O   . ARG B 1 418 ? 26.012  -0.451  -71.957 1.00 67.70  ? 1921 ARG B O   1 
ATOM   6683 C CB  . ARG B 1 418 ? 23.583  1.263   -73.368 1.00 68.50  ? 1921 ARG B CB  1 
ATOM   6684 C CG  . ARG B 1 418 ? 23.680  0.061   -74.291 1.00 69.45  ? 1921 ARG B CG  1 
ATOM   6685 C CD  . ARG B 1 418 ? 22.954  0.328   -75.595 1.00 72.22  ? 1921 ARG B CD  1 
ATOM   6686 N NE  . ARG B 1 418 ? 22.790  -0.876  -76.405 1.00 74.44  ? 1921 ARG B NE  1 
ATOM   6687 C CZ  . ARG B 1 418 ? 23.758  -1.439  -77.121 1.00 75.93  ? 1921 ARG B CZ  1 
ATOM   6688 N NH1 . ARG B 1 418 ? 24.973  -0.901  -77.135 1.00 76.06  ? 1921 ARG B NH1 1 
ATOM   6689 N NH2 . ARG B 1 418 ? 23.514  -2.550  -77.815 1.00 75.54  ? 1921 ARG B NH2 1 
ATOM   6690 N N   . ALA B 1 419 ? 26.439  1.742   -72.196 1.00 67.03  ? 1922 ALA B N   1 
ATOM   6691 C CA  . ALA B 1 419 ? 27.878  1.558   -72.302 1.00 66.47  ? 1922 ALA B CA  1 
ATOM   6692 C C   . ALA B 1 419 ? 28.465  1.039   -70.999 1.00 65.96  ? 1922 ALA B C   1 
ATOM   6693 O O   . ALA B 1 419 ? 29.262  0.101   -70.991 1.00 65.81  ? 1922 ALA B O   1 
ATOM   6694 C CB  . ALA B 1 419 ? 28.545  2.878   -72.684 1.00 66.11  ? 1922 ALA B CB  1 
ATOM   6695 N N   . SER B 1 420 ? 28.055  1.653   -69.896 1.00 65.41  ? 1923 SER B N   1 
ATOM   6696 C CA  . SER B 1 420 ? 28.558  1.291   -68.573 1.00 65.01  ? 1923 SER B CA  1 
ATOM   6697 C C   . SER B 1 420 ? 28.141  -0.108  -68.113 1.00 63.74  ? 1923 SER B C   1 
ATOM   6698 O O   . SER B 1 420 ? 28.869  -0.769  -67.367 1.00 62.93  ? 1923 SER B O   1 
ATOM   6699 C CB  . SER B 1 420 ? 28.097  2.335   -67.553 1.00 64.89  ? 1923 SER B CB  1 
ATOM   6700 O OG  . SER B 1 420 ? 29.005  2.417   -66.473 1.00 66.50  ? 1923 SER B OG  1 
ATOM   6701 N N   . ILE B 1 421 ? 26.970  -0.552  -68.560 1.00 62.18  ? 1924 ILE B N   1 
ATOM   6702 C CA  . ILE B 1 421 ? 26.465  -1.866  -68.189 1.00 61.44  ? 1924 ILE B CA  1 
ATOM   6703 C C   . ILE B 1 421 ? 27.233  -2.935  -68.952 1.00 60.03  ? 1924 ILE B C   1 
ATOM   6704 O O   . ILE B 1 421 ? 27.677  -3.928  -68.378 1.00 60.22  ? 1924 ILE B O   1 
ATOM   6705 C CB  . ILE B 1 421 ? 24.957  -2.000  -68.499 1.00 61.78  ? 1924 ILE B CB  1 
ATOM   6706 C CG1 . ILE B 1 421 ? 24.190  -0.861  -67.828 1.00 63.31  ? 1924 ILE B CG1 1 
ATOM   6707 C CG2 . ILE B 1 421 ? 24.433  -3.319  -67.965 1.00 61.78  ? 1924 ILE B CG2 1 
ATOM   6708 C CD1 . ILE B 1 421 ? 22.712  -0.830  -68.165 1.00 64.24  ? 1924 ILE B CD1 1 
ATOM   6709 N N   . ILE B 1 422 ? 27.391  -2.723  -70.250 1.00 58.65  ? 1925 ILE B N   1 
ATOM   6710 C CA  . ILE B 1 422 ? 28.113  -3.668  -71.078 1.00 57.84  ? 1925 ILE B CA  1 
ATOM   6711 C C   . ILE B 1 422 ? 29.541  -3.784  -70.552 1.00 57.56  ? 1925 ILE B C   1 
ATOM   6712 O O   . ILE B 1 422 ? 30.147  -4.858  -70.577 1.00 56.60  ? 1925 ILE B O   1 
ATOM   6713 C CB  . ILE B 1 422 ? 28.117  -3.204  -72.544 1.00 57.41  ? 1925 ILE B CB  1 
ATOM   6714 C CG1 . ILE B 1 422 ? 26.706  -3.335  -73.109 1.00 57.63  ? 1925 ILE B CG1 1 
ATOM   6715 C CG2 . ILE B 1 422 ? 29.093  -4.022  -73.365 1.00 56.59  ? 1925 ILE B CG2 1 
ATOM   6716 C CD1 . ILE B 1 422 ? 26.592  -2.959  -74.567 1.00 58.11  ? 1925 ILE B CD1 1 
ATOM   6717 N N   . ASP B 1 423 ? 30.064  -2.673  -70.050 1.00 55.98  ? 1926 ASP B N   1 
ATOM   6718 C CA  . ASP B 1 423 ? 31.415  -2.664  -69.523 1.00 55.78  ? 1926 ASP B CA  1 
ATOM   6719 C C   . ASP B 1 423 ? 31.539  -3.548  -68.290 1.00 54.42  ? 1926 ASP B C   1 
ATOM   6720 O O   . ASP B 1 423 ? 32.508  -4.299  -68.157 1.00 55.15  ? 1926 ASP B O   1 
ATOM   6721 C CB  . ASP B 1 423 ? 31.850  -1.240  -69.177 1.00 57.76  ? 1926 ASP B CB  1 
ATOM   6722 C CG  . ASP B 1 423 ? 33.305  -1.167  -68.766 1.00 58.83  ? 1926 ASP B CG  1 
ATOM   6723 O OD1 . ASP B 1 423 ? 34.170  -1.549  -69.586 1.00 60.23  ? 1926 ASP B OD1 1 
ATOM   6724 O OD2 . ASP B 1 423 ? 33.582  -0.737  -67.626 1.00 60.70  ? 1926 ASP B OD2 1 
ATOM   6725 N N   . LYS B 1 424 ? 30.576  -3.454  -67.383 1.00 51.55  ? 1927 LYS B N   1 
ATOM   6726 C CA  . LYS B 1 424 ? 30.628  -4.272  -66.182 1.00 50.68  ? 1927 LYS B CA  1 
ATOM   6727 C C   . LYS B 1 424 ? 30.328  -5.713  -66.555 1.00 49.69  ? 1927 LYS B C   1 
ATOM   6728 O O   . LYS B 1 424 ? 30.812  -6.645  -65.908 1.00 49.69  ? 1927 LYS B O   1 
ATOM   6729 C CB  . LYS B 1 424 ? 29.616  -3.790  -65.149 1.00 51.19  ? 1927 LYS B CB  1 
ATOM   6730 C CG  . LYS B 1 424 ? 29.810  -2.359  -64.700 1.00 51.43  ? 1927 LYS B CG  1 
ATOM   6731 C CD  . LYS B 1 424 ? 28.856  -2.040  -63.569 1.00 52.28  ? 1927 LYS B CD  1 
ATOM   6732 C CE  . LYS B 1 424 ? 29.121  -0.674  -62.964 1.00 52.78  ? 1927 LYS B CE  1 
ATOM   6733 N NZ  . LYS B 1 424 ? 28.646  0.412   -63.851 1.00 54.03  ? 1927 LYS B NZ  1 
ATOM   6734 N N   . TRP B 1 425 ? 29.530  -5.892  -67.606 1.00 47.23  ? 1928 TRP B N   1 
ATOM   6735 C CA  . TRP B 1 425 ? 29.173  -7.227  -68.069 1.00 45.59  ? 1928 TRP B CA  1 
ATOM   6736 C C   . TRP B 1 425 ? 30.434  -7.947  -68.574 1.00 46.71  ? 1928 TRP B C   1 
ATOM   6737 O O   . TRP B 1 425 ? 30.553  -9.173  -68.495 1.00 48.06  ? 1928 TRP B O   1 
ATOM   6738 C CB  . TRP B 1 425 ? 28.098  -7.116  -69.167 1.00 42.13  ? 1928 TRP B CB  1 
ATOM   6739 C CG  . TRP B 1 425 ? 27.655  -8.421  -69.761 1.00 36.97  ? 1928 TRP B CG  1 
ATOM   6740 C CD1 . TRP B 1 425 ? 27.617  -9.633  -69.142 1.00 37.13  ? 1928 TRP B CD1 1 
ATOM   6741 C CD2 . TRP B 1 425 ? 27.184  -8.637  -71.090 1.00 36.10  ? 1928 TRP B CD2 1 
ATOM   6742 N NE1 . TRP B 1 425 ? 27.157  -10.594 -70.001 1.00 35.81  ? 1928 TRP B NE1 1 
ATOM   6743 C CE2 . TRP B 1 425 ? 26.879  -10.010 -71.206 1.00 36.59  ? 1928 TRP B CE2 1 
ATOM   6744 C CE3 . TRP B 1 425 ? 26.986  -7.802  -72.198 1.00 37.68  ? 1928 TRP B CE3 1 
ATOM   6745 C CZ2 . TRP B 1 425 ? 26.386  -10.574 -72.386 1.00 37.35  ? 1928 TRP B CZ2 1 
ATOM   6746 C CZ3 . TRP B 1 425 ? 26.496  -8.361  -73.375 1.00 38.05  ? 1928 TRP B CZ3 1 
ATOM   6747 C CH2 . TRP B 1 425 ? 26.201  -9.739  -73.457 1.00 38.90  ? 1928 TRP B CH2 1 
ATOM   6748 N N   . ARG B 1 426 ? 31.381  -7.174  -69.080 1.00 47.63  ? 1929 ARG B N   1 
ATOM   6749 C CA  . ARG B 1 426 ? 32.632  -7.735  -69.564 1.00 50.09  ? 1929 ARG B CA  1 
ATOM   6750 C C   . ARG B 1 426 ? 33.344  -8.390  -68.396 1.00 48.93  ? 1929 ARG B C   1 
ATOM   6751 O O   . ARG B 1 426 ? 33.916  -9.475  -68.526 1.00 48.22  ? 1929 ARG B O   1 
ATOM   6752 C CB  . ARG B 1 426 ? 33.534  -6.631  -70.141 1.00 53.95  ? 1929 ARG B CB  1 
ATOM   6753 C CG  . ARG B 1 426 ? 32.921  -5.891  -71.318 1.00 61.65  ? 1929 ARG B CG  1 
ATOM   6754 C CD  . ARG B 1 426 ? 33.667  -4.605  -71.725 1.00 66.12  ? 1929 ARG B CD  1 
ATOM   6755 N NE  . ARG B 1 426 ? 34.994  -4.842  -72.293 1.00 71.65  ? 1929 ARG B NE  1 
ATOM   6756 C CZ  . ARG B 1 426 ? 36.113  -4.951  -71.578 1.00 74.60  ? 1929 ARG B CZ  1 
ATOM   6757 N NH1 . ARG B 1 426 ? 36.068  -4.845  -70.251 1.00 75.82  ? 1929 ARG B NH1 1 
ATOM   6758 N NH2 . ARG B 1 426 ? 37.282  -5.153  -72.187 1.00 75.13  ? 1929 ARG B NH2 1 
ATOM   6759 N N   . LYS B 1 427 ? 33.301  -7.724  -67.246 1.00 48.11  ? 1930 LYS B N   1 
ATOM   6760 C CA  . LYS B 1 427 ? 33.986  -8.233  -66.065 1.00 48.76  ? 1930 LYS B CA  1 
ATOM   6761 C C   . LYS B 1 427 ? 33.386  -9.509  -65.484 1.00 48.14  ? 1930 LYS B C   1 
ATOM   6762 O O   . LYS B 1 427 ? 33.995  -10.130 -64.612 1.00 47.41  ? 1930 LYS B O   1 
ATOM   6763 C CB  . LYS B 1 427 ? 34.059  -7.153  -64.982 1.00 49.06  ? 1930 LYS B CB  1 
ATOM   6764 C CG  . LYS B 1 427 ? 34.583  -5.799  -65.479 1.00 52.02  ? 1930 LYS B CG  1 
ATOM   6765 C CD  . LYS B 1 427 ? 35.021  -4.905  -64.308 1.00 55.62  ? 1930 LYS B CD  1 
ATOM   6766 C CE  . LYS B 1 427 ? 35.411  -3.490  -64.769 1.00 57.60  ? 1930 LYS B CE  1 
ATOM   6767 N NZ  . LYS B 1 427 ? 34.253  -2.757  -65.389 1.00 57.33  ? 1930 LYS B NZ  1 
ATOM   6768 N N   . PHE B 1 428 ? 32.214  -9.918  -65.970 1.00 47.13  ? 1931 PHE B N   1 
ATOM   6769 C CA  . PHE B 1 428 ? 31.586  -11.131 -65.448 1.00 46.83  ? 1931 PHE B CA  1 
ATOM   6770 C C   . PHE B 1 428 ? 31.867  -12.392 -66.254 1.00 46.15  ? 1931 PHE B C   1 
ATOM   6771 O O   . PHE B 1 428 ? 31.178  -13.413 -66.100 1.00 43.25  ? 1931 PHE B O   1 
ATOM   6772 C CB  . PHE B 1 428 ? 30.079  -10.936 -65.310 1.00 48.05  ? 1931 PHE B CB  1 
ATOM   6773 C CG  . PHE B 1 428 ? 29.703  -9.870  -64.333 1.00 49.38  ? 1931 PHE B CG  1 
ATOM   6774 C CD1 . PHE B 1 428 ? 30.463  -9.668  -63.186 1.00 50.19  ? 1931 PHE B CD1 1 
ATOM   6775 C CD2 . PHE B 1 428 ? 28.585  -9.070  -64.551 1.00 49.38  ? 1931 PHE B CD2 1 
ATOM   6776 C CE1 . PHE B 1 428 ? 30.117  -8.677  -62.263 1.00 51.34  ? 1931 PHE B CE1 1 
ATOM   6777 C CE2 . PHE B 1 428 ? 28.226  -8.079  -63.642 1.00 49.30  ? 1931 PHE B CE2 1 
ATOM   6778 C CZ  . PHE B 1 428 ? 28.990  -7.878  -62.495 1.00 51.85  ? 1931 PHE B CZ  1 
ATOM   6779 N N   . GLN B 1 429 ? 32.901  -12.326 -67.087 1.00 45.53  ? 1932 GLN B N   1 
ATOM   6780 C CA  . GLN B 1 429 ? 33.271  -13.454 -67.914 1.00 45.79  ? 1932 GLN B CA  1 
ATOM   6781 C C   . GLN B 1 429 ? 33.633  -14.688 -67.084 1.00 45.71  ? 1932 GLN B C   1 
ATOM   6782 O O   . GLN B 1 429 ? 34.544  -14.645 -66.260 1.00 45.61  ? 1932 GLN B O   1 
ATOM   6783 C CB  . GLN B 1 429 ? 34.435  -13.060 -68.816 1.00 46.72  ? 1932 GLN B CB  1 
ATOM   6784 C CG  . GLN B 1 429 ? 34.872  -14.162 -69.771 1.00 49.26  ? 1932 GLN B CG  1 
ATOM   6785 C CD  . GLN B 1 429 ? 35.936  -13.699 -70.741 1.00 50.39  ? 1932 GLN B CD  1 
ATOM   6786 O OE1 . GLN B 1 429 ? 36.904  -13.040 -70.350 1.00 51.69  ? 1932 GLN B OE1 1 
ATOM   6787 N NE2 . GLN B 1 429 ? 35.776  -14.052 -72.013 1.00 49.97  ? 1932 GLN B NE2 1 
ATOM   6788 N N   . GLY B 1 430 ? 32.903  -15.780 -67.306 1.00 45.51  ? 1933 GLY B N   1 
ATOM   6789 C CA  . GLY B 1 430 ? 33.154  -17.023 -66.599 1.00 45.71  ? 1933 GLY B CA  1 
ATOM   6790 C C   . GLY B 1 430 ? 32.046  -17.358 -65.627 1.00 46.16  ? 1933 GLY B C   1 
ATOM   6791 O O   . GLY B 1 430 ? 31.816  -18.522 -65.266 1.00 45.84  ? 1933 GLY B O   1 
ATOM   6792 N N   . MET B 1 431 ? 31.355  -16.315 -65.196 1.00 47.84  ? 1934 MET B N   1 
ATOM   6793 C CA  . MET B 1 431 ? 30.251  -16.442 -64.253 1.00 48.19  ? 1934 MET B CA  1 
ATOM   6794 C C   . MET B 1 431 ? 29.114  -17.257 -64.838 1.00 48.12  ? 1934 MET B C   1 
ATOM   6795 O O   . MET B 1 431 ? 28.513  -16.852 -65.830 1.00 46.53  ? 1934 MET B O   1 
ATOM   6796 C CB  . MET B 1 431 ? 29.725  -15.058 -63.885 1.00 48.28  ? 1934 MET B CB  1 
ATOM   6797 C CG  . MET B 1 431 ? 28.722  -15.064 -62.764 1.00 48.81  ? 1934 MET B CG  1 
ATOM   6798 S SD  . MET B 1 431 ? 28.261  -13.404 -62.287 1.00 50.22  ? 1934 MET B SD  1 
ATOM   6799 C CE  . MET B 1 431 ? 29.772  -12.802 -61.525 1.00 49.34  ? 1934 MET B CE  1 
ATOM   6800 N N   . ASN B 1 432 ? 28.833  -18.406 -64.226 1.00 49.69  ? 1935 ASN B N   1 
ATOM   6801 C CA  . ASN B 1 432 ? 27.748  -19.263 -64.679 1.00 50.66  ? 1935 ASN B CA  1 
ATOM   6802 C C   . ASN B 1 432 ? 26.440  -18.707 -64.126 1.00 50.80  ? 1935 ASN B C   1 
ATOM   6803 O O   . ASN B 1 432 ? 26.450  -17.763 -63.338 1.00 50.32  ? 1935 ASN B O   1 
ATOM   6804 C CB  . ASN B 1 432 ? 27.977  -20.720 -64.235 1.00 52.69  ? 1935 ASN B CB  1 
ATOM   6805 C CG  . ASN B 1 432 ? 28.270  -20.856 -62.748 1.00 54.18  ? 1935 ASN B CG  1 
ATOM   6806 O OD1 . ASN B 1 432 ? 27.450  -20.499 -61.906 1.00 56.66  ? 1935 ASN B OD1 1 
ATOM   6807 N ND2 . ASN B 1 432 ? 29.442  -21.400 -62.421 1.00 54.96  ? 1935 ASN B ND2 1 
ATOM   6808 N N   . GLN B 1 433 ? 25.320  -19.286 -64.534 1.00 51.39  ? 1936 GLN B N   1 
ATOM   6809 C CA  . GLN B 1 433 ? 24.028  -18.787 -64.091 1.00 51.88  ? 1936 GLN B CA  1 
ATOM   6810 C C   . GLN B 1 433 ? 23.767  -18.785 -62.602 1.00 52.29  ? 1936 GLN B C   1 
ATOM   6811 O O   . GLN B 1 433 ? 23.192  -17.833 -62.082 1.00 52.34  ? 1936 GLN B O   1 
ATOM   6812 C CB  . GLN B 1 433 ? 22.901  -19.528 -64.801 1.00 51.65  ? 1936 GLN B CB  1 
ATOM   6813 C CG  . GLN B 1 433 ? 22.709  -19.085 -66.238 1.00 52.40  ? 1936 GLN B CG  1 
ATOM   6814 C CD  . GLN B 1 433 ? 21.448  -19.659 -66.865 1.00 54.63  ? 1936 GLN B CD  1 
ATOM   6815 O OE1 . GLN B 1 433 ? 21.253  -20.881 -66.910 1.00 54.60  ? 1936 GLN B OE1 1 
ATOM   6816 N NE2 . GLN B 1 433 ? 20.585  -18.776 -67.359 1.00 54.73  ? 1936 GLN B NE2 1 
ATOM   6817 N N   . GLU B 1 434 ? 24.171  -19.836 -61.902 1.00 54.26  ? 1937 GLU B N   1 
ATOM   6818 C CA  . GLU B 1 434 ? 23.929  -19.882 -60.463 1.00 55.03  ? 1937 GLU B CA  1 
ATOM   6819 C C   . GLU B 1 434 ? 24.734  -18.813 -59.732 1.00 53.68  ? 1937 GLU B C   1 
ATOM   6820 O O   . GLU B 1 434 ? 24.262  -18.223 -58.770 1.00 53.91  ? 1937 GLU B O   1 
ATOM   6821 C CB  . GLU B 1 434 ? 24.257  -21.264 -59.894 1.00 57.38  ? 1937 GLU B CB  1 
ATOM   6822 C CG  . GLU B 1 434 ? 23.913  -21.386 -58.412 1.00 64.74  ? 1937 GLU B CG  1 
ATOM   6823 C CD  . GLU B 1 434 ? 24.212  -22.764 -57.832 1.00 68.55  ? 1937 GLU B CD  1 
ATOM   6824 O OE1 . GLU B 1 434 ? 23.583  -23.753 -58.285 1.00 70.25  ? 1937 GLU B OE1 1 
ATOM   6825 O OE2 . GLU B 1 434 ? 25.072  -22.850 -56.923 1.00 69.72  ? 1937 GLU B OE2 1 
ATOM   6826 N N   . GLN B 1 435 ? 25.950  -18.558 -60.196 1.00 53.23  ? 1938 GLN B N   1 
ATOM   6827 C CA  . GLN B 1 435 ? 26.791  -17.549 -59.573 1.00 52.53  ? 1938 GLN B CA  1 
ATOM   6828 C C   . GLN B 1 435 ? 26.191  -16.169 -59.825 1.00 51.26  ? 1938 GLN B C   1 
ATOM   6829 O O   . GLN B 1 435 ? 26.178  -15.314 -58.942 1.00 52.22  ? 1938 GLN B O   1 
ATOM   6830 C CB  . GLN B 1 435 ? 28.217  -17.608 -60.143 1.00 54.16  ? 1938 GLN B CB  1 
ATOM   6831 C CG  . GLN B 1 435 ? 29.005  -18.886 -59.807 1.00 56.48  ? 1938 GLN B CG  1 
ATOM   6832 C CD  . GLN B 1 435 ? 30.278  -19.073 -60.661 1.00 57.03  ? 1938 GLN B CD  1 
ATOM   6833 O OE1 . GLN B 1 435 ? 30.979  -20.081 -60.535 1.00 57.47  ? 1938 GLN B OE1 1 
ATOM   6834 N NE2 . GLN B 1 435 ? 30.566  -18.108 -61.530 1.00 55.70  ? 1938 GLN B NE2 1 
ATOM   6835 N N   . ALA B 1 436 ? 25.680  -15.954 -61.028 1.00 48.97  ? 1939 ALA B N   1 
ATOM   6836 C CA  . ALA B 1 436 ? 25.106  -14.659 -61.364 1.00 47.27  ? 1939 ALA B CA  1 
ATOM   6837 C C   . ALA B 1 436 ? 23.854  -14.387 -60.539 1.00 46.33  ? 1939 ALA B C   1 
ATOM   6838 O O   . ALA B 1 436 ? 23.660  -13.274 -60.052 1.00 44.96  ? 1939 ALA B O   1 
ATOM   6839 C CB  . ALA B 1 436 ? 24.794  -14.598 -62.852 1.00 45.28  ? 1939 ALA B CB  1 
ATOM   6840 N N   . MET B 1 437 ? 23.019  -15.415 -60.381 1.00 46.34  ? 1940 MET B N   1 
ATOM   6841 C CA  . MET B 1 437 ? 21.769  -15.313 -59.613 1.00 46.18  ? 1940 MET B CA  1 
ATOM   6842 C C   . MET B 1 437 ? 22.081  -15.039 -58.145 1.00 44.87  ? 1940 MET B C   1 
ATOM   6843 O O   . MET B 1 437 ? 21.382  -14.277 -57.484 1.00 43.80  ? 1940 MET B O   1 
ATOM   6844 C CB  . MET B 1 437 ? 20.953  -16.612 -59.733 1.00 45.53  ? 1940 MET B CB  1 
ATOM   6845 C CG  . MET B 1 437 ? 19.500  -16.521 -59.249 1.00 44.84  ? 1940 MET B CG  1 
ATOM   6846 S SD  . MET B 1 437 ? 18.530  -18.081 -59.478 1.00 46.49  ? 1940 MET B SD  1 
ATOM   6847 C CE  . MET B 1 437 ? 18.114  -17.997 -61.171 1.00 44.72  ? 1940 MET B CE  1 
ATOM   6848 N N   . ALA B 1 438 ? 23.144  -15.659 -57.651 1.00 44.29  ? 1941 ALA B N   1 
ATOM   6849 C CA  . ALA B 1 438 ? 23.565  -15.485 -56.268 1.00 44.28  ? 1941 ALA B CA  1 
ATOM   6850 C C   . ALA B 1 438 ? 24.049  -14.054 -55.990 1.00 44.12  ? 1941 ALA B C   1 
ATOM   6851 O O   . ALA B 1 438 ? 23.653  -13.443 -54.998 1.00 45.50  ? 1941 ALA B O   1 
ATOM   6852 C CB  . ALA B 1 438 ? 24.664  -16.499 -55.926 1.00 42.96  ? 1941 ALA B CB  1 
ATOM   6853 N N   . LYS B 1 439 ? 24.897  -13.517 -56.858 1.00 44.02  ? 1942 LYS B N   1 
ATOM   6854 C CA  . LYS B 1 439 ? 25.389  -12.169 -56.641 1.00 45.35  ? 1942 LYS B CA  1 
ATOM   6855 C C   . LYS B 1 439 ? 24.269  -11.154 -56.820 1.00 45.83  ? 1942 LYS B C   1 
ATOM   6856 O O   . LYS B 1 439 ? 24.213  -10.148 -56.108 1.00 46.48  ? 1942 LYS B O   1 
ATOM   6857 C CB  . LYS B 1 439 ? 26.555  -11.853 -57.584 1.00 47.17  ? 1942 LYS B CB  1 
ATOM   6858 C CG  . LYS B 1 439 ? 27.841  -12.585 -57.216 1.00 49.94  ? 1942 LYS B CG  1 
ATOM   6859 C CD  . LYS B 1 439 ? 29.034  -12.090 -58.014 1.00 52.69  ? 1942 LYS B CD  1 
ATOM   6860 C CE  . LYS B 1 439 ? 30.297  -12.812 -57.593 1.00 54.00  ? 1942 LYS B CE  1 
ATOM   6861 N NZ  . LYS B 1 439 ? 30.603  -12.564 -56.157 1.00 54.05  ? 1942 LYS B NZ  1 
ATOM   6862 N N   . TYR B 1 440 ? 23.370  -11.419 -57.762 1.00 44.53  ? 1943 TYR B N   1 
ATOM   6863 C CA  . TYR B 1 440 ? 22.256  -10.517 -58.001 1.00 44.18  ? 1943 TYR B CA  1 
ATOM   6864 C C   . TYR B 1 440 ? 21.484  -10.339 -56.693 1.00 44.26  ? 1943 TYR B C   1 
ATOM   6865 O O   . TYR B 1 440 ? 21.290  -9.219  -56.195 1.00 44.42  ? 1943 TYR B O   1 
ATOM   6866 C CB  . TYR B 1 440 ? 21.320  -11.103 -59.063 1.00 44.78  ? 1943 TYR B CB  1 
ATOM   6867 C CG  . TYR B 1 440 ? 20.285  -10.116 -59.568 1.00 44.17  ? 1943 TYR B CG  1 
ATOM   6868 C CD1 . TYR B 1 440 ? 20.563  -9.274  -60.647 1.00 44.55  ? 1943 TYR B CD1 1 
ATOM   6869 C CD2 . TYR B 1 440 ? 19.037  -10.010 -58.957 1.00 43.25  ? 1943 TYR B CD2 1 
ATOM   6870 C CE1 . TYR B 1 440 ? 19.620  -8.353  -61.108 1.00 44.44  ? 1943 TYR B CE1 1 
ATOM   6871 C CE2 . TYR B 1 440 ? 18.085  -9.090  -59.408 1.00 44.19  ? 1943 TYR B CE2 1 
ATOM   6872 C CZ  . TYR B 1 440 ? 18.384  -8.270  -60.486 1.00 43.55  ? 1943 TYR B CZ  1 
ATOM   6873 O OH  . TYR B 1 440 ? 17.441  -7.398  -60.957 1.00 41.06  ? 1943 TYR B OH  1 
ATOM   6874 N N   . MET B 1 441 ? 21.054  -11.466 -56.140 1.00 43.93  ? 1944 MET B N   1 
ATOM   6875 C CA  . MET B 1 441 ? 20.300  -11.480 -54.907 1.00 43.30  ? 1944 MET B CA  1 
ATOM   6876 C C   . MET B 1 441 ? 21.066  -10.887 -53.737 1.00 44.21  ? 1944 MET B C   1 
ATOM   6877 O O   . MET B 1 441 ? 20.496  -10.119 -52.950 1.00 44.11  ? 1944 MET B O   1 
ATOM   6878 C CB  . MET B 1 441 ? 19.853  -12.906 -54.593 1.00 42.70  ? 1944 MET B CB  1 
ATOM   6879 C CG  . MET B 1 441 ? 18.704  -13.353 -55.477 1.00 43.75  ? 1944 MET B CG  1 
ATOM   6880 S SD  . MET B 1 441 ? 17.443  -12.040 -55.630 1.00 44.78  ? 1944 MET B SD  1 
ATOM   6881 C CE  . MET B 1 441 ? 16.628  -12.181 -53.967 1.00 44.99  ? 1944 MET B CE  1 
ATOM   6882 N N   . ALA B 1 442 ? 22.349  -11.231 -53.619 1.00 42.32  ? 1945 ALA B N   1 
ATOM   6883 C CA  . ALA B 1 442 ? 23.152  -10.692 -52.534 1.00 42.11  ? 1945 ALA B CA  1 
ATOM   6884 C C   . ALA B 1 442 ? 23.178  -9.182  -52.684 1.00 43.30  ? 1945 ALA B C   1 
ATOM   6885 O O   . ALA B 1 442 ? 22.960  -8.444  -51.722 1.00 43.60  ? 1945 ALA B O   1 
ATOM   6886 C CB  . ALA B 1 442 ? 24.555  -11.244 -52.586 1.00 41.30  ? 1945 ALA B CB  1 
ATOM   6887 N N   . LEU B 1 443 ? 23.425  -8.714  -53.901 1.00 44.03  ? 1946 LEU B N   1 
ATOM   6888 C CA  . LEU B 1 443 ? 23.460  -7.281  -54.143 1.00 45.22  ? 1946 LEU B CA  1 
ATOM   6889 C C   . LEU B 1 443 ? 22.116  -6.652  -53.780 1.00 47.07  ? 1946 LEU B C   1 
ATOM   6890 O O   . LEU B 1 443 ? 22.075  -5.608  -53.125 1.00 47.58  ? 1946 LEU B O   1 
ATOM   6891 C CB  . LEU B 1 443 ? 23.808  -7.013  -55.605 1.00 44.86  ? 1946 LEU B CB  1 
ATOM   6892 C CG  . LEU B 1 443 ? 23.939  -5.564  -56.073 1.00 45.14  ? 1946 LEU B CG  1 
ATOM   6893 C CD1 . LEU B 1 443 ? 24.771  -4.760  -55.080 1.00 46.02  ? 1946 LEU B CD1 1 
ATOM   6894 C CD2 . LEU B 1 443 ? 24.568  -5.553  -57.470 1.00 43.80  ? 1946 LEU B CD2 1 
ATOM   6895 N N   . ILE B 1 444 ? 21.021  -7.289  -54.200 1.00 47.24  ? 1947 ILE B N   1 
ATOM   6896 C CA  . ILE B 1 444 ? 19.686  -6.784  -53.896 1.00 48.35  ? 1947 ILE B CA  1 
ATOM   6897 C C   . ILE B 1 444 ? 19.516  -6.640  -52.378 1.00 49.84  ? 1947 ILE B C   1 
ATOM   6898 O O   . ILE B 1 444 ? 19.174  -5.575  -51.875 1.00 49.02  ? 1947 ILE B O   1 
ATOM   6899 C CB  . ILE B 1 444 ? 18.567  -7.752  -54.428 1.00 49.03  ? 1947 ILE B CB  1 
ATOM   6900 C CG1 . ILE B 1 444 ? 18.350  -7.567  -55.939 1.00 46.36  ? 1947 ILE B CG1 1 
ATOM   6901 C CG2 . ILE B 1 444 ? 17.257  -7.520  -53.659 1.00 48.38  ? 1947 ILE B CG2 1 
ATOM   6902 C CD1 . ILE B 1 444 ? 17.824  -6.221  -56.315 1.00 41.94  ? 1947 ILE B CD1 1 
ATOM   6903 N N   . LYS B 1 445 ? 19.756  -7.723  -51.650 1.00 51.83  ? 1948 LYS B N   1 
ATOM   6904 C CA  . LYS B 1 445 ? 19.603  -7.704  -50.206 1.00 54.11  ? 1948 LYS B CA  1 
ATOM   6905 C C   . LYS B 1 445 ? 20.457  -6.664  -49.491 1.00 55.94  ? 1948 LYS B C   1 
ATOM   6906 O O   . LYS B 1 445 ? 20.343  -6.498  -48.279 1.00 56.13  ? 1948 LYS B O   1 
ATOM   6907 C CB  . LYS B 1 445 ? 19.886  -9.083  -49.625 1.00 54.12  ? 1948 LYS B CB  1 
ATOM   6908 C CG  . LYS B 1 445 ? 18.824  -10.118 -49.956 1.00 54.79  ? 1948 LYS B CG  1 
ATOM   6909 C CD  . LYS B 1 445 ? 19.110  -11.423 -49.228 1.00 56.31  ? 1948 LYS B CD  1 
ATOM   6910 C CE  . LYS B 1 445 ? 18.337  -12.563 -49.841 1.00 58.07  ? 1948 LYS B CE  1 
ATOM   6911 N NZ  . LYS B 1 445 ? 18.815  -13.877 -49.324 1.00 60.90  ? 1948 LYS B NZ  1 
ATOM   6912 N N   . GLU B 1 446 ? 21.327  -5.970  -50.219 1.00 57.55  ? 1949 GLU B N   1 
ATOM   6913 C CA  . GLU B 1 446 ? 22.131  -4.945  -49.573 1.00 57.21  ? 1949 GLU B CA  1 
ATOM   6914 C C   . GLU B 1 446 ? 21.200  -3.787  -49.223 1.00 57.32  ? 1949 GLU B C   1 
ATOM   6915 O O   . GLU B 1 446 ? 21.596  -2.832  -48.559 1.00 57.36  ? 1949 GLU B O   1 
ATOM   6916 C CB  . GLU B 1 446 ? 23.270  -4.462  -50.476 1.00 58.20  ? 1949 GLU B CB  1 
ATOM   6917 C CG  . GLU B 1 446 ? 24.423  -5.452  -50.604 1.00 60.08  ? 1949 GLU B CG  1 
ATOM   6918 C CD  . GLU B 1 446 ? 25.681  -4.835  -51.208 1.00 61.08  ? 1949 GLU B CD  1 
ATOM   6919 O OE1 . GLU B 1 446 ? 26.671  -5.579  -51.403 1.00 59.43  ? 1949 GLU B OE1 1 
ATOM   6920 O OE2 . GLU B 1 446 ? 25.680  -3.609  -51.477 1.00 61.78  ? 1949 GLU B OE2 1 
ATOM   6921 N N   . TRP B 1 447 ? 19.957  -3.858  -49.684 1.00 56.91  ? 1950 TRP B N   1 
ATOM   6922 C CA  . TRP B 1 447 ? 19.002  -2.817  -49.342 1.00 56.21  ? 1950 TRP B CA  1 
ATOM   6923 C C   . TRP B 1 447 ? 18.229  -3.326  -48.122 1.00 55.57  ? 1950 TRP B C   1 
ATOM   6924 O O   . TRP B 1 447 ? 17.626  -4.399  -48.157 1.00 54.30  ? 1950 TRP B O   1 
ATOM   6925 C CB  . TRP B 1 447 ? 18.066  -2.532  -50.508 1.00 55.61  ? 1950 TRP B CB  1 
ATOM   6926 C CG  . TRP B 1 447 ? 16.983  -1.572  -50.155 1.00 56.99  ? 1950 TRP B CG  1 
ATOM   6927 C CD1 . TRP B 1 447 ? 17.122  -0.392  -49.487 1.00 57.32  ? 1950 TRP B CD1 1 
ATOM   6928 C CD2 . TRP B 1 447 ? 15.589  -1.708  -50.447 1.00 57.63  ? 1950 TRP B CD2 1 
ATOM   6929 N NE1 . TRP B 1 447 ? 15.900  0.216   -49.342 1.00 57.77  ? 1950 TRP B NE1 1 
ATOM   6930 C CE2 . TRP B 1 447 ? 14.939  -0.569  -49.920 1.00 57.77  ? 1950 TRP B CE2 1 
ATOM   6931 C CE3 . TRP B 1 447 ? 14.825  -2.681  -51.104 1.00 57.66  ? 1950 TRP B CE3 1 
ATOM   6932 C CZ2 . TRP B 1 447 ? 13.558  -0.374  -50.027 1.00 57.90  ? 1950 TRP B CZ2 1 
ATOM   6933 C CZ3 . TRP B 1 447 ? 13.444  -2.485  -51.213 1.00 58.72  ? 1950 TRP B CZ3 1 
ATOM   6934 C CH2 . TRP B 1 447 ? 12.830  -1.340  -50.675 1.00 58.43  ? 1950 TRP B CH2 1 
ATOM   6935 N N   . PRO B 1 448 ? 18.262  -2.566  -47.015 1.00 55.47  ? 1951 PRO B N   1 
ATOM   6936 C CA  . PRO B 1 448 ? 17.575  -2.932  -45.771 1.00 54.59  ? 1951 PRO B CA  1 
ATOM   6937 C C   . PRO B 1 448 ? 16.084  -3.201  -45.935 1.00 54.26  ? 1951 PRO B C   1 
ATOM   6938 O O   . PRO B 1 448 ? 15.495  -3.922  -45.130 1.00 53.86  ? 1951 PRO B O   1 
ATOM   6939 C CB  . PRO B 1 448 ? 17.841  -1.734  -44.866 1.00 55.04  ? 1951 PRO B CB  1 
ATOM   6940 C CG  . PRO B 1 448 ? 19.167  -1.239  -45.347 1.00 56.57  ? 1951 PRO B CG  1 
ATOM   6941 C CD  . PRO B 1 448 ? 18.989  -1.295  -46.847 1.00 56.01  ? 1951 PRO B CD  1 
ATOM   6942 N N   . GLY B 1 449 ? 15.485  -2.626  -46.978 1.00 53.67  ? 1952 GLY B N   1 
ATOM   6943 C CA  . GLY B 1 449 ? 14.062  -2.809  -47.215 1.00 53.31  ? 1952 GLY B CA  1 
ATOM   6944 C C   . GLY B 1 449 ? 13.628  -3.939  -48.142 1.00 52.68  ? 1952 GLY B C   1 
ATOM   6945 O O   . GLY B 1 449 ? 12.449  -4.049  -48.474 1.00 53.49  ? 1952 GLY B O   1 
ATOM   6946 N N   . TYR B 1 450 ? 14.554  -4.782  -48.581 1.00 51.49  ? 1953 TYR B N   1 
ATOM   6947 C CA  . TYR B 1 450 ? 14.160  -5.875  -49.459 1.00 49.68  ? 1953 TYR B CA  1 
ATOM   6948 C C   . TYR B 1 450 ? 13.187  -6.788  -48.722 1.00 48.97  ? 1953 TYR B C   1 
ATOM   6949 O O   . TYR B 1 450 ? 13.453  -7.215  -47.600 1.00 47.15  ? 1953 TYR B O   1 
ATOM   6950 C CB  . TYR B 1 450 ? 15.363  -6.700  -49.899 1.00 46.78  ? 1953 TYR B CB  1 
ATOM   6951 C CG  . TYR B 1 450 ? 14.956  -7.974  -50.605 1.00 44.27  ? 1953 TYR B CG  1 
ATOM   6952 C CD1 . TYR B 1 450 ? 14.350  -7.940  -51.867 1.00 43.53  ? 1953 TYR B CD1 1 
ATOM   6953 C CD2 . TYR B 1 450 ? 15.168  -9.208  -50.013 1.00 42.28  ? 1953 TYR B CD2 1 
ATOM   6954 C CE1 . TYR B 1 450 ? 13.974  -9.122  -52.517 1.00 41.86  ? 1953 TYR B CE1 1 
ATOM   6955 C CE2 . TYR B 1 450 ? 14.797  -10.385 -50.646 1.00 42.48  ? 1953 TYR B CE2 1 
ATOM   6956 C CZ  . TYR B 1 450 ? 14.205  -10.342 -51.897 1.00 41.65  ? 1953 TYR B CZ  1 
ATOM   6957 O OH  . TYR B 1 450 ? 13.879  -11.529 -52.521 1.00 41.00  ? 1953 TYR B OH  1 
ATOM   6958 N N   . GLY B 1 451 ? 12.067  -7.090  -49.368 1.00 50.16  ? 1954 GLY B N   1 
ATOM   6959 C CA  . GLY B 1 451 ? 11.063  -7.947  -48.760 1.00 51.70  ? 1954 GLY B CA  1 
ATOM   6960 C C   . GLY B 1 451 ? 9.848   -7.139  -48.352 1.00 51.69  ? 1954 GLY B C   1 
ATOM   6961 O O   . GLY B 1 451 ? 8.988   -7.603  -47.586 1.00 52.48  ? 1954 GLY B O   1 
ATOM   6962 N N   . SER B 1 452 ? 9.795   -5.916  -48.875 1.00 50.92  ? 1955 SER B N   1 
ATOM   6963 C CA  . SER B 1 452 ? 8.712   -4.982  -48.612 1.00 50.48  ? 1955 SER B CA  1 
ATOM   6964 C C   . SER B 1 452 ? 8.061   -4.647  -49.933 1.00 49.61  ? 1955 SER B C   1 
ATOM   6965 O O   . SER B 1 452 ? 8.728   -4.594  -50.950 1.00 49.69  ? 1955 SER B O   1 
ATOM   6966 C CB  . SER B 1 452 ? 9.257   -3.685  -48.014 1.00 50.39  ? 1955 SER B CB  1 
ATOM   6967 O OG  . SER B 1 452 ? 10.286  -3.940  -47.078 1.00 52.22  ? 1955 SER B OG  1 
ATOM   6968 N N   . THR B 1 453 ? 6.758   -4.420  -49.912 1.00 50.35  ? 1956 THR B N   1 
ATOM   6969 C CA  . THR B 1 453 ? 6.029   -4.044  -51.111 1.00 50.62  ? 1956 THR B CA  1 
ATOM   6970 C C   . THR B 1 453 ? 5.940   -2.506  -51.066 1.00 51.69  ? 1956 THR B C   1 
ATOM   6971 O O   . THR B 1 453 ? 5.523   -1.936  -50.049 1.00 52.83  ? 1956 THR B O   1 
ATOM   6972 C CB  . THR B 1 453 ? 4.610   -4.678  -51.108 1.00 51.44  ? 1956 THR B CB  1 
ATOM   6973 O OG1 . THR B 1 453 ? 4.716   -6.109  -51.216 1.00 50.11  ? 1956 THR B OG1 1 
ATOM   6974 C CG2 . THR B 1 453 ? 3.775   -4.140  -52.265 1.00 50.97  ? 1956 THR B CG2 1 
ATOM   6975 N N   . LEU B 1 454 ? 6.350   -1.837  -52.146 1.00 51.40  ? 1957 LEU B N   1 
ATOM   6976 C CA  . LEU B 1 454 ? 6.328   -0.373  -52.198 1.00 50.86  ? 1957 LEU B CA  1 
ATOM   6977 C C   . LEU B 1 454 ? 5.120   0.187   -52.891 1.00 51.85  ? 1957 LEU B C   1 
ATOM   6978 O O   . LEU B 1 454 ? 4.938   -0.042  -54.075 1.00 52.59  ? 1957 LEU B O   1 
ATOM   6979 C CB  . LEU B 1 454 ? 7.541   0.181   -52.937 1.00 48.86  ? 1957 LEU B CB  1 
ATOM   6980 C CG  . LEU B 1 454 ? 8.931   0.037   -52.343 1.00 47.67  ? 1957 LEU B CG  1 
ATOM   6981 C CD1 . LEU B 1 454 ? 8.927   0.533   -50.913 1.00 47.40  ? 1957 LEU B CD1 1 
ATOM   6982 C CD2 . LEU B 1 454 ? 9.353   -1.407  -52.415 1.00 49.41  ? 1957 LEU B CD2 1 
ATOM   6983 N N   . PHE B 1 455 ? 4.299   0.933   -52.160 1.00 53.97  ? 1958 PHE B N   1 
ATOM   6984 C CA  . PHE B 1 455 ? 3.130   1.564   -52.759 1.00 56.24  ? 1958 PHE B CA  1 
ATOM   6985 C C   . PHE B 1 455 ? 3.376   3.068   -52.887 1.00 58.97  ? 1958 PHE B C   1 
ATOM   6986 O O   . PHE B 1 455 ? 3.829   3.729   -51.941 1.00 59.45  ? 1958 PHE B O   1 
ATOM   6987 C CB  . PHE B 1 455 ? 1.873   1.327   -51.928 1.00 54.55  ? 1958 PHE B CB  1 
ATOM   6988 C CG  . PHE B 1 455 ? 1.523   -0.114  -51.756 1.00 53.97  ? 1958 PHE B CG  1 
ATOM   6989 C CD1 . PHE B 1 455 ? 2.140   -0.886  -50.766 1.00 54.11  ? 1958 PHE B CD1 1 
ATOM   6990 C CD2 . PHE B 1 455 ? 0.563   -0.701  -52.563 1.00 52.17  ? 1958 PHE B CD2 1 
ATOM   6991 C CE1 . PHE B 1 455 ? 1.800   -2.219  -50.581 1.00 53.07  ? 1958 PHE B CE1 1 
ATOM   6992 C CE2 . PHE B 1 455 ? 0.215   -2.039  -52.385 1.00 54.16  ? 1958 PHE B CE2 1 
ATOM   6993 C CZ  . PHE B 1 455 ? 0.836   -2.799  -51.389 1.00 53.14  ? 1958 PHE B CZ  1 
ATOM   6994 N N   . ASP B 1 456 ? 3.090   3.601   -54.068 1.00 62.27  ? 1959 ASP B N   1 
ATOM   6995 C CA  . ASP B 1 456 ? 3.273   5.023   -54.323 1.00 65.12  ? 1959 ASP B CA  1 
ATOM   6996 C C   . ASP B 1 456 ? 2.139   5.728   -53.606 1.00 65.90  ? 1959 ASP B C   1 
ATOM   6997 O O   . ASP B 1 456 ? 0.982   5.315   -53.707 1.00 65.17  ? 1959 ASP B O   1 
ATOM   6998 C CB  . ASP B 1 456 ? 3.184   5.312   -55.824 1.00 66.96  ? 1959 ASP B CB  1 
ATOM   6999 C CG  . ASP B 1 456 ? 4.177   4.505   -56.634 1.00 68.57  ? 1959 ASP B CG  1 
ATOM   7000 O OD1 . ASP B 1 456 ? 3.972   4.384   -57.863 1.00 69.95  ? 1959 ASP B OD1 1 
ATOM   7001 O OD2 . ASP B 1 456 ? 5.163   4.001   -56.045 1.00 69.84  ? 1959 ASP B OD2 1 
ATOM   7002 N N   . VAL B 1 457 ? 2.470   6.777   -52.866 1.00 67.39  ? 1960 VAL B N   1 
ATOM   7003 C CA  . VAL B 1 457 ? 1.446   7.514   -52.144 1.00 69.00  ? 1960 VAL B CA  1 
ATOM   7004 C C   . VAL B 1 457 ? 1.689   9.007   -52.178 1.00 70.69  ? 1960 VAL B C   1 
ATOM   7005 O O   . VAL B 1 457 ? 2.827   9.464   -52.297 1.00 69.58  ? 1960 VAL B O   1 
ATOM   7006 C CB  . VAL B 1 457 ? 1.346   7.066   -50.657 1.00 68.13  ? 1960 VAL B CB  1 
ATOM   7007 C CG1 . VAL B 1 457 ? 0.658   5.708   -50.559 1.00 67.41  ? 1960 VAL B CG1 1 
ATOM   7008 C CG2 . VAL B 1 457 ? 2.727   7.015   -50.035 1.00 66.54  ? 1960 VAL B CG2 1 
ATOM   7009 N N   . GLU B 1 458 ? 0.594   9.754   -52.085 1.00 73.58  ? 1961 GLU B N   1 
ATOM   7010 C CA  . GLU B 1 458 ? 0.620   11.208  -52.066 1.00 76.29  ? 1961 GLU B CA  1 
ATOM   7011 C C   . GLU B 1 458 ? 0.359   11.637  -50.618 1.00 78.23  ? 1961 GLU B C   1 
ATOM   7012 O O   . GLU B 1 458 ? -0.653  11.242  -50.011 1.00 77.54  ? 1961 GLU B O   1 
ATOM   7013 C CB  . GLU B 1 458 ? -0.465  11.769  -52.995 1.00 76.30  ? 1961 GLU B CB  1 
ATOM   7014 N N   . CYS B 1 459 ? 1.286   12.428  -50.073 1.00 80.18  ? 1962 CYS B N   1 
ATOM   7015 C CA  . CYS B 1 459 ? 1.203   12.923  -48.699 1.00 81.65  ? 1962 CYS B CA  1 
ATOM   7016 C C   . CYS B 1 459 ? 0.155   14.029  -48.574 1.00 82.87  ? 1962 CYS B C   1 
ATOM   7017 O O   . CYS B 1 459 ? 0.361   15.145  -49.055 1.00 83.48  ? 1962 CYS B O   1 
ATOM   7018 C CB  . CYS B 1 459 ? 2.573   13.452  -48.270 1.00 81.43  ? 1962 CYS B CB  1 
ATOM   7019 S SG  . CYS B 1 459 ? 2.759   13.824  -46.511 1.00 81.82  ? 1962 CYS B SG  1 
ATOM   7020 N N   . LYS B 1 460 ? -0.970  13.710  -47.937 1.00 84.25  ? 1963 LYS B N   1 
ATOM   7021 C CA  . LYS B 1 460 ? -2.051  14.676  -47.751 1.00 85.43  ? 1963 LYS B CA  1 
ATOM   7022 C C   . LYS B 1 460 ? -1.705  15.594  -46.582 1.00 86.15  ? 1963 LYS B C   1 
ATOM   7023 O O   . LYS B 1 460 ? -1.329  16.756  -46.779 1.00 86.43  ? 1963 LYS B O   1 
ATOM   7024 C CB  . LYS B 1 460 ? -3.373  13.947  -47.476 1.00 84.63  ? 1963 LYS B CB  1 
ATOM   7025 N N   . GLU B 1 461 ? -1.834  15.061  -45.370 1.00 86.66  ? 1964 GLU B N   1 
ATOM   7026 C CA  . GLU B 1 461 ? -1.524  15.797  -44.145 1.00 86.62  ? 1964 GLU B CA  1 
ATOM   7027 C C   . GLU B 1 461 ? -0.740  14.911  -43.188 1.00 86.07  ? 1964 GLU B C   1 
ATOM   7028 O O   . GLU B 1 461 ? -1.272  13.925  -42.680 1.00 86.08  ? 1964 GLU B O   1 
ATOM   7029 C CB  . GLU B 1 461 ? -2.808  16.274  -43.455 1.00 87.19  ? 1964 GLU B CB  1 
ATOM   7030 C CG  . GLU B 1 461 ? -3.332  17.606  -43.970 1.00 88.15  ? 1964 GLU B CG  1 
ATOM   7031 C CD  . GLU B 1 461 ? -4.611  18.034  -43.284 1.00 88.75  ? 1964 GLU B CD  1 
ATOM   7032 O OE1 . GLU B 1 461 ? -5.653  17.383  -43.509 1.00 88.75  ? 1964 GLU B OE1 1 
ATOM   7033 O OE2 . GLU B 1 461 ? -4.570  19.018  -42.514 1.00 88.82  ? 1964 GLU B OE2 1 
ATOM   7034 N N   . GLY B 1 462 ? 0.522   15.265  -42.948 1.00 85.63  ? 1965 GLY B N   1 
ATOM   7035 C CA  . GLY B 1 462 ? 1.354   14.481  -42.049 1.00 84.66  ? 1965 GLY B CA  1 
ATOM   7036 C C   . GLY B 1 462 ? 2.739   15.051  -41.790 1.00 83.67  ? 1965 GLY B C   1 
ATOM   7037 O O   . GLY B 1 462 ? 3.349   14.761  -40.756 1.00 83.22  ? 1965 GLY B O   1 
ATOM   7038 N N   . GLY B 1 463 ? 3.240   15.853  -42.726 1.00 82.63  ? 1966 GLY B N   1 
ATOM   7039 C CA  . GLY B 1 463 ? 4.556   16.445  -42.563 1.00 82.71  ? 1966 GLY B CA  1 
ATOM   7040 C C   . GLY B 1 463 ? 5.634   15.739  -43.367 1.00 83.06  ? 1966 GLY B C   1 
ATOM   7041 O O   . GLY B 1 463 ? 6.812   15.765  -43.002 1.00 82.83  ? 1966 GLY B O   1 
ATOM   7042 N N   . PHE B 1 464 ? 5.225   15.108  -44.466 1.00 83.22  ? 1967 PHE B N   1 
ATOM   7043 C CA  . PHE B 1 464 ? 6.143   14.384  -45.345 1.00 83.21  ? 1967 PHE B CA  1 
ATOM   7044 C C   . PHE B 1 464 ? 6.127   15.017  -46.731 1.00 83.30  ? 1967 PHE B C   1 
ATOM   7045 O O   . PHE B 1 464 ? 5.178   15.720  -47.085 1.00 83.62  ? 1967 PHE B O   1 
ATOM   7046 C CB  . PHE B 1 464 ? 5.728   12.906  -45.466 1.00 83.06  ? 1967 PHE B CB  1 
ATOM   7047 C CG  . PHE B 1 464 ? 5.919   12.103  -44.203 1.00 82.46  ? 1967 PHE B CG  1 
ATOM   7048 C CD1 . PHE B 1 464 ? 7.194   11.909  -43.668 1.00 82.57  ? 1967 PHE B CD1 1 
ATOM   7049 C CD2 . PHE B 1 464 ? 4.826   11.526  -43.557 1.00 81.64  ? 1967 PHE B CD2 1 
ATOM   7050 C CE1 . PHE B 1 464 ? 7.378   11.153  -42.511 1.00 81.93  ? 1967 PHE B CE1 1 
ATOM   7051 C CE2 . PHE B 1 464 ? 4.996   10.767  -42.400 1.00 81.21  ? 1967 PHE B CE2 1 
ATOM   7052 C CZ  . PHE B 1 464 ? 6.273   10.580  -41.876 1.00 81.82  ? 1967 PHE B CZ  1 
ATOM   7053 N N   . PRO B 1 465 ? 7.183   14.781  -47.531 1.00 82.92  ? 1968 PRO B N   1 
ATOM   7054 C CA  . PRO B 1 465 ? 7.289   15.326  -48.890 1.00 83.12  ? 1968 PRO B CA  1 
ATOM   7055 C C   . PRO B 1 465 ? 6.091   14.893  -49.726 1.00 83.39  ? 1968 PRO B C   1 
ATOM   7056 O O   . PRO B 1 465 ? 5.249   14.144  -49.246 1.00 83.98  ? 1968 PRO B O   1 
ATOM   7057 C CB  . PRO B 1 465 ? 8.599   14.733  -49.391 1.00 82.71  ? 1968 PRO B CB  1 
ATOM   7058 C CG  . PRO B 1 465 ? 9.425   14.670  -48.144 1.00 82.31  ? 1968 PRO B CG  1 
ATOM   7059 C CD  . PRO B 1 465 ? 8.444   14.131  -47.131 1.00 83.12  ? 1968 PRO B CD  1 
ATOM   7060 N N   . GLN B 1 466 ? 6.004   15.352  -50.970 1.00 83.81  ? 1969 GLN B N   1 
ATOM   7061 C CA  . GLN B 1 466 ? 4.869   14.977  -51.808 1.00 84.80  ? 1969 GLN B CA  1 
ATOM   7062 C C   . GLN B 1 466 ? 4.935   13.530  -52.292 1.00 84.29  ? 1969 GLN B C   1 
ATOM   7063 O O   . GLN B 1 466 ? 4.268   12.661  -51.728 1.00 85.33  ? 1969 GLN B O   1 
ATOM   7064 C CB  . GLN B 1 466 ? 4.749   15.908  -53.016 1.00 85.92  ? 1969 GLN B CB  1 
ATOM   7065 C CG  . GLN B 1 466 ? 3.578   15.555  -53.925 1.00 87.32  ? 1969 GLN B CG  1 
ATOM   7066 C CD  . GLN B 1 466 ? 3.441   16.506  -55.089 1.00 88.72  ? 1969 GLN B CD  1 
ATOM   7067 O OE1 . GLN B 1 466 ? 2.618   16.295  -55.991 1.00 88.89  ? 1969 GLN B OE1 1 
ATOM   7068 N NE2 . GLN B 1 466 ? 4.244   17.570  -55.077 1.00 88.08  ? 1969 GLN B NE2 1 
ATOM   7069 N N   . GLU B 1 467 ? 5.719   13.283  -53.345 1.00 82.62  ? 1970 GLU B N   1 
ATOM   7070 C CA  . GLU B 1 467 ? 5.878   11.941  -53.908 1.00 79.90  ? 1970 GLU B CA  1 
ATOM   7071 C C   . GLU B 1 467 ? 6.398   11.037  -52.797 1.00 77.21  ? 1970 GLU B C   1 
ATOM   7072 O O   . GLU B 1 467 ? 7.530   11.191  -52.355 1.00 77.46  ? 1970 GLU B O   1 
ATOM   7073 C CB  . GLU B 1 467 ? 6.869   11.974  -55.078 1.00 81.08  ? 1970 GLU B CB  1 
ATOM   7074 C CG  . GLU B 1 467 ? 6.514   12.995  -56.154 1.00 82.67  ? 1970 GLU B CG  1 
ATOM   7075 C CD  . GLU B 1 467 ? 7.372   12.867  -57.405 1.00 83.83  ? 1970 GLU B CD  1 
ATOM   7076 O OE1 . GLU B 1 467 ? 7.227   13.722  -58.306 1.00 84.20  ? 1970 GLU B OE1 1 
ATOM   7077 O OE2 . GLU B 1 467 ? 8.185   11.916  -57.493 1.00 84.26  ? 1970 GLU B OE2 1 
ATOM   7078 N N   . LEU B 1 468 ? 5.575   10.089  -52.357 1.00 74.23  ? 1971 LEU B N   1 
ATOM   7079 C CA  . LEU B 1 468 ? 5.953   9.205   -51.259 1.00 71.00  ? 1971 LEU B CA  1 
ATOM   7080 C C   . LEU B 1 468 ? 5.831   7.708   -51.551 1.00 68.50  ? 1971 LEU B C   1 
ATOM   7081 O O   . LEU B 1 468 ? 5.181   7.283   -52.509 1.00 67.75  ? 1971 LEU B O   1 
ATOM   7082 C CB  . LEU B 1 468 ? 5.102   9.551   -50.034 1.00 71.04  ? 1971 LEU B CB  1 
ATOM   7083 C CG  . LEU B 1 468 ? 5.750   9.692   -48.660 1.00 71.43  ? 1971 LEU B CG  1 
ATOM   7084 C CD1 . LEU B 1 468 ? 6.886   10.719  -48.704 1.00 70.96  ? 1971 LEU B CD1 1 
ATOM   7085 C CD2 . LEU B 1 468 ? 4.667   10.116  -47.671 1.00 70.61  ? 1971 LEU B CD2 1 
ATOM   7086 N N   . TRP B 1 469 ? 6.464   6.919   -50.692 1.00 65.70  ? 1972 TRP B N   1 
ATOM   7087 C CA  . TRP B 1 469 ? 6.456   5.465   -50.800 1.00 62.48  ? 1972 TRP B CA  1 
ATOM   7088 C C   . TRP B 1 469 ? 5.991   4.849   -49.493 1.00 60.62  ? 1972 TRP B C   1 
ATOM   7089 O O   . TRP B 1 469 ? 6.525   5.157   -48.425 1.00 60.36  ? 1972 TRP B O   1 
ATOM   7090 C CB  . TRP B 1 469 ? 7.861   4.932   -51.076 1.00 62.11  ? 1972 TRP B CB  1 
ATOM   7091 C CG  . TRP B 1 469 ? 8.082   4.390   -52.452 1.00 61.32  ? 1972 TRP B CG  1 
ATOM   7092 C CD1 . TRP B 1 469 ? 7.131   4.063   -53.380 1.00 60.84  ? 1972 TRP B CD1 1 
ATOM   7093 C CD2 . TRP B 1 469 ? 9.349   4.100   -53.054 1.00 60.40  ? 1972 TRP B CD2 1 
ATOM   7094 N NE1 . TRP B 1 469 ? 7.732   3.592   -54.521 1.00 60.68  ? 1972 TRP B NE1 1 
ATOM   7095 C CE2 . TRP B 1 469 ? 9.091   3.604   -54.346 1.00 60.20  ? 1972 TRP B CE2 1 
ATOM   7096 C CE3 . TRP B 1 469 ? 10.681  4.210   -52.621 1.00 60.13  ? 1972 TRP B CE3 1 
ATOM   7097 C CZ2 . TRP B 1 469 ? 10.114  3.220   -55.213 1.00 61.19  ? 1972 TRP B CZ2 1 
ATOM   7098 C CZ3 . TRP B 1 469 ? 11.701  3.826   -53.483 1.00 60.21  ? 1972 TRP B CZ3 1 
ATOM   7099 C CH2 . TRP B 1 469 ? 11.411  3.337   -54.765 1.00 61.38  ? 1972 TRP B CH2 1 
ATOM   7100 N N   . LEU B 1 470 ? 5.002   3.973   -49.573 1.00 57.83  ? 1973 LEU B N   1 
ATOM   7101 C CA  . LEU B 1 470 ? 4.517   3.306   -48.378 1.00 54.37  ? 1973 LEU B CA  1 
ATOM   7102 C C   . LEU B 1 470 ? 5.085   1.888   -48.458 1.00 52.44  ? 1973 LEU B C   1 
ATOM   7103 O O   . LEU B 1 470 ? 4.583   1.053   -49.201 1.00 53.56  ? 1973 LEU B O   1 
ATOM   7104 C CB  . LEU B 1 470 ? 2.991   3.283   -48.382 1.00 53.90  ? 1973 LEU B CB  1 
ATOM   7105 C CG  . LEU B 1 470 ? 2.245   3.474   -47.060 1.00 54.69  ? 1973 LEU B CG  1 
ATOM   7106 C CD1 . LEU B 1 470 ? 2.705   4.749   -46.381 1.00 54.92  ? 1973 LEU B CD1 1 
ATOM   7107 C CD2 . LEU B 1 470 ? 0.738   3.528   -47.328 1.00 53.78  ? 1973 LEU B CD2 1 
ATOM   7108 N N   . GLY B 1 471 ? 6.150   1.624   -47.717 1.00 49.47  ? 1974 GLY B N   1 
ATOM   7109 C CA  . GLY B 1 471 ? 6.744   0.303   -47.750 1.00 46.56  ? 1974 GLY B CA  1 
ATOM   7110 C C   . GLY B 1 471 ? 6.177   -0.634  -46.703 1.00 45.17  ? 1974 GLY B C   1 
ATOM   7111 O O   . GLY B 1 471 ? 6.354   -0.407  -45.505 1.00 44.39  ? 1974 GLY B O   1 
ATOM   7112 N N   . VAL B 1 472 ? 5.501   -1.691  -47.152 1.00 43.30  ? 1975 VAL B N   1 
ATOM   7113 C CA  . VAL B 1 472 ? 4.911   -2.660  -46.237 1.00 40.39  ? 1975 VAL B CA  1 
ATOM   7114 C C   . VAL B 1 472 ? 5.733   -3.933  -46.219 1.00 40.23  ? 1975 VAL B C   1 
ATOM   7115 O O   . VAL B 1 472 ? 6.029   -4.504  -47.267 1.00 42.35  ? 1975 VAL B O   1 
ATOM   7116 C CB  . VAL B 1 472 ? 3.468   -2.990  -46.635 1.00 38.68  ? 1975 VAL B CB  1 
ATOM   7117 C CG1 . VAL B 1 472 ? 2.938   -4.154  -45.790 1.00 39.67  ? 1975 VAL B CG1 1 
ATOM   7118 C CG2 . VAL B 1 472 ? 2.602   -1.765  -46.441 1.00 36.26  ? 1975 VAL B CG2 1 
ATOM   7119 N N   . SER B 1 473 ? 6.106   -4.372  -45.021 1.00 38.42  ? 1976 SER B N   1 
ATOM   7120 C CA  . SER B 1 473 ? 6.907   -5.581  -44.862 1.00 36.06  ? 1976 SER B CA  1 
ATOM   7121 C C   . SER B 1 473 ? 6.509   -6.423  -43.641 1.00 34.24  ? 1976 SER B C   1 
ATOM   7122 O O   . SER B 1 473 ? 5.551   -6.119  -42.945 1.00 32.92  ? 1976 SER B O   1 
ATOM   7123 C CB  . SER B 1 473 ? 8.391   -5.193  -44.775 1.00 35.76  ? 1976 SER B CB  1 
ATOM   7124 O OG  . SER B 1 473 ? 8.662   -4.399  -43.630 1.00 36.25  ? 1976 SER B OG  1 
ATOM   7125 N N   . ALA B 1 474 ? 7.261   -7.483  -43.389 1.00 35.91  ? 1977 ALA B N   1 
ATOM   7126 C CA  . ALA B 1 474 ? 7.017   -8.360  -42.249 1.00 39.32  ? 1977 ALA B CA  1 
ATOM   7127 C C   . ALA B 1 474 ? 7.141   -7.630  -40.888 1.00 42.17  ? 1977 ALA B C   1 
ATOM   7128 O O   . ALA B 1 474 ? 6.315   -7.830  -39.993 1.00 41.84  ? 1977 ALA B O   1 
ATOM   7129 C CB  . ALA B 1 474 ? 7.981   -9.537  -42.300 1.00 36.66  ? 1977 ALA B CB  1 
ATOM   7130 N N   . ASP B 1 475 ? 8.170   -6.792  -40.747 1.00 44.85  ? 1978 ASP B N   1 
ATOM   7131 C CA  . ASP B 1 475 ? 8.419   -6.037  -39.523 1.00 48.45  ? 1978 ASP B CA  1 
ATOM   7132 C C   . ASP B 1 475 ? 7.557   -4.776  -39.381 1.00 49.96  ? 1978 ASP B C   1 
ATOM   7133 O O   . ASP B 1 475 ? 6.909   -4.552  -38.354 1.00 51.52  ? 1978 ASP B O   1 
ATOM   7134 C CB  . ASP B 1 475 ? 9.890   -5.606  -39.442 1.00 50.99  ? 1978 ASP B CB  1 
ATOM   7135 C CG  . ASP B 1 475 ? 10.843  -6.776  -39.274 1.00 55.76  ? 1978 ASP B CG  1 
ATOM   7136 O OD1 . ASP B 1 475 ? 10.469  -7.770  -38.602 1.00 57.90  ? 1978 ASP B OD1 1 
ATOM   7137 O OD2 . ASP B 1 475 ? 11.979  -6.692  -39.797 1.00 57.58  ? 1978 ASP B OD2 1 
ATOM   7138 N N   . ALA B 1 476 ? 7.547   -3.936  -40.406 1.00 49.91  ? 1979 ALA B N   1 
ATOM   7139 C CA  . ALA B 1 476 ? 6.778   -2.707  -40.302 1.00 49.36  ? 1979 ALA B CA  1 
ATOM   7140 C C   . ALA B 1 476 ? 6.328   -2.175  -41.634 1.00 48.42  ? 1979 ALA B C   1 
ATOM   7141 O O   . ALA B 1 476 ? 6.509   -2.814  -42.668 1.00 48.24  ? 1979 ALA B O   1 
ATOM   7142 C CB  . ALA B 1 476 ? 7.615   -1.651  -39.606 1.00 49.18  ? 1979 ALA B CB  1 
ATOM   7143 N N   . VAL B 1 477 ? 5.723   -0.994  -41.581 1.00 47.29  ? 1980 VAL B N   1 
ATOM   7144 C CA  . VAL B 1 477 ? 5.276   -0.276  -42.767 1.00 47.53  ? 1980 VAL B CA  1 
ATOM   7145 C C   . VAL B 1 477 ? 6.038   1.037   -42.651 1.00 47.10  ? 1980 VAL B C   1 
ATOM   7146 O O   . VAL B 1 477 ? 5.957   1.725   -41.645 1.00 47.22  ? 1980 VAL B O   1 
ATOM   7147 C CB  . VAL B 1 477 ? 3.726   -0.056  -42.780 1.00 47.00  ? 1980 VAL B CB  1 
ATOM   7148 C CG1 . VAL B 1 477 ? 3.198   0.121   -41.377 1.00 49.18  ? 1980 VAL B CG1 1 
ATOM   7149 C CG2 . VAL B 1 477 ? 3.377   1.157   -43.616 1.00 47.89  ? 1980 VAL B CG2 1 
ATOM   7150 N N   . SER B 1 478 ? 6.818   1.362   -43.666 1.00 48.29  ? 1981 SER B N   1 
ATOM   7151 C CA  . SER B 1 478 ? 7.619   2.569   -43.616 1.00 49.73  ? 1981 SER B CA  1 
ATOM   7152 C C   . SER B 1 478 ? 7.241   3.615   -44.637 1.00 51.20  ? 1981 SER B C   1 
ATOM   7153 O O   . SER B 1 478 ? 6.448   3.369   -45.543 1.00 51.98  ? 1981 SER B O   1 
ATOM   7154 C CB  . SER B 1 478 ? 9.086   2.206   -43.784 1.00 49.21  ? 1981 SER B CB  1 
ATOM   7155 O OG  . SER B 1 478 ? 9.429   1.191   -42.855 1.00 49.37  ? 1981 SER B OG  1 
ATOM   7156 N N   . VAL B 1 479 ? 7.811   4.799   -44.469 1.00 52.67  ? 1982 VAL B N   1 
ATOM   7157 C CA  . VAL B 1 479 ? 7.552   5.895   -45.381 1.00 53.21  ? 1982 VAL B CA  1 
ATOM   7158 C C   . VAL B 1 479 ? 8.872   6.297   -45.989 1.00 53.90  ? 1982 VAL B C   1 
ATOM   7159 O O   . VAL B 1 479 ? 9.768   6.768   -45.294 1.00 54.01  ? 1982 VAL B O   1 
ATOM   7160 C CB  . VAL B 1 479 ? 6.955   7.106   -44.654 1.00 53.86  ? 1982 VAL B CB  1 
ATOM   7161 C CG1 . VAL B 1 479 ? 6.759   8.270   -45.643 1.00 53.09  ? 1982 VAL B CG1 1 
ATOM   7162 C CG2 . VAL B 1 479 ? 5.638   6.701   -43.990 1.00 53.62  ? 1982 VAL B CG2 1 
ATOM   7163 N N   . TYR B 1 480 ? 8.999   6.070   -47.288 1.00 55.71  ? 1983 TYR B N   1 
ATOM   7164 C CA  . TYR B 1 480 ? 10.209  6.436   -48.002 1.00 56.44  ? 1983 TYR B CA  1 
ATOM   7165 C C   . TYR B 1 480 ? 9.949   7.732   -48.749 1.00 57.17  ? 1983 TYR B C   1 
ATOM   7166 O O   . TYR B 1 480 ? 8.803   8.070   -49.062 1.00 56.88  ? 1983 TYR B O   1 
ATOM   7167 C CB  . TYR B 1 480 ? 10.623  5.337   -48.992 1.00 54.81  ? 1983 TYR B CB  1 
ATOM   7168 C CG  . TYR B 1 480 ? 11.124  4.075   -48.323 1.00 54.11  ? 1983 TYR B CG  1 
ATOM   7169 C CD1 . TYR B 1 480 ? 10.242  3.057   -47.939 1.00 52.71  ? 1983 TYR B CD1 1 
ATOM   7170 C CD2 . TYR B 1 480 ? 12.477  3.926   -48.022 1.00 53.42  ? 1983 TYR B CD2 1 
ATOM   7171 C CE1 . TYR B 1 480 ? 10.702  1.926   -47.267 1.00 52.57  ? 1983 TYR B CE1 1 
ATOM   7172 C CE2 . TYR B 1 480 ? 12.950  2.806   -47.351 1.00 53.66  ? 1983 TYR B CE2 1 
ATOM   7173 C CZ  . TYR B 1 480 ? 12.063  1.809   -46.969 1.00 54.17  ? 1983 TYR B CZ  1 
ATOM   7174 O OH  . TYR B 1 480 ? 12.552  0.726   -46.258 1.00 53.11  ? 1983 TYR B OH  1 
ATOM   7175 N N   . LYS B 1 481 ? 11.021  8.463   -49.004 1.00 59.26  ? 1984 LYS B N   1 
ATOM   7176 C CA  . LYS B 1 481 ? 10.928  9.710   -49.732 1.00 61.26  ? 1984 LYS B CA  1 
ATOM   7177 C C   . LYS B 1 481 ? 10.149  9.371   -50.996 1.00 62.45  ? 1984 LYS B C   1 
ATOM   7178 O O   . LYS B 1 481 ? 9.040   9.865   -51.199 1.00 62.39  ? 1984 LYS B O   1 
ATOM   7179 C CB  . LYS B 1 481 ? 12.335  10.207  -50.083 1.00 62.26  ? 1984 LYS B CB  1 
ATOM   7180 C CG  . LYS B 1 481 ? 13.463  9.337   -49.516 1.00 61.44  ? 1984 LYS B CG  1 
ATOM   7181 C CD  . LYS B 1 481 ? 13.414  9.250   -47.979 1.00 60.93  ? 1984 LYS B CD  1 
ATOM   7182 C CE  . LYS B 1 481 ? 14.767  9.562   -47.319 1.00 61.32  ? 1984 LYS B CE  1 
ATOM   7183 N NZ  . LYS B 1 481 ? 15.224  10.986  -47.487 1.00 58.44  ? 1984 LYS B NZ  1 
ATOM   7184 N N   . ARG B 1 482 ? 10.734  8.499   -51.818 1.00 63.29  ? 1985 ARG B N   1 
ATOM   7185 C CA  . ARG B 1 482 ? 10.137  8.037   -53.077 1.00 64.63  ? 1985 ARG B CA  1 
ATOM   7186 C C   . ARG B 1 482 ? 11.184  7.320   -53.929 1.00 66.08  ? 1985 ARG B C   1 
ATOM   7187 O O   . ARG B 1 482 ? 10.850  6.654   -54.908 1.00 65.76  ? 1985 ARG B O   1 
ATOM   7188 C CB  . ARG B 1 482 ? 9.542   9.203   -53.876 1.00 64.62  ? 1985 ARG B CB  1 
ATOM   7189 C CG  . ARG B 1 482 ? 9.157   8.842   -55.298 1.00 64.33  ? 1985 ARG B CG  1 
ATOM   7190 C CD  . ARG B 1 482 ? 8.128   7.736   -55.346 1.00 63.77  ? 1985 ARG B CD  1 
ATOM   7191 N NE  . ARG B 1 482 ? 6.782   8.231   -55.092 1.00 63.85  ? 1985 ARG B NE  1 
ATOM   7192 C CZ  . ARG B 1 482 ? 5.692   7.733   -55.672 1.00 65.02  ? 1985 ARG B CZ  1 
ATOM   7193 N NH1 . ARG B 1 482 ? 5.808   6.731   -56.531 1.00 65.15  ? 1985 ARG B NH1 1 
ATOM   7194 N NH2 . ARG B 1 482 ? 4.489   8.233   -55.405 1.00 64.22  ? 1985 ARG B NH2 1 
ATOM   7195 N N   . GLY B 1 483 ? 12.451  7.454   -53.551 1.00 67.26  ? 1986 GLY B N   1 
ATOM   7196 C CA  . GLY B 1 483 ? 13.505  6.795   -54.292 1.00 68.02  ? 1986 GLY B CA  1 
ATOM   7197 C C   . GLY B 1 483 ? 14.768  6.629   -53.471 1.00 70.00  ? 1986 GLY B C   1 
ATOM   7198 O O   . GLY B 1 483 ? 15.868  6.792   -53.992 1.00 71.48  ? 1986 GLY B O   1 
ATOM   7199 N N   . GLU B 1 484 ? 14.631  6.304   -52.191 1.00 70.22  ? 1987 GLU B N   1 
ATOM   7200 C CA  . GLU B 1 484 ? 15.812  6.135   -51.354 1.00 71.21  ? 1987 GLU B CA  1 
ATOM   7201 C C   . GLU B 1 484 ? 15.761  4.897   -50.482 1.00 70.50  ? 1987 GLU B C   1 
ATOM   7202 O O   . GLU B 1 484 ? 14.689  4.460   -50.077 1.00 71.34  ? 1987 GLU B O   1 
ATOM   7203 C CB  . GLU B 1 484 ? 16.010  7.369   -50.487 1.00 72.68  ? 1987 GLU B CB  1 
ATOM   7204 C CG  . GLU B 1 484 ? 16.391  8.586   -51.288 1.00 75.96  ? 1987 GLU B CG  1 
ATOM   7205 C CD  . GLU B 1 484 ? 16.264  9.852   -50.483 1.00 78.09  ? 1987 GLU B CD  1 
ATOM   7206 O OE1 . GLU B 1 484 ? 16.815  9.898   -49.358 1.00 79.64  ? 1987 GLU B OE1 1 
ATOM   7207 O OE2 . GLU B 1 484 ? 15.611  10.799  -50.977 1.00 79.49  ? 1987 GLU B OE2 1 
ATOM   7208 N N   . GLY B 1 485 ? 16.932  4.333   -50.201 1.00 69.72  ? 1988 GLY B N   1 
ATOM   7209 C CA  . GLY B 1 485 ? 17.011  3.137   -49.382 1.00 69.73  ? 1988 GLY B CA  1 
ATOM   7210 C C   . GLY B 1 485 ? 16.811  3.437   -47.909 1.00 69.33  ? 1988 GLY B C   1 
ATOM   7211 O O   . GLY B 1 485 ? 16.423  2.562   -47.122 1.00 69.29  ? 1988 GLY B O   1 
ATOM   7212 N N   . ARG B 1 486 ? 17.100  4.677   -47.527 1.00 68.20  ? 1989 ARG B N   1 
ATOM   7213 C CA  . ARG B 1 486 ? 16.936  5.101   -46.147 1.00 66.29  ? 1989 ARG B CA  1 
ATOM   7214 C C   . ARG B 1 486 ? 15.508  5.600   -46.024 1.00 65.31  ? 1989 ARG B C   1 
ATOM   7215 O O   . ARG B 1 486 ? 15.075  6.485   -46.766 1.00 64.81  ? 1989 ARG B O   1 
ATOM   7216 C CB  . ARG B 1 486 ? 17.919  6.223   -45.794 1.00 65.37  ? 1989 ARG B CB  1 
ATOM   7217 N N   . PRO B 1 487 ? 14.739  5.007   -45.108 1.00 64.69  ? 1990 PRO B N   1 
ATOM   7218 C CA  . PRO B 1 487 ? 13.354  5.438   -44.934 1.00 63.72  ? 1990 PRO B CA  1 
ATOM   7219 C C   . PRO B 1 487 ? 13.279  6.661   -44.025 1.00 63.04  ? 1990 PRO B C   1 
ATOM   7220 O O   . PRO B 1 487 ? 14.154  6.878   -43.181 1.00 61.99  ? 1990 PRO B O   1 
ATOM   7221 C CB  . PRO B 1 487 ? 12.699  4.207   -44.313 1.00 63.88  ? 1990 PRO B CB  1 
ATOM   7222 C CG  . PRO B 1 487 ? 13.809  3.679   -43.440 1.00 62.86  ? 1990 PRO B CG  1 
ATOM   7223 C CD  . PRO B 1 487 ? 15.019  3.782   -44.335 1.00 63.09  ? 1990 PRO B CD  1 
ATOM   7224 N N   . LEU B 1 488 ? 12.231  7.455   -44.213 1.00 62.31  ? 1991 LEU B N   1 
ATOM   7225 C CA  . LEU B 1 488 ? 12.003  8.642   -43.403 1.00 61.11  ? 1991 LEU B CA  1 
ATOM   7226 C C   . LEU B 1 488 ? 11.541  8.187   -42.015 1.00 61.07  ? 1991 LEU B C   1 
ATOM   7227 O O   . LEU B 1 488 ? 12.077  8.618   -40.993 1.00 60.32  ? 1991 LEU B O   1 
ATOM   7228 C CB  . LEU B 1 488 ? 10.929  9.507   -44.067 1.00 60.90  ? 1991 LEU B CB  1 
ATOM   7229 C CG  . LEU B 1 488 ? 11.337  10.875  -44.635 1.00 61.27  ? 1991 LEU B CG  1 
ATOM   7230 C CD1 . LEU B 1 488 ? 12.762  10.842  -45.165 1.00 59.12  ? 1991 LEU B CD1 1 
ATOM   7231 C CD2 . LEU B 1 488 ? 10.350  11.272  -45.726 1.00 59.33  ? 1991 LEU B CD2 1 
ATOM   7232 N N   . GLU B 1 489 ? 10.556  7.293   -41.993 1.00 61.26  ? 1992 GLU B N   1 
ATOM   7233 C CA  . GLU B 1 489 ? 10.010  6.768   -40.744 1.00 60.02  ? 1992 GLU B CA  1 
ATOM   7234 C C   . GLU B 1 489 ? 9.570   5.306   -40.886 1.00 59.00  ? 1992 GLU B C   1 
ATOM   7235 O O   . GLU B 1 489 ? 8.928   4.931   -41.872 1.00 58.51  ? 1992 GLU B O   1 
ATOM   7236 C CB  . GLU B 1 489 ? 8.824   7.628   -40.294 1.00 59.90  ? 1992 GLU B CB  1 
ATOM   7237 C CG  . GLU B 1 489 ? 9.112   8.472   -39.046 1.00 60.29  ? 1992 GLU B CG  1 
ATOM   7238 C CD  . GLU B 1 489 ? 7.906   9.278   -38.586 1.00 59.62  ? 1992 GLU B CD  1 
ATOM   7239 O OE1 . GLU B 1 489 ? 7.599   10.310  -39.224 1.00 59.17  ? 1992 GLU B OE1 1 
ATOM   7240 O OE2 . GLU B 1 489 ? 7.260   8.871   -37.592 1.00 57.74  ? 1992 GLU B OE2 1 
ATOM   7241 N N   . VAL B 1 490 ? 9.930   4.493   -39.894 1.00 57.41  ? 1993 VAL B N   1 
ATOM   7242 C CA  . VAL B 1 490 ? 9.589   3.070   -39.863 1.00 56.52  ? 1993 VAL B CA  1 
ATOM   7243 C C   . VAL B 1 490 ? 8.576   2.755   -38.749 1.00 55.36  ? 1993 VAL B C   1 
ATOM   7244 O O   . VAL B 1 490 ? 8.946   2.657   -37.575 1.00 55.72  ? 1993 VAL B O   1 
ATOM   7245 C CB  . VAL B 1 490 ? 10.871  2.201   -39.674 1.00 55.35  ? 1993 VAL B CB  1 
ATOM   7246 C CG1 . VAL B 1 490 ? 11.700  2.737   -38.530 1.00 57.12  ? 1993 VAL B CG1 1 
ATOM   7247 C CG2 . VAL B 1 490 ? 10.495  0.756   -39.408 1.00 55.52  ? 1993 VAL B CG2 1 
ATOM   7248 N N   . PHE B 1 491 ? 7.306   2.597   -39.131 1.00 54.09  ? 1994 PHE B N   1 
ATOM   7249 C CA  . PHE B 1 491 ? 6.211   2.313   -38.189 1.00 53.80  ? 1994 PHE B CA  1 
ATOM   7250 C C   . PHE B 1 491 ? 5.961   0.824   -37.958 1.00 53.47  ? 1994 PHE B C   1 
ATOM   7251 O O   . PHE B 1 491 ? 5.174   0.208   -38.677 1.00 53.69  ? 1994 PHE B O   1 
ATOM   7252 C CB  . PHE B 1 491 ? 4.896   2.928   -38.688 1.00 53.24  ? 1994 PHE B CB  1 
ATOM   7253 C CG  . PHE B 1 491 ? 4.984   4.392   -38.983 1.00 53.47  ? 1994 PHE B CG  1 
ATOM   7254 C CD1 . PHE B 1 491 ? 4.639   4.880   -40.239 1.00 52.65  ? 1994 PHE B CD1 1 
ATOM   7255 C CD2 . PHE B 1 491 ? 5.388   5.291   -38.003 1.00 52.46  ? 1994 PHE B CD2 1 
ATOM   7256 C CE1 . PHE B 1 491 ? 4.690   6.252   -40.514 1.00 54.05  ? 1994 PHE B CE1 1 
ATOM   7257 C CE2 . PHE B 1 491 ? 5.443   6.666   -38.269 1.00 53.76  ? 1994 PHE B CE2 1 
ATOM   7258 C CZ  . PHE B 1 491 ? 5.093   7.148   -39.525 1.00 52.80  ? 1994 PHE B CZ  1 
ATOM   7259 N N   . GLN B 1 492 ? 6.609   0.251   -36.950 1.00 52.99  ? 1995 GLN B N   1 
ATOM   7260 C CA  . GLN B 1 492 ? 6.435   -1.166  -36.628 1.00 52.91  ? 1995 GLN B CA  1 
ATOM   7261 C C   . GLN B 1 492 ? 4.974   -1.491  -36.290 1.00 52.32  ? 1995 GLN B C   1 
ATOM   7262 O O   . GLN B 1 492 ? 4.228   -0.629  -35.819 1.00 51.54  ? 1995 GLN B O   1 
ATOM   7263 C CB  . GLN B 1 492 ? 7.337   -1.540  -35.457 1.00 53.59  ? 1995 GLN B CB  1 
ATOM   7264 C CG  . GLN B 1 492 ? 8.676   -0.823  -35.508 1.00 54.24  ? 1995 GLN B CG  1 
ATOM   7265 C CD  . GLN B 1 492 ? 9.838   -1.748  -35.267 1.00 53.61  ? 1995 GLN B CD  1 
ATOM   7266 O OE1 . GLN B 1 492 ? 10.047  -2.705  -36.015 1.00 52.53  ? 1995 GLN B OE1 1 
ATOM   7267 N NE2 . GLN B 1 492 ? 10.610  -1.470  -34.222 1.00 53.95  ? 1995 GLN B NE2 1 
ATOM   7268 N N   . TYR B 1 493 ? 4.561   -2.732  -36.536 1.00 51.27  ? 1996 TYR B N   1 
ATOM   7269 C CA  . TYR B 1 493 ? 3.180   -3.108  -36.259 1.00 49.97  ? 1996 TYR B CA  1 
ATOM   7270 C C   . TYR B 1 493 ? 2.812   -2.998  -34.789 1.00 50.23  ? 1996 TYR B C   1 
ATOM   7271 O O   . TYR B 1 493 ? 1.681   -2.642  -34.459 1.00 50.80  ? 1996 TYR B O   1 
ATOM   7272 C CB  . TYR B 1 493 ? 2.889   -4.520  -36.764 1.00 48.19  ? 1996 TYR B CB  1 
ATOM   7273 C CG  . TYR B 1 493 ? 2.945   -4.640  -38.266 1.00 47.14  ? 1996 TYR B CG  1 
ATOM   7274 C CD1 . TYR B 1 493 ? 2.324   -3.700  -39.084 1.00 47.08  ? 1996 TYR B CD1 1 
ATOM   7275 C CD2 . TYR B 1 493 ? 3.610   -5.694  -38.870 1.00 45.78  ? 1996 TYR B CD2 1 
ATOM   7276 C CE1 . TYR B 1 493 ? 2.364   -3.811  -40.471 1.00 46.07  ? 1996 TYR B CE1 1 
ATOM   7277 C CE2 . TYR B 1 493 ? 3.656   -5.813  -40.242 1.00 46.42  ? 1996 TYR B CE2 1 
ATOM   7278 C CZ  . TYR B 1 493 ? 3.032   -4.874  -41.041 1.00 45.28  ? 1996 TYR B CZ  1 
ATOM   7279 O OH  . TYR B 1 493 ? 3.059   -5.024  -42.406 1.00 43.57  ? 1996 TYR B OH  1 
ATOM   7280 N N   . GLU B 1 494 ? 3.758   -3.296  -33.905 1.00 50.80  ? 1997 GLU B N   1 
ATOM   7281 C CA  . GLU B 1 494 ? 3.499   -3.216  -32.474 1.00 52.36  ? 1997 GLU B CA  1 
ATOM   7282 C C   . GLU B 1 494 ? 3.095   -1.805  -32.062 1.00 52.18  ? 1997 GLU B C   1 
ATOM   7283 O O   . GLU B 1 494 ? 2.294   -1.629  -31.150 1.00 53.45  ? 1997 GLU B O   1 
ATOM   7284 C CB  . GLU B 1 494 ? 4.739   -3.611  -31.665 1.00 54.70  ? 1997 GLU B CB  1 
ATOM   7285 C CG  . GLU B 1 494 ? 5.345   -4.954  -32.001 1.00 59.58  ? 1997 GLU B CG  1 
ATOM   7286 C CD  . GLU B 1 494 ? 6.315   -4.899  -33.171 1.00 62.29  ? 1997 GLU B CD  1 
ATOM   7287 O OE1 . GLU B 1 494 ? 7.213   -4.017  -33.173 1.00 63.69  ? 1997 GLU B OE1 1 
ATOM   7288 O OE2 . GLU B 1 494 ? 6.184   -5.753  -34.079 1.00 64.10  ? 1997 GLU B OE2 1 
ATOM   7289 N N   . HIS B 1 495 ? 3.633   -0.807  -32.756 1.00 51.72  ? 1998 HIS B N   1 
ATOM   7290 C CA  . HIS B 1 495 ? 3.378   0.593   -32.433 1.00 52.12  ? 1998 HIS B CA  1 
ATOM   7291 C C   . HIS B 1 495 ? 2.351   1.310   -33.306 1.00 53.59  ? 1998 HIS B C   1 
ATOM   7292 O O   . HIS B 1 495 ? 2.293   2.540   -33.310 1.00 54.64  ? 1998 HIS B O   1 
ATOM   7293 C CB  . HIS B 1 495 ? 4.705   1.342   -32.479 1.00 51.29  ? 1998 HIS B CB  1 
ATOM   7294 C CG  . HIS B 1 495 ? 5.826   0.601   -31.822 1.00 51.25  ? 1998 HIS B CG  1 
ATOM   7295 N ND1 . HIS B 1 495 ? 7.146   0.776   -32.179 1.00 53.02  ? 1998 HIS B ND1 1 
ATOM   7296 C CD2 . HIS B 1 495 ? 5.823   -0.333  -30.842 1.00 51.24  ? 1998 HIS B CD2 1 
ATOM   7297 C CE1 . HIS B 1 495 ? 7.908   -0.019  -31.449 1.00 52.23  ? 1998 HIS B CE1 1 
ATOM   7298 N NE2 . HIS B 1 495 ? 7.129   -0.703  -30.630 1.00 52.60  ? 1998 HIS B NE2 1 
ATOM   7299 N N   . ILE B 1 496 ? 1.544   0.551   -34.041 1.00 54.74  ? 1999 ILE B N   1 
ATOM   7300 C CA  . ILE B 1 496 ? 0.527   1.137   -34.908 1.00 56.16  ? 1999 ILE B CA  1 
ATOM   7301 C C   . ILE B 1 496 ? -0.848  1.069   -34.260 1.00 58.19  ? 1999 ILE B C   1 
ATOM   7302 O O   . ILE B 1 496 ? -1.515  0.041   -34.301 1.00 58.43  ? 1999 ILE B O   1 
ATOM   7303 C CB  . ILE B 1 496 ? 0.467   0.422   -36.280 1.00 55.86  ? 1999 ILE B CB  1 
ATOM   7304 C CG1 . ILE B 1 496 ? 1.760   0.695   -37.056 1.00 53.64  ? 1999 ILE B CG1 1 
ATOM   7305 C CG2 . ILE B 1 496 ? -0.763  0.892   -37.070 1.00 53.44  ? 1999 ILE B CG2 1 
ATOM   7306 C CD1 . ILE B 1 496 ? 1.830   0.000   -38.373 1.00 52.55  ? 1999 ILE B CD1 1 
ATOM   7307 N N   . LEU B 1 497 ? -1.271  2.185   -33.680 1.00 60.46  ? 2000 LEU B N   1 
ATOM   7308 C CA  . LEU B 1 497 ? -2.560  2.275   -33.001 1.00 62.10  ? 2000 LEU B CA  1 
ATOM   7309 C C   . LEU B 1 497 ? -3.700  1.705   -33.841 1.00 62.67  ? 2000 LEU B C   1 
ATOM   7310 O O   . LEU B 1 497 ? -4.469  0.866   -33.367 1.00 62.02  ? 2000 LEU B O   1 
ATOM   7311 C CB  . LEU B 1 497 ? -2.837  3.736   -32.625 1.00 62.48  ? 2000 LEU B CB  1 
ATOM   7312 C CG  . LEU B 1 497 ? -1.605  4.440   -32.027 1.00 63.50  ? 2000 LEU B CG  1 
ATOM   7313 C CD1 . LEU B 1 497 ? -1.960  5.852   -31.630 1.00 64.57  ? 2000 LEU B CD1 1 
ATOM   7314 C CD2 . LEU B 1 497 ? -1.084  3.673   -30.823 1.00 62.87  ? 2000 LEU B CD2 1 
ATOM   7315 N N   . SER B 1 498 ? -3.804  2.146   -35.090 1.00 63.95  ? 2001 SER B N   1 
ATOM   7316 C CA  . SER B 1 498 ? -4.857  1.650   -35.960 1.00 66.00  ? 2001 SER B CA  1 
ATOM   7317 C C   . SER B 1 498 ? -4.596  2.058   -37.405 1.00 66.23  ? 2001 SER B C   1 
ATOM   7318 O O   . SER B 1 498 ? -3.705  2.866   -37.675 1.00 66.91  ? 2001 SER B O   1 
ATOM   7319 C CB  . SER B 1 498 ? -6.210  2.195   -35.487 1.00 67.20  ? 2001 SER B CB  1 
ATOM   7320 O OG  . SER B 1 498 ? -7.284  1.387   -35.946 1.00 71.22  ? 2001 SER B OG  1 
ATOM   7321 N N   . PHE B 1 499 ? -5.360  1.487   -38.333 1.00 66.20  ? 2002 PHE B N   1 
ATOM   7322 C CA  . PHE B 1 499 ? -5.207  1.814   -39.748 1.00 66.61  ? 2002 PHE B CA  1 
ATOM   7323 C C   . PHE B 1 499 ? -6.482  1.508   -40.521 1.00 67.26  ? 2002 PHE B C   1 
ATOM   7324 O O   . PHE B 1 499 ? -7.190  0.551   -40.209 1.00 66.89  ? 2002 PHE B O   1 
ATOM   7325 C CB  . PHE B 1 499 ? -4.010  1.063   -40.375 1.00 65.37  ? 2002 PHE B CB  1 
ATOM   7326 C CG  . PHE B 1 499 ? -4.114  -0.440  -40.305 1.00 64.84  ? 2002 PHE B CG  1 
ATOM   7327 C CD1 . PHE B 1 499 ? -3.716  -1.132  -39.160 1.00 64.93  ? 2002 PHE B CD1 1 
ATOM   7328 C CD2 . PHE B 1 499 ? -4.632  -1.164  -41.377 1.00 63.94  ? 2002 PHE B CD2 1 
ATOM   7329 C CE1 . PHE B 1 499 ? -3.834  -2.523  -39.085 1.00 63.92  ? 2002 PHE B CE1 1 
ATOM   7330 C CE2 . PHE B 1 499 ? -4.754  -2.551  -41.312 1.00 63.24  ? 2002 PHE B CE2 1 
ATOM   7331 C CZ  . PHE B 1 499 ? -4.355  -3.230  -40.164 1.00 64.07  ? 2002 PHE B CZ  1 
ATOM   7332 N N   . GLY B 1 500 ? -6.769  2.330   -41.528 1.00 68.40  ? 2003 GLY B N   1 
ATOM   7333 C CA  . GLY B 1 500 ? -7.968  2.130   -42.323 1.00 69.78  ? 2003 GLY B CA  1 
ATOM   7334 C C   . GLY B 1 500 ? -8.096  3.092   -43.488 1.00 70.78  ? 2003 GLY B C   1 
ATOM   7335 O O   . GLY B 1 500 ? -7.226  3.936   -43.729 1.00 69.68  ? 2003 GLY B O   1 
ATOM   7336 N N   . ALA B 1 501 ? -9.195  2.958   -44.222 1.00 72.30  ? 2004 ALA B N   1 
ATOM   7337 C CA  . ALA B 1 501 ? -9.455  3.812   -45.368 1.00 73.64  ? 2004 ALA B CA  1 
ATOM   7338 C C   . ALA B 1 501 ? -10.728 4.637   -45.157 1.00 74.38  ? 2004 ALA B C   1 
ATOM   7339 O O   . ALA B 1 501 ? -11.842 4.153   -45.381 1.00 73.67  ? 2004 ALA B O   1 
ATOM   7340 C CB  . ALA B 1 501 ? -9.570  2.963   -46.634 1.00 73.20  ? 2004 ALA B CB  1 
ATOM   7341 N N   . PRO B 1 502 ? -10.573 5.891   -44.697 1.00 75.51  ? 2005 PRO B N   1 
ATOM   7342 C CA  . PRO B 1 502 ? -11.694 6.805   -44.450 1.00 77.28  ? 2005 PRO B CA  1 
ATOM   7343 C C   . PRO B 1 502 ? -12.323 7.341   -45.750 1.00 78.18  ? 2005 PRO B C   1 
ATOM   7344 O O   . PRO B 1 502 ? -13.351 8.013   -45.721 1.00 77.96  ? 2005 PRO B O   1 
ATOM   7345 C CB  . PRO B 1 502 ? -11.050 7.926   -43.629 1.00 77.40  ? 2005 PRO B CB  1 
ATOM   7346 C CG  . PRO B 1 502 ? -9.897  7.253   -42.962 1.00 76.70  ? 2005 PRO B CG  1 
ATOM   7347 C CD  . PRO B 1 502 ? -9.342  6.422   -44.087 1.00 76.07  ? 2005 PRO B CD  1 
ATOM   7348 N N   . LEU B 1 503 ? -11.699 7.042   -46.884 1.00 79.38  ? 2006 LEU B N   1 
ATOM   7349 C CA  . LEU B 1 503 ? -12.190 7.508   -48.175 1.00 80.48  ? 2006 LEU B CA  1 
ATOM   7350 C C   . LEU B 1 503 ? -11.755 6.554   -49.285 1.00 80.64  ? 2006 LEU B C   1 
ATOM   7351 O O   . LEU B 1 503 ? -10.698 5.930   -49.199 1.00 80.94  ? 2006 LEU B O   1 
ATOM   7352 C CB  . LEU B 1 503 ? -11.656 8.924   -48.444 1.00 81.33  ? 2006 LEU B CB  1 
ATOM   7353 C CG  . LEU B 1 503 ? -12.009 9.662   -49.742 1.00 82.58  ? 2006 LEU B CG  1 
ATOM   7354 C CD1 . LEU B 1 503 ? -11.199 9.099   -50.910 1.00 81.71  ? 2006 LEU B CD1 1 
ATOM   7355 C CD2 . LEU B 1 503 ? -13.516 9.564   -49.991 1.00 82.51  ? 2006 LEU B CD2 1 
ATOM   7356 N N   . ALA B 1 504 ? -12.578 6.452   -50.324 1.00 80.68  ? 2007 ALA B N   1 
ATOM   7357 C CA  . ALA B 1 504 ? -12.306 5.576   -51.460 1.00 80.94  ? 2007 ALA B CA  1 
ATOM   7358 C C   . ALA B 1 504 ? -10.820 5.449   -51.794 1.00 81.29  ? 2007 ALA B C   1 
ATOM   7359 O O   . ALA B 1 504 ? -10.353 4.362   -52.150 1.00 81.14  ? 2007 ALA B O   1 
ATOM   7360 C CB  . ALA B 1 504 ? -13.071 6.069   -52.681 1.00 80.95  ? 2007 ALA B CB  1 
ATOM   7361 N N   . ASN B 1 505 ? -10.087 6.557   -51.684 1.00 81.09  ? 2008 ASN B N   1 
ATOM   7362 C CA  . ASN B 1 505 ? -8.652  6.568   -51.977 1.00 80.49  ? 2008 ASN B CA  1 
ATOM   7363 C C   . ASN B 1 505 ? -7.841  7.190   -50.838 1.00 79.23  ? 2008 ASN B C   1 
ATOM   7364 O O   . ASN B 1 505 ? -6.846  7.880   -51.073 1.00 79.48  ? 2008 ASN B O   1 
ATOM   7365 C CB  . ASN B 1 505 ? -8.386  7.348   -53.269 1.00 81.78  ? 2008 ASN B CB  1 
ATOM   7366 C CG  . ASN B 1 505 ? -9.349  6.979   -54.385 1.00 82.96  ? 2008 ASN B CG  1 
ATOM   7367 O OD1 . ASN B 1 505 ? -9.448  5.814   -54.778 1.00 83.88  ? 2008 ASN B OD1 1 
ATOM   7368 N ND2 . ASN B 1 505 ? -10.067 7.974   -54.902 1.00 82.93  ? 2008 ASN B ND2 1 
ATOM   7369 N N   . THR B 1 506 ? -8.258  6.938   -49.602 1.00 77.48  ? 2009 THR B N   1 
ATOM   7370 C CA  . THR B 1 506 ? -7.560  7.488   -48.451 1.00 75.77  ? 2009 THR B CA  1 
ATOM   7371 C C   . THR B 1 506 ? -7.137  6.426   -47.439 1.00 74.06  ? 2009 THR B C   1 
ATOM   7372 O O   . THR B 1 506 ? -7.953  5.614   -46.998 1.00 73.35  ? 2009 THR B O   1 
ATOM   7373 C CB  . THR B 1 506 ? -8.435  8.535   -47.748 1.00 76.30  ? 2009 THR B CB  1 
ATOM   7374 O OG1 . THR B 1 506 ? -8.476  9.725   -48.545 1.00 76.49  ? 2009 THR B OG1 1 
ATOM   7375 C CG2 . THR B 1 506 ? -7.886  8.853   -46.365 1.00 76.61  ? 2009 THR B CG2 1 
ATOM   7376 N N   . TYR B 1 507 ? -5.854  6.443   -47.079 1.00 72.14  ? 2010 TYR B N   1 
ATOM   7377 C CA  . TYR B 1 507 ? -5.303  5.497   -46.109 1.00 69.62  ? 2010 TYR B CA  1 
ATOM   7378 C C   . TYR B 1 507 ? -4.864  6.266   -44.870 1.00 67.70  ? 2010 TYR B C   1 
ATOM   7379 O O   . TYR B 1 507 ? -4.226  7.308   -44.974 1.00 67.19  ? 2010 TYR B O   1 
ATOM   7380 C CB  . TYR B 1 507 ? -4.102  4.749   -46.698 1.00 69.39  ? 2010 TYR B CB  1 
ATOM   7381 C CG  . TYR B 1 507 ? -3.918  3.371   -46.103 1.00 68.75  ? 2010 TYR B CG  1 
ATOM   7382 C CD1 . TYR B 1 507 ? -4.961  2.447   -46.132 1.00 68.27  ? 2010 TYR B CD1 1 
ATOM   7383 C CD2 . TYR B 1 507 ? -2.718  2.994   -45.494 1.00 68.24  ? 2010 TYR B CD2 1 
ATOM   7384 C CE1 . TYR B 1 507 ? -4.826  1.187   -45.572 1.00 67.87  ? 2010 TYR B CE1 1 
ATOM   7385 C CE2 . TYR B 1 507 ? -2.573  1.727   -44.926 1.00 67.92  ? 2010 TYR B CE2 1 
ATOM   7386 C CZ  . TYR B 1 507 ? -3.640  0.829   -44.970 1.00 67.97  ? 2010 TYR B CZ  1 
ATOM   7387 O OH  . TYR B 1 507 ? -3.549  -0.424  -44.403 1.00 67.73  ? 2010 TYR B OH  1 
ATOM   7388 N N   . LYS B 1 508 ? -5.193  5.740   -43.696 1.00 66.34  ? 2011 LYS B N   1 
ATOM   7389 C CA  . LYS B 1 508 ? -4.859  6.405   -42.441 1.00 63.89  ? 2011 LYS B CA  1 
ATOM   7390 C C   . LYS B 1 508 ? -4.132  5.475   -41.472 1.00 62.54  ? 2011 LYS B C   1 
ATOM   7391 O O   . LYS B 1 508 ? -4.629  4.396   -41.148 1.00 61.68  ? 2011 LYS B O   1 
ATOM   7392 C CB  . LYS B 1 508 ? -6.155  6.917   -41.795 1.00 63.68  ? 2011 LYS B CB  1 
ATOM   7393 C CG  . LYS B 1 508 ? -6.046  8.243   -41.068 1.00 63.30  ? 2011 LYS B CG  1 
ATOM   7394 C CD  . LYS B 1 508 ? -5.373  8.107   -39.716 1.00 63.97  ? 2011 LYS B CD  1 
ATOM   7395 C CE  . LYS B 1 508 ? -5.336  9.453   -38.989 1.00 63.90  ? 2011 LYS B CE  1 
ATOM   7396 N NZ  . LYS B 1 508 ? -6.694  10.076  -38.916 1.00 62.57  ? 2011 LYS B NZ  1 
ATOM   7397 N N   . ILE B 1 509 ? -2.949  5.896   -41.028 1.00 61.18  ? 2012 ILE B N   1 
ATOM   7398 C CA  . ILE B 1 509 ? -2.162  5.131   -40.056 1.00 60.01  ? 2012 ILE B CA  1 
ATOM   7399 C C   . ILE B 1 509 ? -1.973  5.992   -38.802 1.00 59.32  ? 2012 ILE B C   1 
ATOM   7400 O O   . ILE B 1 509 ? -1.352  7.060   -38.847 1.00 58.81  ? 2012 ILE B O   1 
ATOM   7401 C CB  . ILE B 1 509 ? -0.750  4.734   -40.588 1.00 59.27  ? 2012 ILE B CB  1 
ATOM   7402 C CG1 . ILE B 1 509 ? -0.877  3.877   -41.851 1.00 58.53  ? 2012 ILE B CG1 1 
ATOM   7403 C CG2 . ILE B 1 509 ? 0.009   3.947   -39.509 1.00 57.97  ? 2012 ILE B CG2 1 
ATOM   7404 C CD1 . ILE B 1 509 ? 0.453   3.448   -42.441 1.00 56.67  ? 2012 ILE B CD1 1 
ATOM   7405 N N   . VAL B 1 510 ? -2.517  5.522   -37.688 1.00 58.16  ? 2013 VAL B N   1 
ATOM   7406 C CA  . VAL B 1 510 ? -2.415  6.252   -36.435 1.00 56.96  ? 2013 VAL B CA  1 
ATOM   7407 C C   . VAL B 1 510 ? -1.258  5.727   -35.605 1.00 56.34  ? 2013 VAL B C   1 
ATOM   7408 O O   . VAL B 1 510 ? -1.177  4.531   -35.369 1.00 55.45  ? 2013 VAL B O   1 
ATOM   7409 C CB  . VAL B 1 510 ? -3.718  6.118   -35.634 1.00 55.91  ? 2013 VAL B CB  1 
ATOM   7410 C CG1 . VAL B 1 510 ? -3.642  6.958   -34.386 1.00 56.62  ? 2013 VAL B CG1 1 
ATOM   7411 C CG2 . VAL B 1 510 ? -4.903  6.536   -36.499 1.00 52.94  ? 2013 VAL B CG2 1 
ATOM   7412 N N   . VAL B 1 511 ? -0.367  6.625   -35.181 1.00 57.88  ? 2014 VAL B N   1 
ATOM   7413 C CA  . VAL B 1 511 ? 0.801   6.271   -34.364 1.00 59.86  ? 2014 VAL B CA  1 
ATOM   7414 C C   . VAL B 1 511 ? 1.022   7.289   -33.242 1.00 62.05  ? 2014 VAL B C   1 
ATOM   7415 O O   . VAL B 1 511 ? 1.572   6.963   -32.192 1.00 62.89  ? 2014 VAL B O   1 
ATOM   7416 C CB  . VAL B 1 511 ? 2.102   6.188   -35.210 1.00 59.84  ? 2014 VAL B CB  1 
ATOM   7417 C CG1 . VAL B 1 511 ? 3.323   6.023   -34.299 1.00 59.33  ? 2014 VAL B CG1 1 
ATOM   7418 C CG2 . VAL B 1 511 ? 2.025   5.011   -36.169 1.00 60.36  ? 2014 VAL B CG2 1 
ATOM   7419 N N   . ASP B 1 512 ? 0.598   8.527   -33.471 1.00 65.05  ? 2015 ASP B N   1 
ATOM   7420 C CA  . ASP B 1 512 ? 0.736   9.591   -32.472 1.00 66.43  ? 2015 ASP B CA  1 
ATOM   7421 C C   . ASP B 1 512 ? -0.546  10.407  -32.489 1.00 67.38  ? 2015 ASP B C   1 
ATOM   7422 O O   . ASP B 1 512 ? -1.607  9.926   -32.910 1.00 66.08  ? 2015 ASP B O   1 
ATOM   7423 C CB  . ASP B 1 512 ? 1.894   10.533  -32.823 1.00 67.07  ? 2015 ASP B CB  1 
ATOM   7424 C CG  . ASP B 1 512 ? 3.135   9.795   -33.271 1.00 67.97  ? 2015 ASP B CG  1 
ATOM   7425 O OD1 . ASP B 1 512 ? 3.659   8.980   -32.481 1.00 69.03  ? 2015 ASP B OD1 1 
ATOM   7426 O OD2 . ASP B 1 512 ? 3.583   10.030  -34.417 1.00 67.83  ? 2015 ASP B OD2 1 
ATOM   7427 N N   . GLU B 1 513 ? -0.437  11.651  -32.031 1.00 68.69  ? 2016 GLU B N   1 
ATOM   7428 C CA  . GLU B 1 513 ? -1.579  12.558  -32.033 1.00 70.17  ? 2016 GLU B CA  1 
ATOM   7429 C C   . GLU B 1 513 ? -1.668  13.018  -33.491 1.00 69.86  ? 2016 GLU B C   1 
ATOM   7430 O O   . GLU B 1 513 ? -2.632  13.668  -33.915 1.00 70.12  ? 2016 GLU B O   1 
ATOM   7431 C CB  . GLU B 1 513 ? -1.322  13.745  -31.089 1.00 70.63  ? 2016 GLU B CB  1 
ATOM   7432 N N   . ARG B 1 514 ? -0.639  12.649  -34.250 1.00 69.49  ? 2017 ARG B N   1 
ATOM   7433 C CA  . ARG B 1 514 ? -0.558  12.977  -35.662 1.00 69.60  ? 2017 ARG B CA  1 
ATOM   7434 C C   . ARG B 1 514 ? -1.531  12.156  -36.493 1.00 69.86  ? 2017 ARG B C   1 
ATOM   7435 O O   . ARG B 1 514 ? -1.535  10.923  -36.453 1.00 68.86  ? 2017 ARG B O   1 
ATOM   7436 C CB  . ARG B 1 514 ? 0.853   12.739  -36.193 1.00 68.62  ? 2017 ARG B CB  1 
ATOM   7437 C CG  . ARG B 1 514 ? 1.701   13.971  -36.300 1.00 67.10  ? 2017 ARG B CG  1 
ATOM   7438 C CD  . ARG B 1 514 ? 2.980   13.638  -37.013 1.00 67.99  ? 2017 ARG B CD  1 
ATOM   7439 N NE  . ARG B 1 514 ? 3.667   12.522  -36.375 1.00 67.78  ? 2017 ARG B NE  1 
ATOM   7440 C CZ  . ARG B 1 514 ? 4.650   11.829  -36.941 1.00 69.06  ? 2017 ARG B CZ  1 
ATOM   7441 N NH1 . ARG B 1 514 ? 5.070   12.136  -38.166 1.00 68.66  ? 2017 ARG B NH1 1 
ATOM   7442 N NH2 . ARG B 1 514 ? 5.210   10.819  -36.286 1.00 69.25  ? 2017 ARG B NH2 1 
ATOM   7443 N N   . GLU B 1 515 ? -2.352  12.865  -37.251 1.00 71.45  ? 2018 GLU B N   1 
ATOM   7444 C CA  . GLU B 1 515 ? -3.322  12.239  -38.125 1.00 73.25  ? 2018 GLU B CA  1 
ATOM   7445 C C   . GLU B 1 515 ? -2.638  12.118  -39.493 1.00 74.02  ? 2018 GLU B C   1 
ATOM   7446 O O   . GLU B 1 515 ? -2.757  13.012  -40.337 1.00 73.15  ? 2018 GLU B O   1 
ATOM   7447 C CB  . GLU B 1 515 ? -4.572  13.119  -38.209 1.00 73.59  ? 2018 GLU B CB  1 
ATOM   7448 C CG  . GLU B 1 515 ? -5.212  13.393  -36.840 1.00 75.79  ? 2018 GLU B CG  1 
ATOM   7449 C CD  . GLU B 1 515 ? -6.472  12.562  -36.575 1.00 76.19  ? 2018 GLU B CD  1 
ATOM   7450 O OE1 . GLU B 1 515 ? -7.500  12.804  -37.250 1.00 76.23  ? 2018 GLU B OE1 1 
ATOM   7451 O OE2 . GLU B 1 515 ? -6.438  11.671  -35.693 1.00 75.69  ? 2018 GLU B OE2 1 
ATOM   7452 N N   . LEU B 1 516 ? -1.903  11.019  -39.684 1.00 74.68  ? 2019 LEU B N   1 
ATOM   7453 C CA  . LEU B 1 516 ? -1.175  10.747  -40.928 1.00 74.91  ? 2019 LEU B CA  1 
ATOM   7454 C C   . LEU B 1 516 ? -2.109  10.241  -42.025 1.00 75.77  ? 2019 LEU B C   1 
ATOM   7455 O O   . LEU B 1 516 ? -2.608  9.115   -41.965 1.00 75.64  ? 2019 LEU B O   1 
ATOM   7456 C CB  . LEU B 1 516 ? -0.080  9.714   -40.674 1.00 73.90  ? 2019 LEU B CB  1 
ATOM   7457 C CG  . LEU B 1 516 ? 0.951   10.089  -39.610 1.00 73.97  ? 2019 LEU B CG  1 
ATOM   7458 C CD1 . LEU B 1 516 ? 1.901   8.926   -39.382 1.00 74.14  ? 2019 LEU B CD1 1 
ATOM   7459 C CD2 . LEU B 1 516 ? 1.717   11.323  -40.050 1.00 73.90  ? 2019 LEU B CD2 1 
ATOM   7460 N N   . LEU B 1 517 ? -2.317  11.071  -43.042 1.00 76.49  ? 2020 LEU B N   1 
ATOM   7461 C CA  . LEU B 1 517 ? -3.216  10.738  -44.132 1.00 77.12  ? 2020 LEU B CA  1 
ATOM   7462 C C   . LEU B 1 517 ? -2.478  10.453  -45.428 1.00 77.55  ? 2020 LEU B C   1 
ATOM   7463 O O   . LEU B 1 517 ? -1.517  11.135  -45.772 1.00 77.17  ? 2020 LEU B O   1 
ATOM   7464 C CB  . LEU B 1 517 ? -4.190  11.893  -44.344 1.00 77.39  ? 2020 LEU B CB  1 
ATOM   7465 C CG  . LEU B 1 517 ? -5.568  11.535  -44.888 1.00 78.32  ? 2020 LEU B CG  1 
ATOM   7466 C CD1 . LEU B 1 517 ? -5.450  10.913  -46.279 1.00 77.72  ? 2020 LEU B CD1 1 
ATOM   7467 C CD2 . LEU B 1 517 ? -6.240  10.574  -43.911 1.00 78.96  ? 2020 LEU B CD2 1 
ATOM   7468 N N   . PHE B 1 518 ? -2.947  9.453   -46.163 1.00 78.43  ? 2021 PHE B N   1 
ATOM   7469 C CA  . PHE B 1 518 ? -2.317  9.098   -47.423 1.00 79.80  ? 2021 PHE B CA  1 
ATOM   7470 C C   . PHE B 1 518 ? -3.350  8.890   -48.523 1.00 80.22  ? 2021 PHE B C   1 
ATOM   7471 O O   . PHE B 1 518 ? -4.311  8.137   -48.361 1.00 79.09  ? 2021 PHE B O   1 
ATOM   7472 C CB  . PHE B 1 518 ? -1.467  7.831   -47.246 1.00 80.03  ? 2021 PHE B CB  1 
ATOM   7473 C CG  . PHE B 1 518 ? -0.262  8.028   -46.369 1.00 79.87  ? 2021 PHE B CG  1 
ATOM   7474 C CD1 . PHE B 1 518 ? 0.826   8.772   -46.816 1.00 79.59  ? 2021 PHE B CD1 1 
ATOM   7475 C CD2 . PHE B 1 518 ? -0.225  7.505   -45.079 1.00 79.49  ? 2021 PHE B CD2 1 
ATOM   7476 C CE1 . PHE B 1 518 ? 1.929   8.994   -45.994 1.00 78.61  ? 2021 PHE B CE1 1 
ATOM   7477 C CE2 . PHE B 1 518 ? 0.875   7.723   -44.250 1.00 78.94  ? 2021 PHE B CE2 1 
ATOM   7478 C CZ  . PHE B 1 518 ? 1.953   8.469   -44.712 1.00 78.55  ? 2021 PHE B CZ  1 
ATOM   7479 N N   . GLU B 1 519 ? -3.153  9.583   -49.638 1.00 81.87  ? 2022 GLU B N   1 
ATOM   7480 C CA  . GLU B 1 519 ? -4.052  9.459   -50.778 1.00 83.33  ? 2022 GLU B CA  1 
ATOM   7481 C C   . GLU B 1 519 ? -3.408  8.473   -51.747 1.00 83.01  ? 2022 GLU B C   1 
ATOM   7482 O O   . GLU B 1 519 ? -2.254  8.651   -52.146 1.00 83.06  ? 2022 GLU B O   1 
ATOM   7483 C CB  . GLU B 1 519 ? -4.234  10.815  -51.464 1.00 85.14  ? 2022 GLU B CB  1 
ATOM   7484 C CG  . GLU B 1 519 ? -5.145  10.785  -52.685 1.00 87.15  ? 2022 GLU B CG  1 
ATOM   7485 C CD  . GLU B 1 519 ? -4.571  11.574  -53.849 1.00 88.41  ? 2022 GLU B CD  1 
ATOM   7486 O OE1 . GLU B 1 519 ? -4.268  12.773  -53.659 1.00 89.77  ? 2022 GLU B OE1 1 
ATOM   7487 O OE2 . GLU B 1 519 ? -4.418  10.995  -54.949 1.00 88.47  ? 2022 GLU B OE2 1 
ATOM   7488 N N   . THR B 1 520 ? -4.143  7.429   -52.113 1.00 81.88  ? 2023 THR B N   1 
ATOM   7489 C CA  . THR B 1 520 ? -3.619  6.432   -53.033 1.00 81.28  ? 2023 THR B CA  1 
ATOM   7490 C C   . THR B 1 520 ? -4.659  5.413   -53.454 1.00 80.83  ? 2023 THR B C   1 
ATOM   7491 O O   . THR B 1 520 ? -5.397  4.874   -52.630 1.00 80.36  ? 2023 THR B O   1 
ATOM   7492 C CB  . THR B 1 520 ? -2.420  5.660   -52.429 1.00 81.78  ? 2023 THR B CB  1 
ATOM   7493 O OG1 . THR B 1 520 ? -2.045  4.595   -53.316 1.00 81.29  ? 2023 THR B OG1 1 
ATOM   7494 C CG2 . THR B 1 520 ? -2.782  5.077   -51.063 1.00 81.54  ? 2023 THR B CG2 1 
ATOM   7495 N N   . SER B 1 521 ? -4.719  5.160   -54.755 1.00 80.44  ? 2024 SER B N   1 
ATOM   7496 C CA  . SER B 1 521 ? -5.650  4.178   -55.278 1.00 80.20  ? 2024 SER B CA  1 
ATOM   7497 C C   . SER B 1 521 ? -5.283  2.848   -54.630 1.00 80.05  ? 2024 SER B C   1 
ATOM   7498 O O   . SER B 1 521 ? -4.263  2.749   -53.942 1.00 80.12  ? 2024 SER B O   1 
ATOM   7499 C CB  . SER B 1 521 ? -5.515  4.095   -56.802 1.00 79.83  ? 2024 SER B CB  1 
ATOM   7500 O OG  . SER B 1 521 ? -4.165  4.281   -57.204 1.00 78.43  ? 2024 SER B OG  1 
ATOM   7501 N N   . GLU B 1 522 ? -6.123  1.839   -54.827 1.00 79.30  ? 2025 GLU B N   1 
ATOM   7502 C CA  . GLU B 1 522 ? -5.866  0.512   -54.280 1.00 79.76  ? 2025 GLU B CA  1 
ATOM   7503 C C   . GLU B 1 522 ? -5.421  0.469   -52.808 1.00 78.53  ? 2025 GLU B C   1 
ATOM   7504 O O   . GLU B 1 522 ? -4.626  -0.386  -52.403 1.00 77.82  ? 2025 GLU B O   1 
ATOM   7505 C CB  . GLU B 1 522 ? -4.828  -0.215  -55.154 1.00 81.92  ? 2025 GLU B CB  1 
ATOM   7506 C CG  . GLU B 1 522 ? -3.454  0.445   -55.177 1.00 83.25  ? 2025 GLU B CG  1 
ATOM   7507 C CD  . GLU B 1 522 ? -2.428  -0.324  -55.990 1.00 84.65  ? 2025 GLU B CD  1 
ATOM   7508 O OE1 . GLU B 1 522 ? -1.255  0.117   -56.000 1.00 84.75  ? 2025 GLU B OE1 1 
ATOM   7509 O OE2 . GLU B 1 522 ? -2.788  -1.359  -56.603 1.00 85.18  ? 2025 GLU B OE2 1 
ATOM   7510 N N   . VAL B 1 523 ? -5.934  1.380   -51.995 1.00 76.99  ? 2026 VAL B N   1 
ATOM   7511 C CA  . VAL B 1 523 ? -5.582  1.356   -50.582 1.00 75.34  ? 2026 VAL B CA  1 
ATOM   7512 C C   . VAL B 1 523 ? -5.969  -0.013  -50.031 1.00 74.37  ? 2026 VAL B C   1 
ATOM   7513 O O   . VAL B 1 523 ? -5.414  -0.472  -49.032 1.00 74.37  ? 2026 VAL B O   1 
ATOM   7514 C CB  . VAL B 1 523 ? -6.339  2.434   -49.777 1.00 74.68  ? 2026 VAL B CB  1 
ATOM   7515 C CG1 . VAL B 1 523 ? -5.568  3.731   -49.801 1.00 74.35  ? 2026 VAL B CG1 1 
ATOM   7516 C CG2 . VAL B 1 523 ? -7.733  2.632   -50.355 1.00 73.96  ? 2026 VAL B CG2 1 
ATOM   7517 N N   . VAL B 1 524 ? -6.926  -0.658  -50.695 1.00 73.03  ? 2027 VAL B N   1 
ATOM   7518 C CA  . VAL B 1 524 ? -7.409  -1.974  -50.288 1.00 71.70  ? 2027 VAL B CA  1 
ATOM   7519 C C   . VAL B 1 524 ? -6.256  -2.958  -50.301 1.00 70.39  ? 2027 VAL B C   1 
ATOM   7520 O O   . VAL B 1 524 ? -6.191  -3.877  -49.487 1.00 70.11  ? 2027 VAL B O   1 
ATOM   7521 C CB  . VAL B 1 524 ? -8.518  -2.475  -51.245 1.00 72.21  ? 2027 VAL B CB  1 
ATOM   7522 C CG1 . VAL B 1 524 ? -9.083  -3.806  -50.758 1.00 71.65  ? 2027 VAL B CG1 1 
ATOM   7523 C CG2 . VAL B 1 524 ? -9.625  -1.428  -51.342 1.00 72.28  ? 2027 VAL B CG2 1 
ATOM   7524 N N   . ASP B 1 525 ? -5.334  -2.750  -51.225 1.00 69.64  ? 2028 ASP B N   1 
ATOM   7525 C CA  . ASP B 1 525 ? -4.188  -3.626  -51.333 1.00 69.61  ? 2028 ASP B CA  1 
ATOM   7526 C C   . ASP B 1 525 ? -3.218  -3.400  -50.180 1.00 68.28  ? 2028 ASP B C   1 
ATOM   7527 O O   . ASP B 1 525 ? -2.622  -4.350  -49.666 1.00 68.11  ? 2028 ASP B O   1 
ATOM   7528 C CB  . ASP B 1 525 ? -3.505  -3.412  -52.682 1.00 71.84  ? 2028 ASP B CB  1 
ATOM   7529 C CG  . ASP B 1 525 ? -4.324  -3.979  -53.837 1.00 74.47  ? 2028 ASP B CG  1 
ATOM   7530 O OD1 . ASP B 1 525 ? -4.417  -5.227  -53.935 1.00 74.20  ? 2028 ASP B OD1 1 
ATOM   7531 O OD2 . ASP B 1 525 ? -4.882  -3.183  -54.635 1.00 75.38  ? 2028 ASP B OD2 1 
ATOM   7532 N N   . VAL B 1 526 ? -3.081  -2.146  -49.763 1.00 66.08  ? 2029 VAL B N   1 
ATOM   7533 C CA  . VAL B 1 526 ? -2.193  -1.805  -48.662 1.00 63.76  ? 2029 VAL B CA  1 
ATOM   7534 C C   . VAL B 1 526 ? -2.718  -2.391  -47.360 1.00 62.95  ? 2029 VAL B C   1 
ATOM   7535 O O   . VAL B 1 526 ? -1.939  -2.751  -46.475 1.00 63.49  ? 2029 VAL B O   1 
ATOM   7536 C CB  . VAL B 1 526 ? -2.063  -0.278  -48.487 1.00 63.27  ? 2029 VAL B CB  1 
ATOM   7537 C CG1 . VAL B 1 526 ? -1.159  0.030   -47.299 1.00 61.06  ? 2029 VAL B CG1 1 
ATOM   7538 C CG2 . VAL B 1 526 ? -1.514  0.353   -49.766 1.00 61.96  ? 2029 VAL B CG2 1 
ATOM   7539 N N   . ALA B 1 527 ? -4.040  -2.498  -47.251 1.00 61.21  ? 2030 ALA B N   1 
ATOM   7540 C CA  . ALA B 1 527 ? -4.671  -3.031  -46.041 1.00 59.70  ? 2030 ALA B CA  1 
ATOM   7541 C C   . ALA B 1 527 ? -4.577  -4.552  -45.957 1.00 58.13  ? 2030 ALA B C   1 
ATOM   7542 O O   . ALA B 1 527 ? -4.349  -5.114  -44.885 1.00 57.41  ? 2030 ALA B O   1 
ATOM   7543 C CB  . ALA B 1 527 ? -6.136  -2.597  -45.983 1.00 59.16  ? 2030 ALA B CB  1 
ATOM   7544 N N   . LYS B 1 528 ? -4.770  -5.212  -47.094 1.00 56.73  ? 2031 LYS B N   1 
ATOM   7545 C CA  . LYS B 1 528 ? -4.706  -6.664  -47.156 1.00 54.36  ? 2031 LYS B CA  1 
ATOM   7546 C C   . LYS B 1 528 ? -3.310  -7.131  -46.778 1.00 51.62  ? 2031 LYS B C   1 
ATOM   7547 O O   . LYS B 1 528 ? -3.148  -7.975  -45.890 1.00 52.24  ? 2031 LYS B O   1 
ATOM   7548 C CB  . LYS B 1 528 ? -5.024  -7.163  -48.571 1.00 56.86  ? 2031 LYS B CB  1 
ATOM   7549 C CG  . LYS B 1 528 ? -6.428  -6.885  -49.074 1.00 58.57  ? 2031 LYS B CG  1 
ATOM   7550 C CD  . LYS B 1 528 ? -6.528  -7.281  -50.545 1.00 60.79  ? 2031 LYS B CD  1 
ATOM   7551 C CE  . LYS B 1 528 ? -7.848  -6.845  -51.183 1.00 61.82  ? 2031 LYS B CE  1 
ATOM   7552 N NZ  . LYS B 1 528 ? -7.796  -6.888  -52.690 1.00 61.00  ? 2031 LYS B NZ  1 
ATOM   7553 N N   . LEU B 1 529 ? -2.302  -6.576  -47.447 1.00 48.02  ? 2032 LEU B N   1 
ATOM   7554 C CA  . LEU B 1 529 ? -0.924  -6.964  -47.188 1.00 44.62  ? 2032 LEU B CA  1 
ATOM   7555 C C   . LEU B 1 529 ? -0.527  -6.724  -45.731 1.00 44.85  ? 2032 LEU B C   1 
ATOM   7556 O O   . LEU B 1 529 ? 0.244   -7.508  -45.161 1.00 44.84  ? 2032 LEU B O   1 
ATOM   7557 C CB  . LEU B 1 529 ? 0.030   -6.230  -48.142 1.00 41.19  ? 2032 LEU B CB  1 
ATOM   7558 C CG  . LEU B 1 529 ? 1.532   -6.580  -48.085 1.00 38.92  ? 2032 LEU B CG  1 
ATOM   7559 C CD1 . LEU B 1 529 ? 1.769   -8.089  -48.263 1.00 36.44  ? 2032 LEU B CD1 1 
ATOM   7560 C CD2 . LEU B 1 529 ? 2.259   -5.777  -49.156 1.00 35.00  ? 2032 LEU B CD2 1 
ATOM   7561 N N   . MET B 1 530 ? -1.047  -5.655  -45.124 1.00 44.17  ? 2033 MET B N   1 
ATOM   7562 C CA  . MET B 1 530 ? -0.734  -5.377  -43.721 1.00 43.60  ? 2033 MET B CA  1 
ATOM   7563 C C   . MET B 1 530 ? -1.402  -6.428  -42.833 1.00 43.49  ? 2033 MET B C   1 
ATOM   7564 O O   . MET B 1 530 ? -0.778  -6.975  -41.910 1.00 40.42  ? 2033 MET B O   1 
ATOM   7565 C CB  . MET B 1 530 ? -1.206  -3.981  -43.325 1.00 42.38  ? 2033 MET B CB  1 
ATOM   7566 C CG  . MET B 1 530 ? -0.297  -2.876  -43.826 1.00 45.03  ? 2033 MET B CG  1 
ATOM   7567 S SD  . MET B 1 530 ? -0.830  -1.200  -43.344 1.00 46.28  ? 2033 MET B SD  1 
ATOM   7568 C CE  . MET B 1 530 ? -0.405  -1.188  -41.564 1.00 46.74  ? 2033 MET B CE  1 
ATOM   7569 N N   . LYS B 1 531 ? -2.667  -6.724  -43.131 1.00 44.27  ? 2034 LYS B N   1 
ATOM   7570 C CA  . LYS B 1 531 ? -3.393  -7.714  -42.355 1.00 45.63  ? 2034 LYS B CA  1 
ATOM   7571 C C   . LYS B 1 531 ? -2.684  -9.058  -42.441 1.00 45.72  ? 2034 LYS B C   1 
ATOM   7572 O O   . LYS B 1 531 ? -2.557  -9.767  -41.444 1.00 45.82  ? 2034 LYS B O   1 
ATOM   7573 C CB  . LYS B 1 531 ? -4.821  -7.877  -42.861 1.00 46.63  ? 2034 LYS B CB  1 
ATOM   7574 C CG  . LYS B 1 531 ? -5.749  -6.711  -42.608 1.00 50.65  ? 2034 LYS B CG  1 
ATOM   7575 C CD  . LYS B 1 531 ? -7.214  -7.177  -42.631 1.00 52.64  ? 2034 LYS B CD  1 
ATOM   7576 C CE  . LYS B 1 531 ? -7.495  -8.120  -43.814 1.00 54.22  ? 2034 LYS B CE  1 
ATOM   7577 N NZ  . LYS B 1 531 ? -8.878  -8.702  -43.824 1.00 55.56  ? 2034 LYS B NZ  1 
ATOM   7578 N N   . ALA B 1 532 ? -2.225  -9.408  -43.637 1.00 46.08  ? 2035 ALA B N   1 
ATOM   7579 C CA  . ALA B 1 532 ? -1.538  -10.680 -43.833 1.00 46.91  ? 2035 ALA B CA  1 
ATOM   7580 C C   . ALA B 1 532 ? -0.259  -10.728 -42.995 1.00 47.40  ? 2035 ALA B C   1 
ATOM   7581 O O   . ALA B 1 532 ? -0.022  -11.687 -42.267 1.00 49.54  ? 2035 ALA B O   1 
ATOM   7582 C CB  . ALA B 1 532 ? -1.222  -10.884 -45.314 1.00 45.83  ? 2035 ALA B CB  1 
ATOM   7583 N N   . TYR B 1 533 ? 0.568   -9.693  -43.086 1.00 47.56  ? 2036 TYR B N   1 
ATOM   7584 C CA  . TYR B 1 533 ? 1.798   -9.672  -42.299 1.00 47.71  ? 2036 TYR B CA  1 
ATOM   7585 C C   . TYR B 1 533 ? 1.470   -9.694  -40.808 1.00 46.73  ? 2036 TYR B C   1 
ATOM   7586 O O   . TYR B 1 533 ? 2.145   -10.365 -40.028 1.00 44.05  ? 2036 TYR B O   1 
ATOM   7587 C CB  . TYR B 1 533 ? 2.624   -8.431  -42.623 1.00 46.92  ? 2036 TYR B CB  1 
ATOM   7588 C CG  . TYR B 1 533 ? 3.460   -8.563  -43.877 1.00 48.57  ? 2036 TYR B CG  1 
ATOM   7589 C CD1 . TYR B 1 533 ? 4.362   -9.612  -44.022 1.00 48.45  ? 2036 TYR B CD1 1 
ATOM   7590 C CD2 . TYR B 1 533 ? 3.411   -7.593  -44.889 1.00 49.57  ? 2036 TYR B CD2 1 
ATOM   7591 C CE1 . TYR B 1 533 ? 5.200   -9.695  -45.126 1.00 49.35  ? 2036 TYR B CE1 1 
ATOM   7592 C CE2 . TYR B 1 533 ? 4.253   -7.670  -46.000 1.00 49.45  ? 2036 TYR B CE2 1 
ATOM   7593 C CZ  . TYR B 1 533 ? 5.146   -8.724  -46.106 1.00 49.32  ? 2036 TYR B CZ  1 
ATOM   7594 O OH  . TYR B 1 533 ? 6.005   -8.801  -47.178 1.00 52.33  ? 2036 TYR B OH  1 
ATOM   7595 N N   . ILE B 1 534 ? 0.421   -8.966  -40.429 1.00 46.60  ? 2037 ILE B N   1 
ATOM   7596 C CA  . ILE B 1 534 ? 0.012   -8.892  -39.030 1.00 46.90  ? 2037 ILE B CA  1 
ATOM   7597 C C   . ILE B 1 534 ? -0.536  -10.231 -38.559 1.00 48.29  ? 2037 ILE B C   1 
ATOM   7598 O O   . ILE B 1 534 ? -0.272  -10.663 -37.432 1.00 46.89  ? 2037 ILE B O   1 
ATOM   7599 C CB  . ILE B 1 534 ? -1.030  -7.778  -38.823 1.00 45.35  ? 2037 ILE B CB  1 
ATOM   7600 C CG1 . ILE B 1 534 ? -0.360  -6.416  -39.053 1.00 43.18  ? 2037 ILE B CG1 1 
ATOM   7601 C CG2 . ILE B 1 534 ? -1.621  -7.873  -37.427 1.00 43.49  ? 2037 ILE B CG2 1 
ATOM   7602 C CD1 . ILE B 1 534 ? -1.314  -5.269  -39.217 1.00 41.83  ? 2037 ILE B CD1 1 
ATOM   7603 N N   . SER B 1 535 ? -1.286  -10.891 -39.436 1.00 50.20  ? 2038 SER B N   1 
ATOM   7604 C CA  . SER B 1 535 ? -1.848  -12.199 -39.128 1.00 52.08  ? 2038 SER B CA  1 
ATOM   7605 C C   . SER B 1 535 ? -0.717  -13.200 -38.895 1.00 53.59  ? 2038 SER B C   1 
ATOM   7606 O O   . SER B 1 535 ? -0.801  -14.052 -38.009 1.00 53.52  ? 2038 SER B O   1 
ATOM   7607 C CB  . SER B 1 535 ? -2.718  -12.689 -40.278 1.00 51.07  ? 2038 SER B CB  1 
ATOM   7608 O OG  . SER B 1 535 ? -3.017  -14.062 -40.103 1.00 52.70  ? 2038 SER B OG  1 
ATOM   7609 N N   . MET B 1 536 ? 0.341   -13.092 -39.695 1.00 55.63  ? 2039 MET B N   1 
ATOM   7610 C CA  . MET B 1 536 ? 1.482   -13.988 -39.563 1.00 59.33  ? 2039 MET B CA  1 
ATOM   7611 C C   . MET B 1 536 ? 2.205   -13.775 -38.239 1.00 61.29  ? 2039 MET B C   1 
ATOM   7612 O O   . MET B 1 536 ? 2.916   -14.662 -37.771 1.00 62.55  ? 2039 MET B O   1 
ATOM   7613 C CB  . MET B 1 536 ? 2.469   -13.792 -40.725 1.00 59.68  ? 2039 MET B CB  1 
ATOM   7614 C CG  . MET B 1 536 ? 1.969   -14.280 -42.079 1.00 59.93  ? 2039 MET B CG  1 
ATOM   7615 S SD  . MET B 1 536 ? 1.606   -16.062 -42.111 1.00 61.13  ? 2039 MET B SD  1 
ATOM   7616 C CE  . MET B 1 536 ? -0.158  -16.084 -41.749 1.00 59.37  ? 2039 MET B CE  1 
ATOM   7617 N N   . ILE B 1 537 ? 2.031   -12.598 -37.643 1.00 63.50  ? 2040 ILE B N   1 
ATOM   7618 C CA  . ILE B 1 537 ? 2.666   -12.300 -36.366 1.00 65.60  ? 2040 ILE B CA  1 
ATOM   7619 C C   . ILE B 1 537 ? 1.776   -12.836 -35.261 1.00 67.74  ? 2040 ILE B C   1 
ATOM   7620 O O   . ILE B 1 537 ? 2.246   -13.441 -34.304 1.00 68.05  ? 2040 ILE B O   1 
ATOM   7621 C CB  . ILE B 1 537 ? 2.865   -10.771 -36.163 1.00 65.17  ? 2040 ILE B CB  1 
ATOM   7622 C CG1 . ILE B 1 537 ? 3.821   -10.229 -37.225 1.00 64.66  ? 2040 ILE B CG1 1 
ATOM   7623 C CG2 . ILE B 1 537 ? 3.445   -10.484 -34.776 1.00 62.84  ? 2040 ILE B CG2 1 
ATOM   7624 C CD1 . ILE B 1 537 ? 4.051   -8.745  -37.138 1.00 64.01  ? 2040 ILE B CD1 1 
ATOM   7625 N N   . VAL B 1 538 ? 0.479   -12.615 -35.406 1.00 71.08  ? 2041 VAL B N   1 
ATOM   7626 C CA  . VAL B 1 538 ? -0.486  -13.069 -34.415 1.00 74.71  ? 2041 VAL B CA  1 
ATOM   7627 C C   . VAL B 1 538 ? -0.461  -14.582 -34.251 1.00 77.56  ? 2041 VAL B C   1 
ATOM   7628 O O   . VAL B 1 538 ? -0.745  -15.100 -33.171 1.00 78.05  ? 2041 VAL B O   1 
ATOM   7629 C CB  . VAL B 1 538 ? -1.913  -12.654 -34.809 1.00 74.10  ? 2041 VAL B CB  1 
ATOM   7630 C CG1 . VAL B 1 538 ? -2.901  -13.110 -33.751 1.00 74.30  ? 2041 VAL B CG1 1 
ATOM   7631 C CG2 . VAL B 1 538 ? -1.978  -11.155 -34.994 1.00 74.06  ? 2041 VAL B CG2 1 
ATOM   7632 N N   . LYS B 1 539 ? -0.115  -15.287 -35.323 1.00 80.85  ? 2042 LYS B N   1 
ATOM   7633 C CA  . LYS B 1 539 ? -0.078  -16.739 -35.294 1.00 83.97  ? 2042 LYS B CA  1 
ATOM   7634 C C   . LYS B 1 539 ? 1.308   -17.334 -35.061 1.00 85.74  ? 2042 LYS B C   1 
ATOM   7635 O O   . LYS B 1 539 ? 1.425   -18.428 -34.514 1.00 86.45  ? 2042 LYS B O   1 
ATOM   7636 C CB  . LYS B 1 539 ? -0.714  -17.293 -36.577 1.00 84.21  ? 2042 LYS B CB  1 
ATOM   7637 C CG  . LYS B 1 539 ? -2.243  -17.195 -36.559 1.00 85.14  ? 2042 LYS B CG  1 
ATOM   7638 C CD  . LYS B 1 539 ? -2.822  -16.422 -37.747 1.00 85.91  ? 2042 LYS B CD  1 
ATOM   7639 C CE  . LYS B 1 539 ? -2.923  -17.280 -39.003 1.00 85.91  ? 2042 LYS B CE  1 
ATOM   7640 N NZ  . LYS B 1 539 ? -1.592  -17.701 -39.513 1.00 86.70  ? 2042 LYS B NZ  1 
ATOM   7641 N N   . LYS B 1 540 ? 2.357   -16.623 -35.461 1.00 88.10  ? 2043 LYS B N   1 
ATOM   7642 C CA  . LYS B 1 540 ? 3.715   -17.121 -35.246 1.00 90.56  ? 2043 LYS B CA  1 
ATOM   7643 C C   . LYS B 1 540 ? 4.070   -17.044 -33.757 1.00 92.17  ? 2043 LYS B C   1 
ATOM   7644 O O   . LYS B 1 540 ? 4.950   -17.763 -33.278 1.00 92.17  ? 2043 LYS B O   1 
ATOM   7645 C CB  . LYS B 1 540 ? 4.738   -16.301 -36.043 1.00 90.80  ? 2043 LYS B CB  1 
ATOM   7646 C CG  . LYS B 1 540 ? 6.169   -16.807 -35.880 1.00 91.56  ? 2043 LYS B CG  1 
ATOM   7647 C CD  . LYS B 1 540 ? 7.222   -15.741 -36.184 1.00 92.38  ? 2043 LYS B CD  1 
ATOM   7648 C CE  . LYS B 1 540 ? 7.255   -15.343 -37.654 1.00 92.75  ? 2043 LYS B CE  1 
ATOM   7649 N NZ  . LYS B 1 540 ? 8.426   -14.459 -37.944 1.00 92.29  ? 2043 LYS B NZ  1 
ATOM   7650 N N   . ARG B 1 541 ? 3.377   -16.173 -33.028 1.00 94.18  ? 2044 ARG B N   1 
ATOM   7651 C CA  . ARG B 1 541 ? 3.628   -15.994 -31.602 1.00 96.06  ? 2044 ARG B CA  1 
ATOM   7652 C C   . ARG B 1 541 ? 2.675   -16.836 -30.766 1.00 97.54  ? 2044 ARG B C   1 
ATOM   7653 O O   . ARG B 1 541 ? 3.061   -17.375 -29.732 1.00 97.44  ? 2044 ARG B O   1 
ATOM   7654 C CB  . ARG B 1 541 ? 3.492   -14.516 -31.233 1.00 96.09  ? 2044 ARG B CB  1 
ATOM   7655 C CG  . ARG B 1 541 ? 3.948   -14.164 -29.825 1.00 96.06  ? 2044 ARG B CG  1 
ATOM   7656 C CD  . ARG B 1 541 ? 4.370   -12.703 -29.767 1.00 95.74  ? 2044 ARG B CD  1 
ATOM   7657 N NE  . ARG B 1 541 ? 3.358   -11.827 -30.349 1.00 95.21  ? 2044 ARG B NE  1 
ATOM   7658 C CZ  . ARG B 1 541 ? 3.613   -10.618 -30.836 1.00 95.02  ? 2044 ARG B CZ  1 
ATOM   7659 N NH1 . ARG B 1 541 ? 4.852   -10.145 -30.812 1.00 95.15  ? 2044 ARG B NH1 1 
ATOM   7660 N NH2 . ARG B 1 541 ? 2.634   -9.880  -31.344 1.00 94.51  ? 2044 ARG B NH2 1 
ATOM   7661 N N   . TYR B 1 542 ? 1.430   -16.945 -31.218 1.00 99.53  ? 2045 TYR B N   1 
ATOM   7662 C CA  . TYR B 1 542 ? 0.432   -17.748 -30.515 1.00 101.68 ? 2045 TYR B CA  1 
ATOM   7663 C C   . TYR B 1 542 ? 0.814   -19.225 -30.539 1.00 102.61 ? 2045 TYR B C   1 
ATOM   7664 O O   . TYR B 1 542 ? 0.214   -20.042 -29.839 1.00 102.64 ? 2045 TYR B O   1 
ATOM   7665 C CB  . TYR B 1 542 ? -0.944  -17.569 -31.156 1.00 102.60 ? 2045 TYR B CB  1 
ATOM   7666 C CG  . TYR B 1 542 ? -1.792  -16.487 -30.523 1.00 103.66 ? 2045 TYR B CG  1 
ATOM   7667 C CD1 . TYR B 1 542 ? -1.205  -15.420 -29.833 1.00 103.93 ? 2045 TYR B CD1 1 
ATOM   7668 C CD2 . TYR B 1 542 ? -3.184  -16.504 -30.654 1.00 103.80 ? 2045 TYR B CD2 1 
ATOM   7669 C CE1 . TYR B 1 542 ? -1.983  -14.395 -29.292 1.00 104.18 ? 2045 TYR B CE1 1 
ATOM   7670 C CE2 . TYR B 1 542 ? -3.972  -15.484 -30.119 1.00 104.37 ? 2045 TYR B CE2 1 
ATOM   7671 C CZ  . TYR B 1 542 ? -3.365  -14.432 -29.441 1.00 104.50 ? 2045 TYR B CZ  1 
ATOM   7672 O OH  . TYR B 1 542 ? -4.135  -13.413 -28.929 1.00 104.16 ? 2045 TYR B OH  1 
ATOM   7673 N N   . SER B 1 543 ? 1.805   -19.562 -31.362 1.00 103.31 ? 2046 SER B N   1 
ATOM   7674 C CA  . SER B 1 543 ? 2.284   -20.936 -31.461 1.00 103.63 ? 2046 SER B CA  1 
ATOM   7675 C C   . SER B 1 543 ? 3.690   -20.968 -30.875 1.00 104.30 ? 2046 SER B C   1 
ATOM   7676 O O   . SER B 1 543 ? 4.249   -22.036 -30.626 1.00 104.56 ? 2046 SER B O   1 
ATOM   7677 C CB  . SER B 1 543 ? 2.326   -21.402 -32.920 1.00 103.17 ? 2046 SER B CB  1 
ATOM   7678 O OG  . SER B 1 543 ? 3.446   -20.861 -33.598 1.00 101.72 ? 2046 SER B OG  1 
ATOM   7679 N N   . THR B 1 544 ? 4.256   -19.782 -30.662 1.00 104.82 ? 2047 THR B N   1 
ATOM   7680 C CA  . THR B 1 544 ? 5.597   -19.655 -30.102 1.00 105.01 ? 2047 THR B CA  1 
ATOM   7681 C C   . THR B 1 544 ? 5.519   -19.312 -28.619 1.00 105.35 ? 2047 THR B C   1 
ATOM   7682 O O   . THR B 1 544 ? 6.293   -18.495 -28.123 1.00 105.59 ? 2047 THR B O   1 
ATOM   7683 C CB  . THR B 1 544 ? 6.409   -18.558 -30.826 1.00 104.39 ? 2047 THR B CB  1 
ATOM   7684 N N   . THR B 1 545 ? 4.573   -19.938 -27.921 1.00 105.71 ? 2048 THR B N   1 
ATOM   7685 C CA  . THR B 1 545 ? 4.380   -19.721 -26.486 1.00 105.71 ? 2048 THR B CA  1 
ATOM   7686 C C   . THR B 1 545 ? 4.136   -21.052 -25.780 1.00 105.69 ? 2048 THR B C   1 
ATOM   7687 O O   . THR B 1 545 ? 4.180   -22.083 -26.487 1.00 105.55 ? 2048 THR B O   1 
ATOM   7688 C CB  . THR B 1 545 ? 3.174   -18.794 -26.208 1.00 105.41 ? 2048 THR B CB  1 
HETATM 7689 O O   . HOH C 2 .   ? 7.230   -8.520  -23.382 1.00 30.03  ? 1    HOH A O   1 
HETATM 7690 O O   . HOH C 2 .   ? 5.613   -7.743  -21.552 1.00 34.40  ? 2    HOH A O   1 
HETATM 7691 O O   . HOH C 2 .   ? 4.034   -2.588  -17.425 1.00 12.26  ? 3    HOH A O   1 
HETATM 7692 O O   . HOH C 2 .   ? 17.961  0.050   -8.985  1.00 52.47  ? 4    HOH A O   1 
HETATM 7693 O O   . HOH C 2 .   ? 22.267  1.529   -12.177 1.00 33.70  ? 5    HOH A O   1 
HETATM 7694 O O   . HOH C 2 .   ? 17.196  1.808   -18.998 1.00 37.77  ? 6    HOH A O   1 
HETATM 7695 O O   . HOH C 2 .   ? 10.434  2.905   -7.006  1.00 21.32  ? 7    HOH A O   1 
HETATM 7696 O O   . HOH C 2 .   ? 5.701   3.197   -15.411 1.00 12.77  ? 8    HOH A O   1 
HETATM 7697 O O   . HOH C 2 .   ? 9.577   12.929  -10.766 1.00 23.08  ? 9    HOH A O   1 
HETATM 7698 O O   . HOH C 2 .   ? 1.404   30.859  -9.430  1.00 46.29  ? 10   HOH A O   1 
HETATM 7699 O O   . HOH C 2 .   ? -10.426 29.976  -5.157  1.00 47.90  ? 11   HOH A O   1 
HETATM 7700 O O   . HOH C 2 .   ? 6.545   22.454  -7.568  1.00 35.03  ? 12   HOH A O   1 
HETATM 7701 O O   . HOH C 2 .   ? -6.420  17.099  -5.735  1.00 36.46  ? 13   HOH A O   1 
HETATM 7702 O O   . HOH C 2 .   ? 1.149   16.663  -0.746  1.00 43.63  ? 14   HOH A O   1 
HETATM 7703 O O   . HOH C 2 .   ? -8.620  13.660  -22.146 1.00 41.01  ? 15   HOH A O   1 
HETATM 7704 O O   . HOH C 2 .   ? -5.448  14.726  -22.623 1.00 39.44  ? 16   HOH A O   1 
HETATM 7705 O O   . HOH C 2 .   ? -11.526 12.054  -22.647 1.00 32.18  ? 17   HOH A O   1 
HETATM 7706 O O   . HOH C 2 .   ? 10.403  7.066   -7.642  1.00 16.96  ? 18   HOH A O   1 
HETATM 7707 O O   . HOH C 2 .   ? 9.561   -4.766  -5.963  1.00 38.45  ? 19   HOH A O   1 
HETATM 7708 O O   . HOH C 2 .   ? -17.215 0.622   -17.945 1.00 10.41  ? 20   HOH A O   1 
HETATM 7709 O O   . HOH C 2 .   ? 4.211   0.425   -25.084 1.00 22.08  ? 21   HOH A O   1 
HETATM 7710 O O   . HOH C 2 .   ? -5.591  -7.348  -21.750 1.00 35.80  ? 22   HOH A O   1 
HETATM 7711 O O   . HOH C 2 .   ? 3.702   -6.028  -14.298 1.00 18.84  ? 23   HOH A O   1 
HETATM 7712 O O   . HOH C 2 .   ? -11.109 -11.834 -15.266 1.00 39.15  ? 24   HOH A O   1 
HETATM 7713 O O   . HOH C 2 .   ? -13.259 15.214  -21.264 1.00 26.75  ? 25   HOH A O   1 
HETATM 7714 O O   . HOH C 2 .   ? -22.396 9.912   -11.906 1.00 17.17  ? 26   HOH A O   1 
HETATM 7715 O O   . HOH C 2 .   ? -21.659 -4.783  -4.235  1.00 28.99  ? 27   HOH A O   1 
HETATM 7716 O O   . HOH C 2 .   ? -33.556 11.333  -10.909 1.00 35.64  ? 28   HOH A O   1 
HETATM 7717 O O   . HOH C 2 .   ? -24.834 6.555   -18.033 1.00 25.73  ? 29   HOH A O   1 
HETATM 7718 O O   . HOH C 2 .   ? -26.619 3.566   -24.544 1.00 34.83  ? 30   HOH A O   1 
HETATM 7719 O O   . HOH C 2 .   ? -38.775 8.404   -28.722 1.00 33.53  ? 31   HOH A O   1 
HETATM 7720 O O   . HOH C 2 .   ? -59.291 24.657  -24.336 1.00 24.51  ? 32   HOH A O   1 
HETATM 7721 O O   . HOH C 2 .   ? -68.792 14.724  -9.060  1.00 14.22  ? 33   HOH A O   1 
HETATM 7722 O O   . HOH C 2 .   ? -67.607 7.504   -10.532 1.00 22.65  ? 34   HOH A O   1 
HETATM 7723 O O   . HOH C 2 .   ? -66.393 20.926  -0.574  1.00 37.05  ? 35   HOH A O   1 
HETATM 7724 O O   . HOH C 2 .   ? 13.030  17.527  -17.147 1.00 39.19  ? 36   HOH A O   1 
HETATM 7725 O O   . HOH C 2 .   ? 7.167   6.840   -14.069 1.00 13.36  ? 37   HOH A O   1 
HETATM 7726 O O   . HOH C 2 .   ? 3.728   12.318  -22.534 1.00 29.33  ? 38   HOH A O   1 
HETATM 7727 O O   . HOH C 2 .   ? 10.477  -4.980  -29.524 1.00 28.30  ? 39   HOH A O   1 
HETATM 7728 O O   . HOH C 2 .   ? -1.095  8.893   -7.796  1.00 23.06  ? 40   HOH A O   1 
HETATM 7729 O O   . HOH C 2 .   ? -0.675  0.507   -5.667  1.00 17.22  ? 41   HOH A O   1 
HETATM 7730 O O   . HOH C 2 .   ? 8.774   -0.711  -7.051  1.00 28.83  ? 42   HOH A O   1 
HETATM 7731 O O   . HOH C 2 .   ? -10.923 -1.585  -0.126  1.00 36.43  ? 43   HOH A O   1 
HETATM 7732 O O   . HOH C 2 .   ? -3.481  11.890  -28.484 1.00 35.36  ? 44   HOH A O   1 
HETATM 7733 O O   . HOH C 2 .   ? -1.031  -3.940  -25.455 1.00 34.26  ? 45   HOH A O   1 
HETATM 7734 O O   . HOH C 2 .   ? -4.141  -11.685 -20.901 1.00 46.12  ? 46   HOH A O   1 
HETATM 7735 O O   . HOH C 2 .   ? -18.105 9.246   -22.045 1.00 40.82  ? 48   HOH A O   1 
HETATM 7736 O O   . HOH C 2 .   ? -18.444 8.157   -19.195 1.00 41.72  ? 49   HOH A O   1 
HETATM 7737 O O   . HOH C 2 .   ? -19.368 9.502   -0.004  1.00 21.94  ? 50   HOH A O   1 
HETATM 7738 O O   . HOH C 2 .   ? -49.770 3.849   -27.711 1.00 43.24  ? 51   HOH A O   1 
HETATM 7739 O O   . HOH C 2 .   ? -49.704 3.347   -25.132 1.00 40.46  ? 52   HOH A O   1 
HETATM 7740 O O   . HOH C 2 .   ? -33.586 11.906  -24.280 1.00 18.67  ? 53   HOH A O   1 
HETATM 7741 O O   . HOH C 2 .   ? -49.805 23.120  -32.917 1.00 43.76  ? 54   HOH A O   1 
HETATM 7742 O O   . HOH C 2 .   ? -51.686 15.872  -33.515 1.00 48.27  ? 55   HOH A O   1 
HETATM 7743 O O   . HOH C 2 .   ? -61.073 12.839  -26.311 1.00 23.09  ? 56   HOH A O   1 
HETATM 7744 O O   . HOH C 2 .   ? -55.815 5.370   -20.000 1.00 47.89  ? 57   HOH A O   1 
HETATM 7745 O O   . HOH C 2 .   ? -48.380 28.467  -12.596 1.00 28.37  ? 58   HOH A O   1 
HETATM 7746 O O   . HOH C 2 .   ? -63.615 9.477   -12.059 1.00 25.23  ? 60   HOH A O   1 
HETATM 7747 O O   . HOH C 2 .   ? -60.894 7.792   -8.077  1.00 38.19  ? 61   HOH A O   1 
HETATM 7748 O O   . HOH C 2 .   ? -67.310 4.761   -19.956 1.00 30.29  ? 62   HOH A O   1 
HETATM 7749 O O   . HOH C 2 .   ? -38.407 36.211  -20.107 1.00 32.50  ? 64   HOH A O   1 
HETATM 7750 O O   . HOH C 2 .   ? -8.358  10.945  -31.298 1.00 44.71  ? 101  HOH A O   1 
HETATM 7751 O O   . HOH D 2 .   ? -45.125 -19.783 -65.171 1.00 32.86  ? 65   HOH B O   1 
HETATM 7752 O O   . HOH D 2 .   ? -56.378 -22.812 -54.816 1.00 38.63  ? 66   HOH B O   1 
HETATM 7753 O O   . HOH D 2 .   ? -41.835 -11.050 -80.128 1.00 42.63  ? 67   HOH B O   1 
HETATM 7754 O O   . HOH D 2 .   ? -35.558 -12.711 -57.569 1.00 37.19  ? 68   HOH B O   1 
HETATM 7755 O O   . HOH D 2 .   ? -24.792 -13.244 -56.584 1.00 49.84  ? 69   HOH B O   1 
HETATM 7756 O O   . HOH D 2 .   ? -48.079 -18.391 -71.257 1.00 33.86  ? 70   HOH B O   1 
HETATM 7757 O O   . HOH D 2 .   ? -46.755 -26.214 -73.360 1.00 33.26  ? 71   HOH B O   1 
HETATM 7758 O O   . HOH D 2 .   ? -39.634 -27.123 -78.342 1.00 47.35  ? 72   HOH B O   1 
HETATM 7759 O O   . HOH D 2 .   ? -37.423 -30.086 -71.712 1.00 38.86  ? 73   HOH B O   1 
HETATM 7760 O O   . HOH D 2 .   ? -41.996 -31.935 -66.412 1.00 43.15  ? 74   HOH B O   1 
HETATM 7761 O O   . HOH D 2 .   ? -26.613 -37.294 -75.585 1.00 58.66  ? 76   HOH B O   1 
HETATM 7762 O O   . HOH D 2 .   ? -19.227 -27.068 -60.678 1.00 29.94  ? 77   HOH B O   1 
HETATM 7763 O O   . HOH D 2 .   ? -14.405 -27.157 -56.884 1.00 44.28  ? 78   HOH B O   1 
HETATM 7764 O O   . HOH D 2 .   ? -15.864 -29.514 -62.643 1.00 43.37  ? 79   HOH B O   1 
HETATM 7765 O O   . HOH D 2 .   ? -24.749 -23.168 -52.863 1.00 57.76  ? 80   HOH B O   1 
HETATM 7766 O O   . HOH D 2 .   ? -13.989 -14.658 -72.661 1.00 47.59  ? 81   HOH B O   1 
HETATM 7767 O O   . HOH D 2 .   ? -16.064 -18.226 -76.548 1.00 48.50  ? 82   HOH B O   1 
HETATM 7768 O O   . HOH D 2 .   ? -5.695  -26.125 -62.665 1.00 45.72  ? 83   HOH B O   1 
HETATM 7769 O O   . HOH D 2 .   ? -13.490 -20.416 -60.987 1.00 22.91  ? 84   HOH B O   1 
HETATM 7770 O O   . HOH D 2 .   ? 0.320   -19.427 -49.435 1.00 39.83  ? 85   HOH B O   1 
HETATM 7771 O O   . HOH D 2 .   ? -4.287  -12.324 -50.804 1.00 29.22  ? 86   HOH B O   1 
HETATM 7772 O O   . HOH D 2 .   ? -17.683 -15.090 -52.110 1.00 52.22  ? 87   HOH B O   1 
HETATM 7773 O O   . HOH D 2 .   ? 4.382   -8.822  -54.534 1.00 28.84  ? 89   HOH B O   1 
HETATM 7774 O O   . HOH D 2 .   ? 12.520  -10.284 -46.144 1.00 52.52  ? 90   HOH B O   1 
HETATM 7775 O O   . HOH D 2 .   ? 18.539  -16.607 -50.027 1.00 54.82  ? 91   HOH B O   1 
HETATM 7776 O O   . HOH D 2 .   ? 16.133  4.258   -56.597 1.00 48.22  ? 92   HOH B O   1 
HETATM 7777 O O   . HOH D 2 .   ? 29.677  -18.968 -68.630 1.00 27.34  ? 93   HOH B O   1 
HETATM 7778 O O   . HOH D 2 .   ? 25.362  -4.124  -80.891 1.00 47.25  ? 94   HOH B O   1 
HETATM 7779 O O   . HOH D 2 .   ? 19.138  -19.180 -69.776 1.00 45.67  ? 96   HOH B O   1 
HETATM 7780 O O   . HOH D 2 .   ? 20.742  -3.527  -53.829 1.00 47.92  ? 97   HOH B O   1 
HETATM 7781 O O   . HOH D 2 .   ? 6.652   -13.082 -39.783 1.00 52.24  ? 98   HOH B O   1 
HETATM 7782 O O   . HOH D 2 .   ? 1.081   -7.002  -33.809 1.00 33.14  ? 100  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1484 ?    ?   ?   A . n 
A 1 2   PRO 2   1485 ?    ?   ?   A . n 
A 1 3   THR 3   1486 ?    ?   ?   A . n 
A 1 4   ARG 4   1487 ?    ?   ?   A . n 
A 1 5   TRP 5   1488 ?    ?   ?   A . n 
A 1 6   SER 6   1489 ?    ?   ?   A . n 
A 1 7   SER 7   1490 ?    ?   ?   A . n 
A 1 8   ALA 8   1491 ?    ?   ?   A . n 
A 1 9   ILE 9   1492 ?    ?   ?   A . n 
A 1 10  GLN 10  1493 ?    ?   ?   A . n 
A 1 11  ASN 11  1494 ?    ?   ?   A . n 
A 1 12  VAL 12  1495 ?    ?   ?   A . n 
A 1 13  THR 13  1496 ?    ?   ?   A . n 
A 1 14  ASP 14  1497 ?    ?   ?   A . n 
A 1 15  THR 15  1498 ?    ?   ?   A . n 
A 1 16  LYS 16  1499 ?    ?   ?   A . n 
A 1 17  ALA 17  1500 ?    ?   ?   A . n 
A 1 18  PRO 18  1501 1501 PRO PRO A . n 
A 1 19  ILE 19  1502 1502 ILE ILE A . n 
A 1 20  ASP 20  1503 1503 ASP ASP A . n 
A 1 21  THR 21  1504 1504 THR THR A . n 
A 1 22  PRO 22  1505 1505 PRO PRO A . n 
A 1 23  THR 23  1506 1506 THR THR A . n 
A 1 24  GLN 24  1507 1507 GLN GLN A . n 
A 1 25  GLN 25  1508 1508 GLN GLN A . n 
A 1 26  LEU 26  1509 1509 LEU LEU A . n 
A 1 27  ILE 27  1510 1510 ILE ILE A . n 
A 1 28  GLN 28  1511 1511 GLN GLN A . n 
A 1 29  ASP 29  1512 1512 ASP ASP A . n 
A 1 30  ILE 30  1513 1513 ILE ILE A . n 
A 1 31  LYS 31  1514 1514 LYS LYS A . n 
A 1 32  GLU 32  1515 1515 GLU GLU A . n 
A 1 33  ASN 33  1516 1516 ASN ASN A . n 
A 1 34  CYS 34  1517 1517 CYS CYS A . n 
A 1 35  LEU 35  1518 1518 LEU LEU A . n 
A 1 36  ASN 36  1519 1519 ASN ASN A . n 
A 1 37  SER 37  1520 1520 SER SER A . n 
A 1 38  ASP 38  1521 1521 ASP ASP A . n 
A 1 39  VAL 39  1522 1522 VAL VAL A . n 
A 1 40  VAL 40  1523 1523 VAL VAL A . n 
A 1 41  GLU 41  1524 1524 GLU GLU A . n 
A 1 42  GLN 42  1525 1525 GLN GLN A . n 
A 1 43  ILE 43  1526 1526 ILE ILE A . n 
A 1 44  TYR 44  1527 1527 TYR TYR A . n 
A 1 45  LYS 45  1528 1528 LYS LYS A . n 
A 1 46  ARG 46  1529 1529 ARG ARG A . n 
A 1 47  ASN 47  1530 1530 ASN ASN A . n 
A 1 48  PRO 48  1531 1531 PRO PRO A . n 
A 1 49  ILE 49  1532 1532 ILE ILE A . n 
A 1 50  LEU 50  1533 1533 LEU LEU A . n 
A 1 51  ARG 51  1534 1534 ARG ARG A . n 
A 1 52  TYR 52  1535 1535 TYR TYR A . n 
A 1 53  THR 53  1536 1536 THR THR A . n 
A 1 54  HIS 54  1537 1537 HIS HIS A . n 
A 1 55  HIS 55  1538 1538 HIS HIS A . n 
A 1 56  PRO 56  1539 1539 PRO PRO A . n 
A 1 57  LEU 57  1540 1540 LEU LEU A . n 
A 1 58  HIS 58  1541 1541 HIS HIS A . n 
A 1 59  SER 59  1542 1542 SER SER A . n 
A 1 60  PRO 60  1543 1543 PRO PRO A . n 
A 1 61  LEU 61  1544 1544 LEU LEU A . n 
A 1 62  LEU 62  1545 1545 LEU LEU A . n 
A 1 63  PRO 63  1546 1546 PRO PRO A . n 
A 1 64  LEU 64  1547 1547 LEU LEU A . n 
A 1 65  PRO 65  1548 1548 PRO PRO A . n 
A 1 66  TYR 66  1549 1549 TYR TYR A . n 
A 1 67  GLY 67  1550 1550 GLY GLY A . n 
A 1 68  ASP 68  1551 1551 ASP ASP A . n 
A 1 69  ILE 69  1552 1552 ILE ILE A . n 
A 1 70  ASN 70  1553 1553 ASN ASN A . n 
A 1 71  LEU 71  1554 1554 LEU LEU A . n 
A 1 72  ASN 72  1555 1555 ASN ASN A . n 
A 1 73  LEU 73  1556 1556 LEU LEU A . n 
A 1 74  LEU 74  1557 1557 LEU LEU A . n 
A 1 75  LYS 75  1558 1558 LYS LYS A . n 
A 1 76  ASP 76  1559 1559 ASP ASP A . n 
A 1 77  LYS 77  1560 1560 LYS LYS A . n 
A 1 78  GLY 78  1561 1561 GLY GLY A . n 
A 1 79  TYR 79  1562 1562 TYR TYR A . n 
A 1 80  THR 80  1563 1563 THR THR A . n 
A 1 81  THR 81  1564 1564 THR THR A . n 
A 1 82  LEU 82  1565 1565 LEU LEU A . n 
A 1 83  GLN 83  1566 1566 GLN GLN A . n 
A 1 84  ASP 84  1567 1567 ASP ASP A . n 
A 1 85  GLU 85  1568 1568 GLU GLU A . n 
A 1 86  ALA 86  1569 1569 ALA ALA A . n 
A 1 87  ILE 87  1570 1570 ILE ILE A . n 
A 1 88  LYS 88  1571 1571 LYS LYS A . n 
A 1 89  ILE 89  1572 1572 ILE ILE A . n 
A 1 90  PHE 90  1573 1573 PHE PHE A . n 
A 1 91  ASN 91  1574 1574 ASN ASN A . n 
A 1 92  SER 92  1575 1575 SER SER A . n 
A 1 93  LEU 93  1576 1576 LEU LEU A . n 
A 1 94  GLN 94  1577 1577 GLN GLN A . n 
A 1 95  GLN 95  1578 1578 GLN GLN A . n 
A 1 96  LEU 96  1579 1579 LEU LEU A . n 
A 1 97  GLU 97  1580 ?    ?   ?   A . n 
A 1 98  SER 98  1581 ?    ?   ?   A . n 
A 1 99  MET 99  1582 1582 MET MET A . n 
A 1 100 SER 100 1583 1583 SER SER A . n 
A 1 101 ASP 101 1584 1584 ASP ASP A . n 
A 1 102 PRO 102 1585 1585 PRO PRO A . n 
A 1 103 ILE 103 1586 1586 ILE ILE A . n 
A 1 104 PRO 104 1587 1587 PRO PRO A . n 
A 1 105 ILE 105 1588 1588 ILE ILE A . n 
A 1 106 ILE 106 1589 1589 ILE ILE A . n 
A 1 107 GLN 107 1590 1590 GLN GLN A . n 
A 1 108 GLY 108 1591 1591 GLY GLY A . n 
A 1 109 ILE 109 1592 1592 ILE ILE A . n 
A 1 110 LEU 110 1593 1593 LEU LEU A . n 
A 1 111 GLN 111 1594 1594 GLN GLN A . n 
A 1 112 THR 112 1595 1595 THR THR A . n 
A 1 113 GLY 113 1596 1596 GLY GLY A . n 
A 1 114 HIS 114 1597 1597 HIS HIS A . n 
A 1 115 ASP 115 1598 1598 ASP ASP A . n 
A 1 116 LEU 116 1599 1599 LEU LEU A . n 
A 1 117 ARG 117 1600 1600 ARG ARG A . n 
A 1 118 PRO 118 1601 1601 PRO PRO A . n 
A 1 119 LEU 119 1602 1602 LEU LEU A . n 
A 1 120 ARG 120 1603 1603 ARG ARG A . n 
A 1 121 ASP 121 1604 1604 ASP ASP A . n 
A 1 122 GLU 122 1605 1605 GLU GLU A . n 
A 1 123 LEU 123 1606 1606 LEU LEU A . n 
A 1 124 TYR 124 1607 1607 TYR TYR A . n 
A 1 125 CYS 125 1608 1608 CYS CYS A . n 
A 1 126 GLN 126 1609 1609 GLN GLN A . n 
A 1 127 LEU 127 1610 1610 LEU LEU A . n 
A 1 128 ILE 128 1611 1611 ILE ILE A . n 
A 1 129 LYS 129 1612 1612 LYS LYS A . n 
A 1 130 GLN 130 1613 1613 GLN GLN A . n 
A 1 131 THR 131 1614 1614 THR THR A . n 
A 1 132 ASN 132 1615 1615 ASN ASN A . n 
A 1 133 LYS 133 1616 1616 LYS LYS A . n 
A 1 134 VAL 134 1617 1617 VAL VAL A . n 
A 1 135 PRO 135 1618 1618 PRO PRO A . n 
A 1 136 HIS 136 1619 1619 HIS HIS A . n 
A 1 137 PRO 137 1620 1620 PRO PRO A . n 
A 1 138 GLY 138 1621 1621 GLY GLY A . n 
A 1 139 SER 139 1622 1622 SER SER A . n 
A 1 140 VAL 140 1623 1623 VAL VAL A . n 
A 1 141 GLY 141 1624 1624 GLY GLY A . n 
A 1 142 ASN 142 1625 1625 ASN ASN A . n 
A 1 143 LEU 143 1626 1626 LEU LEU A . n 
A 1 144 TYR 144 1627 1627 TYR TYR A . n 
A 1 145 SER 145 1628 1628 SER SER A . n 
A 1 146 TRP 146 1629 1629 TRP TRP A . n 
A 1 147 GLN 147 1630 1630 GLN GLN A . n 
A 1 148 ILE 148 1631 1631 ILE ILE A . n 
A 1 149 LEU 149 1632 1632 LEU LEU A . n 
A 1 150 THR 150 1633 1633 THR THR A . n 
A 1 151 CYS 151 1634 1634 CYS CYS A . n 
A 1 152 LEU 152 1635 1635 LEU LEU A . n 
A 1 153 SER 153 1636 1636 SER SER A . n 
A 1 154 CYS 154 1637 1637 CYS CYS A . n 
A 1 155 THR 155 1638 1638 THR THR A . n 
A 1 156 PHE 156 1639 1639 PHE PHE A . n 
A 1 157 LEU 157 1640 1640 LEU LEU A . n 
A 1 158 PRO 158 1641 1641 PRO PRO A . n 
A 1 159 SER 159 1642 1642 SER SER A . n 
A 1 160 ARG 160 1643 1643 ARG ARG A . n 
A 1 161 GLY 161 1644 1644 GLY GLY A . n 
A 1 162 ILE 162 1645 1645 ILE ILE A . n 
A 1 163 LEU 163 1646 1646 LEU LEU A . n 
A 1 164 LYS 164 1647 1647 LYS LYS A . n 
A 1 165 TYR 165 1648 1648 TYR TYR A . n 
A 1 166 LEU 166 1649 1649 LEU LEU A . n 
A 1 167 LYS 167 1650 1650 LYS LYS A . n 
A 1 168 PHE 168 1651 1651 PHE PHE A . n 
A 1 169 HIS 169 1652 1652 HIS HIS A . n 
A 1 170 LEU 170 1653 1653 LEU LEU A . n 
A 1 171 LYS 171 1654 1654 LYS LYS A . n 
A 1 172 ARG 172 1655 1655 ARG ARG A . n 
A 1 173 ILE 173 1656 1656 ILE ILE A . n 
A 1 174 ARG 174 1657 1657 ARG ARG A . n 
A 1 175 GLU 175 1658 1658 GLU GLU A . n 
A 1 176 GLN 176 1659 1659 GLN GLN A . n 
A 1 177 PHE 177 1660 1660 PHE PHE A . n 
A 1 178 PRO 178 1661 1661 PRO PRO A . n 
A 1 179 GLY 179 1662 1662 GLY GLY A . n 
A 1 180 THR 180 1663 1663 THR THR A . n 
A 1 181 GLU 181 1664 1664 GLU GLU A . n 
A 1 182 MET 182 1665 1665 MET MET A . n 
A 1 183 GLU 183 1666 1666 GLU GLU A . n 
A 1 184 LYS 184 1667 1667 LYS LYS A . n 
A 1 185 TYR 185 1668 1668 TYR TYR A . n 
A 1 186 ALA 186 1669 1669 ALA ALA A . n 
A 1 187 LEU 187 1670 1670 LEU LEU A . n 
A 1 188 PHE 188 1671 1671 PHE PHE A . n 
A 1 189 THR 189 1672 1672 THR THR A . n 
A 1 190 TYR 190 1673 1673 TYR TYR A . n 
A 1 191 GLU 191 1674 1674 GLU GLU A . n 
A 1 192 SER 192 1675 1675 SER SER A . n 
A 1 193 LEU 193 1676 1676 LEU LEU A . n 
A 1 194 LYS 194 1677 1677 LYS LYS A . n 
A 1 195 LYS 195 1678 1678 LYS LYS A . n 
A 1 196 THR 196 1679 1679 THR THR A . n 
A 1 197 LYS 197 1680 1680 LYS LYS A . n 
A 1 198 CYS 198 1681 1681 CYS CYS A . n 
A 1 199 ARG 199 1682 1682 ARG ARG A . n 
A 1 200 GLU 200 1683 1683 GLU GLU A . n 
A 1 201 PHE 201 1684 1684 PHE PHE A . n 
A 1 202 VAL 202 1685 1685 VAL VAL A . n 
A 1 203 PRO 203 1686 1686 PRO PRO A . n 
A 1 204 SER 204 1687 1687 SER SER A . n 
A 1 205 ARG 205 1688 1688 ARG ARG A . n 
A 1 206 ASP 206 1689 1689 ASP ASP A . n 
A 1 207 GLU 207 1690 1690 GLU GLU A . n 
A 1 208 ILE 208 1691 1691 ILE ILE A . n 
A 1 209 GLU 209 1692 1692 GLU GLU A . n 
A 1 210 ALA 210 1693 1693 ALA ALA A . n 
A 1 211 LEU 211 1694 1694 LEU LEU A . n 
A 1 212 ILE 212 1695 1695 ILE ILE A . n 
A 1 213 HIS 213 1696 1696 HIS HIS A . n 
A 1 214 ARG 214 1697 1697 ARG ARG A . n 
A 1 215 GLN 215 1698 1698 GLN GLN A . n 
A 1 216 GLU 216 1699 1699 GLU GLU A . n 
A 1 217 MET 217 1700 1700 MET MET A . n 
A 1 218 THR 218 1701 1701 THR THR A . n 
A 1 219 SER 219 1702 1702 SER SER A . n 
A 1 220 THR 220 1703 1703 THR THR A . n 
A 1 221 VAL 221 1704 1704 VAL VAL A . n 
A 1 222 TYR 222 1705 1705 TYR TYR A . n 
A 1 223 CYS 223 1706 1706 CYS CYS A . n 
A 1 224 HIS 224 1707 1707 HIS HIS A . n 
A 1 225 GLY 225 1708 1708 GLY GLY A . n 
A 1 226 GLY 226 1709 1709 GLY GLY A . n 
A 1 227 GLY 227 1710 1710 GLY GLY A . n 
A 1 228 SER 228 1711 1711 SER SER A . n 
A 1 229 CYS 229 1712 1712 CYS CYS A . n 
A 1 230 LYS 230 1713 1713 LYS LYS A . n 
A 1 231 ILE 231 1714 1714 ILE ILE A . n 
A 1 232 THR 232 1715 1715 THR THR A . n 
A 1 233 ILE 233 1716 1716 ILE ILE A . n 
A 1 234 ASN 234 1717 1717 ASN ASN A . n 
A 1 235 SER 235 1718 1718 SER SER A . n 
A 1 236 HIS 236 1719 1719 HIS HIS A . n 
A 1 237 THR 237 1720 1720 THR THR A . n 
A 1 238 THR 238 1721 1721 THR THR A . n 
A 1 239 ALA 239 1722 1722 ALA ALA A . n 
A 1 240 GLY 240 1723 1723 GLY GLY A . n 
A 1 241 GLU 241 1724 1724 GLU GLU A . n 
A 1 242 VAL 242 1725 1725 VAL VAL A . n 
A 1 243 VAL 243 1726 1726 VAL VAL A . n 
A 1 244 GLU 244 1727 1727 GLU GLU A . n 
A 1 245 LYS 245 1728 1728 LYS LYS A . n 
A 1 246 LEU 246 1729 1729 LEU LEU A . n 
A 1 247 ILE 247 1730 1730 ILE ILE A . n 
A 1 248 ARG 248 1731 1731 ARG ARG A . n 
A 1 249 GLY 249 1732 1732 GLY GLY A . n 
A 1 250 LEU 250 1733 1733 LEU LEU A . n 
A 1 251 ALA 251 1734 1734 ALA ALA A . n 
A 1 252 MET 252 1735 1735 MET MET A . n 
A 1 253 GLU 253 1736 1736 GLU GLU A . n 
A 1 254 ASP 254 1737 1737 ASP ASP A . n 
A 1 255 SER 255 1738 1738 SER SER A . n 
A 1 256 ARG 256 1739 1739 ARG ARG A . n 
A 1 257 ASN 257 1740 1740 ASN ASN A . n 
A 1 258 MET 258 1741 1741 MET MET A . n 
A 1 259 PHE 259 1742 1742 PHE PHE A . n 
A 1 260 ALA 260 1743 1743 ALA ALA A . n 
A 1 261 LEU 261 1744 1744 LEU LEU A . n 
A 1 262 PHE 262 1745 1745 PHE PHE A . n 
A 1 263 GLU 263 1746 1746 GLU GLU A . n 
A 1 264 TYR 264 1747 1747 TYR TYR A . n 
A 1 265 ASN 265 1748 1748 ASN ASN A . n 
A 1 266 GLY 266 1749 1749 GLY GLY A . n 
A 1 267 HIS 267 1750 1750 HIS HIS A . n 
A 1 268 VAL 268 1751 1751 VAL VAL A . n 
A 1 269 ASP 269 1752 1752 ASP ASP A . n 
A 1 270 LYS 270 1753 1753 LYS LYS A . n 
A 1 271 ALA 271 1754 1754 ALA ALA A . n 
A 1 272 ILE 272 1755 1755 ILE ILE A . n 
A 1 273 GLU 273 1756 1756 GLU GLU A . n 
A 1 274 SER 274 1757 1757 SER SER A . n 
A 1 275 ARG 275 1758 1758 ARG ARG A . n 
A 1 276 THR 276 1759 1759 THR THR A . n 
A 1 277 VAL 277 1760 1760 VAL VAL A . n 
A 1 278 VAL 278 1761 1761 VAL VAL A . n 
A 1 279 ALA 279 1762 1762 ALA ALA A . n 
A 1 280 ASP 280 1763 1763 ASP ASP A . n 
A 1 281 VAL 281 1764 1764 VAL VAL A . n 
A 1 282 LEU 282 1765 1765 LEU LEU A . n 
A 1 283 ALA 283 1766 1766 ALA ALA A . n 
A 1 284 LYS 284 1767 1767 LYS LYS A . n 
A 1 285 PHE 285 1768 1768 PHE PHE A . n 
A 1 286 GLU 286 1769 1769 GLU GLU A . n 
A 1 287 LYS 287 1770 1770 LYS LYS A . n 
A 1 288 LEU 288 1771 1771 LEU LEU A . n 
A 1 289 ALA 289 1772 1772 ALA ALA A . n 
A 1 290 ALA 290 1773 1773 ALA ALA A . n 
A 1 291 THR 291 1774 1774 THR THR A . n 
A 1 292 SER 292 1775 1775 SER SER A . n 
A 1 293 GLU 293 1776 ?    ?   ?   A . n 
A 1 294 VAL 294 1777 ?    ?   ?   A . n 
A 1 295 GLY 295 1778 ?    ?   ?   A . n 
A 1 296 ASP 296 1779 ?    ?   ?   A . n 
A 1 297 LEU 297 1780 1780 LEU LEU A . n 
A 1 298 PRO 298 1781 1781 PRO PRO A . n 
A 1 299 TRP 299 1782 1782 TRP TRP A . n 
A 1 300 LYS 300 1783 1783 LYS LYS A . n 
A 1 301 PHE 301 1784 1784 PHE PHE A . n 
A 1 302 TYR 302 1785 1785 TYR TYR A . n 
A 1 303 PHE 303 1786 1786 PHE PHE A . n 
A 1 304 LYS 304 1787 1787 LYS LYS A . n 
A 1 305 LEU 305 1788 1788 LEU LEU A . n 
A 1 306 TYR 306 1789 1789 TYR TYR A . n 
A 1 307 CYS 307 1790 1790 CYS CYS A . n 
A 1 308 PHE 308 1791 1791 PHE PHE A . n 
A 1 309 LEU 309 1792 1792 LEU LEU A . n 
A 1 310 ASP 310 1793 1793 ASP ASP A . n 
A 1 311 THR 311 1794 1794 THR THR A . n 
A 1 312 ASP 312 1795 1795 ASP ASP A . n 
A 1 313 ASN 313 1796 1796 ASN ASN A . n 
A 1 314 VAL 314 1797 1797 VAL VAL A . n 
A 1 315 PRO 315 1798 1798 PRO PRO A . n 
A 1 316 LYS 316 1799 1799 LYS LYS A . n 
A 1 317 ASP 317 1800 1800 ASP ASP A . n 
A 1 318 SER 318 1801 1801 SER SER A . n 
A 1 319 VAL 319 1802 1802 VAL VAL A . n 
A 1 320 GLU 320 1803 1803 GLU GLU A . n 
A 1 321 PHE 321 1804 1804 PHE PHE A . n 
A 1 322 ALA 322 1805 1805 ALA ALA A . n 
A 1 323 PHE 323 1806 1806 PHE PHE A . n 
A 1 324 MET 324 1807 1807 MET MET A . n 
A 1 325 PHE 325 1808 1808 PHE PHE A . n 
A 1 326 GLU 326 1809 1809 GLU GLU A . n 
A 1 327 GLN 327 1810 1810 GLN GLN A . n 
A 1 328 ALA 328 1811 1811 ALA ALA A . n 
A 1 329 HIS 329 1812 1812 HIS HIS A . n 
A 1 330 GLU 330 1813 1813 GLU GLU A . n 
A 1 331 ALA 331 1814 1814 ALA ALA A . n 
A 1 332 VAL 332 1815 1815 VAL VAL A . n 
A 1 333 ILE 333 1816 1816 ILE ILE A . n 
A 1 334 HIS 334 1817 1817 HIS HIS A . n 
A 1 335 GLY 335 1818 1818 GLY GLY A . n 
A 1 336 HIS 336 1819 1819 HIS HIS A . n 
A 1 337 HIS 337 1820 1820 HIS HIS A . n 
A 1 338 PRO 338 1821 1821 PRO PRO A . n 
A 1 339 ALA 339 1822 1822 ALA ALA A . n 
A 1 340 PRO 340 1823 1823 PRO PRO A . n 
A 1 341 GLU 341 1824 1824 GLU GLU A . n 
A 1 342 GLU 342 1825 1825 GLU GLU A . n 
A 1 343 ASN 343 1826 1826 ASN ASN A . n 
A 1 344 LEU 344 1827 1827 LEU LEU A . n 
A 1 345 GLN 345 1828 1828 GLN GLN A . n 
A 1 346 VAL 346 1829 1829 VAL VAL A . n 
A 1 347 LEU 347 1830 1830 LEU LEU A . n 
A 1 348 ALA 348 1831 1831 ALA ALA A . n 
A 1 349 ALA 349 1832 1832 ALA ALA A . n 
A 1 350 LEU 350 1833 1833 LEU LEU A . n 
A 1 351 ARG 351 1834 1834 ARG ARG A . n 
A 1 352 LEU 352 1835 1835 LEU LEU A . n 
A 1 353 GLN 353 1836 1836 GLN GLN A . n 
A 1 354 TYR 354 1837 1837 TYR TYR A . n 
A 1 355 LEU 355 1838 1838 LEU LEU A . n 
A 1 356 GLN 356 1839 1839 GLN GLN A . n 
A 1 357 GLY 357 1840 1840 GLY GLY A . n 
A 1 358 ASP 358 1841 1841 ASP ASP A . n 
A 1 359 TYR 359 1842 1842 TYR TYR A . n 
A 1 360 THR 360 1843 1843 THR THR A . n 
A 1 361 LEU 361 1844 1844 LEU LEU A . n 
A 1 362 HIS 362 1845 1845 HIS HIS A . n 
A 1 363 ALA 363 1846 1846 ALA ALA A . n 
A 1 364 ALA 364 1847 1847 ALA ALA A . n 
A 1 365 ILE 365 1848 1848 ILE ILE A . n 
A 1 366 PRO 366 1849 1849 PRO PRO A . n 
A 1 367 PRO 367 1850 1850 PRO PRO A . n 
A 1 368 LEU 368 1851 1851 LEU LEU A . n 
A 1 369 GLU 369 1852 1852 GLU GLU A . n 
A 1 370 GLU 370 1853 1853 GLU GLU A . n 
A 1 371 VAL 371 1854 1854 VAL VAL A . n 
A 1 372 TYR 372 1855 1855 TYR TYR A . n 
A 1 373 SER 373 1856 1856 SER SER A . n 
A 1 374 LEU 374 1857 1857 LEU LEU A . n 
A 1 375 GLN 375 1858 1858 GLN GLN A . n 
A 1 376 ARG 376 1859 1859 ARG ARG A . n 
A 1 377 LEU 377 1860 1860 LEU LEU A . n 
A 1 378 LYS 378 1861 1861 LYS LYS A . n 
A 1 379 ALA 379 1862 1862 ALA ALA A . n 
A 1 380 ARG 380 1863 1863 ARG ARG A . n 
A 1 381 ILE 381 1884 ?    ?   ?   A . n 
A 1 382 SER 382 1885 ?    ?   ?   A . n 
A 1 383 GLN 383 1886 ?    ?   ?   A . n 
A 1 384 SER 384 1887 ?    ?   ?   A . n 
A 1 385 THR 385 1888 ?    ?   ?   A . n 
A 1 386 LYS 386 1889 ?    ?   ?   A . n 
A 1 387 THR 387 1890 ?    ?   ?   A . n 
A 1 388 PHE 388 1891 ?    ?   ?   A . n 
A 1 389 SER 389 1892 ?    ?   ?   A . n 
A 1 390 PHE 390 1893 ?    ?   ?   A . n 
A 1 391 ARG 391 1894 ?    ?   ?   A . n 
A 1 392 THR 392 1895 ?    ?   ?   A . n 
A 1 393 GLY 393 1896 ?    ?   ?   A . n 
A 1 394 SER 394 1897 ?    ?   ?   A . n 
A 1 395 VAL 395 1898 ?    ?   ?   A . n 
A 1 396 VAL 396 1899 ?    ?   ?   A . n 
A 1 397 ARG 397 1900 ?    ?   ?   A . n 
A 1 398 GLN 398 1901 ?    ?   ?   A . n 
A 1 399 LYS 399 1902 ?    ?   ?   A . n 
A 1 400 VAL 400 1903 ?    ?   ?   A . n 
A 1 401 GLU 401 1904 ?    ?   ?   A . n 
A 1 402 GLU 402 1905 ?    ?   ?   A . n 
A 1 403 GLU 403 1906 ?    ?   ?   A . n 
A 1 404 GLN 404 1907 ?    ?   ?   A . n 
A 1 405 MET 405 1908 ?    ?   ?   A . n 
A 1 406 LEU 406 1909 ?    ?   ?   A . n 
A 1 407 ASP 407 1910 ?    ?   ?   A . n 
A 1 408 MET 408 1911 ?    ?   ?   A . n 
A 1 409 TRP 409 1912 ?    ?   ?   A . n 
A 1 410 ILE 410 1913 1913 ILE ILE A . n 
A 1 411 LYS 411 1914 1914 LYS LYS A . n 
A 1 412 GLU 412 1915 1915 GLU GLU A . n 
A 1 413 GLU 413 1916 1916 GLU GLU A . n 
A 1 414 VAL 414 1917 1917 VAL VAL A . n 
A 1 415 SER 415 1918 1918 SER SER A . n 
A 1 416 SER 416 1919 1919 SER SER A . n 
A 1 417 ALA 417 1920 1920 ALA ALA A . n 
A 1 418 ARG 418 1921 1921 ARG ARG A . n 
A 1 419 ALA 419 1922 1922 ALA ALA A . n 
A 1 420 SER 420 1923 1923 SER SER A . n 
A 1 421 ILE 421 1924 1924 ILE ILE A . n 
A 1 422 ILE 422 1925 1925 ILE ILE A . n 
A 1 423 ASP 423 1926 1926 ASP ASP A . n 
A 1 424 LYS 424 1927 1927 LYS LYS A . n 
A 1 425 TRP 425 1928 1928 TRP TRP A . n 
A 1 426 ARG 426 1929 1929 ARG ARG A . n 
A 1 427 LYS 427 1930 1930 LYS LYS A . n 
A 1 428 PHE 428 1931 1931 PHE PHE A . n 
A 1 429 GLN 429 1932 1932 GLN GLN A . n 
A 1 430 GLY 430 1933 1933 GLY GLY A . n 
A 1 431 MET 431 1934 1934 MET MET A . n 
A 1 432 ASN 432 1935 1935 ASN ASN A . n 
A 1 433 GLN 433 1936 1936 GLN GLN A . n 
A 1 434 GLU 434 1937 1937 GLU GLU A . n 
A 1 435 GLN 435 1938 1938 GLN GLN A . n 
A 1 436 ALA 436 1939 1939 ALA ALA A . n 
A 1 437 MET 437 1940 1940 MET MET A . n 
A 1 438 ALA 438 1941 1941 ALA ALA A . n 
A 1 439 LYS 439 1942 1942 LYS LYS A . n 
A 1 440 TYR 440 1943 1943 TYR TYR A . n 
A 1 441 MET 441 1944 1944 MET MET A . n 
A 1 442 ALA 442 1945 1945 ALA ALA A . n 
A 1 443 LEU 443 1946 1946 LEU LEU A . n 
A 1 444 ILE 444 1947 1947 ILE ILE A . n 
A 1 445 LYS 445 1948 1948 LYS LYS A . n 
A 1 446 GLU 446 1949 1949 GLU GLU A . n 
A 1 447 TRP 447 1950 1950 TRP TRP A . n 
A 1 448 PRO 448 1951 1951 PRO PRO A . n 
A 1 449 GLY 449 1952 1952 GLY GLY A . n 
A 1 450 TYR 450 1953 1953 TYR TYR A . n 
A 1 451 GLY 451 1954 1954 GLY GLY A . n 
A 1 452 SER 452 1955 1955 SER SER A . n 
A 1 453 THR 453 1956 1956 THR THR A . n 
A 1 454 LEU 454 1957 1957 LEU LEU A . n 
A 1 455 PHE 455 1958 1958 PHE PHE A . n 
A 1 456 ASP 456 1959 1959 ASP ASP A . n 
A 1 457 VAL 457 1960 1960 VAL VAL A . n 
A 1 458 GLU 458 1961 1961 GLU GLU A . n 
A 1 459 CYS 459 1962 1962 CYS CYS A . n 
A 1 460 LYS 460 1963 1963 LYS LYS A . n 
A 1 461 GLU 461 1964 1964 GLU GLU A . n 
A 1 462 GLY 462 1965 1965 GLY GLY A . n 
A 1 463 GLY 463 1966 1966 GLY GLY A . n 
A 1 464 PHE 464 1967 1967 PHE PHE A . n 
A 1 465 PRO 465 1968 1968 PRO PRO A . n 
A 1 466 GLN 466 1969 1969 GLN GLN A . n 
A 1 467 GLU 467 1970 1970 GLU GLU A . n 
A 1 468 LEU 468 1971 1971 LEU LEU A . n 
A 1 469 TRP 469 1972 1972 TRP TRP A . n 
A 1 470 LEU 470 1973 1973 LEU LEU A . n 
A 1 471 GLY 471 1974 1974 GLY GLY A . n 
A 1 472 VAL 472 1975 1975 VAL VAL A . n 
A 1 473 SER 473 1976 1976 SER SER A . n 
A 1 474 ALA 474 1977 1977 ALA ALA A . n 
A 1 475 ASP 475 1978 1978 ASP ASP A . n 
A 1 476 ALA 476 1979 1979 ALA ALA A . n 
A 1 477 VAL 477 1980 1980 VAL VAL A . n 
A 1 478 SER 478 1981 1981 SER SER A . n 
A 1 479 VAL 479 1982 1982 VAL VAL A . n 
A 1 480 TYR 480 1983 1983 TYR TYR A . n 
A 1 481 LYS 481 1984 1984 LYS LYS A . n 
A 1 482 ARG 482 1985 1985 ARG ARG A . n 
A 1 483 GLY 483 1986 1986 GLY GLY A . n 
A 1 484 GLU 484 1987 1987 GLU GLU A . n 
A 1 485 GLY 485 1988 1988 GLY GLY A . n 
A 1 486 ARG 486 1989 1989 ARG ARG A . n 
A 1 487 PRO 487 1990 1990 PRO PRO A . n 
A 1 488 LEU 488 1991 1991 LEU LEU A . n 
A 1 489 GLU 489 1992 1992 GLU GLU A . n 
A 1 490 VAL 490 1993 1993 VAL VAL A . n 
A 1 491 PHE 491 1994 1994 PHE PHE A . n 
A 1 492 GLN 492 1995 1995 GLN GLN A . n 
A 1 493 TYR 493 1996 1996 TYR TYR A . n 
A 1 494 GLU 494 1997 1997 GLU GLU A . n 
A 1 495 HIS 495 1998 1998 HIS HIS A . n 
A 1 496 ILE 496 1999 1999 ILE ILE A . n 
A 1 497 LEU 497 2000 2000 LEU LEU A . n 
A 1 498 SER 498 2001 2001 SER SER A . n 
A 1 499 PHE 499 2002 2002 PHE PHE A . n 
A 1 500 GLY 500 2003 2003 GLY GLY A . n 
A 1 501 ALA 501 2004 2004 ALA ALA A . n 
A 1 502 PRO 502 2005 2005 PRO PRO A . n 
A 1 503 LEU 503 2006 2006 LEU LEU A . n 
A 1 504 ALA 504 2007 2007 ALA ALA A . n 
A 1 505 ASN 505 2008 2008 ASN ASN A . n 
A 1 506 THR 506 2009 2009 THR THR A . n 
A 1 507 TYR 507 2010 2010 TYR TYR A . n 
A 1 508 LYS 508 2011 2011 LYS LYS A . n 
A 1 509 ILE 509 2012 2012 ILE ILE A . n 
A 1 510 VAL 510 2013 2013 VAL VAL A . n 
A 1 511 VAL 511 2014 2014 VAL VAL A . n 
A 1 512 ASP 512 2015 2015 ASP ASP A . n 
A 1 513 GLU 513 2016 2016 GLU GLU A . n 
A 1 514 ARG 514 2017 2017 ARG ARG A . n 
A 1 515 GLU 515 2018 2018 GLU GLU A . n 
A 1 516 LEU 516 2019 2019 LEU LEU A . n 
A 1 517 LEU 517 2020 2020 LEU LEU A . n 
A 1 518 PHE 518 2021 2021 PHE PHE A . n 
A 1 519 GLU 519 2022 2022 GLU GLU A . n 
A 1 520 THR 520 2023 2023 THR THR A . n 
A 1 521 SER 521 2024 2024 SER SER A . n 
A 1 522 GLU 522 2025 2025 GLU GLU A . n 
A 1 523 VAL 523 2026 2026 VAL VAL A . n 
A 1 524 VAL 524 2027 2027 VAL VAL A . n 
A 1 525 ASP 525 2028 2028 ASP ASP A . n 
A 1 526 VAL 526 2029 2029 VAL VAL A . n 
A 1 527 ALA 527 2030 2030 ALA ALA A . n 
A 1 528 LYS 528 2031 2031 LYS LYS A . n 
A 1 529 LEU 529 2032 2032 LEU LEU A . n 
A 1 530 MET 530 2033 2033 MET MET A . n 
A 1 531 LYS 531 2034 2034 LYS LYS A . n 
A 1 532 ALA 532 2035 2035 ALA ALA A . n 
A 1 533 TYR 533 2036 2036 TYR TYR A . n 
A 1 534 ILE 534 2037 2037 ILE ILE A . n 
A 1 535 SER 535 2038 2038 SER SER A . n 
A 1 536 MET 536 2039 2039 MET MET A . n 
A 1 537 ILE 537 2040 2040 ILE ILE A . n 
A 1 538 VAL 538 2041 2041 VAL VAL A . n 
A 1 539 LYS 539 2042 2042 LYS LYS A . n 
A 1 540 LYS 540 2043 2043 LYS LYS A . n 
A 1 541 ARG 541 2044 2044 ARG ARG A . n 
A 1 542 TYR 542 2045 2045 TYR TYR A . n 
A 1 543 SER 543 2046 2046 SER SER A . n 
A 1 544 THR 544 2047 2047 THR THR A . n 
A 1 545 THR 545 2048 2048 THR THR A . n 
A 1 546 ARG 546 2049 ?    ?   ?   A . n 
A 1 547 SER 547 2050 ?    ?   ?   A . n 
A 1 548 ALA 548 2051 ?    ?   ?   A . n 
A 1 549 SER 549 2052 ?    ?   ?   A . n 
A 1 550 SER 550 2053 ?    ?   ?   A . n 
A 1 551 GLN 551 2054 ?    ?   ?   A . n 
A 1 552 GLY 552 2055 ?    ?   ?   A . n 
A 1 553 SER 553 2056 ?    ?   ?   A . n 
A 1 554 SER 554 2057 ?    ?   ?   A . n 
A 1 555 ARG 555 2058 ?    ?   ?   A . n 
B 1 1   GLY 1   1484 ?    ?   ?   B . n 
B 1 2   PRO 2   1485 ?    ?   ?   B . n 
B 1 3   THR 3   1486 ?    ?   ?   B . n 
B 1 4   ARG 4   1487 ?    ?   ?   B . n 
B 1 5   TRP 5   1488 ?    ?   ?   B . n 
B 1 6   SER 6   1489 ?    ?   ?   B . n 
B 1 7   SER 7   1490 ?    ?   ?   B . n 
B 1 8   ALA 8   1491 ?    ?   ?   B . n 
B 1 9   ILE 9   1492 ?    ?   ?   B . n 
B 1 10  GLN 10  1493 ?    ?   ?   B . n 
B 1 11  ASN 11  1494 ?    ?   ?   B . n 
B 1 12  VAL 12  1495 ?    ?   ?   B . n 
B 1 13  THR 13  1496 ?    ?   ?   B . n 
B 1 14  ASP 14  1497 ?    ?   ?   B . n 
B 1 15  THR 15  1498 ?    ?   ?   B . n 
B 1 16  LYS 16  1499 ?    ?   ?   B . n 
B 1 17  ALA 17  1500 ?    ?   ?   B . n 
B 1 18  PRO 18  1501 ?    ?   ?   B . n 
B 1 19  ILE 19  1502 1502 ILE ILE B . n 
B 1 20  ASP 20  1503 1503 ASP ASP B . n 
B 1 21  THR 21  1504 1504 THR THR B . n 
B 1 22  PRO 22  1505 1505 PRO PRO B . n 
B 1 23  THR 23  1506 1506 THR THR B . n 
B 1 24  GLN 24  1507 1507 GLN GLN B . n 
B 1 25  GLN 25  1508 1508 GLN GLN B . n 
B 1 26  LEU 26  1509 1509 LEU LEU B . n 
B 1 27  ILE 27  1510 1510 ILE ILE B . n 
B 1 28  GLN 28  1511 1511 GLN GLN B . n 
B 1 29  ASP 29  1512 1512 ASP ASP B . n 
B 1 30  ILE 30  1513 1513 ILE ILE B . n 
B 1 31  LYS 31  1514 1514 LYS LYS B . n 
B 1 32  GLU 32  1515 1515 GLU GLU B . n 
B 1 33  ASN 33  1516 1516 ASN ASN B . n 
B 1 34  CYS 34  1517 1517 CYS CYS B . n 
B 1 35  LEU 35  1518 1518 LEU LEU B . n 
B 1 36  ASN 36  1519 1519 ASN ASN B . n 
B 1 37  SER 37  1520 1520 SER SER B . n 
B 1 38  ASP 38  1521 1521 ASP ASP B . n 
B 1 39  VAL 39  1522 1522 VAL VAL B . n 
B 1 40  VAL 40  1523 1523 VAL VAL B . n 
B 1 41  GLU 41  1524 1524 GLU GLU B . n 
B 1 42  GLN 42  1525 1525 GLN GLN B . n 
B 1 43  ILE 43  1526 1526 ILE ILE B . n 
B 1 44  TYR 44  1527 1527 TYR TYR B . n 
B 1 45  LYS 45  1528 1528 LYS LYS B . n 
B 1 46  ARG 46  1529 1529 ARG ARG B . n 
B 1 47  ASN 47  1530 1530 ASN ASN B . n 
B 1 48  PRO 48  1531 1531 PRO PRO B . n 
B 1 49  ILE 49  1532 1532 ILE ILE B . n 
B 1 50  LEU 50  1533 1533 LEU LEU B . n 
B 1 51  ARG 51  1534 1534 ARG ARG B . n 
B 1 52  TYR 52  1535 1535 TYR TYR B . n 
B 1 53  THR 53  1536 1536 THR THR B . n 
B 1 54  HIS 54  1537 1537 HIS HIS B . n 
B 1 55  HIS 55  1538 1538 HIS HIS B . n 
B 1 56  PRO 56  1539 1539 PRO PRO B . n 
B 1 57  LEU 57  1540 1540 LEU LEU B . n 
B 1 58  HIS 58  1541 1541 HIS HIS B . n 
B 1 59  SER 59  1542 1542 SER SER B . n 
B 1 60  PRO 60  1543 1543 PRO PRO B . n 
B 1 61  LEU 61  1544 1544 LEU LEU B . n 
B 1 62  LEU 62  1545 1545 LEU LEU B . n 
B 1 63  PRO 63  1546 1546 PRO PRO B . n 
B 1 64  LEU 64  1547 1547 LEU LEU B . n 
B 1 65  PRO 65  1548 1548 PRO PRO B . n 
B 1 66  TYR 66  1549 1549 TYR TYR B . n 
B 1 67  GLY 67  1550 ?    ?   ?   B . n 
B 1 68  ASP 68  1551 ?    ?   ?   B . n 
B 1 69  ILE 69  1552 ?    ?   ?   B . n 
B 1 70  ASN 70  1553 ?    ?   ?   B . n 
B 1 71  LEU 71  1554 ?    ?   ?   B . n 
B 1 72  ASN 72  1555 ?    ?   ?   B . n 
B 1 73  LEU 73  1556 ?    ?   ?   B . n 
B 1 74  LEU 74  1557 1557 LEU LEU B . n 
B 1 75  LYS 75  1558 1558 LYS LYS B . n 
B 1 76  ASP 76  1559 1559 ASP ASP B . n 
B 1 77  LYS 77  1560 1560 LYS LYS B . n 
B 1 78  GLY 78  1561 1561 GLY GLY B . n 
B 1 79  TYR 79  1562 1562 TYR TYR B . n 
B 1 80  THR 80  1563 1563 THR THR B . n 
B 1 81  THR 81  1564 1564 THR THR B . n 
B 1 82  LEU 82  1565 1565 LEU LEU B . n 
B 1 83  GLN 83  1566 1566 GLN GLN B . n 
B 1 84  ASP 84  1567 1567 ASP ASP B . n 
B 1 85  GLU 85  1568 1568 GLU GLU B . n 
B 1 86  ALA 86  1569 1569 ALA ALA B . n 
B 1 87  ILE 87  1570 1570 ILE ILE B . n 
B 1 88  LYS 88  1571 1571 LYS LYS B . n 
B 1 89  ILE 89  1572 1572 ILE ILE B . n 
B 1 90  PHE 90  1573 1573 PHE PHE B . n 
B 1 91  ASN 91  1574 1574 ASN ASN B . n 
B 1 92  SER 92  1575 1575 SER SER B . n 
B 1 93  LEU 93  1576 1576 LEU LEU B . n 
B 1 94  GLN 94  1577 1577 GLN GLN B . n 
B 1 95  GLN 95  1578 1578 GLN GLN B . n 
B 1 96  LEU 96  1579 1579 LEU LEU B . n 
B 1 97  GLU 97  1580 ?    ?   ?   B . n 
B 1 98  SER 98  1581 ?    ?   ?   B . n 
B 1 99  MET 99  1582 ?    ?   ?   B . n 
B 1 100 SER 100 1583 1583 SER SER B . n 
B 1 101 ASP 101 1584 1584 ASP ASP B . n 
B 1 102 PRO 102 1585 1585 PRO PRO B . n 
B 1 103 ILE 103 1586 1586 ILE ILE B . n 
B 1 104 PRO 104 1587 1587 PRO PRO B . n 
B 1 105 ILE 105 1588 1588 ILE ILE B . n 
B 1 106 ILE 106 1589 1589 ILE ILE B . n 
B 1 107 GLN 107 1590 1590 GLN GLN B . n 
B 1 108 GLY 108 1591 1591 GLY GLY B . n 
B 1 109 ILE 109 1592 1592 ILE ILE B . n 
B 1 110 LEU 110 1593 1593 LEU LEU B . n 
B 1 111 GLN 111 1594 1594 GLN GLN B . n 
B 1 112 THR 112 1595 1595 THR THR B . n 
B 1 113 GLY 113 1596 1596 GLY GLY B . n 
B 1 114 HIS 114 1597 1597 HIS HIS B . n 
B 1 115 ASP 115 1598 1598 ASP ASP B . n 
B 1 116 LEU 116 1599 1599 LEU LEU B . n 
B 1 117 ARG 117 1600 1600 ARG ARG B . n 
B 1 118 PRO 118 1601 1601 PRO PRO B . n 
B 1 119 LEU 119 1602 1602 LEU LEU B . n 
B 1 120 ARG 120 1603 1603 ARG ARG B . n 
B 1 121 ASP 121 1604 1604 ASP ASP B . n 
B 1 122 GLU 122 1605 1605 GLU GLU B . n 
B 1 123 LEU 123 1606 1606 LEU LEU B . n 
B 1 124 TYR 124 1607 1607 TYR TYR B . n 
B 1 125 CYS 125 1608 1608 CYS CYS B . n 
B 1 126 GLN 126 1609 1609 GLN GLN B . n 
B 1 127 LEU 127 1610 1610 LEU LEU B . n 
B 1 128 ILE 128 1611 1611 ILE ILE B . n 
B 1 129 LYS 129 1612 1612 LYS LYS B . n 
B 1 130 GLN 130 1613 1613 GLN GLN B . n 
B 1 131 THR 131 1614 1614 THR THR B . n 
B 1 132 ASN 132 1615 1615 ASN ASN B . n 
B 1 133 LYS 133 1616 1616 LYS LYS B . n 
B 1 134 VAL 134 1617 1617 VAL VAL B . n 
B 1 135 PRO 135 1618 1618 PRO PRO B . n 
B 1 136 HIS 136 1619 1619 HIS HIS B . n 
B 1 137 PRO 137 1620 1620 PRO PRO B . n 
B 1 138 GLY 138 1621 1621 GLY GLY B . n 
B 1 139 SER 139 1622 1622 SER SER B . n 
B 1 140 VAL 140 1623 1623 VAL VAL B . n 
B 1 141 GLY 141 1624 1624 GLY GLY B . n 
B 1 142 ASN 142 1625 1625 ASN ASN B . n 
B 1 143 LEU 143 1626 1626 LEU LEU B . n 
B 1 144 TYR 144 1627 1627 TYR TYR B . n 
B 1 145 SER 145 1628 1628 SER SER B . n 
B 1 146 TRP 146 1629 1629 TRP TRP B . n 
B 1 147 GLN 147 1630 1630 GLN GLN B . n 
B 1 148 ILE 148 1631 1631 ILE ILE B . n 
B 1 149 LEU 149 1632 1632 LEU LEU B . n 
B 1 150 THR 150 1633 1633 THR THR B . n 
B 1 151 CYS 151 1634 1634 CYS CYS B . n 
B 1 152 LEU 152 1635 1635 LEU LEU B . n 
B 1 153 SER 153 1636 1636 SER SER B . n 
B 1 154 CYS 154 1637 1637 CYS CYS B . n 
B 1 155 THR 155 1638 1638 THR THR B . n 
B 1 156 PHE 156 1639 1639 PHE PHE B . n 
B 1 157 LEU 157 1640 1640 LEU LEU B . n 
B 1 158 PRO 158 1641 1641 PRO PRO B . n 
B 1 159 SER 159 1642 1642 SER SER B . n 
B 1 160 ARG 160 1643 1643 ARG ARG B . n 
B 1 161 GLY 161 1644 1644 GLY GLY B . n 
B 1 162 ILE 162 1645 1645 ILE ILE B . n 
B 1 163 LEU 163 1646 1646 LEU LEU B . n 
B 1 164 LYS 164 1647 1647 LYS LYS B . n 
B 1 165 TYR 165 1648 1648 TYR TYR B . n 
B 1 166 LEU 166 1649 1649 LEU LEU B . n 
B 1 167 LYS 167 1650 1650 LYS LYS B . n 
B 1 168 PHE 168 1651 1651 PHE PHE B . n 
B 1 169 HIS 169 1652 1652 HIS HIS B . n 
B 1 170 LEU 170 1653 1653 LEU LEU B . n 
B 1 171 LYS 171 1654 1654 LYS LYS B . n 
B 1 172 ARG 172 1655 1655 ARG ARG B . n 
B 1 173 ILE 173 1656 1656 ILE ILE B . n 
B 1 174 ARG 174 1657 1657 ARG ARG B . n 
B 1 175 GLU 175 1658 1658 GLU GLU B . n 
B 1 176 GLN 176 1659 1659 GLN GLN B . n 
B 1 177 PHE 177 1660 1660 PHE PHE B . n 
B 1 178 PRO 178 1661 1661 PRO PRO B . n 
B 1 179 GLY 179 1662 1662 GLY GLY B . n 
B 1 180 THR 180 1663 1663 THR THR B . n 
B 1 181 GLU 181 1664 1664 GLU GLU B . n 
B 1 182 MET 182 1665 1665 MET MET B . n 
B 1 183 GLU 183 1666 1666 GLU GLU B . n 
B 1 184 LYS 184 1667 1667 LYS LYS B . n 
B 1 185 TYR 185 1668 1668 TYR TYR B . n 
B 1 186 ALA 186 1669 1669 ALA ALA B . n 
B 1 187 LEU 187 1670 1670 LEU LEU B . n 
B 1 188 PHE 188 1671 1671 PHE PHE B . n 
B 1 189 THR 189 1672 1672 THR THR B . n 
B 1 190 TYR 190 1673 1673 TYR TYR B . n 
B 1 191 GLU 191 1674 1674 GLU GLU B . n 
B 1 192 SER 192 1675 1675 SER SER B . n 
B 1 193 LEU 193 1676 1676 LEU LEU B . n 
B 1 194 LYS 194 1677 1677 LYS LYS B . n 
B 1 195 LYS 195 1678 1678 LYS LYS B . n 
B 1 196 THR 196 1679 1679 THR THR B . n 
B 1 197 LYS 197 1680 1680 LYS LYS B . n 
B 1 198 CYS 198 1681 1681 CYS CYS B . n 
B 1 199 ARG 199 1682 1682 ARG ARG B . n 
B 1 200 GLU 200 1683 1683 GLU GLU B . n 
B 1 201 PHE 201 1684 1684 PHE PHE B . n 
B 1 202 VAL 202 1685 1685 VAL VAL B . n 
B 1 203 PRO 203 1686 1686 PRO PRO B . n 
B 1 204 SER 204 1687 1687 SER SER B . n 
B 1 205 ARG 205 1688 1688 ARG ARG B . n 
B 1 206 ASP 206 1689 1689 ASP ASP B . n 
B 1 207 GLU 207 1690 1690 GLU GLU B . n 
B 1 208 ILE 208 1691 1691 ILE ILE B . n 
B 1 209 GLU 209 1692 1692 GLU GLU B . n 
B 1 210 ALA 210 1693 1693 ALA ALA B . n 
B 1 211 LEU 211 1694 1694 LEU LEU B . n 
B 1 212 ILE 212 1695 1695 ILE ILE B . n 
B 1 213 HIS 213 1696 1696 HIS HIS B . n 
B 1 214 ARG 214 1697 1697 ARG ARG B . n 
B 1 215 GLN 215 1698 1698 GLN GLN B . n 
B 1 216 GLU 216 1699 1699 GLU GLU B . n 
B 1 217 MET 217 1700 1700 MET MET B . n 
B 1 218 THR 218 1701 1701 THR THR B . n 
B 1 219 SER 219 1702 1702 SER SER B . n 
B 1 220 THR 220 1703 1703 THR THR B . n 
B 1 221 VAL 221 1704 1704 VAL VAL B . n 
B 1 222 TYR 222 1705 1705 TYR TYR B . n 
B 1 223 CYS 223 1706 1706 CYS CYS B . n 
B 1 224 HIS 224 1707 1707 HIS HIS B . n 
B 1 225 GLY 225 1708 1708 GLY GLY B . n 
B 1 226 GLY 226 1709 1709 GLY GLY B . n 
B 1 227 GLY 227 1710 1710 GLY GLY B . n 
B 1 228 SER 228 1711 1711 SER SER B . n 
B 1 229 CYS 229 1712 1712 CYS CYS B . n 
B 1 230 LYS 230 1713 1713 LYS LYS B . n 
B 1 231 ILE 231 1714 1714 ILE ILE B . n 
B 1 232 THR 232 1715 1715 THR THR B . n 
B 1 233 ILE 233 1716 1716 ILE ILE B . n 
B 1 234 ASN 234 1717 1717 ASN ASN B . n 
B 1 235 SER 235 1718 1718 SER SER B . n 
B 1 236 HIS 236 1719 1719 HIS HIS B . n 
B 1 237 THR 237 1720 1720 THR THR B . n 
B 1 238 THR 238 1721 1721 THR THR B . n 
B 1 239 ALA 239 1722 1722 ALA ALA B . n 
B 1 240 GLY 240 1723 1723 GLY GLY B . n 
B 1 241 GLU 241 1724 1724 GLU GLU B . n 
B 1 242 VAL 242 1725 1725 VAL VAL B . n 
B 1 243 VAL 243 1726 1726 VAL VAL B . n 
B 1 244 GLU 244 1727 1727 GLU GLU B . n 
B 1 245 LYS 245 1728 1728 LYS LYS B . n 
B 1 246 LEU 246 1729 1729 LEU LEU B . n 
B 1 247 ILE 247 1730 1730 ILE ILE B . n 
B 1 248 ARG 248 1731 1731 ARG ARG B . n 
B 1 249 GLY 249 1732 1732 GLY GLY B . n 
B 1 250 LEU 250 1733 1733 LEU LEU B . n 
B 1 251 ALA 251 1734 1734 ALA ALA B . n 
B 1 252 MET 252 1735 1735 MET MET B . n 
B 1 253 GLU 253 1736 1736 GLU GLU B . n 
B 1 254 ASP 254 1737 1737 ASP ASP B . n 
B 1 255 SER 255 1738 1738 SER SER B . n 
B 1 256 ARG 256 1739 1739 ARG ARG B . n 
B 1 257 ASN 257 1740 1740 ASN ASN B . n 
B 1 258 MET 258 1741 1741 MET MET B . n 
B 1 259 PHE 259 1742 1742 PHE PHE B . n 
B 1 260 ALA 260 1743 1743 ALA ALA B . n 
B 1 261 LEU 261 1744 1744 LEU LEU B . n 
B 1 262 PHE 262 1745 1745 PHE PHE B . n 
B 1 263 GLU 263 1746 1746 GLU GLU B . n 
B 1 264 TYR 264 1747 1747 TYR TYR B . n 
B 1 265 ASN 265 1748 1748 ASN ASN B . n 
B 1 266 GLY 266 1749 1749 GLY GLY B . n 
B 1 267 HIS 267 1750 1750 HIS HIS B . n 
B 1 268 VAL 268 1751 1751 VAL VAL B . n 
B 1 269 ASP 269 1752 1752 ASP ASP B . n 
B 1 270 LYS 270 1753 1753 LYS LYS B . n 
B 1 271 ALA 271 1754 1754 ALA ALA B . n 
B 1 272 ILE 272 1755 1755 ILE ILE B . n 
B 1 273 GLU 273 1756 1756 GLU GLU B . n 
B 1 274 SER 274 1757 1757 SER SER B . n 
B 1 275 ARG 275 1758 1758 ARG ARG B . n 
B 1 276 THR 276 1759 1759 THR THR B . n 
B 1 277 VAL 277 1760 1760 VAL VAL B . n 
B 1 278 VAL 278 1761 1761 VAL VAL B . n 
B 1 279 ALA 279 1762 1762 ALA ALA B . n 
B 1 280 ASP 280 1763 1763 ASP ASP B . n 
B 1 281 VAL 281 1764 1764 VAL VAL B . n 
B 1 282 LEU 282 1765 1765 LEU LEU B . n 
B 1 283 ALA 283 1766 1766 ALA ALA B . n 
B 1 284 LYS 284 1767 1767 LYS LYS B . n 
B 1 285 PHE 285 1768 1768 PHE PHE B . n 
B 1 286 GLU 286 1769 1769 GLU GLU B . n 
B 1 287 LYS 287 1770 1770 LYS LYS B . n 
B 1 288 LEU 288 1771 1771 LEU LEU B . n 
B 1 289 ALA 289 1772 1772 ALA ALA B . n 
B 1 290 ALA 290 1773 1773 ALA ALA B . n 
B 1 291 THR 291 1774 ?    ?   ?   B . n 
B 1 292 SER 292 1775 ?    ?   ?   B . n 
B 1 293 GLU 293 1776 ?    ?   ?   B . n 
B 1 294 VAL 294 1777 ?    ?   ?   B . n 
B 1 295 GLY 295 1778 ?    ?   ?   B . n 
B 1 296 ASP 296 1779 ?    ?   ?   B . n 
B 1 297 LEU 297 1780 1780 LEU LEU B . n 
B 1 298 PRO 298 1781 1781 PRO PRO B . n 
B 1 299 TRP 299 1782 1782 TRP TRP B . n 
B 1 300 LYS 300 1783 1783 LYS LYS B . n 
B 1 301 PHE 301 1784 1784 PHE PHE B . n 
B 1 302 TYR 302 1785 1785 TYR TYR B . n 
B 1 303 PHE 303 1786 1786 PHE PHE B . n 
B 1 304 LYS 304 1787 1787 LYS LYS B . n 
B 1 305 LEU 305 1788 1788 LEU LEU B . n 
B 1 306 TYR 306 1789 1789 TYR TYR B . n 
B 1 307 CYS 307 1790 1790 CYS CYS B . n 
B 1 308 PHE 308 1791 1791 PHE PHE B . n 
B 1 309 LEU 309 1792 1792 LEU LEU B . n 
B 1 310 ASP 310 1793 1793 ASP ASP B . n 
B 1 311 THR 311 1794 1794 THR THR B . n 
B 1 312 ASP 312 1795 1795 ASP ASP B . n 
B 1 313 ASN 313 1796 1796 ASN ASN B . n 
B 1 314 VAL 314 1797 1797 VAL VAL B . n 
B 1 315 PRO 315 1798 1798 PRO PRO B . n 
B 1 316 LYS 316 1799 1799 LYS LYS B . n 
B 1 317 ASP 317 1800 1800 ASP ASP B . n 
B 1 318 SER 318 1801 1801 SER SER B . n 
B 1 319 VAL 319 1802 1802 VAL VAL B . n 
B 1 320 GLU 320 1803 1803 GLU GLU B . n 
B 1 321 PHE 321 1804 1804 PHE PHE B . n 
B 1 322 ALA 322 1805 1805 ALA ALA B . n 
B 1 323 PHE 323 1806 1806 PHE PHE B . n 
B 1 324 MET 324 1807 1807 MET MET B . n 
B 1 325 PHE 325 1808 1808 PHE PHE B . n 
B 1 326 GLU 326 1809 1809 GLU GLU B . n 
B 1 327 GLN 327 1810 1810 GLN GLN B . n 
B 1 328 ALA 328 1811 1811 ALA ALA B . n 
B 1 329 HIS 329 1812 1812 HIS HIS B . n 
B 1 330 GLU 330 1813 1813 GLU GLU B . n 
B 1 331 ALA 331 1814 1814 ALA ALA B . n 
B 1 332 VAL 332 1815 1815 VAL VAL B . n 
B 1 333 ILE 333 1816 1816 ILE ILE B . n 
B 1 334 HIS 334 1817 1817 HIS HIS B . n 
B 1 335 GLY 335 1818 1818 GLY GLY B . n 
B 1 336 HIS 336 1819 1819 HIS HIS B . n 
B 1 337 HIS 337 1820 1820 HIS HIS B . n 
B 1 338 PRO 338 1821 1821 PRO PRO B . n 
B 1 339 ALA 339 1822 1822 ALA ALA B . n 
B 1 340 PRO 340 1823 1823 PRO PRO B . n 
B 1 341 GLU 341 1824 1824 GLU GLU B . n 
B 1 342 GLU 342 1825 1825 GLU GLU B . n 
B 1 343 ASN 343 1826 1826 ASN ASN B . n 
B 1 344 LEU 344 1827 1827 LEU LEU B . n 
B 1 345 GLN 345 1828 1828 GLN GLN B . n 
B 1 346 VAL 346 1829 1829 VAL VAL B . n 
B 1 347 LEU 347 1830 1830 LEU LEU B . n 
B 1 348 ALA 348 1831 1831 ALA ALA B . n 
B 1 349 ALA 349 1832 1832 ALA ALA B . n 
B 1 350 LEU 350 1833 1833 LEU LEU B . n 
B 1 351 ARG 351 1834 1834 ARG ARG B . n 
B 1 352 LEU 352 1835 1835 LEU LEU B . n 
B 1 353 GLN 353 1836 1836 GLN GLN B . n 
B 1 354 TYR 354 1837 1837 TYR TYR B . n 
B 1 355 LEU 355 1838 1838 LEU LEU B . n 
B 1 356 GLN 356 1839 1839 GLN GLN B . n 
B 1 357 GLY 357 1840 1840 GLY GLY B . n 
B 1 358 ASP 358 1841 1841 ASP ASP B . n 
B 1 359 TYR 359 1842 1842 TYR TYR B . n 
B 1 360 THR 360 1843 1843 THR THR B . n 
B 1 361 LEU 361 1844 1844 LEU LEU B . n 
B 1 362 HIS 362 1845 1845 HIS HIS B . n 
B 1 363 ALA 363 1846 1846 ALA ALA B . n 
B 1 364 ALA 364 1847 1847 ALA ALA B . n 
B 1 365 ILE 365 1848 1848 ILE ILE B . n 
B 1 366 PRO 366 1849 1849 PRO PRO B . n 
B 1 367 PRO 367 1850 1850 PRO PRO B . n 
B 1 368 LEU 368 1851 1851 LEU LEU B . n 
B 1 369 GLU 369 1852 1852 GLU GLU B . n 
B 1 370 GLU 370 1853 1853 GLU GLU B . n 
B 1 371 VAL 371 1854 1854 VAL VAL B . n 
B 1 372 TYR 372 1855 1855 TYR TYR B . n 
B 1 373 SER 373 1856 1856 SER SER B . n 
B 1 374 LEU 374 1857 1857 LEU LEU B . n 
B 1 375 GLN 375 1858 1858 GLN GLN B . n 
B 1 376 ARG 376 1859 1859 ARG ARG B . n 
B 1 377 LEU 377 1860 1860 LEU LEU B . n 
B 1 378 LYS 378 1861 1861 LYS LYS B . n 
B 1 379 ALA 379 1862 1862 ALA ALA B . n 
B 1 380 ARG 380 1863 1863 ARG ARG B . n 
B 1 381 ILE 381 1884 ?    ?   ?   B . n 
B 1 382 SER 382 1885 ?    ?   ?   B . n 
B 1 383 GLN 383 1886 ?    ?   ?   B . n 
B 1 384 SER 384 1887 ?    ?   ?   B . n 
B 1 385 THR 385 1888 ?    ?   ?   B . n 
B 1 386 LYS 386 1889 ?    ?   ?   B . n 
B 1 387 THR 387 1890 ?    ?   ?   B . n 
B 1 388 PHE 388 1891 ?    ?   ?   B . n 
B 1 389 SER 389 1892 ?    ?   ?   B . n 
B 1 390 PHE 390 1893 ?    ?   ?   B . n 
B 1 391 ARG 391 1894 ?    ?   ?   B . n 
B 1 392 THR 392 1895 ?    ?   ?   B . n 
B 1 393 GLY 393 1896 ?    ?   ?   B . n 
B 1 394 SER 394 1897 ?    ?   ?   B . n 
B 1 395 VAL 395 1898 ?    ?   ?   B . n 
B 1 396 VAL 396 1899 ?    ?   ?   B . n 
B 1 397 ARG 397 1900 ?    ?   ?   B . n 
B 1 398 GLN 398 1901 ?    ?   ?   B . n 
B 1 399 LYS 399 1902 ?    ?   ?   B . n 
B 1 400 VAL 400 1903 ?    ?   ?   B . n 
B 1 401 GLU 401 1904 ?    ?   ?   B . n 
B 1 402 GLU 402 1905 ?    ?   ?   B . n 
B 1 403 GLU 403 1906 ?    ?   ?   B . n 
B 1 404 GLN 404 1907 ?    ?   ?   B . n 
B 1 405 MET 405 1908 ?    ?   ?   B . n 
B 1 406 LEU 406 1909 ?    ?   ?   B . n 
B 1 407 ASP 407 1910 ?    ?   ?   B . n 
B 1 408 MET 408 1911 1911 MET MET B . n 
B 1 409 TRP 409 1912 1912 TRP TRP B . n 
B 1 410 ILE 410 1913 1913 ILE ILE B . n 
B 1 411 LYS 411 1914 1914 LYS LYS B . n 
B 1 412 GLU 412 1915 1915 GLU GLU B . n 
B 1 413 GLU 413 1916 1916 GLU GLU B . n 
B 1 414 VAL 414 1917 1917 VAL VAL B . n 
B 1 415 SER 415 1918 1918 SER SER B . n 
B 1 416 SER 416 1919 1919 SER SER B . n 
B 1 417 ALA 417 1920 1920 ALA ALA B . n 
B 1 418 ARG 418 1921 1921 ARG ARG B . n 
B 1 419 ALA 419 1922 1922 ALA ALA B . n 
B 1 420 SER 420 1923 1923 SER SER B . n 
B 1 421 ILE 421 1924 1924 ILE ILE B . n 
B 1 422 ILE 422 1925 1925 ILE ILE B . n 
B 1 423 ASP 423 1926 1926 ASP ASP B . n 
B 1 424 LYS 424 1927 1927 LYS LYS B . n 
B 1 425 TRP 425 1928 1928 TRP TRP B . n 
B 1 426 ARG 426 1929 1929 ARG ARG B . n 
B 1 427 LYS 427 1930 1930 LYS LYS B . n 
B 1 428 PHE 428 1931 1931 PHE PHE B . n 
B 1 429 GLN 429 1932 1932 GLN GLN B . n 
B 1 430 GLY 430 1933 1933 GLY GLY B . n 
B 1 431 MET 431 1934 1934 MET MET B . n 
B 1 432 ASN 432 1935 1935 ASN ASN B . n 
B 1 433 GLN 433 1936 1936 GLN GLN B . n 
B 1 434 GLU 434 1937 1937 GLU GLU B . n 
B 1 435 GLN 435 1938 1938 GLN GLN B . n 
B 1 436 ALA 436 1939 1939 ALA ALA B . n 
B 1 437 MET 437 1940 1940 MET MET B . n 
B 1 438 ALA 438 1941 1941 ALA ALA B . n 
B 1 439 LYS 439 1942 1942 LYS LYS B . n 
B 1 440 TYR 440 1943 1943 TYR TYR B . n 
B 1 441 MET 441 1944 1944 MET MET B . n 
B 1 442 ALA 442 1945 1945 ALA ALA B . n 
B 1 443 LEU 443 1946 1946 LEU LEU B . n 
B 1 444 ILE 444 1947 1947 ILE ILE B . n 
B 1 445 LYS 445 1948 1948 LYS LYS B . n 
B 1 446 GLU 446 1949 1949 GLU GLU B . n 
B 1 447 TRP 447 1950 1950 TRP TRP B . n 
B 1 448 PRO 448 1951 1951 PRO PRO B . n 
B 1 449 GLY 449 1952 1952 GLY GLY B . n 
B 1 450 TYR 450 1953 1953 TYR TYR B . n 
B 1 451 GLY 451 1954 1954 GLY GLY B . n 
B 1 452 SER 452 1955 1955 SER SER B . n 
B 1 453 THR 453 1956 1956 THR THR B . n 
B 1 454 LEU 454 1957 1957 LEU LEU B . n 
B 1 455 PHE 455 1958 1958 PHE PHE B . n 
B 1 456 ASP 456 1959 1959 ASP ASP B . n 
B 1 457 VAL 457 1960 1960 VAL VAL B . n 
B 1 458 GLU 458 1961 1961 GLU GLU B . n 
B 1 459 CYS 459 1962 1962 CYS CYS B . n 
B 1 460 LYS 460 1963 1963 LYS LYS B . n 
B 1 461 GLU 461 1964 1964 GLU GLU B . n 
B 1 462 GLY 462 1965 1965 GLY GLY B . n 
B 1 463 GLY 463 1966 1966 GLY GLY B . n 
B 1 464 PHE 464 1967 1967 PHE PHE B . n 
B 1 465 PRO 465 1968 1968 PRO PRO B . n 
B 1 466 GLN 466 1969 1969 GLN GLN B . n 
B 1 467 GLU 467 1970 1970 GLU GLU B . n 
B 1 468 LEU 468 1971 1971 LEU LEU B . n 
B 1 469 TRP 469 1972 1972 TRP TRP B . n 
B 1 470 LEU 470 1973 1973 LEU LEU B . n 
B 1 471 GLY 471 1974 1974 GLY GLY B . n 
B 1 472 VAL 472 1975 1975 VAL VAL B . n 
B 1 473 SER 473 1976 1976 SER SER B . n 
B 1 474 ALA 474 1977 1977 ALA ALA B . n 
B 1 475 ASP 475 1978 1978 ASP ASP B . n 
B 1 476 ALA 476 1979 1979 ALA ALA B . n 
B 1 477 VAL 477 1980 1980 VAL VAL B . n 
B 1 478 SER 478 1981 1981 SER SER B . n 
B 1 479 VAL 479 1982 1982 VAL VAL B . n 
B 1 480 TYR 480 1983 1983 TYR TYR B . n 
B 1 481 LYS 481 1984 1984 LYS LYS B . n 
B 1 482 ARG 482 1985 1985 ARG ARG B . n 
B 1 483 GLY 483 1986 1986 GLY GLY B . n 
B 1 484 GLU 484 1987 1987 GLU GLU B . n 
B 1 485 GLY 485 1988 1988 GLY GLY B . n 
B 1 486 ARG 486 1989 1989 ARG ARG B . n 
B 1 487 PRO 487 1990 1990 PRO PRO B . n 
B 1 488 LEU 488 1991 1991 LEU LEU B . n 
B 1 489 GLU 489 1992 1992 GLU GLU B . n 
B 1 490 VAL 490 1993 1993 VAL VAL B . n 
B 1 491 PHE 491 1994 1994 PHE PHE B . n 
B 1 492 GLN 492 1995 1995 GLN GLN B . n 
B 1 493 TYR 493 1996 1996 TYR TYR B . n 
B 1 494 GLU 494 1997 1997 GLU GLU B . n 
B 1 495 HIS 495 1998 1998 HIS HIS B . n 
B 1 496 ILE 496 1999 1999 ILE ILE B . n 
B 1 497 LEU 497 2000 2000 LEU LEU B . n 
B 1 498 SER 498 2001 2001 SER SER B . n 
B 1 499 PHE 499 2002 2002 PHE PHE B . n 
B 1 500 GLY 500 2003 2003 GLY GLY B . n 
B 1 501 ALA 501 2004 2004 ALA ALA B . n 
B 1 502 PRO 502 2005 2005 PRO PRO B . n 
B 1 503 LEU 503 2006 2006 LEU LEU B . n 
B 1 504 ALA 504 2007 2007 ALA ALA B . n 
B 1 505 ASN 505 2008 2008 ASN ASN B . n 
B 1 506 THR 506 2009 2009 THR THR B . n 
B 1 507 TYR 507 2010 2010 TYR TYR B . n 
B 1 508 LYS 508 2011 2011 LYS LYS B . n 
B 1 509 ILE 509 2012 2012 ILE ILE B . n 
B 1 510 VAL 510 2013 2013 VAL VAL B . n 
B 1 511 VAL 511 2014 2014 VAL VAL B . n 
B 1 512 ASP 512 2015 2015 ASP ASP B . n 
B 1 513 GLU 513 2016 2016 GLU GLU B . n 
B 1 514 ARG 514 2017 2017 ARG ARG B . n 
B 1 515 GLU 515 2018 2018 GLU GLU B . n 
B 1 516 LEU 516 2019 2019 LEU LEU B . n 
B 1 517 LEU 517 2020 2020 LEU LEU B . n 
B 1 518 PHE 518 2021 2021 PHE PHE B . n 
B 1 519 GLU 519 2022 2022 GLU GLU B . n 
B 1 520 THR 520 2023 2023 THR THR B . n 
B 1 521 SER 521 2024 2024 SER SER B . n 
B 1 522 GLU 522 2025 2025 GLU GLU B . n 
B 1 523 VAL 523 2026 2026 VAL VAL B . n 
B 1 524 VAL 524 2027 2027 VAL VAL B . n 
B 1 525 ASP 525 2028 2028 ASP ASP B . n 
B 1 526 VAL 526 2029 2029 VAL VAL B . n 
B 1 527 ALA 527 2030 2030 ALA ALA B . n 
B 1 528 LYS 528 2031 2031 LYS LYS B . n 
B 1 529 LEU 529 2032 2032 LEU LEU B . n 
B 1 530 MET 530 2033 2033 MET MET B . n 
B 1 531 LYS 531 2034 2034 LYS LYS B . n 
B 1 532 ALA 532 2035 2035 ALA ALA B . n 
B 1 533 TYR 533 2036 2036 TYR TYR B . n 
B 1 534 ILE 534 2037 2037 ILE ILE B . n 
B 1 535 SER 535 2038 2038 SER SER B . n 
B 1 536 MET 536 2039 2039 MET MET B . n 
B 1 537 ILE 537 2040 2040 ILE ILE B . n 
B 1 538 VAL 538 2041 2041 VAL VAL B . n 
B 1 539 LYS 539 2042 2042 LYS LYS B . n 
B 1 540 LYS 540 2043 2043 LYS LYS B . n 
B 1 541 ARG 541 2044 2044 ARG ARG B . n 
B 1 542 TYR 542 2045 2045 TYR TYR B . n 
B 1 543 SER 543 2046 2046 SER SER B . n 
B 1 544 THR 544 2047 2047 THR THR B . n 
B 1 545 THR 545 2048 2048 THR THR B . n 
B 1 546 ARG 546 2049 ?    ?   ?   B . n 
B 1 547 SER 547 2050 ?    ?   ?   B . n 
B 1 548 ALA 548 2051 ?    ?   ?   B . n 
B 1 549 SER 549 2052 ?    ?   ?   B . n 
B 1 550 SER 550 2053 ?    ?   ?   B . n 
B 1 551 GLN 551 2054 ?    ?   ?   B . n 
B 1 552 GLY 552 2055 ?    ?   ?   B . n 
B 1 553 SER 553 2056 ?    ?   ?   B . n 
B 1 554 SER 554 2057 ?    ?   ?   B . n 
B 1 555 ARG 555 2058 ?    ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-07-13 
2 'Structure model' 1 1 2014-01-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .   ? 1 
PHASER   phasing           .   ? 2 
CNS      refinement        1.3 ? 3 
HKL-2000 'data reduction'  .   ? 4 
HKL-2000 'data scaling'    .   ? 5 
# 
_pdbx_entry_details.entry_id             3AU5 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'RESIDUE SER1663THR IS NATURAL VARIANT ACCORDING TO DATABASE Q9HD67 (MYO10_HUMAN).' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 1516 ? ? -145.97 13.42   
2  1 LEU A 1547 ? ? -118.70 74.93   
3  1 ASP A 1551 ? ? -113.72 56.59   
4  1 THR A 1563 ? ? -94.95  -88.58  
5  1 LEU A 1576 ? ? -72.58  27.88   
6  1 SER A 1583 ? ? -67.54  4.75    
7  1 LYS A 1680 ? ? -105.69 -90.96  
8  1 ASN A 1717 ? ? -109.24 -167.48 
9  1 PRO A 1821 ? ? -69.44  92.15   
10 1 GLU A 1964 ? ? -167.18 118.09  
11 1 PRO A 1968 ? ? -60.51  -171.00 
12 1 ARG A 1985 ? ? -20.51  98.76   
13 1 GLU A 1992 ? ? 175.24  133.43  
14 1 ASP A 2015 ? ? 51.31   -177.36 
15 1 GLU A 2016 ? ? -67.11  22.87   
16 1 GLU A 2025 ? ? -93.90  45.18   
17 1 ASP B 1503 ? ? -119.60 -150.18 
18 1 ASN B 1516 ? ? -148.66 15.80   
19 1 ASP B 1559 ? ? -64.04  10.08   
20 1 LYS B 1560 ? ? 179.16  166.15  
21 1 THR B 1563 ? ? -127.58 -77.99  
22 1 ASP B 1584 ? ? 45.82   85.24   
23 1 ILE B 1586 ? ? -25.99  -53.54  
24 1 PHE B 1660 ? ? -150.85 52.79   
25 1 LYS B 1680 ? ? -119.41 -93.70  
26 1 PRO B 1686 ? ? -29.16  135.91  
27 1 ARG B 1731 ? ? -76.22  36.64   
28 1 SER B 1738 ? ? -39.51  142.02  
29 1 ASP B 1800 ? ? 78.39   -20.67  
30 1 GLU B 1824 ? ? -28.41  -58.83  
31 1 LEU B 1844 ? ? -27.94  -38.89  
32 1 GLU B 1852 ? ? -55.23  -9.63   
33 1 GLU B 1915 ? ? -50.05  -70.15  
34 1 LYS B 1948 ? ? -57.97  -5.70   
35 1 LYS B 1963 ? ? -79.82  -75.05  
36 1 PRO B 1968 ? ? -57.11  177.13  
37 1 GLN B 1969 ? ? -73.30  -80.70  
38 1 ARG B 1985 ? ? 166.47  -12.59  
39 1 ALA B 2007 ? ? -33.87  -38.64  
40 1 ASP B 2015 ? ? -139.10 -156.80 
41 1 THR B 2023 ? ? -173.20 133.01  
42 1 THR B 2047 ? ? -100.94 40.01   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ASP 1551 ? CG  ? A ASP 68  CG  
2   1 Y 1 A ASP 1551 ? OD1 ? A ASP 68  OD1 
3   1 Y 1 A ASP 1551 ? OD2 ? A ASP 68  OD2 
4   1 Y 1 A LEU 1576 ? CG  ? A LEU 93  CG  
5   1 Y 1 A LEU 1576 ? CD1 ? A LEU 93  CD1 
6   1 Y 1 A LEU 1576 ? CD2 ? A LEU 93  CD2 
7   1 Y 1 A LYS 1680 ? CG  ? A LYS 197 CG  
8   1 Y 1 A LYS 1680 ? CD  ? A LYS 197 CD  
9   1 Y 1 A LYS 1680 ? CE  ? A LYS 197 CE  
10  1 Y 1 A LYS 1680 ? NZ  ? A LYS 197 NZ  
11  1 Y 1 A GLU 1727 ? CG  ? A GLU 244 CG  
12  1 Y 1 A GLU 1727 ? CD  ? A GLU 244 CD  
13  1 Y 1 A GLU 1727 ? OE1 ? A GLU 244 OE1 
14  1 Y 1 A GLU 1727 ? OE2 ? A GLU 244 OE2 
15  1 Y 1 A LYS 1728 ? CG  ? A LYS 245 CG  
16  1 Y 1 A LYS 1728 ? CD  ? A LYS 245 CD  
17  1 Y 1 A LYS 1728 ? CE  ? A LYS 245 CE  
18  1 Y 1 A LYS 1728 ? NZ  ? A LYS 245 NZ  
19  1 Y 1 A HIS 1750 ? CG  ? A HIS 267 CG  
20  1 Y 1 A HIS 1750 ? ND1 ? A HIS 267 ND1 
21  1 Y 1 A HIS 1750 ? CD2 ? A HIS 267 CD2 
22  1 Y 1 A HIS 1750 ? CE1 ? A HIS 267 CE1 
23  1 Y 1 A HIS 1750 ? NE2 ? A HIS 267 NE2 
24  1 Y 1 A ARG 1758 ? CG  ? A ARG 275 CG  
25  1 Y 1 A ARG 1758 ? CD  ? A ARG 275 CD  
26  1 Y 1 A ARG 1758 ? NE  ? A ARG 275 NE  
27  1 Y 1 A ARG 1758 ? CZ  ? A ARG 275 CZ  
28  1 Y 1 A ARG 1758 ? NH1 ? A ARG 275 NH1 
29  1 Y 1 A ARG 1758 ? NH2 ? A ARG 275 NH2 
30  1 Y 1 A LEU 1857 ? CG  ? A LEU 374 CG  
31  1 Y 1 A LEU 1857 ? CD1 ? A LEU 374 CD1 
32  1 Y 1 A LEU 1857 ? CD2 ? A LEU 374 CD2 
33  1 Y 1 A GLN 1858 ? CG  ? A GLN 375 CG  
34  1 Y 1 A GLN 1858 ? CD  ? A GLN 375 CD  
35  1 Y 1 A GLN 1858 ? OE1 ? A GLN 375 OE1 
36  1 Y 1 A GLN 1858 ? NE2 ? A GLN 375 NE2 
37  1 Y 1 A ARG 1859 ? CG  ? A ARG 376 CG  
38  1 Y 1 A ARG 1859 ? CD  ? A ARG 376 CD  
39  1 Y 1 A ARG 1859 ? NE  ? A ARG 376 NE  
40  1 Y 1 A ARG 1859 ? CZ  ? A ARG 376 CZ  
41  1 Y 1 A ARG 1859 ? NH1 ? A ARG 376 NH1 
42  1 Y 1 A ARG 1859 ? NH2 ? A ARG 376 NH2 
43  1 Y 1 A ARG 1863 ? CG  ? A ARG 380 CG  
44  1 Y 1 A ARG 1863 ? CD  ? A ARG 380 CD  
45  1 Y 1 A ARG 1863 ? NE  ? A ARG 380 NE  
46  1 Y 1 A ARG 1863 ? CZ  ? A ARG 380 CZ  
47  1 Y 1 A ARG 1863 ? NH1 ? A ARG 380 NH1 
48  1 Y 1 A ARG 1863 ? NH2 ? A ARG 380 NH2 
49  1 Y 1 A LYS 1914 ? CG  ? A LYS 411 CG  
50  1 Y 1 A LYS 1914 ? CD  ? A LYS 411 CD  
51  1 Y 1 A LYS 1914 ? CE  ? A LYS 411 CE  
52  1 Y 1 A LYS 1914 ? NZ  ? A LYS 411 NZ  
53  1 Y 1 A LYS 1963 ? CG  ? A LYS 460 CG  
54  1 Y 1 A LYS 1963 ? CD  ? A LYS 460 CD  
55  1 Y 1 A LYS 1963 ? CE  ? A LYS 460 CE  
56  1 Y 1 A LYS 1963 ? NZ  ? A LYS 460 NZ  
57  1 Y 1 A GLU 1964 ? CG  ? A GLU 461 CG  
58  1 Y 1 A GLU 1964 ? CD  ? A GLU 461 CD  
59  1 Y 1 A GLU 1964 ? OE1 ? A GLU 461 OE1 
60  1 Y 1 A GLU 1964 ? OE2 ? A GLU 461 OE2 
61  1 Y 1 A LYS 1984 ? CG  ? A LYS 481 CG  
62  1 Y 1 A LYS 1984 ? CD  ? A LYS 481 CD  
63  1 Y 1 A LYS 1984 ? CE  ? A LYS 481 CE  
64  1 Y 1 A LYS 1984 ? NZ  ? A LYS 481 NZ  
65  1 Y 1 A GLU 1987 ? CG  ? A GLU 484 CG  
66  1 Y 1 A GLU 1987 ? CD  ? A GLU 484 CD  
67  1 Y 1 A GLU 1987 ? OE1 ? A GLU 484 OE1 
68  1 Y 1 A GLU 1987 ? OE2 ? A GLU 484 OE2 
69  1 Y 1 A ARG 1989 ? CG  ? A ARG 486 CG  
70  1 Y 1 A ARG 1989 ? CD  ? A ARG 486 CD  
71  1 Y 1 A ARG 1989 ? NE  ? A ARG 486 NE  
72  1 Y 1 A ARG 1989 ? CZ  ? A ARG 486 CZ  
73  1 Y 1 A ARG 1989 ? NH1 ? A ARG 486 NH1 
74  1 Y 1 A ARG 1989 ? NH2 ? A ARG 486 NH2 
75  1 Y 1 A LEU 2000 ? CG  ? A LEU 497 CG  
76  1 Y 1 A LEU 2000 ? CD1 ? A LEU 497 CD1 
77  1 Y 1 A LEU 2000 ? CD2 ? A LEU 497 CD2 
78  1 Y 1 A LYS 2011 ? CG  ? A LYS 508 CG  
79  1 Y 1 A LYS 2011 ? CD  ? A LYS 508 CD  
80  1 Y 1 A LYS 2011 ? CE  ? A LYS 508 CE  
81  1 Y 1 A LYS 2011 ? NZ  ? A LYS 508 NZ  
82  1 Y 1 A VAL 2014 ? CG1 ? A VAL 511 CG1 
83  1 Y 1 A VAL 2014 ? CG2 ? A VAL 511 CG2 
84  1 Y 1 A GLU 2016 ? CG  ? A GLU 513 CG  
85  1 Y 1 A GLU 2016 ? CD  ? A GLU 513 CD  
86  1 Y 1 A GLU 2016 ? OE1 ? A GLU 513 OE1 
87  1 Y 1 A GLU 2016 ? OE2 ? A GLU 513 OE2 
88  1 Y 1 A GLU 2018 ? CG  ? A GLU 515 CG  
89  1 Y 1 A GLU 2018 ? CD  ? A GLU 515 CD  
90  1 Y 1 A GLU 2018 ? OE1 ? A GLU 515 OE1 
91  1 Y 1 A GLU 2018 ? OE2 ? A GLU 515 OE2 
92  1 Y 1 A LEU 2020 ? CG  ? A LEU 517 CG  
93  1 Y 1 A LEU 2020 ? CD1 ? A LEU 517 CD1 
94  1 Y 1 A LEU 2020 ? CD2 ? A LEU 517 CD2 
95  1 Y 1 A GLU 2022 ? CG  ? A GLU 519 CG  
96  1 Y 1 A GLU 2022 ? CD  ? A GLU 519 CD  
97  1 Y 1 A GLU 2022 ? OE1 ? A GLU 519 OE1 
98  1 Y 1 A GLU 2022 ? OE2 ? A GLU 519 OE2 
99  1 Y 1 A LYS 2034 ? CG  ? A LYS 531 CG  
100 1 Y 1 A LYS 2034 ? CD  ? A LYS 531 CD  
101 1 Y 1 A LYS 2034 ? CE  ? A LYS 531 CE  
102 1 Y 1 A LYS 2034 ? NZ  ? A LYS 531 NZ  
103 1 Y 1 A LYS 2042 ? CG  ? A LYS 539 CG  
104 1 Y 1 A LYS 2042 ? CD  ? A LYS 539 CD  
105 1 Y 1 A LYS 2042 ? CE  ? A LYS 539 CE  
106 1 Y 1 A LYS 2042 ? NZ  ? A LYS 539 NZ  
107 1 Y 1 A ARG 2044 ? CG  ? A ARG 541 CG  
108 1 Y 1 A ARG 2044 ? CD  ? A ARG 541 CD  
109 1 Y 1 A ARG 2044 ? NE  ? A ARG 541 NE  
110 1 Y 1 A ARG 2044 ? CZ  ? A ARG 541 CZ  
111 1 Y 1 A ARG 2044 ? NH1 ? A ARG 541 NH1 
112 1 Y 1 A ARG 2044 ? NH2 ? A ARG 541 NH2 
113 1 Y 1 A TYR 2045 ? CG  ? A TYR 542 CG  
114 1 Y 1 A TYR 2045 ? CD1 ? A TYR 542 CD1 
115 1 Y 1 A TYR 2045 ? CD2 ? A TYR 542 CD2 
116 1 Y 1 A TYR 2045 ? CE1 ? A TYR 542 CE1 
117 1 Y 1 A TYR 2045 ? CE2 ? A TYR 542 CE2 
118 1 Y 1 A TYR 2045 ? CZ  ? A TYR 542 CZ  
119 1 Y 1 A TYR 2045 ? OH  ? A TYR 542 OH  
120 1 Y 1 A SER 2046 ? OG  ? A SER 543 OG  
121 1 Y 1 A THR 2048 ? OG1 ? A THR 545 OG1 
122 1 Y 1 A THR 2048 ? CG2 ? A THR 545 CG2 
123 1 Y 1 B GLN 1525 ? CG  ? B GLN 42  CG  
124 1 Y 1 B GLN 1525 ? CD  ? B GLN 42  CD  
125 1 Y 1 B GLN 1525 ? OE1 ? B GLN 42  OE1 
126 1 Y 1 B GLN 1525 ? NE2 ? B GLN 42  NE2 
127 1 Y 1 B LYS 1558 ? CG  ? B LYS 75  CG  
128 1 Y 1 B LYS 1558 ? CD  ? B LYS 75  CD  
129 1 Y 1 B LYS 1558 ? CE  ? B LYS 75  CE  
130 1 Y 1 B LYS 1558 ? NZ  ? B LYS 75  NZ  
131 1 Y 1 B LYS 1560 ? CG  ? B LYS 77  CG  
132 1 Y 1 B LYS 1560 ? CD  ? B LYS 77  CD  
133 1 Y 1 B LYS 1560 ? CE  ? B LYS 77  CE  
134 1 Y 1 B LYS 1560 ? NZ  ? B LYS 77  NZ  
135 1 Y 1 B THR 1564 ? OG1 ? B THR 81  OG1 
136 1 Y 1 B THR 1564 ? CG2 ? B THR 81  CG2 
137 1 Y 1 B GLN 1566 ? CG  ? B GLN 83  CG  
138 1 Y 1 B GLN 1566 ? CD  ? B GLN 83  CD  
139 1 Y 1 B GLN 1566 ? OE1 ? B GLN 83  OE1 
140 1 Y 1 B GLN 1566 ? NE2 ? B GLN 83  NE2 
141 1 Y 1 B LYS 1571 ? CG  ? B LYS 88  CG  
142 1 Y 1 B LYS 1571 ? CD  ? B LYS 88  CD  
143 1 Y 1 B LYS 1571 ? CE  ? B LYS 88  CE  
144 1 Y 1 B LYS 1571 ? NZ  ? B LYS 88  NZ  
145 1 Y 1 B LEU 1579 ? CG  ? B LEU 96  CG  
146 1 Y 1 B LEU 1579 ? CD1 ? B LEU 96  CD1 
147 1 Y 1 B LEU 1579 ? CD2 ? B LEU 96  CD2 
148 1 Y 1 B SER 1583 ? OG  ? B SER 100 OG  
149 1 Y 1 B LYS 1680 ? CG  ? B LYS 197 CG  
150 1 Y 1 B LYS 1680 ? CD  ? B LYS 197 CD  
151 1 Y 1 B LYS 1680 ? CE  ? B LYS 197 CE  
152 1 Y 1 B LYS 1680 ? NZ  ? B LYS 197 NZ  
153 1 Y 1 B ARG 1739 ? CG  ? B ARG 256 CG  
154 1 Y 1 B ARG 1739 ? CD  ? B ARG 256 CD  
155 1 Y 1 B ARG 1739 ? NE  ? B ARG 256 NE  
156 1 Y 1 B ARG 1739 ? CZ  ? B ARG 256 CZ  
157 1 Y 1 B ARG 1739 ? NH1 ? B ARG 256 NH1 
158 1 Y 1 B ARG 1739 ? NH2 ? B ARG 256 NH2 
159 1 Y 1 B VAL 1751 ? CG1 ? B VAL 268 CG1 
160 1 Y 1 B VAL 1751 ? CG2 ? B VAL 268 CG2 
161 1 Y 1 B ARG 1859 ? CG  ? B ARG 376 CG  
162 1 Y 1 B ARG 1859 ? CD  ? B ARG 376 CD  
163 1 Y 1 B ARG 1859 ? NE  ? B ARG 376 NE  
164 1 Y 1 B ARG 1859 ? CZ  ? B ARG 376 CZ  
165 1 Y 1 B ARG 1859 ? NH1 ? B ARG 376 NH1 
166 1 Y 1 B ARG 1859 ? NH2 ? B ARG 376 NH2 
167 1 Y 1 B LEU 1860 ? CG  ? B LEU 377 CG  
168 1 Y 1 B LEU 1860 ? CD1 ? B LEU 377 CD1 
169 1 Y 1 B LEU 1860 ? CD2 ? B LEU 377 CD2 
170 1 Y 1 B MET 1911 ? CG  ? B MET 408 CG  
171 1 Y 1 B MET 1911 ? SD  ? B MET 408 SD  
172 1 Y 1 B MET 1911 ? CE  ? B MET 408 CE  
173 1 Y 1 B TRP 1912 ? CG  ? B TRP 409 CG  
174 1 Y 1 B TRP 1912 ? CD1 ? B TRP 409 CD1 
175 1 Y 1 B TRP 1912 ? CD2 ? B TRP 409 CD2 
176 1 Y 1 B TRP 1912 ? NE1 ? B TRP 409 NE1 
177 1 Y 1 B TRP 1912 ? CE2 ? B TRP 409 CE2 
178 1 Y 1 B TRP 1912 ? CE3 ? B TRP 409 CE3 
179 1 Y 1 B TRP 1912 ? CZ2 ? B TRP 409 CZ2 
180 1 Y 1 B TRP 1912 ? CZ3 ? B TRP 409 CZ3 
181 1 Y 1 B TRP 1912 ? CH2 ? B TRP 409 CH2 
182 1 Y 1 B ILE 1913 ? CG1 ? B ILE 410 CG1 
183 1 Y 1 B ILE 1913 ? CG2 ? B ILE 410 CG2 
184 1 Y 1 B ILE 1913 ? CD1 ? B ILE 410 CD1 
185 1 Y 1 B LYS 1914 ? CG  ? B LYS 411 CG  
186 1 Y 1 B LYS 1914 ? CD  ? B LYS 411 CD  
187 1 Y 1 B LYS 1914 ? CE  ? B LYS 411 CE  
188 1 Y 1 B LYS 1914 ? NZ  ? B LYS 411 NZ  
189 1 Y 1 B GLU 1961 ? CG  ? B GLU 458 CG  
190 1 Y 1 B GLU 1961 ? CD  ? B GLU 458 CD  
191 1 Y 1 B GLU 1961 ? OE1 ? B GLU 458 OE1 
192 1 Y 1 B GLU 1961 ? OE2 ? B GLU 458 OE2 
193 1 Y 1 B LYS 1963 ? CG  ? B LYS 460 CG  
194 1 Y 1 B LYS 1963 ? CD  ? B LYS 460 CD  
195 1 Y 1 B LYS 1963 ? CE  ? B LYS 460 CE  
196 1 Y 1 B LYS 1963 ? NZ  ? B LYS 460 NZ  
197 1 Y 1 B ARG 1989 ? CG  ? B ARG 486 CG  
198 1 Y 1 B ARG 1989 ? CD  ? B ARG 486 CD  
199 1 Y 1 B ARG 1989 ? NE  ? B ARG 486 NE  
200 1 Y 1 B ARG 1989 ? CZ  ? B ARG 486 CZ  
201 1 Y 1 B ARG 1989 ? NH1 ? B ARG 486 NH1 
202 1 Y 1 B ARG 1989 ? NH2 ? B ARG 486 NH2 
203 1 Y 1 B GLU 2016 ? CG  ? B GLU 513 CG  
204 1 Y 1 B GLU 2016 ? CD  ? B GLU 513 CD  
205 1 Y 1 B GLU 2016 ? OE1 ? B GLU 513 OE1 
206 1 Y 1 B GLU 2016 ? OE2 ? B GLU 513 OE2 
207 1 Y 1 B THR 2047 ? OG1 ? B THR 544 OG1 
208 1 Y 1 B THR 2047 ? CG2 ? B THR 544 CG2 
209 1 Y 1 B THR 2048 ? OG1 ? B THR 545 OG1 
210 1 Y 1 B THR 2048 ? CG2 ? B THR 545 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 1484 ? A GLY 1   
2   1 Y 1 A PRO 1485 ? A PRO 2   
3   1 Y 1 A THR 1486 ? A THR 3   
4   1 Y 1 A ARG 1487 ? A ARG 4   
5   1 Y 1 A TRP 1488 ? A TRP 5   
6   1 Y 1 A SER 1489 ? A SER 6   
7   1 Y 1 A SER 1490 ? A SER 7   
8   1 Y 1 A ALA 1491 ? A ALA 8   
9   1 Y 1 A ILE 1492 ? A ILE 9   
10  1 Y 1 A GLN 1493 ? A GLN 10  
11  1 Y 1 A ASN 1494 ? A ASN 11  
12  1 Y 1 A VAL 1495 ? A VAL 12  
13  1 Y 1 A THR 1496 ? A THR 13  
14  1 Y 1 A ASP 1497 ? A ASP 14  
15  1 Y 1 A THR 1498 ? A THR 15  
16  1 Y 1 A LYS 1499 ? A LYS 16  
17  1 Y 1 A ALA 1500 ? A ALA 17  
18  1 Y 1 A GLU 1580 ? A GLU 97  
19  1 Y 1 A SER 1581 ? A SER 98  
20  1 Y 1 A GLU 1776 ? A GLU 293 
21  1 Y 1 A VAL 1777 ? A VAL 294 
22  1 Y 1 A GLY 1778 ? A GLY 295 
23  1 Y 1 A ASP 1779 ? A ASP 296 
24  1 Y 1 A ILE 1884 ? A ILE 381 
25  1 Y 1 A SER 1885 ? A SER 382 
26  1 Y 1 A GLN 1886 ? A GLN 383 
27  1 Y 1 A SER 1887 ? A SER 384 
28  1 Y 1 A THR 1888 ? A THR 385 
29  1 Y 1 A LYS 1889 ? A LYS 386 
30  1 Y 1 A THR 1890 ? A THR 387 
31  1 Y 1 A PHE 1891 ? A PHE 388 
32  1 Y 1 A SER 1892 ? A SER 389 
33  1 Y 1 A PHE 1893 ? A PHE 390 
34  1 Y 1 A ARG 1894 ? A ARG 391 
35  1 Y 1 A THR 1895 ? A THR 392 
36  1 Y 1 A GLY 1896 ? A GLY 393 
37  1 Y 1 A SER 1897 ? A SER 394 
38  1 Y 1 A VAL 1898 ? A VAL 395 
39  1 Y 1 A VAL 1899 ? A VAL 396 
40  1 Y 1 A ARG 1900 ? A ARG 397 
41  1 Y 1 A GLN 1901 ? A GLN 398 
42  1 Y 1 A LYS 1902 ? A LYS 399 
43  1 Y 1 A VAL 1903 ? A VAL 400 
44  1 Y 1 A GLU 1904 ? A GLU 401 
45  1 Y 1 A GLU 1905 ? A GLU 402 
46  1 Y 1 A GLU 1906 ? A GLU 403 
47  1 Y 1 A GLN 1907 ? A GLN 404 
48  1 Y 1 A MET 1908 ? A MET 405 
49  1 Y 1 A LEU 1909 ? A LEU 406 
50  1 Y 1 A ASP 1910 ? A ASP 407 
51  1 Y 1 A MET 1911 ? A MET 408 
52  1 Y 1 A TRP 1912 ? A TRP 409 
53  1 Y 1 A ARG 2049 ? A ARG 546 
54  1 Y 1 A SER 2050 ? A SER 547 
55  1 Y 1 A ALA 2051 ? A ALA 548 
56  1 Y 1 A SER 2052 ? A SER 549 
57  1 Y 1 A SER 2053 ? A SER 550 
58  1 Y 1 A GLN 2054 ? A GLN 551 
59  1 Y 1 A GLY 2055 ? A GLY 552 
60  1 Y 1 A SER 2056 ? A SER 553 
61  1 Y 1 A SER 2057 ? A SER 554 
62  1 Y 1 A ARG 2058 ? A ARG 555 
63  1 Y 1 B GLY 1484 ? B GLY 1   
64  1 Y 1 B PRO 1485 ? B PRO 2   
65  1 Y 1 B THR 1486 ? B THR 3   
66  1 Y 1 B ARG 1487 ? B ARG 4   
67  1 Y 1 B TRP 1488 ? B TRP 5   
68  1 Y 1 B SER 1489 ? B SER 6   
69  1 Y 1 B SER 1490 ? B SER 7   
70  1 Y 1 B ALA 1491 ? B ALA 8   
71  1 Y 1 B ILE 1492 ? B ILE 9   
72  1 Y 1 B GLN 1493 ? B GLN 10  
73  1 Y 1 B ASN 1494 ? B ASN 11  
74  1 Y 1 B VAL 1495 ? B VAL 12  
75  1 Y 1 B THR 1496 ? B THR 13  
76  1 Y 1 B ASP 1497 ? B ASP 14  
77  1 Y 1 B THR 1498 ? B THR 15  
78  1 Y 1 B LYS 1499 ? B LYS 16  
79  1 Y 1 B ALA 1500 ? B ALA 17  
80  1 Y 1 B PRO 1501 ? B PRO 18  
81  1 Y 1 B GLY 1550 ? B GLY 67  
82  1 Y 1 B ASP 1551 ? B ASP 68  
83  1 Y 1 B ILE 1552 ? B ILE 69  
84  1 Y 1 B ASN 1553 ? B ASN 70  
85  1 Y 1 B LEU 1554 ? B LEU 71  
86  1 Y 1 B ASN 1555 ? B ASN 72  
87  1 Y 1 B LEU 1556 ? B LEU 73  
88  1 Y 1 B GLU 1580 ? B GLU 97  
89  1 Y 1 B SER 1581 ? B SER 98  
90  1 Y 1 B MET 1582 ? B MET 99  
91  1 Y 1 B THR 1774 ? B THR 291 
92  1 Y 1 B SER 1775 ? B SER 292 
93  1 Y 1 B GLU 1776 ? B GLU 293 
94  1 Y 1 B VAL 1777 ? B VAL 294 
95  1 Y 1 B GLY 1778 ? B GLY 295 
96  1 Y 1 B ASP 1779 ? B ASP 296 
97  1 Y 1 B ILE 1884 ? B ILE 381 
98  1 Y 1 B SER 1885 ? B SER 382 
99  1 Y 1 B GLN 1886 ? B GLN 383 
100 1 Y 1 B SER 1887 ? B SER 384 
101 1 Y 1 B THR 1888 ? B THR 385 
102 1 Y 1 B LYS 1889 ? B LYS 386 
103 1 Y 1 B THR 1890 ? B THR 387 
104 1 Y 1 B PHE 1891 ? B PHE 388 
105 1 Y 1 B SER 1892 ? B SER 389 
106 1 Y 1 B PHE 1893 ? B PHE 390 
107 1 Y 1 B ARG 1894 ? B ARG 391 
108 1 Y 1 B THR 1895 ? B THR 392 
109 1 Y 1 B GLY 1896 ? B GLY 393 
110 1 Y 1 B SER 1897 ? B SER 394 
111 1 Y 1 B VAL 1898 ? B VAL 395 
112 1 Y 1 B VAL 1899 ? B VAL 396 
113 1 Y 1 B ARG 1900 ? B ARG 397 
114 1 Y 1 B GLN 1901 ? B GLN 398 
115 1 Y 1 B LYS 1902 ? B LYS 399 
116 1 Y 1 B VAL 1903 ? B VAL 400 
117 1 Y 1 B GLU 1904 ? B GLU 401 
118 1 Y 1 B GLU 1905 ? B GLU 402 
119 1 Y 1 B GLU 1906 ? B GLU 403 
120 1 Y 1 B GLN 1907 ? B GLN 404 
121 1 Y 1 B MET 1908 ? B MET 405 
122 1 Y 1 B LEU 1909 ? B LEU 406 
123 1 Y 1 B ASP 1910 ? B ASP 407 
124 1 Y 1 B ARG 2049 ? B ARG 546 
125 1 Y 1 B SER 2050 ? B SER 547 
126 1 Y 1 B ALA 2051 ? B ALA 548 
127 1 Y 1 B SER 2052 ? B SER 549 
128 1 Y 1 B SER 2053 ? B SER 550 
129 1 Y 1 B GLN 2054 ? B GLN 551 
130 1 Y 1 B GLY 2055 ? B GLY 552 
131 1 Y 1 B SER 2056 ? B SER 553 
132 1 Y 1 B SER 2057 ? B SER 554 
133 1 Y 1 B ARG 2058 ? B ARG 555 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  1   1   HOH HOH A . 
C 2 HOH 2  2   2   HOH HOH A . 
C 2 HOH 3  3   3   HOH HOH A . 
C 2 HOH 4  4   4   HOH HOH A . 
C 2 HOH 5  5   5   HOH HOH A . 
C 2 HOH 6  6   6   HOH HOH A . 
C 2 HOH 7  7   7   HOH HOH A . 
C 2 HOH 8  8   8   HOH HOH A . 
C 2 HOH 9  9   9   HOH HOH A . 
C 2 HOH 10 10  10  HOH HOH A . 
C 2 HOH 11 11  11  HOH HOH A . 
C 2 HOH 12 12  12  HOH HOH A . 
C 2 HOH 13 13  13  HOH HOH A . 
C 2 HOH 14 14  14  HOH HOH A . 
C 2 HOH 15 15  15  HOH HOH A . 
C 2 HOH 16 16  16  HOH HOH A . 
C 2 HOH 17 17  17  HOH HOH A . 
C 2 HOH 18 18  18  HOH HOH A . 
C 2 HOH 19 19  19  HOH HOH A . 
C 2 HOH 20 20  20  HOH HOH A . 
C 2 HOH 21 21  21  HOH HOH A . 
C 2 HOH 22 22  22  HOH HOH A . 
C 2 HOH 23 23  23  HOH HOH A . 
C 2 HOH 24 24  24  HOH HOH A . 
C 2 HOH 25 25  25  HOH HOH A . 
C 2 HOH 26 26  26  HOH HOH A . 
C 2 HOH 27 27  27  HOH HOH A . 
C 2 HOH 28 28  28  HOH HOH A . 
C 2 HOH 29 29  29  HOH HOH A . 
C 2 HOH 30 30  30  HOH HOH A . 
C 2 HOH 31 31  31  HOH HOH A . 
C 2 HOH 32 32  32  HOH HOH A . 
C 2 HOH 33 33  33  HOH HOH A . 
C 2 HOH 34 34  34  HOH HOH A . 
C 2 HOH 35 35  35  HOH HOH A . 
C 2 HOH 36 36  36  HOH HOH A . 
C 2 HOH 37 37  37  HOH HOH A . 
C 2 HOH 38 38  38  HOH HOH A . 
C 2 HOH 39 39  39  HOH HOH A . 
C 2 HOH 40 40  40  HOH HOH A . 
C 2 HOH 41 41  41  HOH HOH A . 
C 2 HOH 42 42  42  HOH HOH A . 
C 2 HOH 43 43  43  HOH HOH A . 
C 2 HOH 44 44  44  HOH HOH A . 
C 2 HOH 45 45  45  HOH HOH A . 
C 2 HOH 46 46  46  HOH HOH A . 
C 2 HOH 47 48  48  HOH HOH A . 
C 2 HOH 48 49  49  HOH HOH A . 
C 2 HOH 49 50  50  HOH HOH A . 
C 2 HOH 50 51  51  HOH HOH A . 
C 2 HOH 51 52  52  HOH HOH A . 
C 2 HOH 52 53  53  HOH HOH A . 
C 2 HOH 53 54  54  HOH HOH A . 
C 2 HOH 54 55  55  HOH HOH A . 
C 2 HOH 55 56  56  HOH HOH A . 
C 2 HOH 56 57  57  HOH HOH A . 
C 2 HOH 57 58  58  HOH HOH A . 
C 2 HOH 58 60  60  HOH HOH A . 
C 2 HOH 59 61  61  HOH HOH A . 
C 2 HOH 60 62  62  HOH HOH A . 
C 2 HOH 61 64  64  HOH HOH A . 
C 2 HOH 62 101 101 HOH HOH A . 
D 2 HOH 1  65  65  HOH HOH B . 
D 2 HOH 2  66  66  HOH HOH B . 
D 2 HOH 3  67  67  HOH HOH B . 
D 2 HOH 4  68  68  HOH HOH B . 
D 2 HOH 5  69  69  HOH HOH B . 
D 2 HOH 6  70  70  HOH HOH B . 
D 2 HOH 7  71  71  HOH HOH B . 
D 2 HOH 8  72  72  HOH HOH B . 
D 2 HOH 9  73  73  HOH HOH B . 
D 2 HOH 10 74  74  HOH HOH B . 
D 2 HOH 11 76  76  HOH HOH B . 
D 2 HOH 12 77  77  HOH HOH B . 
D 2 HOH 13 78  78  HOH HOH B . 
D 2 HOH 14 79  79  HOH HOH B . 
D 2 HOH 15 80  80  HOH HOH B . 
D 2 HOH 16 81  81  HOH HOH B . 
D 2 HOH 17 82  82  HOH HOH B . 
D 2 HOH 18 83  83  HOH HOH B . 
D 2 HOH 19 84  84  HOH HOH B . 
D 2 HOH 20 85  85  HOH HOH B . 
D 2 HOH 21 86  86  HOH HOH B . 
D 2 HOH 22 87  87  HOH HOH B . 
D 2 HOH 23 89  89  HOH HOH B . 
D 2 HOH 24 90  90  HOH HOH B . 
D 2 HOH 25 91  91  HOH HOH B . 
D 2 HOH 26 92  92  HOH HOH B . 
D 2 HOH 27 93  93  HOH HOH B . 
D 2 HOH 28 94  94  HOH HOH B . 
D 2 HOH 29 96  96  HOH HOH B . 
D 2 HOH 30 97  97  HOH HOH B . 
D 2 HOH 31 98  98  HOH HOH B . 
D 2 HOH 32 100 100 HOH HOH B . 
#